4XYHA

Wild-type full length mis16 in schizosaccharomyces japonicus
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
402
structure length
375
Chain Sequence
LSEVDLEKKIQEEYKLWKQNVPFLYDLVITEALEWPSLTVEWFPGSEDNSSIQKLLLGTQTSGNDQNYLQVASVQLPTLDIVQKIHHEGDVNKARFMPQNPDIIATLGLNGNGYIFDLNLYREQPIVQTGHQACLRHHTSEGFGLGWNFIQEGTLATGTEDTSICVWDIKGKSLSLEKSIDVAPVSVYHRHTAVVNDLQFHLQHEALLTSVSDDCTLQIHDTRLPSSSSASQCVKAHEQPVNGVAFNPFNDYLLATASADHTVALWDLRRLNQRLHTLEGHEDEVYNVQWSPHDEPILVTSSTDRRVCVWDLSKIGEEQTVEDSEDGAPELMFMHGGHTNRVSDLSWNPNNKWVLASLADDNILQIWSPSKVIWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kinetochore protein Mis16
publication title Mis16 Independently Recognizes Histone H4 and the CENP-ACnp1-Specific Chaperone Scm3sp.
pubmed doi rcsb
source organism Schizosaccharomyces japonicus (strain yfs275 / fy16936)
molecule tags Chaperone
total genus 110
structure length 375
sequence length 402
ec nomenclature
pdb deposition date 2015-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF12265 CAF1C_H4-bd Histone-binding protein RBBP4 or subunit C of CAF1 complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4xyhA00
4J86A 3DXMC 5FLXg 1QNIA 5SXMA 3I7NA 2HJ4A 3N0EA 2UZXB 1JMZB 3EMHA 3EI3B 3U4YA 3AL8B 4CI1A 1MG2A 3ODTA 1OMWB 3RFHA 2UZYB 2OVPB 4GQBB 5IJ7E 1U4CA 3NVNA 4E5ZA 2OVRB 1PBYB 2AGYA 4ZOVA 5K1CC 2H9MA 2P9KC 3BG1A 3JZHA 3PVWB 1MG3A 3I7OA 1PGUA 1B9XA 4O45A 4XEIC 3F3PA 4FA9D 4GMBA 3GREA 2MTAH 3UVLA 3OL2A 4O1QD 3VH0A 4A09B 3C9CA 1PEVA 3RN1D 4JSNC 4AOWA 3EI1A 2IUQA 5FKSA 1JOFA 1TBGA 2Z2PA 3F3FA 4CI8A 1GP2B 4OWRA 4U1EI 4ZOZA 4L3HD 4FB1D 4L1QD 2OJYA 2Q7QA 5TEFA 2GNQA 1FWXA 2IUPA 3VGZA 3EG6A 4CI3A 5IC7A 4JSXC 4ZN4A 3EU7A 4PBYA 5TDHB 2GC7A 2PM9A 3V7DB 5EAMA 3JRPA 2H13A 1RI6A 2XL2A 4XYIA 4L3GD 3HFQA 4H5IA 3EWEA 1GG2B 3V9FA 4PBZA 4N14A 3OKTA 2IURA 3DXKC 5CYKB 2J55H 2OIZA 1K8KC 3DWLC 4ES0A 1U2VC 4MK0B 3SBPA 2CE8A 3IJCA 3SLED 5EMJB 5KDOB 3PXSD 4D6VA 4A0BA 3I7LA 3K26A 5H17A 4J8BA 4H5JA 4QQEA 3A0FA 4GGAA 2AGWA 3AH8B 4J8GA 4QL1A 3IKOA 2P9PC 5IT9g 2QXVA 1P22A 1JJUB 3AFCA 5GXHA 3IJ1A 2IWKA 5EM2A 2CE9A 3PXTD 4BUJC 3PSCB 4J82A 5IJ8E 3DSMA 3FRXA 2TRCB 3C5MA 4ZOYA 3MXXA 5FKQA 3OKWA 4GGCA 4J0WA 1SQ9A 2CNXA 5IGOA 2CN3A 3OL2B 5B4WA 1N6DA 3UVKA 4A11B 2I0RA 4JT5C 3BWSA 4E54A 1A0RB 2YNOA 4FAND 3UVOA 4Y7RA 3RFGA 4TZ4A 2B5MA 4GM3A 3J81g 1S4UX 3RN0D 3I7PA 2H68A 4A08A 2IWFA 3SBRA 2OK4A 4GZ8A 2Z2NA 3BG0A 3F3GA 4K3ID 4QRJA 5HE0B 3V5WB 4R7AB 4CY3A 3J80g 2OK6A 2HKMA 2PM9B 5I5JA 5FKRA 1XKSA 3P4FA 2P9UC 4FAVD 3L4MD 4JSVC 3B7FA 3MZLA 2AQ5A 3ULEC 2G99A 5GMKn 2EBSA 3CFVA 2YB8B 2AGZA 3SHFA 2CO0A 2O9KA 3FGBA 5AFU3 1MDAH 2PBIB 5CXBB 3RLMD 4O3UB 1NEXB 2AGXA 2J56H 3FM0A 2P9SC 4BH6A 3KRXB 3EI2A 4JSPC 3L4OD 4CY1A 2YMUA 3EI3A 4U7AA 4A0BB 3AL8A 2P9NC 4GQ1A 2H9NA 4X60B 4J0XA 4A2MA 2I0SA 2B5LA 4GGDA 4ERYA 3SFZA 5AJAA 4CZYA 3OKYA 3EI4B 3KRWB 3IIWA 4JT6C 4PNKB 4UI9R 3SVWD 4O3TB 2AH1A 5HE3B 4A09A 1B9YA 4EWRA 2XL3A 5EMKB 2OVQB 3PXWD 4CI2A 4GM8A 5CXCA 5H14A 3UKRC 1XHMA 3N0DA 3CIKB 1L0QA 5EMMB 3SJLD 4ERZA 1N6FA 3CFSB 4J79A 5TF2A 2IAAA 4J78A 5HE2B 3OTTA 4E54B 2B5NA 5JWZA 2HKRA 3OW8A 5AMSA 2YNNA 3AL9A 2HESX 4E5ZB 1R5MA 1JMXB 4BL0A 1TYQC 1SQJA 4O9DA 4ERQA 4I79A 4X63B 4J77A 4J87A 2AH0A 5K19A 4A08B 1PI6A 4GQ2P 4CZXA 2H14A 5EALA 2B4EA 5CYKA 3I7HA 3SCYA 3MMYA 5C2WB 2YBAA 3I89A 4JXMA 3IIYA 4X61B 4PXWA 5GXIA 2I3SA 3EI1B 3RMZD 3NVQA 3JZGA 1Q47A 2J57G 4LG9A 2H6NA 2Z2OA 2H6QA 2PM6B 5TEEA 5GSAA 3UVNA 4A7JA 3RRMC 2HXCA 3DM0A 