4XYHA

Wild-type full length mis16 in schizosaccharomyces japonicus
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
402
structure length
375
Chain Sequence
LSEVDLEKKIQEEYKLWKQNVPFLYDLVITEALEWPSLTVEWFPGSEDNSSIQKLLLGTQTSGNDQNYLQVASVQLPTLDIVQKIHHEGDVNKARFMPQNPDIIATLGLNGNGYIFDLNLYREQPIVQTGHQACLRHHTSEGFGLGWNFIQEGTLATGTEDTSICVWDIKGKSLSLEKSIDVAPVSVYHRHTAVVNDLQFHLQHEALLTSVSDDCTLQIHDTRLPSSSSASQCVKAHEQPVNGVAFNPFNDYLLATASADHTVALWDLRRLNQRLHTLEGHEDEVYNVQWSPHDEPILVTSSTDRRVCVWDLSKIGEEQTVEDSEDGAPELMFMHGGHTNRVSDLSWNPNNKWVLASLADDNILQIWSPSKVIWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kinetochore protein Mis16
publication title Mis16 Independently Recognizes Histone H4 and the CENP-ACnp1-Specific Chaperone Scm3sp.
pubmed doi rcsb
source organism Schizosaccharomyces japonicus (strain yfs275 / fy16936)
molecule tags Chaperone
total genus 110
structure length 375
sequence length 402
ec nomenclature
pdb deposition date 2015-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF12265 CAF1C_H4-bd Histone-binding protein RBBP4 or subunit C of CAF1 complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4xyhA00
5FXYA 3V5WB 2I0TA 2H6QA 2HYEA 3F3PA 4GM9A 2H9MA 4LGNA 5EAMA 2AGWA 4QL1A 2HKRA 1VYHC 3AFCA 3EI1B 4ZN4A 4N14A 3I7KA 4IA9A 4Z8LA 3EI2A 2B5NA 3MKQA 4O3UB 2XU7A 4A09A 4I79A 2PM9B 4A08B 2IURA 3EI2B 1GXRA 2TRCB 5K19A 3AL8A 3HFQA 3I89A 1N6EA 3IIWA 4A09B 3PVUB 4A0AA 2CE9A 4X61B 5H17A 3NVNA 1R5MA 4CY2A 5EMKB 4D6VA 3KRWB 3SMRA 3L4MD 3DXMC 4CI3A 4A0AB 2PM7B 2YMUA 2CNXA 3UVLA 4FHLA 5CXCB 4CI2A 3JZNA 4GZ8A 3UVMA 1Q47A 3SJLD 5IJ7E 2O9KA 3F3FA 4FA9D 4CI1A 4GQ1A 4O1QD 2AGLA 2H9NA 1SQJA 4PSXB 2HKMA 2AH1A 4CY3A 3C99A 3ULEC 2XL2A 2P9IC 2P9UC 3E0CA 5GSAA 1FWXA 3JRPA 3VGZA 4J82A 3RN0D 4J8BA 2OVRB 2AH0A 1OMWB 4ES0A 5GMKn 3MKSB 4XEIC 2AGZA 4E54B 3BG1A 3SN6B 3I2NA 3AL9A 2H13A 4ESGA 3RMZD 4BL0A 4ERYA 2CN2A 4CZXA 3PVWB 4PNKB 5HE0B 2YNNA 5CYKB 5TF2A 3I8CA 2YNOA 3I7LA 2OVPB 4G56B 3I7OA 3UVKA 4FA1D 2GC4A 3J81g 4J79A 2AGYA 2I3SA 1K8KC 5FQDA 2CO0C 1OLZA 5IT9g 3DSMA 3PSCB 4L3GD 5EALA 2J56H 5TEEA 3OL2A 3CIKB 4A11A 3SXTD 5SXMA 5FKTA 2UZYB 5AFU3 3EI4A 4ERQA 3FRXA 3OL2B 3OKYA 4GM3A 2OK6A 5I5JA 5C9ZB 5FKSA 3EI4B 3IJ1A 4FA4D 3I8EA 4JSXC 3DM0A 4U1EI 1ERJA 2P9PC 2OK4A 2CO0A 3A0FA 4XYIA 4GM8A 3OW8A 3EI3A 3UVNA 5HYNB 1TBGA 1MG2A 3EI3B 3MMYA 1K32A 5I5IA 3IJ0A 1P22A 5IJ8E 4CY5A 3N0DA 4NSXA 2GNQA 3SCYA 4JSVC 3F3GA 3ORVD 3AL8B 4HDJA 3U4YA 3UVOA 5EAPA 2B5MA 3JZGA 1A0RB 2P9KC 4JT6C 4O9DA 4J8GA 4Y7RA 1MDAH 2OJYA 3OTTA 4BH6A 5KDOB 1B9XA 4ZOVA 4OZUA 2H6KA 1N6DA 3CFVA 3RN1D 3SVWD 5FLXg 2YBAA 5FKQA 3W15A 1N6FA 4PBYA 4CC9A 4K3ID 1JOFA 1GOTB 3PSLA 4X60B 3VH0A 5K1CC 3FM0A 3V9FA 1PGUA 3DXKC 4CI8A 3VA6A 2H68A 1XIPA 3PE7A 2XL3A 5EMMB 3MZKA 3PXSD 3ZWLB 2OVQB 3B7FA 2CE8A 3IIYA 2H9PA 5EMLB 2UZXB 1S4UX 2P9NC 5TDHB 2GC7A 4GGDA 1L0QA 4GGCA 5HE3B 5GXIA 2HJ4A 4E5ZA 3JAMg 4ZOZA 3K26A 2IUVA 3SFZA 3I7HA 2H3XA 1PBYB 3KRXB 3PXTD 4E5ZB 2Z2PA 1SHYB 4H5JA 3RFHA 3FGBA 2MTAH 2PBIB 5C2WB 5CXBA 4QRJA 4J81A 5JWZA 4LG8A 4J73A 3SWSD 5CXBB 2H47A 3ODTA 5A2Qg 4TZ4A 5FKRA 3IKOA 4EWRA 4GQ2P 4A2LA 3EG6A 3SBPA 2J55H 3PXWD 5IC7A 2HXCA 3JB9L 4L3HD 2XYIA 4A11B 4A2MA 2HESX 4JSNC 4PSWB 5EM2A 1B9YA 3CFSB 5H1MA 3OKYB 1TYQC 3C9CA 4U7AA 2AGXA 5EM2B 3GFCA 5H14A 4CY1A 4J87A 3NVQA 3UKUC 4GQBB 4O3TB 2B5LA 2IWFA 4K3JB 5FA5B 5EARA 3EI1A 4J86A 5AMSA 2I3TA 4GMBA 4FAVD 1SQ9A 4ZOXA 2H14A 1MG3A 2BCJB 2H9LA 3J80g 2W18A 3JROA 2B4EA 4A08A 2PM9A 2IWKA 1YFQA 