4XYHA

Wild-type full length mis16 in schizosaccharomyces japonicus
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
402
structure length
375
Chain Sequence
LSEVDLEKKIQEEYKLWKQNVPFLYDLVITEALEWPSLTVEWFPGSEDNSSIQKLLLGTQTSGNDQNYLQVASVQLPTLDIVQKIHHEGDVNKARFMPQNPDIIATLGLNGNGYIFDLNLYREQPIVQTGHQACLRHHTSEGFGLGWNFIQEGTLATGTEDTSICVWDIKGKSLSLEKSIDVAPVSVYHRHTAVVNDLQFHLQHEALLTSVSDDCTLQIHDTRLPSSSSASQCVKAHEQPVNGVAFNPFNDYLLATASADHTVALWDLRRLNQRLHTLEGHEDEVYNVQWSPHDEPILVTSSTDRRVCVWDLSKIGEEQTVEDSEDGAPELMFMHGGHTNRVSDLSWNPNNKWVLASLADDNILQIWSPSKVIWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mis16 Independently Recognizes Histone H4 and the CENP-ACnp1-Specific Chaperone Scm3sp.
pubmed doi rcsb
molecule keywords Kinetochore protein Mis16
molecule tags Chaperone
source organism Schizosaccharomyces japonicus (strain yfs275 / fy16936)
total genus 110
structure length 375
sequence length 402
ec nomenclature
pdb deposition date 2015-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF12265 CAF1C_H4-bd Histone-binding protein RBBP4 or subunit C of CAF1 complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4xyhA00
2IUQA 4A08B 3DM0A 4E5ZB 1JMZB 1K32A 4EWRA 2IWFA 2H9LA 4ERZA 5HE2B 5AFU3 3J81g 3OTTA 1SQJA 2UZXB 3I7KA 3BG1A 3B7FA 4A09B 4GQ1A 3ODTA 4J73A 4X60B 4N14A 4OZUA 4Y7RA 4CC9A 3I8CA 4K3ID 2H9NA 3EI3B 2HESX 3BG0A 2Q7QA 4CI2A 5CXCB 5H17A 3JZHA 4J81A 2XU7A 4J8BA 2Z2OA 5TDHB 1GP2B 4A08A 3ULEC 3IIWA 3JAMg 4E5ZA 3OKYB 2CN3A 3RMZD 3IKOA 4MK0B 4XEIC 4CZXA 3GFCA 4CI8A 3F3FA 1JJUB 3K26A 4A09A 4JT6C 2YBAA 4O9DA 2CO0C 2AGXA 3DSMA 4LGNA 5IJ7E 3L4MD 1PGUA 3V7DB 5FKTA 4QL1A 2YNNA 3UVLA 4JSVC 3CFSB 5CXCA 4CI1A 4JT5C 3PE7A 3SBQA 3JROA 4J86A 2H68A 3CIKB 2OK4A 3EU7A 1ERJA 5HE0B 2H13A 2I0RA 3OKYA 5HE3B 4A7JA 3EG6A 4J87A 2EBSA 1PI6A 3JPXA 5EM2B 3AFCA 2H14A 2B5NA 3A0FA 4XYHA 1N6EA 2J55H 3EI4B 5EALA 5FKRA 3NVQA 2MTAH 2H3XA 5GSAA 2QC5A 2AGZA 4FA9D 3OL2B 5AMSA 3SBRA 2B5LA 4FA4D 4X3EA 3EMHA 4Z8LA 2YB8B 3EI2B 5I5IA 4U1EI 3J80g 2I0SA 5IJ8E 5CXBB 5FA5B 3GREA 3I8EA 4FHLA 2CO0A 3I2NA 5EM2A 2H9MA 2IUVA 3EI4A 3FM0A 2YNOA 4JSNC 5I5JA 2OK6A 4D0KA 2CN2A 4H5IA 2H9PA 3C5MA 1S4UX 2AH0A 3OL2A 4BL0A 4FAVD 3IJCA 4JD2C 4GQ2P 4I79A 3JZGA 3EI2A 3PXSD 2B5MA 4H5JA 1QNIA 5IGQA 4BH6A 3EI1B 3UVOA 5EMMB 2OVRB 3VA6A 3PXWD 5CXBA 5FLXg 4A11B 5EAPA 2HXCA 5JWZA 3OKWA 5IC7A 2H47A 3PVUB 4FAND 4IA9A 4XYIA 2P9IC 5B4WA 5THAA 1GXRA 3I7PA 4LG8A 2P9UC 4ZOXA 4BUJC 2IAAA 3MKQA 3IIYA 2W18A 3U4YA 4PXWA 2H6KA 3PXTD 3PSLA 1PEVA 3EI1A 5TEEA 5GXHA 3N0EA 5C2WB 4CY2A 5H14A 2IWKA 4A11A 2YMUA 3UKRC 5FKQA 2IURA 4HDJA 3FRXA 1A0RB 2AGLA 3P4FA 4ZOYA 2CNXA 3JRPA 1YFQA 2P9SC 3KRWB 2HKMA 3RFGA 3I7NA 4J8GA 2BBKH 1NR0A 4IMMA 4ERQA 5GXIA 4U7AA 2Z2PA 4O1QD 4ZN4A 4CY3A 4FA1D 1VYHC 4QQEA 2CE8A 1JOFA 2HKRA 2XYIA 4JSPC 4Y5RD 3UVNA 5H1MA 2AQ5A 2J57G 4GM8A 3OKTA 3AH8B 1U4CA 1XIPA 1XKSA 3SLED 3ORVD 3MZLA 5EMJB 5HQGA 3VGZA 1PBYB 5AJAA 3NVNA 2GNQA 2PM9B 3RSEC 3RFHA 4GGDA 4GGCA 5K19A 2I0TA 1K8KC 4ZOVA 1N6DA 3HFQA 4JXMA 3JZNA 5HYNB 3SHFA 4LG9A 4NSXA 4J77A 3MZKA 4O45A 2G99A 4PBYA 4FA5D 2P9PC 3EWEA 3I7OA 3ZWLB 1FWXA 3DXMC 3I7HA 3KRXB 1B9YA 4J0WA 4PBZA 2AGYA 2O9KA 4J79A 1N6FA 3DXKC 4J78A 3L4OD 2PM9A 3SN6B 5C2VB 2J56H 4A2LA 4L3GD 1L0QA 4CY1A 4PSWB 3SMRA 5IT9g 2YNPA 1MDAH 1TYQC 4L3HD 2HJBA 5EMKB 2B4EA 4CI3A 3SVWD 3PSCB 3W15A 5EARA 2OJYA 4TZ4A 3C99A 3SWSD 4L1QD 3RN0D 4PSXB 1MG2A 3I89A 4GM3A 4X63B 3IJ0A 1JMXB 3CFVA 3C9CA 2HYEA 4GGAA 5FQDA 3C75H 4O3UB 2H6NA 