4XYCA

Nanomolar inhibitors of mycobacterium tuberculosis glutamine synthetase 1: synthesis, biological evaluation and x-ray crystallographic studies
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
475
structure length
466
Chain Sequence
KTPDDVFKLAKDEKVEYVDVRFCDLPGIMQHFTIPASAFDKSVFDDGLAFDGHESDMLLLPDPETARIDPFRAAKTLNINFFVHDPFTLEPYSRDPRNIARKAENYLISTGIADTAYFGAEAEFYIFDSVSFDSRANGSFYEVDAISGWWNTGAATEADGSPNRGYKVRHKGGYFPVAPNDQYVDLRDKMLTNLINSGFILEKGHHEVGSGGQAEINYQFNSLLHAADDMQLYKYIIKNTAWQNGKTVTFMPKPLFGDNGSGMHCHQSLWKDGAPLMYDETGYAGLSDTARHYIGGLLHHAPSLLAFTNPTVNSYKRLVPGYEAPINLVYSQRNRSACVRIPITGSNPKAKRLEFRSPDSSGNPYLAFSAMLMAGLDGIKNKIEPQAPVDKDLYELPPEEAASIPQTPTQLSDVIDRLEADHEYLTEGGVFTNDLIETWISFKRENEIEPVNIRPHPYEFALYYDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Nanomolar inhibitors of Mycobacterium tuberculosis glutamine synthetase 1: Synthesis, biological evaluation and X-ray crystallographic studies.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
molecule keywords Glutamine synthetase 1
total genus 137
structure length 466
sequence length 475
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature ec 6.3.1.2: Glutamine synthetase.
pdb deposition date 2015-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 4xycA01
3.30.590.10 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Glutamine synthetase/guanido kinase, catalytic domain 4xycA02
1M15A 3L2EB 3M10A 4BG4A 2OJWA 2D3AA 3NG0A 4GW2A 4Q2RA 4BHLA 4LNKA 3L2DA 1CRKA 1QH4A 4RF6A 1VRPA 1BG0A 1P50A 2CRKA 4GVZA 3JQ3A 1HTOA 3FKYA 1I0EA 4GVYA 3L2EA 1F1HA 3JU5A 4LNIA 1SD0A 5J99A 4S0RA 2WGSA 3JPZA 4HPPA 1G0WA 4LNOA 1FPYA 4ACFA 3ZXVA 4RF7A 4AM1A 2UU7A 4BG4B 1QK1A 4Z9MA 3JU6A 2WHIA 4XYCA 1F52A 4LNNA 2QC8A 4BAXA 3B6RA 1P52A 1RL9A 2J1QA 3DRBA 1HTQA 4S17A 4RF9A 3ZXRA 1LGRA 2LGSA 2D3CA 2D3BA 2GLSA 3DREA 4RF8A 2BVCA 4GW0A 5J9AA 4LNFA 1U6RA
chains in the Genus database with same CATH superfamily
1AARA 1WE7A 3NZUA 4AS1A 4CHKA 1EWYC 1WXAA 3ZJUA 5LXIB 5L95C 3DHGC 1C4PA 1OQQA 3CMMB 4KIKA 1LQBA 4RFBA 2KC2A 4LDTB 3GS2A 4B95A 1WX8A 1SE4A 2VZKB 2KFJA 3Q14C 3DVGX 5J2RA 2PLPA 3Q3NC 2D3AA 5CX3A 5FR3A 1R4MB 1VD2A 1RYJA 4HPLB 1SBBB 5JHBA 2LEKA 1FM0D 2KDMA 2LJIA 2SEBD 4UDUC 1ZDXA 2HD5B 1V8CA 2QEJC 4C56C 2R2OA 3A1QB 3V05A 3BIID 4LLGM 2G3QB 2G9HD 4QAYA 4GVYA 1EU3A 3PVLA 4RF7A 1NBFC 4R3DA 3VH4B 2MWSB 1UNSA 2NVUI 1N60A 2PVOD 4RF9A 4MJSB 2LRWA 3CSTA 5AUIA 4WAFA 3B0AA 1TY0A 3V3XA 3N1YC 1A5RA 1YMHE 4MM3B 3Q8AA 3L54A 3SDLC 1UH6A 1P7EA 3VXWA 4CO7A 3RNFC 2OEDA 1MJDA 5TR5A 3VTWA 4NPNA 2ZW0A 2JQRB 1ENFA 4XYCA 1VZ7A 2IY1B 1UGMA 3TEWA 3RNBC 2D32A 1KJTA 2INCC 2N9PC 1R8GA 4EZKA 4W9CA 1CMXB 2WX1A 3NZTA 1KLGD 1LXDA 2YEPF 2MBHA 4LNKA 3RYTA 2C5LC 4NAMA 5IKCM 3HK0A 2KQSA 4WWMA 2XEWA 3TL5A 2I1KA 3ECIA 2W9NA 1TKEA 2V4LA 3QJZA 2J53A 3ZGZA 3VUWA 1Y56A 2HE7A 3TIXA 5I4DA 2MP2A 1NI3A 4HCNB 1D6EC 4HWIB 2BT6A 2J52A 2KDIA 1TKGA 3FC4A 4IW0A 3QCAA 2PPHA 3AE3B 2D5GA 3APCA 4C80A 2VRRB 4L1BA 3ABVB 1F2RI 4Z9MA 1E6EB 5JH5C 2DZJA 4JGHB 2D3CA 3DVGY 3R7RA 3UINB 5J9AA 5MPOA 5E6NA 1E5WA 4L23A 3VQIA 1JWUD 2DNFA 3L2DA 3H8HA 2HTHA 1V1PB 2N0SB 4TKNA 2B3AA 3JPZA 4M00A 4ANUA 4II3B 1VCBA 1I42A 2WQYB 2W54A 4FLHA 2M0XA 1MFWA 2RSUA 4N9F4 2WHIA 1AYFA 2QDFA 2FAZA 4HLEA 2NS5A 2KACA 3AV8A 1X1MA 4LCDE 4ZHPA 3RT3B 4BZAA 3AE1B 3VRBB 3QARA 4ZDVA 2LI5A 4WJNA 3ZJTA 5DPWA 4P7IA 1FXIA 1Z5SB 2JYEA 1GJZA 5IP4D 3SFEB 1TKYA 2Z0DB 4G11A 2BF8B 4CQNA 4BOSC 2PE9A 1JROA 4W9JA 2NR2A 3B2GA 2D11A 3AMZA 5DPSA 2L32A 3DVNV 4J3OD 2WU2B 2K6DB 1Q10A 3QQ8B 2GBNA 2M8SA 4C4VA 3X23A 3KH0A 4DWFA 3RUIB 3W1SA 2LGYA 1QT9A 4XDCA 4DHJD 3RCZA 3N30A 2XN9C 3LN6A 3A9KB 3BWUD 4PK1A 1G0WA 3FAHA 2WP9B 4P1CC 1KOTA 1DYQA 3QHTA 2QHOA 3ETRA 5G5GA 2WXKA 3B6RA 2N9KA 5D3DA 2DYOA 3W1YA 5HKHA 1YD8U 1C79A 4AQ7A 1FCCC 3P4RB 3H7SA 5D3IB 2WXJA 4DK5A 3PRPB 3JYUA 3JQ3A 2CU3A 1OGWA 2EMSA 2FCNA 3GP7A 1T3QA 2KQ7A 4LNOA 1TZOA 3AEFB 3AM9A 1KLVA 5LNK1 2BB6A 3QAQA 4KZ0A 2JSVX 2O6VB 4EUTA 1WJ4A 4YSZB 1F77A 3VTVA 4US8A 4MH0E 3LJ3A 3R3MA 4JE3B 3BVGA 4W9GA 3ZQ4A 2WXNA 1KF6B 1YQ4B 2DAFA 1UWXA 1YOVB 1ACCA 2LVPA 4A90A 