2G99A 4JT5C 2Z2NA 2OIZA 3RRMC 4X63B 3AH8B 4FA5D 3BWSA 2YNPA 2Q7QA 2BBKH 3OKWA 4Y5RD 4OWRA 2P9LC 3N0EA 4PXWA 1JJUB 2I0RA 4A7JA 2P9SC 5CXCA 4CZVA 3EMHA 5AJAA 3UR4A 2IAAA 3NVXA 4L1QD 1GP2B 1U4CA 3RLMD 5C2VB 3IJCA 4BUJC 2IUQA 5I5MA 4FB1D 4LG9A 1JMZB 4ZOYA 4X3EA 4J77A 1NR0A 2H6NA 1PEVA 2Z2OA 5HE2B 4GGAA 3SHFA 3MXXA 4MK0B 3EWEA 3JPXA 3P4FA 3L4OD 3EU7A 1GG2B 4AEZA 4JXMA 3MZLA 5HE1B 4E54A 1XHMA 3RFGA 2YB8B 2IUPA 3I7PA 5B4WA 4J84A 1RI6A 4JSPC 3GREA 5CYKA 3K27A 3SLED 4L9OA 5HQGA 3JZHA 3OKTA 4J0WA 2CN3A 4H5IA 4XYHA 1PI6A 4J78A 4A0BA 2EBSA 4AOWA 3I7NA 2AQ5A 4JD2C 5IGQA 2HJBA 4FAND 4D0KA 4A0BB 4PC0A 4R7AB 2PM6B 5IGOA 1NEXB 1U2VC 2J57G 3C5MA 3DWLC 2I0SA 3V7DB 5THAA 3C75H 4QT8A 4IMMA 4QQEA 2G9AA 3UKRC 3SBQA 2QC5A 4KFMB 1QNIA 3SBRA 4YVDA 1JMXB 4FWWA 4J0XA 5TEFA 4CZYA 5GXHA 4PBZA 3RSEC 5EMJB 1XKSA 2QXVA 3BG0A 4UI9R 4ERZA 4O45A
chains in the Genus database with same CATH superfamily
5FXYA 3V5WB 2I0TA 2H6QA 2HYEA 3F3PA 4GM9A 2H9MA 4LGNA 4D9SA 1GOHA 5EAMA 2AGWA 3ZDZA 4QL1A 3IUNA 4WK4A 2HKRA 1VYHC 2HU7A 2VDPA 4AMZA 3AFCA 2WQ8A 4ZN4A 3EI1B 4N14A 3I7KA 4IA9A 4Z8LA 4Z7NA 3NIDA 3EI2A 2B5NA 3MKQA 4O3UB 2XZGA 2XU7A 3IURA 4A09A 4I79A 2PM9B 4A08B 1H2WA 2IURA 1VE6A 3EI2B 1GXRA 2TRCB 5K19A 3AL8A 3HFQA 3I89A 1N6EA 3IIWA 4G1EA 4A09B 3QI0A 3PVUB 4A0AA 5E6SA 2CE9A 4X61B 5H17A 5M5RA 3NVNA 1QFMA 1R5MA 4CY2A 5EMKB 4D6VA 3KRWB 3SMRA 3L4MD 3DXMC 4CI3A 4A0AB 2PM7B 2YMUA 2CNXA 3UVLA 4FHLA 5CXCB 4CI2A 3JZNA 4GZ8A 3UVMA 1Q47A 3SJLD 1E5TA 5IJ7E 2O9KA 1GOGA 2XE4A 2HU8A 3F3FA 1M1XA 4FA9D 1H2YA 4CI1A 4NAAA 3T3PA 1E8MA 4GQ1A 4O1QD 2AGLA 4QAMA 3ZE0A 2H9NA 1SQJA 4PSXB 3ZE2A 2HKMA 2AH1A 2QR5A 4CY3A 3C99A 3O4HA 3ULEC 2XL2A 3QHYB 2P9IC 2P9UC 4WJKA 4BCDA 3E0CA 5GSAA 4BP8A 1FWXA 3JRPA 3VGZA 4G55A 4J82A 1VE7A 3RN0D 4J8BA 2OVRB 2AH0A 1OMWB 4ES0A 5GMKn 3IULA 3MKSB 4XEIC 2AGZA 1VZ3A 4E54B 3BG1A 3SN6B 3I2NA 4DNVA 3AL9A 2H13A 1JTDB 3MVDK 2VDLA 4ESGA 3RMZD 1C9IA 4BL0A 4ERYA 2CN2A 4CZXA 3PVWB 4PNKB 5HE0B 3O4JA 2YNNA 5CYKB 5TF2A 3I8CA 5C86A 2YNOA 1YR2A 4IRZA 3EQ7A 3I7LA 2OVPB 4G56B 3I7OA 3IUMA 3UVKA 4FA1D 2GC4A 3J81g 1UOOA 4J79A 2AGYA 2I3SA 1K8KC 5FQDA 2CO0C 1OLZA 5IT9g 3DSMA 3IUJA 3PSCB 4L3GD 5EALA 2J56H 5TEEA 3OL2A 3CIKB 3KCIA 4A11A 3SXTD 2EIEA 5SXMA 5FKTA 1K3IA 4O2WA 2UZYB 1BPOA 5AFU3 3EI4A 3NIFA 2VZ1A 4ERQA 3FRXA 3OL2B 3OKYA 4GM3A 2OK6A 5I5JA 5C9ZB 5FKSA 3MUNA 3EI4B 3IJ1A 3T3MA 4FA4D 3I8EA 4JSXC 3DM0A 4U1EI 1ERJA 2P9PC 2OK4A 2CO0A 3A0FA 4XYIA 4GM8A 3OW8A 3EI3A 3UVNA 5HYNB 1O6GA 2VDQA 4MMXA 1TBGA 1MG2A 3EI3B 3MMYA 1K32A 3O4IA 5I5IA 3IJ0A 1QFSA 1P22A 1T2XA 5IJ8E 4MMYA 4CY5A 3N0DA 2VZ3A 4NSXA 2GNQA 3SCYA 4JSVC 3F3GA 3ZDXA 3ORVD 3AL8B 4HDJA 1UOPA 4UM8A 3FCSA 3U4YA 3K6SA 2JKXA 3UVOA 5EAPA 2B5MA 3JZGA 1A0RB 2P9KC 4JT6C 1VZ2A 4O9DA 4J8GA 4Y7RA 1MDAH 2OJYA 3OTTA 4BH6A 4Z7OA 5KDOB 1B9XA 3IUQA 3FCUA 3IVMA 4ZOVA 4OZUA 2H6KA 1N6DA 3CFVA 3RN1D 3SVWD 5FLXg 2YBAA 5FKQA 3W15A 1N6FA 3ZDYA 4PBYA 1O6FA 4CC9A 4K3ID 1JOFA 1GOTB 3PSLA 2EIBA 4X60B 3VH0A 5K1CC 3FM0A 3V9FA 1PGUA 3DXKC 4CI8A 3VA6A 2H68A 1XIPA 3PE7A 2XL3A 5EMMB 3MZKA 3PXSD 3ZWLB 2OVQB 2HU5A 2CE8A 3B7FA 5M61A 3IIYA 2H9PA 5EMLB 2UZXB 4JHPC 1S4UX 3DDUA 1U8CA 2P9NC 5TDHB 4DNWA 2GC7A 4GGDA 1L0QA 4GGCA 5HE3B 4WK0A 5GXIA 2HJ4A 4E5ZA 3JAMg 5FFGA 4ZOZA 3K26A 2IUVA 3SFZA 3I7HA 2H3XA 1PBYB 2BKLA 3KRXB 3PXTD 4DNUA 4E5ZB 3V4PA 2Z2PA 1SHYB 4AN0A 4H5JA 3RFHA 3FGBA 2MTAH 2PBIB 5C2WB 5CXBA 5M5VA 4QRJA 2VDKA 4J81A 5JWZA 4LG8A 4J73A 3SWSD 5CXBB 2H47A 3ODTA 5A2Qg 3GC3B 4TZ4A 5FKRA 