3E0CA 5EMLB 4GMBA 3PVWB 2OVPB 1NEXB 3MKSB 3VH0A 3NVXA 3SJLD 4A2MA 4J82A 1OMWB 4R7AB 4L9OA 4AEZA 4D6VA 5CYKB 1B9XA 3V9FA 4YVDA 4E54B 4QRJA 3F3GA 3MXXA 5EAMA 2PM7B 3RLMD 2IUPA 3JB9L 5GMKn 2GC4A 4ES0A 1P22A 4KFMB 4K3JB 5TF2A 3SCYA 4X61B 3SXTD 3K27A 4O3TB 5C9ZB 4PNKB 1R5MA 4GM9A 1U2VC 2TRCB 3EI3A 3SBPA 1RI6A 4A0AB 1SHYB 4ERYA 2HJ4A 3I7LA 5FXYA 5I5MA 4GQBB 4G56B 2I3SA 1OLZA 1SQ9A 2GC7A 3UVMA 4QT8A 4ESGA 5CYKA 3N0DA 4E54A 3IJ1A 4CZVA 3FGBA 1GG2B 3AL8B 4GZ8A 4OWRA 2I3TA 3RN1D 3DWLC 5TEFA 2P9LC 4FB1D 3V5WB 2BCJB 4A0AA 2H6QA 4A0BB 2P9NC 2AH1A 2Z2NA 4JSXC 5KDOB 4UI9R 3UVKA 4CY5A 4PC0A 4J0XA 5HE1B 5K1CC 1XHMA 4FWWA 3SFZA 4ZOZA 2PBIB 3BWSA 1TBGA 5SXMA 2P9KC 2PM6B 3MMYA 5FKSA 2G9AA 3AL8A 2CE9A 2UZYB 2OIZA 1GOTB 2OVQB 5A2Qg 4CZYA 2AGWA 3F3PA 3AL9A 4AOWA 3UR4A 2XL2A 4A0BA 2QXVA 5IGOA 2XL3A 3RRMC 4J84A 3OW8A 1MG3A 3UKUC 1Q47A
chains in the Genus database with same CATH superfamily
2IUQA 4A08B 2VC2A 3DM0A 4E5ZB 1JMZB 1K32A 4EWRA 2IWFA 2H9LA 4ERZA 5HE2B 5AFU3 3J81g 2BKLA 3OTTA 1H2WA 1SQJA 2UZXB 3I7KA 4BCDA 3BG1A 3B7FA 4A09B 1GOGA 4GQ1A 5HDBA 3ODTA 5M5UA 4J73A 4X60B 4N14A 4OZUA 2XDWA 4Y7RA 4CC9A 2VDNA 3I8CA 4K3ID 2H9NA 2VDLA 3EI3B 3V4PA 2HESX 3BG0A 2Q7QA 4CI2A 5CXCB 5H17A 3JZHA 4J81A 4UM8A 2XU7A 3GD1I 4J8BA 1M1XA 2Z2OA 5TDHB 1GP2B 4A08A 3ULEC 3IIWA 3JAMg 4E5ZA 3OKYB 4BCBA 2CN3A 3RMZD 4G55A 5M5SA 4Z7QA 3IKOA 4JHNA 4MK0B 4XEIC 4CZXA 3GFCA 4CI8A 1C9IA 3F3FA 1BPOA 1JJUB 4AN0A 3K26A 4A09A 4JT6C 4DNWA 2YBAA 4O9DA 2CO0C 2AGXA 3DSMA 4LGNA 5IJ7E 3L4MD 1PGUA 4RE5A 3V7DB 3ZE0A 5FKTA 4QL1A 2YNNA 3UVLA 4MMYA 4JSVC 3CFSB 5CXCA 4CI1A 4JT5C 3PE7A 3T3PA 3MUNA 2XZGA 3SBQA 5M61A 2HU5A 3JROA 1E8MA 4J86A 4O2WA 2H68A 3CIKB 3EQ7A 2OK4A 3EU7A 1ERJA 5HE0B 2H13A 2I0RA 1TYEA 3OKYA 5HE3B 4A7JA 3EG6A 4J87A 2EBSA 1PI6A 3NIGA 3JPXA 4AMYA 3AFCA 2H14A 2B5NA 5EM2B 3A0FA 4XYHA 1N6EA 2J55H 3EI4B 5EALA 5FKRA 4WK4A 5FFOA 3NVQA 4NBMA 2MTAH 2H3XA 3IURA 5GSAA 1E8NA 2QC5A 2AGZA 4FA9D 3OL2B 5AMSA 3SBRA 4WJKA 2B5LA 1UOOA 2HU8A 4FA4D 3K71A 4X3EA 3EMHA 4Z8LA 2YB8B 3EI2B 5I5IA 3IUQA 4U1EI 3J80g 2I0SA 2VDQA 5IJ8E 5CXBB 1VE7A 5FA5B 3GREA 3I8EA 5M5TA 4FHLA 2CO0A 3I2NA 5EM2A 3K6SA 2H9MA 2IUVA 3EI4A 4Z7NA 3FM0A 2YNOA 4JSNC 4DNUA 5I5JA 2OK6A 4D0KA 3O4JA 2CN2A 4H5IA 2H9PA 3C5MA 3MVDK 1S4UX 2AH0A 3OL2A 4BL0A 4FAVD 2JKXA 3IJCA 4JD2C 5E6SA 4GQ2P 4I79A 3JZGA 3EI2A 3PXSD 2B5MA 4H5JA 1QNIA 5IGQA 3IVMA 4BH6A 3EI1B 3UVOA 5EMMB 2OVRB 3VA6A 3PXWD 5CXBA 5FLXg 4A11B 5EAPA 2HXCA 3K72A 5JWZA 3OKWA 5IC7A 2H47A 3PVUB 4FAND 4IA9A 3O4IA 4XYIA 2P9IC 5B4WA 5THAA 1GXRA 3ZDZA 3I7PA 4LG8A 2P9UC 4ZOXA 4BUJC 2IAAA 3MKQA 3IIYA 3QHYB 2W18A 3U4YA 1VZ2A 1VZ3A 4PXWA 5C86A 2H6KA 3PXTD 3PSLA 1PEVA 3EI1A 5TEEA 5GXHA 3N0EA 4L1MA 5C2WB 4CY2A 5H14A 2IWKA 1C9LA 4A11A 2YMUA 3UKRC 5FKQA 1JTDB 2VDOA 2IURA 4HDJA 3FRXA 1A0RB 2AGLA 3ZDXA 3P4FA 4ZOYA 2CNXA 4G1MA 5E6UA 2VDMA 3IJEA 3JRPA 1YFQA 3ZDYA 3ZE1A 2P9SC 3KRWB 2HKMA 1U8CA 3RFGA 3VI3A 3I7NA 4J8GA 2BBKH 2VDRA 1K3IA 1NR0A 4IMMA 4WK2A 4ERQA 4U7AA 5GXIA 2Z2PA 4O1QD 4ZN4A 4CY3A 4FA1D 1I2MB 1VYHC 1UTCA 4QQEA 2CE8A 1JOFA 2QZPA 3VI4A 2HKRA 2XYIA 4JSPC 4Y5RD 3FCSA 3UVNA 5H1MA 2AQ5A 2J57G 4GM8A 3OKTA 3AH8B 1U4CA 1XIPA 5M5VA 1XKSA 3SLED 3IUJA 3MUOA 3ORVD 3MZLA 5EMJB 4BP8A 2VZ1A 5HQGA 2EIEA 3VGZA 1PBYB 5AJAA 3NVNA 2GNQA 2WQ8A 2PM9B 3RSEC 3RFHA 4GGDA 4GGCA 2QR5A 5K19A 2I0TA 1K8KC 4ZOVA 1N6DA 3HFQA 4JXMA 3JZNA 5HYNB 3SHFA 4LG9A 4NSXA 4J77A 3DDUA 3MZKA 4O45A 2G99A 4PBYA 3V4VA 4FA5D 3IUNA 2P9PC 3EWEA 3I7OA 3ZWLB 1FWXA 