4XYMA

Ca. korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 in complex with coenzyme a, ca-ampcp and hgcl+
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
464
structure length
464
Chain Sequence
MNDLERLFNPSAIAVVGASKDPSKIGSQILRNLLSYGFKGKVYPINPTADELMGLKCYPKVSDVPDKVDVAVISVPSDKVLGVIDDCGKAGVKFAVVITSGFKEVGNEELEEELVRRAHSYGMRVLGPNIFGYLYAPARLNATFGPKDVLSGNVAFISQSGALGIALMGYTVVENIGISSIVSVGNKADLDDVDLLDFFDKDPNTGVIMIYLEGIAPGRGRMFIDVASRVSLRKPIIVIKAGRTEVGARAAASHTGSIAGSVAIYESAFKQSGILMAKSVEDAFDWTKALSWNPIPEGERLIVLTNGGGAGVQSTDTFADNGIYLSKPPESLIQEIKKFVPPFASFANPIDITGMAPDDWYYMGTLAALKNPDVDALTVLYCQTAVTTPIGVAKGIVDAIKEAGNSKPVTVGMVGGPEVAEAVSFLNKQRIAAYPTPERASSAMSALYAYARARSYVMKSLAVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Korarchaeum cryptofilum (strain opf8)
molecule tags Ligase
molecule keywords alpha subunit of Acyl-CoA synthetase (NDP forming)
total genus 173
structure length 464
sequence length 464
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13380 CoA_binding_2 CoA binding domain
A PF13607 Succ_CoA_lig Succinyl-CoA ligase like flavodoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 4xymA02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 4xymA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4xymA01
3UHAA 1CDOA 1ENPA 4E5PA 2RAFA 3ORFA 1UXHA 1DC4A 1OBFO 1GYPA 3OQBA 2GCGA 1GQ2A 1T1RA 3PVZA 3G0OA 4UULA 1AHHA 4MIEA 3MWEA 4RPLA 3GPDG 2C59A 5A3JA 3ZU4A 2VUUA 3GVIA 1EVYA 3L07A 1KC3A 4ZA2A 5FF9A 3UXYA 5KVQA 2HU2A 4K6FA 4J7XA 2NQ8A 4OSOA 2IE0A 4OH1A 2Q4BA 5KVVA 2J8ZA 4LCEA 3ZHZA 2JAHA 3A4VA 3DTTA 4J4TA 4PZEA 3RJ9A 9LDBA 2Y1FA 4WCDA 1DIGA 1ADFA 1BSVA 1A7KA 1GQQA 3OH8A 2C5EA 5CDGA 1ADCA 1EUCA 2WD8A 2P9GA 1DIHA 1GPJA 1V35A 2PV7A 3JQFA 5EL0A 4ZD6A 4ZN6A 3VZPA 1YVEI 3TFOA 2C2YA 4R16A 2IXBA 2OP0A 4OM8A 5A05A 4P4NA 4QO7A 1UJMA 3DL2A 4LVUA 5JAMA 4E21A 2X5JO 4ND2A 3S1LA 1WXDA 2JHFA 4LRTB 4NBUA 4NQZA 3MTGA 3WG9A 2FPIB 1YS4A 2HSDA 2XAAA 6ADHA 4AL4A 3QVOA 5B12A 4J9VA 5HWSA 4I5GA 4XWYA 2GUGA 1RM5A 3GR6A 2W2LA 2FZEA 2UUOA 3K6JA 4QEDA 4RPGA 3OA2A 2WE7A 4R1TA 2PFGA 3TF5A 4B79A 3H9JA 1GZ4A 3WNQA 4XYGA 5ER9A 4KTTE 2NVUB 4BO0A 3ZU2A 4XJTA 2DAPA 2Q1TA 3GVHA 5T8KA 2VYNA 1TT5B 2FY8A 4W7IA 4EUEA 3GGGA 4RVDA 1HDYA 3WMWA 1DO8A 4U0JA 3TZCA 2GDZA 1T4BA 5G0VA 4CJXA 3HWRA 3ZI0A 3W4KA 1AXGA 3MZ0A 1KETA 3BA1A 2YV2A 1Q0QA 2X86A 5ITVA 1JQBA 1XLTA 3O9ZA 3WGGA 5GMOA 3ON5A 3D3EA 3KSDO 4OGWA 4WNIA 4Q3NA 1J0XO 2XXJA 3TJRA 1I3KA 4BGEA 2V6GA 4ZVVA 2JFGA 4FR5A 1O95A 1AE1A 4PLTA 4C4OA 5BR7A 2X0RA 3W8FA 4YAKA 2D2IA 1VL6A 4BNIA 4XQCA 4IBOA 1QYXA 1SMKA 4NFSA 2IDZA 3U4CA 1NAIA 1M6WA 5DZSA 5L45A 2CFCA 4WCFC 3GG2A 1F12A 4EJMA 5I8WA 2IEBA 2E37A 3QWIA 4J4HA 4JBHA 4RPJA 1YL7A 1BVRA 3WYCA 4AJ4A 4RV9A 5T57A 3LLSA 1DFGA 1PJBA 2DTXA 4UUNA 1WWKA 3C7CB 3JQBA 1SOVA 2VOJA 3F6YA 3GDOA 3U4IA 3RWBA 3IUPA 3PIDA 1E7YA 3AY6A 4HWKA 3VPHA 1UP4A 2NV6A 4RGBA 4M54A 3W8EA 2GO1A 1DLJA 5F5NA 4BMNA 1ZXLA 1HDXA 3WLEA 4O1MA 1YQXA 3RC9A 9LDTA 3FHLA 1U28A 4A7PA 3IQDB 3JQGB 1PR9A 4YB8A 1Q0LA 3BHIA 3UCEA 4B8WA 4YRBA 4RDHA 5IZCA 1DAPA 2D8AA 4BO9A 1MFPA 3ROPA 4YAJA 3PYMA 2HMVA 5JYDA 3G3EA 1B8VA 3KYCA 2OP1A 3GA0A 4MJLA 4Q3DA 1Q7CA 2PR2A 2X5KO 1UP6A 1J6UA 5IN5A 4GLOA 4GQAA 3X2FA 4ZJUA 2WM3A 3PEFA 4WLEA 5IN4A 2CNBA 1RWBA 5COQA 3VH3A 3ZWOA 4A27A 3WQRA 4WLUA 2Y0DA 1LDGA 3VOSA 3OSUA 2BGKA 1MG5A 2PZLA 3IC5A 2DKNA 3P5SA 3K2EA 3MCVA 5EPOA 2WYWA 1PGQA 3KLMX 1V3VA 3RUIA 3ZW9A 4R5MA 5A06A 4N5MA 1R0SA 3QWAA 1EUZA 3KYDA 3PJEA 4J90A 3E9MA 4CQMA 2PGJA 1FDUA 4GLLA 4J91A 1T24A 4J1QA 5CEEA 3RUHA 1E1KA 3MJVA 2P5UA 4YAEA 1PX0A 1SBYA 1LSOA 