4XYHA

Wild-type full length mis16 in schizosaccharomyces japonicus
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
402
structure length
375
Chain Sequence
b'LSEVDLEKKIQEEYKLWKQNVPFLYDLVITEALEWPSLTVEWFPGSEDNSSIQKLLLGTQTSGNDQNYLQVASVQLPTLDIVQKIHHEGDVNKARFMPQNPDIIATLGLNGNGYIFDLNLYREQPIVQTGHQACLRHHTSEGFGLGWNFIQEGTLATGTEDTSICVWDIKGKSLSLEKSIDVAPVSVYHRHTAVVNDLQFHLQHEALLTSVSDDCTLQIHDTRLPSSSSASQCVKAHEQPVNGVAFNPFNDYLLATASADHTVALWDLRRLNQRLHTLEGHEDEVYNVQWSPHDEPILVTSSTDRRVCVWDLSKIGEEQTVEDSEDGAPELMFMHGGHTNRVSDLSWNPNNKWVLASLADDNILQIWSPSKVIWA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kinetochore protein Mis16
molecule tags Chaperone
source organism Schizosaccharomyces japonicus (strain yfs275 / fy16936)
publication title Mis16 Independently Recognizes Histone H4 and the CENP-ACnp1-Specific Chaperone Scm3sp.
pubmed doi rcsb
total genus 110
structure length 375
sequence length 402
ec nomenclature
pdb deposition date 2015-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF12265 CAF1C_H4-bd Histone-binding protein RBBP4 or subunit C of CAF1 complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4xyhA00
2YNOA 3PVWB 4A0BA 4JSXC 3MXXA 4J0WA 4FA5D 3DXMC 1N6FA 5K1CC 1PBYB 2QC5A 4BH6A 2H6QA 3RFHA 4IA9A 4A08B 3RMZD 3FGBA 2IUPA 4X60B 5CXCB 2IUQA 3NVXA 3RFGA 5SXMA 3ORVD 2CE8A 4PNKB 3RLMD 3JB9L 2H9PA 3EI4B 4QQEA 2AH1A 4JT5C 2G99A 4O3TB 2QXVA 4HDJA 5CXBA 3C99A 2IWFA 5FKTA 3P4FA 4FHLA 3I7HA 3SHFA 4K3ID 4CZXA 3VA6A 3OKYB 4IMMA 3SVWD 4J8BA 4QRJA 4QT8A 3JROA 2Q7QA 4E54B 2XYIA 4ZOZA 3SJLD 4A2LA 5FA5B 3EI4A 2B4EA 3SBRA 5A2Qg 4FA9D 1U2VC 4J81A 2GC4A 3C75H 4PBZA 2AGXA 2P9LC 2H9MA 2W18A 1SQJA 3EU7A 3B7FA 3SCYA 2H9NA 5K19A 4JXMA 2HJ4A 2Z2OA 4LGNA 3NVNA 1B9YA 2H3XA 1JOFA 3EWEA 3I7KA 4X3EA 4J87A 5FKRA 5THAA 3DM0A 4KFMB 2H6KA 4J84A 2GC7A 4MK0B 4A08A 2PM7B 3OKYA 5I5MA 1MG2A 1PI6A 4L1QD 5FKQA 4XEIC 3PSCB 3IJ0A 1ERJA 3I8CA 2AGLA 5AFU3 5TF2A 4BL0A 3DXKC 3BWSA 2HKRA 2CNXA 5IC7A 4TZ4A 2CO0A 4FA1D 2I3TA 4CI2A 2P9IC 5IGQA 4FWWA 3UVOA 3DSMA 2CN2A 2XL3A 4L3GD 3GFCA 3OL2B 4G56B 4CZYA 5TEFA 4ZOXA 1K32A 3SBQA 3JPXA 4H5JA 5I5IA 4ERZA 3U4YA 2GNQA 2HYEA 1OMWB 2UZXB 3I8EA 2P9UC 5C9ZB 2H47A 2J56H 5EMMB 3A0FA 3CIKB 4J0XA 4JSVC 2CE9A 2XU7A 3W15A 1QNIA 3N0EA 1PGUA 2I3SA 3AFCA 4N14A 5IJ7E 3EI1B 3VH0A 5TDHB 4OZUA 4ZOVA 2B5MA 5EALA 2H14A 2IAAA 5HE3B 3JZNA 4J86A 3OW8A 1K8KC 5EAMA 3F3PA 5AJAA 4CY2A 2IWKA 3V5WB 3AL8B 2OK4A 3L4OD 4XYHA 5GXHA 4O3UB 1PEVA 4J8GA 2P9NC 1JJUB 3NVQA 1GOTB 5HYNB 3I7PA 3IJ1A 4BUJC 3UR4A 1L0QA 4O1QD 4ERYA 4J82A 4I79A 2O9KA 3MKQA 4Y7RA 3SLED 4R7AB 3FRXA 3UVLA 1GXRA 2J57G 3EI3A 2I0SA 5EAPA 3UKRC 3KRWB 4ZN4A 4U7AA 3AL9A 5C2VB 3PXWD 4CI3A 4A11A 4FAVD 4E5ZB 3F3GA 3EMHA 3JZHA 5GSAA 1OLZA 3N0DA 4ES0A 1MG3A 4A0AB 4JT6C 1NEXB 3J80g 4O9DA 4Z8LA 3C9CA 4LG8A 3SN6B 1XHMA 5FXYA 3V7DB 3I7NA 2IURA 3E0CA 5I5JA 4GZ8A 3L4MD 5CYKB 4CI8A 5HE1B 4ERQA 3I7OA 2OK6A 3I2NA 4X61B 3IJCA 3OTTA 2AGYA 1A0RB 3DWLC 2Z2PA 4CC9A 1SQ9A 2YNPA 4L9OA 3JAMg 2PM9A 4A7JA 4PSXB 3AL8A 4FB1D 3MMYA 3PVUB 3EI3B 4GQ1A 2BCJB 4GM8A 2AGZA 5JWZA 3F3FA 2G9AA 2OIZA 2CO0C 5CXCA 4JSPC 2PM6B 3ZWLB 4O45A 3SFZA 2XL2A 3GREA 2YMUA 4GGCA 3EG6A 4PXWA 4H5IA 1S4UX 1JMZB 1R5MA 4GM3A 2HESX 2YBAA 5EMJB 3BG0A 4A0BB 2HJBA 4D6VA 2AQ5A 5CXBB 4GQBB 2P9KC 3PE7A 5H14A 5IT9g 5KDOB 5IGOA 1VYHC 2OVPB 2HXCA 5HE2B 2YB8B 3C5MA 4A0AA 2I0TA 4AEZA 3PSLA 1RI6A 5EMLB 1N6DA 4CI1A 1GP2B 4XYIA 2PM9B 5IJ8E 3J81g 1TYQC 3MZLA 3RN1D 3SBPA 5GXIA 1N6EA 4GMBA 4J77A 