4XYHA

Wild-type full length mis16 in schizosaccharomyces japonicus
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
402
structure length
375
Chain Sequence
LSEVDLEKKIQEEYKLWKQNVPFLYDLVITEALEWPSLTVEWFPGSEDNSSIQKLLLGTQTSGNDQNYLQVASVQLPTLDIVQKIHHEGDVNKARFMPQNPDIIATLGLNGNGYIFDLNLYREQPIVQTGHQACLRHHTSEGFGLGWNFIQEGTLATGTEDTSICVWDIKGKSLSLEKSIDVAPVSVYHRHTAVVNDLQFHLQHEALLTSVSDDCTLQIHDTRLPSSSSASQCVKAHEQPVNGVAFNPFNDYLLATASADHTVALWDLRRLNQRLHTLEGHEDEVYNVQWSPHDEPILVTSSTDRRVCVWDLSKIGEEQTVEDSEDGAPELMFMHGGHTNRVSDLSWNPNNKWVLASLADDNILQIWSPSKVIWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mis16 Independently Recognizes Histone H4 and the CENP-ACnp1-Specific Chaperone Scm3sp.
pubmed doi rcsb
source organism Schizosaccharomyces japonicus (strain yfs275 / fy16936)
molecule tags Chaperone
molecule keywords Kinetochore protein Mis16
total genus 110
structure length 375
sequence length 402
ec nomenclature
pdb deposition date 2015-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF12265 CAF1C_H4-bd Histone-binding protein RBBP4 or subunit C of CAF1 complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4xyhA00
5CXCA 3BG0A 3V7DB 4A09B 4BH6A 1PI6A 3GFCA 1A0RB 4JT6C 3OKYB 4E54A 4J82A 4ZOVA 4A2MA 4A08A 2IUVA 3I8EA 3P4FA 4L3HD 3C9CA 3C5MA 3JRPA 3UR4A 4KFMB 2YNPA 3CIKB 5H17A 1SQJA 3SCYA 2AGZA 4O1QD 5IT9g 5K1CC 3AL8B 3ZWLB 4J78A 3W15A 2XL2A 4QRJA 3GREA 3JROA 2OVPB 4H5IA 3OKWA 3PSLA 5FA5B 5IGQA 3SWSD 2H9PA 4J8GA 4A11A 3JZNA 3DM0A 3I7NA 5EALA 2I3TA 3C99A 5EM2B 4O3TB 5C2WB 4J8BA 4A09A 4QT8A 4ZN4A 5EMMB 3NVQA 2P9PC 4AOWA 3JZGA 3F3FA 4O3UB 5I5IA 2AH0A 3I7PA 1VYHC 4GQ1A 2H6NA 4K3ID 1JMXB 2B5NA 3EI3A 2OJYA 3ORVD 2AGLA 4HDJA 4CZYA 5HYNB 2PM6B 4UI9R 1U4CA 4I79A 3I7OA 5IJ7E 4FAND 3I7KA 3MKSB 1JMZB 4QQEA 3KRXB 3AL8A 5EAPA 4O45A 3NVXA 3SBRA 1U2VC 2AGWA 5I5MA 3C75H 4PC0A 3DSMA 3ULEC 1TYQC 4FB1D 3EG6A 5AMSA 1GG2B 4XYHA 3RN0D 2CO0A 4D0KA 4QL1A 5CYKA 4ZOYA 5C9ZB 2IUQA 2AH1A 5EMLB 4GM8A 4J73A 3I7HA 3UKUC 2XU7A 4A0AB 1PBYB 3VGZA 5AJAA 4GZ8A 3OTTA 1OMWB 4PSWB 3UVKA 5FLXg 5K19A 3PE7A 5FXYA 1ERJA 4J77A 4L1QD 5AFU3 2J56H 2XYIA 2YNOA 4ERZA 1K32A 2QC5A 2CE9A 3SMRA 4J81A 4OZUA 1YFQA 2G99A 2HYEA 3E0CA 4FHLA 5SXMA 5HE2B 3U4YA 5I5JA 4G56B 3EI1A 4CC9A 4FAVD 1XIPA 3EMHA 3I7LA 2HESX 2EBSA 2GNQA 3IIYA 5TF2A 3UKRC 1MG2A 4GMBA 2XL3A 1NEXB 3J81g 5CYKB 4ERYA 2I0TA 5CXBA 5FKSA 1MG3A 4H5JA 3DXKC 2YB8B 4J79A 4Y5RD 4LGNA 2H6QA 2IWKA 3EI2A 4GQ2P 1S4UX 2IURA 2I3SA 2MTAH 2W18A 3MZLA 1B9XA 2H14A 2PM9A 4E5ZA 2OIZA 3SVWD 4Z8LA 3PXSD 4BUJC 4L9OA 3UVLA 5GSAA 4MK0B 4FA5D 4JSVC 4CY2A 3EI1B 1GP2B 4CY3A 4E54B 2OVQB 3F3GA 1B9YA 2QXVA 2HKRA 2H6KA 2H9MA 2B5LA 3J80g 3F3PA 3IJ0A 1R5MA 4A7JA 3PSCB 5FQDA 4IMMA 3A0FA 4GQBB 1N6DA 4JSNC 4J84A 3VH0A 4JD2C 4N14A 5CXBB 3K27A 5FKRA 4IA9A 2H9NA 3UVNA 4GM3A 2H13A 1GXRA 1QNIA 1Q47A 3JB9L 2H68A 4FWWA 3B7FA 4XYIA 3SJLD 2IWFA 4PBZA 5GXIA 3L4OD 3PXWD 4A0BA 2PBIB 3I89A 2PM9B 5HE3B 1JOFA 4E5ZB 3MXXA 3MKQA 4CI1A 1PGUA 2I0RA 3L4MD 4GGDA 4GM9A 4EWRA 3DXMC 5GXHA 2H47A 2P9IC 3RFHA 3RMZD 3RFGA 2I0SA 2CN3A 4CI8A 2P9KC 3MMYA 4JXMA 4X3EA 3RN1D 4ERQA 4A2LA 3OW8A 3MZKA 4GGCA 3PXTD 5FKTA 4A08B 1TBGA 1L0QA 2B4EA 5FKQA 5H14A 5IJ8E 3KRWB 5EMJB 4TZ4A 3AL9A 4PXWA 5H1MA 2Z2OA 5GMKn 3BG1A 1JJUB 1N6EA 3NVNA 2Q7QA 2OK4A 4BL0A 3UVOA 4X61B 3SN6B 2BBKH 4AEZA 4OWRA 4Y7RA 2CO0C 4PSXB 4R7AB 2CN2A 4D6VA 4A11B 3N0EA 5EARA 5EM2A 5C2VB 2G9AA 3CFSB 3ODTA 3PVWB 3FGBA 4FA4D 3RRMC 2HKMA 3JZHA 4LG9A 3RSEC 4PNKB 1SHYB 