4XYCA

Nanomolar inhibitors of mycobacterium tuberculosis glutamine synthetase 1: synthesis, biological evaluation and x-ray crystallographic studies
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
475
structure length
466
Chain Sequence
b'KTPDDVFKLAKDEKVEYVDVRFCDLPGIMQHFTIPASAFDKSVFDDGLAFDGHESDMLLLPDPETARIDPFRAAKTLNINFFVHDPFTLEPYSRDPRNIARKAENYLISTGIADTAYFGAEAEFYIFDSVSFDSRANGSFYEVDAISGWWNTGAATEADGSPNRGYKVRHKGGYFPVAPNDQYVDLRDKMLTNLINSGFILEKGHHEVGSGGQAEINYQFNSLLHAADDMQLYKYIIKNTAWQNGKTVTFMPKPLFGDNGSGMHCHQSLWKDGAPLMYDETGYAGLSDTARHYIGGLLHHAPSLLAFTNPTVNSYKRLVPGYEAPINLVYSQRNRSACVRIPITGSNPKAKRLEFRSPDSSGNPYLAFSAMLMAGLDGIKNKIEPQAPVDKDLYELPPEEAASIPQTPTQLSDVIDRLEADHEYLTEGGVFTNDLIETWISFKRENEIEPVNIRPHPYEFALYYDV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamine synthetase 1
molecule tags Ligase/ligase inhibitor
source organism Mycobacterium tuberculosis
publication title Nanomolar inhibitors of Mycobacterium tuberculosis glutamine synthetase 1: Synthesis, biological evaluation and X-ray crystallographic studies.
pubmed doi rcsb
total genus 137
structure length 466
sequence length 475
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature ec 6.3.1.2: Glutamine synthetase.
pdb deposition date 2015-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 4xycA01
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 4xycA02
4S17A 2BVCA 1RL9A 3L2EA 4HPPA 2OJWA 2D3AA 1G0WA 3B6RA 1F1HA 4GVZA 4Z9MA 2D3BA 1CRKA 2J1QA 1P50A 1QK1A 2QC8A 1HTQA 4RF9A 4RF7A 3L2EB 3DREA 4BHLA 1M15A 4LNIA 2GLSA 3JPZA 1I0EA 2CRKA 4LNKA 3JU6A 3M10A 4GW2A 4Q2RA 3JU5A 4RF8A 5J9AA 4GVYA 1P52A 2D3CA 1VRPA 4BG4A 4S0RA 4GW0A 3ZXVA 1HTOA 2LGSA 2UU7A 3FKYA 3NG0A 4LNNA 3ZXRA 1BG0A 1QH4A 1SD0A 4AM1A 1F52A 1FPYA 4LNFA 5J99A 1U6RA 4RF6A 4LNOA 4XYCA 4ACFA 2WGSA 4BAXA 3L2DA 3JQ3A 4BG4B 3DRBA 2WHIA 1LGRA
chains in the Genus database with same CATH superfamily
4GGQA 3VXWA 1HZ6A 4GN1A 2KQSA 4NY0A 1WH3A 2KYWA 4C00A 2NMQA 3VHTC 3PT2B 4OZCA 2L05A 3FILB 4K7UA 1Z5SB 3I3TB 4BKTA 2W3RA 4IC7B 2WQYB 4WJNA 1E0ZA 2NTSA 4XYCA 1FFUA 4TV3A 1T6BX 1CZPA 1UELA 2JY6A 2CU3A 3I57A 3EUB2 1WE6A 2JVCA 2BKFA 3MP9A 5AZHA 2JXTA 3BINA 3M63B 3DBRB 5E6JA 4NJ7A 1P7EA 1Y8RC 1WMHA 1WZ3A 1RWSA 1U6RA 4JGHB 3WAMA 2BS3B 4TKNA 5GXGB 3VAWA 2WHIA 1TS2A 1KM7A 1WXVA 4MH0E 1UBIA 4DHZB 1KOTA 4G50A 1WM3A 4G3XB 2MBEA 1N60A 4FLHA 4WQOB 1M15A 3RMKC 4LNKA 3JU6A 2QMTA 4W9CA 3NZTA 2WXGA 1QZEA 4HEA1 3TIXA 2MJ3A 5CHFA 2PE6B 2BT6A 4I6NB 1RAXA 4L23A 4WWMA 1GAQB 5DPSA 2MLBA 4EZJA 2L7RA 2HD5B 5AZGA 4ZRPA 3IAM1 3ZIMA 2ZCBA 2KLCA 1OEYA 1R7SA 4GVYA 4JIOU 1WSPA 4WJPA 3U8ZA 2LGSA 4LDTB 4GU2A 1G6JA 1V97A 4DK5A 2D10A 2BS4B 2KFKB 3DOWA 3SFEB 2CKHB 3A4SC 2DYBA 4EE2A 4KKJA 4GVZA 4Z9MA 2CHZA 4IOIE 4M01A 4RF7A 2KOXA 1V1OA 4FN2A 1PUTA 1UWXA 2MBHA 1WF9A 2WXOA 3NY5A 2BWFA 2JYTA 4AJWA 2J42A 1I4RA 4RFBA 4URKA 4IM2A 3KLSX 5JHAA 2QIEB 1H8CA 4JWSC 3UIPB 5AUKA 1E7VA 3ENEA 2N1WA 2NTTA 3QX1A 3PGEA 3H1UA 1K50A 2CHXA 4YTNB 2Y5CA 1QKZA 1K8RB 4WJQA 3DHHC 1EU4A 4KIKB 4MGYE 4PS3A 2DAJA 4ANVA 1I4QA 1JWBD 3ZVVA 1TKGA 2WYQA 3AE5B 2J4XA 2TSSA 5IKCM 1HXYD 4WIPA 4C7YA 2WX0A 3SR6A 1C4CA 3QARA 2KJ6A 4K7SA 1Q0WB 1FNUA 2RPQA 2INDC 1BT0A 3ZGZA 3VUXA 3VUYA 1ZXIA 1V4GA 2N9XA 1F2RC 3W1YA 1L6VA 2JX5A 5AZFA 1YJIA 2J7QB 1WE7A 2QC8A 3DBRI 2WXHA 1F0ZA 4OVVA 2KDFB 2SEBD 2KO3A 2NPTA 1JMLA 3CWIA 4GDKB 5JHBA 4LNOA 2QCZA 1ET9A 2G4DB 4HKZE 3M3JA 3MFGA 2CJNA 3DRBA 2KT7A 4PS8A 4MM3B 1XLOA 1WI0A 2Z0EB 1JWUD 4NAMA 1SE2A 3RI7C 4P1BC 1C3TA 3W1SA 3AE9B 3CSTA 1WX8A 3ZXVA 5D6JB 3AE1B 3RD2A 4OZAA 1ZDXA 1U4AA 3VH3B 1GJZA 2O6VB 3RZWC 2N9KA 4FA6A 4ZRIA 1GOZA 4WJOA 1ESFA 1HE8A 2FCQA 1J0GA 3B1LX 1WXAA 1XLPA 4DHJB 1IPGA 3ZNGC 3QA8A 5L83A 5IAAC 2N7JA 3N20C 2IBIB 1WIAA 3V60A 2IO3B 4BBNC 1L4ZB 1WJ6A 2KACA 1GC6A 2D3GA 1L2NA 2BB5A 3BVGA 1ZKHA 1J7BA 3R3MA 2OJWA 3QC8B 1YJ1A 3WIMA 1WR1A 3U4EG 3UF8A 1QF6A 1JRUA 5J18A 2DYMA 1MJDA 4FHJA 3L08A 3QCAA 4KZCA 2XN9C 3WALA 3IG3A 1GB4A 2IYDB 2NPTB 1VZ8A 1ZPSA 5AEKB 4HCPB 2OJRA 4XX5A 2M0XA 1V1PA 3CF6E 3ZRFA 3T3OA 4K7WA 4YWGG 1FRDA 3A1QA 1KH0A 2WXKA 3WA0A 