5TEEA 3VGZA 5CYKA 1SHYB 3IKOA 4QL1A 3EI1A 2HKMA 2UZYB 5GMKn 2I0RA 3JRPA 4FAND 4LG9A 3K26A 5FQDA 2PBIB 2AH0A 2H68A 5B4WA 4GGDA 1XKSA 5EARA 2Z2NA 4GM9A 3IIWA 4CY3A 4NSXA 2AGWA 4J79A 4K3JB 4A09B 5FKSA 1Q47A 3I89A 3CFVA 1B9XA 4ESGA 3RSEC 3MKSB 1GG2B 2EBSA 5EM2B 2B5LA 3EI2B 3UVKA 3BG1A 1XIPA 4J78A 2YNNA 4D0KA 4JD2C 2OVQB 3SWSD 3JZGA 5H17A 4J73A 3RRMC 4YVDA 3V9FA 2BBKH 2MTAH 3RN0D 3MZKA 2P9PC 2H13A 4U1EI 4A11B 3CFSB 2CN3A 4ZOYA 3HFQA 1FWXA 5FLXg 1JMXB 3ODTA 2IUVA 4GQ2P 2J55H 2H9LA 4PSWB 3AH8B 4AOWA 2B5NA 3FM0A 4PC0A 3ULEC 5C2WB 3I7LA 1MDAH 2TRCB 4CZVA 4L3HD 4CY5A 4JSNC 1NR0A 4UI9R 3OL2A 4E5ZA 3IIYA 4A09A 5H1MA 4EWRA 3PXSD 3SXTD 4Y5RD 5HE0B 5HQGA 4X63B 3UVMA 3KRXB 2OJYA 2OVRB 3SMRA 5AMSA 5EMKB 2H6NA 1P22A 4OWRA 4A2MA 1U4CA 3PXTD 4GGAA 3OKTA 3OKWA 1TBGA 3UKUC 4E54A 4FA4D 4PBYA 5EM2A 3EI2A 4CY1A 3K27A 3UVNA 1YFQA 2P9SC
chains in the Genus database with same CATH superfamily
4BCDA 2YNOA 3PVWB 2QZPA 5M5VA 4A0BA 4JSXC 3MXXA 3O4HA 4J0WA 4FA5D 3DXMC 1N6FA 5K1CC 3ZDXA 1PBYB 2QC5A 4BH6A 3V4PA 2H6QA 3RFHA 4G1MA 4IA9A 4A08B 3RMZD 3FGBA 2IUPA 4X60B 5CXCB 2IUQA 3NVXA 3RFGA 5SXMA 3ORVD 2CE8A 4PNKB 3RLMD 3JB9L 2H9PA 3EI4B 4QQEA 2AH1A 3FCUA 4JT5C 3K71A 2G99A 4O3TB 2QXVA 4HDJA 5CXBA 3C99A 2IWFA 5FKTA 4FHLA 3P4FA 1A12A 1VZ3A 3GC3B 3I7HA 3SHFA 1UTCA 4K3ID 4CZXA 3VA6A 3OKYB 4IMMA 3SVWD 4J8BA 4QRJA 4QT8A 1C9IA 3JROA 2Q7QA 1YR2A 4E54B 2XYIA 3ZE0A 4ZOZA 3SJLD 4A2LA 5FA5B 4BCBA 4RE5A 3EI4A 1GOGA 2B4EA 3SBRA 5A2Qg 4FA9D 1U2VC 4J81A 2GC4A 4WK0A 3C75H 3IUNA 4PBZA 2AGXA 2P9LC 2H9MA 2W18A 1SQJA 3EU7A 3B7FA 4IRZA 3O4IA 3SCYA 2H9NA 5K19A 4JXMA 3DDUA 2HJ4A 4WK4A 2Z2OA 4LGNA 3NVNA 1B9YA 2VDRA 2H3XA 1JOFA 3EWEA 3IVMA 3I7KA 2WQ8A 3EQ7A 5M5RA 4X3EA 3ZDZA 4J87A 5FKRA 5THAA 3DM0A 3VI3A 4KFMB 2H6KA 4J84A 2GC7A 4MK0B 4A08A 2PM7B 3OKYA 5I5MA 5C92A 1MG2A 1PI6A 4L1QD 5FKQA 4XEIC 3MUNA 3PSCB 3IJ0A 1BPOA 1ERJA 3I8CA 4BP8A 2AGLA 5AFU3 5TF2A 4BL0A 3DXKC 1JTDB 3BWSA 2HKRA 2CNXA 5IC7A 4TZ4A 4MMZA 2CO0A 4FA1D 2I3TA 4CI2A 2HU5A 2P9IC 5IGQA 5FFGA 1UOQA 4FWWA 3UVOA 3DSMA 2CN2A 2EIEA 2XL3A 3IURA 3GFCA 3OL2B 4G56B 4L3GD 4CZYA 5TEFA 4ZOXA 1K32A 3SBQA 3JPXA 4H5JA 5I5IA 4ERZA 3U4YA 2GNQA 2HYEA 1M1XA 2XE4A 1OMWB 2UZXB 2VZ3A 3I8EA 3NIDA 2P9UC 1GOFA 5C9ZB 2H47A 5HDBA 2J56H 5EMMB 3A0FA 3CIKB 4J0XA 4JSVC 1GOHA 2CE9A 2XU7A 1H2XA 4UM8A 1QNIA 3N0EA 3W15A 1PGUA 2I3SA 3AFCA 4N14A 5IJ7E 3VI4A 3EI1B 3VH0A 5TDHB 4OZUA 4ZOVA 2B5MA 1QFSA 5EALA 2H14A 2IAAA 4JHPC 5HE3B 3JZNA 4J86A 4JHNA 3OW8A 4NC4A 1K8KC 5EAMA 3F3PA 5AJAA 4CY2A 2IWKA 3IUQA 3AL8B 3V5WB 2OK4A 3L4OD 4XYHA 5GXHA 4O3UB 1T2XA 1PEVA 4J8GA 2P9NC 1JJUB 3NVQA 1GOTB 5HYNB 3I7PA 3IJ1A 4BUJC 3UR4A 1L0QA 4O1QD 3O4JA 4L1MA 4ERYA 2JKXA 4J82A 3QI0A 4I79A 2O9KA 3MKQA 4MMXA 4Y7RA 3SLED 4R7AB 5M5TA 4QAMA 4AMZA 3FRXA 3OF7A 1GXRA 2J57G 3EI3A 3UVLA 2I0SA 5EAPA 3UKRC 2EICA 3KRWB 4ZN4A 3FCSA 4U7AA 3AL9A 5C2VB 1UOPA 3PXWD 1H2WA 4CI3A 4A11A 4FAVD 1JV2A 4E5ZB 3F3GA 3EMHA 3JZHA 5GSAA 1U8CA 1OLZA 3N0DA 4ES0A 1MG3A 4A0AB 4JT6C 2VZ1A 4G55A 1NEXB 3J80g 1L5GA 4O9DA 4Z8LA 4WJKA 3C9CA 4LG8A 2VDLA 3SN6B 1E8NA 1XHMA 5FXYA 3V7DB 3I7NA 2IURA 5M61A 4NAAA 3E0CA 5I5JA 1H2YA 4GZ8A 3L4MD 5CYKB 4CI8A 5HE1B 4AN1A 1UOOA 4ERQA 3I7OA 2OK6A 3I2NA 4X61B 3IJCA 1O6FA 3OTTA 2AGYA 1A0RB 3DWLC 2Z2PA 4CC9A 1SQ9A 2YNPA 4L9OA 3JAMg 1TYEA 2PM9A 4A7JA 1K3IA 4PSXB 3AL8A 1O6GA 4FB1D 3MMYA 3PVUB 3EI3B 3O4GA 4GQ1A 2BCJB 3T3MA 4GM8A 2AGZA 5JWZA 3K6SA 3F3FA 1QFMA 2G9AA 4AX4A 2OIZA 2CO0C 5CXCA 4JSPC 2PM6B 3ZWLB 4O45A 3SFZA 