1R15A 3DEYX 3D3WA 3KTDA 4CUZA 4Y6PA 1U3UA 3LDHA 1BMDA 3H5RA 3PYXA 3INGA 2IEDA 1I3MA 4GAEA 2PKRA 1K2WA 4DGSA 3HE3A 8LDHA 4II3A 1I8TA 3H5AA 3PYLA 3H9QA 2VYVA 1PS8A 2P9EA 4Q9NA 5DOVA 3WX0A 1QP8A 2OZPA 3TNLA 1TI7A 1E0DA 1LLUA 2D5CA 5F21A 5U9CA 3VPFA 4IS3A 1E77A 4UEOA 3C24A 4KWIA 3JQAA 1I2ZA 4IIVA 3OJFA 2PTGA 5COAA 1PZHA 5KKCA 3WGHA 1P0FA 2NVBA 1GYQA 4RL6A 4E31A 1PSDA 1QLJA 2YW9A 2GZ1A 4CMKA 4MPDA 4PLHA 1E92A 3AY3A 3M2TA 3DMTA 4M89A 1OFGA 2J5QA 2GLXA 2Z5LA 3PHGA 1E1MA 1C0LA 1W4ZA 3H65A 4TRNA 1F06A 5ENVA 4OXNA 1JVBA 1F14A 4M86A 4BGUA 1ZMOA 4AJKA 2YV3A 1TEHA 4KDEA 4PVDA 2P4HX 4CM8B 2ZTUA 2JAPA 5JSFA 3OQ6A 4ND3A 4BKRA 3JSAA 3BMOB 1FF9A 3EHEA 1SCUB 2R2GA 2ZYAA 3L77A 2V6BA 1SEVA 3GUCA 4KUEA 1ZSNA 5KCZA 2PZKA 3LT4A 1A9ZA 1HDGO 1UH5A 4YDRA 3BMNB 1YL5A 2IXAA 5DN9A 3K31A 2YYYA 3VZQA 2D59A 3MJ4A 4CMAA 1HKUA 1ZJYA 3NYWA 3O03A 1BXGB 5G4LA 2CY0A 1FXSA 1I32A 3Q2IA 4NDNE 4PLWA 1M6HA 4CMEA 1L7EA 3A14A 4K9DA 1E7QA 5KVCA 4E12A 2O48X 1IULA 3OEYA 1UDBA 2HMWA 2ZTLA 1OI7A 1I2BA 1IHYA 2O2YA 4DVJA 4ZICA 1YQGA 5G0WA 1DC3A 4A5OA 4NNJA 4CUJA 2D0IA 1GPDG 4WPGA 3ETEA 1TLTA 1DFHA 2AG5A 3MWDB 3HFSA 3ROMA 1YJ8A 1JU9A 2D5AA 2X0JA 4N7RA 5IDWA 4YCAA 4DQUA 4U5QA 3RU9A 1E1LA 1LLCA 2CF6A 2E82A 4S3MA 5BSFA 3H2SA 3QWFA 2J5KA 2F00A 3DZKA 4J49A 3ZWMA 1HYGA 4CL3A 5CFZA 2O3JA 1HLPA 2DU8A 4GL4A 5F1PA 2GN9A 4D79A 2CVQA 4U8GA 3WBFA 1ENOA 1YQDA 1PS9A 1UZNA 1I3NA 3JQ7A 3D1LA 3H9GA 1R0LA 4D3FA 4ZQGA 2QRKA 2X23A 1UUFA 3L4BA 4GMGA 2Q46A 2NTNA 4XZ3A 4OQYA 1VC2A 4O5OA 3G1TA 2X5OA 4R4JA 3ZNNA 1OZAA 4YR9A 7MDHA 1VJ0A 1Z45A 1PL8A 5DULA 3U62A 5AXCA 4F6LA 3C1OA 3GN2A 3KRTA 3I9OA 3QVSA 4YPOA 3PZBA 4BKQA 1ZW1A 2OXIA 1N1EA 1NX6A 1EZ4A 2PD6A 2G1UA 3M1LA 4L4XA 3FSRA 3NDRA 5B37A 3FN4A 3GH3A 4DREA 4WJZA 4CUKA 4NH4A 3V1YA 2WSBA 4XB2A 3VAZA 3DONA 1JKJA 3U9LA 1XYGA 4O6VA 4E32A 3JQ8B 3HN2A 4O63O 2GF2A 4BKPA 2AEFA 4IJVA 1NNUA 4QXMA 4XDYA 5JCJA 1NWCA 4ZQEA 4DMMA 1JKJB 2WDZA 4BO2A 3JQ8A 2EGHA 1FK8A 5EQFA 5CAEA 5DCYA 3IS3A 5ILOA 1WDKA 4YRAA 4HFMA 1Y1PA 4Q39A 5JLAA 1C1DB 1X14A 2VHWA 3V2GA 2DBZA 3GLQA 3GC6A 4JLWA 4CMGA 1ZUD1 1IE3A 3C85A 4DBZA 3CH6A 3WTBA 3WGQA 4DC1A 4CLRA 2E4AA 1RYDA 1X1EA 3Q9NA 3B70A 4GH5A 1F8FA 4IUYA 4E2WA 2J3JA 2QRLA 4HY3A 2J3IA 1NPDA 1P1HA 3NRCA 3DOCA 1LDBA 2FN7A 4M1QA 1PZEA 1G1AA 4KUHA 1UDCA 4PGFA 5ICMA 1NFRA 1XCBA 4FFNA 4CR8A 3UF0A 5JC1A 3NKLA 1RKXA 3EDMA 4BS9A 5JAQA 4OXKA 1ZEMA 5JO9A 5A5FA 4BUCA 1NASA 4U6QA 2Q2QA 1YJQA 5DCUA 3E48A 5KJ1A 2H6EA 3ZWWA 2B4QA 3ZHBA 3RUFA 3NTOA 4L4RA 3I5MA 1ISJA 2GPTA 3ICPA 4JBGA 3OIFA 4W99A 2EXXA 2I6TA 4FC7A 4NZ9A 3ZU3A 4EUHA 3MJTA 1H9BA 4FQ8A 4Q3EA 3UW3A 2P5YA 4R1NA 3C1TA 1ZO8A 4C7JA 3RJ5A 3A06A 3OEWA 2R6JA 4Y67A 4J6FA 2Q3EA 4J1SA 4D42A 4BKOA 3DQPA 1LA2A 2HLPA 5BNFA 2GASA 2A94A 4AJHA 3DMTC 2O7QA 2FP4A 1P77A 3MJSA 5EMHA 3UUWA 5KTKA 4ZGWA 2GZ3A 4J2OA 2EEZA 3DBHA 3RD5A 4BV9A 5CG1A 1WDMA 2AEJA 5JW6A 3LT0A 4JN6B 1HT0A 2I3GA 3ZHXA 3TDKA 4W82A 4Z9XA 1LJ8A 1ULUA 4DYVA 5JAIA 1HDCA 4RVHA 4A2CA 4B4WA 4IJUA 1P0CA 1LLQA 2RH4A 3NDJA 3RROA 1B15A 4RZHA 4RVGA 2W2KA 3V8BA 2YJZA 2FPIA 2OMEA 5FI3A 4R1UA 2Y67A 4L75A 2AE2A 3TRIA 1L1FA 2JD1A 3S2EA 1N2SA 4F46A 3B1KA 1NXQA 2HDHA 3C1AA 2AMFA 5HM8A 4CLOB 3L6DA 1P1RA 4L0QA 2RBEA 1NPTO 3U4DA 4CQLB 3ZV4A 2R00C 4HV4A 3AUTA 2X58A 4DPKA 1DHTA 3WGIA 3D4NA 3ZNOA 2I9PA 2VWGA 4H7PA 1GEEA 4HFNA 4CL8A 3HDQA 1YRLA 3AI2A 4L74A 4BKUA 5KJEA 3KEQA 3H8VA 4WLNA 1PJLA 3AI1A 5ENDA 4PLGA 3D7LA 5EINA 4OOFA 4HX5A 3UVEA 3U4HA 4PG8A 3CMCO 3ZW8A 4CR7A 1VJTA 3JYOA 4B7CA 4DIBA 4D3SA 4FD3A 4YACA 1X7GA 3H3FA 4PIVA 1EK5A 4QECA 4EEXA 3ZWXA 1EVJA 1H6AA 2X22A 4P22A 3STHA 2LDBA 5CDTA 