5GMVA 4W9HA 3EFUA 4GW0A 1QLBB 4LNFA 4A3PA 2KOXA 3J9CA 2ZNVC 3I63C 2OHFA 3IHPC 3PLUA 3VFKA 4KGRA 1LFDA 2IGHA 3RZFA 5EDSA 3AN1A 2AL6A 2R61A 2RD0A 2H89B 2K1FA 2JZZA 2ZVNA 2RMMA 3NVVA 4O1NA 2K6QA 1MG8A 3NG0A 1YX5B 4KIKB 1SIJA 3ZIMA 3EGRA 4JLCA 3U7DA 3SD5A 4PS7A 3T8MA 1D5ZC 2HJ1A 4GGQA 4FA6A 4NJ7A 2KN4A 3QWZB 1WZ3A 1UD7A 1P52A 4YXDB 4WURA 3C19A 5IOIA 3AEAB 4K3BA 2K8BA 1MHHE 2V3SA 5IN7A 2KT7A 1YJJA 3IT4B 3EHVA 2X8XX 2OJRA 2LUMA 2AQ2B 2D3GA 3L17A 1ROEA 4A8XC 1SEBD 1WIAA 4NJ6A 2L7RA 2QIEB 5DPTA 2AWTA 4ICUA 4DDID 1YX6B 1HTOA 2O6VD 3AE5B 4LNIA 1TS3A 4HK2A 2MBOA 4BG4B 3B2FA 3I57A 1BT0A 1SE9A 1J19A 4JX1C 2IDYA 1LGRA 2MH7A 4WIPA 4CYEA 1XT9B 3H1UA 3EFCA 3A9JA 2WS3B 1CK1A 1TY2A 3Q8EA 2NCNA 3I3TB 1VLBA 4IM0A 2KMCA 4K81A 3MC8A 1WMHA 1HZ5A 5C23A 1IBXB 3PV1A 3L13A 2AQ3B 2PEAA 1F52A 1KH0A 1F0ZA 4E74A 5IAAC 2Q5WD 4WQMA 1YIWA 3RD2A 4MDKE 1Y8RC 2WDQB 3TJPA 3LXFA 2GWDA 2KJHB 1ESFA 2WXLA 2MP2B 2RPQA 3AE6B 3V6EB 1K51A 4I6PA 1WXVA 2KWCA 1F9JA 2DZMA 3Q8CA 4DHZE 1XEEA 1EM7A 2ZW1A 2ZCCA 3SR6A 2PIAA 2KC1A 2X38A 4YWGG 3N3KB 4HDOA 2LUEA 3Q3FA 4LTUA 5AUKA 4ZRPA 1TT4A 2JYTA 4FJYA 5T8IA 4G50A 2KMAA 1QOBA 2LFIA 2BS3B 1SF0A 4GDKA 3RNCC 2E6XA 2L0TA 3RI7C 1K52A 3HUIA 2VH2A 4KDIC 2KZRA 2DBYA 3DWMA 1E8YA 2MRPA 1P50A 4OHJA 4DXGA 2L8JA 4J6IA 1NYRA 2DWQA 1YN3A 2WDTB 4PT5A 1TJEA 3VRAB 1PFDA 4MSMB 1XLPA 4BFRA 5CHVC 1TGZB 2D3BA 1WGYA 2DLBA 2KLGA 4NZLB 4WQOB 1IGDA 1P3QU 3A4RA 1I35A 4XE0A 4RF1A 4NY0A 3PO0A 4NQKE 3HIZA 2JX5A 4IUMB 5TSSA 1TTNA 2DZIA 1YN5A 3U30A 4W9DA 2L00B 4KDLB 1D5XC 4BBNC 2IPKD 3RPFC 2W82A 2KK8A 1C1YB 4ZYSA 1S3SG 4KSKC 4N58A 2L0FA 3ZKJC 2GLSA 2ZEQA 2FUHB 2GOWA 1NDDA 1WMHB 1M4VA 2N1VA 3NVZA 3P4QB 4FJVB 3AEGB 3X0WA 1XD3B 4MT5A 4YTMB 1V81A 2GMIC 3AE2B 1P9DU 3UIOB 2CHXA 3KUCB 4RGTA 1OQRA 4GSWA 2CJOA 2L76A 3UQBA 4ZRJA 3IG5A 4GIVA 3L4PA 2ASQA 4ZYNA 2DYMA 1EF1A 3AEEB 4FHJA 3Q8BA 1WJNA 2J0KA 2IO2B 4EZJA 3KW5B 2JT4B 3TMPB 5D7GA 2L1AA 2CHZA 3ZNHB 1SSNA 5J17A 3R8BA 3PZ8A 2BVCA 2XNAC 1E8WA 2JWZA 2V3NA 4DHZB 3UQAA 3A33B 4M0WB 1HE8A 5J99A 3AEBB 4XC2A 2G4DB 4FBJB 2CJNA 2DYBA 3VHTC 3M62B 3APFA 3BYTB 2O2VA 4XZ4A 5IA7A 1VDVA 2NBUA 5G5HA 1WJUA 4NJCA 1B1ZA 4AUQC 1WX7A 2IY0B 4G3XB 2VZKD 1F1HA 2G45B 3LVVA 2N7JA 2KMMA 5JZEB 4GDLB 3WAMA 3AE8B 1C77A 2MSED 4ZRIA 3DBLB 5D2MB 2M19A 1FO4A 2LASA 5BMHA 3AU5A 4EEWA 1ZPSA 4I6LB 4WAAA 2PE6B 4ANVA 1R7SA 2N7DA 1AWDA 1RFKA 1XF5L 4HKZE 1AW7A 1TZ1A 3RZWC 1QF6A 1MPEA 1J7CA 3PLVA 2PTLA 5AZHA 3Q2AC 4GXBA 1BMLC 1JRUA 1I4QA 2LVOA 3IAM1 5C2TB 3QA8A 2REXA 3JSVB 1CZPA 2KWDA 2M1MA 2K8HA 1WRDB 4REZA 2Y5CA 2G4SA 4IG7B 3H6NA 2JPHA 3SFDB 2WDRB 3HRDD 2JXTA 1SJHD 3NOBA 4ITKA 4JQWC 2QC8A 3AH7A 4OZAA 3DBHI 2DAJA 4RCOA 2KWVB 3L08A 1SGHA 2KTFA 3MHSD 2ZCBA 2JF5A 4AJWA 1E9MA 1P0RA 3NZ3A 2WDVB 2M17A 4YSXB 2CR5A 4TUUA 2NPTA 3W9CB 1T0RC 4HRSA 5CTRC 2V0GA 2RDGA 3V60A 3NVYA 4WWPA 2GB1A 1CQVA 5D6JB 3AE9B 1R4MI 1P1AA 1QQRA 5IO9A 2WLBA 4MSQB 1JQ4A 1WR1A 1QH4A 3R2IA 1FRDA 4ICVA 4LK0M 1ZDVA 4N59A 3ZW3A 1WX9A 2N4FA 2MQJA 4B9KA 5BMIA 1NYQA 1PDXA 1R4NI 1V9JA 3ENEA 3DCGA 1FPYA 3H9DA 1UZXB 2SAKA 2CHWA 3C8YA 1PYWD 3N32A 2YVCA 1FIQA 2RDBC 3HM3A 3BZDB 2C7NB 3LVWA 3E56A 1JALA 2INDC 1T5XD 5HI1A 4FADA 4IC7B 4NAWA 3B9JA 4OVVA 1L2NA 1JWBD 3LB8C 4IKGA 2UU7A 2G1EA 1V5TA 1SJED 1AN8A 2RPVA 1RLFA 3E9SA 4A20A 1IPGA 2BYVE 1XXGA 1T0YA 3VR8B 3P4PB 1GB4A 3OWEB 3KLSX 1WYGA 3CIRB 2Y5PA 4AJYB 5EE0A 1FD6A 1EF5A 4ASWC 1YJIA 4RGOS 1L0XB 3R66C 4HXDA 3TUOA 1D4BA 5EE9A 4LDTD 4OVZA 4AM1A 1V86A 3GOEA 3QC8B 2I2YA 2LVQA 2DENB 2LGIA 3AI5A 2BGFA 1UWMA 2L83A 4ARIA 3V61A 2MHJA 2D2QA 2J7QB 2AX5A 5FKAC 1V97A 4JIOU 3ZJVA 1D3ZA 4TQ1A 3FKYA 4EOYA 2J0MA 3DVNU 2MX2A 3LDZE 1V80A 1WH3A 2HTME 4EKUA 3PTFC 4AWJA 1RL9A 1QKZA 1SE2A 5BO4B 3N20C 3VR9B 1STEA 3Q3MC 1LM8B 3WA0A 1WE6A 2Y3AA 2BYFA 2L05A 3JW0X 1QOFA 2M4NA 5BYRA 2AL3A 2N9XA 1J7BA 3JU6A 1IGCA 2LGSA 2MW5A 3DBLI 1TS2A 1J8CA 1E90A 1WYWB 1I7HA 1D5MC 3PZ7A 1UUPA 5C3JB 3VVWB 4XWTA 3QK0A 1JMLA 3Q3JA 3M95A 3ZTDA 4NQLB 1GUAB 2WXIA 1HQRD 1WM2A 2V4IB 4I6NB 1FCLA 2W55A 4WJOA 2KDEB 3ZUNA 1K8RB 1WGGA 4HCPB 2JY6A 4C7YA 1TBEA 1UBQA 2ACZB 4URKA 2CS4A 3MTNB 4IM2A 5HG2A 4GVZA 