1T0QC 3LXFA 2RDBC 1EF5A 3FILA 3L2DA 3LB8C 4HJGE 1FO4A 4OZBA 4ZHOA 3KUZA 5BMHA 2J52A 3AEEB 3MTNB 3UINB 3DBLB 3L13A 1M94A 3OJ3A 2BYEA 1OGWA 3B2FA 3ZJUA 3VVWB 5G55A 1TZOA 1ZE3D 1E90A 2WXFA 2WXQA 3V6EB 2ON8A 2EKEC 1WXSA 2D07B 2FCMA 3NZSA 2WWZA 4W9KA 4XDCA 1XLNA 3RNGC 1R4NI 1UGMA 1CRKA 3DREA 4MH8A 3DVNU 1V80A 4X57B 3GZNI 3AXCA 4AS1A 2YLMA 4LNNA 1WGDA 2V1YA 1N5XA 3Q69A 2RDHA 4B0MA 3NUHB 4WWNA 5TR5A 4A90A 3KYCD 4C4VB 3H6NA 1GPXA 4MT5A 2NR2A 1ROEA 1N62A 2IO0B 3L0WB 3CSFA 3NS1A 2QILA 2ZW1A 2G45B 3RYTA 4F7ZA 4IM3A 3RNAC 2Y3AA 4MJSB 4YL8A 3TUOA 2OEDA 4DHZE 2LHEA 4M8MA 1AWDA 1SJED 4XZ4A 2ZVNA 2K6DB 2LASA 4RGNA 2H89B 5E6OA 3FKYA 2MHJA 1WJNA 5C2TB 2WGSA 2VH2A 3PHWB 5HHDG 1YJJA 2IDYA 4KDLB 2GI9A 4M0WB 2KKCA 4B6WA 3AMZA 3RULA 1BUIC 2CS4A 1NBFC 1FXIA 2IY0B 1Y56A 1QLBB 3EHVA 2V3NA 4GB9A 3PTFC 3PRMB 2IO1B 4O1NA 4DXGA 3CIRB 5LXIB 3M10A 4CHKA 2K22A 5D94A 3SEBA 2D2QA 2GB1A 4JX1C 2JPHA 3VH4B 2UYZB 4NAWA 4ASWC 4GMVA 3AN1A 1YN4A 4YSXB 3LVWA 1F9JA 1ZOYB 1E5WA 3R66C 1TS4A 5G2NA 3AE2B 2YVCA 1YIWA 5BYRA 3N1YC 2MBOA 2PJHA 2KWCA 1VZ7A 2G3QB 3KQ4A 1RL9A 2C5LC 4EUTA 3UI3A 2BQQA 3AV8A 4JE3B 2M19A 5LLIA 2GBJA 1FCCC 2GMIC 1TGZB 2RGFA 5CHVC 2D33A 4W9JA 3U52E 1TT5B 3TEYA 4LTUA 1WX7A 3WAPA 4YSZB 1F77A 2NBWB 1SEBD 2KAJA 2LVQA 4FJZA 3ZDMC 2INNE 2DLBA 3P42A 3ALBA 4WWPA 2K9XA 4C4VA 1DOXA 2WDVB 4XGAB 1P7FA 4TSSA 1K51A 4ZRJA 2DENB 2MCNB 1NYRA 3HRDD 1FD6A 2N0SB 3P4RB 3A4RA 3UQAA 4NQKE 2VH1A 2ZJDA 3OWEB 2Z0DB 5EE0A 4QAYA 2DWQA 1SGHA 2KDIA 2VRRB 3WCQA 1ZW7A 1I4GA 2KD0A 2JZ3B 2BB6A 2WXMA 1MHHE 1IBXA 5DPRA 1OTRB 3WAOA 1C4AA 1VRAB 1OEYJ 2D3BA 3NRZA 3Q2AC 2MP2B 1BMLC 3AECB 4LNIA 4IWOA 5DPTA 4C7ZA 1AW7A 3EA6A 1HA5A 2L52A 4IWQA 4WQMA 1WXMA 2OHFA 3DWGC 3V62A 1V2YA 4HCNB 3KH0A 2WDQB 3S2AA 3VTWA 3TEZA 2KX0A 2ZEQA 1UWMA 1EM7A 2GRIA 1EUVB 3AH7A 2HTHA 1OQQA 4HJKA 3JYUA 2C7MB 4IW0A 3AE8B 1MFWA 4PT5A 1HTQA 2R61A 3SDLC 1I0EA 3CMMB 3NZ3A 4XWWA 2IY1B 2PW9A 3E9SA 1GG3A 2N9LA 3H7PA 1YQ4B 3IVFA 3DPDA 1UBQA 2LUEA 2L83A 2NBUA 3JSVA 3I5JC 2L0FA 4MJSA 2KWUB 4TMAB 5KHOA 2V3SA 4NQLB 2CRKA 2GWDA 1TKEA 1JCKB 2JYEA 2DAFA 2BGFA 1KRHA 2MRPA 3HM6X 1Q5WB 2V9HA 3UQBA 3P2BA 3SFDB 1V81A 4KVGB 2QDFA 3IAS1 3TJPA 4KDIC 3RNEC 3H8HA 3VTVA 4W9HA 1NDDA 3C0RB 1UNSA 2FNJB 2MW5A 5BO4B 2LWPA 4N9F4 4BHLA 5L95C 2XBBC 4L2YA 3IG5A 5H92C 3OLMD 2B3AA 2DZIA 3ZNID 3GZNB 4RM9A 3BZDB 1L0XB 3AEGB 3TSSA 2HTME 2K25A 3BK1A 3V6CB 2I38A 1T0SC 1M4VA 2WX1A 1DOIA 4K81A 1NYQA 1ZDVA 2KMMA 4F8CB 5D3DA 1AARA 2RDGA 4BZAA 3B6RA 5BMIA 2K8HA 3PS6A 3UIOB 2KDMA 2XEWA 1XO3A 1LO5D 3MC0B 2MEKA 3DBSA 3H7SA 3Q3MC 3ZUNA 3BYTB 1LM8B 1L4DB 3HHMA 1WJUA 2BKRB 1EU3A 2AYOB 1YNTE 2FAZA 2KQ4X 1MPEA 3DCGA 2AL6A 4RF0A 4AQ7A 1WYWB 4B95A 3N30A 1TKYA 1JQ4A 1OFFA 4GDKA 4JWUC 1LXDA 1QOFA 1FXAA 1HEZE 5CTRC 1TIFA 3SU8X 1SB3C 4E71A 3DVNV 3Q8EA 1IUEA 1WFYA 1C78A 3P4SB 3U7DA 2I1JA 5JXVA 4ZRQA 1WYGA 1QQRA 4ZDVA 2E6XA 1WM2A 3A9KB 1FNWA 2CR5A 2GBRA 2L32A 4ANWA 3PHXB 4AWJA 4KZ0A 2CJOA 4GDLB 2RMMA 5D7GA 2KANA 1CQVA 5HG2A 1CMXB 5IA7A 2KLGA 3C8YA 1F2RI 2Z59B 4A3PA 3NVYA 5CHWA 3Q6BA 4KSKC 1N5WA 1I35A 3LDZE 1SD0A 1F52A 3MHSD 1IYFA 3TBLD 2KJRA 3NJTA 3U7ZA 2WXJA 3SD5A 5H8YE 1UH6A 3ZTDA 2LEKA 4J6IA 3IG8A 3JPZA 3AE3B 4RF8A 1P9DU 3TL5A 2K8CA 2BYFA 3MJWA 2EKIA 4KGTA 3ZXRA 2WXIA 1R8GA 1NVID 2L00B 3L54A 2DZJA 1C1YB 2ZW0A 3A9JB 2RSUA 1MVKA 2K39A 3MJ5A 2WXPA 4WAFA 1P50A 3RZFA 3V05A 4W9IA 2JZZA 4BKGA 4NJCA 2L8JA 4DWFA 1LFDA 3UGBB 3ZDTA 2MQJA 3PVLA 1C79A 4OW0A 3Q3NC 3JVZX 1VDVA 2AQ1B 2PLPA 4GXBA 4C80A 4MSMB 2LMCA 3RT3B 3IT4B 4XWTA 2J1QA 1WGHA 4FBJB 1TTNA 2R2QA 3P1MA 1YD8U 1WJ4A 3PREA 4ARIA 2J0KA 2PVOD 1UGJA 4UDUC 4DBGA 3R7QA 2JRHA 3P4QB 3Q3OC 1V9JA 3VUWA 1XF5L 2NVUI 1WGYA 1VR9A 2D11A 4W9DA 2ZPYA 3APFA 4WAAA 2LJIA 2OOBB 4LLGM 1YN3A 1IP9A 3L10B 4GLSC 4DXFA 2D3CA 5E6PA 1P3QU 2ZVOA 2YEPB 3AEBB 2JF5A 4M02A 1D5XC 3DWMA 3JQ3A 3KWVA 2C7HA 1PDXA 2EELA 2INPE 1ZXHA 1WMHB 4MACA 2KN5A 1V5TA 1VD2A 1WRIA 2L1AA 3BYYB 3BIID 3WANA 1QOAA 2QSDA 1D5MC 2M0AA 3DVGY 4DHJD 5TSSA 4TQ0A 3TEXA 2N1VA 1MG8A 5IOIA 2MH7A 1UUPA 3BWUD 3DBHI 1L5PA 4RGOS 2KFKA 2LJ5A 2LUMA 3QK0A 3RNFC 2KWVB 1XLQA 4BOSC 1JROA 4K3CA 