2PWZA 1H93A 3ZWVA 2CF5A 3ZWPA 3UOGA 4YT4A 1TA4A 3D64A 2ZYDA 3WQSB 3ADOA 4IDCA 1C0PA 1NQTA 1WZEA 1T1SA 2BMAA 3R3JA 1BGVA 4MOWA 1LC0A 3DOJA 2H63A 4M8SA 4RF3A 2UV8A 4MVJP 5DF1A 4BNWA 1VJ1A 5L4NA 4BNXA 2CSUA 2PKQP 1R0KA 3F46A 4W6ZA 2X9GA 4CMJA 1ID1A 3BMNA 1KYQA 2GZ2A 3JQ9A 5DOZA 3T4EA 1WAMA 2DFVA 2EF1A 1PU2A 5JY1A 3RUDA 4BNMA 3OBBA 3IP3A 1NFFA 4WASA 1N8KA 3F5QA 5COBA 5A9TA 3WSWA 5IJZA 3PP8A 4ALJA 3MWEB 2C0CA 4YT5A 5L95A 2VCYA 2Y99A 1C14A 3JQGA 3PWKA 3JQ9C 5MGBA 4Y6RA 1HL3A 1T26A 1QYDA 3GY0A 2FPPB 3GUYA 4XQGA 1YE3A 1F8GA 2O4CA 4B4OA 2IODA 2C7GA 1KEWA 3CZMA 1H9AA 1HF3A 4HFRA 4IM7A 4XQ9A 2FPPA 4P38A 3C3XA 4IMPA 4B3JA 5I9NA 1J5PA 1AGNA 3L9WA 4FCCA 3JD0A 3VPXA 4CPDA 1N92A 2OOSA 2GN8A 3D5QA 4NG5A 1P1JA 4YT8A 1P74A 1QORA 4IGFA 2E49A 1P31A 3LSYA 1OMOA 3E9NA 3EK2A 5JC8A 2WWRA 1B3BA 1YB4A 3WYEA 5K9ZA 3MWDA 1B3RA 4NJOA 4BNTA 3RFTA 3L6EA 3PFFA 4U0KA 4PG7A 3Q6IA 4XB1A 1GV1A 1PGPA 3ENNA 2YQ4A 3RASA 3JQEA 2AA3A 1S7CA 4TKMA 1P1KA 4NMHA 3WTCA 2DTDA 3O4RA 5BQFA 1RM0A 3AY7A 3OJLA 5U1PA 1HYHA 1UDAA 4WEQA 4E3ZA 4BB6A 1B16A 1HYEA 2B69A 5IDQA 1QYVA 3DZIA 3HADA 3H2ZA 5JXWA 3OICA 5ADHA 1PEDA 3RQSA 4DQXA 4HP8A 3QWHA 4ID9A 3ONEA 5L3ZA 2UAGA 5AOVA 1R66A 4D3DA 1H6CA 4LVCA 4L4SA 5JDCC 3B6ZA 1JKFA 3WSVA 4BNNA 3JQDA 5JDIC 3TL3A 4GSKA 4CMBA 2H1SA 1D8AA 1ISHA 3AFNA 1NTOA 1Z6ZA 3CPSA 1T25A 1CQJB 4IDAA 3VDRA 3ZCXA 5AXAA 3ASUA 1SB9A 3JQFC 5BNTA 4FSHA 1XEAA 5JE8A 1XQ6A 4QFCA 1WP4A 5B4TA 1VL0A 1N9GB 3JYLA 3NTQA 4BO1A 3FR7A 3GDFA 4CMCA 3DAGA 3QVWA 3ZN2A 3DB2A 3LVFO 4MP8A 2PH3A 2ZJ1A 3I9NA 2R00A 2DM6A 3TL2A 1MB4A 4S1VA 2WMDA 5F1KA 3WGTA 5CHEA 1PWZA 1I33A 2HKIA 3JTMA 2WYVA 3VKVA 2CMDA 1C0IA 2NU7A 1E6WA 1I24A 3V1UA 3ZHYA 5K0ZA 3GRKA 1QMGA 4PG5A 3OIDA 1GV0A 1WNTA 2YHIA 5L4SA 2O23A 1ZIDA 5CPFA 3PPIA 2ZATA 3NEPX 2VTDA 1P3DA 3PJFA 4I5EA 2O50A 3EYWA 3G17A 1U3VA 3QY9A 4IQGA 4MVJF 1UXIA 2CDCA 3HZZA 3PFWO 4TZKA 3HDHA 3JYQA 2Y1OA 3NTRA 5J23A 2W98A 2Y05A 3ZNPA 4FDAA 2EJVA 1MUUA 4WNCA 5TGDA 4GVLA 1B2LA 2C7VA 4GPD1 4ND4A 4XR4A 4TVBA 3W6ZA 2Z95A 2DVMA 4P8RA 3VZRA 5A9SB 3C8MA 4YTEA 1LSJA 5A03A 2O3UA 2ZCUA 3IJPA 2DBRA 4D7AA 3H9UA 4CV3A 8ADHA 4WEOA 2FRDA 2ZTVA 3KB6A 5I9MA 5FWNA 2X9VA 3FPCA 4Y8VA 4GWGA 4MVJM 2FSSA 4WGGA 3IUSA 4XEHA 1K0UA 2EHDA 4NK4A 4Z9YA 5G4KB 3GQVA 1R12A 4GX1A 3BTSA 4IDFA 2QX7A 1I30A 3GEMA 3FWNA 3OECA 2QG4A 2VWHA 3FR8A 3BTOA 4XIYA 1LLDA 3I9JA 3K96A 4RQUA 4UVGA 4FFOA 1JA9A 1U9JA 4N5LA 4DC0A 1Y8RB 5I7EA 4RPKA 3RVDA 2VHYA 2Y1EA 1QV7A 2OFPA 3HB5X 5HS4A 3SEFA 1QLHA 1YH3A 4R68A 1EUCB 3KV3O 5HA5A 4OKIA 5IXYA 3KZVA 4GKBA 1D7OA 4RORA 1DBVO 2ZQZA 5DBFA 3KYCB 3JD4A 4DWVA 1T2EA 1LBEA 2HCTA 4J16A 2ZB3A 5IF3A 4BIIA 4DQVA 2DQ4A 2BH9A 2SCUB 4FC6A 4J7CA 1HDOA 1GUFA 4ZQFA 2FMUA 3ROKA 2ZK7A 3WDSA 4F3YA 4YQYA 4U6SA 2P9CA 4BO6A 4BNLA 1MC4A 5DNAA 3OHSX 3RC2A 3TQHA 1RYEA 1SAYA 3E1KA 1MFZA 3DZJA 3Q11A 1LDNA 3ZZNA 2JCYA 3NT4A 4FOOA 4K6CA 4ALIA 4EITA 3U09A 1T2CA 2YZ7A 4Z3KA 3DFZA 4NU6A 2NU9B 2Z1NA 3OETA 2NUAB 4DPMA 3IP1A 4ND5A 5EESA 3KBOA 3VDQA 4D45A 1T4DA 4JNKA 4XDZA 3AOGA 3WWYA 1CETA 1UZLA 4XD2A 5TS3A 1QYCA 3ZGYA 4FB5A 1MA0A 4YAIA 3ABIA 5T8KC 1ONPA 3EAGA 2OO5A 2EW2A 1HSZA 1KEPA 1MG0A 2ZTMA 2B5WA 3NGLA 4MDHA 4OKNA 3ZWBA 5JCXA 3CE6A 4DL9A 5JS6A 1W73A 1E3IA 4CMIA 5JDCA 3IMFA 1ONOA 1CYDA 4FW8A 2A4KA 3LU1A 2QIOA 4XJSA 3P7MA 3QVXA 4ALLA 4G5HA 4WLOA 1ZK4A 3JQAB 1MC5A 4D43A 4Q3AA 1GCOA 1HWYA 4FOSA 4W7HA 4Y98A 1IOLA 1YB5A 4DMLA 3WJ7A 1PJSA 5TJHA 4JXKA 1JWBB 1G0OA 2EP7A 4ITUA 4MVJE 4MVJA 4YA6A 4CLHA 4BNKA 5LC1A 4LSMA 2QHXA 3CEAA 4P4LA 1WMAA 3L0DA 1NQ5A 2WTBA 1YKFA 2I76A 4R9RA 7ADHA 2NU6B 1GCUA 1N7GA 4RLSA 1TT7A 1MV8A 4WLFA 5BSHA 