2XL2A 2BKLA 2YMUA 3GREA 4GGCA 3EG6A 4PXWA 4BCCA 4H5IA 1S4UX 1JMZB 1R5MA 4GM3A 1E5TA 2HESX 2YBAA 5EMJB 2HU8A 3BG0A 4D9SA 4A0BB 2HJBA 4D6VA 2AQ5A 5CXBB 3IUMA 4GQBB 2P9KC 3PE7A 5H14A 5IT9g 5KDOB 5IGOA 1VYHC 2OVPB 2HXCA 5HE2B 2YB8B 3C5MA 4A0AA 2I0TA 4AEZA 2QR5A 1RI6A 2EIDA 3PSLA 4DNWA 5EMLB 1N6DA 2VDPA 4CI1A 1GP2B 4XYIA 2PM9B 5IJ8E 3J81g 1TYQC 2VDKA 3MZLA 3RN1D 3SBPA 2VC2A 5E6RA 5GXIA 1N6EA 4GMBA 4J77A 5TEEA 3VGZA 5CYKA 1SHYB 3IKOA 3IUJA 1VE6A 4QL1A 3EI1A 4Z7NA 2HKMA 2UZYB 5GMKn 2I0RA 3KCIA 3JRPA 4BP9A 4FAND 4LG9A 3K72A 3K26A 5FQDA 4NBMA 2PBIB 2AH0A 2H68A 5B4WA 4GGDA 1XKSA 5EARA 2Z2NA 4GM9A 3IIWA 4CY3A 4NSXA 2AGWA 1VE7A 4J79A 4K3JB 5C86A 2EIBA 4AMYA 3ZE1A 4A09B 3NIFA 5FKSA 1Q47A 3I89A 3CFVA 1B9XA 1C9LA 4MMYA 5E6SA 4ESGA 5M5SA 2VDNA 3RSEC 3MKSB 1GG2B 4DNVA 2EBSA 5EM2B 2B5LA 3EI2B 3UVKA 3BG1A 4AN0A 1XIPA 4J78A 2YNNA 4D0KA 4JD2C 2OVQB 3SWSD 3JZGA 5M5UA 5H17A 4J73A 3RRMC 4YVDA 3V9FA 2BBKH 2MTAH 3RN0D 2VDMA 3MZKA 2P9PC 2H13A 4Z7OA 4U1EI 4A11B 3CFSB 2CN3A 4ZOYA 3ZE2A 3HFQA 4O2WA 1FWXA 3V4VA 5FLXg 1JMXB 3EQ9A 3IULA 3ODTA 2IUVA 3MUOA 4GQ2P 4O02A 2J55H 2H9LA 4PSWB 3AH8B 4AOWA 2B5NA 4G1EA 3FM0A 4PC0A 3ULEC 5C2WB 3I7LA 1MDAH 2TRCB 4CZVA 4L3HD 4CY5A 4JSNC 4UM9A 1NR0A 4UI9R 3OL2A 2VDQA 4E5ZA 3IIYA 4A09A 4NENA 5E6UA 1H2ZA 5H1MA 5FFOA 4DNUA 4EWRA 3GD1I 3PXSD 3SXTD 3QHYB 1VZ2A 4WK2A 2VDOA 4Y5RD 5HE0B 1I2MB 5HQGA 4X63B 3UVMA 3KRXB 2OJYA 2OVRB 3IJEA 4RE6A 3SMRA 5AMSA 5EMKB 3T3PA 3NIGA 2H6NA 1P22A 2HU7A 2XDWA 4OWRA 1U4CA 4A2MA 3MVDK 3PXTD 3EQ8A 3OKTA 3OKWA 4GGAA 1TBGA 3ZDYA 3UKUC 4E54A 4Z7QA 4FA4D 4PBYA 5EM2A 3EI2A 1E8MA 4CY1A 3K27A 3UVNA 1YFQA 2XZGA 2P9SC
chains in the Genus database with same CATH topology
2YNOA 3PVWB 4A0BA 4JSXC 3MXXA 4J0WA 4FA5D 3DXMC 1N6FA 5K1CC 1PBYB 2QC5A 4BH6A 2H6QA 3RFHA 4IA9A 4A08B 3RMZD 3FGBA 2IUPA 4X60B 5CXCB 2IUQA 3NVXA 3RFGA 5SXMA 3ORVD 2CE8A 4PNKB 3RLMD 3JB9L 2H9PA 3EI4B 4QQEA 2AH1A 4JT5C 2G99A 4O3TB 2QXVA 4HDJA 5CXBA 3C99A 2IWFA 5FKTA 3P4FA 4FHLA 3I7HA 3SHFA 4K3ID 4CZXA 3VA6A 3OKYB 4IMMA 3SVWD 4J8BA 4QRJA 4QT8A 3JROA 2Q7QA 4E54B 2XYIA 4ZOZA 3SJLD 4A2LA 5FA5B 3EI4A 2B4EA 3SBRA 5A2Qg 4FA9D 1U2VC 4J81A 2GC4A 3C75H 4PBZA 2AGXA 2P9LC 2H9MA 2W18A 1SQJA 3EU7A 3B7FA 3SCYA 2H9NA 5K19A 4JXMA 2HJ4A 2Z2OA 4LGNA 3NVNA 1B9YA 2H3XA 1JOFA 3EWEA 3I7KA 4X3EA 4J87A 5FKRA 5THAA 3DM0A 4KFMB 2H6KA 4J84A 2GC7A 4MK0B 4A08A 2PM7B 3OKYA 5I5MA 1MG2A 1PI6A 4L1QD 5FKQA 4XEIC 3PSCB 3IJ0A 1ERJA 3I8CA 2AGLA 5AFU3 5TF2A 4BL0A 3DXKC 3BWSA 2HKRA 2CNXA 5IC7A 4TZ4A 2CO0A 4FA1D 2I3TA 4CI2A 2P9IC 5IGQA 4FWWA 3UVOA 3DSMA 2CN2A 2XL3A 4L3GD 3GFCA 3OL2B 4G56B 4CZYA 5TEFA 4ZOXA 1K32A 3SBQA 3JPXA 4H5JA 5I5IA 4ERZA 3U4YA 2GNQA 2HYEA 1OMWB 2UZXB 3I8EA 2P9UC 5C9ZB 2H47A 2J56H 5EMMB 3A0FA 3CIKB 4J0XA 4JSVC 2CE9A 2XU7A 3W15A 1QNIA 3N0EA 1PGUA 2I3SA 3AFCA 4N14A 5IJ7E 3EI1B 3VH0A 5TDHB 4OZUA 4ZOVA 2B5MA 5EALA 2H14A 2IAAA 5HE3B 3JZNA 4J86A 3OW8A 1K8KC 5EAMA 3F3PA 5AJAA 4CY2A 2IWKA 3V5WB 3AL8B 2OK4A 3L4OD 4XYHA 5GXHA 4O3UB 1PEVA 4J8GA 2P9NC 1JJUB 3NVQA 1GOTB 5HYNB 3I7PA 3IJ1A 4BUJC 3UR4A 1L0QA 4O1QD 4ERYA 4J82A 4I79A 2O9KA 3MKQA 4Y7RA 3SLED 4R7AB 3FRXA 3UVLA 1GXRA 2J57G 3EI3A 2I0SA 5EAPA 3UKRC 3KRWB 4ZN4A 4U7AA 3AL9A 5C2VB 3PXWD 4CI3A 4A11A 4FAVD 4E5ZB 3F3GA 3EMHA 3JZHA 5GSAA 1OLZA 3N0DA 4ES0A 1MG3A 4A0AB 4JT6C 1NEXB 3J80g 4O9DA 4Z8LA 3C9CA 4LG8A 3SN6B 1XHMA 5FXYA 3V7DB 3I7NA 2IURA 3E0CA 5I5JA 4GZ8A 3L4MD 5CYKB 4CI8A 5HE1B 4ERQA 3I7OA 2OK6A 3I2NA 4X61B 3IJCA 3OTTA 2AGYA 1A0RB 3DWLC 2Z2PA 