4ZOZA 1K8KC 3IJ1A 2H9LA 2TRCB 4LG8A 2YMUA 4ESGA 4YVDA 3RLMD 3EI3B 2PM7B 3IKOA 3IJCA 2P9LC 3AFCA 3OL2B 4X60B 1XHMA 5KDOB 1PEVA 2AGXA 3FM0A 4J0XA 2OK6A 4L3GD 5HE0B 2O9KA 4PBYA 5B4WA 2J57G 4NSXA 2P9UC 1GOTB 1OLZA 4CZVA 3SLED 5TDHB 3EU7A 4O9DA 1XKSA 3PVUB 4XEIC 2HJ4A 2Z2NA 2J55H 2Z2PA 3IIWA 2AQ5A 3EI2B 3JAMg 5HE1B 2AGYA 1FWXA 3I2NA 3I8CA 4JT5C 4X63B 4A0AA 1RI6A 2GC4A 5THAA 1MDAH 2H3XA 5JWZA 5IGOA 4CI3A 5EMKB 2OVRB 2CNXA 4K3JB 2HJBA 3N0DA 4GGAA 4U1EI 5IC7A 2HXCA 3EI4B 2YBAA 1NR0A 4JSPC 2IAAA 2P9NC 3OL2A 2CE8A 1N6FA 3FRXA 3SHFA 5CXCB 3SFZA 2UZYB 3OKYA 1P22A 3UVMA 4ZOXA 2UZXB 2P9SC 3SXTD 4JSXC 2YNNA 2B5MA 5HQGA 3CFVA 5TEEA 3OKTA 4CZXA 4FA1D 2GC7A 3SBQA 3JPXA 4CY1A 4J86A 3VA6A 3V9FA 4A0BB 5A2Qg 3HFQA 4CY5A 2BCJB 3BWSA 3DWLC 3EWEA 4J87A 1SQ9A 3AH8B 3SBPA 4U7AA 3EI4A 4J0WA 4FA9D 5TEFA 5EAMA 4ES0A 3K26A 4CI2A 2IUPA 3V5WB
chains in the Genus database with same CATH superfamily
5CXCA 3BG0A 3V7DB 4A09B 4BH6A 3QI0A 1PI6A 2HU5A 3GFCA 2EIDA 1A0RB 1A12A 4JT6C 1BPOA 3OKYB 4E54A 4J82A 4ZOVA 4A2MA 4A08A 2QR5A 2IUVA 5E6SA 3T3MA 4O02A 3ZDZA 4DNWA 3I8EA 3P4FA 4L3HD 3C9CA 3C5MA 1JTDB 3JRPA 3UR4A 4BCCA 3ZDYA 4KFMB 2YNPA 1UOOA 1UTCA 3CIKB 5H17A 2VDRA 1SQJA 3SCYA 2AGZA 4O1QD 1VE6A 3K71A 5IT9g 5K1CC 3AL8B 5E6RA 3ZWLB 4J78A 3W15A 4D9SA 2XL2A 4QRJA 3GREA 3JROA 2OVPB 4H5IA 3O4GA 3OKWA 3PSLA 5FA5B 5IGQA 3SWSD 2H9PA 4J8GA 4A11A 3JZNA 3DM0A 3DDUA 3I7NA 5EALA 3K6SA 2I3TA 3C99A 4DNUA 4G55A 4JHPC 5EM2B 4O3TB 3IVMA 5C2WB 1C9IA 4J8BA 4A09A 4QT8A 4ZN4A 5EMMB 3NVQA 2P9PC 4AOWA 3JZGA 4AMYA 3F3FA 4O3UB 5I5IA 2AH0A 3I7PA 1VYHC 4GQ1A 2H6NA 1E8NA 3FCSA 4K3ID 1JMXB 3GC3B 2B5NA 1C9LA 3EI3A 3MVDK 2OJYA 3ORVD 2AGLA 4HDJA 4CZYA 5HYNB 2PM6B 4UI9R 1U4CA 4I79A 3I7OA 3NIFA 2EIEA 5IJ7E 4FAND 3I7KA 1UOPA 3MKSB 3IUJA 1JMZB 4QQEA 3KRXB 3AL8A 5EAPA 4O45A 3NVXA 3SBRA 1U2VC 2AGWA 5I5MA 3C75H 4PC0A 4DNVA 3DSMA 3ULEC 3OF7A 1TYQC 4FB1D 3EG6A 5AMSA 3KCIA 1GG2B 3K72A 4XYHA 3RN0D 2CO0A 4D0KA 4QL1A 5CYKA 4ZOYA 5C9ZB 2IUQA 2AH1A 5EMLB 4GM8A 1O6FA 4J73A 3I7HA 3UKUC 2XU7A 4A0AB 1PBYB 3VGZA 5AJAA 2VDNA 4GZ8A 3OTTA 1OMWB 4PSWB 3UVKA 5FFOA 4BCDA 5K19A 3PE7A 4BP8A 5FXYA 1ERJA 3O4JA 4WJKA 5M5SA 4J77A 4L1QD 5AFU3 2J56H 2XYIA 2YNOA 4ERZA 1K32A 4RE5A 2QC5A 2CE9A 3SMRA 4J81A 3O4HA 4OZUA 1YFQA 2G99A 2HYEA 3E0CA 4FHLA 5SXMA 3EQ8A 5HE2B 3ZE0A 3U4YA 1T2XA 5I5JA 4G56B 3EI1A 4CC9A 4FAVD 4IRZA 1XIPA 2HU7A 3EMHA 4L1MA 3I7LA 2HESX 2EBSA 2GNQA 3IIYA 5TF2A 3UKRC 4Z7OA 1MG2A 4GMBA 5M5RA 2XL3A 1NEXB 3J81g 5CYKB 4ERYA 5M5UA 2I0TA 3V4VA 5CXBA 3ZDXA 5FKSA 1MG3A 4H5JA 1UOQA 3DXKC 2YB8B 4J79A 4Y5RD 4LGNA 2H6QA 2IWKA 3EI2A 4GQ2P 1S4UX 2IURA 2I3SA 2VC2A 2VZ3A 2MTAH 2W18A 3MZLA 1B9XA 3MUOA 2H14A 2PM9A 4E5ZA 2OIZA 3SVWD 4Z8LA 3PXSD 1QFMA 2HU8A 1QFSA 4BUJC 4L9OA 3O4IA 3UVLA 3NIGA 5GSAA 4MK0B 4FA5D 4JSVC 4CY2A 3EI1B 1GP2B 4CY3A 4E54B 2OVQB 3F3GA 1B9YA 2QXVA 1H2WA 2HKRA 2H6KA 2H9MA 2B5LA 3J80g 3F3PA 3IJ0A 1R5MA 4A7JA 3PSCB 5FQDA 4IMMA 3IUNA 3A0FA 4GQBB 5C92A 1N6DA 4JSNC 2VDOA 3IUQA 4J84A 3GD1I 4JD2C 4N14A 5CXBB 5C86A 3VH0A 3K27A 5FKRA 4IA9A 2H9NA 3UVNA 4GM3A 2H13A 1GXRA 1QNIA 2QZPA 1Q47A 3JB9L 2H68A 4FWWA 2VDLA 2VDKA 3B7FA 4XYIA 3SJLD 2WQ8A 2IWFA 4PBZA 5GXIA 3EQ7A 3L4OD 3PXWD 4A0BA 2PBIB 1E8MA 3I89A 2PM9B 5HE3B 1JOFA 4E5ZB 3MXXA 3MKQA 4AX4A 4CI1A 1PGUA 2I0RA 3L4MD 4UM9A 5M5TA 4GGDA 4GM9A 4EWRA 3DXMC 5GXHA 2H47A 2P9IC 3RFHA 4NENA 2EICA 3RMZD 4G1EA 3ZE1A 3RFGA 2I0SA 2CN3A 4CI8A 2P9KC 3MMYA 4JXMA 4X3EA 3RN1D 4ERQA 5FLXg 4A2LA 4Z7QA 3OW8A 3MZKA 4GGCA 