3MZKA 3EI2B 1ERJA 3I8CA 4Y5RD 2H9PA 2QC5A 3C99A 3JB9L 1VYHC 3MKSB 2H47A 4A0AA 3JAMg 3C75H 2AGLA 2HYEA 2I3TA 3RSEC 4J81A 5H1MA 3UKUC 4FA1D 3W15A 4KFMB 4FA4D 2P9IC 4NSXA 4J73A 4FA5D 4L9OA 3OKYB 4LGNA 2GC4A 1XIPA 4PSWB 3SXTD 1OLZA 4A11A 5EAPA 3GFCA 2P9LC 5C9ZB 2I0TA 2YNPA 5CXCB 3SMRA 4AEZA 5HE1B 3PVUB 1NR0A 3IJ0A 3SWSD 2G9AA 3K27A 3PE7A 2W18A 4CZVA 2H3XA 1GXRA 1YFQA 4FWWA 2BCJB 5EM2B 1SHYB 5FKTA 3I8EA 3SBQA 4CC9A 4X3EA 4LG8A 5THAA 4A2LA 4QT8A 4D0KA 3UR4A 3UVMA 3JZNA 4XYHA 4IMMA 5CXBA 5A2Qg 4G56B 4CY5A 3I2NA 4OZUA 3ORVD 5EARA 4GM9A 5HQGA 4K3JB 3NVXA 3E0CA 4PC0A 2CN2A 3VA6A 2HJBA 2H6KA 3SN6B 5I5MA 4HDJA 5FXYA 4ZOXA 5HYNB 5I5IA 2IUVA 4Z8LA 3I7KA 1K32A 3ZWLB 5FA5B 5EMLB 4A0AB 2CO0C 3EI4A 3JPXA 4CY2A 5IGQA 3PSLA 1GOTB 3JROA 2BBKH 4ESGA 2XU7A 4PSXB 4IA9A 2H9LA 2PM7B 4J84A 1N6EA 5FQDA 5C2VB 4FHLA 4JD2C 2XYIA 4YVDA 3MKQA
chains in the Genus database with same CATH superfamily
4J86A 3DXMC 5FLXg 1QNIA 5SXMA 4JHPC 2EIDA 3I7NA 4WK4A 2HJ4A 3N0EA 2UZXB 1JMZB 3EMHA 3EI3B 3U4YA 3KCIA 3AL8B 4CI1A 1MG2A 3ODTA 1OMWB 3RFHA 2UZYB 2OVPB 4GQBB 5IJ7E 1U4CA 3NVNA 4E5ZA 2OVRB 1PBYB 2AGYA 3K72A 4ZOVA 4MMXA 5HDBA 5K1CC 2H9MA 2P9KC 3JZHA 3BG1A 3PVWB 1MG3A 3I7OA 1PGUA 1B9XA 4O45A 4XEIC 3F3PA 4FA9D 2EICA 4GMBA 1JTDB 3V4PA 3GREA 2MTAH 3NIDA 3UVLA 3OL2A 3ZDXA 5M5TA 4O1QD 3VH0A 4A09B 3C9CA 1PEVA 4BP9A 3IURA 2BKLA 4JSNC 3RN1D 4AOWA 3EI1A 2IUQA 5FKSA 3ZE1A 1JOFA 1TBGA 2Z2PA 3F3FA 4CI8A 1GP2B 4OWRA 4U1EI 3DDUA 4ZOZA 5FFOA 4L3HD 4FB1D 4L1QD 2OJYA 2Q7QA 4G1EA 4G55A 5TEFA 2GNQA 1FWXA 2IUPA 3VGZA 3ZE0A 4BP8A 3VI4A 3EG6A 4CI3A 5IC7A 4JSXC 1VZ2A 4ZN4A 3EU7A 4PBYA 5TDHB 2GC7A 2PM9A 3V7DB 1I2MB 5EAMA 3JRPA 2H13A 1RI6A 2XL2A 4XYIA 3O4JA 4NC4A 4L3GD 3HFQA 4H5IA 3EWEA 1GG2B 3V9FA 4PBZA 4N14A 3OKTA 1UOOA 2IURA 3DXKC 5CYKB 1QFMA 2J55H 2OIZA 1K8KC 3DWLC 4NAAA 4ES0A 1U2VC 3GD1I 4O2WA 4MK0B 3SBPA 2EIBA 3IUNA 2CE8A 3IJCA 3SLED 5EMJB 3IULA 5KDOB 3PXSD 4D6VA 4A0BA 3I7LA 3K26A 5H17A 4J8BA 4H5JA 4QQEA 3A0FA 4GGAA 2AGWA 3AH8B 4J8GA 4QL1A 4O02A 3IKOA 2P9PC 5IT9g 5M5UA 2QXVA 1P22A 2VDNA 1JJUB 3AFCA 5GXHA 3IJ1A 2IWKA 3NIFA 3OF7A 4WK2A 5EM2A 2CE9A 3PXTD 4BUJC 3PSCB 4J82A 5IJ8E 3DSMA 5M5VA 3FRXA 2TRCB 3C5MA 4ZOYA 3ZDYA 2HU5A 3MXXA 5FKQA 4D9SA 1GOHA 3OKWA 1H2WA 4GGCA 4J0WA 1SQ9A 1BPOA 2CNXA 5IGOA 2CN3A 1U8CA 3OL2B 5B4WA 1N6DA 3UVKA 3T3MA 4A11B 2I0RA 4JT5C 3ZE2A 3BWSA 4E54A 1A0RB 2YNOA 4FAND 3UVOA 4Y7RA 5M5RA 3EQ9A 3RFGA 4TZ4A 2B5MA 4GM3A 2JKXA 3J81g 1S4UX 3RN0D 3I7PA 2H68A 4A08A 2VC2A 2IWFA 3SBRA 2OK4A 4GZ8A 2Z2NA 3O4HA 3BG0A 3F3GA 4K3ID 3EQ8A 4QRJA 4RE6A 5HE0B 3V5WB 4R7AB 4CY3A 3J80g 2OK6A 2HKMA 2PM9B 5I5JA 5FKRA 1XKSA 5E6SA 3P4FA 2P9UC 4FAVD 2VDOA 3L4MD 4JSVC 3B7FA 3MZLA 2AQ5A 3ULEC 3MUOA 2G99A 5GMKn 4QAMA 2EBSA 3CFVA 2YB8B 2AGZA 3SHFA 4AMZA 2CO0A 2O9KA 3FGBA 5AFU3 1MDAH 2PBIB 5CXBB 3RLMD 1M1XA 4O3UB 2QZPA 1NEXB 2AGXA 5E6UA 2J56H 3FM0A 2P9SC 4BH6A 1YR2A 3KRXB 3EI2A 4JSPC 3L4OD 4CY1A 2YMUA 3EI3A 2HU7A 4BCDA 4U7AA 4A0BB 3AL8A 2P9NC 4GQ1A 2H9NA 4X60B 1UOQA 4J0XA 4BCBA 2HU8A 4A2MA 2I0SA 2B5LA 4GGDA 3IJEA 3FCUA 1H2XA 4DNWA 1VE6A 4ERYA 3SFZA 5AJAA 4CZYA 3OKYA 3EI4B 3KRWB 2VDRA 3IIWA 4JT6C 4PNKB 4UI9R 3SVWD 4O3TB 1UTCA 2AH1A 5HE3B 4A09A 1B9YA 4EWRA 3MUNA 3GC3B 4UM9A 2XL3A 3NIGA 5EMKB 2OVQB 3PXWD 4CI2A 4GM8A 5CXCA 5H14A 1QFSA 3UKRC 1XHMA 3N0DA 1TYEA 3CIKB 3EQ7A 3V4VA 1L0QA 5C86A 5EMMB 3SJLD 4ERZA 1N6FA 3CFSB 4G1MA 4J79A 5TF2A 2IAAA 4J78A 5HE2B 3OTTA 4E54B 2B5NA 4L1MA 5JWZA 1E5TA 2HKRA 3OW8A 5AMSA 2YNNA 2EIEA 3AL9A 