4CC9A 1SQ9A 2YNPA 4L9OA 3JAMg 2PM9A 4A7JA 4PSXB 3AL8A 4FB1D 3MMYA 3PVUB 3EI3B 4GQ1A 2BCJB 4GM8A 2AGZA 5JWZA 3F3FA 2G9AA 2OIZA 2CO0C 5CXCA 4JSPC 2PM6B 3ZWLB 4O45A 3SFZA 2XL2A 3GREA 2YMUA 4GGCA 3EG6A 4PXWA 4H5IA 1S4UX 1JMZB 1R5MA 4GM3A 2HESX 2YBAA 5EMJB 3BG0A 4A0BB 2HJBA 4D6VA 2AQ5A 5CXBB 4GQBB 2P9KC 3PE7A 5H14A 5IT9g 5KDOB 5IGOA 1VYHC 2OVPB 2HXCA 5HE2B 2YB8B 3C5MA 4A0AA 2I0TA 4AEZA 3PSLA 1RI6A 5EMLB 1N6DA 4CI1A 1GP2B 4XYIA 2PM9B 5IJ8E 3J81g 1TYQC 3MZLA 3RN1D 3SBPA 5GXIA 1N6EA 4GMBA 4J77A 5TEEA 3VGZA 5CYKA 1SHYB 3IKOA 4QL1A 3EI1A 2HKMA 2UZYB 5GMKn 2I0RA 3JRPA 4FAND 4LG9A 3K26A 5FQDA 2PBIB 2AH0A 2H68A 5B4WA 4GGDA 1XKSA 5EARA 2Z2NA 4GM9A 3IIWA 4CY3A 4NSXA 2AGWA 4J79A 4K3JB 4A09B 5FKSA 1Q47A 3I89A 3CFVA 1B9XA 4ESGA 3RSEC 3MKSB 1GG2B 2EBSA 5EM2B 2B5LA 3EI2B 3UVKA 3BG1A 1XIPA 4J78A 2YNNA 4D0KA 4JD2C 2OVQB 3SWSD 3JZGA 5H17A 4J73A 3RRMC 4YVDA 3V9FA 2BBKH 2MTAH 3RN0D 3MZKA 2P9PC 2H13A 4U1EI 4A11B 3CFSB 2CN3A 4ZOYA 3HFQA 1FWXA 5FLXg 1JMXB 3ODTA 2IUVA 4GQ2P 2J55H 2H9LA 4PSWB 3AH8B 4AOWA 2B5NA 3FM0A 4PC0A 3ULEC 5C2WB 3I7LA 1MDAH 2TRCB 4CZVA 4L3HD 4CY5A 4JSNC 1NR0A 4UI9R 3OL2A 4E5ZA 3IIYA 4A09A 5H1MA 4EWRA 3PXSD 3SXTD 4Y5RD 5HE0B 5HQGA 4X63B 3UVMA 3KRXB 2OJYA 2OVRB 3SMRA 5AMSA 5EMKB 2H6NA 1P22A 4OWRA 4A2MA 1U4CA 3PXTD 4GGAA 3OKTA 3OKWA 1TBGA 3UKUC 4E54A 4FA4D 4PBYA 5EM2A 3EI2A 4CY1A 3K27A 3UVNA 1YFQA 2P9SC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YNO A;  3PVW B;  4A0B A;  4JSX C;  3MXX A;  4J0W A;  4FA5 D;  3DXM C;  1N6F A;  5K1C C;  1PBY B;  2QC5 A;  4BH6 A;  2H6Q A;  3RFH A;  4IA9 A;  4A08 B;  3RMZ D;  3FGB A;  2IUP A;  4X60 B;  5CXC B;  2IUQ A;  3NVX A;  3RFG A;  5SXM A;  3ORV D;  2CE8 A;  4PNK B;  3RLM D;  3JB9 L;  2H9P A;  3EI4 B;  4QQE A;  2AH1 A;  4JT5 C;  2G99 A;  4O3T B;  2QXV A;  4HDJ A;  5CXB A;  3C99 A;  2IWF A;  5FKT A;  3P4F A;  4FHL A;  3I7H A;  3SHF A;  4K3I D;  4CZX A;  3VA6 A;  3OKY B;  4IMM A;  3SVW D;  4J8B A;  4QRJ A;  4QT8 A;  3JRO A;  2Q7Q A;  4E54 B;  2XYI A;  4ZOZ A;  3SJL D;  4A2L A;  5FA5 B;  3EI4 A;  2B4E A;  3SBR A;  5A2Q g;  4FA9 D;  1U2V C;  4J81 A;  2GC4 A;  3C75 H;  4PBZ A;  2AGX A;  2P9L C;  2H9M A;  2W18 A;  1SQJ A;  3EU7 A;  3B7F A;  3SCY A;  2H9N A;  5K19 A;  4JXM A;  2HJ4 A;  2Z2O A;  4LGN A;  3NVN A;  1B9Y A;  2H3X A;  1JOF A;  3EWE A;  3I7K A;  4X3E A;  4J87 A;  5FKR A;  5THA A;  3DM0 A;  4KFM B;  2H6K A;  4J84 A;  2GC7 A;  4MK0 B;  4A08 A;  2PM7 B;  3OKY A;  5I5M A;  1MG2 A;  1PI6 A;  4L1Q D;  5FKQ A;  4XEI C;  3PSC B;  3IJ0 A;  1ERJ A;  3I8C A;  2AGL A;  5AFU 3;  5TF2 A;  4BL0 A;  3DXK C;  3BWS A;  2HKR A;  2CNX A;  5IC7 A;  4TZ4 A;  2CO0 A;  4FA1 D;  2I3T A;  4CI2 A;  2P9I C;  5IGQ A;  4FWW A;  3UVO A;  3DSM A;  2CN2 A;  2XL3 A;  4L3G D;  3GFC A;  3OL2 B;  4G56 B;  4CZY A;  5TEF A;  4ZOX A;  1K32 A;  3SBQ A;  3JPX A;  4H5J A;  5I5I A;  4ERZ A;  3U4Y A;  2GNQ A;  2HYE A;  1OMW B;  2UZX B;  3I8E A;  2P9U C;  5C9Z B;  2H47 A;  2J56 H;  5EMM B;  3A0F A;  3CIK B;  4J0X A;  4JSV C;  2CE9 A;  2XU7 A;  3W15 A;  1QNI A;  3N0E A;  1PGU A;  2I3S A;  3AFC A;  4N14 A;  5IJ7 E;  3EI1 B;  3VH0 A;  5TDH B;  4OZU A;  4ZOV A;  2B5M A;  5EAL A;  2H14 A;  2IAA A;  5HE3 B;  3JZN A;  4J86 A;  3OW8 A;  1K8K C;  5EAM A;  3F3P A;  5AJA A;  4CY2 A;  2IWK A;  3V5W B;  3AL8 B;  2OK4 A;  3L4O D;  4XYH A;  5GXH A;  4O3U B;  1PEV A;  4J8G A;  2P9N C;  1JJU B;  3NVQ A;  1GOT B;  5HYN B;  3I7P A;  3IJ1 A;  4BUJ C;  3UR4 A;  1L0Q A;  4O1Q