1MG4A 1DOXA 2LZ6A 1XLQA 1VRAB 3K9PB 1V6EA 1L6UA 4KKJA 3ZNZB 4A55A 1NI2A 2IO3B 2I1JA 3ZDMC 2BYTA 1I4XA 2R2QA 2IO0B 1C3TA 3M63B 4KKIA 3UGBB 3NRZA 4W9FA 2ZVOA 2GRIA 1KTKA 2O6VA 4KSLC 2QILA 5KHOA 1H8CA 2TSSA 3DHIC 3PS6A 1ZP0B 4LNNA 3NS1A 3MJWA 2O2VB 4RH6A 3TBLD 1Q1OA 1OTRB 4K7UA 1FNWA 1L4ZB 1WR6E 4IM3A 4M0WA 1WXQA 1JWMD 4II2B 1A70A 4WJPA 4US9A 1ZOYB 3RULA 3ZTCA 3ALBA 3OLMD 1HTQA 2ZJDA 3AB5A 2NBVB 1IP9A 3CF6E 1WI0A 1GAQB 2GBJA 1RWSA 3AULA 1OEYA 2V1YA 1N63A 1V49A 3HVZA 5LLIA 1QOGA 4IOIE 4RMAA 2YLMA 2GBKA 4L2YA 3T3NA 2ONQA 3KUZA 1U4AA 2LGDA 3BVMA 3ML9A 4W9LA 1YNTE 2C9WB 4BKTA 2BQQA 4K3CA 2PVGC 4WJQA 1PGBA 2FIDA 2JRHA 4HPPA 2KTRB 3AEDB 1ZXHA 2AEHA 1XO3A 5AZFA 3Q69A 5H8YE 5DPRA 5E6OA 2JXXA 4W9KA 4KX6B 1K50A 4RM8A 1E8ZA 1VJKA 1VZ8A 4GW2A 2WXMA 1M94A 3IVFA 3OG5A 1I0EA 4F7ZA 1MHXA 2EKIA 2WXQA 4GMVA 1E7PB 3EA6A 4F1SA 2KVRA 3HHMA 2I38A 4FHKA 4IDIA 2KANA 5CHFA 1WM3A 5EE1A 4BKGA 1V1PA 2K25A 4NNJB 3T3OA 5BMGA 1FMAD 1UGJA 4ARCA 3EECA 2KNBA 3MHZA 3PGEA 4YTNB 4RF6A 3CWIA 3W1SC 4PYZA 1VR9A 1JCKB 2FNJB 3L2EA 1SD0A 2NTSA 2LXCA 5CHWA 3WANA 3CSFA 1XQQA 2OOBB 3A4SC 5HHDG 1OQYA 4RGNA 1UBIA 4B0EA 2LXAA 3I5JC 1L0YB 4WWOA 5DCNA 2ZNVB 3APDA 1V4GA 2QCZA 3L10B 1KFYB 3JU5A 3WALA 3WAOA 2KLCA 1T6BX 2WXGA 2LRUA 4K7SA 3PRZA 2NTTA 2BWES 2IO1B 3ONSA 4GU2A 3ZNGC 3U52E 5FR6A 2LWPA 1NVID 2KD0A 2KX3A 4BBNF 1NENB 4ANXA 5L83A 1I4HA 3BVZA 1HA5A 2FCMA 3UF8A 2BPSA 3GZNB 4ZRQA 1PQSA 3AE7B 4MGKE 3RNGC 1I4PA 3IT6B 4FN2A 3SU8X 1XLNA 2GBMA 3R2TA 2DZKA 3URYA 2RDHA 2KYWA 3QX1A 3IG8A 3GB1A 1BUIC 1N6ZA 2BKRB 1UELA 4MM3A 5H92C 1FXAA 1JW9D 3VDZA 4C00A 1L6VA 4K1RB 4DHJB 3GE3C 1XCQL 1J7AA 3DBHB 2PKOA 2IBIB 1V1OA 1NEKB 1T0QC 5JHAA 4RM9A 2NBWB 1ET6A 3OJ3A 2KO3A 1SIFA 4X57B 3A1QA 3PRMB 2KQ4X 3Q3OC 2JZ3B 5E6PA 2MCNB 1Q5WB 2V9HA 1EU4A 3VTUA 3A9JB 2KFKB 2FBWB 4F8CB 1ZXIA 2KX0A 1FFVA 2MJDA 1GNUA 2XBBC 1TIFA 1FXTB 3PZDA 1Q0WB 2MJEA 4JWSC 5BYSA 4BG4A 4MELA 4K7WA 4A9AA 1KLUD 3SHQA 1N5XA 5JXVA 3TCAA 5EE3A 2KDFB 1EUVB 3MP9A 4M01A 4MACA 3BYYB 2MBQA 1PUTA 2WXPA 3PHWB 4BKSD 4YT0B 3U4EG 3DBSA 4JWUC 3DQVA 4WWNA 3M3JA 1RRBA 1WXMA 4HKQA 3DREA 4IWPA 4HEA1 1H4RA 2WWZA 4YL8A 1OFFA 4ZRKA 1QZEA 1CRKA 2MA9B 1WGHA 2N7EA 1E7VA 2KVZA 3KWLA 3N1ZC 4NAWB 3N1XC 2BWFA 4M02A 4P6VF 4KZCA 4GLSC 2WNMA 3KQ4A 3H7PB 3PT2B 3T9LA 3IBEA 1GOZA 3K9OB 2AYOB 4MGZE 3WIMA 3L16A 4OZBA 4S0RA 2MEKA 1TT5B 2ZPNA 3ZXVA 3FILB 4IWOA 1P7FA 3VH3B 2K9XA 3D32A 1TS5A 4BAXA 2BTEA 2WU5B 4DXFA 4EZLA 4TQ0A 4EE2A 3IG3A 4RGMA 1E0ZA 4PYUA 3IFWB 1I4GA 1WSPA 1RFAA 1QILA 3KWVA 3P2BA 4YSYB 1C4CA 4USAA 1JRPA 4E71A 2IGDA 2KAJA 4RNAA 3P63A 2INNE 3OJ4B 1XCTL 2UYZB 2BYEA 1U6RA 1GPXA 3ML8A 1ET9A 1V2YA 4GB9A 3BK1A 4Q2JA 3P4SB 4EFOA 2MBBB 2JUOA 3VUXA 3R7QA 1JWAD 1KM7A 3GE8C 3I9V1 2PJHA 2IGGA 4DBGA 2AQ1B 4OW0A 4RF8A 2L3ZA 2ZPYA 2KN5A 2EKEC 2OJWA 3WCQA 2RR9A 3B1LX 2BKFA 3LYYA 1C9FA 4B6WA 3VAWA 2KJRA 5GXGB 2A4ZA 1WJ6A 1PGXA 3RFZB 1ZUD2 3NUHB 1I4RA 2J4XA 3UIPB 2QJLA 4P1BC 4TMAB 2CU1A 2FCSA 1L4DB 1M15A 1V5OA 3BINA 2M0AA 2LHDA 2FCQA 2JU6X 3ZNID 4DQOC 3Q6BA 4E3CA 2KDBA 1R4NB 1L5PA 3ZXRA 2INPE 5LXHA 1SB3C 2GI9A 3ZYYX 3DDCB 3P42A 1S1QB 3SEBA 1VA6A 1N5WA 2CRKA 3ZDTA 1G6JA 2YEPB 2NMQA 1FNUA 4ACFA 4W9EA 2J0JA 5G55A 5HFYA 1WY8A 1QK1A 1ZGUB 2WXRA 1ZE3D 4GN1A 2JWUA 2WXOA 4LJPB 5AZGA 1L7YA 1C4AA 5J18A 3PSEB 3RMKC 1HXYD 3O13A 2QMTA 1LO5D 1ISNA 4TV3A 2Y5BB 3U2SC 2IZVB 3KYDD 4MEMA 3AE4B 2C7MB 5KHQA 2MJ3A 3H7PA 1CJEA 2XK5B 2L52A 1FFUA 3VUYA 2K22A 4C4VB 1WGRA 4D2KA 3O65B 1PGAA 3IAS1 2MBEA 3V62A 1SE3A 2GBRA 1XLOA 3GZNI 3NZSA 2V3PA 1B9RA 3ZVVA 5C1ZA 1HZ6A 4AOFA 5AEKB 1T0SC 2WGSA 1IBXA 2BW2A 5D94A 2K5PA 4IWQA 1E8XA 3AXCA 3DBRB 3DRBA 2D10A 1N62A 3AU4A 3RN9C 1K53A 2H88B 1TYGB 1ZW7A 3IXSA 2IJ0A 5BYQA 2HJ8A 3ZRCA 4H2AA 2BS2B 3DHHC 2XK5A 2VH1A 4XX5A 3MC0B 3AECB 2KFKA 2LGXA 3NS8A 1BXTA 4JPSA 1GG3A 5FK9C 3S2AA 1DOYA 1MI0A 4ZHOA 3M10A 4BHLA 1E10A 2LMCA 1VRPA 4OVUA 1YQBA 1SXTA 4KVGB 3BY4B 3ZLZA 4W9IA 4KV2A 4KGTA 4DXAB 2PMVA 4C7ZA 4YTPB 2NPTB 3PHXB 1C78A 2FIFA 2Z59B 3EUB2 1GC7A 2EMTA 2HDEA 4HROA 2ICIA 3TEZA 3DOWA 2C60A 3UI3A 3NY5A 2M56B 2LHEA 3MFGA 4B0MA 3LN7A 3NHEB 1BG0A 2Z0EB 1WGDA 