2HESX 4E5ZB 1R5MA 1JMXB 1L5GA 4BL0A 3K71A 1TYQC 2VDLA 4WK0A 1JV2A 1SQJA 4O9DA 4NENA 2VDQA 4ERQA 4I79A 4X63B 1T2XA 4J77A 4J87A 2AH0A 5K19A 4A08B 1PI6A 4GQ2P 4CZXA 2H14A 4UM8A 5EALA 2B4EA 3MVDK 5CYKA 3I7HA 2VZ3A 3SCYA 4NBMA 3IVMA 3MMYA 5C2WB 2XE4A 5E6RA 2YBAA 3I89A 4JXMA 3IIYA 4X61B 4PXWA 5GXIA 2I3SA 3EI1B 3RMZD 3NVQA 3JZGA 1Q47A 2J57G 4LG9A 1GOFA 5M61A 1O6GA 2H6NA 1A12A 2Z2OA 2H6QA 2PM6B 5TEEA 5GSAA 3UVNA 4A7JA 3IUQA 1H2ZA 3RRMC 2HXCA 3DM0A 3MZKA 2VDKA 3EI2B 1ERJA 3I8CA 5FFGA 4Y5RD 3IUJA 2H9PA 3O4GA 2QC5A 3C99A 3JB9L 1VYHC 3MKSB 2H47A 2VDPA 2WQ8A 4A0AA 3JAMg 3C75H 1K3IA 2AGLA 2I3TA 2HYEA 3RSEC 4J81A 5H1MA 3UKUC 4FA1D 3W15A 4KFMB 1O6FA 4FA4D 3IUMA 2P9IC 2XDWA 4Z7OA 4JHNA 4NSXA 4Z7QA 4J73A 4FA5D 4L9OA 3OKYB 3QHYB 4LGNA 3K6SA 2VDMA 1VE7A 2GC4A 1XIPA 4PSWB 3SXTD 1OLZA 1E8MA 2XZGA 5EAPA 4A11A 3GFCA 2P9LC 5C9ZB 2I0TA 2YNPA 5CXCB 3SMRA 4AEZA 5HE1B 3PVUB 1GOGA 1NR0A 3VI3A 3IJ0A 3SWSD 2G9AA 3K27A 3PE7A 2W18A 4IRZA 4CZVA 2H3XA 3ZDZA 1GXRA 1YFQA 4FWWA 2BCJB 5EM2B 4MMZA 1SHYB 1VZ3A 4RE5A 5FKTA 3I8EA 3SBQA 4CC9A 4X3EA 4LG8A 5THAA 4A2LA 5C92A 4QT8A 1C9IA 4D0KA 3UR4A 3QI0A 4DNVA 3UVMA 3JZNA 4XYHA 4IMMA 5CXBA 5A2Qg 4G56B 4CY5A 3I2NA 4OZUA 1UOPA 3ORVD 5EARA 4GM9A 5HQGA 4Z7NA 4K3JB 3NVXA 3E0CA 4PC0A 2CN2A 3VA6A 2HJBA 2H6KA 4AMYA 3SN6B 5I5MA 4HDJA 5FXYA 5M5SA 4ZOXA 3FCSA 5HYNB 5I5IA 2IUVA 4AX4A 4Z8LA 4DNUA 1C9LA 3I7KA 1K32A 3O4IA 3ZWLB 4BCCA 5FA5B 4AN1A 5EMLB 4A0AB 2QR5A 2CO0C 3EI4A 4AN0A 1E8NA 3JPXA 4CY2A 5IGQA 3PSLA 1GOTB 3JROA 2BBKH 4ESGA 2XU7A 4PSXB 4IA9A 2H9LA 2PM7B 4J84A 1N6EA 5FQDA 4MMYA 4WJKA 1H2YA 5C2VB 4FHLA 4JD2C 3T3PA 2VZ1A 2XYIA 4YVDA 3MKQA
chains in the Genus database with same CATH topology
4J86A 3DXMC 5FLXg 1QNIA 5SXMA 3I7NA 2HJ4A 3N0EA 2UZXB 1JMZB 3EMHA 3EI3B 3U4YA 3AL8B 4CI1A 1MG2A 3ODTA 1OMWB 3RFHA 2UZYB 2OVPB 4GQBB 5IJ7E 1U4CA 3NVNA 4E5ZA 2OVRB 1PBYB 2AGYA 4ZOVA 5K1CC 2H9MA 2P9KC 3BG1A 3JZHA 3PVWB 1MG3A 3I7OA 1PGUA 1B9XA 4O45A 4XEIC 3F3PA 4FA9D 4GMBA 3GREA 2MTAH 3UVLA 3OL2A 4O1QD 3VH0A 4A09B 3C9CA 1PEVA 3RN1D 4JSNC 4AOWA 3EI1A 2IUQA 5FKSA 1JOFA 1TBGA 2Z2PA 3F3FA 4CI8A 1GP2B 4OWRA 4U1EI 4ZOZA 4L3HD 4FB1D 4L1QD 2OJYA 2Q7QA 5TEFA 2GNQA 1FWXA 2IUPA 3VGZA 3EG6A 4CI3A 5IC7A 4JSXC 4ZN4A 3EU7A 4PBYA 5TDHB 2GC7A 2PM9A 3V7DB 5EAMA 3JRPA 2H13A 1RI6A 2XL2A 4XYIA 4L3GD 3HFQA 4H5IA 3EWEA 1GG2B 3V9FA 4PBZA 4N14A 3OKTA 2IURA 3DXKC 5CYKB 2J55H 2OIZA 1K8KC 3DWLC 4ES0A 1U2VC 4MK0B 3SBPA 2CE8A 3IJCA 3SLED 5EMJB 5KDOB 3PXSD 4D6VA 4A0BA 3I7LA 3K26A 5H17A 4J8BA 4H5JA 4QQEA 3A0FA 4GGAA 2AGWA 3AH8B 4J8GA 4QL1A 3IKOA 2P9PC 5IT9g 2QXVA 1P22A 1JJUB 3AFCA 5GXHA 3IJ1A 2IWKA 5EM2A 2CE9A 3PXTD 4BUJC 3PSCB 4J82A 5IJ8E 3DSMA 3FRXA 2TRCB 3C5MA 4ZOYA 3MXXA 5FKQA 3OKWA 4GGCA 4J0WA 1SQ9A 2CNXA 5IGOA 2CN3A 3OL2B 5B4WA 1N6DA 3UVKA 4A11B 2I0RA 4JT5C 3BWSA 4E54A 1A0RB 2YNOA 4FAND 3UVOA 4Y7RA 3RFGA 4TZ4A 2B5MA 4GM3A 3J81g 1S4UX 3RN0D 3I7PA 2H68A 4A08A 2IWFA 3SBRA 2OK4A 4GZ8A 2Z2NA 3BG0A 3F3GA 4K3ID 4QRJA 5HE0B 3V5WB 4R7AB 4CY3A 3J80g 2OK6A 2HKMA 2PM9B 5I5JA 5FKRA 1XKSA 3P4FA 2P9UC 4FAVD 3L4MD 4JSVC 3B7FA 3MZLA 2AQ5A 3ULEC 2G99A 5GMKn 2EBSA 3CFVA 2YB8B 2AGZA 3SHFA 2CO0A 2O9KA 3FGBA 5AFU3 1MDAH 2PBIB 5CXBB 3RLMD 4O3UB 1NEXB 2AGXA 2J56H 3FM0A 2P9SC 4BH6A 3KRXB 3EI2A 4JSPC 3L4OD 4CY1A 2YMUA 3EI3A 4U7AA 4A0BB 3AL8A 2P9NC 4GQ1A 2H9NA 4X60B 4J0XA 4A2MA 2I0SA 2B5LA 4GGDA 4ERYA 3SFZA 5AJAA 4CZYA 3OKYA 3EI4B 3KRWB 3IIWA 4JT6C 4PNKB 4UI9R 3SVWD 4O3TB 2AH1A 5HE3B 4A09A 1B9YA 4EWRA 2XL3A 5EMKB 2OVQB 