3H9DA 4DDID 4PYUA 4YTMB 2UU7A 4JPSA 4KGRA 1JWMD 2LVOA 2IPKD 2LGIA 1STEA 2M56B 2JZPA 1ZGUB 2QEJC 1MG4A 3IFWB 3QJZA 3U2SC 1S1QB 2I1KA 4P7IA 3LN7A 1WXQA 2JT4B 2KMAA 1SE9A 5DPWA 4AJYB 2AQ3B 1SIJA 1E10A 3T8MA 2KTRA 2FIDA 1B1ZA 2V3PA 1Z2MA 3PV1A 1VJKA 1I4XA 3ZO5B 1R4NB 2I2YA 3T3NA 1KJTA 5AUIA 2MBBB 1CJEA 2ZNVC 2KVRA 4TUUA 1KLVA 4HROA 2K6QA 1GC7A 1B9RA 3RN9C 1VA6A 4LNFA 5G5GA 2N7DA 1A5RA 4AUQC 3ML8A 1TZ1A 4G0NB 1N63A 5HFYA 3W2DA 2IGGA 4N6EB 1T3QA 2KDEB 2HE7A 4USAA 4FHKA 3OG5A 3EGRA 3P4PB 1DGJA 3A33B 2WS3B 4JLCA 1GB1A 1JW9D 1FIQA 4RGMA 4ANXA 1TT4A 1C9FA 1EO6A 3IBEA 1UF0A 1SIFA 1V1PB 1QOBA 2X38A 1UD7A 1PYWD 2MX2A 1YMHE 3PZ7A 3OJ4B 1TY2A 3ABVB 4P16A 5I4DA 1SJHD 4YT0B 2C7NB 2YEPF 4ANUA 1SBBB 4W9GA 4LCDE 1J19A 4HKQA 2JWUA 3KUDB 5C1ZA 4BFRA 1R4MI 4B9KA 5IN7A 1VCBA 3Q14C 5IP4D 1C77A 2KFJA 4P6VF 4PK1A 3PZ8A 2M4NA 2PKOA 1WX9A 2WXLA 3AB5A 4NZLB 2Z8LA 3HUIA 2JRIB 2JUOA 2DHZA 1FM0D 5EE9A 5BMGA 4EOYA 5HKHA 1EF1A 2JSVX 2XK5B 1H4RA 1KFYB 2DYOA 1UZXB 1V5OA 3APCA 3U30A 3RPFC 4ZYSA 4I6PA 1XCQL 2JU6X 5C3JB 2FUHB 2ONQA 4MGZE 4WURA 1OQRA 4NAWB 1I42A 2O2VB 1E8YA 2L76A 4W9FA 1XXGA 4FULA 3PPAA 1L0YB 4ARCA 3AM9A 3SHQA 4ZOHC 5EDSA 2FCSA 1TYGB 4EEWA 2G1EA 3H7PB 2HJ1A 4ZRKA 3MHZA 3AEAB 3RFZB 1E9MA 3A9KA 5D2MB 1X1MA 4Q2RA 1TS3A 1VLBA 1SXTA 5J99A 4DDGD 1QT9A 4BVUC 1GUAB 1XEEA 2QHOA 1IBXB 3APDA 3Q3JA 3Q8CA 3PO0A 1KLGD 1KTKA 3EFUA 2CHWA 3ZNZB 4MDKE 1RLFA 2N7EA 2MP2A 4W9EA 2W82A 2WDRB 2BW2A 2G4SA 2LXCA 3ZQ4A 3IXSA 2CU1A 3V61A 2FIFA 1JALA 2INCC 1IGCA 3TEWA 3DQVA 3GS2A 3N1ZC 2D3AA 2V0GA 1RFAA 3JU5A 3HVDA 5J9AA 3KWLA 3RCZA 1BG0A 3ZJTA 1FXTB 3VDZA 2WU2B 1K53A 2ACZB 4A20A 2KNBA 1IGDA 1I4PA 1F1HA 1KF6B 2B76B 2V4IB 1FCLA 2LXAA 3EFCA 4RF9A 3PRZA 4TQ1A 2BF8B 1YX6B 4HLEA 5BYQA 1V86A 1ZP0B 2DBYA 4RF6A 2UWQA 3ZW3A 4MELA 4GIVA 2MBQA 4MSQB 3B9JA 3J9CA 1TY0A 4AOFA 2HJ8A 3C19A 5LNK1 2D32A 2NCNA 3LVVA 4ITKA 3GOEA 3HK0A 3NVWA 2M17A 2V4LA 4BKSD 3TCAA 4ZYNA 1P98A 3HM3A 4FXCA 4MEMA 4W9LA 3DHGC 3ZJVA 1RYJA 1HQRD 1XD3B 1EWYC 4JQWC 2BBCA 1BXTA 4D2KA 3ECIA 4NNJB 5EE3A 2M8SA 2VZKB 2PMVA 2R2OA 2N4FA 2ZPNA 4RH6A 3BY4B 3R8BA 4AP4C 3ETRA 1V8CA 2WXNA 4M0WA 1E6EB 2KHWB 1E8ZA 1RM6C 3B2GA 2L0TA 4A55A 1FRRA 2GOWA 4DQOC 4KSLC 1Q1OA 2KJHB 3ONSA 2GBMA 5JZEB 2KQ7A 3R7RA 4C56C 1I7HA 3X0WA 2E3TA 4LDTD 4BKSA 2ZNVB 1YQBA 2ASQA 1CK1A 1NENB 1D5ZC 3NHEB 4S17A 2GWCA 5KHQA 3QIJA 3Q8FA 3LYYA 3AULA 1PGAA 1XT9B 2BYVE 1EWCA 2Y5PA 3AU5A 1D4BA 4HPLB 4IWPA 3PZDA 1QILA 4BAXA 2C60A 5LXHA 3PSEB 3AEDB 1YN5A 3TMPB 1DOYA 2ZCCA 2O6VD 2AQ2B 3N1XC 4ZHPA 5HI1A 3JSVB 3DDCB 5T8IA 3BVMA 2JXXA 1WZ0A 1YQ3B 1TS5A 1QH4A 1QOGA 1E7PB 2K8BA 2RPVA 4HK2A 4MM3A 1D3ZA 2EMSA 3I63C 2PE9A 1XCTL 1N6ZA 3R2IA 4OVZA 1PGBA 4RNAA 3A9JA 3GE3C 4LJPB 3ZNHB 1JRPA 2W54A 2L3ZA 3W5UB 4ICUA 4GW2A 1MI0A 3HVZA 4CQNA 3PLVA 5BYSA 2BS2B 4GOCA 4OHJA 2Y5BB 2WU5B 2HDEA 2X8XX 1AYFA 1WY8A 4FADA 3L17A 1NI3A 3L4PA 3AI5A 3L16A 1WGRA 4A9AA 1ENFA 3I9V1 3Q3FA 1TBEA 3NS8A 1E8XA 3RNCC 1GNUA 4II3B 3T9LA 2RR9A 1WR6E 3K9OB 3EECA 2SAKA 2KN4A 1LQBA 3AE7B 3M95A 4ACFA 4XDDA 1WRDB 2A4ZA 4CO7A 3LJ3A 1E8WA 4GDLA 2W3SA 3NVVA 3VR9B 5FR3A 3QAQA 2AX5A 2BTEA 3L2EB 2KZRA 4M8NA 2IGDA 3M62B 4K3BA 4L1BA 4A8XC 4RM8A 3D32A 2FCNA 1V49A 4B0EA 5EE1A 1LGRA 3VQIA 2KTRB 1ET6A 4BBNF 1PGXA 3NOBA 4EZKA 1KLUD 2PTLA 5CX3A 5FKAC 3KW5B 3PRPB 1N61A 4MGIE 5IO9A 1JWAD 2FBWB 4BG4A 1E7UA 3KYDD 4P1CC 2LRWA 2NS5A 2DX5B 5MPOA 2LVPA 3RNBC 4F1SA 2H88B 5DCNA 4Q2JA 1PQSA 2MJEA 2W9NA 4JL9A 2IGHA 3IHPC 3AE4B 5G5HA 3AU4A 2LGYA 3W1SC 1MHXA 1K52A 4DXAB 4YTPB 4YSYB 1WWTA 1T0YA 4RF1A 4GSWA 1XQQA 2WNMA 2QJLA 1YOVB 3Q8AA 4FJVB 3JW0X 4LK0M 4HDQA 4GW0A 2FE8A 4MGKE 2N9EB 4N59A 2D5GA 2RD0A 1YX5B 2EMTA 4KV2A 4IDIA 1A70A 4NPNA 2KVZA 2N9PC 3W5VB 2FUG1 2IZVB 4HPPA 3DBHB 2BYTA 2PIAA 1G0WA 1PFDA 3RUIB 1T5XD 2DZKA 3VRBB 2KK8A 3B08A 4HVBA 2LI5A 3BK2A 3VRAB 2W55A 3KVFB 5JH5C 2BWES 1SF0A 4CYEA 2KWDA 3X23A 1FMAD 3GP7A 1P0RA 2G9HD 3QWZB 4H2AA 1V6EA 4ICVA 3GB1A 4BOZB 3P63A 2VZKD 2LHDA 1FFVA 4NJ6A 1J8CA 1P52A 2KTFA 4S0RA 2AL3A 3DBLI 2M1MA 2MWSB 2KC1A 1DYQA 3HIZA 1L0VB 1P1AA 3FAHA 1TJEA 2KX3A 2LRUA 2XK5A 1Q10A 2PEAA 3MC9A 4M00A 