1H2HA 2NU8A 1MGOA 1NAHA 5L7TA 1DRUA 3CKYA 2OBNA 4BNVA 1ZCJA 4HXYA 3LF1A 3EVTA 1ISMA 2B83A 4WLVA 2O7SA 3AM4A 1I0ZA 4MVJI 1PJTA 2DUUA 3G79A 1EQUA 3VPSA 4RZIA 3SVTA 4J7UA 3WFIA 4MIYA 5A3VA 3PQEA 4NPCA 1H94A 3FBTA 3QP9A 4IQ8A 3D4OA 3DHEA 3VPGA 1LDMA 4KQWA 3K2BA 3UICA 1ZXBA 1YB1A 5EJ2A 4MINA 5G0UA 3VVCA 1OAAA 1U2DA 1GY8A 3DHYA 4RO0A 5F5LA 3ETGA 4OO3A 1DLIA 3EY4A 4X54A 3SX2A 5C3MA 4BV8A 1U8FO 2AQHA 2ILTA 4BQRA 5C7OO 1LX6A 1Y8QB 3VH1A 2WE8A 3WGZA 4Y9DA 4B4VA 2B36A 3HQ4O 3CXRA 4K28A 4PLYA 3VKUA 2JCVA 1E3WA 3F4LA 2C5AA 4NFYA 1Y9AA 2VHVA 3QIVA 4E2ZA 3JV7A 1I01A 3FNFA 1YONA 1X15A 2BHLA 5L7WA 1DSSG 2E6UX 4YJFA 1FDSA 5L51A 4I9HA 4OOEA 1UP7A 3NGXA 4CODB 3ZH2A 4JJFA 1U5AA 1QG6A 1ONNA 2BKAA 2J6IA 5JY6A 5TIIA 1BHSA 5G0SA 2W8ZA 2FHSA 5GY7A 1HE2A 1PGOA 3ICCA 5C37A 1U1IA 2RHRA 1EBFA 3NX4A 4L9RA 5THKA 1R4MB 4PLCA 3ZDFA 3HB4X 4FGWA 1F17A 1WVGA 4FBGA 3RC1A 3DDNA 2EKLA 3GNSA 1ZH8A 4TVOA 1A7AA 2NM0A 3GVXA 4H16A 3K30A 3TOXA 4YEDA 1HZZA 1DOHA 3E9QA 2ZB7A 3QJ5A 1PQUA 2Q1SA 3UKOA 3MTJA 4W9NA 1NR1A 3KSUA 4D0RA 2XPCA 3AOEA 4EEZA 1S6YA 2C2XA 3WGOA 2AW5A 3GMSA 2AQIA 4QX6A 1ISIA 1Y5RA 1KS9A 1I5RA 5AQ1A 2Q1UA 1J49A 5JYEA 1VM6A 4FFMA 1SCUA 2WJPA 3PJGA 1XIVA 1Z7EA 3DBRA 1EQ2A 3AJRA 3RCBA 4B3IA 5IAAA 1FJHA 3JCZA 1BG6A 2VT3A 3GNTA 2HK7A 5KKAA 3CIFA 2O3TA 4DPLA 2PKQO 3TWOA 3DZBA 4KQXA 2AG8A 1P33A 1BXKA 2B0JA 2EIHA 4FFLA 1P1IA 1P44A 3I9KA 1HE4A 1AUPA 1A4IA 4J1NA 3W8DA 1C1XB 4E30A 1KY5A 3AU8A 4IZHA 2WEKA 3ETDA 1PQWA 4RCVA 1KOLA 5A02A 1GEGA 5A9SA 2VWPA 2HJRA 4FPXA 5KIAA 1XU7A 3BTUA 2BGLA 2B5VA 5HS6A 3GGOA 3WNVA 5JFOA 4GX5A 3UH1A 4FJ2A 4DUPA 1SC6A 1XU9A 2TMDA 3D5TA 2O4UX 1JLLB 2W2KB 2V6MA 1YBMA 2Y68A 1W0CA 3AUAA 1SPXA 4NU5A 3DBLB 1L7DA 3ZV6A 2NACA 2VNSA 2Y1CA 4N18A 2OBYA 2VZ8A 5I7SA 4R1SA 4JP3A 1A4UA 4J43A 2B4RO 2VHXA 1V3TA 1LSSA 3D0OA 4LGVA 1KVTA 3FPLA 3DR3A 3MOGA 4NBTA 1GQYA 4AICA 4CMEC 4QTZA 1X0VA 4CR6A 1O0SA 4LW8A 4Z0PA 5JDIA 4GI2A 1CQIA 2Y93A 3RC7A 3AM3A 3GRPA 5TC4A 1BVUA 3OP4A 4XCVA 2Q2WA 4CQMD 3WIEA 4YRDA 3RUCA 1PJQA 1PZGA 6LDHA 2ZB8A 4IJWA 3ZWAA 4PLPA 2DLDA 4CV2A 4H15A 2E48A 4BNUA 2G82A 4HNHA 5BT9A 5HTOA 3M6IA 1WMBA 4YVFA 4PFJA 2VRCA 2PGDA 3FCOA 1E6EA 2P4QA 4IXTA 4IQ0A 3ANLA 4PZCA 4R54A 3HG7A 1B0AA 3DHNA 4TSKA 4UUOA 4BMSA 4H3VA 3DBLA 3R0IA 1JAYA 4K26A 1KIFA 2IZ0A 3Q1LA 1E7MA 2WD7A 2VYVD 4Z6KA 5AVOA 3U49A 2EW8A 3ZWCA 4BB5A 4BO3A 1NVTA 1MXFA 1DXYA 2YDXA 4F6CA 4AJ1A 4URFA 1KEVA 2J3HA 2DFDA 3ONDA 4B7UA 4HNGA 2ZKLA 2VOEA 4AG3A 4E33A 3KSZO 3UAGA 2NQTA 3GF4A 1EE2A 3GMDA 1PL6A 4A26A 3ST7A 3ANMA 3JYPA 2VZ0A 4E5MA 3RU7A 1IHXA 2O3SA 4XIJA 3AFMA 1E1NA 3QHAA 3JQ6A 4I8XA 1SZJG 1EFKA 3QA9A 1UAGA 4O59O 3W4JA 3F3SA 2ZQYA 3CTMA 4TRRA 1GDHA 3KYBA 1DIRA 4OAQA 5TNXA 3B1FA 5A4DA 1Y6JA 2X0NA 1DIBA 1HEUA 1VL8A 3FNGA 3OMLA 2G0TA 2NNLD 5B1YA 4RF5A 2GYYA 4MKXA 4JGBA 4OL9A 2HMSA 1ZKMA 1DEHA 5FFFA 3GT0A 3FWZA 1NYTA 1ENYA 4HBGA 1K89A 3INRA 3B1JA 4PRLA 1ZFNA 3GN1A 3PGXA 4YYZA 2C29D 1A5ZA 3HDJA 2X1HA 1C3VA 3GHHA 3BIOA 3S8MA 1BTOA 1H6BA 4HKTA 1BWSA 3IOYA 2NWQA 2EERA 3KO8A 5A5EA 2BLLA 4I5FA 1F0YA 1YOVA 4OXYA 4RLHA 1T2DA 3Q3CA 2BI8A 1M75A 3PI7A 1O8CA 3A28A 3R1IA 2VYND 3TPCA 2P2SA 4XRGA 5ITWA 1LRJA 2NU9A 2XOXA 3TZQA 4WK6A 1Y8RA 2FPGB 3ROQA 4JROA 1ISGA 5IDXA 4W9NC 2Y0EA 1PGJA 5U4QA 4INAA 1I36A 1DRWA 4KTVE 1IYZA 4YJFB 3GAZA 3S2GA 4AJLA 4KP7A 3IL2A 3RI3A 4UVDA 1GD1O 4J0FA 4Q3CA 2Y1GA 3GPIA 3PGJA 3PWSA 4YQZA 4I9NA 3ZV3A 1VPDA 5KJ6A 1MLDA 3GZNA 1A71A 4YJGA 3SLKA 4B4UA 5KNLA 3K9QO 2VN8A 5GZ6A 3IKVA 4BGIA 3GEGA 3OQ1A 5TF4A 5MDHA 2RHCA 5A9RA 2F1KA 2VUSA 5DT9A 1B7GO 1E7RA 3IDSA 4UVIA 4XKJA 5DCWA 4Z0TA 3RSHA 3VTZA 3FI9A 2HK8A 