3DXMC 2EIDA 3I7HA 3KRXB 1H2ZA 1B9YA 4J0WA 4PBZA 2AGYA 2O9KA 4J79A 3QI0A 3EQ8A 1N6FA 3DXKC 4J78A 3L4OD 2PM9A 4IRZA 3SN6B 1UOPA 1E5TA 3NIFA 1QFMA 2XE4A 5C2VB 2J56H 4A2LA 4L3GD 1L0QA 4CY1A 4PSWB 3SMRA 2VDPA 5IT9g 3EQ9A 2YNPA 1MDAH 1TYQC 4L3HD 2HJBA 5EMKB 2B4EA 4CI3A 3SVWD 3PSCB 3W15A 5EARA 2OJYA 4TZ4A 3C99A 3SWSD 4L1QD 3RN0D 4MMZA 4PSXB 1MG2A 3I89A 4GM3A 4X63B 4DNVA 3IJ0A 1JMXB 3CFVA 3C9CA 2HYEA 2VDKA 4GGAA 5FQDA 3C75H 3OF7A 4O3UB 2H6NA 3O4HA 3T3MA 1H2YA 3E0CA 5EMLB 4G1EA 4GMBA 3PVWB 4AMZA 1O6FA 2OVPB 1NEXB 3MKSB 5C92A 1QFSA 3VH0A 4QAMA 1L5GA 3NVXA 3SJLD 4A2MA 4J82A 3IULA 1OMWB 4R7AB 4L9OA 4NC4A 4AEZA 5CYKB 1B9XA 3V9FA 4D6VA 4YVDA 4E54B 4QRJA 3F3GA 4UM9A 3MXXA 5EAMA 3NIDA 2PM7B 3RLMD 2IUPA 3JB9L 5GMKn 2GC4A 4NENA 4ES0A 1JV2A 5FFGA 1P22A 4KFMB 4K3JB 5TF2A 3SCYA 4X61B 5M5RA 3SXTD 3K27A 4JHPC 4O3TB 5C9ZB 4PNKB 1R5MA 4GM9A 1U2VC 2TRCB 3EI3A 3SBPA 1RI6A 4A0AB 3FCUA 1SHYB 4ERYA 2HJ4A 3I7LA 5FXYA 5I5MA 3ZE2A 1T2XA 4GQBB 4NAAA 2EIBA 4G56B 4D9SA 3GC3B 2I3SA 1OLZA 1SQ9A 2GC7A 3UVMA 4BP9A 4QT8A 1VE6A 1H2XA 5CYKA 3N0DA 4ESGA 3KCIA 4E54A 3IJ1A 5E6RA 4BCCA 4CZVA 3FGBA 1GG2B 3AL8B 4GZ8A 4OWRA 4O02A 4RE6A 1GOHA 1O6GA 2I3TA 3RN1D 1A12A 3DWLC 5TEFA 2P9LC 4FB1D 3V5WB 2BCJB 4A0AA 2H6QA 4A0BB 2P9NC 1GOFA 1YR2A 2AH1A 2Z2NA 4JSXC 5KDOB 4UI9R 3UVKA 4CY5A 4MMXA 4PC0A 3IUMA 4J0XA 5HE1B 5K1CC 1XHMA 4FWWA 3SFZA 4ZOZA 2PBIB 3BWSA 1TBGA 5SXMA 2P9KC 2PM6B 1UOQA 3MMYA 5FKSA 2G9AA 2HU7A 3AL8A 2CE9A 2UZYB 2OIZA 1GOTB 4WK0A 2OVQB 5A2Qg 4CZYA 2VZ3A 4AN1A 2AGWA 3F3PA 3AL9A 4AOWA 2EICA 3UR4A 2XL2A 3O4GA 4A0BA 2QXVA 5IGOA 4AX4A 2XL3A 3RRMC 4J84A 3OW8A 1MG3A 4Z7OA 3UKUC 1Q47A
chains in the Genus database with same CATH topology
2IUQA 4A08B 3DM0A 4E5ZB 1JMZB 1K32A 4EWRA 2IWFA 2H9LA 4ERZA 5HE2B 5AFU3 3J81g 3OTTA 1SQJA 2UZXB 3I7KA 3BG1A 3B7FA 4A09B 4GQ1A 3ODTA 4J73A 4X60B 4N14A 4OZUA 4Y7RA 4CC9A 3I8CA 4K3ID 2H9NA 3EI3B 2HESX 3BG0A 2Q7QA 4CI2A 5CXCB 5H17A 3JZHA 4J81A 2XU7A 4J8BA 2Z2OA 5TDHB 1GP2B 4A08A 3ULEC 3IIWA 3JAMg 4E5ZA 3OKYB 2CN3A 3RMZD 3IKOA 4MK0B 4XEIC 4CZXA 3GFCA 4CI8A 3F3FA 1JJUB 3K26A 4A09A 4JT6C 2YBAA 4O9DA 2CO0C 2AGXA 3DSMA 4LGNA 5IJ7E 3L4MD 1PGUA 3V7DB 5FKTA 4QL1A 2YNNA 3UVLA 4JSVC 3CFSB 5CXCA 4CI1A 4JT5C 3PE7A 3SBQA 3JROA 4J86A 2H68A 3CIKB 2OK4A 3EU7A 1ERJA 5HE0B 2H13A 2I0RA 3OKYA 5HE3B 4A7JA 3EG6A 4J87A 2EBSA 1PI6A 3JPXA 5EM2B 3AFCA 2H14A 2B5NA 3A0FA 4XYHA 1N6EA 2J55H 3EI4B 5EALA 5FKRA 3NVQA 2MTAH 2H3XA 5GSAA 2QC5A 2AGZA 4FA9D 3OL2B 5AMSA 3SBRA 2B5LA 4FA4D 4X3EA 3EMHA 4Z8LA 2YB8B 3EI2B 5I5IA 4U1EI 3J80g 2I0SA 5IJ8E 5CXBB 5FA5B 3GREA 3I8EA 4FHLA 2CO0A 3I2NA 5EM2A 2H9MA 2IUVA 3EI4A 3FM0A 2YNOA 4JSNC 5I5JA 2OK6A 4D0KA 2CN2A 4H5IA 2H9PA 3C5MA 1S4UX 2AH0A 3OL2A 4BL0A 4FAVD 3IJCA 4JD2C 4GQ2P 4I79A 3JZGA 3EI2A 3PXSD 2B5MA 4H5JA 1QNIA 5IGQA 4BH6A 3EI1B 3UVOA 5EMMB 2OVRB 3VA6A 3PXWD 5CXBA 5FLXg 4A11B 5EAPA 2HXCA 5JWZA 3OKWA 5IC7A 2H47A 3PVUB 4FAND 4IA9A 4XYIA 2P9IC 5B4WA 5THAA 1GXRA 3I7PA 4LG8A 2P9UC 4ZOXA 4BUJC 2IAAA 3MKQA 3IIYA 2W18A 3U4YA 4PXWA 2H6KA 3PXTD 3PSLA 1PEVA 3EI1A 5TEEA 5GXHA 3N0EA 5C2WB 4CY2A 5H14A 2IWKA 4A11A 2YMUA 3UKRC 5FKQA 2IURA 4HDJA 3FRXA 1A0RB 2AGLA 3P4FA 4ZOYA 2CNXA 3JRPA 1YFQA 2P9SC 3KRWB 2HKMA 3RFGA 3I7NA 4J8GA 2BBKH 1NR0A 4IMMA 4ERQA 5GXIA 4U7AA 2Z2PA 4O1QD 4ZN4A 4CY3A 4FA1D 1VYHC 4QQEA 2CE8A 1JOFA 2HKRA 2XYIA 4JSPC 4Y5RD 3UVNA 5H1MA 2AQ5A 2J57G 4GM8A 3OKTA 3AH8B 1U4CA 1XIPA 1XKSA 3SLED 3ORVD 3MZLA 5EMJB 5HQGA 3VGZA 1PBYB 5AJAA 3NVNA 2GNQA 2PM9B 3RSEC 3RFHA 