4FJYA 4PYZA 1AN8A 4KGSA 2K0PA 2KC2A 2DZMA 4II2B 1J7AA 1S3SG 3ZYYX 4US9A 4R3DA 2ZZPB 1SE4A 1JWSD 3AE6B 1FNVA 3VR8B 4XC2A 2J0JA 3PLUA 2WDTB 1ACCA 2O2VA 1QK1A 4XE0A 4J3OD 1NI2A 3BVZA 1FEHA 3Q8BA 2MSED 4LJOB 2WLBA 5C23A 1WGKA 1FPYA 4RGTA 3ZKJC 4RCOA 4BG4B 4WH4A 1RRBA 2XNAC 2K3UA 2BPSA 2PPHA 2A5UA 3W9CB 4PS7A 3NZUA 1I4HA 2PVGC 4G11A 3EC8A 2J0MA 2LZ6A 4REZA 2AEHA 2K5PA 4KX6B 2KXJA 2LGXA 3DVGX 3E56A 2C9WB 3ML9A 3NVZA 2KDBA 4EFOA 2WXRA 1C76A 2MJDA 4HPMB 2J53A 5D3IB 2IJ0A 2LGDA 4RMAA 2BVCA 3L2EA 2KMCA 3FC4A 1D6EC 4E3CA 1WGGA 2Q5WD 4HXDA 3R2TA 1SSNA 2AWTA 2GLSA 3OAWA 4IKGA 4KKIA 3KUCB 1VZ6A 1HTOA 5FK9C 3NG0A 4AM1A 3QQ8B 3A1QB 1L7YA 1RFKA 2JQRB 3K9PB 3GE8C 3IT6B 5E6NA 4EZLA 4KIKA 3N3KB 3QHTA 4I6LB 4US8A 2DNFA 4A6QA 3B0AA 3ZTCA 2WP9B 3O13A 3ZLZA 1NEKB 4YXDB 2GBKA 3O65B 4HRSA 1SE3A 3MC8A 2GBNA 1C4PA 2MA9B 3N32A 2IO2B 4OVUA 2JWZA 1L6UA 4IM0A 4A3OA 3DHIC 3V3XA 2LFIA 2K1FA 1VRPA 4HDOA 5GMVA 3N9YC 4N58A 1OQYA 1R4MB 3ZRCA 1ISNA 4HWIB 2ICIA 2LD9A 2NBVB 5FR6A 1ZUD2 4EKUA 5J2RA 4IG7B 5J17A 2O6VA 3VTUA 2REXA 3AEFB 3URYA 4E74A 1J7CA 1HZ5A 4IUMB 3LN6A 4WWOA 1T0RC 4K1RB 3VFKA
chains in the Genus database with same CATH topology
4S17A 2BVCA 1RL9A 3L2EA 4HPPA 2OJWA 2D3AA 1G0WA 3B6RA 1F1HA 4GVZA 4Z9MA 2D3BA 1CRKA 2J1QA 1P50A 1QK1A 2QC8A 1HTQA 4RF9A 4RF7A 3L2EB 3DREA 4BHLA 1M15A 4LNIA 2GLSA 3JPZA 1I0EA 2CRKA 4LNKA 3JU6A 3M10A 4GW2A 4Q2RA 3JU5A 4RF8A 5J9AA 4GVYA 1P52A 2D3CA 1VRPA 4BG4A 4S0RA 4GW0A 3ZXVA 1HTOA 2LGSA 2UU7A 3FKYA 3NG0A 4LNNA 3ZXRA 1BG0A 1QH4A 1SD0A 4AM1A 1F52A 1FPYA 4LNFA 5J99A 1U6RA 4RF6A 4LNOA 4XYCA 4ACFA 2WGSA 4BAXA 3L2DA 3JQ3A 4BG4B 3DRBA 2WHIA 1LGRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4S17 A;  2BVC A;  1RL9 A;  3L2E A;  4HPP A;  2OJW A;  2D3A A;  1G0W A;  3B6R A;  1F1H A;  4GVZ A;  4Z9M A;  2D3B A;  1CRK A;  2J1Q A;  1P50 A;  1QK1 A;  2QC8 A;  1HTQ A;  4RF9 A;  4RF7 A;  3L2E B;  3DRE A;  4BHL A;  1M15 A;  4LNI A;  2GLS A;  3JPZ A;  1I0E A;  2CRK A;  4LNK A;  3JU6 A;  3M10 A;  4GW2 A;  4Q2R A;  3JU5 A;  4RF8 A;  5J9A A;  4GVY A;  1P52 A;  2D3C A;  1VRP A;  4BG4 A;  4S0R A;  4GW0 A;  3ZXV A;  1HTO A;  2LGS A;  2UU7 A;  3FKY A;  3NG0 A;  4LNN A;  3ZXR A;  1BG0 A;  1QH4 A;  1SD0 A;  4AM1 A;  1F52 A;  1FPY A;  4LNF A;  5J99 A;  1U6R A;  4RF6 A;  4LNO A;  4XYC A;  4ACF A;  2WGS A;  4BAX A;  3L2D A;  3JQ3 A;  4BG4 B;  3DRB A;  2WHI A;  1LGR A; 
#chains in the Genus database with same CATH topology
 4GGQ A;  3VXW A;  1HZ6 A;  4GN1 A;  2KQS A;  4NY0 A;  1WH3 A;  2KYW A;  4C00 A;  2NMQ A;  3VHT C;  3PT2 B;  4OZC A;  2L05 A;  3FIL B;  4K7U A;  1Z5S B;  3I3T B;  4BKT A;  2W3R A;  4IC7 B;  2WQY B;  4WJN A;  1E0Z A;  2NTS A;  4XYC A;  1FFU A;  4TV3 A;  1T6B X;  1CZP A;  1UEL A;  2JY6 A;  2CU3 A;  3I57 A;  3EUB 2;  1WE6 A;  2JVC A;  2BKF A;  3MP9 A;  5AZH A;  2JXT A;  3BIN A;  3M63 B;  3DBR B;  5E6J A;  4NJ7 A;  1P7E A;  1Y8R C;  1WMH A;  1WZ3 A;  1RWS A;  1U6R A;  4JGH B;  3WAM A;  2BS3 B;  4TKN A;  5GXG B;  3VAW A;  2WHI A;  1TS2 A;  1KM7 A;  1WXV A;  4MH0 E;  1UBI A;  4DHZ B;  1KOT A;  4G50 A;  1WM3 A;  4G3X B;  2MBE A;  1N60 A;  4FLH A;  4WQO B;  1M15 A;  3RMK C;  4LNK A;  3JU6 A;  2QMT A;  4W9C A;  3NZT A;  2WXG A;  1QZE A;  4HEA 1;  3TIX A;  2MJ3 A;  5CHF A;  2PE6 B;  2BT6 A;  4I6N B;  1RAX A;  4L23 A;  4WWM A;  1GAQ B;  5DPS A;  2MLB A;  4EZJ A;  2L7R A;  2HD5 B;  5AZG A;  4ZRP A;  3IAM 1;  3ZIM A;  2ZCB A;  2KLC A;  1OEY A;  1R7S A;  4GVY A;  4JIO U;  1WSP A;  4WJP A;  3U8Z A;  2LGS A;  4LDT B;  4GU2 A;  1G6J A;  1V97 A;  4DK5 A;  2D10 A;  2BS4 B;  2KFK B;  3DOW A;  3SFE B;  2CKH B;  3A4S C;  2DYB A;  4EE2 A;  4KKJ A;  4GVZ A;  4Z9M A;  2CHZ A;  4IOI E;  4M01 A;  4RF7 A;  2KOX A;  1V1O A;  4FN2 A;  1PUT A;  1UWX A;  2MBH A;  1WF9 A;  2WXO A;  3NY5 A;  2BWF A;  2JYT A;  4AJW A;  2J42 A;  1I4R A;  4RFB A;  4URK A;  4IM2 A;  3KLS X;  5JHA A;  2QIE B;  1H8C A;  4JWS C;  3UIP B;  5AUK A;  1E7V A;  3ENE A;  2N1W A;  2NTT A;  3QX1 A;  3PGE A;  3H1U A;  1K50 A;  2CHX A;  4YTN B;  2Y5C A;  1QKZ A;  1K8R B;  4WJQ A;  3DHH C;  