3PXWD 4CI2A 4GM8A 5CXCA 5H14A 3UKRC 1XHMA 3N0DA 3CIKB 1L0QA 5EMMB 3SJLD 4ERZA 1N6FA 3CFSB 4J79A 5TF2A 2IAAA 4J78A 5HE2B 3OTTA 4E54B 2B5NA 5JWZA 2HKRA 3OW8A 5AMSA 2YNNA 3AL9A 2HESX 4E5ZB 1R5MA 1JMXB 4BL0A 1TYQC 1SQJA 4O9DA 4ERQA 4I79A 4X63B 4J77A 4J87A 2AH0A 5K19A 4A08B 1PI6A 4GQ2P 4CZXA 2H14A 5EALA 2B4EA 5CYKA 3I7HA 3SCYA 3MMYA 5C2WB 2YBAA 3I89A 4JXMA 3IIYA 4X61B 4PXWA 5GXIA 2I3SA 3EI1B 3RMZD 3NVQA 3JZGA 1Q47A 2J57G 4LG9A 2H6NA 2Z2OA 2H6QA 2PM6B 5TEEA 5GSAA 3UVNA 4A7JA 3RRMC 2HXCA 3DM0A 3MZKA 3EI2B 1ERJA 3I8CA 4Y5RD 2H9PA 2QC5A 3C99A 3JB9L 1VYHC 3MKSB 2H47A 4A0AA 3JAMg 3C75H 2AGLA 2HYEA 2I3TA 3RSEC 4J81A 5H1MA 3UKUC 4FA1D 3W15A 4KFMB 4FA4D 2P9IC 4NSXA 4J73A 4FA5D 4L9OA 3OKYB 4LGNA 2GC4A 1XIPA 4PSWB 3SXTD 1OLZA 4A11A 5EAPA 3GFCA 2P9LC 5C9ZB 2I0TA 2YNPA 5CXCB 3SMRA 4AEZA 5HE1B 3PVUB 1NR0A 3IJ0A 3SWSD 2G9AA 3K27A 3PE7A 2W18A 4CZVA 2H3XA 1GXRA 1YFQA 4FWWA 2BCJB 5EM2B 1SHYB 5FKTA 3I8EA 3SBQA 4CC9A 4X3EA 4LG8A 5THAA 4A2LA 4QT8A 4D0KA 3UR4A 3UVMA 3JZNA 4XYHA 4IMMA 5CXBA 5A2Qg 4G56B 4CY5A 3I2NA 4OZUA 3ORVD 5EARA 4GM9A 5HQGA 4K3JB 3NVXA 3E0CA 4PC0A 2CN2A 3VA6A 2HJBA 2H6KA 3SN6B 5I5MA 4HDJA 5FXYA 4ZOXA 5HYNB 5I5IA 2IUVA 4Z8LA 3I7KA 1K32A 3ZWLB 5FA5B 5EMLB 4A0AB 2CO0C 3EI4A 3JPXA 4CY2A 5IGQA 3PSLA 1GOTB 3JROA 2BBKH 4ESGA 2XU7A 4PSXB 4IA9A 2H9LA 2PM7B 4J84A 1N6EA 5FQDA 5C2VB 4FHLA 4JD2C 2XYIA 4YVDA 3MKQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J86 A;  3DXM C;  5FLX g;  1QNI A;  5SXM A;  3I7N A;  2HJ4 A;  3N0E A;  2UZX B;  1JMZ B;  3EMH A;  3EI3 B;  3U4Y A;  3AL8 B;  4CI1 A;  1MG2 A;  3ODT A;  1OMW B;  3RFH A;  2UZY B;  2OVP B;  4GQB B;  5IJ7 E;  1U4C A;  3NVN A;  4E5Z A;  2OVR B;  1PBY B;  2AGY A;  4ZOV A;  5K1C C;  2H9M A;  2P9K C;  3BG1 A;  3JZH A;  3PVW B;  1MG3 A;  3I7O A;  1PGU A;  1B9X A;  4O45 A;  4XEI C;  3F3P A;  4FA9 D;  4GMB A;  3GRE A;  2MTA H;  3UVL A;  3OL2 A;  4O1Q D;  3VH0 A;  4A09 B;  3C9C A;  1PEV A;  3RN1 D;  4JSN C;  4AOW A;  3EI1 A;  2IUQ A;  5FKS A;  1JOF A;  1TBG A;  2Z2P A;  3F3F A;  4CI8 A;  1GP2 B;  4OWR A;  4U1E I;  4ZOZ A;  4L3H D;  4FB1 D;  4L1Q D;  2OJY A;  2Q7Q A;  5TEF A;  2GNQ A;  1FWX A;  2IUP A;  3VGZ A;  3EG6 A;  4CI3 A;  5IC7 A;  4JSX C;  4ZN4 A;  3EU7 A;  4PBY A;  5TDH B;  2GC7 A;  2PM9 A;  3V7D B;  5EAM A;  3JRP A;  2H13 A;  1RI6 A;  2XL2 A;  4XYI A;  4L3G D;  3HFQ A;  4H5I A;  3EWE A;  1GG2 B;  3V9F A;  4PBZ A;  4N14 A;  3OKT A;  2IUR A;  3DXK C;  5CYK B;  2J55 H;  2OIZ A;  1K8K C;  3DWL C;  4ES0 A;  1U2V C;  4MK0 B;  3SBP A;  2CE8 A;  3IJC A;  3SLE D;  5EMJ B;  5KDO B;  3PXS D;  4D6V A;  4A0B A;  3I7L A;  3K26 A;  5H17 A;  4J8B A;  4H5J A;  4QQE A;  3A0F A;  4GGA A;  2AGW A;  3AH8 B;  4J8G A;  4QL1 A;  3IKO A;  2P9P C;  5IT9 g;  2QXV A;  1P22 A;  1JJU B;  3AFC A;  5GXH A;  3IJ1 A;  2IWK A;  5EM2 A;  2CE9 A;  3PXT D;  4BUJ C;  3PSC B;  4J82 A;  5IJ8 E;  3DSM A;  3FRX A;  2TRC B;  3C5M A;  4ZOY A;  3MXX A;  5FKQ A;  3OKW A;  4GGC A;  4J0W A;  1SQ9 A;  2CNX A;  5IGO A;  2CN3 A;  3OL2 B;  5B4W A;  1N6D A;  3UVK A;  4A11 B;  2I0R A;  4JT5 C;  3BWS A;  4E54 A;  1A0R B;  2YNO A;  4FAN D;  3UVO A;  4Y7R A;  3RFG A;  4TZ4 A;  2B5M A;  4GM3 A;  3J81 g;  1S4U X;  3RN0 D;  3I7P A;  2H68 A;  4A08 A;  2IWF A;  3SBR A;  2OK4 A;  4GZ8 A;  2Z2N A;  3BG0 A;  3F3G A;  4K3I D;  4QRJ A;  5HE0 B;  3V5W B;  4R7A B;  4CY3 A;  3J80 g;  2OK6 A;  2HKM A;  2PM9 B;  5I5J A;  5FKR A;  1XKS A;  3P4F A;  2P9U C;  4FAV D;  3L4M D;  4JSV