3IKOA 4EWRA 4GQ2P 4BCBA 4A2LA 3EG6A 3SBPA 2VDRA 2J55H 3PXWD 5IC7A 2HXCA 3JB9L 4L3HD 2XYIA 4RE6A 4A11B 1JV2A 4A2MA 2HESX 4AN1A 4JSNC 4PSWB 5EM2A 3EQ8A 1B9YA 3CFSB 4G1MA 5H1MA 2EIDA 3OKYB 1TYQC 3ZE1A 3C9CA 1L5GA 4U7AA 5M5SA 2AGXA 5EM2B 3GFCA 5H14A 4CY1A 4J87A 3NIGA 3NVQA 3UKUC 3O4GA 1I2MB 4GQBB 5M5UA 4O3TB 2B5LA 2IWFA 3IJEA 4K3JB 1GOFA 5FA5B 5EARA 3K71A 4J86A 5AMSA 3EI1A 1UOQA 2I3TA 5E6RA 4GMBA 4FAVD 1SQ9A 4ZOXA 2H14A 4AX4A 1MG3A 2BCJB 2H9LA 3J80g 2W18A 3JROA 2B4EA 1C9LA 2PM9A 4A08A 2IWKA 1YFQA 2G99A 4JT5C 2Z2NA 2OIZA 4WK2A 3GD1I 3RRMC 4NC4A 1TYEA 4X63B 3AH8B 4FA5D 3BWSA 2YNPA 4BP9A 2Q7QA 4BCCA 2BBKH 3OKWA 4Y5RD 4OWRA 1UTCA 2P9LC 2VDMA 3N0EA 4Z7QA 4PXWA 1JJUB 2EICA 2I0RA 5C92A 4A7JA 2P9SC 5CXCA 4CZVA 3EMHA 5AJAA 3UR4A 2IAAA 3NVXA 1E8NA 3EQ9A 4L1QD 3V4VA 4L1MA 1GP2B 3OF7A 1U4CA 3K72A 3RLMD 3IJCA 4BUJC 2IUQA 5C2VB 4FB1D 5I5MA 4NBMA 4LG9A 1JMZB 4ZOYA 4X3EA 4J77A 1NR0A 2QZPA 2H6NA 1PEVA 2Z2OA 5M5TA 4AMYA 5HE2B 4GGAA 4RE5A 3SHFA 3MXXA 4MK0B 1H2XA 2VDNA 3EWEA 3JPXA 3P4FA 4NENA 3L4OD 3MUOA 3EU7A 1GG2B 4AEZA 5HDBA 4JXMA 3MZLA 5HE1B 4E54A 4JHNA 1XHMA 3RFGA 2YB8B 2IUPA 5FFOA 3I7PA 5B4WA 4J84A 1RI6A 4JSPC 3GREA 5CYKA 3K27A 3SLED 4L9OA 4UM9A 5HQGA 3JZHA 3OKTA 4MMZA 4J0WA 2CN3A 4H5IA 1H2ZA 4XYHA 1PI6A 4J78A 4A0BA 2EBSA 4AOWA 3I7NA 2AQ5A 4JD2C 5IGQA 2HJBA 4FAND 4D0KA 4A0BB 4O02A 4PC0A 4R7AB 2PM6B 5IGOA 5E6UA 1NEXB 1U2VC 2J57G 3C5MA 3DWLC 2I0SA 2XDWA 1A12A 3V7DB 3VI4A 5THAA 3C75H 4QT8A 4IMMA 4QQEA 2G9AA 3UKRC 3SBQA 2QC5A 4KFMB 1QNIA 3SBRA 4YVDA 1JMXB 4FWWA 4J0XA 5TEFA 4CZYA 5GXHA 4PBZA 3RSEC 3VI3A 5EMJB 2VDOA 1XKSA 2QXVA 3BG0A 2VC2A 4UI9R 4ERZA 4O45A
chains in the Genus database with same CATH topology
5FXYA 3V5WB 2I0TA 2H6QA 2HYEA 3F3PA 4GM9A 2H9MA 4LGNA 5EAMA 2AGWA 4QL1A 2HKRA 1VYHC 3AFCA 3EI1B 4ZN4A 4N14A 3I7KA 4IA9A 4Z8LA 3EI2A 2B5NA 3MKQA 4O3UB 2XU7A 4A09A 4I79A 2PM9B 4A08B 2IURA 3EI2B 1GXRA 2TRCB 5K19A 3AL8A 3HFQA 3I89A 1N6EA 3IIWA 4A09B 3PVUB 4A0AA 2CE9A 4X61B 5H17A 3NVNA 1R5MA 4CY2A 5EMKB 4D6VA 3KRWB 3SMRA 3L4MD 3DXMC 4CI3A 4A0AB 2PM7B 2YMUA 2CNXA 3UVLA 4FHLA 5CXCB 4CI2A 3JZNA 4GZ8A 3UVMA 1Q47A 3SJLD 5IJ7E 2O9KA 3F3FA 4FA9D 4CI1A 4GQ1A 4O1QD 2AGLA 2H9NA 1SQJA 4PSXB 2HKMA 2AH1A 4CY3A 3C99A 3ULEC 2XL2A 2P9IC 2P9UC 3E0CA 5GSAA 1FWXA 3JRPA 3VGZA 4J82A 3RN0D 4J8BA 2OVRB 2AH0A 1OMWB 4ES0A 5GMKn 3MKSB 4XEIC 2AGZA 4E54B 3BG1A 3SN6B 3I2NA 3AL9A 2H13A 4ESGA 3RMZD 4BL0A 4ERYA 2CN2A 4CZXA 3PVWB 4PNKB 5HE0B 2YNNA 5CYKB 5TF2A 3I8CA 2YNOA 3I7LA 2OVPB 4G56B 3I7OA 3UVKA 4FA1D 2GC4A 3J81g 4J79A 2AGYA 2I3SA 1K8KC 5FQDA 2CO0C 1OLZA 5IT9g 3DSMA 3PSCB 4L3GD 5EALA 2J56H 5TEEA 3OL2A 3CIKB 4A11A 3SXTD 5SXMA 5FKTA 2UZYB 5AFU3 3EI4A 4ERQA 3FRXA 3OL2B 3OKYA 4GM3A 2OK6A 5I5JA 5C9ZB 5FKSA 3EI4B 3IJ1A 4FA4D 3I8EA 4JSXC 3DM0A 4U1EI 1ERJA 2P9PC 2OK4A 2CO0A 3A0FA 4XYIA 4GM8A 3OW8A 3EI3A 3UVNA 5HYNB 1TBGA 1MG2A 3EI3B 3MMYA 1K32A 5I5IA 3IJ0A 1P22A 5IJ8E 4CY5A 3N0DA 4NSXA 2GNQA 3SCYA 4JSVC 3F3GA 3ORVD 3AL8B 4HDJA 3U4YA 3UVOA 5EAPA 2B5MA 3JZGA 1A0RB 2P9KC 4JT6C 4O9DA 4J8GA 4Y7RA 1MDAH 2OJYA 3OTTA 4BH6A 5KDOB 1B9XA 4ZOVA 4OZUA 2H6KA 1N6DA 3CFVA 3RN1D 3SVWD 5FLXg 2YBAA 5FKQA 3W15A 1N6FA 4PBYA 4CC9A 4K3ID 1JOFA 1GOTB 3PSLA 4X60B 3VH0A 5K1CC 3FM0A 3V9FA 1PGUA 3DXKC 4CI8A 3VA6A 2H68A 1XIPA 3PE7A 2XL3A 5EMMB 3MZKA 3PXSD 3ZWLB 2OVQB 3B7FA 2CE8A 3IIYA 2H9PA 5EMLB 2UZXB 1S4UX 2P9NC 5TDHB 2GC7A 4GGDA 1L0QA 4GGCA 5HE3B 5GXIA 2HJ4A 4E5ZA 3JAMg 4ZOZA 3K26A 2IUVA 3SFZA 3I7HA 2H3XA 1PBYB 3KRXB 3PXTD 4E5ZB 