1EU4 A;  4KIK B;  4MGY E;  4PS3 A;  2DAJ A;  4ANV A;  1I4Q A;  1JWB D;  3ZVV A;  1TKG A;  2WYQ A;  3AE5 B;  2J4X A;  2TSS A;  5IKC M;  1HXY D;  4WIP A;  4C7Y A;  2WX0 A;  3SR6 A;  1C4C A;  3QAR A;  2KJ6 A;  4K7S A;  1Q0W B;  1FNU A;  2RPQ A;  2IND C;  1BT0 A;  3ZGZ A;  3VUX A;  3VUY A;  1ZXI A;  1V4G A;  2N9X A;  1F2R C;  3W1Y A;  1L6V A;  2JX5 A;  5AZF A;  1YJI A;  2J7Q B;  1WE7 A;  2QC8 A;  3DBR I;  2WXH A;  1F0Z A;  4OVV A;  2KDF B;  2SEB D;  2KO3 A;  2NPT A;  1JML A;  3CWI A;  4GDK B;  5JHB A;  4LNO A;  2QCZ A;  1ET9 A;  2G4D B;  4HKZ E;  3M3J A;  3MFG A;  2CJN A;  3DRB A;  2KT7 A;  4PS8 A;  4MM3 B;  1XLO A;  1WI0 A;  2Z0E B;  1JWU D;  4NAM A;  1SE2 A;  3RI7 C;  4P1B C;  1C3T A;  3W1S A;  3AE9 B;  3CST A;  1WX8 A;  3ZXV A;  5D6J B;  3AE1 B;  3RD2 A;  4OZA A;  1ZDX A;  1U4A A;  3VH3 B;  1GJZ A;  2O6V B;  3RZW C;  2N9K A;  4FA6 A;  4ZRI A;  1GOZ A;  4WJO A;  1ESF A;  1HE8 A;  2FCQ A;  1J0G A;  3B1L X;  1WXA A;  1XLP A;  4DHJ B;  1IPG A;  3ZNG C;  3QA8 A;  5L83 A;  5IAA C;  2N7J A;  3N20 C;  2IBI B;  1WIA A;  3V60 A;  2IO3 B;  4BBN C;  1L4Z B;  1WJ6 A;  2KAC A;  1GC6 A;  2D3G A;  1L2N A;  2BB5 A;  3BVG A;  1ZKH A;  1J7B A;  3R3M A;  2OJW A;  3QC8 B;  1YJ1 A;  3WIM A;  1WR1 A;  3U4E G;  3UF8 A;  1QF6 A;  1JRU A;  5J18 A;  2DYM A;  1MJD A;  4FHJ A;  3L08 A;  3QCA A;  4KZC A;  2XN9 C;  3WAL A;  3IG3 A;  1GB4 A;  2IYD B;  2NPT B;  1VZ8 A;  1ZPS A;  5AEK B;  4HCP B;  2OJR A;  4XX5 A;  2M0X A;  1V1P A;  3CF6 E;  3ZRF A;  3T3O A;  4K7W A;  4YWG G;  1FRD A;  3A1Q A;  1KH0 A;  2WXK A;  3WA0 A;  1T0Q C;  3LXF A;  2RDB C;  1EF5 A;  3FIL A;  3L2D A;  3LB8 C;  4HJG E;  1FO4 A;  4OZB A;  4ZHO A;  3KUZ A;  5BMH A;  2J52 A;  3AEE B;  3MTN B;  3UIN B;  3DBL B;  3L13 A;  1M94 A;  3OJ3 A;  2BYE A;  1OGW A;  3B2F A;  3ZJU A;  3VVW B;  5G55 A;  1TZO A;  1ZE3 D;  1E90 A;  2WXF A;  2WXQ A;  3V6E B;  2ON8 A;  2EKE C;  1WXS A;  2D07 B;  2FCM A;  3NZS A;  2WWZ A;  4W9K A;  4XDC A;  1XLN A;  3RNG C;  1R4N I;  1UGM A;  1CRK A;  3DRE A;  4MH8 A;  3DVN U;  1V80 A;  4X57 B;  3GZN I;  3AXC A;  4AS1 A;  2YLM A;  4LNN A;  1WGD A;  2V1Y A;  1N5X A;  3Q69 A;  2RDH A;  4B0M A;  3NUH B;  4WWN A;  5TR5 A;  4A90 A;  3KYC D;  4C4V B;  3H6N A;  1GPX A;  4MT5 A;  2NR2 A;  1ROE A;  1N62 A;  2IO0 B;  3L0W B;  3CSF A;  3NS1 A;  2QIL A;  2ZW1 A;  2G45 B;  3RYT A;  4F7Z A;  4IM3 A;  3RNA C;  2Y3A A;  4MJS B;  4YL8 A;  3TUO A;  2OED A;  4DHZ E;  2LHE A;  4M8M A;  1AWD A;  1SJE D;  4XZ4 A;  2ZVN A;  2K6D B;  2LAS A;  4RGN A;  2H89 B;  5E6O A;  3FKY A;  2MHJ A;  1WJN A;  5C2T B;  2WGS A;  2VH2 A;  3PHW B;  5HHD G;  1YJJ A;  2IDY A;  4KDL B;  2GI9 A;  4M0W B;  2KKC A;  4B6W A;  3AMZ A;  3RUL A;  1BUI C;  2CS4 A;  1NBF C;  1FXI A;  2IY0 B;  1Y56 A;  1QLB B;  3EHV A;  2V3N A;  4GB9 A;  3PTF C;  3PRM B;  2IO1 B;  4O1N A;  4DXG A;  3CIR B;  5LXI B;  3M10 A;  4CHK A;  2K22 A;  5D94 A;  3SEB A;  2D2Q A;  2GB1 A;  4JX1 C;  2JPH A;  3VH4 B;  2UYZ B;  4NAW A;  4ASW C;  4GMV A;  3AN1 A;  1YN4 A;  4YSX B;  3LVW A;  1F9J A;  1ZOY B;  1E5W A;  3R66 C;  1TS4 A;  5G2N A;  3AE2 B;  2YVC A;  1YIW A;  5BYR A;  3N1Y C;  2MBO A;  2PJH A;  2KWC A;  1VZ7 A;  2G3Q B;  3KQ4 A;  1RL9 A;  2C5L C;  4EUT A;  3UI3 A;  2BQQ A;  3AV8 A;  4JE3 B;  2M19 A;  5LLI A;  2GBJ A;  1FCC C;  2GMI C;  1TGZ B;  2RGF A;  5CHV C;  2D33 A;  4W9J A;  3U52 E;  1TT5 B;  3TEY A;  4LTU A;  1WX7 A;  3WAP A;  4YSZ B;  1F77 A;  2NBW B;  1SEB D;  2KAJ A;  2LVQ A;  4FJZ A;  3ZDM C;  2INN E;  2DLB A;  3P42 A;  3ALB A;  4WWP A;  2K9X A;  4C4V A;  1DOX A;  2WDV B;  4XGA B;  1P7F A;  4TSS A;  1K51 A;  4ZRJ A;  2DEN B;  2MCN B;  1NYR A;  3HRD D;  1FD6 A;  2N0S B;  3P4R B;  3A4R A;  3UQA A;  4NQK E;  2VH1 A;  2ZJD A;  3OWE B;  2Z0D B;  5EE0 A;  4QAY A;  2DWQ A;  1SGH A;  2KDI A;  2VRR B;  3WCQ A;  1ZW7 A;  1I4G A;  2KD0 A;  2JZ3 B;  2BB6 A;  2WXM A;  1MHH E;  1IBX A;  5DPR A;  1OTR B;  3WAO A;  1C4A A;  1VRA B;  1OEY J;  2D3B A;  3NRZ A;  3Q2A C;  2MP2 B;  1BML C;  3AEC B;  4LNI A;  4IWO A;  5DPT A;  4C7Z A;  1AW7 A;  