C;  3B7F A;  3MZL A;  2AQ5 A;  3ULE C;  2G99 A;  5GMK n;  2EBS A;  3CFV A;  2YB8 B;  2AGZ A;  3SHF A;  2CO0 A;  2O9K A;  3FGB A;  5AFU 3;  1MDA H;  2PBI B;  5CXB B;  3RLM D;  4O3U B;  1NEX B;  2AGX A;  2J56 H;  3FM0 A;  2P9S C;  4BH6 A;  3KRX B;  3EI2 A;  4JSP C;  3L4O D;  4CY1 A;  2YMU A;  3EI3 A;  4U7A A;  4A0B B;  3AL8 A;  2P9N C;  4GQ1 A;  2H9N A;  4X60 B;  4J0X A;  4A2M A;  2I0S A;  2B5L A;  4GGD A;  4ERY A;  3SFZ A;  5AJA A;  4CZY A;  3OKY A;  3EI4 B;  3KRW B;  3IIW A;  4JT6 C;  4PNK B;  4UI9 R;  3SVW D;  4O3T B;  2AH1 A;  5HE3 B;  4A09 A;  1B9Y A;  4EWR A;  2XL3 A;  5EMK B;  2OVQ B;  3PXW D;  4CI2 A;  4GM8 A;  5CXC A;  5H14 A;  3UKR C;  1XHM A;  3N0D A;  3CIK B;  1L0Q A;  5EMM B;  3SJL D;  4ERZ A;  1N6F A;  3CFS B;  4J79 A;  5TF2 A;  2IAA A;  4J78 A;  5HE2 B;  3OTT A;  4E54 B;  2B5N A;  5JWZ A;  2HKR A;  3OW8 A;  5AMS A;  2YNN A;  3AL9 A;  2HES X;  4E5Z B;  1R5M A;  1JMX B;  4BL0 A;  1TYQ C;  1SQJ A;  4O9D A;  4ERQ A;  4I79 A;  4X63 B;  4J77 A;  4J87 A;  2AH0 A;  5K19 A;  4A08 B;  1PI6 A;  4GQ2 P;  4CZX A;  2H14 A;  5EAL A;  2B4E A;  5CYK A;  3I7H A;  3SCY A;  3MMY A;  5C2W B;  2YBA A;  3I89 A;  4JXM A;  3IIY A;  4X61 B;  4PXW A;  5GXI A;  2I3S A;  3EI1 B;  3RMZ D;  3NVQ A;  3JZG A;  1Q47 A;  2J57 G;  4LG9 A;  2H6N A;  2Z2O A;  2H6Q A;  2PM6 B;  5TEE A;  5GSA A;  3UVN A;  4A7J A;  3RRM C;  2HXC A;  3DM0 A;  3MZK A;  3EI2 B;  1ERJ A;  3I8C A;  4Y5R D;  2H9P A;  2QC5 A;  3C99 A;  3JB9 L;  1VYH C;  3MKS B;  2H47 A;  4A0A A;  3JAM g;  3C75 H;  2AGL A;  2HYE A;  2I3T A;  3RSE C;  4J81 A;  5H1M A;  3UKU C;  4FA1 D;  3W15 A;  4KFM B;  4FA4 D;  2P9I C;  4NSX A;  4J73 A;  4FA5 D;  4L9O A;  3OKY B;  4LGN A;  2GC4 A;  1XIP A;  4PSW B;  3SXT D;  1OLZ A;  4A11 A;  5EAP A;  3GFC A;  2P9L C;  5C9Z B;  2I0T A;  2YNP A;  5CXC B;  3SMR A;  4AEZ A;  5HE1 B;  3PVU B;  1NR0 A;  3IJ0 A;  3SWS D;  2G9A A;  3K27 A;  3PE7 A;  2W18 A;  4CZV A;  2H3X A;  1GXR A;  1YFQ A;  4FWW A;  2BCJ B;  5EM2 B;  1SHY B;  5FKT A;  3I8E A;  3SBQ A;  4CC9 A;  4X3E A;  4LG8 A;  5THA A;  4A2L A;  4QT8 A;  4D0K A;  3UR4 A;  3UVM A;  3JZN A;  4XYH A;  4IMM A;  5CXB A;  5A2Q g;  4G56 B;  4CY5 A;  3I2N A;  4OZU A;  3ORV D;  5EAR A;  4GM9 A;  5HQG A;  4K3J B;  3NVX A;  3E0C A;  4PC0 A;  2CN2 A;  3VA6 A;  2HJB A;  2H6K A;  3SN6 B;  5I5M A;  4HDJ A;  5FXY A;  4ZOX A;  5HYN B;  5I5I A;  2IUV A;  4Z8L A;  3I7K A;  1K32 A;  3ZWL B;  5FA5 B;  5EML B;  4A0A B;  2CO0 C;  3EI4 A;  3JPX A;  4CY2 A;  5IGQ A;  3PSL A;  1GOT B;  3JRO A;  2BBK H;  4ESG A;  2XU7 A;  4PSX B;  4IA9 A;  2H9L A;  2PM7 B;  4J84 A;  1N6E A;  5FQD A;  5C2V B;  4FHL A;  4JD2 C;  2XYI A;  4YVD A;  3MKQ A; 
#chains in the Genus database with same CATH topology
 4J86 A;  3DXM C;  5FLX g;  1QNI A;  5SXM A;  4JHP C;  2EID A;  3I7N A;  4WK4 A;  2HJ4 A;  3N0E A;  2UZX B;  1JMZ B;  3EMH A;  3EI3 B;  3U4Y A;  3KCI A;  3AL8 B;  4CI1 A;  1MG2 A;  3ODT A;  1OMW B;  3RFH A;  2UZY B;  2OVP B;  4GQB B;  5IJ7 E;  1U4C A;  3NVN A;  4E5Z A;  2OVR B;  1PBY B;  2AGY A;  3K72 A;  4ZOV A;  4MMX A;  5HDB A;  5K1C C;  2H9M A;  2P9K C;  3JZH A;  3BG1 A;  3PVW B;  1MG3 A;  3I7O A;  1PGU A;  1B9X A;  4O45 A;  4XEI C;  3F3P A;  4FA9 D;  2EIC A;  4GMB A;  1JTD B;  3V4P A;  3GRE A;  2MTA H;  3NID A;  3UVL A;  3OL2 A;  3ZDX A;  5M5T A;  4O1Q D;  3VH0 A;  4A09 B;  3C9C A;  1PEV A;  4BP9 A;  3IUR A;  2BKL A;  4JSN C;  3RN1 D;  4AOW A;  3EI1 A;  2IUQ A;  5FKS