4GGDA 4GGCA 5K19A 2I0TA 1K8KC 4ZOVA 1N6DA 3HFQA 4JXMA 3JZNA 5HYNB 3SHFA 4LG9A 4NSXA 4J77A 3MZKA 4O45A 2G99A 4PBYA 4FA5D 2P9PC 3EWEA 3I7OA 3ZWLB 1FWXA 3DXMC 3I7HA 3KRXB 1B9YA 4J0WA 4PBZA 2AGYA 2O9KA 4J79A 1N6FA 3DXKC 4J78A 3L4OD 2PM9A 3SN6B 5C2VB 2J56H 4A2LA 4L3GD 1L0QA 4CY1A 4PSWB 3SMRA 5IT9g 2YNPA 1MDAH 1TYQC 4L3HD 2HJBA 5EMKB 2B4EA 4CI3A 3SVWD 3PSCB 3W15A 5EARA 2OJYA 4TZ4A 3C99A 3SWSD 4L1QD 3RN0D 4PSXB 1MG2A 3I89A 4GM3A 4X63B 3IJ0A 1JMXB 3CFVA 3C9CA 2HYEA 4GGAA 5FQDA 3C75H 4O3UB 2H6NA 3E0CA 5EMLB 4GMBA 3PVWB 2OVPB 1NEXB 3MKSB 3VH0A 3NVXA 3SJLD 4A2MA 4J82A 1OMWB 4R7AB 4L9OA 4AEZA 4D6VA 5CYKB 1B9XA 3V9FA 4YVDA 4E54B 4QRJA 3F3GA 3MXXA 5EAMA 2PM7B 3RLMD 2IUPA 3JB9L 5GMKn 2GC4A 4ES0A 1P22A 4KFMB 4K3JB 5TF2A 3SCYA 4X61B 3SXTD 3K27A 4O3TB 5C9ZB 4PNKB 1R5MA 4GM9A 1U2VC 2TRCB 3EI3A 3SBPA 1RI6A 4A0AB 1SHYB 4ERYA 2HJ4A 3I7LA 5FXYA 5I5MA 4GQBB 4G56B 2I3SA 1OLZA 1SQ9A 2GC7A 3UVMA 4QT8A 4ESGA 5CYKA 3N0DA 4E54A 3IJ1A 4CZVA 3FGBA 1GG2B 3AL8B 4GZ8A 4OWRA 2I3TA 3RN1D 3DWLC 5TEFA 2P9LC 4FB1D 3V5WB 2BCJB 4A0AA 2H6QA 4A0BB 2P9NC 2AH1A 2Z2NA 4JSXC 5KDOB 4UI9R 3UVKA 4CY5A 4PC0A 4J0XA 5HE1B 5K1CC 1XHMA 4FWWA 3SFZA 4ZOZA 2PBIB 3BWSA 1TBGA 5SXMA 2P9KC 2PM6B 3MMYA 5FKSA 2G9AA 3AL8A 2CE9A 2UZYB 2OIZA 1GOTB 2OVQB 5A2Qg 4CZYA 2AGWA 3F3PA 3AL9A 4AOWA 3UR4A 2XL2A 4A0BA 2QXVA 5IGOA 2XL3A 3RRMC 4J84A 3OW8A 1MG3A 3UKUC 1Q47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IUQ A;  4A08 B;  3DM0 A;  4E5Z B;  1JMZ B;  1K32 A;  4EWR A;  2IWF A;  2H9L A;  4ERZ A;  5HE2 B;  5AFU 3;  3J81 g;  3OTT A;  1SQJ A;  2UZX B;  3I7K A;  3BG1 A;  3B7F A;  4A09 B;  4GQ1 A;  3ODT A;  4J73 A;  4X60 B;  4N14 A;  4OZU A;  4Y7R A;  4CC9 A;  3I8C A;  4K3I D;  2H9N A;  3EI3 B;  2HES X;  3BG0 A;  2Q7Q A;  4CI2 A;  5CXC B;  5H17 A;  3JZH A;  4J81 A;  2XU7 A;  4J8B A;  2Z2O A;  5TDH B;  1GP2 B;  4A08 A;  3ULE C;  3IIW A;  3JAM g;  4E5Z A;  3OKY B;  2CN3 A;  3RMZ D;  3IKO A;  4MK0 B;  4XEI C;  4CZX A;  3GFC A;  4CI8 A;  3F3F A;  1JJU B;  3K26 A;  4A09 A;  4JT6 C;  2YBA A;  4O9D A;  2CO0 C;  2AGX A;  3DSM A;  4LGN A;  5IJ7 E;  3L4M D;  1PGU A;  3V7D B;  5FKT A;  4QL1 A;  2YNN A;  3UVL A;  4JSV C;  3CFS B;  5CXC A;  4CI1 A;  4JT5 C;  3PE7 A;  3SBQ A;  3JRO A;  4J86 A;  2H68 A;  3CIK B;  2OK4 A;  3EU7 A;  1ERJ A;  5HE0 B;  2H13 A;  2I0R A;  3OKY A;  5HE3 B;  4A7J A;  3EG6 A;  4J87 A;  2EBS A;  1PI6 A;  3JPX A;  5EM2 B;  3AFC A;  2H14 A;  2B5N A;  3A0F A;  4XYH A;  1N6E A;  2J55 H;  3EI4 B;  5EAL A;  5FKR A;  3NVQ A;  2MTA H;  2H3X A;  5GSA A;  2QC5 A;  2AGZ A;  4FA9 D;  3OL2 B;  5AMS A;  3SBR A;  2B5L A;  4FA4 D;  4X3E A;  3EMH A;  4Z8L A;  2YB8 B;  3EI2 B;  5I5I A;  4U1E I;  3J80 g;  2I0S A;  5IJ8 E;  5CXB B;  5FA5 B;  3GRE A;  3I8E A;  4FHL A;  2CO0 A;  3I2N A;  5EM2 A;  2H9M A;  2IUV A;  3EI4 A;  3FM0 A;  2YNO A;  4JSN C;  5I5J A;  2OK6 A;  4D0K A;  2CN2 A;  4H5I A;  2H9P A;  3C5M A;  1S4U X;  2AH0 A;  3OL2 A;  4BL0 A;  4FAV D;  3IJC A;  4JD2 C;  4GQ2 P;  4I79 A;  3JZG A;  3EI2 A;  3PXS D;  2B5M A;  4H5J A;  1QNI A;  5IGQ A;  4BH6 A;  3EI1 B;  3UVO A;  5EMM B;  2OVR B;  3VA6 A;  3PXW D;  5CXB A;  5FLX g;  4A11 B;  5EAP A;  2HXC A;  5JWZ A;  3OKW A;  5IC7 A;  2H47 A;  3PVU B;  4FAN D;  4IA9 A;  4XYI A;  2P9I C;  5B4W A;  5THA A;  1GXR A;  3I7P A;  4LG8 A;  2P9U C;  4ZOX A;  4BUJ C;  2IAA A;  3MKQ A;  3IIY A;  2W18 A;  3U4Y A;  4PXW A;  2H6K A;  3PXT D;  3PSL A;  1PEV A;  3EI1 A;  5TEE A;  5GXH A;  3N0E