3EA6 A;  1HA5 A;  2L52 A;  4IWQ A;  4WQM A;  1WXM A;  2OHF A;  3DWG C;  3V62 A;  1V2Y A;  4HCN B;  3KH0 A;  2WDQ B;  3S2A A;  3VTW A;  3TEZ A;  2KX0 A;  2ZEQ A;  1UWM A;  1EM7 A;  2GRI A;  1EUV B;  3AH7 A;  2HTH A;  1OQQ A;  4HJK A;  3JYU A;  2C7M B;  4IW0 A;  3AE8 B;  1MFW A;  4PT5 A;  1HTQ A;  2R61 A;  3SDL C;  1I0E A;  3CMM B;  3NZ3 A;  4XWW A;  2IY1 B;  2PW9 A;  3E9S A;  1GG3 A;  2N9L A;  3H7P A;  1YQ4 B;  3IVF A;  3DPD A;  1UBQ A;  2LUE A;  2L83 A;  2NBU A;  3JSV A;  3I5J C;  2L0F A;  4MJS A;  2KWU B;  4TMA B;  5KHO A;  2V3S A;  4NQL B;  2CRK A;  2GWD A;  1TKE A;  1JCK B;  2JYE A;  2DAF A;  2BGF A;  1KRH A;  2MRP A;  3HM6 X;  1Q5W B;  2V9H A;  3UQB A;  3P2B A;  3SFD B;  1V81 A;  4KVG B;  2QDF A;  3IAS 1;  3TJP A;  4KDI C;  3RNE C;  3H8H A;  3VTV A;  4W9H A;  1NDD A;  3C0R B;  1UNS A;  2FNJ B;  2MW5 A;  5BO4 B;  2LWP A;  4N9F 4;  4BHL A;  5L95 C;  2XBB C;  4L2Y A;  3IG5 A;  5H92 C;  3OLM D;  2B3A A;  2DZI A;  3ZNI D;  3GZN B;  4RM9 A;  3BZD B;  1L0X B;  3AEG B;  3TSS A;  2HTM E;  2K25 A;  3BK1 A;  3V6C B;  2I38 A;  1T0S C;  1M4V A;  2WX1 A;  1DOI A;  4K81 A;  1NYQ A;  1ZDV A;  2KMM A;  4F8C B;  5D3D A;  1AAR A;  2RDG A;  4BZA A;  3B6R A;  5BMI A;  2K8H A;  3PS6 A;  3UIO B;  2KDM A;  2XEW A;  1XO3 A;  1LO5 D;  3MC0 B;  2MEK A;  3DBS A;  3H7S A;  3Q3M C;  3ZUN A;  3BYT B;  1LM8 B;  1L4D B;  3HHM A;  1WJU A;  2BKR B;  1EU3 A;  2AYO B;  1YNT E;  2FAZ A;  2KQ4 X;  1MPE A;  3DCG A;  2AL6 A;  4RF0 A;  4AQ7 A;  1WYW B;  4B95 A;  3N30 A;  1TKY A;  1JQ4 A;  1OFF A;  4GDK A;  4JWU C;  1LXD A;  1QOF A;  1FXA A;  1HEZ E;  5CTR C;  1TIF A;  3SU8 X;  1SB3 C;  4E71 A;  3DVN V;  3Q8E A;  1IUE A;  1WFY A;  1C78 A;  3P4S B;  3U7D A;  2I1J A;  5JXV A;  4ZRQ A;  1WYG A;  1QQR A;  4ZDV A;  2E6X A;  1WM2 A;  3A9K B;  1FNW A;  2CR5 A;  2GBR A;  2L32 A;  4ANW A;  3PHX B;  4AWJ A;  4KZ0 A;  2CJO A;  4GDL B;  2RMM A;  5D7G A;  2KAN A;  1CQV A;  5HG2 A;  1CMX B;  5IA7 A;  2KLG A;  3C8Y A;  1F2R I;  2Z59 B;  4A3P A;  3NVY A;  5CHW A;  3Q6B A;  4KSK C;  1N5W A;  1I35 A;  3LDZ E;  1SD0 A;  1F52 A;  3MHS D;  1IYF A;  3TBL D;  2KJR A;  3NJT A;  3U7Z A;  2WXJ A;  3SD5 A;  5H8Y E;  1UH6 A;  3ZTD A;  2LEK A;  4J6I A;  3IG8 A;  3JPZ A;  3AE3 B;  4RF8 A;  1P9D U;  3TL5 A;  2K8C A;  2BYF A;  3MJW A;  2EKI A;  4KGT A;  3ZXR A;  2WXI A;  1R8G A;  1NVI D;  2L00 B;  3L54 A;  2DZJ A;  1C1Y B;  2ZW0 A;  3A9J B;  2RSU A;  1MVK A;  2K39 A;  3MJ5 A;  2WXP A;  4WAF A;  1P50 A;  3RZF A;  3V05 A;  4W9I A;  2JZZ A;  4BKG A;  4NJC A;  2L8J A;  4DWF A;  1LFD A;  3UGB B;  3ZDT A;  2MQJ A;  3PVL A;  1C79 A;  4OW0 A;  3Q3N C;  3JVZ X;  1VDV A;  2AQ1 B;  2PLP A;  4GXB A;  4C80 A;  4MSM B;  2LMC A;  3RT3 B;  3IT4 B;  4XWT A;  2J1Q A;  1WGH A;  4FBJ B;  1TTN A;  2R2Q A;  3P1M A;  1YD8 U;  1WJ4 A;  3PRE A;  4ARI A;  2J0K A;  2PVO D;  1UGJ A;  4UDU C;  4DBG A;  3R7Q A;  2JRH A;  3P4Q B;  3Q3O C;  1V9J A;  3VUW A;  1XF5 L;  2NVU I;  1WGY A;  1VR9 A;  2D11 A;  4W9D A;  2ZPY A;  3APF A;  4WAA A;  2LJI A;  2OOB B;  4LLG M;  1YN3 A;  1IP9 A;  3L10 B;  4GLS C;  4DXF A;  2D3C A;  5E6P A;  1P3Q U;  2ZVO A;  2YEP B;  3AEB B;  2JF5 A;  4M02 A;  1D5X C;  3DWM A;  3JQ3 A;  3KWV A;  2C7H A;  1PDX A;  2EEL A;  2INP E;  1ZXH A;  1WMH B;  4MAC A;  2KN5 A;  1V5T A;  1VD2 A;  1WRI A;  2L1A A;  3BYY B;  3BII D;  3WAN A;  1QOA A;  2QSD A;  1D5M C;  2M0A A;  3DVG Y;  4DHJ D;  5TSS A;  4TQ0 A;  3TEX A;  2N1V A;  1MG8 A;  5IOI A;  2MH7 A;  1UUP A;  3BWU D;  3DBH I;  1L5P A;  4RGO S;  2KFK A;  2LJ5 A;  2LUM A;  3QK0 A;  3RNF C;  2KWV B;  1XLQ A;  4BOS C;  1JRO A;  4K3C A;  3H9D A;  4DDI D;  4PYU A;  4YTM B;  2UU7 A;  4JPS A;  4KGR A;  1JWM D;  2LVO A;  2IPK D;  2LGI A;  1STE A;  2M56 B;  2JZP A;  1ZGU B;  2QEJ C;  1MG4 A;  3IFW B;  3QJZ A;  3U2S C;  1S1Q B;  2I1K A;  4P7I A;  3LN7 A;  1WXQ A;  2JT4 B;  2KMA A;  1SE9 A;  5DPW A;  4AJY B;  2AQ3 B;  1SIJ A;  1E10 A;  3T8M A;  2KTR A;  2FID A;  1B1Z A;  2V3P A;  1Z2M A;  3PV1 A;  1VJK A;  1I4X A;  3ZO5 B;  1R4N B;  2I2Y A;  3T3N A;  1KJT A;  5AUI