4IGEA 1V8BA 2Q49A 2WD7B 4IDGA 4M87A 2OHXA 1G0NA 3GFGA 1YDEA 2Q1WA 3ZNQA 1E6UA 2JFHA 5GZ3A 1DJQA 2AQ8A 3WQQA 3ULKA 4FFPA 1ZZEA 4CQMB 1Z75A 4A73A 3BMCB 4GBJA 1NHWA 3EZLA 4FIZA 3Q2KA 1D4FA 4FS3A 4IIUA 4J1TA 3ITDA 1U2GA 2FZWA 4CM8A 5HBRA 2I3AA 3O26A 2VNAA 1U3TA 3AI3A 3GGPA 4UVEA 4LSWA 5TRTA 1QKIA 1HLDA 4MKRA 3U0BA 3PZRA 4L8VA 5L9AA 1HZJA 4ESOA 1G6KA 4EBFA 2HRZA 3RBVA 4HFJA 3GOHA 3NUGA 3IKTA 2YDYA 3PHLA 4FGSA 2BELA 4CM4A 4I9UA 3WS7A 3BMOA 3V1TC 2AXQA 3F47A 3I4FA 1I10A 4DLLA 1Q7BA 4IDBA 1RM3A 3BMQA 1HTBA 1ORRA 4XX0A 3O8QA 3WIDA 1MP0A 1R4NA 1Z7BA 1PWXA 4NJMA 4AJJA 1WW8A 1VI2A 4QO8A 1Y5MA 4NHEA 1H2BA 1CQJA 1EDZA 2NTJA 3VVBA 1AHIA 5B4VA 2FR1A 3QRWA 4DLAA 2H9IA 4IPTA 4ZRMA 4R41A 2CZCA 2D1YA 5BSEA 5TX7A 4AJEA 2ZB4A 3F5SA 1PIWA 3NDIA 4PG4A 2Q4EA 4IXWA 3KLPX 5CDSA 2NSDA 1NQAO 3UN1A 3GVPA 4PCVA 4EJ6A 1QRRA 3EUWA 2VRBA 1EMDA 3DMYA 1KY4A 4YT2A 2VWQA 3H7AA 4AJOA 4DIOA 1IZ9A 4BNHA 2IYOA 3CINA 1CEQA 1DC6A 1LU9A 3F1LA 3K92A 3L9XA 4XYMA 1NM5A 3V2UA 4E2XA 4D41A 4ZHSA 1IUKA 2B4TO 3V2HA 3KOUA 2P91A 4ZQHA 1E3JA 3LT1A 3SLGA 1K6JA 1CF2O 2OUIA 1NR7A 1Y7TA 1MX3A 4WECA 2QQ5A 1SOWA 1ZK3A 2C07A 4RQTA 5H82A 3JQAD 4MP3A 1R16A 3M1AA 1X7DA 3K8ZA 3WMXA 1HXHA 3S2IA 1UXKA 2PGLA 1U4OA 4I1IA 1XWFA 2EP5A 2UVDA 3IJRA 5TLSA 3PLRA 4B8ZA 4E5KA 1PR3A 4IDDA 4C7KA 5IZ4A 2RCYA 4ROSA 5EQDA 1JTVA 2GNAA 2HMTA 3QWBA 1JLLA 1VSVA 1ENZA 2GR9A 1VSUA 1X7HA 4LMRA 1PQPA 4RJTA 1TT5A 2CVZA 4CM6A 5F3RA 3VH2A 1LDEA 4EUFA 3GG9A 1K6XA 2HMUA 3DZGA 4LN1A 1MXHA 4JCOA 5JBIA 2GERA 1GAEO 3FD8A 2EJWA 2H5LA 4TZTA 3PLNA 3RFVA 1CQIB 1P1FA 3IIEA 3P19A 2FOIA 2BFMA 3MOIA 4NI5A 5KJFA 3K5PA 4GKVA 4YJDA 4G81A 4BNFA 1C1DA 2YY7A 1BDMA 1LUAA 1CERA 2I66A 3DXFA 3GZ4A 1NFQA 4BO5A 3W6UA 3ANNA 4J3FA 1E5LA 1UXGA 2I67A 2PZJA 5AXBA 2CDBA 3HHPA 4EYEA 4GSLA 3T4XA 3TZKA 4IINA 2GSDA 3EVNA 3QSGA 1LRLA 2JJYA 3BYZA 5FYDA 2BF7A 3TOZA 3LT2A 3H9EO 4ZRNA 4W4TA 4RVFA 1WZIA 1U8XX 4RF2A 1EBUA 3LC7O 3BTVA 3NT2A 2X0IA 3HDYA 1LTHR 2JHGA 2P68A 3LK7A 1E5QA 5CDUA 5CG2A 4N5NA 5LDHA 4DBVO 3ITKA 3TSCA 1GYRA 4PZDA 1X1TA 3ZWNA 3HNPA 3AU9A 5C5IA 3EMKA 4ONEA 3AK4A 4UAGA 4BQPA 2J5RA 5G0TA 2JFFA 2ZCVA 1J4AA 4RF4A 4CM7A 4NR0A 2Q99A 1YL6A 2W2LD 1DPGA 1E3EA 2NU8B 5CEFA 3CSDA 5IFLA 1JDJA 3BXXA 5L4LA 3ADPA 5ES3A 2GN4A 5EIOA 4CMHA 1W8DA 4J0EA 4E2YA 1O94A 1KVRA 3M2PA 3ZWYA 1FMCA 3F4BA 4AFNA 1DC5A 3I52A 1SB8A 3L4BC 4MVJD 1ZVMA 2ZIZA 4MKZA 4JK3A 3SC6A 4WUVA 5TJ9A 2IYPA 1VLLA 3OM9A 2HK9A 4U7WA 2EG9A 3PDJA 4ZQBA 5EN4A 4F45A 1GUZA 2GRAA 2GGSA 2O3RA 2Q2VA 3RBXA 2SCUA 3COSA 4CV0A 5K6AA 4GVXA 3R6DA 4LK3A 2PK3A 3UCFA 2X7HA 2BD0A 4BVAA 1V6AA 4K1LA 1GADO 5CAEB 1DAOA 2A35A 1O89A 2AQKA 2ZJ0A 3KYDB 4CM9D 3DBHB 4TQGA 5DP1A 3I1JA 4CLOA 2A92A 4CQLA 2V6FA 4R3NA 3WXBA 2AE1A 4KUGA 4UREA 4XGNA 3GZNB 2I99A 1GR0A 3AWDA 3QQPA 4MO2A 4MVJG 1KEUA 3MEQA 3VTFA 1VKNA 3F9IA 2NUAA 4PLVA 4KZPA 4MIOA 2BFOA 4CM4B 4ND1A 1KVQA 3OA0A 2PD4A 1X13A 1ZK2A 1NWHA 2JL1A 1ZJZA 1BRMA 3H5NA 3RIHA 3X2EA 3NJ8A 3AUUA 1DRVA 4TMFA 2DUWA 1JWAB 3QVTA 4CM9A 1ARZA 1GUYA 5H81A 4BNZA 4WCFB 4D0SA 3AOEC 2VHZA 2DTEA 4YWJA 4EZBA 3LQFA 2D4AA 1A72A 4BHTA 1DHRA 4AVYA 3N74A 3UFXB 1V3UA 1ZEJA 3WICA 4EW6A 1H6DA 2IRWA 4E5YA 4UUMA 1Z73A 3C7DB 4NK5A 3TZHA 1LNQA 3GEDA 3WR5A 1UZMA 3WLFA 4M49A 2IZZA 5JAZA 2YHIB 3BAZA 3KXDA 1BXGA 5TSDA 2BFAA 1EE9A 4DA9A 3E03A 2V7PA 3EW7A 3R3SA 3VH4A 1ZK1A 4NIMA 4NBRA 3LLVA 2FP4B 4II2A 1ZBQA 5JPIA 3PJDA 3RAJA 3VHRA 1AN9A 1ZMTA 2FSVA 3L4SO 3PQFA 4E4YA 1P9LA 3FRJA 2LDXA 2Q45A 3BZUA 5CEJA 3BHJA 2PNFA 3PTZA 2G5CA 3N58A 1U7HA 1T2FA 4A03A 2AEMA 3JD2A 4EJ0A 1YOVB 3LZ6A 1D1TA 4Z3DA 4I5DA 1LQUA 5JNLA 4BMVA 3PRJA 3RUAA 3A9WA 