A;  5C2W B;  4CY2 A;  5H14 A;  2IWK A;  4A11 A;  2YMU A;  3UKR C;  5FKQ A;  2IUR A;  4HDJ A;  3FRX A;  1A0R B;  2AGL A;  3P4F A;  4ZOY A;  2CNX A;  3JRP A;  1YFQ A;  2P9S C;  3KRW B;  2HKM A;  3RFG A;  3I7N A;  4J8G A;  2BBK H;  1NR0 A;  4IMM A;  4ERQ A;  5GXI A;  4U7A A;  2Z2P A;  4O1Q D;  4ZN4 A;  4CY3 A;  4FA1 D;  1VYH C;  4QQE A;  2CE8 A;  1JOF A;  2HKR A;  2XYI A;  4JSP C;  4Y5R D;  3UVN A;  5H1M A;  2AQ5 A;  2J57 G;  4GM8 A;  3OKT A;  3AH8 B;  1U4C A;  1XIP A;  1XKS A;  3SLE D;  3ORV D;  3MZL A;  5EMJ B;  5HQG A;  3VGZ A;  1PBY B;  5AJA A;  3NVN A;  2GNQ A;  2PM9 B;  3RSE C;  3RFH A;  4GGD A;  4GGC A;  5K19 A;  2I0T A;  1K8K C;  4ZOV A;  1N6D A;  3HFQ A;  4JXM A;  3JZN A;  5HYN B;  3SHF A;  4LG9 A;  4NSX A;  4J77 A;  3MZK A;  4O45 A;  2G99 A;  4PBY A;  4FA5 D;  2P9P C;  3EWE A;  3I7O A;  3ZWL B;  1FWX A;  3DXM C;  3I7H A;  3KRX B;  1B9Y A;  4J0W A;  4PBZ A;  2AGY A;  2O9K A;  4J79 A;  1N6F A;  3DXK C;  4J78 A;  3L4O D;  2PM9 A;  3SN6 B;  5C2V B;  2J56 H;  4A2L A;  4L3G D;  1L0Q A;  4CY1 A;  4PSW B;  3SMR A;  5IT9 g;  2YNP A;  1MDA H;  1TYQ C;  4L3H D;  2HJB A;  5EMK B;  2B4E A;  4CI3 A;  3SVW D;  3PSC B;  3W15 A;  5EAR A;  2OJY A;  4TZ4 A;  3C99 A;  3SWS D;  4L1Q D;  3RN0 D;  4PSX B;  1MG2 A;  3I89 A;  4GM3 A;  4X63 B;  3IJ0 A;  1JMX B;  3CFV A;  3C9C A;  2HYE A;  4GGA A;  5FQD A;  3C75 H;  4O3U B;  2H6N A;  3E0C A;  5EML B;  4GMB A;  3PVW B;  2OVP B;  1NEX B;  3MKS B;  3VH0 A;  3NVX A;  3SJL D;  4A2M A;  4J82 A;  1OMW B;  4R7A B;  4L9O A;  4AEZ A;  4D6V A;  5CYK B;  1B9X A;  3V9F A;  4YVD A;  4E54 B;  4QRJ A;  3F3G A;  3MXX A;  5EAM A;  2PM7 B;  3RLM D;  2IUP A;  3JB9 L;  5GMK n;  2GC4 A;  4ES0 A;  1P22 A;  4KFM B;  4K3J B;  5TF2 A;  3SCY A;  4X61 B;  3SXT D;  3K27 A;  4O3T B;  5C9Z B;  4PNK B;  1R5M A;  4GM9 A;  1U2V C;  2TRC B;  3EI3 A;  3SBP A;  1RI6 A;  4A0A B;  1SHY B;  4ERY A;  2HJ4 A;  3I7L A;  5FXY A;  5I5M A;  4GQB B;  4G56 B;  2I3S A;  1OLZ A;  1SQ9 A;  2GC7 A;  3UVM A;  4QT8 A;  4ESG A;  5CYK A;  3N0D A;  4E54 A;  3IJ1 A;  4CZV A;  3FGB A;  1GG2 B;  3AL8 B;  4GZ8 A;  4OWR A;  2I3T A;  3RN1 D;  3DWL C;  5TEF A;  2P9L C;  4FB1 D;  3V5W B;  2BCJ B;  4A0A A;  2H6Q A;  4A0B B;  2P9N C;  2AH1 A;  2Z2N A;  4JSX C;  5KDO B;  4UI9 R;  3UVK A;  4CY5 A;  4PC0 A;  4J0X A;  5HE1 B;  5K1C C;  1XHM A;  4FWW A;  3SFZ A;  4ZOZ A;  2PBI B;  3BWS A;  1TBG A;  5SXM A;  2P9K C;  2PM6 B;  3MMY A;  5FKS A;  2G9A A;  3AL8 A;  2CE9 A;  2UZY B;  2OIZ A;  1GOT B;  2OVQ B;  5A2Q g;  4CZY A;  2AGW A;  3F3P A;  3AL9 A;  4AOW A;  3UR4 A;  2XL2 A;  4A0B A;  2QXV A;  5IGO A;  2XL3 A;  3RRM C;  4J84 A;  3OW8 A;  1MG3 A;  3UKU C;  1Q47 A; 
#chains in the Genus database with same CATH topology
 2IUQ A;  4A08 B;  2VC2 A;  3DM0 A;  4E5Z B;  1JMZ B;  1K32 A;  4EWR A;  2IWF A;  2H9L A;  4ERZ A;  5HE2 B;  5AFU 3;  3J81 g;  2BKL A;  3OTT A;  1H2W A;  1SQJ A;  2UZX B;  3I7K A;  4BCD A;  3BG1 A;  3B7F A;  4A09 B;  1GOG A;  4GQ1 A;  5HDB A;  3ODT A;  5M5U A;  4J73 A;  4X60 B;  4N14 A;  4OZU A;  2XDW A;  4Y7R A;  4CC9 A;  2VDN A;  3I8C A;  4K3I D;  2H9N A;  2VDL A;  3EI3 B;  3V4P A;  2HES X;  3BG0 A;  2Q7Q A;  4CI2 A;  5CXC B;  5H17 A;  3JZH A;  4J81 A;  4UM8 A;  2XU7 A;  3GD1 I;  4J8B A;  1M1X A;  2Z2O A;  5TDH B;  1GP2 B;  4A08 A;  3ULE C;  3IIW A;  3JAM g;  4E5Z A;  3OKY B;  4BCB A;  2CN3 A;  3RMZ D;  4G55 A;  5M5S A;  4Z7Q A;  3IKO A;  4JHN A;  4MK0 B;  4XEI C;  4CZX