2Z2PA 1SHYB 4H5JA 3RFHA 3FGBA 2MTAH 2PBIB 5C2WB 5CXBA 4QRJA 4J81A 5JWZA 4LG8A 4J73A 3SWSD 5CXBB 2H47A 3ODTA 5A2Qg 4TZ4A 5FKRA 3IKOA 4EWRA 4GQ2P 4A2LA 3EG6A 3SBPA 2J55H 3PXWD 5IC7A 2HXCA 3JB9L 4L3HD 2XYIA 4A11B 4A2MA 2HESX 4JSNC 4PSWB 5EM2A 1B9YA 3CFSB 5H1MA 3OKYB 1TYQC 3C9CA 4U7AA 2AGXA 5EM2B 3GFCA 5H14A 4CY1A 4J87A 3NVQA 3UKUC 4GQBB 4O3TB 2B5LA 2IWFA 4K3JB 5FA5B 5EARA 3EI1A 4J86A 5AMSA 2I3TA 4GMBA 4FAVD 1SQ9A 4ZOXA 2H14A 1MG3A 2BCJB 2H9LA 3J80g 2W18A 3JROA 2B4EA 4A08A 2PM9A 2IWKA 1YFQA 2G99A 4JT5C 2Z2NA 2OIZA 3RRMC 4X63B 3AH8B 4FA5D 3BWSA 2YNPA 2Q7QA 2BBKH 3OKWA 4Y5RD 4OWRA 2P9LC 3N0EA 4PXWA 1JJUB 2I0RA 4A7JA 2P9SC 5CXCA 4CZVA 3EMHA 5AJAA 3UR4A 2IAAA 3NVXA 4L1QD 1GP2B 1U4CA 3RLMD 5C2VB 3IJCA 4BUJC 2IUQA 5I5MA 4FB1D 4LG9A 1JMZB 4ZOYA 4X3EA 4J77A 1NR0A 2H6NA 1PEVA 2Z2OA 5HE2B 4GGAA 3SHFA 3MXXA 4MK0B 3EWEA 3JPXA 3P4FA 3L4OD 3EU7A 1GG2B 4AEZA 4JXMA 3MZLA 5HE1B 4E54A 1XHMA 3RFGA 2YB8B 2IUPA 3I7PA 5B4WA 4J84A 1RI6A 4JSPC 3GREA 5CYKA 3K27A 3SLED 4L9OA 5HQGA 3JZHA 3OKTA 4J0WA 2CN3A 4H5IA 4XYHA 1PI6A 4J78A 4A0BA 2EBSA 4AOWA 3I7NA 2AQ5A 4JD2C 5IGQA 2HJBA 4FAND 4D0KA 4A0BB 4PC0A 4R7AB 2PM6B 5IGOA 1NEXB 1U2VC 2J57G 3C5MA 3DWLC 2I0SA 3V7DB 5THAA 3C75H 4QT8A 4IMMA 4QQEA 2G9AA 3UKRC 3SBQA 2QC5A 4KFMB 1QNIA 3SBRA 4YVDA 1JMXB 4FWWA 4J0XA 5TEFA 4CZYA 5GXHA 4PBZA 3RSEC 5EMJB 1XKSA 2QXVA 3BG0A 4UI9R 4ERZA 4O45A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FXY A;  3V5W B;  2I0T A;  2H6Q A;  2HYE A;  3F3P A;  4GM9 A;  2H9M A;  4LGN A;  5EAM A;  2AGW A;  4QL1 A;  2HKR A;  1VYH C;  3AFC A;  3EI1 B;  4ZN4 A;  4N14 A;  3I7K A;  4IA9 A;  4Z8L A;  3EI2 A;  2B5N A;  3MKQ A;  4O3U B;  2XU7 A;  4A09 A;  4I79 A;  2PM9 B;  4A08 B;  2IUR A;  3EI2 B;  1GXR A;  2TRC B;  5K19 A;  3AL8 A;  3HFQ A;  3I89 A;  1N6E A;  3IIW A;  4A09 B;  3PVU B;  4A0A A;  2CE9 A;  4X61 B;  5H17 A;  3NVN A;  1R5M A;  4CY2 A;  5EMK B;  4D6V A;  3KRW B;  3SMR A;  3L4M D;  3DXM C;  4CI3 A;  4A0A B;  2PM7 B;  2YMU A;  2CNX A;  3UVL A;  4FHL A;  5CXC B;  4CI2 A;  3JZN A;  4GZ8 A;  3UVM A;  1Q47 A;  3SJL D;  5IJ7 E;  2O9K A;  3F3F A;  4FA9 D;  4CI1 A;  4GQ1 A;  4O1Q D;  2AGL A;  2H9N A;  1SQJ A;  4PSX B;  2HKM A;  2AH1 A;  4CY3 A;  3C99 A;  3ULE C;  2XL2 A;  2P9I C;  2P9U C;  3E0C A;  5GSA A;  1FWX A;  3JRP A;  3VGZ A;  4J82 A;  3RN0 D;  4J8B A;  2OVR B;  2AH0 A;  1OMW B;  4ES0 A;  5GMK n;  3MKS B;  4XEI C;  2AGZ A;  4E54 B;  3BG1 A;  3SN6 B;  3I2N A;  3AL9 A;  2H13 A;  4ESG A;  3RMZ D;  4BL0 A;  4ERY A;  2CN2 A;  4CZX A;  3PVW B;  4PNK B;  5HE0 B;  2YNN A;  5CYK B;  5TF2 A;  3I8C A;  2YNO A;  3I7L A;  2OVP B;  4G56 B;  3I7O A;  3UVK A;  4FA1 D;  2GC4 A;  3J81 g;  4J79 A;  2AGY A;  2I3S A;  1K8K C;  5FQD A;  2CO0 C;  1OLZ A;  5IT9 g;  3DSM A;  3PSC B;  4L3G D;  5EAL A;  2J56 H;  5TEE A;  3OL2 A;  3CIK B;  4A11 A;  3SXT D;  5SXM A;  5FKT A;  2UZY B;  5AFU 3;  3EI4 A;  4ERQ A;  3FRX A;  3OL2 B;  3OKY A;  4GM3 A;  2OK6 A;  5I5J A;  5C9Z B;  5FKS A;  3EI4 B;  3IJ1 A;  4FA4 D;  3I8E A;  4JSX C;  3DM0 A;  4U1E I;  1ERJ A;  2P9P C;  2OK4 A;  2CO0 A;  3A0F A;  4XYI A;  4GM8 A;  3OW8 A;  3EI3 A;  3UVN A;  5HYN B;  1TBG A;  1MG2 A;  3EI3 B;  3MMY A;  1K32 A;  5I5I A;  3IJ0 A;  1P22 A;  5IJ8 E;  4CY5 A;  3N0D A;  4NSX A;  2GNQ A;  3SCY A;  4JSV C;  3F3G A;  3ORV D;  3AL8 B;  4HDJ A;  3U4Y A;  3UVO A;  5EAP A;  2B5M A;  3JZG A;  1A0R B;  2P9K C;  4JT6 C;  4O9D A;  4J8G A;  4Y7R A;  1MDA H;  2OJY A;  3OTT A;  4BH6 