2DHZA 1UF0A 1C76A 1YN4A 1ZKHA 1DGJA 2JVCA 1FEHA 3TSSA 4RF0A 4WH4A 4MJSA 1WZ0A 2CKHB 4GDKB 2FE8A 2ON8A 1WFYA 2WYQA 4A3OA 1KRHA 2MLBA 2KHWB 4DDGD 3BK2A 4PS3A 1N61A 3W2DA 4HVBA 2J42A 2UWQA 4BOZB 2QSDA 1WF9A 1WGKA 2BS4B 4M8MA 3DBRI 1RAXA 2K0PA 1WXSA 1HEZE 2LJ5A 2IYDB 3QIJA 3TEXA 1TS4A 1YQ3B 4XWWA 2J1QA 2BB5A 3HVDA 1EWCA 4N6EB 2N9EB 4M8NA 1QOAA 2ZZPB 2KXJA 4LJOB 3HM6X 2D07B 2A5UA 4A6QA 3OAWA 3NJTA 2WXHA 3L0WB 4HJGE 4GOCA 1DOIA 1IUEA 3V6CB 3RNAC 3C0RB 4HJKA 2N9LA 4FXCA 3DPDA 3JSVA 3EC8A 4S17A 1EO6A 1F2RC 3L2EB 4KGSA 2RGFA 4MGIE 4XGAB 3W5UB 1OEYJ 1P98A 3P1MA 1E7UA 2JRIB 3N9YC 3PPAA 1VZ6A 2K39A 1J0GA 2B76B 4MGYE 4BKSA 4P16A 2E3TA 1RM6C 4FULA 4ZOHC 2W3RA 5E6JA 1IYFA 2W3SA 4ANWA 1GB1A 3PREA 1GC6A 1JWSD 3NVWA 3U8ZA 2KKCA 3B08A 4G0NB 2K8CA 4GDLA 2BBCA 1MVKA 2FUG1 3FILA 2JZPA 3KVFB 2EELA 2LD9A 2DX5B 3A9KA 3MC9A 2KTRA 5G2NA 3RNEC 4MH8A 4XDDA 3W5VB 1FNVA 2D33A 4OZCA 3JVZX 1FRRA 3ZO5B 4Q2RA 3WAPA 3TEYA 2PW9A 2GWCA 3KUDB 2KWUB 2C7HA 2N1WA 2KJ6A 3KYCD 3MJ5A 4JL9A 4BVUC 1YJ1A 1L0VB 1Z2MA 4FJZA 1WWTA 2K3UA 3U7ZA 3DWGC 2WX0A 4PS8A 1WRIA 4HPMB 3Q8FA 4AP4C 4HDQA 4TSSA 3ZRFA 2Z8LA 2WXFA
chains in the Genus database with same CATH topology
1M15A 3L2EB 3M10A 4BG4A 2OJWA 2D3AA 3NG0A 4GW2A 4Q2RA 4BHLA 4LNKA 3L2DA 1CRKA 1QH4A 4RF6A 1VRPA 1BG0A 1P50A 2CRKA 4GVZA 3JQ3A 1HTOA 3FKYA 1I0EA 4GVYA 3L2EA 1F1HA 3JU5A 4LNIA 1SD0A 5J99A 4S0RA 2WGSA 3JPZA 4HPPA 1G0WA 4LNOA 1FPYA 4ACFA 3ZXVA 4RF7A 4AM1A 2UU7A 4BG4B 1QK1A 4Z9MA 3JU6A 2WHIA 4XYCA 1F52A 4LNNA 2QC8A 4BAXA 3B6RA 1P52A 1RL9A 2J1QA 3DRBA 1HTQA 4S17A 4RF9A 3ZXRA 1LGRA 2LGSA 2D3CA 2D3BA 2GLSA 3DREA 4RF8A 2BVCA 4GW0A 5J9AA 4LNFA 1U6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M15 A;  3L2E B;  3M10 A;  4BG4 A;  2OJW A;  2D3A A;  3NG0 A;  4GW2 A;  4Q2R A;  4BHL A;  4LNK A;  3L2D A;  1CRK A;  1QH4 A;  4RF6 A;  1VRP A;  1BG0 A;  1P50 A;  2CRK A;  4GVZ A;  3JQ3 A;  1HTO A;  3FKY A;  1I0E A;  4GVY A;  3L2E A;  1F1H A;  3JU5 A;  4LNI A;  1SD0 A;  5J99 A;  4S0R A;  2WGS A;  3JPZ A;  4HPP A;  1G0W A;  4LNO A;  1FPY A;  4ACF A;  3ZXV A;  4RF7 A;  4AM1 A;  2UU7 A;  4BG4 B;  1QK1 A;  4Z9M A;  3JU6 A;  2WHI A;  4XYC A;  1F52 A;  4LNN A;  2QC8 A;  4BAX A;  3B6R A;  1P52 A;  1RL9 A;  2J1Q A;  3DRB A;  1HTQ A;  4S17 A;  4RF9 A;  3ZXR A;  1LGR A;  2LGS A;  2D3C A;  2D3B A;  2GLS A;  3DRE A;  4RF8 A;  2BVC A;  4GW0 A;  5J9A A;  4LNF A;  1U6R A; 
#chains in the Genus database with same CATH topology
 1AAR A;  1WE7 A;  3NZU A;  4AS1 A;  4CHK A;  1EWY C;  1WXA A;  3ZJU A;  5LXI B;  5L95 C;  3DHG C;  1C4P A;  1OQQ A;  3CMM B;  4KIK A;  1LQB A;  4RFB A;  2KC2 A;  4LDT B;  3GS2 A;  4B95 A;  1WX8 A;  1SE4 A;  2VZK B;  2KFJ A;  3Q14 C;  3DVG X;  5J2R A;  2PLP A;  3Q3N C;  2D3A A;  5CX3 A;  5FR3 A;  1R4M B;  1VD2 A;  1RYJ A;  4HPL B;  1SBB B;  5JHB A;  2LEK A;  1FM0 D;  2KDM A;  2LJI A;  2SEB D;  4UDU C;  1ZDX A;  2HD5 B;  1V8C A;  2QEJ C;  4C56 C;  2R2O A;  3A1Q B;  3V05 A;  3BII D;  4LLG M;  2G3Q B;  2G9H D;  4QAY A;  4GVY A;  1EU3 A;  3PVL A;  4RF7 A;  1NBF C;  4R3D A;  3VH4 B;  2MWS B;  1UNS A;  2NVU I;  1N60 A;  2PVO D;  4RF9 A;  4MJS B;  2LRW A;  3CST A;  5AUI A;  4WAF A;  3B0A A;  1TY0 A;  3V3X A;  3N1Y C;  1A5R A;  1YMH E;  4MM3 B;  3Q8A A;  3L54 A;  3SDL C;  1UH6 A;  1P7E A;  3VXW A;  4CO7 A;  3RNF C;  2OED A;  1MJD A;  5TR5 A;  3VTW A;  4NPN A;  2ZW0 A;  2JQR B;  1ENF A;  4XYC A;  1VZ7 A;  2IY1 B;  1UGM A;  3TEW A;  3RNB C;  2D32 A;  1KJT A;  2INC C;  2N9P C;  1R8G A;  4EZK A;  4W9C A;  1CMX B;  2WX1 A;  3NZT A;  1KLG D;  1LXD A;  2YEP F;  2MBH A;  4LNK A;  3RYT A;  2C5L C;  4NAM A;  5IKC M;  3HK0 A;  2KQS A;  4WWM A;  2XEW A;  3TL5 A;  2I1K A;  3ECI A;  2W9N A;  1TKE A;  2V4L A;  3QJZ A;  2J53 A;  3ZGZ A;  3VUW A;  1Y56 A;  2HE7 A;  3TIX A;  5I4D A;  2MP2 A;  1NI3 A;  4HCN B;  1D6E C;  4HWI B;  2BT6 A;  2J52 A;  2KDI A;  1TKG A;  3FC4 A;  4IW0 A;  3QCA A;  2PPH A;  3AE3 B;  2D5G A;  3APC A;  4C80 A;  2VRR B;  4L1B A;  3ABV B;  1F2R I;  4Z9M A;  1E6E B;  5JH5 C;  2DZJ A;  4JGH B;  2D3C A;  3DVG Y;  3R7R