A;  3GFC A;  4CI8 A;  1C9I A;  3F3F A;  1BPO A;  1JJU B;  4AN0 A;  3K26 A;  4A09 A;  4JT6 C;  4DNW A;  2YBA A;  4O9D A;  2CO0 C;  2AGX A;  3DSM A;  4LGN A;  5IJ7 E;  3L4M D;  1PGU A;  4RE5 A;  3V7D B;  3ZE0 A;  5FKT A;  4QL1 A;  2YNN A;  3UVL A;  4MMY A;  4JSV C;  3CFS B;  5CXC A;  4CI1 A;  4JT5 C;  3PE7 A;  3T3P A;  3MUN A;  2XZG A;  3SBQ A;  5M61 A;  2HU5 A;  3JRO A;  1E8M A;  4J86 A;  4O2W A;  2H68 A;  3CIK B;  3EQ7 A;  2OK4 A;  3EU7 A;  1ERJ A;  5HE0 B;  2H13 A;  2I0R A;  1TYE A;  3OKY A;  5HE3 B;  4A7J A;  3EG6 A;  4J87 A;  2EBS A;  1PI6 A;  3NIG A;  3JPX A;  4AMY A;  3AFC A;  2H14 A;  2B5N A;  5EM2 B;  3A0F A;  4XYH A;  1N6E A;  2J55 H;  3EI4 B;  5EAL A;  5FKR A;  4WK4 A;  5FFO A;  3NVQ A;  4NBM A;  2MTA H;  2H3X A;  3IUR A;  5GSA A;  1E8N A;  2QC5 A;  2AGZ A;  4FA9 D;  3OL2 B;  5AMS A;  3SBR A;  4WJK A;  2B5L A;  1UOO A;  2HU8 A;  4FA4 D;  3K71 A;  4X3E A;  3EMH A;  4Z8L A;  2YB8 B;  3EI2 B;  5I5I A;  3IUQ A;  4U1E I;  3J80 g;  2I0S A;  2VDQ A;  5IJ8 E;  5CXB B;  1VE7 A;  5FA5 B;  3GRE A;  3I8E A;  5M5T A;  4FHL A;  2CO0 A;  3I2N A;  5EM2 A;  3K6S A;  2H9M A;  2IUV A;  3EI4 A;  4Z7N A;  3FM0 A;  2YNO A;  4JSN C;  4DNU A;  5I5J A;  2OK6 A;  4D0K A;  3O4J A;  2CN2 A;  4H5I A;  2H9P A;  3C5M A;  3MVD K;  1S4U X;  2AH0 A;  3OL2 A;  4BL0 A;  4FAV D;  2JKX A;  3IJC A;  4JD2 C;  5E6S A;  4GQ2 P;  4I79 A;  3JZG A;  3EI2 A;  3PXS D;  2B5M A;  4H5J A;  1QNI A;  5IGQ A;  3IVM A;  4BH6 A;  3EI1 B;  3UVO A;  5EMM B;  2OVR B;  3VA6 A;  3PXW D;  5CXB A;  5FLX g;  4A11 B;  5EAP A;  2HXC A;  3K72 A;  5JWZ A;  3OKW A;  5IC7 A;  2H47 A;  3PVU B;  4FAN D;  4IA9 A;  3O4I A;  4XYI A;  2P9I C;  5B4W A;  5THA A;  1GXR A;  3ZDZ A;  3I7P A;  4LG8 A;  2P9U C;  4ZOX A;  4BUJ C;  2IAA A;  3MKQ A;  3IIY A;  3QHY B;  2W18 A;  3U4Y A;  1VZ2 A;  1VZ3 A;  4PXW A;  5C86 A;  2H6K A;  3PXT D;  3PSL A;  1PEV A;  3EI1 A;  5TEE A;  5GXH A;  3N0E A;  4L1M A;  5C2W B;  4CY2 A;  5H14 A;  2IWK A;  1C9L A;  4A11 A;  2YMU A;  3UKR C;  5FKQ A;  1JTD B;  2VDO A;  2IUR A;  4HDJ A;  3FRX A;  1A0R B;  2AGL A;  3ZDX A;  3P4F A;  4ZOY A;  2CNX A;  4G1M A;  5E6U A;  2VDM A;  3IJE A;  3JRP A;  1YFQ A;  3ZDY A;  3ZE1 A;  2P9S C;  3KRW B;  2HKM A;  1U8C A;  3RFG A;  3VI3 A;  3I7N A;  4J8G A;  2BBK H;  2VDR A;  1K3I A;  1NR0 A;  4IMM A;  4WK2 A;  4ERQ A;  4U7A A;  5GXI A;  2Z2P A;  4O1Q D;  4ZN4 A;  4CY3 A;  4FA1 D;  1I2M B;  1VYH C;  1UTC A;  4QQE A;  2CE8 A;  1JOF A;  2QZP A;  3VI4 A;  2HKR A;  2XYI A;  4JSP C;  4Y5R D;  3FCS A;  3UVN A;  5H1M A;  2AQ5 A;  2J57 G;  4GM8 A;  3OKT A;  3AH8 B;  1U4C A;  1XIP A;  5M5V A;  1XKS A;  3SLE D;  3IUJ A;  3MUO A;  3ORV D;  3MZL A;  5EMJ B;  4BP8 A;  2VZ1 A;  5HQG A;  2EIE A;  3VGZ A;  1PBY B;  5AJA A;  3NVN A;  2GNQ A;  2WQ8 A;  2PM9 B;  3RSE C;  3RFH A;  4GGD A;  4GGC A;  2QR5 A;  5K19 A;  2I0T A;  1K8K C;  4ZOV A;  1N6D A;  3HFQ A;  4JXM A;  3JZN A;  5HYN B;  3SHF A;  4LG9 A;  4NSX A;  4J77 A;  3DDU A;  3MZK A;  4O45 A;  2G99 A;  4PBY A;  3V4V A;  4FA5 D;  3IUN A;  2P9P C;  3EWE A;  3I7O A;  3ZWL B;  1FWX A;  3DXM C;  2EID A;  3I7H A;  3KRX B;  1H2Z A;  1B9Y A;  4J0W A;  4PBZ A;  2AGY A;  2O9K A;  4J79 A;  3QI0 A;  3EQ8 A;  1N6F A;  3DXK C;  4J78 A;  3L4O D;  2PM9 A;  4IRZ A;  3SN6 B;  1UOP A;  1E5T A;  3NIF A;  1QFM A;  2XE4 A;  5C2V B;  2J56 H;  4A2L A;  4L3G D;  1L0Q A;  4CY1 A;  4PSW B;  3SMR A;  2VDP A;  5IT9 g;  3EQ9 A;  2YNP A;  1MDA H;  1TYQ C;  4L3H D;  2HJB A;  5EMK B;  2B4E A;  4CI3 A;  3SVW D;  3PSC B;  3W15 A;  5EAR A;  2OJY A;  4TZ4 A;  3C99 A;  3SWS D;  4L1Q D;  3RN0 D;  4MMZ A;  4PSX B;  1MG2 A;  3I89 A;  4GM3 A;  4X63 B;  4DNV A;  3IJ0 A;  1JMX B;  3CFV A;  3C9C A;  2HYE A;  2VDK A;  4GGA A;  5FQD A;  3C75 H;  3OF7 A;  4O3U B;  2H6N A;  3O4H A;  3T3M A;  1H2Y A;  3E0C A;  5EML B;  4G1E A;  4GMB A;  3PVW B;  4AMZ A;  1O6F A;  2OVP B;  1NEX B;  3MKS B;  5C92 A;  1QFS A;  3VH0 A;  4QAM A;  1L5G A;  3NVX A;  3SJL D;  4A2M A;  4J82 A;  3IUL A;  1OMW B;  4R7A B;  4L9O A;  4NC4 A;  4AEZ A;  5CYK B;  1B9X A;  3V9F A;  4D6V A;  4YVD A;  4E54 B;  4QRJ A;  3F3G A;  4UM9 A;  3MXX A;  5EAM A;  3NID A;  2PM7 B;  3RLM D;  2IUP A;  3JB9 L;  5GMK n;  2GC4 A;  4NEN A;  4ES0 A;  1JV2 A;  5FFG A;  1P22 A;  4KFM B;  4K3J B;  5TF2 A;  3SCY A;  4X61 B;  5M5R A;  3SXT D;  3K27 A;  4JHP C;  4O3T B;  5C9Z B;  4PNK B;  1R5M A;  4GM9 A;  1U2V C;  2TRC B;  3EI3 A;  3SBP A;  1RI6 A;  4A0A B;  3FCU A;  1SHY B;  4ERY A;  2HJ4 A;  3I7L A;  5FXY A;  5I5M A;  3ZE2 A;  1T2X A;  4GQB B;  4NAA A;  2EIB A;  4G56 B;  4D9S A;  3GC3 B;  2I3S A;  1OLZ A;  1SQ9 A;  2GC7 A;  3UVM A;  4BP9 A;  4QT8 A;  1VE6 A;  1H2X A;  5CYK A;  3N0D A;  4ESG A;  3KCI A;  4E54 A;  3IJ1 A;  5E6R A;  4BCC A;  4CZV A;  3FGB A;  1GG2 B;  3AL8 B;  4GZ8 A;  4OWR A;  4O02 A;  4RE6 A;  1GOH A;  1O6G A;  2I3T A;  3RN1 D;  1A12 A;  3DWL C;  5TEF A;  2P9L C;  4FB1 D;  3V5W B;  2BCJ B;  4A0A A;  2H6Q A;  4A0B B;  2P9N C;  1GOF A;  1YR2 A;  2AH1 A;  2Z2N A;  4JSX C;  5KDO B;  4UI9 R;  3UVK A;  4CY5 A;  4MMX A;  4PC0 A;  3IUM A;  4J0X A;  5HE1 B;  5K1C C;  1XHM A;  4FWW A;  3SFZ A;  4ZOZ A;  2PBI B;  3BWS A;  1TBG A;  5SXM A;  2P9K C;  2PM6 B;  1UOQ A;  3MMY A;  5FKS A;  2G9A A;  2HU7 A;  3AL8 A;  2CE9 A;  2UZY B;  2OIZ A;  1GOT B;  4WK0 A;  2OVQ B;  5A2Q g;  4CZY A;  2VZ3 A;  4AN1 A;  2AGW A;  3F3P A;  3AL9 A;  4AOW A;  2EIC A;  3UR4 A;  2XL2 A;  3O4G A;  4A0B A;  2QXV A;  5IGO A;  4AX4 A;  2XL3 A;  3RRM C;  4J84 A;  3OW8 A;  1MG3 A;  4Z7O A;  3UKU C;  1Q47 A; 
#chains in the Genus database with same CATH homology
 2IUQ A;  4A08 B;  3DM0 A;  4E5Z B;  1JMZ B;  1K32 A;  4EWR A;  2IWF A;  2H9L A;  4ERZ A;  5HE2 B;  5AFU 3;  3J81 g;  3OTT A;  1SQJ A;  2UZX B;  3I7K A;  3BG1 A;  3B7F A;  4A09 B;  4GQ1 A;  3ODT A;  4J73 A;  4X60 B;  4N14 A;  4OZU A;  4Y7R A;  4CC9 A;  3I8C A;  4K3I D;  2H9N A;  3EI3 B;  2HES X;  3BG0 A;  2Q7Q A;  4CI2 A;  5CXC B;  5H17 A;  3JZH A;  4J81 A;  2XU7 A;  4J8B A;  2Z2O A;  5TDH B;  1GP2 B;  4A08 A;  3ULE C;  3IIW A;  3JAM g;  4E5Z A;  3OKY B;  2CN3 A;  3RMZ D;  3IKO A;  4MK0 B;  4XEI C;  4CZX A;  3GFC A;  4CI8 A;  3F3F A;  1JJU B;  3K26 A;  4A09 A;  4JT6 C;  2YBA A;  4O9D A;  2CO0 C;  2AGX A;  3DSM A;  4LGN A;  5IJ7 E;  3L4M D;  1PGU A;  3V7D B;  5FKT A;  4QL1 A;  2YNN A;  3UVL A;  4JSV C;  3CFS B;  5CXC A;  4CI1 A;  4JT5 C;  3PE7 A;  3SBQ A;  3JRO A;  4J86 A;  2H68 A;  3CIK B;  2OK4 A;  3EU7 A;  1ERJ A;  5HE0 B;  2H13 A;  2I0R A;  3OKY A;  5HE3 B;  4A7J A;  3EG6 A;  4J87 A;  2EBS A;  1PI6 A;  3JPX A;  5EM2 B;  3AFC A;  2H14 A;  2B5N A;  3A0F A;  4XYH A;  1N6E A;  2J55 H;  3EI4 B;  5EAL A;  5FKR A;  3NVQ A;  2MTA H;  2H3X A;  5GSA A;  2QC5 A;  2AGZ A;  4FA9 D;  3OL2 B;  5AMS A;  3SBR A;  2B5L A;  4FA4 D;  4X3E A;  3EMH A;  4Z8L A;  2YB8 B;  3EI2 B;  5I5I A;  4U1E I;  3J80 g;  2I0S A;  5IJ8 E;  5CXB B;  5FA5 B;  3GRE A;  3I8E