A;  5KDO B;  1B9X A;  4ZOV A;  4OZU A;  2H6K A;  1N6D A;  3CFV A;  3RN1 D;  3SVW D;  5FLX g;  2YBA A;  5FKQ A;  3W15 A;  1N6F A;  4PBY A;  4CC9 A;  4K3I D;  1JOF A;  1GOT B;  3PSL A;  4X60 B;  3VH0 A;  5K1C C;  3FM0 A;  3V9F A;  1PGU A;  3DXK C;  4CI8 A;  3VA6 A;  2H68 A;  1XIP A;  3PE7 A;  2XL3 A;  5EMM B;  3MZK A;  3PXS D;  3ZWL B;  2OVQ B;  3B7F A;  2CE8 A;  3IIY A;  2H9P A;  5EML B;  2UZX B;  1S4U X;  2P9N C;  5TDH B;  2GC7 A;  4GGD A;  1L0Q A;  4GGC A;  5HE3 B;  5GXI A;  2HJ4 A;  4E5Z A;  3JAM g;  4ZOZ A;  3K26 A;  2IUV A;  3SFZ A;  3I7H A;  2H3X A;  1PBY B;  3KRX B;  3PXT D;  4E5Z B;  2Z2P A;  1SHY B;  4H5J A;  3RFH A;  3FGB A;  2MTA H;  2PBI B;  5C2W B;  5CXB A;  4QRJ A;  4J81 A;  5JWZ A;  4LG8 A;  4J73 A;  3SWS D;  5CXB B;  2H47 A;  3ODT A;  5A2Q g;  4TZ4 A;  5FKR A;  3IKO A;  4EWR A;  4GQ2 P;  4A2L A;  3EG6 A;  3SBP A;  2J55 H;  3PXW D;  5IC7 A;  2HXC A;  3JB9 L;  4L3H D;  2XYI A;  4A11 B;  4A2M A;  2HES X;  4JSN C;  4PSW B;  5EM2 A;  1B9Y A;  3CFS B;  5H1M A;  3OKY B;  1TYQ C;  3C9C A;  4U7A A;  2AGX A;  5EM2 B;  3GFC A;  5H14 A;  4CY1 A;  4J87 A;  3NVQ A;  3UKU C;  4GQB B;  4O3T B;  2B5L A;  2IWF A;  4K3J B;  5FA5 B;  5EAR A;  3EI1 A;  4J86 A;  5AMS A;  2I3T A;  4GMB A;  4FAV D;  1SQ9 A;  4ZOX A;  2H14 A;  1MG3 A;  2BCJ B;  2H9L A;  3J80 g;  2W18 A;  3JRO A;  2B4E A;  4A08 A;  2PM9 A;  2IWK A;  1YFQ A;  2G99 A;  4JT5 C;  2Z2N A;  2OIZ A;  3RRM C;  4X63 B;  3AH8 B;  4FA5 D;  3BWS A;  2YNP A;  2Q7Q A;  2BBK H;  3OKW A;  4Y5R D;  4OWR A;  2P9L C;  3N0E A;  4PXW A;  1JJU B;  2I0R A;  4A7J A;  2P9S C;  5CXC A;  4CZV A;  3EMH A;  5AJA A;  3UR4 A;  2IAA A;  3NVX A;  4L1Q D;  1GP2 B;  1U4C A;  3RLM D;  5C2V B;  3IJC A;  4BUJ C;  2IUQ A;  5I5M A;  4FB1 D;  4LG9 A;  1JMZ B;  4ZOY A;  4X3E A;  4J77 A;  1NR0 A;  2H6N A;  1PEV A;  2Z2O A;  5HE2 B;  4GGA A;  3SHF A;  3MXX A;  4MK0 B;  3EWE A;  3JPX A;  3P4F A;  3L4O D;  3EU7 A;  1GG2 B;  4AEZ A;  4JXM A;  3MZL A;  5HE1 B;  4E54 A;  1XHM A;  3RFG A;  2YB8 B;  2IUP A;  3I7P A;  5B4W A;  4J84 A;  1RI6 A;  4JSP C;  3GRE A;  5CYK A;  3K27 A;  3SLE D;  4L9O A;  5HQG A;  3JZH A;  3OKT A;  4J0W A;  2CN3 A;  4H5I A;  4XYH A;  1PI6 A;  4J78 A;  4A0B A;  2EBS A;  4AOW A;  3I7N A;  2AQ5 A;  4JD2 C;  5IGQ A;  2HJB A;  4FAN D;  4D0K A;  4A0B B;  4PC0 A;  4R7A B;  2PM6 B;  5IGO A;  1NEX B;  1U2V C;  2J57 G;  3C5M A;  3DWL C;  2I0S A;  3V7D B;  5THA A;  3C75 H;  4QT8 A;  4IMM A;  4QQE A;  2G9A A;  3UKR C;  3SBQ A;  2QC5 A;  4KFM B;  1QNI A;  3SBR A;  4YVD A;  1JMX B;  4FWW A;  4J0X A;  5TEF A;  4CZY A;  5GXH A;  4PBZ A;  3RSE C;  5EMJ B;  1XKS A;  2QXV A;  3BG0 A;  4UI9 R;  4ERZ A;  4O45 A; 
#chains in the Genus database with same CATH topology
 5FXY A;  3V5W B;  2I0T A;  2H6Q A;  2HYE A;  3F3P A;  4GM9 A;  2H9M A;  4LGN A;  4D9S A;  1GOH A;  5EAM A;  2AGW A;  3ZDZ A;  4QL1 A;  3IUN A;  4WK4 A;  2HKR A;  1VYH C;  2HU7 A;  2VDP A;  4AMZ A;  3AFC A;  2WQ8 A;  4ZN4 A;  3EI1 B;  4N14 A;  3I7K A;  4IA9 A;  4Z8L A;  4Z7N A;  3NID A;  3EI2 A;  2B5N A;  3MKQ A;  4O3U B;  2XZG A;  2XU7 A;  3IUR A;  4A09 A;  4I79 A;  2PM9 B;  4A08 B;  1H2W A;  2IUR A;  1VE6 A;  3EI2 B;  1GXR A;  2TRC B;  5K19 A;  3AL8 A;  3HFQ A;  3I89 A;  1N6E A;  3IIW A;  4G1E A;  4A09 B;  3QI0 A;  3PVU B;  4A0A A;  5E6S A;  2CE9 A;  4X61 B;  5H17 A;  5M5R A;  3NVN A;  1QFM A;  1R5M A;  4CY2 A;  5EMK B;  4D6V A;  3KRW B;  3SMR A;  3L4M D;  3DXM C;  4CI3 