A;  3ZE1 A;  1JOF A;  1TBG A;  2Z2P A;  3F3F A;  4CI8 A;  1GP2 B;  4OWR A;  4U1E I;  3DDU A;  4ZOZ A;  5FFO A;  4L3H D;  4FB1 D;  4L1Q D;  2OJY A;  2Q7Q A;  4G1E A;  4G55 A;  5TEF A;  2GNQ A;  1FWX A;  2IUP A;  3VGZ A;  3ZE0 A;  4BP8 A;  3VI4 A;  3EG6 A;  4CI3 A;  5IC7 A;  4JSX C;  1VZ2 A;  4ZN4 A;  3EU7 A;  4PBY A;  5TDH B;  2GC7 A;  2PM9 A;  3V7D B;  1I2M B;  5EAM A;  3JRP A;  2H13 A;  1RI6 A;  2XL2 A;  4XYI A;  3O4J A;  4NC4 A;  4L3G D;  3HFQ A;  4H5I A;  3EWE A;  1GG2 B;  3V9F A;  4PBZ A;  4N14 A;  3OKT A;  1UOO A;  2IUR A;  3DXK C;  5CYK B;  1QFM A;  2J55 H;  2OIZ A;  1K8K C;  3DWL C;  4NAA A;  4ES0 A;  1U2V C;  3GD1 I;  4O2W A;  4MK0 B;  3SBP A;  2EIB A;  3IUN A;  2CE8 A;  3IJC A;  3SLE D;  5EMJ B;  3IUL A;  5KDO B;  3PXS D;  4D6V A;  4A0B A;  3I7L A;  3K26 A;  5H17 A;  4J8B A;  4H5J A;  4QQE A;  3A0F A;  4GGA A;  2AGW A;  3AH8 B;  4J8G A;  4QL1 A;  4O02 A;  3IKO A;  2P9P C;  5IT9 g;  5M5U A;  2QXV A;  1P22 A;  2VDN A;  1JJU B;  3AFC A;  5GXH A;  3IJ1 A;  2IWK A;  3NIF A;  3OF7 A;  4WK2 A;  5EM2 A;  2CE9 A;  3PXT D;  4BUJ C;  3PSC B;  4J82 A;  5IJ8 E;  3DSM A;  5M5V A;  3FRX A;  2TRC B;  3C5M A;  4ZOY A;  3ZDY A;  2HU5 A;  3MXX A;  5FKQ A;  4D9S A;  1GOH A;  3OKW A;  1H2W A;  4GGC A;  4J0W A;  1SQ9 A;  1BPO A;  2CNX A;  5IGO A;  2CN3 A;  1U8C A;  3OL2 B;  5B4W A;  1N6D A;  3UVK A;  3T3M A;  4A11 B;  2I0R A;  4JT5 C;  3ZE2 A;  3BWS A;  4E54 A;  1A0R B;  2YNO A;  4FAN D;  3UVO A;  4Y7R A;  5M5R A;  3EQ9 A;  3RFG A;  4TZ4 A;  2B5M A;  4GM3 A;  2JKX A;  3J81 g;  1S4U X;  3RN0 D;  3I7P A;  2H68 A;  4A08 A;  2VC2 A;  2IWF A;  3SBR A;  2OK4 A;  4GZ8 A;  2Z2N A;  3O4H A;  3BG0 A;  3F3G A;  4K3I D;  3EQ8 A;  4QRJ A;  4RE6 A;  5HE0 B;  3V5W B;  4R7A B;  4CY3 A;  3J80 g;  2OK6 A;  2HKM A;  2PM9 B;  5I5J A;  5FKR A;  1XKS A;  5E6S A;  3P4F A;  2P9U C;  4FAV D;  2VDO A;  3L4M D;  4JSV C;  3B7F A;  3MZL A;  2AQ5 A;  3ULE C;  3MUO A;  2G99 A;  5GMK n;  4QAM A;  2EBS A;  3CFV A;  2YB8 B;  2AGZ A;  3SHF A;  4AMZ A;  2CO0 A;  2O9K A;  3FGB A;  5AFU 3;  1MDA H;  2PBI B;  5CXB B;  3RLM D;  1M1X A;  4O3U B;  2QZP A;  1NEX B;  2AGX A;  5E6U A;  2J56 H;  3FM0 A;  2P9S C;  4BH6 A;  1YR2 A;  3KRX B;  3EI2 A;  4JSP C;  3L4O D;  4CY1 A;  2YMU A;  3EI3 A;  2HU7 A;  4BCD A;  4U7A A;  4A0B B;  3AL8 A;  2P9N C;  4GQ1 A;  2H9N A;  4X60 B;  1UOQ A;  4J0X A;  4BCB A;  2HU8 A;  4A2M A;  2I0S A;  2B5L A;  4GGD A;  3IJE A;  3FCU A;  1H2X A;  4DNW A;  1VE6 A;  4ERY A;  3SFZ A;  5AJA A;  4CZY A;  3OKY A;  3EI4 B;  3KRW B;  2VDR A;  3IIW A;  4JT6 C;  4PNK B;  4UI9 R;  3SVW D;  4O3T B;  1UTC A;  2AH1 A;  5HE3 B;  4A09 A;  1B9Y A;  4EWR A;  3MUN A;  3GC3 B;  4UM9 A;  2XL3 A;  3NIG A;  5EMK B;  2OVQ B;  3PXW D;  4CI2 A;  4GM8 A;  5CXC A;  5H14 A;  1QFS A;  3UKR C;  1XHM A;  3N0D A;  1TYE A;  3CIK B;  3EQ7 A;  3V4V A;  1L0Q A;  5C86 A;  5EMM B;  3SJL D;  4ERZ A;  1N6F A;  3CFS B;  4G1M A;  4J79 A;  5TF2 A;  2IAA A;  4J78 A;  5HE2 B;  3OTT A;  4E54 B;  2B5N A;  4L1M A;  5JWZ A;  1E5T A;  2HKR A;  3OW8 A;  5AMS A;  2YNN A;  2EIE A;  3AL9 A;  2HES X;  4E5Z B;  1R5M A;  1JMX B;  1L5G A;  4BL0 A;  3K71 A;  1TYQ C;  2VDL A;  4WK0 A;  1JV2 A;  1SQJ A;  4O9D A;  4NEN A;  2VDQ A;  4ERQ A;  4I79 A;  4X63 B;  1T2X A;  4J77 A;  4J87 A;  2AH0 A;  5K19 A;  4A08 B;  1PI6 A;  4GQ2 P;  4CZX A;  2H14 A;  4UM8 A;  5EAL A;  2B4E A;  3MVD K;  5CYK A;  3I7H A;  2VZ3 A;  3SCY A;  4NBM A;  3IVM A;  3MMY A;  5C2W B;  2XE4 A;  5E6R A;  2YBA A;  3I89 A;  4JXM A;  3IIY A;  4X61 B;  4PXW A;  5GXI A;  2I3S A;  3EI1 B;  3RMZ D;  3NVQ A;  3JZG A;  1Q47 A;  2J57 G;  4LG9 A;  1GOF A;  5M61 A;  1O6G A;  2H6N A;  1A12 A;  2Z2O A;  2H6Q A;  2PM6 B;  5TEE A;  5GSA A;  3UVN A;  4A7J A;  3IUQ A;  1H2Z A;  3RRM C;  2HXC A;  3DM0 A;  3MZK A;  2VDK A;  3EI2 B;  1ERJ A;  3I8C A;  5FFG A;  4Y5R D;  3IUJ A;  2H9P A;  3O4G A;  2QC5 A;  3C99 A;  3JB9 L;  1VYH C;  3MKS B;  2H47 A;  2VDP A;  2WQ8 A;  4A0A A;  3JAM g;  3C75 H;  1K3I A;  2AGL A;  2I3T A;  2HYE A;  3RSE C;  4J81 A;  5H1M A;  3UKU C;  4FA1 D;  3W15 A;  4KFM B;  1O6F A;  4FA4 D;  3IUM A;  2P9I C;  2XDW A;  4Z7O A;  4JHN A;  4NSX A;  4Z7Q A;  4J73 A;  4FA5 D;  4L9O A;  3OKY B;  3QHY B;  4LGN A;  3K6S A;  2VDM A;  1VE7 A;  2GC4 A;  1XIP A;  4PSW B;  3SXT D;  1OLZ A;  1E8M A;  2XZG A;  5EAP A;  4A11 A;  3GFC A;  2P9L C;  5C9Z B;  2I0T A;  2YNP A;  5CXC B;  3SMR A;  4AEZ A;  5HE1 B;  3PVU B;  1GOG A;  1NR0 A;  3VI3 A;  3IJ0 A;  3SWS D;  2G9A A;  3K27 A;  3PE7 A;  2W18 A;  4IRZ A;  4CZV A;  2H3X A;  3ZDZ A;  1GXR A;  1YFQ A;  4FWW A;  2BCJ B;  5EM2 B;  4MMZ A;  1SHY B;  1VZ3 A;  4RE5 A;  5FKT A;  3I8E A;  3SBQ A;  4CC9 A;  4X3E A;  4LG8 A;  5THA A;  4A2L A;  5C92 A;  4QT8 A;  1C9I A;  4D0K A;  3UR4 A;  3QI0 A;  4DNV A;  3UVM A;  3JZN A;  4XYH A;  4IMM A;  5CXB A;  5A2Q g;  4G56 B;  4CY5 A;  3I2N A;  4OZU A;  1UOP A;  3ORV D;  5EAR A;  4GM9 A;  5HQG A;  4Z7N A;  4K3J B;  3NVX A;  3E0C A;  4PC0 A;  2CN2 A;  3VA6 A;  2HJB A;  2H6K A;  4AMY A;  3SN6 B;  5I5M A;  4HDJ A;  5FXY A;  5M5S A;  4ZOX A;  3FCS A;  5HYN B;  5I5I A;  2IUV A;  4AX4 A;  4Z8L A;  4DNU A;  1C9L A;  3I7K A;  1K32 A;  3O4I A;  3ZWL B;  4BCC A;  5FA5 B;  4AN1 A;  5EML B;  4A0A B;  2QR5 A;  2CO0 C;  3EI4 A;  4AN0 A;  1E8N A;  3JPX A;  4CY2 A;  5IGQ A;  3PSL A;  1GOT B;  3JRO A;  2BBK H;  4ESG A;  2XU7 A;  4PSX B;  4IA9 A;  2H9L A;  2PM7 B;  4J84 A;  1N6E A;  5FQD A;  4MMY A;  4WJK A;  1H2Y A;  5C2V B;  4FHL A;  4JD2 C;  3T3P A;  2VZ1 A;  2XYI A;  4YVD A;  3MKQ A; 
#chains in the Genus database with same CATH homology
 4J86 A;  3DXM C;  5FLX g;  1QNI A;  5SXM A;  3I7N A;  2HJ4 A;  3N0E A;  2UZX B;  1JMZ B;  3EMH A;  3EI3 B;  3U4Y A;  3AL8 B;  4CI1 A;  1MG2 A;  3ODT A;  1OMW B;  3RFH A;  2UZY B;  2OVP B;  4GQB B;  5IJ7 E;  1U4C A;  3NVN A;  4E5Z A;  2OVR B;  1PBY B;  2AGY A;  4ZOV A;  5K1C C;  2H9M A;  2P9K C;  3BG1 A;  3JZH A;  3PVW B;  1MG3 A;  3I7O A;  1PGU A;  1B9X A;  4O45 A;  4XEI C;  3F3P A;  4FA9 D;  4GMB A;  3GRE A;  2MTA H;  3UVL A;  3OL2 A;  4O1Q D;  3VH0 A;  4A09 B;  3C9C A;  1PEV A;  3RN1 D;  4JSN C;  4AOW A;  3EI1 A;  2IUQ A;  5FKS A;  1JOF A;  1TBG A;  2Z2P A;  3F3F A;  4CI8 A;  1GP2 B;  4OWR A;  4U1E I;  4ZOZ A;  4L3H D;  4FB1 D;  4L1Q D;  2OJY A;  2Q7Q A;  5TEF A;  2GNQ A;  1FWX A;  2IUP A;  3VGZ A;  3EG6 A;  4CI3 A;  5IC7 A;  4JSX C;  4ZN4 A;  3EU7 A;  4PBY A;  5TDH B;  2GC7 A;  2PM9 A;  3V7D B;  5EAM A;  3JRP A;  2H13 A;  1RI6 A;  2XL2 A;  4XYI A;  4L3G D;  3HFQ A;  4H5I A;  3EWE A;  1GG2 B;  3V9F A;  4PBZ A;  4N14 A;  3OKT A;  2IUR A;  3DXK C;  5CYK B;  2J55 H;  2OIZ A;  1K8K C;  3DWL C;  4ES0 A;  1U2V C;  4MK0 B;  3SBP A;  2CE8 A;  3IJC A;  3SLE D;  5EMJ B;  5KDO B;  3PXS D;  4D6V A;  4A0B A;  3I7L A;  3K26 A;  5H17 A;  4J8B A;  4H5J A;  4QQE A;  3A0F A;  4GGA A;  2AGW A;  3AH8 B;  4J8G A;  4QL1 A;  3IKO A;  2P9P C;  5IT9 g;  2QXV