A;  3UIN B;  5J9A A;  5MPO A;  5E6N A;  1E5W A;  4L23 A;  3VQI A;  1JWU D;  2DNF A;  3L2D A;  3H8H A;  2HTH A;  1V1P B;  2N0S B;  4TKN A;  2B3A A;  3JPZ A;  4M00 A;  4ANU A;  4II3 B;  1VCB A;  1I42 A;  2WQY B;  2W54 A;  4FLH A;  2M0X A;  1MFW A;  2RSU A;  4N9F 4;  2WHI A;  1AYF A;  2QDF A;  2FAZ A;  4HLE A;  2NS5 A;  2KAC A;  3AV8 A;  1X1M A;  4LCD E;  4ZHP A;  3RT3 B;  4BZA A;  3AE1 B;  3VRB B;  3QAR A;  4ZDV A;  2LI5 A;  4WJN A;  3ZJT A;  5DPW A;  4P7I A;  1FXI A;  1Z5S B;  2JYE A;  1GJZ A;  5IP4 D;  3SFE B;  1TKY A;  2Z0D B;  4G11 A;  2BF8 B;  4CQN A;  4BOS C;  2PE9 A;  1JRO A;  4W9J A;  2NR2 A;  3B2G A;  2D11 A;  3AMZ A;  5DPS A;  2L32 A;  3DVN V;  4J3O D;  2WU2 B;  2K6D B;  1Q10 A;  3QQ8 B;  2GBN A;  2M8S A;  4C4V A;  3X23 A;  3KH0 A;  4DWF A;  3RUI B;  3W1S A;  2LGY A;  1QT9 A;  4XDC A;  4DHJ D;  3RCZ A;  3N30 A;  2XN9 C;  3LN6 A;  3A9K B;  3BWU D;  4PK1 A;  1G0W A;  3FAH A;  2WP9 B;  4P1C C;  1KOT A;  1DYQ A;  3QHT A;  2QHO A;  3ETR A;  5G5G A;  2WXK A;  3B6R A;  2N9K A;  5D3D A;  2DYO A;  3W1Y A;  5HKH A;  1YD8 U;  1C79 A;  4AQ7 A;  1FCC C;  3P4R B;  3H7S A;  5D3I B;  2WXJ A;  4DK5 A;  3PRP B;  3JYU A;  3JQ3 A;  2CU3 A;  1OGW A;  2EMS A;  2FCN A;  3GP7 A;  1T3Q A;  2KQ7 A;  4LNO A;  1TZO A;  3AEF B;  3AM9 A;  1KLV A;  5LNK 1;  2BB6 A;  3QAQ A;  4KZ0 A;  2JSV X;  2O6V B;  4EUT A;  1WJ4 A;  4YSZ B;  1F77 A;  3VTV A;  4US8 A;  4MH0 E;  3LJ3 A;  3R3M A;  4JE3 B;  3BVG A;  4W9G A;  3ZQ4 A;  2WXN A;  1KF6 B;  1YQ4 B;  2DAF A;  1UWX A;  1YOV B;  1ACC A;  2LVP A;  4A90 A;  5GMV A;  4W9H A;  3EFU A;  4GW0 A;  1QLB B;  4LNF A;  4A3P A;  2KOX A;  3J9C A;  2ZNV C;  3I63 C;  2OHF A;  3IHP C;  3PLU A;  3VFK A;  4KGR A;  1LFD A;  2IGH A;  3RZF A;  5EDS A;  3AN1 A;  2AL6 A;  2R61 A;  2RD0 A;  2H89 B;  2K1F A;  2JZZ A;  2ZVN A;  2RMM A;  3NVV A;  4O1N A;  2K6Q A;  1MG8 A;  3NG0 A;  1YX5 B;  4KIK B;  1SIJ A;  3ZIM A;  3EGR A;  4JLC A;  3U7D A;  3SD5 A;  4PS7 A;  3T8M A;  1D5Z C;  2HJ1 A;  4GGQ A;  4FA6 A;  4NJ7 A;  2KN4 A;  3QWZ B;  1WZ3 A;  1UD7 A;  1P52 A;  4YXD B;  4WUR A;  3C19 A;  5IOI A;  3AEA B;  4K3B A;  2K8B A;  1MHH E;  2V3S A;  5IN7 A;  2KT7 A;  1YJJ A;  3IT4 B;  3EHV A;  2X8X X;  2OJR A;  2LUM A;  2AQ2 B;  2D3G A;  3L17 A;  1ROE A;  4A8X C;  1SEB D;  1WIA A;  4NJ6 A;  2L7R A;  2QIE B;  5DPT A;  2AWT A;  4ICU A;  4DDI D;  1YX6 B;  1HTO A;  2O6V D;  3AE5 B;  4LNI A;  1TS3 A;  4HK2 A;  2MBO A;  4BG4 B;  3B2F A;  3I57 A;  1BT0 A;  1SE9 A;  1J19 A;  4JX1 C;  2IDY A;  1LGR A;  2MH7 A;  4WIP A;  4CYE A;  1XT9 B;  3H1U A;  3EFC A;  3A9J A;  2WS3 B;  1CK1 A;  1TY2 A;  3Q8E A;  2NCN A;  3I3T B;  1VLB A;  4IM0 A;  2KMC A;  4K81 A;  3MC8 A;  1WMH A;  1HZ5 A;  5C23 A;  1IBX B;  3PV1 A;  3L13 A;  2AQ3 B;  2PEA A;  1F52 A;  1KH0 A;  1F0Z A;  4E74 A;  5IAA C;  2Q5W D;  4WQM A;  1YIW A;  3RD2 A;  4MDK E;  1Y8R C;  2WDQ B;  3TJP A;  3LXF A;  2GWD A;  2KJH B;  1ESF A;  2WXL A;  2MP2 B;  2RPQ A;  3AE6 B;  3V6E B;  1K51 A;  4I6P A;  1WXV A;  2KWC A;  1F9J A;  2DZM A;  3Q8C A;  4DHZ E;  1XEE A;  1EM7 A;  2ZW1 A;  2ZCC A;  3SR6 A;  2PIA A;  2KC1 A;  2X38 A;  4YWG G;  3N3K B;  4HDO A;  2LUE A;  3Q3F A;  4LTU A;  5AUK A;  4ZRP A;  1TT4 A;  2JYT A;  4FJY A;  5T8I A;  4G50 A;  2KMA A;  1QOB A;  2LFI A;  2BS3 B;  1SF0 A;  4GDK A;  3RNC C;  2E6X A;  2L0T A;  3RI7 C;  1K52 A;  3HUI A;  2VH2 A;  4KDI C;  2KZR A;  2DBY A;  3DWM A;  1E8Y A;  2MRP A;  1P50 A;  4OHJ A;  4DXG A;  2L8J A;  4J6I A;  1NYR A;  2DWQ A;  1YN3 A;  2WDT B;  4PT5 A;  1TJE A;  3VRA B;  1PFD A;  4MSM B;  1XLP A;  4BFR A;  5CHV C;  1TGZ B;  2D3B A;  1WGY A;  2DLB A;  2KLG A;  4NZL B;  4WQO B;  1IGD A;  1P3Q U;  3A4R A;  1I35 A;  4XE0 A;  4RF1 A;  4NY0 A;  3PO0 A;  4NQK E;  3HIZ A;  2JX5 A;  4IUM B;  5TSS A;  1TTN A;  2DZI A;  1YN5 A;  3U30 A;  4W9D A;  2L00 B;  4KDL B;  1D5X C;  4BBN C;  2IPK D;  3RPF C;  2W82 A;  2KK8 A;  1C1Y B;  4ZYS A;  1S3S G;  4KSK C;  4N58 A;  2L0F A;  3ZKJ C;  2GLS A;  2ZEQ A;  2FUH B;  2GOW A;  1NDD A;  1WMH B;  1M4V A;  2N1V A;  3NVZ A;  3P4Q B;  