D;  4ERY A;  4J82 A;  4I79 A;  2O9K A;  3MKQ A;  4Y7R A;  3SLE D;  4R7A B;  3FRX A;  3UVL A;  1GXR A;  2J57 G;  3EI3 A;  2I0S A;  5EAP A;  3UKR C;  3KRW B;  4ZN4 A;  4U7A A;  3AL9 A;  5C2V B;  3PXW D;  4CI3 A;  4A11 A;  4FAV D;  4E5Z B;  3F3G A;  3EMH A;  3JZH A;  5GSA A;  1OLZ A;  3N0D A;  4ES0 A;  1MG3 A;  4A0A B;  4JT6 C;  1NEX B;  3J80 g;  4O9D A;  4Z8L A;  3C9C A;  4LG8 A;  3SN6 B;  1XHM A;  5FXY A;  3V7D B;  3I7N A;  2IUR A;  3E0C A;  5I5J A;  4GZ8 A;  3L4M D;  5CYK B;  4CI8 A;  5HE1 B;  4ERQ A;  3I7O A;  2OK6 A;  3I2N A;  4X61 B;  3IJC A;  3OTT A;  2AGY A;  1A0R B;  3DWL C;  2Z2P A;  4CC9 A;  1SQ9 A;  2YNP A;  4L9O A;  3JAM g;  2PM9 A;  4A7J A;  4PSX B;  3AL8 A;  4FB1 D;  3MMY A;  3PVU B;  3EI3 B;  4GQ1 A;  2BCJ B;  4GM8 A;  2AGZ A;  5JWZ A;  3F3F A;  2G9A A;  2OIZ A;  2CO0 C;  5CXC A;  4JSP C;  2PM6 B;  3ZWL B;  4O45 A;  3SFZ A;  2XL2 A;  3GRE A;  2YMU A;  4GGC A;  3EG6 A;  4PXW A;  4H5I A;  1S4U X;  1JMZ B;  1R5M A;  4GM3 A;  2HES X;  2YBA A;  5EMJ B;  3BG0 A;  4A0B B;  2HJB A;  4D6V A;  2AQ5 A;  5CXB B;  4GQB B;  2P9K C;  3PE7 A;  5H14 A;  5IT9 g;  5KDO B;  5IGO A;  1VYH C;  2OVP B;  2HXC A;  5HE2 B;  2YB8 B;  3C5M A;  4A0A A;  2I0T A;  4AEZ A;  3PSL A;  1RI6 A;  5EML B;  1N6D A;  4CI1 A;  1GP2 B;  4XYI A;  2PM9 B;  5IJ8 E;  3J81 g;  1TYQ C;  3MZL A;  3RN1 D;  3SBP A;  5GXI A;  1N6E A;  4GMB A;  4J77 A;  5TEE A;  3VGZ A;  5CYK A;  1SHY B;  3IKO A;  4QL1 A;  3EI1 A;  2HKM A;  2UZY B;  5GMK n;  2I0R A;  3JRP A;  4FAN D;  4LG9 A;  3K26 A;  5FQD A;  2PBI B;  2AH0 A;  2H68 A;  5B4W A;  4GGD A;  1XKS A;  5EAR A;  2Z2N A;  4GM9 A;  3IIW A;  4CY3 A;  4NSX A;  2AGW A;  4J79 A;  4K3J B;  4A09 B;  5FKS A;  1Q47 A;  3I89 A;  3CFV A;  1B9X A;  4ESG A;  3RSE C;  3MKS B;  1GG2 B;  2EBS A;  5EM2 B;  2B5L A;  3EI2 B;  3UVK A;  3BG1 A;  1XIP A;  4J78 A;  2YNN A;  4D0K A;  4JD2 C;  2OVQ B;  3SWS D;  3JZG A;  5H17 A;  4J73 A;  3RRM C;  4YVD A;  3V9F A;  2BBK H;  2MTA H;  3RN0 D;  3MZK A;  2P9P C;  2H13 A;  4U1E I;  4A11 B;  3CFS B;  2CN3 A;  4ZOY A;  3HFQ A;  1FWX A;  5FLX g;  1JMX B;  3ODT A;  2IUV A;  4GQ2 P;  2J55 H;  2H9L A;  4PSW B;  3AH8 B;  4AOW A;  2B5N A;  3FM0 A;  4PC0 A;  3ULE C;  5C2W B;  3I7L A;  1MDA H;  2TRC B;  4CZV A;  4L3H D;  4CY5 A;  4JSN C;  1NR0 A;  4UI9 R;  3OL2 A;  4E5Z A;  3IIY A;  4A09 A;  5H1M A;  4EWR A;  3PXS D;  3SXT D;  4Y5R D;  5HE0 B;  5HQG A;  4X63 B;  3UVM A;  3KRX B;  2OJY A;  2OVR B;  3SMR A;  5AMS A;  5EMK B;  2H6N A;  1P22 A;  4OWR A;  4A2M A;  1U4C A;  3PXT D;  4GGA A;  3OKT A;  3OKW A;  1TBG A;  3UKU C;  4E54 A;  4FA4 D;  4PBY A;  5EM2 A;  3EI2 A;  4CY1 A;  3K27 A;  3UVN A;  1YFQ A;  2P9S C; 
#chains in the Genus database with same CATH topology
 4BCD A;  2YNO A;  3PVW B;  2QZP A;  5M5V A;  4A0B A;  4JSX C;  3MXX A;  3O4H A;  4J0W A;  4FA5 D;  3DXM C;  1N6F A;  5K1C C;  3ZDX A;  1PBY B;  2QC5 A;  4BH6 A;  3V4P A;  2H6Q A;  3RFH A;  4G1M A;  4IA9 A;  4A08 B;  3RMZ D;  3FGB A;  2IUP A;  4X60 B;  5CXC B;  2IUQ A;  3NVX A;  3RFG A;  5SXM A;  3ORV D;  2CE8 A;  4PNK B;  3RLM D;  3JB9 L;  2H9P A;  3EI4 B;  4QQE A;  2AH1 A;  3FCU A;  4JT5 C;  3K71 A;  2G99 A;  4O3T B;  2QXV A;  4HDJ A;  5CXB A;  3C99 A;  2IWF A;  5FKT A;  4FHL A;  3P4F A;  1A12 A;  1VZ3 A;  3GC3 B;  3I7H A;  3SHF A;  1UTC A;  4K3I D;  4CZX A;  3VA6 A;  3OKY B;  4IMM A;  3SVW D;  4J8B A;  4QRJ A;  4QT8 A;  1C9I A;  3JRO A;  2Q7Q A;  1YR2 A;  4E54 B;  2XYI