1PJCA 4E5NA 2EV9A 3HJAA 1LSUA 1HETA 4XQEA 1Y8QA 1YGYA 2A9FA 4XGKA 3I6IA 1HRDA 3NAQA 3QV1A 2BI7A 1GFSA 2QZZA 3HN7A 4BL5A 4QUKA 3PHIA 5IDYA 5JMPA 2QW8A 2FWMX 5T6BA 3UCXA 3P2YA 5C7LO 2FR8A 1UR5A 2VZ9A 4IS2A 2JCXA 3P2OA 1VRWA 1K5HA 1I2CA 1M76A 2C82A 1VE9A 3S55A 2PD3A 1OC2A 4DXHA 4PN3A 1XKQA 4BO4A 3I4CA 2X4GA 2NLOA 2NTVA 4JX8A 4UEJA 4XYEA 4E13A 3S2FA 3EZYA 2OL4A 1BXZA 1GL3A 2OGUA 2QYSA 4CV1A 2G76A 1LDYA 4BOYA 3QLJA 3OF2A 4EI2A 1RM4A 5T67A 3RKUA 3KVOA 3I9LA 3I9MA 2VTEA 1ZSVA 3BMCA 3SJ7A 1LQTA 1XSEA 5T64A 4RVUA 4ALMA 3JD1A 1SO8A 3WWZA 1VKOA 1LC3A 3B20A 3WYBA 2CD9A 5I8ZA 3E18A 5ILGA 4J9UE 2TMGA 1YBVA 4MP6A 3WBBA 3SBOA 3TN7A 3WB9A 3JD3A 4R5HA 1PJ2A 1B8PA 1LRKA 5BNIA 4GGOA 4ZU3A 5A04A 1NVGA 4LISA 5H83A 4DRYA 4ALKA 1EK6A 3C7AA 1IL0A 3QW2A 4AJPA 3NT5A 4O0LA 1BDBA 3ONFA 4FN4A 4CLDA 1QR6A 2HO5A 1XDWA 1O6ZA 3NV9A 2B35A 4A10A 2D3TA 1R4MA 1SNYA 5G4KA 1NHGA 3JQ7B 3WFJA 4OYRA 5LCXA 5DP2A 4TKLA 2YV1A 3BMQB 3ASVA 4IY1A 2JD2A 2DT5A 5L53A 1E3LA 4XA8A 4XX0B 3O8QB 3PHJA 3W4IA 2PY6A 1R4NB 1V0JA 2QZ9A 1TVEA 1Z82A 3KHUA 1KERA 4G2NA 4NJMB 1PJ3A 1EUDB 1PTJA 2DBQA 2UYYA 4PRKA 3OJEA 4KMSA 1O9BA 5C7IO 2YQ5A 1XELA 5LDGA 2JD0A 5IG2A 1EUDA 1KC1A 2GN6A 2X6TA 2BRUA 2VT2A 4JIGA 3CMMA 1JKIA 3LF2A 1ADGA 3GVCA 3TZ6A 2YHUA 2UUPA 4TRJA 3PDUA 4QT0A 5I9LA 2WYUA 5CP8A 3FTPA 1EDOA 2O2SA 2X8LA 5ER6A 4GX2A 3FBGA 4BNYA 1RPNA 3IAHA 2NU6A 3OJOA 3CZRA 1O5IA 4R69A 1X0XA 2OORA 4FJ0A 3GNQA 4GWKA 3ZU5A 5KVSA 3E82A 1N5DA 3U3XA 4YJHA 2C54A 1Z74A 1WLYA 1CJCA 3WGYA 5AXDA 5L40A 1AXEA 1EVIA 1A9YA 1C1XA 2Y1DA 5B4UA 2X9NA 3HUDA 1TB4A 3UGKA 1BW9B 3N7UA 3DAPA 1PS0A 1NQOA 4RVSA 5CDYA 3T7CA 2HJSA 4L76A 4IMRA 2W90A 3DWFA 5AYVA 4YAGA 1OC4A 1UXJA 3D4PA 4Y6SA 3VC7A 4OSPA 3PQDA 3FNEA 5KWEA 3WOHA 4CLEA 1XG5A 2PZMA 4YJGB 2I5PO 4AJ2A 1U4SA 4DIFA 3OJ0A 3A1NA 3OIGA 4RPHA 1ZNQO 4TROA 4WKGA 2Q50A 4I08A 3KM0A 5TT1A 5IZCC 2VUTA 5CPBA 4XYBA 3WJAA 4YXFA 4BO7A 1KVUA 5FI5A 4GX0A 4NBWA 5EERA 3DO5A 3FNHA 1DFIA 4OHUA 5THQA 4IJKA 3DFUA 5KJCA 3T7EA 2DPGA 2J3KA 4OMUA 3DTYA 3JYNA 3INTA 4EGFA 2EKQA 4A0SA 3LYLA 1HDRA 2EGGA 3MJEA 3H6KA 1I3LA 4DYDA 1ML3A 4FJ1A 1KBZA 3AM5A 1N7HA 4E6PA 4JJGA 1BW9A 2HQ1A 1C0KA 1K3TA 4R51A 5T5QA 4CLXA 4DTIA 4NFHA 2HUNA 2XF8A 4N54A 1IZ0A 4OJNA 1WPQA 2G17A 1DJNA 2NU7B 2RH8A 4UUPA 1YDWA 1Q0HA 4KWHA 1PGNA 2UDPA 5I7FA 1HDZA 4CLRB 1CIVA 1YXMA 5JCJD 1Q2XA 4CMIB 2PA3A 1LEHA 3Q9UA 3E6AA 4TWRA 3FF4A 1FDVA 1GU7A 4AJNA 2ZYGA 1CWUA 1H0KA 4BO8A 1SEPA 5JO0A 4NBVA 3F1KA 3CUKA 4Z0HO 4LMPA 1LXCA 1QV6A 2C20A 4CM1A 5KOIA 1W6UA 2O3QA 1XR3A 2NVWA 4L73A 4BNGA 5IXSA 2JKVA 4FFRA 3E5MA 4KOAA 5HRUA 3E8XA 2ET6A 5TQVA 2Z1MA 4J4BA 2AHRA 1PJ4A 1YWGO 1U5CA 3GAFA 1YBAA 3I83A 1QYWA 2I65A 4Z9FA 5BSGA 3PHHA 1B26A 3AUSA 3EC7A 1B14A 4IZIA 4P4GA 3SJUA 2IZ1A 1E3SA 3KETA 1CRWG 3W1VA 3GK3A 3OFSA 4QSMA 1R37A 3PXXA 2CUKA 4YBZA 1D1SA 4JJIA 3V5NA 2DC1A 1H5QA 1IY8A 5F1OA 4B7XA 3DBVO 3HFGA 3DAFA 1ZSYA 1PL7A 4PLFA 3PK0A 2FPGA 3K73O 1ZK0A 1HE3A 4GMFA 4HUJA 4YJHB 1GTMA 2QYTA 3D3WB 4Q3BA 1K6IA 2DPHA 2GD1O 3KEOA 3RBZA 4LCJA 4D46A 4XGIA 3TFQA 1XQ1A 5DBGA 1FDTA 3DOOA 1JVSA 5DBIA 2CVOA 1U3WA 3GHYA 4WOJA 1GZ6A 2QRJA 1P45A 4UEKA 5TT0A 4J2HA 4UVHA 3SXPA 4CM3A 1EEHA 2PLAA 3ZV5A 4XR9A 4ALNA 2EKPA 1RJWA 4G65A 5K6AC 2BGMA 1LI4A 3U5TA 1E7SA 3MJCA 4TRMA 2DBVO 4PVCA 1QSGA 1ULSA 4D44A 5ICSA 3JQBC 1E7WA 2W4QA 4HADA 2HAEA 3KUXA 1NVMB 3NJ4A 4KDFA 1YO6A 1JAXA 3DC2A 3I6QA 4DLBA 1TXGA 3RUEA 2XXBA 1DIAA 2Y66A 4JQCA 4JP2A 3ENKA 1UAYA 4E0BA 1E3WB 3DZFA 3VZSA 1FDWA 1NBOA 1WDLA 1U7TA 1NPYA 4CM5A 1Q1NA 3SC4A 1XGKA 4R3WA 2NADA 1HSOA 2YUTA 5L7YA 1EFLA 4QFDA 1EVZA 2YFHA 1IPEA 5DDIP 3LC2O 1D3AA 2PH5A 