4FJV B;  3AEG B;  3X0W A;  1XD3 B;  4MT5 A;  4YTM B;  1V81 A;  2GMI C;  3AE2 B;  1P9D U;  3UIO B;  2CHX A;  3KUC B;  4RGT A;  1OQR A;  4GSW A;  2CJO A;  2L76 A;  3UQB A;  4ZRJ A;  3IG5 A;  4GIV A;  3L4P A;  2ASQ A;  4ZYN A;  2DYM A;  1EF1 A;  3AEE B;  4FHJ A;  3Q8B A;  1WJN A;  2J0K A;  2IO2 B;  4EZJ A;  3KW5 B;  2JT4 B;  3TMP B;  5D7G A;  2L1A A;  2CHZ A;  3ZNH B;  1SSN A;  5J17 A;  3R8B A;  3PZ8 A;  2BVC A;  2XNA C;  1E8W A;  2JWZ A;  2V3N A;  4DHZ B;  3UQA A;  3A33 B;  4M0W B;  1HE8 A;  5J99 A;  3AEB B;  4XC2 A;  2G4D B;  4FBJ B;  2CJN A;  2DYB A;  3VHT C;  3M62 B;  3APF A;  3BYT B;  2O2V A;  4XZ4 A;  5IA7 A;  1VDV A;  2NBU A;  5G5H A;  1WJU A;  4NJC A;  1B1Z A;  4AUQ C;  1WX7 A;  2IY0 B;  4G3X B;  2VZK D;  1F1H A;  2G45 B;  3LVV A;  2N7J A;  2KMM A;  5JZE B;  4GDL B;  3WAM A;  3AE8 B;  1C77 A;  2MSE D;  4ZRI A;  3DBL B;  5D2M B;  2M19 A;  1FO4 A;  2LAS A;  5BMH A;  3AU5 A;  4EEW A;  1ZPS A;  4I6L B;  4WAA A;  2PE6 B;  4ANV A;  1R7S A;  2N7D A;  1AWD A;  1RFK A;  1XF5 L;  4HKZ E;  1AW7 A;  1TZ1 A;  3RZW C;  1QF6 A;  1MPE A;  1J7C A;  3PLV A;  2PTL A;  5AZH A;  3Q2A C;  4GXB A;  1BML C;  1JRU A;  1I4Q A;  2LVO A;  3IAM 1;  5C2T B;  3QA8 A;  2REX A;  3JSV B;  1CZP A;  2KWD A;  2M1M A;  2K8H A;  1WRD B;  4REZ A;  2Y5C A;  2G4S A;  4IG7 B;  3H6N A;  2JPH A;  3SFD B;  2WDR B;  3HRD D;  2JXT A;  1SJH D;  3NOB A;  4ITK A;  4JQW C;  2QC8 A;  3AH7 A;  4OZA A;  3DBH I;  2DAJ A;  4RCO A;  2KWV B;  3L08 A;  1SGH A;  2KTF A;  3MHS D;  2ZCB A;  2JF5 A;  4AJW A;  1E9M A;  1P0R A;  3NZ3 A;  2WDV B;  2M17 A;  4YSX B;  2CR5 A;  4TUU A;  2NPT A;  3W9C B;  1T0R C;  4HRS A;  5CTR C;  2V0G A;  2RDG A;  3V60 A;  3NVY A;  4WWP A;  2GB1 A;  1CQV A;  5D6J B;  3AE9 B;  1R4M I;  1P1A A;  1QQR A;  5IO9 A;  2WLB A;  4MSQ B;  1JQ4 A;  1WR1 A;  1QH4 A;  3R2I A;  1FRD A;  4ICV A;  4LK0 M;  1ZDV A;  4N59 A;  3ZW3 A;  1WX9 A;  2N4F A;  2MQJ A;  4B9K A;  5BMI A;  1NYQ A;  1PDX A;  1R4N I;  1V9J A;  3ENE A;  3DCG A;  1FPY A;  3H9D A;  1UZX B;  2SAK A;  2CHW A;  3C8Y A;  1PYW D;  3N32 A;  2YVC A;  1FIQ A;  2RDB C;  3HM3 A;  3BZD B;  2C7N B;  3LVW A;  3E56 A;  1JAL A;  2IND C;  1T5X D;  5HI1 A;  4FAD A;  4IC7 B;  4NAW A;  3B9J A;  4OVV A;  1L2N A;  1JWB D;  3LB8 C;  4IKG A;  2UU7 A;  2G1E A;  1V5T A;  1SJE D;  1AN8 A;  2RPV A;  1RLF A;  3E9S A;  4A20 A;  1IPG A;  2BYV E;  1XXG A;  1T0Y A;  3VR8 B;  3P4P B;  1GB4 A;  3OWE B;  3KLS X;  1WYG A;  3CIR B;  2Y5P A;  4AJY B;  5EE0 A;  1FD6 A;  1EF5 A;  4ASW C;  1YJI A;  4RGO S;  1L0X B;  3R66 C;  4HXD A;  3TUO A;  1D4B A;  5EE9 A;  4LDT D;  4OVZ A;  4AM1 A;  1V86 A;  3GOE A;  3QC8 B;  2I2Y A;  2LVQ A;  2DEN B;  2LGI A;  3AI5 A;  2BGF A;  1UWM A;  2L83 A;  4ARI A;  3V61 A;  2MHJ A;  2D2Q A;  2J7Q B;  2AX5 A;  5FKA C;  1V97 A;  4JIO U;  3ZJV A;  1D3Z A;  4TQ1 A;  3FKY A;  4EOY A;  2J0M A;  3DVN U;  2MX2 A;  3LDZ E;  1V80 A;  1WH3 A;  2HTM E;  4EKU A;  3PTF C;  4AWJ A;  1RL9 A;  1QKZ A;  1SE2 A;  5BO4 B;  3N20 C;  3VR9 B;  1STE A;  3Q3M C;  1LM8 B;  3WA0 A;  1WE6 A;  2Y3A A;  2BYF A;  2L05 A;  3JW0 X;  1QOF A;  2M4N A;  5BYR A;  2AL3 A;  2N9X A;  1J7B A;  3JU6 A;  1IGC A;  2LGS A;  2MW5 A;  3DBL I;  1TS2 A;  1J8C A;  1E90 A;  1WYW B;  1I7H A;  1D5M C;  3PZ7 A;  1UUP A;  5C3J B;  3VVW B;  4XWT A;  3QK0 A;  1JML A;  3Q3J A;  3M95 A;  3ZTD A;  4NQL B;  1GUA B;  2WXI A;  1HQR D;  1WM2 A;  2V4I B;  4I6N B;  1FCL A;  2W55 A;  4WJO A;  2KDE B;  3ZUN A;  1K8R B;  1WGG A;  4HCP B;  2JY6 A;  4C7Y A;  1TBE A;  1UBQ A;  2ACZ B;  4URK A;  2CS4 A;  3MTN B;  4IM2 A;  5HG2 A;  4GVZ A;  1MG4 A;  1DOX A;  2LZ6 A;  1XLQ A;  1VRA B;  3K9P B;  1V6E A;  1L6U A;  4KKJ A;  3ZNZ B;  4A55 A;  1NI2 A;  2IO3 B;  2I1J A;  3ZDM C;  2BYT A;  1I4X A;  2R2Q A;  2IO0 B;  1C3T A;  3M63 B;  4KKI A;  3UGB B;  3NRZ A;  4W9F A;  2ZVO A;  2GRI A;  1KTK A;  2O6V A;  4KSL C;  2QIL A;  5KHO A;  1H8C A;  2TSS A;  3DHI C;  3PS6 A;  1ZP0 B;  4LNN A;  3NS1 A;  3MJW A;  2O2V B;  4RH6 A;  3TBL D;  1Q1O A;  1OTR B;  4K7U A;  1FNW A;  1L4Z B;  1WR6 E;  4IM3 