A;  3ZE0 A;  4ZOZ A;  3SJL D;  4A2L A;  5FA5 B;  4BCB A;  4RE5 A;  3EI4 A;  1GOG A;  2B4E A;  3SBR A;  5A2Q g;  4FA9 D;  1U2V C;  4J81 A;  2GC4 A;  4WK0 A;  3C75 H;  3IUN A;  4PBZ A;  2AGX A;  2P9L C;  2H9M A;  2W18 A;  1SQJ A;  3EU7 A;  3B7F A;  4IRZ A;  3O4I A;  3SCY A;  2H9N A;  5K19 A;  4JXM A;  3DDU A;  2HJ4 A;  4WK4 A;  2Z2O A;  4LGN A;  3NVN A;  1B9Y A;  2VDR A;  2H3X A;  1JOF A;  3EWE A;  3IVM A;  3I7K A;  2WQ8 A;  3EQ7 A;  5M5R A;  4X3E A;  3ZDZ A;  4J87 A;  5FKR A;  5THA A;  3DM0 A;  3VI3 A;  4KFM B;  2H6K A;  4J84 A;  2GC7 A;  4MK0 B;  4A08 A;  2PM7 B;  3OKY A;  5I5M A;  5C92 A;  1MG2 A;  1PI6 A;  4L1Q D;  5FKQ A;  4XEI C;  3MUN A;  3PSC B;  3IJ0 A;  1BPO A;  1ERJ A;  3I8C A;  4BP8 A;  2AGL A;  5AFU 3;  5TF2 A;  4BL0 A;  3DXK C;  1JTD B;  3BWS A;  2HKR A;  2CNX A;  5IC7 A;  4TZ4 A;  4MMZ A;  2CO0 A;  4FA1 D;  2I3T A;  4CI2 A;  2HU5 A;  2P9I C;  5IGQ A;  5FFG A;  1UOQ A;  4FWW A;  3UVO A;  3DSM A;  2CN2 A;  2EIE A;  2XL3 A;  3IUR A;  3GFC A;  3OL2 B;  4G56 B;  4L3G D;  4CZY A;  5TEF A;  4ZOX A;  1K32 A;  3SBQ A;  3JPX A;  4H5J A;  5I5I A;  4ERZ A;  3U4Y A;  2GNQ A;  2HYE A;  1M1X A;  2XE4 A;  1OMW B;  2UZX B;  2VZ3 A;  3I8E A;  3NID A;  2P9U C;  1GOF A;  5C9Z B;  2H47 A;  5HDB A;  2J56 H;  5EMM B;  3A0F A;  3CIK B;  4J0X A;  4JSV C;  1GOH A;  2CE9 A;  2XU7 A;  1H2X A;  4UM8 A;  1QNI A;  3N0E A;  3W15 A;  1PGU A;  2I3S A;  3AFC A;  4N14 A;  5IJ7 E;  3VI4 A;  3EI1 B;  3VH0 A;  5TDH B;  4OZU A;  4ZOV A;  2B5M A;  1QFS A;  5EAL A;  2H14 A;  2IAA A;  4JHP C;  5HE3 B;  3JZN A;  4J86 A;  4JHN A;  3OW8 A;  4NC4 A;  1K8K C;  5EAM A;  3F3P A;  5AJA A;  4CY2 A;  2IWK A;  3IUQ A;  3AL8 B;  3V5W B;  2OK4 A;  3L4O D;  4XYH A;  5GXH A;  4O3U B;  1T2X A;  1PEV A;  4J8G A;  2P9N C;  1JJU B;  3NVQ A;  1GOT B;  5HYN B;  3I7P A;  3IJ1 A;  4BUJ C;  3UR4 A;  1L0Q A;  4O1Q D;  3O4J A;  4L1M A;  4ERY A;  2JKX A;  4J82 A;  3QI0 A;  4I79 A;  2O9K A;  3MKQ A;  4MMX A;  4Y7R A;  3SLE D;  4R7A B;  5M5T A;  4QAM A;  4AMZ A;  3FRX A;  3OF7 A;  1GXR A;  2J57 G;  3EI3 A;  3UVL A;  2I0S A;  5EAP A;  3UKR C;  2EIC A;  3KRW B;  4ZN4 A;  3FCS A;  4U7A A;  3AL9 A;  5C2V B;  1UOP A;  3PXW D;  1H2W A;  4CI3 A;  4A11 A;  4FAV D;  1JV2 A;  4E5Z B;  3F3G A;  3EMH A;  3JZH A;  5GSA A;  1U8C A;  1OLZ A;  3N0D A;  4ES0 A;  1MG3 A;  4A0A B;  4JT6 C;  2VZ1 A;  4G55 A;  1NEX B;  3J80 g;  1L5G A;  4O9D A;  4Z8L A;  4WJK A;  3C9C A;  4LG8 A;  2VDL A;  3SN6 B;  1E8N A;  1XHM A;  5FXY A;  3V7D B;  3I7N A;  2IUR A;  5M61 A;  4NAA A;  3E0C A;  5I5J A;  1H2Y A;  4GZ8 A;  3L4M D;  5CYK B;  4CI8 A;  5HE1 B;  4AN1 A;  1UOO A;  4ERQ A;  3I7O A;  2OK6 A;  3I2N A;  4X61 B;  3IJC A;  1O6F A;  3OTT A;  2AGY A;  1A0R B;  3DWL C;  2Z2P A;  4CC9 A;  1SQ9 A;  2YNP A;  4L9O A;  3JAM g;  1TYE A;  2PM9 A;  4A7J A;  1K3I A;  4PSX B;  3AL8 A;  1O6G A;  4FB1 D;  3MMY A;  3PVU B;  3EI3 B;  3O4G A;  4GQ1 A;  2BCJ B;  3T3M A;  4GM8 A;  2AGZ A;  5JWZ A;  3K6S A;  3F3F A;  1QFM A;  2G9A A;  4AX4 A;  2OIZ A;  2CO0 C;  5CXC A;  4JSP C;  2PM6 B;  3ZWL B;  4O45 A;  3SFZ A;  2XL2 A;  2BKL A;  2YMU A;  3GRE A;  4GGC A;  3EG6 A;  4PXW A;  4BCC A;  4H5I A;  1S4U X;  1JMZ B;  1R5M A;  4GM3 A;  1E5T A;  2HES X;  2YBA A;  5EMJ B;  2HU8 A;  3BG0 A;  4D9S A;  4A0B B;  2HJB A;  4D6V A;  2AQ5 A;  5CXB B;  3IUM A;  4GQB B;  2P9K C;  3PE7 A;  5H14 A;  5IT9 g;  5KDO B;  5IGO A;  1VYH C;  2OVP B;  2HXC A;  5HE2 B;  2YB8 B;  3C5M