3PXTD 5FKTA 2BKLA 4A08B 1TBGA 2VZ1A 1JV2A 1GOHA 1L0QA 2B4EA 2XE4A 5FKQA 5H14A 5IJ8E 4AN1A 3IURA 3KRWB 2JKXA 1VZ2A 2EIBA 5EMJB 4TZ4A 4O2WA 3AL9A 4PXWA 5H1MA 2Z2OA 5GMKn 2IUPA 3BG1A 3QHYB 1JJUB 1N6EA 3NVNA 2Q7QA 2OK4A 4BL0A 5E6UA 3UVOA 4X61B 4NAAA 1GOGA 3SN6B 2BBKH 4WK0A 4AEZA 4OWRA 4Y7RA 5HDBA 1VZ3A 2CO0C 4AN0A 3EQ9A 4PSXB 4R7AB 2CN2A 4D6VA 4A11B 3N0EA 4WK2A 4MMXA 5EARA 5EM2A 5C2VB 2G9AA 3CFSB 3ODTA 3PVWB 4QAMA 3FGBA 4FA4D 3RRMC 2HKMA 3JZHA 4LG9A 3RSEC 4PNKB 1SHYB 4ZOZA 1K8KC 3IJ1A 4BCBA 2H9LA 2TRCB 2VDMA 4LG8A 2YMUA 4ESGA 4YVDA 3IUMA 3RLMD 3EI3B 2XDWA 3VI4A 2PM7B 3IKOA 3IJCA 3ZE2A 2P9LC 1O6GA 4AMZA 1U8CA 3AFCA 3OL2B 4X60B 3V4PA 1XHMA 5KDOB 1PEVA 2AGXA 3FM0A 3T3PA 1GOFA 4J0XA 2OK6A 4L3GD 2VDQA 4WK4A 5HE0B 2O9KA 4PBYA 5B4WA 2J57G 4NSXA 2P9UC 1GOTB 1OLZA 3FCUA 4CZVA 3SLED 5TDHB 3EU7A 4O9DA 1XKSA 3PVUB 4XEIC 4NC4A 2HJ4A 2Z2NA 3NIDA 2J55H 2Z2PA 3IIWA 2AQ5A 4NBMA 3EI2B 4Z7NA 3JAMg 1H2YA 1TYEA 5HE1B 2AGYA 3IULA 1K3IA 1FWXA 3I2NA 3I8CA 4JT5C 1E5TA 4X63B 5M61A 4A0AA 1RI6A 2GC4A 5THAA 1H2XA 1MDAH 2H3XA 5JWZA 5IGOA 5M5VA 4CI3A 5EMKB 2OVRB 2CNXA 4K3JB 2HJBA 3N0DA 4GGAA 4U1EI 5IC7A 2HXCA 3EI4B 2YBAA 1NR0A 4JSPC 4RE6A 2IAAA 2P9NC 3OL2A 2CE8A 1N6FA 3FRXA 3SHFA 5CXCB 5FFGA 2VDPA 2XZGA 3SFZA 1M1XA 2UZYB 3OKYA 1P22A 3UVMA 4ZOXA 2UZXB 2P9SC 4BP9A 3SXTD 1YR2A 2YNNA 4JSXC 2B5MA 5HQGA 3CFVA 1I2MB 4JHNA 5TEEA 3OKTA 4MMZA 4MMYA 3VI3A 4CZXA 4FA1D 1L5GA 2GC7A 3SBQA 3JPXA 4CY1A 4G1MA 4J86A 3VA6A 3V9FA 4A0BB 5A2Qg 1H2ZA 3HFQA 4CY5A 2BCJB 3BWSA 3DWLC 3EWEA 4J87A 1SQ9A 3AH8B 3SBPA 4UM8A 4U7AA 3EI4A 4J0WA 4FA9D 5TEFA 1VE7A 5EAMA 4ES0A 3K26A 4CI2A 3MUNA 3IJEA 3V5WB
chains in the Genus database with same CATH topology
5CXCA 3BG0A 3V7DB 4A09B 4BH6A 1PI6A 3GFCA 1A0RB 4JT6C 3OKYB 4E54A 4J82A 4ZOVA 4A2MA 4A08A 2IUVA 3I8EA 3P4FA 4L3HD 3C9CA 3C5MA 3JRPA 3UR4A 4KFMB 2YNPA 3CIKB 5H17A 1SQJA 3SCYA 2AGZA 4O1QD 5IT9g 5K1CC 3AL8B 3ZWLB 4J78A 3W15A 2XL2A 4QRJA 3GREA 3JROA 2OVPB 4H5IA 3OKWA 3PSLA 5FA5B 5IGQA 3SWSD 2H9PA 4J8GA 4A11A 3JZNA 3DM0A 3I7NA 5EALA 2I3TA 3C99A 5EM2B 4O3TB 5C2WB 4J8BA 4A09A 4QT8A 4ZN4A 5EMMB 3NVQA 2P9PC 4AOWA 3JZGA 3F3FA 4O3UB 5I5IA 2AH0A 3I7PA 1VYHC 4GQ1A 2H6NA 4K3ID 1JMXB 2B5NA 3EI3A 2OJYA 3ORVD 2AGLA 4HDJA 4CZYA 5HYNB 2PM6B 4UI9R 1U4CA 4I79A 3I7OA 5IJ7E 4FAND 3I7KA 3MKSB 1JMZB 4QQEA 3KRXB 3AL8A 5EAPA 4O45A 3NVXA 3SBRA 1U2VC 2AGWA 5I5MA 3C75H 4PC0A 3DSMA 3ULEC 1TYQC 4FB1D 3EG6A 5AMSA 1GG2B 4XYHA 3RN0D 2CO0A 4D0KA 4QL1A 5CYKA 4ZOYA 5C9ZB 2IUQA 2AH1A 5EMLB 4GM8A 4J73A 3I7HA 3UKUC 2XU7A 4A0AB 1PBYB 3VGZA 5AJAA 4GZ8A 3OTTA 1OMWB 4PSWB 3UVKA 5FLXg 5K19A 3PE7A 5FXYA 1ERJA 4J77A 4L1QD 5AFU3 2J56H 2XYIA 2YNOA 4ERZA 1K32A 2QC5A 2CE9A 3SMRA 4J81A 4OZUA 1YFQA 2G99A 2HYEA 3E0CA 4FHLA 5SXMA 5HE2B 3U4YA 5I5JA 4G56B 3EI1A 4CC9A 4FAVD 1XIPA 3EMHA 3I7LA 2HESX 2EBSA 2GNQA 3IIYA 5TF2A 3UKRC 1MG2A 4GMBA 2XL3A 1NEXB 3J81g 5CYKB 4ERYA 2I0TA 5CXBA 5FKSA 1MG3A 4H5JA 3DXKC 2YB8B 4J79A 4Y5RD 4LGNA 2H6QA 2IWKA 3EI2A 4GQ2P 1S4UX 2IURA 2I3SA 2MTAH 2W18A 3MZLA 1B9XA 2H14A 2PM9A 4E5ZA 2OIZA 3SVWD 4Z8LA 3PXSD 4BUJC 4L9OA 3UVLA 5GSAA 4MK0B 4FA5D 4JSVC 4CY2A 3EI1B 1GP2B 4CY3A 4E54B 2OVQB 3F3GA 1B9YA 2QXVA 2HKRA 2H6KA 2H9MA 2B5LA 3J80g 3F3PA 3IJ0A 1R5MA 4A7JA 3PSCB 5FQDA 4IMMA 3A0FA 4GQBB 1N6DA 4JSNC 4J84A 3VH0A 4JD2C 4N14A 5CXBB 3K27A 5FKRA 4IA9A 2H9NA 3UVNA 4GM3A 2H13A 1GXRA 1QNIA 1Q47A 3JB9L 2H68A 4FWWA 3B7FA 4XYIA 3SJLD 2IWFA 4PBZA 5GXIA 3L4OD 3PXWD 4A0BA 2PBIB 3I89A 2PM9B 5HE3B 1JOFA 4E5ZB 3MXXA 