A;  4M0W A;  1WXQ A;  1JWM D;  4II2 B;  1A70 A;  4WJP A;  4US9 A;  1ZOY B;  3RUL A;  3ZTC A;  3ALB A;  3OLM D;  1HTQ A;  2ZJD A;  3AB5 A;  2NBV B;  1IP9 A;  3CF6 E;  1WI0 A;  1GAQ B;  2GBJ A;  1RWS A;  3AUL A;  1OEY A;  2V1Y A;  1N63 A;  1V49 A;  3HVZ A;  5LLI A;  1QOG A;  4IOI E;  4RMA A;  2YLM A;  2GBK A;  4L2Y A;  3T3N A;  2ONQ A;  3KUZ A;  1U4A A;  2LGD A;  3BVM A;  3ML9 A;  4W9L A;  1YNT E;  2C9W B;  4BKT A;  2BQQ A;  4K3C A;  2PVG C;  4WJQ A;  1PGB A;  2FID A;  2JRH A;  4HPP A;  2KTR B;  3AED B;  1ZXH A;  2AEH A;  1XO3 A;  5AZF A;  3Q69 A;  5H8Y E;  5DPR A;  5E6O A;  2JXX A;  4W9K A;  4KX6 B;  1K50 A;  4RM8 A;  1E8Z A;  1VJK A;  1VZ8 A;  4GW2 A;  2WXM A;  1M94 A;  3IVF A;  3OG5 A;  1I0E A;  4F7Z A;  1MHX A;  2EKI A;  2WXQ A;  4GMV A;  1E7P B;  3EA6 A;  4F1S A;  2KVR A;  3HHM A;  2I38 A;  4FHK A;  4IDI A;  2KAN A;  5CHF A;  1WM3 A;  5EE1 A;  4BKG A;  1V1P A;  2K25 A;  4NNJ B;  3T3O A;  5BMG A;  1FMA D;  1UGJ A;  4ARC A;  3EEC A;  2KNB A;  3MHZ A;  3PGE A;  4YTN B;  4RF6 A;  3CWI A;  3W1S C;  4PYZ A;  1VR9 A;  1JCK B;  2FNJ B;  3L2E A;  1SD0 A;  2NTS A;  2LXC A;  5CHW A;  3WAN A;  3CSF A;  1XQQ A;  2OOB B;  3A4S C;  5HHD G;  1OQY A;  4RGN A;  1UBI A;  4B0E A;  2LXA A;  3I5J C;  1L0Y B;  4WWO A;  5DCN A;  2ZNV B;  3APD A;  1V4G A;  2QCZ A;  3L10 B;  1KFY B;  3JU5 A;  3WAL A;  3WAO A;  2KLC A;  1T6B X;  2WXG A;  2LRU A;  4K7S A;  3PRZ A;  2NTT A;  2BWE S;  2IO1 B;  3ONS A;  4GU2 A;  3ZNG C;  3U52 E;  5FR6 A;  2LWP A;  1NVI D;  2KD0 A;  2KX3 A;  4BBN F;  1NEN B;  4ANX A;  5L83 A;  1I4H A;  3BVZ A;  1HA5 A;  2FCM A;  3UF8 A;  2BPS A;  3GZN B;  4ZRQ A;  1PQS A;  3AE7 B;  4MGK E;  3RNG C;  1I4P A;  3IT6 B;  4FN2 A;  3SU8 X;  1XLN A;  2GBM A;  3R2T A;  2DZK A;  3URY A;  2RDH A;  2KYW A;  3QX1 A;  3IG8 A;  3GB1 A;  1BUI C;  1N6Z A;  2BKR B;  1UEL A;  4MM3 A;  5H92 C;  1FXA A;  1JW9 D;  3VDZ A;  4C00 A;  1L6V A;  4K1R B;  4DHJ B;  3GE3 C;  1XCQ L;  1J7A A;  3DBH B;  2PKO A;  2IBI B;  1V1O A;  1NEK B;  1T0Q C;  5JHA A;  4RM9 A;  2NBW B;  1ET6 A;  3OJ3 A;  2KO3 A;  1SIF A;  4X57 B;  3A1Q A;  3PRM B;  2KQ4 X;  3Q3O C;  2JZ3 B;  5E6P A;  2MCN B;  1Q5W B;  2V9H A;  1EU4 A;  3VTU A;  3A9J B;  2KFK B;  2FBW B;  4F8C B;  1ZXI A;  2KX0 A;  1FFV A;  2MJD A;  1GNU A;  2XBB C;  1TIF A;  1FXT B;  3PZD A;  1Q0W B;  2MJE A;  4JWS C;  5BYS A;  4BG4 A;  4MEL A;  4K7W A;  4A9A A;  1KLU D;  3SHQ A;  1N5X A;  5JXV A;  3TCA A;  5EE3 A;  2KDF B;  1EUV B;  3MP9 A;  4M01 A;  4MAC A;  3BYY B;  2MBQ A;  1PUT A;  2WXP A;  3PHW B;  4BKS D;  4YT0 B;  3U4E G;  3DBS A;  4JWU C;  3DQV A;  4WWN A;  3M3J A;  1RRB A;  1WXM A;  4HKQ A;  3DRE A;  4IWP A;  4HEA 1;  1H4R A;  2WWZ A;  4YL8 A;  1OFF A;  4ZRK A;  1QZE A;  1CRK A;  2MA9 B;  1WGH A;  2N7E A;  1E7V A;  2KVZ A;  3KWL A;  3N1Z C;  4NAW B;  3N1X C;  2BWF A;  4M02 A;  4P6V F;  4KZC A;  4GLS C;  2WNM A;  3KQ4 A;  3H7P B;  3PT2 B;  3T9L A;  3IBE A;  1GOZ A;  3K9O B;  2AYO B;  4MGZ E;  3WIM A;  3L16 A;  4OZB A;  4S0R A;  2MEK A;  1TT5 B;  2ZPN A;  3ZXV A;  3FIL B;  4IWO A;  1P7F A;  3VH3 B;  2K9X A;  3D32 A;  1TS5 A;  4BAX A;  2BTE A;  2WU5 B;  4DXF A;  4EZL A;  4TQ0 A;  4EE2 A;  3IG3 A;  4RGM A;  1E0Z A;  4PYU A;  3IFW B;  1I4G A;  1WSP A;  1RFA A;  1QIL A;  3KWV A;  3P2B A;  4YSY B;  1C4C A;  4USA A;  1JRP A;  4E71 A;  2IGD A;  2KAJ A;  4RNA A;  3P63 A;  2INN E;  3OJ4 B;  1XCT L;  2UYZ B;  2BYE A;  1U6R A;  1GPX A;  3ML8 A;  1ET9 A;  1V2Y A;  4GB9 A;  3BK1 A;  4Q2J A;  3P4S B;  4EFO A;  2MBB B;  2JUO A;  3VUX A;  3R7Q A;  1JWA D;  1KM7 A;  3GE8 C;  3I9V 1;  2PJH A;  2IGG A;  4DBG A;  2AQ1 B;  4OW0 A;  4RF8 A;  2L3Z A;  2ZPY A;  2KN5 A;  2EKE C;  2OJW A;  3WCQ A;  2RR9 A;  3B1L X;  2BKF A;  3LYY A;  1C9F A;  4B6W A;  3VAW A;  2KJR A;  5GXG B;  2A4Z A;  1WJ6 A;  1PGX A;  3RFZ B;  1ZUD 2;  3NUH B;  1I4R A;  2J4X A;  3UIP B;  2QJL A;  4P1B C;  4TMA B;  2CU1 A;  2FCS A;  1L4D B;  1M15 A;  1V5O A;  3BIN A;  2M0A A;  2LHD A;  2FCQ A;  2JU6 X;  3ZNI D;  4DQO C;  3Q6B A;  4E3C A;  2KDB A;  1R4N B;  1L5P A;  