A;  2MBB B;  1CJE A;  2ZNV C;  2KVR A;  4TUU A;  1KLV A;  4HRO A;  2K6Q A;  1GC7 A;  1B9R A;  3RN9 C;  1VA6 A;  4LNF A;  5G5G A;  2N7D A;  1A5R A;  4AUQ C;  3ML8 A;  1TZ1 A;  4G0N B;  1N63 A;  5HFY A;  3W2D A;  2IGG A;  4N6E B;  1T3Q A;  2KDE B;  2HE7 A;  4USA A;  4FHK A;  3OG5 A;  3EGR A;  3P4P B;  1DGJ A;  3A33 B;  2WS3 B;  4JLC A;  1GB1 A;  1JW9 D;  1FIQ A;  4RGM A;  4ANX A;  1TT4 A;  1C9F A;  1EO6 A;  3IBE A;  1UF0 A;  1SIF A;  1V1P B;  1QOB A;  2X38 A;  1UD7 A;  1PYW D;  2MX2 A;  1YMH E;  3PZ7 A;  3OJ4 B;  1TY2 A;  3ABV B;  4P16 A;  5I4D A;  1SJH D;  4YT0 B;  2C7N B;  2YEP F;  4ANU A;  1SBB B;  4W9G A;  4LCD E;  1J19 A;  4HKQ A;  2JWU A;  3KUD B;  5C1Z A;  4BFR A;  1R4M I;  4B9K A;  5IN7 A;  1VCB A;  3Q14 C;  5IP4 D;  1C77 A;  2KFJ A;  4P6V F;  4PK1 A;  3PZ8 A;  2M4N A;  2PKO A;  1WX9 A;  2WXL A;  3AB5 A;  4NZL B;  2Z8L A;  3HUI A;  2JRI B;  2JUO A;  2DHZ A;  1FM0 D;  5EE9 A;  5BMG A;  4EOY A;  5HKH A;  1EF1 A;  2JSV X;  2XK5 B;  1H4R A;  1KFY B;  2DYO A;  1UZX B;  1V5O A;  3APC A;  3U30 A;  3RPF C;  4ZYS A;  4I6P A;  1XCQ L;  2JU6 X;  5C3J B;  2FUH B;  2ONQ A;  4MGZ E;  4WUR A;  1OQR A;  4NAW B;  1I42 A;  2O2V B;  1E8Y A;  2L76 A;  4W9F A;  1XXG A;  4FUL A;  3PPA A;  1L0Y B;  4ARC A;  3AM9 A;  3SHQ A;  4ZOH C;  5EDS A;  2FCS A;  1TYG B;  4EEW A;  2G1E A;  3H7P B;  2HJ1 A;  4ZRK A;  3MHZ A;  3AEA B;  3RFZ B;  1E9M A;  3A9K A;  5D2M B;  1X1M A;  4Q2R A;  1TS3 A;  1VLB A;  1SXT A;  5J99 A;  4DDG D;  1QT9 A;  4BVU C;  1GUA B;  1XEE A;  2QHO A;  1IBX B;  3APD A;  3Q3J A;  3Q8C A;  3PO0 A;  1KLG D;  1KTK A;  3EFU A;  2CHW A;  3ZNZ B;  4MDK E;  1RLF A;  2N7E A;  2MP2 A;  4W9E A;  2W82 A;  2WDR B;  2BW2 A;  2G4S A;  2LXC A;  3ZQ4 A;  3IXS A;  2CU1 A;  3V61 A;  2FIF A;  1JAL A;  2INC C;  1IGC A;  3TEW A;  3DQV A;  3GS2 A;  3N1Z C;  2D3A A;  2V0G A;  1RFA A;  3JU5 A;  3HVD A;  5J9A A;  3KWL A;  3RCZ A;  1BG0 A;  3ZJT A;  1FXT B;  3VDZ A;  2WU2 B;  1K53 A;  2ACZ B;  4A20 A;  2KNB A;  1IGD A;  1I4P A;  1F1H A;  1KF6 B;  2B76 B;  2V4I B;  1FCL A;  2LXA A;  3EFC A;  4RF9 A;  3PRZ A;  4TQ1 A;  2BF8 B;  1YX6 B;  4HLE A;  5BYQ A;  1V86 A;  1ZP0 B;  2DBY A;  4RF6 A;  2UWQ A;  3ZW3 A;  4MEL A;  4GIV A;  2MBQ A;  4MSQ B;  3B9J A;  3J9C A;  1TY0 A;  4AOF A;  2HJ8 A;  3C19 A;  5LNK 1;  2D32 A;  2NCN A;  3LVV A;  4ITK A;  3GOE A;  3HK0 A;  3NVW A;  2M17 A;  2V4L A;  4BKS D;  3TCA A;  4ZYN A;  1P98 A;  3HM3 A;  4FXC A;  4MEM A;  4W9L A;  3DHG C;  3ZJV A;  1RYJ A;  1HQR D;  1XD3 B;  1EWY C;  4JQW C;  2BBC A;  1BXT A;  4D2K A;  3ECI A;  4NNJ B;  5EE3 A;  2M8S A;  2VZK B;  2PMV A;  2R2O A;  2N4F A;  2ZPN A;  4RH6 A;  3BY4 B;  3R8B A;  4AP4 C;  3ETR A;  1V8C A;  2WXN A;  4M0W A;  1E6E B;  2KHW B;  1E8Z A;  1RM6 C;  3B2G A;  2L0T A;  4A55 A;  1FRR A;  2GOW A;  4DQO C;  4KSL C;  1Q1O A;  2KJH B;  3ONS A;  2GBM A;  5JZE B;  2KQ7 A;  3R7R A;  4C56 C;  1I7H A;  3X0W A;  2E3T A;  4LDT D;  4BKS A;  2ZNV B;  1YQB A;  2ASQ A;  1CK1 A;  1NEN B;  1D5Z C;  3NHE B;  4S17 A;  2GWC A;  5KHQ A;  3QIJ A;  3Q8F A;  3LYY A;  3AUL A;  1PGA A;  1XT9 B;  2BYV E;  1EWC A;  2Y5P A;  3AU5 A;  1D4B A;  4HPL B;  4IWP A;  3PZD A;  1QIL A;  4BAX A;  2C60 A;  5LXH A;  3PSE B;  3AED B;  1YN5 A;  3TMP B;  1DOY A;  2ZCC A;  2O6V D;  2AQ2 B;  3N1X C;  4ZHP A;  5HI1 A;  3JSV B;  3DDC B;  5T8I A;  3BVM A;  2JXX A;  1WZ0 A;  1YQ3 B;  1TS5 A;  1QH4 A;  1QOG A;  1E7P B;  2K8B A;  2RPV A;  4HK2 A;  4MM3 A;  1D3Z A;  2EMS A;  3I63 C;  2PE9 A;  1XCT L;  1N6Z A;  3R2I A;  4OVZ A;  1PGB A;  4RNA A;  3A9J A;  3GE3 C;  4LJP B;  3ZNH B;  1JRP A;  2W54 A;  2L3Z A;  3W5U B;  4ICU A;  4GW2 A;  1MI0 A;  3HVZ A;  4CQN A;  3PLV A;  5BYS A;  2BS2 B;  4GOC A;  4OHJ A;  2Y5B B;  2WU5 B;  2HDE A;  2X8X X;  1AYF A;  1WY8 A;  4FAD A;  3L17 A;  1NI3 A;  3L4P A;  3AI5 A;  3L16 A;  1WGR A;  4A9A A;  1ENF A;  3I9V 1;  3Q3F A;  1TBE A;  3NS8 A;  1E8X A;  3RNC C;  1GNU A;  4II3 B;  3T9L A;  2RR9 A;  1WR6 E;  3K9O B;  3EEC A;  2SAK A;  2KN4 A;  1LQB A;  3AE7 B;  3M95 A;  4ACF A;  4XDD A;  1WRD