A;  1P22 A;  1JJU B;  3AFC A;  5GXH A;  3IJ1 A;  2IWK A;  5EM2 A;  2CE9 A;  3PXT D;  4BUJ C;  3PSC B;  4J82 A;  5IJ8 E;  3DSM A;  3FRX A;  2TRC B;  3C5M A;  4ZOY A;  3MXX A;  5FKQ A;  3OKW A;  4GGC A;  4J0W A;  1SQ9 A;  2CNX A;  5IGO A;  2CN3 A;  3OL2 B;  5B4W A;  1N6D A;  3UVK A;  4A11 B;  2I0R A;  4JT5 C;  3BWS A;  4E54 A;  1A0R B;  2YNO A;  4FAN D;  3UVO A;  4Y7R A;  3RFG A;  4TZ4 A;  2B5M A;  4GM3 A;  3J81 g;  1S4U X;  3RN0 D;  3I7P A;  2H68 A;  4A08 A;  2IWF A;  3SBR A;  2OK4 A;  4GZ8 A;  2Z2N A;  3BG0 A;  3F3G A;  4K3I D;  4QRJ A;  5HE0 B;  3V5W B;  4R7A B;  4CY3 A;  3J80 g;  2OK6 A;  2HKM A;  2PM9 B;  5I5J A;  5FKR A;  1XKS A;  3P4F A;  2P9U C;  4FAV D;  3L4M D;  4JSV C;  3B7F A;  3MZL A;  2AQ5 A;  3ULE C;  2G99 A;  5GMK n;  2EBS A;  3CFV A;  2YB8 B;  2AGZ A;  3SHF A;  2CO0 A;  2O9K A;  3FGB A;  5AFU 3;  1MDA H;  2PBI B;  5CXB B;  3RLM D;  4O3U B;  1NEX B;  2AGX A;  2J56 H;  3FM0 A;  2P9S C;  4BH6 A;  3KRX B;  3EI2 A;  4JSP C;  3L4O D;  4CY1 A;  2YMU A;  3EI3 A;  4U7A A;  4A0B B;  3AL8 A;  2P9N C;  4GQ1 A;  2H9N A;  4X60 B;  4J0X A;  4A2M A;  2I0S A;  2B5L A;  4GGD A;  4ERY A;  3SFZ A;  5AJA A;  4CZY A;  3OKY A;  3EI4 B;  3KRW B;  3IIW A;  4JT6 C;  4PNK B;  4UI9 R;  3SVW D;  4O3T B;  2AH1 A;  5HE3 B;  4A09 A;  1B9Y A;  4EWR A;  2XL3 A;  5EMK B;  2OVQ B;  3PXW D;  4CI2 A;  4GM8 A;  5CXC A;  5H14 A;  3UKR C;  1XHM A;  3N0D A;  3CIK B;  1L0Q A;  5EMM B;  3SJL D;  4ERZ A;  1N6F A;  3CFS B;  4J79 A;  5TF2 A;  2IAA A;  4J78 A;  5HE2 B;  3OTT A;  4E54 B;  2B5N A;  5JWZ A;  2HKR A;  3OW8 A;  5AMS A;  2YNN A;  3AL9 A;  2HES X;  4E5Z B;  1R5M A;  1JMX B;  4BL0 A;  1TYQ C;  1SQJ A;  4O9D A;  4ERQ A;  4I79 A;  4X63 B;  4J77 A;  4J87 A;  2AH0 A;  5K19 A;  4A08 B;  1PI6 A;  4GQ2 P;  4CZX A;  2H14 A;  5EAL A;  2B4E A;  5CYK A;  3I7H A;  3SCY A;  3MMY A;  5C2W B;  2YBA A;  3I89 A;  4JXM A;  3IIY A;  4X61 B;  4PXW A;  5GXI A;  2I3S A;  3EI1 B;  3RMZ D;  3NVQ A;  3JZG A;  1Q47 A;  2J57 G;  4LG9 A;  2H6N A;  2Z2O A;  2H6Q A;  2PM6 B;  5TEE A;  5GSA A;  3UVN A;  4A7J A;  3RRM C;  2HXC A;  3DM0 A;  3MZK A;  3EI2 B;  1ERJ A;  3I8C A;  4Y5R D;  2H9P A;  2QC5 A;  3C99 A;  3JB9 L;  1VYH C;  3MKS B;  2H47 A;  4A0A A;  3JAM g;  3C75 H;  2AGL A;  2HYE A;  2I3T A;  3RSE C;  4J81 A;  5H1M A;  3UKU C;  4FA1 D;  3W15 A;  4KFM B;  4FA4 D;  2P9I C;  4NSX A;  4J73 A;  4FA5 D;  4L9O A;  3OKY B;  4LGN A;  2GC4 A;  1XIP A;  4PSW B;  3SXT D;  1OLZ A;  4A11 A;  5EAP A;  3GFC A;  2P9L C;  5C9Z B;  2I0T A;  2YNP A;  5CXC B;  3SMR A;  4AEZ A;  5HE1 B;  3PVU B;  1NR0 A;  3IJ0 A;  3SWS D;  2G9A A;  3K27 A;  3PE7 A;  2W18 A;  4CZV A;  2H3X A;  1GXR A;  1YFQ A;  4FWW A;  2BCJ B;  5EM2 B;  1SHY B;  5FKT A;  3I8E A;  3SBQ A;  4CC9 A;  4X3E A;  4LG8 A;  5THA A;  4A2L A;  4QT8 A;  4D0K A;  3UR4 A;  3UVM A;  3JZN A;  4XYH A;  4IMM A;  5CXB A;  5A2Q g;  4G56 B;  4CY5 A;  3I2N A;  4OZU A;  3ORV D;  5EAR A;  4GM9 A;  5HQG A;  4K3J B;  3NVX A;  3E0C A;  4PC0 A;  2CN2 A;  3VA6 A;  2HJB A;  2H6K A;  3SN6 B;  5I5M A;  4HDJ A;  5FXY A;  4ZOX A;  5HYN B;  5I5I A;  2IUV A;  4Z8L A;  3I7K A;  1K32 A;  3ZWL B;  5FA5 B;  5EML B;  4A0A B;  2CO0 C;  3EI4 A;  3JPX A;  4CY2 A;  5IGQ A;  3PSL A;  1GOT B;  3JRO A;  2BBK H;  4ESG A;  2XU7 A;  4PSX B;  4IA9 A;  2H9L A;  2PM7 B;  4J84 A;  1N6E A;  5FQD A;  5C2V B;  4FHL A;  4JD2 C;  2XYI A;  4YVD A;  3MKQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...