3MKQA 4CI1A 1PGUA 2I0RA 3L4MD 4GGDA 4GM9A 4EWRA 3DXMC 5GXHA 2H47A 2P9IC 3RFHA 3RMZD 3RFGA 2I0SA 2CN3A 4CI8A 2P9KC 3MMYA 4JXMA 4X3EA 3RN1D 4ERQA 4A2LA 3OW8A 3MZKA 4GGCA 3PXTD 5FKTA 4A08B 1TBGA 1L0QA 2B4EA 5FKQA 5H14A 5IJ8E 3KRWB 5EMJB 4TZ4A 3AL9A 4PXWA 5H1MA 2Z2OA 5GMKn 3BG1A 1JJUB 1N6EA 3NVNA 2Q7QA 2OK4A 4BL0A 3UVOA 4X61B 3SN6B 2BBKH 4AEZA 4OWRA 4Y7RA 2CO0C 4PSXB 4R7AB 2CN2A 4D6VA 4A11B 3N0EA 5EARA 5EM2A 5C2VB 2G9AA 3CFSB 3ODTA 3PVWB 3FGBA 4FA4D 3RRMC 2HKMA 3JZHA 4LG9A 3RSEC 4PNKB 1SHYB 4ZOZA 1K8KC 3IJ1A 2H9LA 2TRCB 4LG8A 2YMUA 4ESGA 4YVDA 3RLMD 3EI3B 2PM7B 3IKOA 3IJCA 2P9LC 3AFCA 3OL2B 4X60B 1XHMA 5KDOB 1PEVA 2AGXA 3FM0A 4J0XA 2OK6A 4L3GD 5HE0B 2O9KA 4PBYA 5B4WA 2J57G 4NSXA 2P9UC 1GOTB 1OLZA 4CZVA 3SLED 5TDHB 3EU7A 4O9DA 1XKSA 3PVUB 4XEIC 2HJ4A 2Z2NA 2J55H 2Z2PA 3IIWA 2AQ5A 3EI2B 3JAMg 5HE1B 2AGYA 1FWXA 3I2NA 3I8CA 4JT5C 4X63B 4A0AA 1RI6A 2GC4A 5THAA 1MDAH 2H3XA 5JWZA 5IGOA 4CI3A 5EMKB 2OVRB 2CNXA 4K3JB 2HJBA 3N0DA 4GGAA 4U1EI 5IC7A 2HXCA 3EI4B 2YBAA 1NR0A 4JSPC 2IAAA 2P9NC 3OL2A 2CE8A 1N6FA 3FRXA 3SHFA 5CXCB 3SFZA 2UZYB 3OKYA 1P22A 3UVMA 4ZOXA 2UZXB 2P9SC 3SXTD 4JSXC 2YNNA 2B5MA 5HQGA 3CFVA 5TEEA 3OKTA 4CZXA 4FA1D 2GC7A 3SBQA 3JPXA 4CY1A 4J86A 3VA6A 3V9FA 4A0BB 5A2Qg 3HFQA 4CY5A 2BCJB 3BWSA 3DWLC 3EWEA 4J87A 1SQ9A 3AH8B 3SBPA 4U7AA 3EI4A 4J0WA 4FA9D 5TEFA 5EAMA 4ES0A 3K26A 4CI2A 2IUPA 3V5WB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CXC A;  3BG0 A;  3V7D B;  4A09 B;  4BH6 A;  1PI6 A;  3GFC A;  1A0R B;  4JT6 C;  3OKY B;  4E54 A;  4J82 A;  4ZOV A;  4A2M A;  4A08 A;  2IUV A;  3I8E A;  3P4F A;  4L3H D;  3C9C A;  3C5M A;  3JRP A;  3UR4 A;  4KFM B;  2YNP A;  3CIK B;  5H17 A;  1SQJ A;  3SCY A;  2AGZ A;  4O1Q D;  5IT9 g;  5K1C C;  3AL8 B;  3ZWL B;  4J78 A;  3W15 A;  2XL2 A;  4QRJ A;  3GRE A;  3JRO A;  2OVP B;  4H5I A;  3OKW A;  3PSL A;  5FA5 B;  5IGQ A;  3SWS D;  2H9P A;  4J8G A;  4A11 A;  3JZN A;  3DM0 A;  3I7N A;  5EAL A;  2I3T A;  3C99 A;  5EM2 B;  4O3T B;  5C2W B;  4J8B A;  4A09 A;  4QT8 A;  4ZN4 A;  5EMM B;  3NVQ A;  2P9P C;  4AOW A;  3JZG A;  3F3F A;  4O3U B;  5I5I A;  2AH0 A;  3I7P A;  1VYH C;  4GQ1 A;  2H6N A;  4K3I D;  1JMX B;  2B5N A;  3EI3 A;  2OJY A;  3ORV D;  2AGL A;  4HDJ A;  4CZY A;  5HYN B;  2PM6 B;  4UI9 R;  1U4C A;  4I79 A;  3I7O A;  5IJ7 E;  4FAN D;  3I7K A;  3MKS B;  1JMZ B;  4QQE A;  3KRX B;  3AL8 A;  5EAP A;  4O45 A;  3NVX A;  3SBR A;  1U2V C;  2AGW A;  5I5M A;  3C75 H;  4PC0 A;  3DSM A;  3ULE C;  1TYQ C;  4FB1 D;  3EG6 A;  5AMS A;  1GG2 B;  4XYH A;  3RN0 D;  2CO0 A;  4D0K A;  4QL1 A;  5CYK A;  4ZOY A;  5C9Z B;  2IUQ A;  2AH1 A;  5EML B;  4GM8 A;  4J73 A;  3I7H A;  3UKU C;  2XU7 A;  4A0A B;  1PBY B;  3VGZ A;  5AJA A;  4GZ8 A;  3OTT A;  1OMW B;  4PSW B;  3UVK A;  5FLX g;  5K19 A;  3PE7 A;  5FXY A;  1ERJ A;  4J77 A;  4L1Q D;  5AFU 3;  2J56 H;  2XYI A;  2YNO A;  4ERZ A;  1K32 A;  2QC5 A;  2CE9 A;  3SMR A;  4J81 A;  4OZU A;  1YFQ A;  2G99 A;  2HYE A;  3E0C A;  4FHL A;  5SXM A;  5HE2 B;  3U4Y A;  5I5J A;  4G56 B;  3EI1 A;  4CC9 A;  4FAV D;  1XIP A;  3EMH A;  3I7L A;  2HES X;  2EBS A;  2GNQ A;  3IIY A;  5TF2 A;  3UKR C;  1MG2 A;  4GMB A;  2XL3 A;  1NEX B;  3J81 g;  5CYK B;  4ERY A;  2I0T A;  5CXB A;  5FKS A;  1MG3 A;  4H5J A;  3DXK C;  2YB8 B;  4J79 A;  4Y5R D;  4LGN A;  2H6Q A;  2IWK A;  3EI2 A;  4GQ2 P;  1S4U X;  2IUR A;  2I3S A;  2MTA H;  2W18 A;  3MZL A;  1B9X A;  2H14 A;  2PM9 A;  4E5Z A;  2OIZ A;  3SVW D;  4Z8L A;  3PXS