A;  4A0A A;  2I0T A;  4AEZ A;  2QR5 A;  1RI6 A;  2EID A;  3PSL A;  4DNW A;  5EML B;  1N6D A;  2VDP A;  4CI1 A;  1GP2 B;  4XYI A;  2PM9 B;  5IJ8 E;  3J81 g;  1TYQ C;  2VDK A;  3MZL A;  3RN1 D;  3SBP A;  2VC2 A;  5E6R A;  5GXI A;  1N6E A;  4GMB A;  4J77 A;  5TEE A;  3VGZ A;  5CYK A;  1SHY B;  3IKO A;  3IUJ A;  1VE6 A;  4QL1 A;  3EI1 A;  4Z7N A;  2HKM A;  2UZY B;  5GMK n;  2I0R A;  3KCI A;  3JRP A;  4BP9 A;  4FAN D;  4LG9 A;  3K72 A;  3K26 A;  5FQD A;  4NBM A;  2PBI B;  2AH0 A;  2H68 A;  5B4W A;  4GGD A;  1XKS A;  5EAR A;  2Z2N A;  4GM9 A;  3IIW A;  4CY3 A;  4NSX A;  2AGW A;  1VE7 A;  4J79 A;  4K3J B;  5C86 A;  2EIB A;  4AMY A;  3ZE1 A;  4A09 B;  3NIF A;  5FKS A;  1Q47 A;  3I89 A;  3CFV A;  1B9X A;  1C9L A;  4MMY A;  5E6S A;  4ESG A;  5M5S A;  2VDN A;  3RSE C;  3MKS B;  1GG2 B;  4DNV A;  2EBS A;  5EM2 B;  2B5L A;  3EI2 B;  3UVK A;  3BG1 A;  4AN0 A;  1XIP A;  4J78 A;  2YNN A;  4D0K A;  4JD2 C;  2OVQ B;  3SWS D;  3JZG A;  5M5U A;  5H17 A;  4J73 A;  3RRM C;  4YVD A;  3V9F A;  2BBK H;  2MTA H;  3RN0 D;  2VDM A;  3MZK A;  2P9P C;  2H13 A;  4Z7O A;  4U1E I;  4A11 B;  3CFS B;  2CN3 A;  4ZOY A;  3ZE2 A;  3HFQ A;  4O2W A;  1FWX A;  3V4V A;  5FLX g;  1JMX B;  3EQ9 A;  3IUL A;  3ODT A;  2IUV A;  3MUO A;  4GQ2 P;  4O02 A;  2J55 H;  2H9L A;  4PSW B;  3AH8 B;  4AOW A;  2B5N A;  4G1E A;  3FM0 A;  4PC0 A;  3ULE C;  5C2W B;  3I7L A;  1MDA H;  2TRC B;  4CZV A;  4L3H D;  4CY5 A;  4JSN C;  4UM9 A;  1NR0 A;  4UI9 R;  3OL2 A;  2VDQ A;  4E5Z A;  3IIY A;  4A09 A;  4NEN A;  5E6U A;  1H2Z A;  5H1M A;  5FFO A;  4DNU A;  4EWR A;  3GD1 I;  3PXS D;  3SXT D;  3QHY B;  1VZ2 A;  4WK2 A;  2VDO A;  4Y5R D;  5HE0 B;  1I2M B;  5HQG A;  4X63 B;  3UVM A;  3KRX B;  2OJY A;  2OVR B;  3IJE A;  4RE6 A;  3SMR A;  5AMS A;  5EMK B;  3T3P A;  3NIG A;  2H6N A;  1P22 A;  2HU7 A;  2XDW A;  4OWR A;  1U4C A;  4A2M A;  3MVD K;  3PXT D;  3EQ8 A;  3OKT A;  3OKW A;  4GGA A;  1TBG A;  3ZDY A;  3UKU C;  4E54 A;  4Z7Q A;  4FA4 D;  4PBY A;  5EM2 A;  3EI2 A;  1E8M A;  4CY1 A;  3K27 A;  3UVN A;  1YFQ A;  2XZG A;  2P9S C; 
#chains in the Genus database with same CATH homology
 2YNO A;  3PVW B;  4A0B A;  4JSX C;  3MXX A;  4J0W A;  4FA5 D;  3DXM C;  1N6F A;  5K1C C;  1PBY B;  2QC5 A;  4BH6 A;  2H6Q A;  3RFH A;  4IA9 A;  4A08 B;  3RMZ D;  3FGB A;  2IUP A;  4X60 B;  5CXC B;  2IUQ A;  3NVX A;  3RFG A;  5SXM A;  3ORV D;  2CE8 A;  4PNK B;  3RLM D;  3JB9 L;  2H9P A;  3EI4 B;  4QQE A;  2AH1 A;  4JT5 C;  2G99 A;  4O3T B;  2QXV A;  4HDJ A;  5CXB A;  3C99 A;  2IWF A;  5FKT A;  3P4F A;  4FHL A;  3I7H A;  3SHF A;  4K3I D;  4CZX A;  3VA6 A;  3OKY B;  4IMM A;  3SVW D;  4J8B A;  4QRJ A;  4QT8 A;  3JRO A;  2Q7Q A;  4E54 B;  2XYI A;  4ZOZ A;  3SJL D;  4A2L A;  5FA5 B;  3EI4 A;  2B4E A;  3SBR A;  5A2Q g;  4FA9 D;  1U2V C;  4J81 A;  2GC4 A;  3C75 H;  4PBZ A;  2AGX A;  2P9L C;  2H9M A;  2W18 A;  1SQJ A;  3EU7 A;  3B7F A;  3SCY A;  2H9N A;  5K19 A;  4JXM A;  2HJ4 A;  2Z2O A;  4LGN A;  3NVN A;  1B9Y A;  2H3X A;  1JOF A;  3EWE A;  3I7K A;  4X3E A;  4J87 A;  5FKR A;  5THA A;  3DM0 A;  4KFM B;  2H6K A;  4J84 A;  2GC7 A;  4MK0 B;  4A08 A;  2PM7 B;  3OKY A;  5I5M A;  1MG2 A;  1PI6 A;  4L1Q D;  5FKQ A;  4XEI C;  3PSC B;  3IJ0 A;  1ERJ A;  3I8C A;  2AGL A;  5AFU 3;  5TF2 A;  4BL0 A;  3DXK C;  3BWS A;  2HKR A;  2CNX A;  5IC7 A;  4TZ4 A;  2CO0 A;  4FA1 D;  2I3T A;  4CI2 A;  2P9I C;  5IGQ A;  4FWW A;  3UVO A;  3DSM A;  2CN2 A;  2XL3 A;  4L3G