3ZXR A;  2INP E;  5LXH A;  1SB3 C;  2GI9 A;  3ZYY X;  3DDC B;  3P42 A;  1S1Q B;  3SEB A;  1VA6 A;  1N5W A;  2CRK A;  3ZDT A;  1G6J A;  2YEP B;  2NMQ A;  1FNU A;  4ACF A;  4W9E A;  2J0J A;  5G55 A;  5HFY A;  1WY8 A;  1QK1 A;  1ZGU B;  2WXR A;  1ZE3 D;  4GN1 A;  2JWU A;  2WXO A;  4LJP B;  5AZG A;  1L7Y A;  1C4A A;  5J18 A;  3PSE B;  3RMK C;  1HXY D;  3O13 A;  2QMT A;  1LO5 D;  1ISN A;  4TV3 A;  2Y5B B;  3U2S C;  2IZV B;  3KYD D;  4MEM A;  3AE4 B;  2C7M B;  5KHQ A;  2MJ3 A;  3H7P A;  1CJE A;  2XK5 B;  2L52 A;  1FFU A;  3VUY A;  2K22 A;  4C4V B;  1WGR A;  4D2K A;  3O65 B;  1PGA A;  3IAS 1;  2MBE A;  3V62 A;  1SE3 A;  2GBR A;  1XLO A;  3GZN I;  3NZS A;  2V3P A;  1B9R A;  3ZVV A;  5C1Z A;  1HZ6 A;  4AOF A;  5AEK B;  1T0S C;  2WGS A;  1IBX A;  2BW2 A;  5D94 A;  2K5P A;  4IWQ A;  1E8X A;  3AXC A;  3DBR B;  3DRB A;  2D10 A;  1N62 A;  3AU4 A;  3RN9 C;  1K53 A;  2H88 B;  1TYG B;  1ZW7 A;  3IXS A;  2IJ0 A;  5BYQ A;  2HJ8 A;  3ZRC A;  4H2A A;  2BS2 B;  3DHH C;  2XK5 A;  2VH1 A;  4XX5 A;  3MC0 B;  3AEC B;  2KFK A;  2LGX A;  3NS8 A;  1BXT A;  4JPS A;  1GG3 A;  5FK9 C;  3S2A A;  1DOY A;  1MI0 A;  4ZHO A;  3M10 A;  4BHL A;  1E10 A;  2LMC A;  1VRP A;  4OVU A;  1YQB A;  1SXT A;  4KVG B;  3BY4 B;  3ZLZ A;  4W9I A;  4KV2 A;  4KGT A;  4DXA B;  2PMV A;  4C7Z A;  4YTP B;  2NPT B;  3PHX B;  1C78 A;  2FIF A;  2Z59 B;  3EUB 2;  1GC7 A;  2EMT A;  2HDE A;  4HRO A;  2ICI A;  3TEZ A;  3DOW A;  2C60 A;  3UI3 A;  3NY5 A;  2M56 B;  2LHE A;  3MFG A;  4B0M A;  3LN7 A;  3NHE B;  1BG0 A;  2Z0E B;  1WGD A;  2DHZ A;  1UF0 A;  1C76 A;  1YN4 A;  1ZKH A;  1DGJ A;  2JVC A;  1FEH A;  3TSS A;  4RF0 A;  4WH4 A;  4MJS A;  1WZ0 A;  2CKH B;  4GDK B;  2FE8 A;  2ON8 A;  1WFY A;  2WYQ A;  4A3O A;  1KRH A;  2MLB A;  2KHW B;  4DDG D;  3BK2 A;  4PS3 A;  1N61 A;  3W2D A;  4HVB A;  2J42 A;  2UWQ A;  4BOZ B;  2QSD A;  1WF9 A;  1WGK A;  2BS4 B;  4M8M A;  3DBR I;  1RAX A;  2K0P A;  1WXS A;  1HEZ E;  2LJ5 A;  2IYD B;  3QIJ A;  3TEX A;  1TS4 A;  1YQ3 B;  4XWW A;  2J1Q A;  2BB5 A;  3HVD A;  1EWC A;  4N6E B;  2N9E B;  4M8N A;  1QOA A;  2ZZP B;  2KXJ A;  4LJO B;  3HM6 X;  2D07 B;  2A5U A;  4A6Q A;  3OAW A;  3NJT A;  2WXH A;  3L0W B;  4HJG E;  4GOC A;  1DOI A;  1IUE A;  3V6C B;  3RNA C;  3C0R B;  4HJK A;  2N9L A;  4FXC A;  3DPD A;  3JSV A;  3EC8 A;  4S17 A;  1EO6 A;  1F2R C;  3L2E B;  4KGS A;  2RGF A;  4MGI E;  4XGA B;  3W5U B;  1OEY J;  1P98 A;  3P1M A;  1E7U A;  2JRI B;  3N9Y C;  3PPA A;  1VZ6 A;  2K39 A;  1J0G A;  2B76 B;  4MGY E;  4BKS A;  4P16 A;  2E3T A;  1RM6 C;  4FUL A;  4ZOH C;  2W3R A;  5E6J A;  1IYF A;  2W3S A;  4ANW A;  1GB1 A;  3PRE A;  1GC6 A;  1JWS D;  3NVW A;  3U8Z A;  2KKC A;  3B08 A;  4G0N B;  2K8C A;  4GDL A;  2BBC A;  1MVK A;  2FUG 1;  3FIL A;  2JZP A;  3KVF B;  2EEL A;  2LD9 A;  2DX5 B;  3A9K A;  3MC9 A;  2KTR A;  5G2N A;  3RNE C;  4MH8 A;  4XDD A;  3W5V B;  1FNV A;  2D33 A;  4OZC A;  3JVZ X;  1FRR A;  3ZO5 B;  4Q2R A;  3WAP A;  3TEY A;  2PW9 A;  2GWC A;  3KUD B;  2KWU B;  2C7H A;  2N1W A;  2KJ6 A;  3KYC D;  3MJ5 A;  4JL9 A;  4BVU C;  1YJ1 A;  1L0V B;  1Z2M A;  4FJZ A;  1WWT A;  2K3U A;  3U7Z A;  3DWG C;  2WX0 A;  4PS8 A;  1WRI A;  4HPM B;  3Q8F A;  4AP4 C;  4HDQ A;  4TSS A;  3ZRF A;  2Z8L A;  2WXF A; 
#chains in the Genus database with same CATH homology
 1M15 A;  3L2E B;  3M10 A;  4BG4 A;  2OJW A;  2D3A A;  3NG0 A;  4GW2 A;  4Q2R A;  4BHL A;  4LNK A;  3L2D A;  1CRK A;  1QH4 A;  4RF6 A;  1VRP A;  1BG0 A;  1P50 A;  2CRK A;  4GVZ A;  3JQ3 A;  1HTO A;  3FKY A;  1I0E A;  4GVY A;  3L2E A;  1F1H A;  3JU5 A;  4LNI A;  1SD0 A;  5J99 A;  4S0R A;  2WGS A;  3JPZ A;  4HPP A;  1G0W A;  4LNO A;  1FPY A;  4ACF A;  3ZXV A;  4RF7 A;  4AM1 A;  2UU7 A;  4BG4 B;  1QK1 A;  4Z9M A;  3JU6 A;  2WHI A;  4XYC A;  1F52 A;  4LNN A;  2QC8 A;  4BAX A;  3B6R A;  1P52 A;  1RL9 A;  2J1Q A;  3DRB A;  1HTQ A;  4S17 A;  4RF9 A;  3ZXR A;  1LGR A;  2LGS A;  2D3C A;  2D3B A;  2GLS A;  3DRE A;  4RF8 A;  2BVC A;  4GW0 A;  5J9A A;  4LNF A;  1U6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...