D;  4BUJ C;  4L9O A;  3UVL A;  5GSA A;  4MK0 B;  4FA5 D;  4JSV C;  4CY2 A;  3EI1 B;  1GP2 B;  4CY3 A;  4E54 B;  2OVQ B;  3F3G A;  1B9Y A;  2QXV A;  2HKR A;  2H6K A;  2H9M A;  2B5L A;  3J80 g;  3F3P A;  3IJ0 A;  1R5M A;  4A7J A;  3PSC B;  5FQD A;  4IMM A;  3A0F A;  4GQB B;  1N6D A;  4JSN C;  4J84 A;  3VH0 A;  4JD2 C;  4N14 A;  5CXB B;  3K27 A;  5FKR A;  4IA9 A;  2H9N A;  3UVN A;  4GM3 A;  2H13 A;  1GXR A;  1QNI A;  1Q47 A;  3JB9 L;  2H68 A;  4FWW A;  3B7F A;  4XYI A;  3SJL D;  2IWF A;  4PBZ A;  5GXI A;  3L4O D;  3PXW D;  4A0B A;  2PBI B;  3I89 A;  2PM9 B;  5HE3 B;  1JOF A;  4E5Z B;  3MXX A;  3MKQ A;  4CI1 A;  1PGU A;  2I0R A;  3L4M D;  4GGD A;  4GM9 A;  4EWR A;  3DXM C;  5GXH A;  2H47 A;  2P9I C;  3RFH A;  3RMZ D;  3RFG A;  2I0S A;  2CN3 A;  4CI8 A;  2P9K C;  3MMY A;  4JXM A;  4X3E A;  3RN1 D;  4ERQ A;  4A2L A;  3OW8 A;  3MZK A;  4GGC A;  3PXT D;  5FKT A;  4A08 B;  1TBG A;  1L0Q A;  2B4E A;  5FKQ A;  5H14 A;  5IJ8 E;  3KRW B;  5EMJ B;  4TZ4 A;  3AL9 A;  4PXW A;  5H1M A;  2Z2O A;  5GMK n;  3BG1 A;  1JJU B;  1N6E A;  3NVN A;  2Q7Q A;  2OK4 A;  4BL0 A;  3UVO A;  4X61 B;  3SN6 B;  2BBK H;  4AEZ A;  4OWR A;  4Y7R A;  2CO0 C;  4PSX B;  4R7A B;  2CN2 A;  4D6V A;  4A11 B;  3N0E A;  5EAR A;  5EM2 A;  5C2V B;  2G9A A;  3CFS B;  3ODT A;  3PVW B;  3FGB A;  4FA4 D;  3RRM C;  2HKM A;  3JZH A;  4LG9 A;  3RSE C;  4PNK B;  1SHY B;  4ZOZ A;  1K8K C;  3IJ1 A;  2H9L A;  2TRC B;  4LG8 A;  2YMU A;  4ESG A;  4YVD A;  3RLM D;  3EI3 B;  2PM7 B;  3IKO A;  3IJC A;  2P9L C;  3AFC A;  3OL2 B;  4X60 B;  1XHM A;  5KDO B;  1PEV A;  2AGX A;  3FM0 A;  4J0X A;  2OK6 A;  4L3G D;  5HE0 B;  2O9K A;  4PBY A;  5B4W A;  2J57 G;  4NSX A;  2P9U C;  1GOT B;  1OLZ A;  4CZV A;  3SLE D;  5TDH B;  3EU7 A;  4O9D A;  1XKS A;  3PVU B;  4XEI C;  2HJ4 A;  2Z2N A;  2J55 H;  2Z2P A;  3IIW A;  2AQ5 A;  3EI2 B;  3JAM g;  5HE1 B;  2AGY A;  1FWX A;  3I2N A;  3I8C A;  4JT5 C;  4X63 B;  4A0A A;  1RI6 A;  2GC4 A;  5THA A;  1MDA H;  2H3X A;  5JWZ A;  5IGO A;  4CI3 A;  5EMK B;  2OVR B;  2CNX A;  4K3J B;  2HJB A;  3N0D A;  4GGA A;  4U1E I;  5IC7 A;  2HXC A;  3EI4 B;  2YBA A;  1NR0 A;  4JSP C;  2IAA A;  2P9N C;  3OL2 A;  2CE8 A;  1N6F A;  3FRX A;  3SHF A;  5CXC B;  3SFZ A;  2UZY B;  3OKY A;  1P22 A;  3UVM A;  4ZOX A;  2UZX B;  2P9S C;  3SXT D;  4JSX C;  2YNN A;  2B5M A;  5HQG A;  3CFV A;  5TEE A;  3OKT A;  4CZX A;  4FA1 D;  2GC7 A;  3SBQ A;  3JPX A;  4CY1 A;  4J86 A;  3VA6 A;  3V9F A;  4A0B B;  5A2Q g;  3HFQ A;  4CY5 A;  2BCJ B;  3BWS A;  3DWL C;  3EWE A;  4J87 A;  1SQ9 A;  3AH8 B;  3SBP A;  4U7A A;  3EI4 A;  4J0W A;  4FA9 D;  5TEF A;  5EAM A;  4ES0 A;  3K26 A;  4CI2 A;  2IUP A;  3V5W B; 
#chains in the Genus database with same CATH topology
 5CXC A;  3BG0 A;  3V7D B;  4A09 B;  4BH6 A;  3QI0 A;  1PI6 A;  2HU5 A;  3GFC A;  2EID A;  1A0R B;  1A12 A;  4JT6 C;  1BPO A;  3OKY B;  4E54 A;  4J82 A;  4ZOV A;  4A2M A;  4A08 A;  2QR5 A;  2IUV A;  5E6S A;  3T3M A;  4O02 A;  3ZDZ A;  4DNW A;  3I8E A;  3P4F A;  4L3H D;  3C9C A;  3C5M A;  1JTD B;  3JRP A;  3UR4 A;  4BCC A;  3ZDY A;  4KFM B;  2YNP A;  1UOO A;  1UTC A;  3CIK B;  5H17 A;  2VDR A;  1SQJ A;  3SCY A;  2AGZ A;  4O1Q D;  1VE6 A;  3K71 A;  5IT9 g;  5K1C C;  3AL8 B;  5E6R A;  3ZWL B;  4J78 A;  3W15 A;  4D9S A;  2XL2 A;  4QRJ A;  3GRE A;  3JRO A;  2OVP B;  4H5I A;  3O4G A;  3OKW A;  3PSL A;  5FA5 B;  5IGQ A;  3SWS D;  2H9P A;  4J8G A;  4A11 A;  3JZN A;  3DM0 A;  3DDU