A;  4FHL A;  2CO0 A;  3I2N A;  5EM2 A;  2H9M A;  2IUV A;  3EI4 A;  3FM0 A;  2YNO A;  4JSN C;  5I5J A;  2OK6 A;  4D0K A;  2CN2 A;  4H5I A;  2H9P A;  3C5M A;  1S4U X;  2AH0 A;  3OL2 A;  4BL0 A;  4FAV D;  3IJC A;  4JD2 C;  4GQ2 P;  4I79 A;  3JZG A;  3EI2 A;  3PXS D;  2B5M A;  4H5J A;  1QNI A;  5IGQ A;  4BH6 A;  3EI1 B;  3UVO A;  5EMM B;  2OVR B;  3VA6 A;  3PXW D;  5CXB A;  5FLX g;  4A11 B;  5EAP A;  2HXC A;  5JWZ A;  3OKW A;  5IC7 A;  2H47 A;  3PVU B;  4FAN D;  4IA9 A;  4XYI A;  2P9I C;  5B4W A;  5THA A;  1GXR A;  3I7P A;  4LG8 A;  2P9U C;  4ZOX A;  4BUJ C;  2IAA A;  3MKQ A;  3IIY A;  2W18 A;  3U4Y A;  4PXW A;  2H6K A;  3PXT D;  3PSL A;  1PEV A;  3EI1 A;  5TEE A;  5GXH A;  3N0E A;  5C2W B;  4CY2 A;  5H14 A;  2IWK A;  4A11 A;  2YMU A;  3UKR C;  5FKQ A;  2IUR A;  4HDJ A;  3FRX A;  1A0R B;  2AGL A;  3P4F A;  4ZOY A;  2CNX A;  3JRP A;  1YFQ A;  2P9S C;  3KRW B;  2HKM A;  3RFG A;  3I7N A;  4J8G A;  2BBK H;  1NR0 A;  4IMM A;  4ERQ A;  5GXI A;  4U7A A;  2Z2P A;  4O1Q D;  4ZN4 A;  4CY3 A;  4FA1 D;  1VYH C;  4QQE A;  2CE8 A;  1JOF A;  2HKR A;  2XYI A;  4JSP C;  4Y5R D;  3UVN A;  5H1M A;  2AQ5 A;  2J57 G;  4GM8 A;  3OKT A;  3AH8 B;  1U4C A;  1XIP A;  1XKS A;  3SLE D;  3ORV D;  3MZL A;  5EMJ B;  5HQG A;  3VGZ A;  1PBY B;  5AJA A;  3NVN A;  2GNQ A;  2PM9 B;  3RSE C;  3RFH A;  4GGD A;  4GGC A;  5K19 A;  2I0T A;  1K8K C;  4ZOV A;  1N6D A;  3HFQ A;  4JXM A;  3JZN A;  5HYN B;  3SHF A;  4LG9 A;  4NSX A;  4J77 A;  3MZK A;  4O45 A;  2G99 A;  4PBY A;  4FA5 D;  2P9P C;  3EWE A;  3I7O A;  3ZWL B;  1FWX A;  3DXM C;  3I7H A;  3KRX B;  1B9Y A;  4J0W A;  4PBZ A;  2AGY A;  2O9K A;  4J79 A;  1N6F A;  3DXK C;  4J78 A;  3L4O D;  2PM9 A;  3SN6 B;  5C2V B;  2J56 H;  4A2L A;  4L3G D;  1L0Q A;  4CY1 A;  4PSW B;  3SMR A;  5IT9 g;  2YNP A;  1MDA H;  1TYQ C;  4L3H D;  2HJB A;  5EMK B;  2B4E A;  4CI3 A;  3SVW D;  3PSC B;  3W15 A;  5EAR A;  2OJY A;  4TZ4 A;  3C99 A;  3SWS D;  4L1Q D;  3RN0 D;  4PSX B;  1MG2 A;  3I89 A;  4GM3 A;  4X63 B;  3IJ0 A;  1JMX B;  3CFV A;  3C9C A;  2HYE A;  4GGA A;  5FQD A;  3C75 H;  4O3U B;  2H6N A;  3E0C A;  5EML B;  4GMB A;  3PVW B;  2OVP B;  1NEX B;  3MKS B;  3VH0 A;  3NVX A;  3SJL D;  4A2M A;  4J82 A;  1OMW B;  4R7A B;  4L9O A;  4AEZ A;  4D6V A;  5CYK B;  1B9X A;  3V9F A;  4YVD A;  4E54 B;  4QRJ A;  3F3G A;  3MXX A;  5EAM A;  2PM7 B;  3RLM D;  2IUP A;  3JB9 L;  5GMK n;  2GC4 A;  4ES0 A;  1P22 A;  4KFM B;  4K3J B;  5TF2 A;  3SCY A;  4X61 B;  3SXT D;  3K27 A;  4O3T B;  5C9Z B;  4PNK B;  1R5M A;  4GM9 A;  1U2V C;  2TRC B;  3EI3 A;  3SBP A;  1RI6 A;  4A0A B;  1SHY B;  4ERY A;  2HJ4 A;  3I7L A;  5FXY A;  5I5M A;  4GQB B;  4G56 B;  2I3S A;  1OLZ A;  1SQ9 A;  2GC7 A;  3UVM A;  4QT8 A;  4ESG A;  5CYK A;  3N0D A;  4E54 A;  3IJ1 A;  4CZV A;  3FGB A;  1GG2 B;  3AL8 B;  4GZ8 A;  4OWR A;  2I3T A;  3RN1 D;  3DWL C;  5TEF A;  2P9L C;  4FB1 D;  3V5W B;  2BCJ B;  4A0A A;  2H6Q A;  4A0B B;  2P9N C;  2AH1 A;  2Z2N A;  4JSX C;  5KDO B;  4UI9 R;  3UVK A;  4CY5 A;  4PC0 A;  4J0X A;  5HE1 B;  5K1C C;  1XHM A;  4FWW A;  3SFZ A;  4ZOZ A;  2PBI B;  3BWS A;  1TBG A;  5SXM A;  2P9K C;  2PM6 B;  3MMY A;  5FKS A;  2G9A A;  3AL8 A;  2CE9 A;  2UZY B;  2OIZ A;  1GOT B;  2OVQ B;  5A2Q g;  4CZY A;  2AGW A;  3F3P A;  3AL9 A;  4AOW A;  3UR4 A;  2XL2 A;  4A0B A;  2QXV A;  5IGO A;  2XL3 A;  3RRM C;  4J84 A;  3OW8 A;  1MG3 A;  3UKU C;  1Q47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...