5JMWA 3RKRA 2NVUA 3FTNA 4M55A 1B8UA 1OOEA 3L6OO 3LC1O 5A1TA 2YFQA 4R01A 3HSKA 4AJIA 2RIRA 3H4VA 1NP3A 3I3OA 5G2OA 4BGVA 1QXSA 1IB6A 1HE5A 4XYLA 2CDAA 2VQ3A 3DZHA 1JW9B 1DB3A 4QQRA 1DDOA 2FR0A 4IDEA 3JQCA 1Y81A 4JBIA 4OIMA 3PWZA 1KVSA 1T2AA 4B3HA 3G49A 2POQX 3Q0EA 4EDFA 4GGPA 4XRRA 3GFBA 1PZFA 5GZ1A 1Q7GA 2V65A 1M66A 1V9LA 2VRCD 4BNJA 2B37A 4WOKA 1IPFA 1N1GA 1ISFA 1R6DA 3PIIA 2EWMA 3G1UA 1XHLA 1A27A 3BHMA 4WCFA 5I7VA 3QE3A 3E5RA 3O38A 3AW9A 2BFPA 4WE3A 1ADBA 1Y9EA 4PG6A 3GDGA 3RFXA 1M67A 4PLZA 1JN0A 4MVJH 3I23A 3DBRB 5FEUA 4ILKA 3UFXA 1M2WA 3H3JA 1N9GA 4RDIA 1GZ3A 2HRBA 4LRSB 4R9SA 4OQZA 1XA0A 2Y0CA 3EGOA
chains in the Genus database with same CATH superfamily
2OXTA 1ENPA 3L7NA 2RAFA 2YMPA 2EFCB 1UXHA 1DC4A 3ZDQA 5CX1A 1GYPA 1XAHA 4RW0A 4F7DA 1T1RA 1QHHB 4UULA 4HEJA 1JG1A 4G0XA 4MIEA 3PFGA 4WNAB 1UBLS 2BR4A 2XMRA 2ZRHA 3GPDG 2VUUA 5A3JA 1EVYA 3SM9A 3PITA 1L3BA 5AOBA 1ZVVA 1KC3A 4GP9A 3UXYA 1OFTA 4G5GA 4ZU1X 5KVQA 4K6FA 2PKYX 3VNSA 1IXSB 2NQ8A 4OSOA 4H17A 1D2HA 1GILA 1QB8A 3MINB 3AETB 1Z6GA 4B44A 1M34E 1AF4A 1WF6A 2JAHA 3A4VA 3G8YA 3MXTA 3SQOA 3V4LA 3VJLA 2F55A 2Y1FA 5LD2C 4K0KB 4MHOA 1WPRA 1DIGA 3W9SA 5IM4A 1A7KA 3GYBA 3OH8A 4M1EA 2H5EA 3R7AA 1X19A 1ADCA 5CDGA 3JQFA 3CCFA 1DIHA 1GPJA 2R8OA 5FTLA 3QKIA 2NP7A 5AP9A 3TXXA 2DEUA 4W1PA 1PE0A 4PONA 3AZPA 4S1NA 3WY9A 4IYJA 4P4NA 1OXMA 1U0TA 4E21A 1XCMA 2FDXA 4OQEA 3DNFA 3QV2A 1SUCA 1TCVA 3IDAA 5FP0A 6ADHA 2OB1A 4L07A 1CUBA 1CVRA 3IULA 4UNRA 3C3AA 1V4BA 1XCLA 2WKRA 5GONB 2PUGA 1RM5A 3OT5A 1KK3A 4G25A 4UQPA 4MDYA 5BRJA 3OA2A 2H08A 2NZJA 3TF5A 3KQKA 1RIIA 1GZ4A 1RC0A 4XYGA 1W44A 4G0PA 4UNNA 2COUA 1BQEA 1XKLA 1CVLA 3KD3A 2NVUB 1RHQA 4HH3C 1G7TA 4XJTA 1XAJA 1PHRA 1UEJA 3KSAC 2YZKA 1H85A 2GD0A 1QAQA 2FY8A 3WKAA 3NUZA 1JH9A 1XWIA 4OI2A 4OSEA 4ZCLA 5CDFE 1FUIA 1ZICA 1FFCA 2F6RA 3BIFA 4BMZA 2FPMA 5G0VA 3DGEC 1JB1A 4L72A 1AXGA 3HM2A 5ECDA 1V5IA 1BD3A 3H8SA 2YV2A 2NYAA 4KPUA 3H75A 1FJGB 1WABA 2ZSIA 4G37A 2X86A 4QPNA 5ITVA 1PFGA 3K9BA 3WGGA 2VF5X 1YBHA 3ON5A 4KQJA 3KSDO 4ZI7A 1J0XO 3IAAA 4OV6B 2LKDA 4PSVA 2Y0BA 4UHBA 4KR9A 3S5JA 3MT9A 2FLVA 2IOYA 3TM5A 2JFGA 4FR5A 5CA1A 4Y1FA 3EVCA 4ZI7B 4UNPA 3IBYA 2VK1A 5BR7A 4R2LA 4NYMR 4YAKA 2AD5A 4BNIA 2QTVA 1ZUWA 4MQ4A 1XAIA 4E4TA 2JPDA 1DTWA 2OC4A 4EF4A 1F12A 4KO8A 1I9GA 2Q3JA 2D0OB 3LH5A 2QZSA 3CN9A 2W48A 3TAUA 3WV4A 3WYCA 1KO7A 4RELA 1G291 4J7AA 3LLSA 3ESRA 5AVSA 1SCDA 3CZQA 2L69A 1A9TA 4P4SA 3OY7A 3U4IA 2XTAA 1J0EA 1KARA 1YQUA 3A1WA 1Y5IA 3PIDA 4FQ5A 1E7YA 5GV7A 3RARA 3MFQA 4HWKA 3RG2A 4AN4A 1QH8A 3F9CA 2NV6A 3AQIA 3NHJA 3QI7A 4HLUA 4L7QA 2ZR0A 4MRAA 4RSGA 4RGBA 3TMYA 1FBNA 3U4QB 1NJ6A 3BREA 1EH5A 3IUMA 4BMNA 5JSZB 2JAXA 3RGWS 4B0PA 2WC1A 5KTMA 4QVIA 4B3GA 9LDTA 1QGDA 1QJ4A 2ZRJA 4FS8A 2H3EA 1Z6XA 4MS4B 3U7FB 3EXG1 1S3SA 4A7PA 5DHUA 1PR9A 2BTEA 4YB8A 3ZBUA 3WZMA 3UCEA 1KQFA 4YRBA 1DAPA 1K7FB 3EAQA 3KCNA 1MFPA 4F96A 3F97A 1RRPA 2DFTA 3K9GA 3GAMA 4ZAWA 3PYMA 2GHIA 2HMVA 4I19A 1O08A 3BGWA 1U28C 3EEFA 4GXTA 4MJ3A 5CB4F 2ANBA 3GA0A 1QPGA 1M5UA 2GCEA 2CNLA 4H60A 2NUTA 3VPDA 4TKVB 2V03A 3Q98A 4P3XA 4DMUB 1NMQA 4GLOA 4WD3A 4EG0A 4GQAA 3X2FA 5CCBA 2WM3A 3LQ2A 4WLEA 5AW0A 3I39X 3WWOA 4XUGB 1RWBA 5COQA 4XOIA 3IAS6 3W9UA 4CCYA 4RULA 4RYLA 4C6SA 5EHZA 3RHSA 4P4SB 5EY5B 2PZLA 3PKZA 1IY1A 4Q9IA 1TO2E 3MCVA 2QVYX 1QHYA 3F6RA 1I7NA 1VKJA 3PFNA 2WYWA 5EPOA 2GRUA 4L0DA 5DM4A 3WISA 5A06A 3R20A 3AIMA 5FDFA 4V3BA 3P2IA 1TZJA 4P7FA 1OFVA 1SG6A 1LW7A 1FDUA 2BEVA 4S0ZA 3LRPA 5B36A 5IJWA 3NHZA 3T7IA 1E1KA 1T36B 1XVLA 4GIBA 2PMEA 2P3OA 3E9RA 4LNUB 4MS1B 1M2VA 2I33A 2XD4A 3CSUA 2O0MA 5EP4A 1OPXA 1NW8A 