A;  3I7N A;  5EAL A;  3K6S A;  2I3T A;  3C99 A;  4DNU A;  4G55 A;  4JHP C;  5EM2 B;  4O3T B;  3IVM A;  5C2W B;  1C9I A;  4J8B A;  4A09 A;  4QT8 A;  4ZN4 A;  5EMM B;  3NVQ A;  2P9P C;  4AOW A;  3JZG A;  4AMY A;  3F3F A;  4O3U B;  5I5I A;  2AH0 A;  3I7P A;  1VYH C;  4GQ1 A;  2H6N A;  1E8N A;  3FCS A;  4K3I D;  1JMX B;  3GC3 B;  2B5N A;  1C9L A;  3EI3 A;  3MVD K;  2OJY A;  3ORV D;  2AGL A;  4HDJ A;  4CZY A;  5HYN B;  2PM6 B;  4UI9 R;  1U4C A;  4I79 A;  3I7O A;  3NIF A;  2EIE A;  5IJ7 E;  4FAN D;  3I7K A;  1UOP A;  3MKS B;  3IUJ A;  1JMZ B;  4QQE A;  3KRX B;  3AL8 A;  5EAP A;  4O45 A;  3NVX A;  3SBR A;  1U2V C;  2AGW A;  5I5M A;  3C75 H;  4PC0 A;  4DNV A;  3DSM A;  3ULE C;  3OF7 A;  1TYQ C;  4FB1 D;  3EG6 A;  5AMS A;  3KCI A;  1GG2 B;  3K72 A;  4XYH A;  3RN0 D;  2CO0 A;  4D0K A;  4QL1 A;  5CYK A;  4ZOY A;  5C9Z B;  2IUQ A;  2AH1 A;  5EML B;  4GM8 A;  1O6F A;  4J73 A;  3I7H A;  3UKU C;  2XU7 A;  4A0A B;  1PBY B;  3VGZ A;  5AJA A;  2VDN A;  4GZ8 A;  3OTT A;  1OMW B;  4PSW B;  3UVK A;  5FFO A;  4BCD A;  5K19 A;  3PE7 A;  4BP8 A;  5FXY A;  1ERJ A;  3O4J A;  4WJK A;  5M5S A;  4J77 A;  4L1Q D;  5AFU 3;  2J56 H;  2XYI A;  2YNO A;  4ERZ A;  1K32 A;  4RE5 A;  2QC5 A;  2CE9 A;  3SMR A;  4J81 A;  3O4H A;  4OZU A;  1YFQ A;  2G99 A;  2HYE A;  3E0C A;  4FHL A;  5SXM A;  3EQ8 A;  5HE2 B;  3ZE0 A;  3U4Y A;  1T2X A;  5I5J A;  4G56 B;  3EI1 A;  4CC9 A;  4FAV D;  4IRZ A;  1XIP A;  2HU7 A;  3EMH A;  4L1M A;  3I7L A;  2HES X;  2EBS A;  2GNQ A;  3IIY A;  5TF2 A;  3UKR C;  4Z7O A;  1MG2 A;  4GMB A;  5M5R A;  2XL3 A;  1NEX B;  3J81 g;  5CYK B;  4ERY A;  5M5U A;  2I0T A;  3V4V A;  5CXB A;  3ZDX A;  5FKS A;  1MG3 A;  4H5J A;  1UOQ A;  3DXK C;  2YB8 B;  4J79 A;  4Y5R D;  4LGN A;  2H6Q A;  2IWK A;  3EI2 A;  4GQ2 P;  1S4U X;  2IUR A;  2I3S A;  2VC2 A;  2VZ3 A;  2MTA H;  2W18 A;  3MZL A;  1B9X A;  3MUO A;  2H14 A;  2PM9 A;  4E5Z A;  2OIZ A;  3SVW D;  4Z8L A;  3PXS D;  1QFM A;  2HU8 A;  1QFS A;  4BUJ C;  4L9O A;  3O4I A;  3UVL A;  3NIG A;  5GSA A;  4MK0 B;  4FA5 D;  4JSV C;  4CY2 A;  3EI1 B;  1GP2 B;  4CY3 A;  4E54 B;  2OVQ B;  3F3G A;  1B9Y A;  2QXV A;  1H2W A;  2HKR A;  2H6K A;  2H9M A;  2B5L A;  3J80 g;  3F3P A;  3IJ0 A;  1R5M A;  4A7J A;  3PSC B;  5FQD A;  4IMM A;  3IUN A;  3A0F A;  4GQB B;  5C92 A;  1N6D A;  4JSN C;  2VDO A;  3IUQ A;  4J84 A;  3GD1 I;  4JD2 C;  4N14 A;  5CXB B;  5C86 A;  3VH0 A;  3K27 A;  5FKR A;  4IA9 A;  2H9N A;  3UVN A;  4GM3 A;  2H13 A;  1GXR A;  1QNI A;  2QZP A;  1Q47 A;  3JB9 L;  2H68 A;  4FWW A;  2VDL A;  2VDK A;  3B7F A;  4XYI A;  3SJL D;  2WQ8 A;  2IWF A;  4PBZ A;  5GXI A;  3EQ7 A;  3L4O D;  3PXW D;  4A0B A;  2PBI B;  1E8M A;  3I89 A;  2PM9 B;  5HE3 B;  1JOF A;  4E5Z B;  3MXX A;  3MKQ A;  4AX4 A;  4CI1 A;  1PGU A;  2I0R A;  3L4M D;  4UM9 A;  5M5T A;  4GGD A;  4GM9 A;  4EWR A;  3DXM C;  5GXH A;  2H47 A;  2P9I C;  3RFH A;  4NEN A;  2EIC A;  3RMZ D;  4G1E A;  3ZE1 A;  3RFG A;  2I0S A;  2CN3 A;  4CI8 A;  2P9K C;  3MMY A;  4JXM A;  4X3E A;  3RN1 D;  4ERQ A;  5FLX g;  4A2L A;  4Z7Q A;  3OW8 A;  3MZK A;  4GGC A;  3PXT D;  5FKT A;  2BKL A;  4A08 B;  1TBG A;  2VZ1 A;  1JV2 A;  1GOH A;  1L0Q A;  2B4E A;  2XE4 A;  5FKQ A;  5H14 A;  5IJ8 E;  4AN1 A;  3IUR A;  3KRW B;  2JKX A;  1VZ2 A;  2EIB A;  5EMJ B;  4TZ4 A;  4O2W A;  3AL9 A;  4PXW A;  5H1M A;  2Z2O A;  5GMK n;  2IUP A;  3BG1 A;  3QHY B;  1JJU B;  1N6E A;  3NVN A;  2Q7Q A;  2OK4 A;  4BL0 A;  5E6U A;  3UVO