A;  4A0A B;  2PM7 B;  2YMU A;  2CNX A;  3UVL A;  4FHL A;  5CXC B;  4CI2 A;  3JZN A;  4GZ8 A;  3UVM A;  1Q47 A;  3SJL D;  1E5T A;  5IJ7 E;  2O9K A;  1GOG A;  2XE4 A;  2HU8 A;  3F3F A;  1M1X A;  4FA9 D;  1H2Y A;  4CI1 A;  4NAA A;  3T3P A;  1E8M A;  4GQ1 A;  4O1Q D;  2AGL A;  4QAM A;  3ZE0 A;  2H9N A;  1SQJ A;  4PSX B;  3ZE2 A;  2HKM A;  2AH1 A;  2QR5 A;  4CY3 A;  3C99 A;  3O4H A;  3ULE C;  2XL2 A;  3QHY B;  2P9I C;  2P9U C;  4WJK A;  4BCD A;  3E0C A;  5GSA A;  4BP8 A;  1FWX A;  3JRP A;  3VGZ A;  4G55 A;  4J82 A;  1VE7 A;  3RN0 D;  4J8B A;  2OVR B;  2AH0 A;  1OMW B;  4ES0 A;  5GMK n;  3IUL A;  3MKS B;  4XEI C;  2AGZ A;  1VZ3 A;  4E54 B;  3BG1 A;  3SN6 B;  3I2N A;  4DNV A;  3AL9 A;  2H13 A;  1JTD B;  3MVD K;  2VDL A;  4ESG A;  3RMZ D;  1C9I A;  4BL0 A;  4ERY A;  2CN2 A;  4CZX A;  3PVW B;  4PNK B;  5HE0 B;  3O4J A;  2YNN A;  5CYK B;  5TF2 A;  3I8C A;  5C86 A;  2YNO A;  1YR2 A;  4IRZ A;  3EQ7 A;  3I7L A;  2OVP B;  4G56 B;  3I7O A;  3IUM A;  3UVK A;  4FA1 D;  2GC4 A;  3J81 g;  1UOO A;  4J79 A;  2AGY A;  2I3S A;  1K8K C;  5FQD A;  2CO0 C;  1OLZ A;  5IT9 g;  3DSM A;  3IUJ A;  3PSC B;  4L3G D;  5EAL A;  2J56 H;  5TEE A;  3OL2 A;  3CIK B;  3KCI A;  4A11 A;  3SXT D;  2EIE A;  5SXM A;  5FKT A;  1K3I A;  4O2W A;  2UZY B;  1BPO A;  5AFU 3;  3EI4 A;  3NIF A;  2VZ1 A;  4ERQ A;  3FRX A;  3OL2 B;  3OKY A;  4GM3 A;  2OK6 A;  5I5J A;  5C9Z B;  5FKS A;  3MUN A;  3EI4 B;  3IJ1 A;  3T3M A;  4FA4 D;  3I8E A;  4JSX C;  3DM0 A;  4U1E I;  1ERJ A;  2P9P C;  2OK4 A;  2CO0 A;  3A0F A;  4XYI A;  4GM8 A;  3OW8 A;  3EI3 A;  3UVN A;  5HYN B;  1O6G A;  2VDQ A;  4MMX A;  1TBG A;  1MG2 A;  3EI3 B;  3MMY A;  1K32 A;  3O4I A;  5I5I A;  3IJ0 A;  1QFS A;  1P22 A;  1T2X A;  5IJ8 E;  4MMY A;  4CY5 A;  3N0D A;  2VZ3 A;  4NSX A;  2GNQ A;  3SCY A;  4JSV C;  3F3G A;  3ZDX A;  3ORV D;  3AL8 B;  4HDJ A;  1UOP A;  4UM8 A;  3FCS A;  3U4Y A;  3K6S A;  2JKX A;  3UVO A;  5EAP A;  2B5M A;  3JZG A;  1A0R B;  2P9K C;  4JT6 C;  1VZ2 A;  4O9D A;  4J8G A;  4Y7R A;  1MDA H;  2OJY A;  3OTT A;  4BH6 A;  4Z7O A;  5KDO B;  1B9X A;  3IUQ A;  3FCU A;  3IVM A;  4ZOV A;  4OZU A;  2H6K A;  1N6D A;  3CFV A;  3RN1 D;  3SVW D;  5FLX g;  2YBA A;  5FKQ A;  3W15 A;  1N6F A;  3ZDY A;  4PBY A;  1O6F A;  4CC9 A;  4K3I D;  1JOF A;  1GOT B;  3PSL A;  2EIB A;  4X60 B;  3VH0 A;  5K1C C;  3FM0 A;  3V9F A;  1PGU A;  3DXK C;  4CI8 A;  3VA6 A;  2H68 A;  1XIP A;  3PE7 A;  2XL3 A;  5EMM B;  3MZK A;  3PXS D;  3ZWL B;  2OVQ B;  2HU5 A;  2CE8 A;  3B7F A;  5M61 A;  3IIY A;  2H9P A;  5EML B;  2UZX B;  4JHP C;  1S4U X;  3DDU A;  1U8C A;  2P9N C;  5TDH B;  4DNW A;  2GC7 A;  4GGD A;  1L0Q A;  4GGC A;  5HE3 B;  4WK0 A;  5GXI A;  2HJ4 A;  4E5Z A;  3JAM g;  5FFG A;  4ZOZ A;  3K26 A;  2IUV A;  3SFZ A;  3I7H A;  2H3X A;  1PBY B;  2BKL A;  3KRX B;  3PXT D;  4DNU A;  4E5Z B;  3V4P A;  2Z2P A;  1SHY B;  4AN0 A;  4H5J A;  3RFH A;  3FGB A;  2MTA H;  2PBI B;  5C2W B;  5CXB A;  5M5V A;  4QRJ A;  2VDK A;  4J81 A;  5JWZ A;  4LG8 A;  4J73 A;  3SWS D;  5CXB B;  2H47 A;  3ODT A;  5A2Q g;  3GC3 B;  4TZ4 A;  5FKR A;  3IKO A;  4EWR A;  4GQ2 P;  4BCB A;  4A2L A;  3EG6 A;  3SBP A;  2VDR A;  2J55 H;  3PXW D;  5IC7 A;  2HXC A;  3JB9 L;  4L3H D;  2XYI A;  4RE6 A;  4A11 B;  1JV2 A;  4A2M A;  2HES X;  4AN1 A;  4JSN C;  4PSW B;  5EM2 A;  3EQ8 A;  1B9Y A;  3CFS B;  4G1M A;  5H1M A;  2EID A;  3OKY B;  1TYQ C;  3ZE1 A;  3C9C A;  1L5G A;  4U7A A;  5M5S A;  2AGX A;  5EM2 