D;  3GFC A;  3OL2 B;  4G56 B;  4CZY A;  5TEF A;  4ZOX A;  1K32 A;  3SBQ A;  3JPX A;  4H5J A;  5I5I A;  4ERZ A;  3U4Y A;  2GNQ A;  2HYE A;  1OMW B;  2UZX B;  3I8E A;  2P9U C;  5C9Z B;  2H47 A;  2J56 H;  5EMM B;  3A0F A;  3CIK B;  4J0X A;  4JSV C;  2CE9 A;  2XU7 A;  3W15 A;  1QNI A;  3N0E A;  1PGU A;  2I3S A;  3AFC A;  4N14 A;  5IJ7 E;  3EI1 B;  3VH0 A;  5TDH B;  4OZU A;  4ZOV A;  2B5M A;  5EAL A;  2H14 A;  2IAA A;  5HE3 B;  3JZN A;  4J86 A;  3OW8 A;  1K8K C;  5EAM A;  3F3P A;  5AJA A;  4CY2 A;  2IWK A;  3V5W B;  3AL8 B;  2OK4 A;  3L4O D;  4XYH A;  5GXH A;  4O3U B;  1PEV A;  4J8G A;  2P9N C;  1JJU B;  3NVQ A;  1GOT B;  5HYN B;  3I7P A;  3IJ1 A;  4BUJ C;  3UR4 A;  1L0Q A;  4O1Q D;  4ERY A;  4J82 A;  4I79 A;  2O9K A;  3MKQ A;  4Y7R A;  3SLE D;  4R7A B;  3FRX A;  3UVL A;  1GXR A;  2J57 G;  3EI3 A;  2I0S A;  5EAP A;  3UKR C;  3KRW B;  4ZN4 A;  4U7A A;  3AL9 A;  5C2V B;  3PXW D;  4CI3 A;  4A11 A;  4FAV D;  4E5Z B;  3F3G A;  3EMH A;  3JZH A;  5GSA A;  1OLZ A;  3N0D A;  4ES0 A;  1MG3 A;  4A0A B;  4JT6 C;  1NEX B;  3J80 g;  4O9D A;  4Z8L A;  3C9C A;  4LG8 A;  3SN6 B;  1XHM A;  5FXY A;  3V7D B;  3I7N A;  2IUR A;  3E0C A;  5I5J A;  4GZ8 A;  3L4M D;  5CYK B;  4CI8 A;  5HE1 B;  4ERQ A;  3I7O A;  2OK6 A;  3I2N A;  4X61 B;  3IJC A;  3OTT A;  2AGY A;  1A0R B;  3DWL C;  2Z2P A;  4CC9 A;  1SQ9 A;  2YNP A;  4L9O A;  3JAM g;  2PM9 A;  4A7J A;  4PSX B;  3AL8 A;  4FB1 D;  3MMY A;  3PVU B;  3EI3 B;  4GQ1 A;  2BCJ B;  4GM8 A;  2AGZ A;  5JWZ A;  3F3F A;  2G9A A;  2OIZ A;  2CO0 C;  5CXC A;  4JSP C;  2PM6 B;  3ZWL B;  4O45 A;  3SFZ A;  2XL2 A;  3GRE A;  2YMU A;  4GGC A;  3EG6 A;  4PXW A;  4H5I A;  1S4U X;  1JMZ B;  1R5M A;  4GM3 A;  2HES X;  2YBA A;  5EMJ B;  3BG0 A;  4A0B B;  2HJB A;  4D6V A;  2AQ5 A;  5CXB B;  4GQB B;  2P9K C;  3PE7 A;  5H14 A;  5IT9 g;  5KDO B;  5IGO A;  1VYH C;  2OVP B;  2HXC A;  5HE2 B;  2YB8 B;  3C5M A;  4A0A A;  2I0T A;  4AEZ A;  3PSL A;  1RI6 A;  5EML B;  1N6D A;  4CI1 A;  1GP2 B;  4XYI A;  2PM9 B;  5IJ8 E;  3J81 g;  1TYQ C;  3MZL A;  3RN1 D;  3SBP A;  5GXI A;  1N6E A;  4GMB A;  4J77 A;  5TEE A;  3VGZ A;  5CYK A;  1SHY B;  3IKO A;  4QL1 A;  3EI1 A;  2HKM A;  2UZY B;  5GMK n;  2I0R A;  3JRP A;  4FAN D;  4LG9 A;  3K26 A;  5FQD A;  2PBI B;  2AH0 A;  2H68 A;  5B4W A;  4GGD A;  1XKS A;  5EAR A;  2Z2N A;  4GM9 A;  3IIW A;  4CY3 A;  4NSX A;  2AGW A;  4J79 A;  4K3J B;  4A09 B;  5FKS A;  1Q47 A;  3I89 A;  3CFV A;  1B9X A;  4ESG A;  3RSE C;  3MKS B;  1GG2 B;  2EBS A;  5EM2 B;  2B5L A;  3EI2 B;  3UVK A;  3BG1 A;  1XIP A;  4J78 A;  2YNN A;  4D0K A;  4JD2 C;  2OVQ B;  3SWS D;  3JZG A;  5H17 A;  4J73 A;  3RRM C;  4YVD A;  3V9F A;  2BBK H;  2MTA H;  3RN0 D;  3MZK A;  2P9P C;  2H13 A;  4U1E I;  4A11 B;  3CFS B;  2CN3 A;  4ZOY A;  3HFQ A;  1FWX A;  5FLX g;  1JMX B;  3ODT A;  2IUV A;  4GQ2 P;  2J55 H;  2H9L A;  4PSW B;  3AH8 B;  4AOW A;  2B5N A;  3FM0 A;  4PC0 A;  3ULE C;  5C2W B;  3I7L A;  1MDA H;  2TRC B;  4CZV A;  4L3H D;  4CY5 A;  4JSN C;  1NR0 A;  4UI9 R;  3OL2 A;  4E5Z A;  3IIY A;  4A09 A;  5H1M A;  4EWR A;  3PXS D;  3SXT D;  4Y5R D;  5HE0 B;  5HQG A;  4X63 B;  3UVM A;  3KRX B;  2OJY A;  2OVR B;  3SMR A;  5AMS A;  5EMK B;  2H6N A;  1P22 A;  4OWR A;  4A2M A;  1U4C A;  3PXT D;  4GGA A;  3OKT A;  3OKW A;  1TBG A;  3UKU C;  4E54 A;  4FA4 D;  4PBY A;  5EM2 A;  3EI2 A;  4CY1 A;  3K27 A;  3UVN A;  1YFQ A;  2P9S C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...