A;  4X61 B;  4NAA A;  1GOG A;  3SN6 B;  2BBK H;  4WK0 A;  4AEZ A;  4OWR A;  4Y7R A;  5HDB A;  1VZ3 A;  2CO0 C;  4AN0 A;  3EQ9 A;  4PSX B;  4R7A B;  2CN2 A;  4D6V A;  4A11 B;  3N0E A;  4WK2 A;  4MMX A;  5EAR A;  5EM2 A;  5C2V B;  2G9A A;  3CFS B;  3ODT A;  3PVW B;  4QAM A;  3FGB A;  4FA4 D;  3RRM C;  2HKM A;  3JZH A;  4LG9 A;  3RSE C;  4PNK B;  1SHY B;  4ZOZ A;  1K8K C;  3IJ1 A;  4BCB A;  2H9L A;  2TRC B;  2VDM A;  4LG8 A;  2YMU A;  4ESG A;  4YVD A;  3IUM A;  3RLM D;  3EI3 B;  2XDW A;  3VI4 A;  2PM7 B;  3IKO A;  3IJC A;  3ZE2 A;  2P9L C;  1O6G A;  4AMZ A;  1U8C A;  3AFC A;  3OL2 B;  4X60 B;  3V4P A;  1XHM A;  5KDO B;  1PEV A;  2AGX A;  3FM0 A;  3T3P A;  1GOF A;  4J0X A;  2OK6 A;  4L3G D;  2VDQ A;  4WK4 A;  5HE0 B;  2O9K A;  4PBY A;  5B4W A;  2J57 G;  4NSX A;  2P9U C;  1GOT B;  1OLZ A;  3FCU A;  4CZV A;  3SLE D;  5TDH B;  3EU7 A;  4O9D A;  1XKS A;  3PVU B;  4XEI C;  4NC4 A;  2HJ4 A;  2Z2N A;  3NID A;  2J55 H;  2Z2P A;  3IIW A;  2AQ5 A;  4NBM A;  3EI2 B;  4Z7N A;  3JAM g;  1H2Y A;  1TYE A;  5HE1 B;  2AGY A;  3IUL A;  1K3I A;  1FWX A;  3I2N A;  3I8C A;  4JT5 C;  1E5T A;  4X63 B;  5M61 A;  4A0A A;  1RI6 A;  2GC4 A;  5THA A;  1H2X A;  1MDA H;  2H3X A;  5JWZ A;  5IGO A;  5M5V A;  4CI3 A;  5EMK B;  2OVR B;  2CNX A;  4K3J B;  2HJB A;  3N0D A;  4GGA A;  4U1E I;  5IC7 A;  2HXC A;  3EI4 B;  2YBA A;  1NR0 A;  4JSP C;  4RE6 A;  2IAA A;  2P9N C;  3OL2 A;  2CE8 A;  1N6F A;  3FRX A;  3SHF A;  5CXC B;  5FFG A;  2VDP A;  2XZG A;  3SFZ A;  1M1X A;  2UZY B;  3OKY A;  1P22 A;  3UVM A;  4ZOX A;  2UZX B;  2P9S C;  4BP9 A;  3SXT D;  1YR2 A;  2YNN A;  4JSX C;  2B5M A;  5HQG A;  3CFV A;  1I2M B;  4JHN A;  5TEE A;  3OKT A;  4MMZ A;  4MMY A;  3VI3 A;  4CZX A;  4FA1 D;  1L5G A;  2GC7 A;  3SBQ A;  3JPX A;  4CY1 A;  4G1M A;  4J86 A;  3VA6 A;  3V9F A;  4A0B B;  5A2Q g;  1H2Z A;  3HFQ A;  4CY5 A;  2BCJ B;  3BWS A;  3DWL C;  3EWE A;  4J87 A;  1SQ9 A;  3AH8 B;  3SBP A;  4UM8 A;  4U7A A;  3EI4 A;  4J0W A;  4FA9 D;  5TEF A;  1VE7 A;  5EAM A;  4ES0 A;  3K26 A;  4CI2 A;  3MUN A;  3IJE A;  3V5W B; 
#chains in the Genus database with same CATH homology
 5CXC A;  3BG0 A;  3V7D B;  4A09 B;  4BH6 A;  1PI6 A;  3GFC A;  1A0R B;  4JT6 C;  3OKY B;  4E54 A;  4J82 A;  4ZOV A;  4A2M A;  4A08 A;  2IUV A;  3I8E A;  3P4F A;  4L3H D;  3C9C A;  3C5M A;  3JRP A;  3UR4 A;  4KFM B;  2YNP A;  3CIK B;  5H17 A;  1SQJ A;  3SCY A;  2AGZ A;  4O1Q D;  5IT9 g;  5K1C C;  3AL8 B;  3ZWL B;  4J78 A;  3W15 A;  2XL2 A;  4QRJ A;  3GRE A;  3JRO A;  2OVP B;  4H5I A;  3OKW A;  3PSL A;  5FA5 B;  5IGQ A;  3SWS D;  2H9P A;  4J8G A;  4A11 A;  3JZN A;  3DM0 A;  3I7N A;  5EAL A;  2I3T A;  3C99 A;  5EM2 B;  4O3T B;  5C2W B;  4J8B A;  4A09 A;  4QT8 A;  4ZN4 A;  5EMM B;  3NVQ A;  2P9P C;  4AOW A;  3JZG A;  3F3F A;  4O3U B;  5I5I A;  2AH0 A;  3I7P A;  1VYH C;  4GQ1 A;  2H6N A;  4K3I D;  1JMX B;  2B5N A;  3EI3 A;  2OJY A;  3ORV D;  2AGL A;  4HDJ A;  4CZY A;  5HYN B;  2PM6 B;  4UI9 R;  1U4C A;  4I79 A;  3I7O A;  5IJ7 E;  4FAN D;  3I7K A;  3MKS B;  1JMZ B;  4QQE A;  3KRX B;  3AL8 A;  5EAP A;  4O45 A;  3NVX A;  3SBR A;  1U2V C;  2AGW A;  5I5M A;  3C75 H;  4PC0 A;  3DSM A;  3ULE C;  1TYQ C;  4FB1 D;  3EG6 A;  5AMS A;  1GG2 B;  4XYH A;  3RN0 D;  2CO0 A;  4D0K A;  4QL1 A;  5CYK A;  4ZOY A;  5C9Z B;  2IUQ A;  2AH1 A;  5EML B;  4GM8 A;  4J73 A;  3I7H A;  3UKU C;  2XU7 A;  4A0A B;  1PBY B;  3VGZ A;  5AJA A;  4GZ8 A;  3OTT A;  1OMW B;  4PSW