B;  3GFC A;  5H14 A;  4CY1 A;  4J87 A;  3NIG A;  3NVQ A;  3UKU C;  3O4G A;  1I2M B;  4GQB B;  5M5U A;  4O3T B;  2B5L A;  2IWF A;  3IJE A;  4K3J B;  1GOF A;  5FA5 B;  5EAR A;  3K71 A;  4J86 A;  5AMS A;  3EI1 A;  1UOQ A;  2I3T A;  5E6R A;  4GMB A;  4FAV D;  1SQ9 A;  4ZOX A;  2H14 A;  4AX4 A;  1MG3 A;  2BCJ B;  2H9L A;  3J80 g;  2W18 A;  3JRO A;  2B4E A;  1C9L A;  2PM9 A;  4A08 A;  2IWK A;  1YFQ A;  2G99 A;  4JT5 C;  2Z2N A;  2OIZ A;  4WK2 A;  3GD1 I;  3RRM C;  4NC4 A;  1TYE A;  4X63 B;  3AH8 B;  4FA5 D;  3BWS A;  2YNP A;  4BP9 A;  2Q7Q A;  4BCC A;  2BBK H;  3OKW A;  4Y5R D;  4OWR A;  1UTC A;  2P9L C;  2VDM A;  3N0E A;  4Z7Q A;  4PXW A;  1JJU B;  2EIC A;  2I0R A;  5C92 A;  4A7J A;  2P9S C;  5CXC A;  4CZV A;  3EMH A;  5AJA A;  3UR4 A;  2IAA A;  3NVX A;  1E8N A;  3EQ9 A;  4L1Q D;  3V4V A;  4L1M A;  1GP2 B;  3OF7 A;  1U4C A;  3K72 A;  3RLM D;  3IJC A;  4BUJ C;  2IUQ A;  5C2V B;  4FB1 D;  5I5M A;  4NBM A;  4LG9 A;  1JMZ B;  4ZOY A;  4X3E A;  4J77 A;  1NR0 A;  2QZP A;  2H6N A;  1PEV A;  2Z2O A;  5M5T A;  4AMY A;  5HE2 B;  4GGA A;  4RE5 A;  3SHF A;  3MXX A;  4MK0 B;  1H2X A;  2VDN A;  3EWE A;  3JPX A;  3P4F A;  4NEN A;  3L4O D;  3MUO A;  3EU7 A;  1GG2 B;  4AEZ A;  5HDB A;  4JXM A;  3MZL A;  5HE1 B;  4E54 A;  4JHN A;  1XHM A;  3RFG A;  2YB8 B;  2IUP A;  5FFO A;  3I7P A;  5B4W A;  4J84 A;  1RI6 A;  4JSP C;  3GRE A;  5CYK A;  3K27 A;  3SLE D;  4L9O A;  4UM9 A;  5HQG A;  3JZH A;  3OKT A;  4MMZ A;  4J0W A;  2CN3 A;  4H5I A;  1H2Z A;  4XYH A;  1PI6 A;  4J78 A;  4A0B A;  2EBS A;  4AOW A;  3I7N A;  2AQ5 A;  4JD2 C;  5IGQ A;  2HJB A;  4FAN D;  4D0K A;  4A0B B;  4O02 A;  4PC0 A;  4R7A B;  2PM6 B;  5IGO A;  5E6U A;  1NEX B;  1U2V C;  2J57 G;  3C5M A;  3DWL C;  2I0S A;  2XDW A;  1A12 A;  3V7D B;  3VI4 A;  5THA A;  3C75 H;  4QT8 A;  4IMM A;  4QQE A;  2G9A A;  3UKR C;  3SBQ A;  2QC5 A;  4KFM B;  1QNI A;  3SBR A;  4YVD A;  1JMX B;  4FWW A;  4J0X A;  5TEF A;  4CZY A;  5GXH A;  4PBZ A;  3RSE C;  3VI3 A;  5EMJ B;  2VDO A;  1XKS A;  2QXV A;  3BG0 A;  2VC2 A;  4UI9 R;  4ERZ A;  4O45 A; 
#chains in the Genus database with same CATH homology
 5FXY A;  3V5W B;  2I0T A;  2H6Q A;  2HYE A;  3F3P A;  4GM9 A;  2H9M A;  4LGN A;  5EAM A;  2AGW A;  4QL1 A;  2HKR A;  1VYH C;  3AFC A;  3EI1 B;  4ZN4 A;  4N14 A;  3I7K A;  4IA9 A;  4Z8L A;  3EI2 A;  2B5N A;  3MKQ A;  4O3U B;  2XU7 A;  4A09 A;  4I79 A;  2PM9 B;  4A08 B;  2IUR A;  3EI2 B;  1GXR A;  2TRC B;  5K19 A;  3AL8 A;  3HFQ A;  3I89 A;  1N6E A;  3IIW A;  4A09 B;  3PVU B;  4A0A A;  2CE9 A;  4X61 B;  5H17 A;  3NVN A;  1R5M A;  4CY2 A;  5EMK B;  4D6V A;  3KRW B;  3SMR A;  3L4M D;  3DXM C;  4CI3 A;  4A0A B;  2PM7 B;  2YMU A;  2CNX A;  3UVL A;  4FHL A;  5CXC B;  4CI2 A;  3JZN A;  4GZ8 A;  3UVM A;  1Q47 A;  3SJL D;  5IJ7 E;  2O9K A;  3F3F A;  4FA9 D;  4CI1 A;  4GQ1 A;  4O1Q D;  2AGL A;  2H9N A;  1SQJ A;  4PSX B;  2HKM A;  2AH1 A;  4CY3 A;  3C99 A;  3ULE C;  2XL2 A;  2P9I C;  2P9U C;  3E0C A;  5GSA A;  1FWX A;  3JRP A;  3VGZ A;  4J82 A;  3RN0 D;  4J8B A;  2OVR B;  2AH0 A;  1OMW B;  4ES0 A;  5GMK n;  3MKS B;  4XEI C;  2AGZ A;  4E54 B;  3BG1 A;  3SN6 B;  3I2N A;  3AL9 A;  2H13 A;  4ESG A;  3RMZ D;  4BL0 A;  4ERY A;  2CN2 A;  4CZX A;  3PVW B;  4PNK B;  5HE0 B;  2YNN A;  5CYK B;  5TF2 A;  3I8C A;  2YNO A;  3I7L A;  2OVP B;  4G56 B;  3I7O A;  3UVK A;  4FA1 D;  2GC4 A;  3J81 g;  4J79 A;  2AGY A;  2I3S A;  1K8K C;  5FQD A;  2CO0 C;  1OLZ A;  5IT9 