B;  2A4Z A;  4CO7 A;  3LJ3 A;  1E8W A;  4GDL A;  2W3S A;  3NVV A;  3VR9 B;  5FR3 A;  3QAQ A;  2AX5 A;  2BTE A;  3L2E B;  2KZR A;  4M8N A;  2IGD A;  3M62 B;  4K3B A;  4L1B A;  4A8X C;  4RM8 A;  3D32 A;  2FCN A;  1V49 A;  4B0E A;  5EE1 A;  1LGR A;  3VQI A;  2KTR B;  1ET6 A;  4BBN F;  1PGX A;  3NOB A;  4EZK A;  1KLU D;  2PTL A;  5CX3 A;  5FKA C;  3KW5 B;  3PRP B;  1N61 A;  4MGI E;  5IO9 A;  1JWA D;  2FBW B;  4BG4 A;  1E7U A;  3KYD D;  4P1C C;  2LRW A;  2NS5 A;  2DX5 B;  5MPO A;  2LVP A;  3RNB C;  4F1S A;  2H88 B;  5DCN A;  4Q2J A;  1PQS A;  2MJE A;  2W9N A;  4JL9 A;  2IGH A;  3IHP C;  3AE4 B;  5G5H A;  3AU4 A;  2LGY A;  3W1S C;  1MHX A;  1K52 A;  4DXA B;  4YTP B;  4YSY B;  1WWT A;  1T0Y A;  4RF1 A;  4GSW A;  1XQQ A;  2WNM A;  2QJL A;  1YOV B;  3Q8A A;  4FJV B;  3JW0 X;  4LK0 M;  4HDQ A;  4GW0 A;  2FE8 A;  4MGK E;  2N9E B;  4N59 A;  2D5G A;  2RD0 A;  1YX5 B;  2EMT A;  4KV2 A;  4IDI A;  1A70 A;  4NPN A;  2KVZ A;  2N9P C;  3W5V B;  2FUG 1;  2IZV B;  4HPP A;  3DBH B;  2BYT A;  2PIA A;  1G0W A;  1PFD A;  3RUI B;  1T5X D;  2DZK A;  3VRB B;  2KK8 A;  3B08 A;  4HVB A;  2LI5 A;  3BK2 A;  3VRA B;  2W55 A;  3KVF B;  5JH5 C;  2BWE S;  1SF0 A;  4CYE A;  2KWD A;  3X23 A;  1FMA D;  3GP7 A;  1P0R A;  2G9H D;  3QWZ B;  4H2A A;  1V6E A;  4ICV A;  3GB1 A;  4BOZ B;  3P63 A;  2VZK D;  2LHD A;  1FFV A;  4NJ6 A;  1J8C A;  1P52 A;  2KTF A;  4S0R A;  2AL3 A;  3DBL I;  2M1M A;  2MWS B;  2KC1 A;  1DYQ A;  3HIZ A;  1L0V B;  1P1A A;  3FAH A;  1TJE A;  2KX3 A;  2LRU A;  2XK5 A;  1Q10 A;  2PEA A;  3MC9 A;  4M00 A;  4FJY A;  4PYZ A;  1AN8 A;  4KGS A;  2K0P A;  2KC2 A;  2DZM A;  4II2 B;  1J7A A;  1S3S G;  3ZYY X;  4US9 A;  4R3D A;  2ZZP B;  1SE4 A;  1JWS D;  3AE6 B;  1FNV A;  3VR8 B;  4XC2 A;  2J0J A;  3PLU A;  2WDT B;  1ACC A;  2O2V A;  1QK1 A;  4XE0 A;  4J3O D;  1NI2 A;  3BVZ A;  1FEH A;  3Q8B A;  2MSE D;  4LJO B;  2WLB A;  5C23 A;  1WGK A;  1FPY A;  4RGT A;  3ZKJ C;  4RCO A;  4BG4 B;  4WH4 A;  1RRB A;  2XNA C;  2K3U A;  2BPS A;  2PPH A;  2A5U A;  3W9C B;  4PS7 A;  3NZU A;  1I4H A;  2PVG C;  4G11 A;  3EC8 A;  2J0M A;  2LZ6 A;  4REZ A;  2AEH A;  2K5P A;  4KX6 B;  2KXJ A;  2LGX A;  3DVG X;  3E56 A;  2C9W B;  3ML9 A;  3NVZ A;  2KDB A;  4EFO A;  2WXR A;  1C76 A;  2MJD A;  4HPM B;  2J53 A;  5D3I B;  2IJ0 A;  2LGD A;  4RMA A;  2BVC A;  3L2E A;  2KMC A;  3FC4 A;  1D6E C;  4E3C A;  1WGG A;  2Q5W D;  4HXD A;  3R2T A;  1SSN A;  2AWT A;  2GLS A;  3OAW A;  4IKG A;  4KKI A;  3KUC B;  1VZ6 A;  1HTO A;  5FK9 C;  3NG0 A;  4AM1 A;  3QQ8 B;  3A1Q B;  1L7Y A;  1RFK A;  2JQR B;  3K9P B;  3GE8 C;  3IT6 B;  5E6N A;  4EZL A;  4KIK A;  3N3K B;  3QHT A;  4I6L B;  4US8 A;  2DNF A;  4A6Q A;  3B0A A;  3ZTC A;  2WP9 B;  3O13 A;  3ZLZ A;  1NEK B;  4YXD B;  2GBK A;  3O65 B;  4HRS A;  1SE3 A;  3MC8 A;  2GBN A;  1C4P A;  2MA9 B;  3N32 A;  2IO2 B;  4OVU A;  2JWZ A;  1L6U A;  4IM0 A;  4A3O A;  3DHI C;  3V3X A;  2LFI A;  2K1F A;  1VRP A;  4HDO A;  5GMV A;  3N9Y C;  4N58 A;  1OQY A;  1R4M B;  3ZRC A;  1ISN A;  4HWI B;  2ICI A;  2LD9 A;  2NBV B;  5FR6 A;  1ZUD 2;  4EKU A;  5J2R A;  4IG7 B;  5J17 A;  2O6V A;  3VTU A;  2REX A;  3AEF B;  3URY A;  4E74 A;  1J7C A;  1HZ5 A;  4IUM B;  3LN6 A;  4WWO A;  1T0R C;  4K1R B;  3VFK A; 
#chains in the Genus database with same CATH homology
 4S17 A;  2BVC A;  1RL9 A;  3L2E A;  4HPP A;  2OJW A;  2D3A A;  1G0W A;  3B6R A;  1F1H A;  4GVZ A;  4Z9M A;  2D3B A;  1CRK A;  2J1Q A;  1P50 A;  1QK1 A;  2QC8 A;  1HTQ A;  4RF9 A;  4RF7 A;  3L2E B;  3DRE A;  4BHL A;  1M15 A;  4LNI A;  2GLS A;  3JPZ A;  1I0E A;  2CRK A;  4LNK A;  3JU6 A;  3M10 A;  4GW2 A;  4Q2R A;  3JU5 A;  4RF8 A;  5J9A A;  4GVY A;  1P52 A;  2D3C A;  1VRP A;  4BG4 A;  4S0R A;  4GW0 A;  3ZXV A;  1HTO A;  2LGS A;  2UU7 A;  3FKY A;  3NG0 A;  4LNN A;  3ZXR A;  1BG0 A;  1QH4 A;  1SD0 A;  4AM1 A;  1F52 A;  1FPY A;  4LNF A;  5J99 A;  1U6R A;  4RF6 A;  4LNO A;  4XYC A;  4ACF A;  2WGS A;  4BAX A;  3L2D A;  3JQ3 A;  4BG4 B;  3DRB A;  2WHI A;  1LGR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...