B;  3UVK A;  5FLX g;  5K19 A;  3PE7 A;  5FXY A;  1ERJ A;  4J77 A;  4L1Q D;  5AFU 3;  2J56 H;  2XYI A;  2YNO A;  4ERZ A;  1K32 A;  2QC5 A;  2CE9 A;  3SMR A;  4J81 A;  4OZU A;  1YFQ A;  2G99 A;  2HYE A;  3E0C A;  4FHL A;  5SXM A;  5HE2 B;  3U4Y A;  5I5J A;  4G56 B;  3EI1 A;  4CC9 A;  4FAV D;  1XIP A;  3EMH A;  3I7L A;  2HES X;  2EBS A;  2GNQ A;  3IIY A;  5TF2 A;  3UKR C;  1MG2 A;  4GMB A;  2XL3 A;  1NEX B;  3J81 g;  5CYK B;  4ERY A;  2I0T A;  5CXB A;  5FKS A;  1MG3 A;  4H5J A;  3DXK C;  2YB8 B;  4J79 A;  4Y5R D;  4LGN A;  2H6Q A;  2IWK A;  3EI2 A;  4GQ2 P;  1S4U X;  2IUR A;  2I3S A;  2MTA H;  2W18 A;  3MZL A;  1B9X A;  2H14 A;  2PM9 A;  4E5Z A;  2OIZ A;  3SVW D;  4Z8L A;  3PXS D;  4BUJ C;  4L9O A;  3UVL A;  5GSA A;  4MK0 B;  4FA5 D;  4JSV C;  4CY2 A;  3EI1 B;  1GP2 B;  4CY3 A;  4E54 B;  2OVQ B;  3F3G A;  1B9Y A;  2QXV A;  2HKR A;  2H6K A;  2H9M A;  2B5L A;  3J80 g;  3F3P A;  3IJ0 A;  1R5M A;  4A7J A;  3PSC B;  5FQD A;  4IMM A;  3A0F A;  4GQB B;  1N6D A;  4JSN C;  4J84 A;  3VH0 A;  4JD2 C;  4N14 A;  5CXB B;  3K27 A;  5FKR A;  4IA9 A;  2H9N A;  3UVN A;  4GM3 A;  2H13 A;  1GXR A;  1QNI A;  1Q47 A;  3JB9 L;  2H68 A;  4FWW A;  3B7F A;  4XYI A;  3SJL D;  2IWF A;  4PBZ A;  5GXI A;  3L4O D;  3PXW D;  4A0B A;  2PBI B;  3I89 A;  2PM9 B;  5HE3 B;  1JOF A;  4E5Z B;  3MXX A;  3MKQ A;  4CI1 A;  1PGU A;  2I0R A;  3L4M D;  4GGD A;  4GM9 A;  4EWR A;  3DXM C;  5GXH A;  2H47 A;  2P9I C;  3RFH A;  3RMZ D;  3RFG A;  2I0S A;  2CN3 A;  4CI8 A;  2P9K C;  3MMY A;  4JXM A;  4X3E A;  3RN1 D;  4ERQ A;  4A2L A;  3OW8 A;  3MZK A;  4GGC A;  3PXT D;  5FKT A;  4A08 B;  1TBG A;  1L0Q A;  2B4E A;  5FKQ A;  5H14 A;  5IJ8 E;  3KRW B;  5EMJ B;  4TZ4 A;  3AL9 A;  4PXW A;  5H1M A;  2Z2O A;  5GMK n;  3BG1 A;  1JJU B;  1N6E A;  3NVN A;  2Q7Q A;  2OK4 A;  4BL0 A;  3UVO A;  4X61 B;  3SN6 B;  2BBK H;  4AEZ A;  4OWR A;  4Y7R A;  2CO0 C;  4PSX B;  4R7A B;  2CN2 A;  4D6V A;  4A11 B;  3N0E A;  5EAR A;  5EM2 A;  5C2V B;  2G9A A;  3CFS B;  3ODT A;  3PVW B;  3FGB A;  4FA4 D;  3RRM C;  2HKM A;  3JZH A;  4LG9 A;  3RSE C;  4PNK B;  1SHY B;  4ZOZ A;  1K8K C;  3IJ1 A;  2H9L A;  2TRC B;  4LG8 A;  2YMU A;  4ESG A;  4YVD A;  3RLM D;  3EI3 B;  2PM7 B;  3IKO A;  3IJC A;  2P9L C;  3AFC A;  3OL2 B;  4X60 B;  1XHM A;  5KDO B;  1PEV A;  2AGX A;  3FM0 A;  4J0X A;  2OK6 A;  4L3G D;  5HE0 B;  2O9K A;  4PBY A;  5B4W A;  2J57 G;  4NSX A;  2P9U C;  1GOT B;  1OLZ A;  4CZV A;  3SLE D;  5TDH B;  3EU7 A;  4O9D A;  1XKS A;  3PVU B;  4XEI C;  2HJ4 A;  2Z2N A;  2J55 H;  2Z2P A;  3IIW A;  2AQ5 A;  3EI2 B;  3JAM g;  5HE1 B;  2AGY A;  1FWX A;  3I2N A;  3I8C A;  4JT5 C;  4X63 B;  4A0A A;  1RI6 A;  2GC4 A;  5THA A;  1MDA H;  2H3X A;  5JWZ A;  5IGO A;  4CI3 A;  5EMK B;  2OVR B;  2CNX A;  4K3J B;  2HJB A;  3N0D A;  4GGA A;  4U1E I;  5IC7 A;  2HXC A;  3EI4 B;  2YBA A;  1NR0 A;  4JSP C;  2IAA A;  2P9N C;  3OL2 A;  2CE8 A;  1N6F A;  3FRX A;  3SHF A;  5CXC B;  3SFZ A;  2UZY B;  3OKY A;  1P22 A;  3UVM A;  4ZOX A;  2UZX B;  2P9S C;  3SXT D;  4JSX C;  2YNN A;  2B5M A;  5HQG A;  3CFV A;  5TEE A;  3OKT A;  4CZX A;  4FA1 D;  2GC7 A;  3SBQ A;  3JPX A;  4CY1 A;  4J86 A;  3VA6 A;  3V9F A;  4A0B B;  5A2Q g;  3HFQ A;  4CY5 A;  2BCJ B;  3BWS A;  3DWL C;  3EWE A;  4J87 A;  1SQ9 A;  3AH8 B;  3SBP A;  4U7A A;  3EI4 A;  4J0W A;  4FA9 D;  5TEF A;  5EAM A;  4ES0 A;  3K26 A;  4CI2 A;  2IUP A;  3V5W B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...