g;  3DSM A;  3PSC B;  4L3G D;  5EAL A;  2J56 H;  5TEE A;  3OL2 A;  3CIK B;  4A11 A;  3SXT D;  5SXM A;  5FKT A;  2UZY B;  5AFU 3;  3EI4 A;  4ERQ A;  3FRX A;  3OL2 B;  3OKY A;  4GM3 A;  2OK6 A;  5I5J A;  5C9Z B;  5FKS A;  3EI4 B;  3IJ1 A;  4FA4 D;  3I8E A;  4JSX C;  3DM0 A;  4U1E I;  1ERJ A;  2P9P C;  2OK4 A;  2CO0 A;  3A0F A;  4XYI A;  4GM8 A;  3OW8 A;  3EI3 A;  3UVN A;  5HYN B;  1TBG A;  1MG2 A;  3EI3 B;  3MMY A;  1K32 A;  5I5I A;  3IJ0 A;  1P22 A;  5IJ8 E;  4CY5 A;  3N0D A;  4NSX A;  2GNQ A;  3SCY A;  4JSV C;  3F3G A;  3ORV D;  3AL8 B;  4HDJ A;  3U4Y A;  3UVO A;  5EAP A;  2B5M A;  3JZG A;  1A0R B;  2P9K C;  4JT6 C;  4O9D A;  4J8G A;  4Y7R A;  1MDA H;  2OJY A;  3OTT A;  4BH6 A;  5KDO B;  1B9X A;  4ZOV A;  4OZU A;  2H6K A;  1N6D A;  3CFV A;  3RN1 D;  3SVW D;  5FLX g;  2YBA A;  5FKQ A;  3W15 A;  1N6F A;  4PBY A;  4CC9 A;  4K3I D;  1JOF A;  1GOT B;  3PSL A;  4X60 B;  3VH0 A;  5K1C C;  3FM0 A;  3V9F A;  1PGU A;  3DXK C;  4CI8 A;  3VA6 A;  2H68 A;  1XIP A;  3PE7 A;  2XL3 A;  5EMM B;  3MZK A;  3PXS D;  3ZWL B;  2OVQ B;  3B7F A;  2CE8 A;  3IIY A;  2H9P A;  5EML B;  2UZX B;  1S4U X;  2P9N C;  5TDH B;  2GC7 A;  4GGD A;  1L0Q A;  4GGC A;  5HE3 B;  5GXI A;  2HJ4 A;  4E5Z A;  3JAM g;  4ZOZ A;  3K26 A;  2IUV A;  3SFZ A;  3I7H A;  2H3X A;  1PBY B;  3KRX B;  3PXT D;  4E5Z B;  2Z2P A;  1SHY B;  4H5J A;  3RFH A;  3FGB A;  2MTA H;  2PBI B;  5C2W B;  5CXB A;  4QRJ A;  4J81 A;  5JWZ A;  4LG8 A;  4J73 A;  3SWS D;  5CXB B;  2H47 A;  3ODT A;  5A2Q g;  4TZ4 A;  5FKR A;  3IKO A;  4EWR A;  4GQ2 P;  4A2L A;  3EG6 A;  3SBP A;  2J55 H;  3PXW D;  5IC7 A;  2HXC A;  3JB9 L;  4L3H D;  2XYI A;  4A11 B;  4A2M A;  2HES X;  4JSN C;  4PSW B;  5EM2 A;  1B9Y A;  3CFS B;  5H1M A;  3OKY B;  1TYQ C;  3C9C A;  4U7A A;  2AGX A;  5EM2 B;  3GFC A;  5H14 A;  4CY1 A;  4J87 A;  3NVQ A;  3UKU C;  4GQB B;  4O3T B;  2B5L A;  2IWF A;  4K3J B;  5FA5 B;  5EAR A;  3EI1 A;  4J86 A;  5AMS A;  2I3T A;  4GMB A;  4FAV D;  1SQ9 A;  4ZOX A;  2H14 A;  1MG3 A;  2BCJ B;  2H9L A;  3J80 g;  2W18 A;  3JRO A;  2B4E A;  4A08 A;  2PM9 A;  2IWK A;  1YFQ A;  2G99 A;  4JT5 C;  2Z2N A;  2OIZ A;  3RRM C;  4X63 B;  3AH8 B;  4FA5 D;  3BWS A;  2YNP A;  2Q7Q A;  2BBK H;  3OKW A;  4Y5R D;  4OWR A;  2P9L C;  3N0E A;  4PXW A;  1JJU B;  2I0R A;  4A7J A;  2P9S C;  5CXC A;  4CZV A;  3EMH A;  5AJA A;  3UR4 A;  2IAA A;  3NVX A;  4L1Q D;  1GP2 B;  1U4C A;  3RLM D;  5C2V B;  3IJC A;  4BUJ C;  2IUQ A;  5I5M A;  4FB1 D;  4LG9 A;  1JMZ B;  4ZOY A;  4X3E A;  4J77 A;  1NR0 A;  2H6N A;  1PEV A;  2Z2O A;  5HE2 B;  4GGA A;  3SHF A;  3MXX A;  4MK0 B;  3EWE A;  3JPX A;  3P4F A;  3L4O D;  3EU7 A;  1GG2 B;  4AEZ A;  4JXM A;  3MZL A;  5HE1 B;  4E54 A;  1XHM A;  3RFG A;  2YB8 B;  2IUP A;  3I7P A;  5B4W A;  4J84 A;  1RI6 A;  4JSP C;  3GRE A;  5CYK A;  3K27 A;  3SLE D;  4L9O A;  5HQG A;  3JZH A;  3OKT A;  4J0W A;  2CN3 A;  4H5I A;  4XYH A;  1PI6 A;  4J78 A;  4A0B A;  2EBS A;  4AOW A;  3I7N A;  2AQ5 A;  4JD2 C;  5IGQ A;  2HJB A;  4FAN D;  4D0K A;  4A0B B;  4PC0 A;  4R7A B;  2PM6 B;  5IGO A;  1NEX B;  1U2V C;  2J57 G;  3C5M A;  3DWL C;  2I0S A;  3V7D B;  5THA A;  3C75 H;  4QT8 A;  4IMM A;  4QQE A;  2G9A A;  3UKR C;  3SBQ A;  2QC5 A;  4KFM B;  1QNI A;  3SBR A;  4YVD A;  1JMX B;  4FWW A;  4J0X A;  5TEF A;  4CZY A;  5GXH A;  4PBZ A;  3RSE C;  5EMJ B;  1XKS A;  2QXV A;  3BG0 A;  4UI9 R;  4ERZ A;  4O45 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...