3VISA 3KTDA 3HVKA 5IM4F 3LWBA 2RAPA 3ESYA 1OU4A 4PS0A 5K45A 3H5RA 5K0BA 4O4JB 5AMXA 4HAOA 2C4UA 4QDZA 3INGA 4DR2B 3CT4A 3EVEA 4NVRA 3L79A 2IYYA 3SBDA 4ZU6X 5LQJA 4DGSA 1E1QD 1I3OA 1XVIA 2C8JA 2HNAA 3AR3A 4RH3A 2JIMA 5FPTA 3FYUB 2VYVA 2NXJA 1PS8A 2Z58A 4KQMA 2JIOA 3TNLA 1LLUA 3IUYA 5REQB 5U9CA 2XWQA 5EJGA 1O1YA 4IS3A 4TMZA 3C24A 3K5IA 4KWIA 3UT0A 1QTNA 4RK7A 1XJWA 1HT1E 4QGBA 5JARA 4Y9TA 2PTGA 1PZHA 4A8TA 4LXTA 4UUAA 2NVBA 4JI5B 3WGHA 3N8NA 2CLCX 3S99A 2PTHA 4QLBA 3FVWA 3T5MA 2FSGA 4MPDA 4PLHA 3DDWA 3R4VA 3M9XA 1JJ7A 1MABB 1NOIA 2H59A 3L6UA 4IDOA 5JSHA 3AY3A 3P94A 3GPLA 2AWNA 3M2TA 4XD7D 5ALHA 5EFZA 3UC5A 1M1XB 1DTWB 4C30A 1W25A 1N5LA 3DL0A 3H65A 3F4KA 1FL9A 5ENVA 2POCA 1IBMB 1JVBA 1F14A 1R8YA 1YDGA 4UD2A 4BGUA 4WOPA 1MAWA 2E1RA 3ZPXA 4W5OA 2YJGA 2YV3A 2B6NA 1SQ0A 4KDEA 2HIMA 2P4HX 4RHXA 4ZO6A 4CM8B 4GKJB 1W29A 1P2VA 4CYMA 2YCLA 5IFKA 4CEHA 3B3AA 3BMOB 4NCJA 4LKRA 3RRZA 3TXYA 3P97A 4IFTA 3IKMB 4LECA 5DBEX 4JQOA 1GNQA 2R2GA 3BFXA 3WO0A 4CCAA 1MB2A 1ZSNA 2R4QA 4MVCA 3RK1A 1P1CA 5JS2A 3NI2A 2BONA 16PKA 4YDRA 1YL5A 2XNCA 3G89A 1EXVA 4JUCA 1U8UA 1T5SA 2WZQA 3MJ4A 4RKQA 3VZQA 3U31A 1TJNA 2BKUA 3CSSA 3NYWA 3O03A 1T5DX 2FW0A 5ESWA 4NHOA 2FTKE 1S1MA 1MOZA 4I55F 4ACAA 4ZVKA 1V96A 4IJMA 1MDBA 1L7EA 1PUIA 1TMKA 2OAEA 2W00A 5L3SB 1V3QE 1JQ5A 1MC1A 1UMBA 1NN3A 3GFOA 4P3KA 5KNBD 4XVHA 1QVRA 4WIAA 1F4VA 2OE2A 1IHYA 1S9DA 4ZICA 4W8GA 5F78A 4WUTA 5L8VA 2VH2A 4ND8B 1PFQA 3L6BA 1T9GR 3F5FA 3B1VA 2D0IA 2JAWA 1EGAA 3R77A 4R83A 3G6WA 4KAXA 5E1DA 3QSYA 2IPXA 3W5DA 4V0QA 1DFHA 4H3HB 4JC8A 1JR6A 3KOMA 4Y1EA 1NYRA 5FNZA 1ZJJA 1ZIOA 2JDID 4DQUA 4P0TA 2YOFA 4U5QA 2PSFA 3QKSA 1JHUA 3K2QA 2HMYB 1B0UA 2L2QA 4Z5XA 2VVTA 1LLCA 4O4IF 2E82A 4RMIA 3DZDA 2JGAA 3G0HA 4Y6GB 1GTSA 2XDAA 1AGRA 2ECPA 4GL4A 9MHTA 2JK1A 4QM7A 2WJZB 3WBFA 2Q0HA 3FFWA 5JECA 1JQLB 3LRTA 3RHTA 3QUCA 3QI2A 5F5XA 3LUCA 1R4AA 2X4DA 2RC5A 2HN9A 4J0JA 3CZCA 3Q8KA 1S2NA 5B53A 4ZAFA 3TJZA 3D1LA 3WOVA 3H9GA 1R0LA 3H17A 4JQYA 4D3FA 1C0EA 4CR8A 4V24A 3ZNNA 1VC2A 1HNZB 2ZIFA 5CVTA 4C3UA 7MDHA 3JATB 5EFOA 3GRCA 1VZ3A 2ZTHA 2GPBA 3C1OA 4LY3A 4RFVA 1L8AA 1I6KA 5ARBA 3PZBA 1BFUA 1PYDA 3KVNA 4TMXA 5IVIA 1PP4A 4L4XA 1K63A 1H2EA 2J9ZB 3FSRA 1IMOA 5E3HA 4UMVA 3PB3A 2AOXA 2VDLB 4HDMA 5BN3B 3EUFA 2PHZA 3VAZA 1I2MA 3HKDB 4E32A 4O6VA 1W9HA 1PDVA 4BRSA 1CYEA 3SKXA 4QHTA 1XDBA 2AEFA 1JMVA 4JBWA 4PSKA 4MV8A 4XDYA 2DHRA 4HDMB 5CW2A 2J46A 5JCJA 4BYGA 3RC3A 5BN3A 3NBXX 4DMMA 3COYA 2A88A 1TE2A 2IEYA 3P8ZA 2QRQA 1NW6A 3A25A 1A77A 1R6XA 3HEAA 4GMHA 2X41A 1P4AA 1V16A 4C88A 1TZCA 2V7TA 5ILOA 1SQGA 5AJTA 1M1UA 3QITA 2ZYVX 1GG2A 2DGDA 1C1DB 2JLRA 1Y1QA 2W5UA 4G3XA 4M0FA 3V2GA 2XZLA 2CWWA 3MJFA 3Q87B 3QMWA 1G64A 4NV0A 2PEYA 3F71A 1CNMA 1FX0A 3OUTA 4FMDB 5F4BA 3G0GA 3WTBA 1VBKA 3WGQA 4CLRA 4CTOA 2A9JA 1Y3IA 4DG9A 2Q9UA 1RYDA 3Q9NA 2GBCA 1VE1A 4IUYA 3STXA 4V2UA 4RWZA 5AI0A 5L3QA 4B83A 3O75A 4HY3A 1VHTA 1WU7A 3NBMA 4MGHA 3UT5B 2B92A 3O95A 3MILA 1ZI6A 4H18A 5D7BA 1XD2A 4I8DA 4M1QA 4OD0A 1KEEB 3LVQE 4OXRA 1A04A 3I32A 4QRIA 5BSRA 5JTTA 3DPIA 3IQHX 4DN6A 1PG2A 3ZD7A 4BDTA 1SVMA 5JC1A 1DVRA 2OD9A 3TMKA 3X1WA 1RE0A 5JAQA 2ECKA 4OXKA 4ZYVA 2GZHA 3ZTWA 2OSVA 5A5FA 2JBHA 1ISRA 1NASA 1X8JA 1MB0A 2MIIA 5B1DA 1IAVA 2B4QA 1YCDA 1NT4A 1QYRA 5DGXA 2AHOA 3I5MA 3NVMB 5AKLA 2C3MA 2BEJA 3OIFA 4YRMA 3FZNA 4W99A 3HS3A 4IDNA 5EWLB 2I6TA 2X0KA 2R65A 4FC7A 4NZ9A 5GONA 3MJTA 3QEMB 5IABA 3A4YA 4RIIA 1Z8NA 3UW3A 2Q5CA 3WQHA 5B5SA 5JH7A 3QLEA 3OEWA 3JASB 3FDIA 1P4JA 4Y67A 4UU0A 4A8HA 2VDVE 2H4WA 1K8XB 1Y6QA 1SWVA 2VF2A 4JXJA 3QEBZ 2HLPA 3R3ZA 1NG1A 1HUQA 1NU8A 4D8WA 2TMYA 4EW2A 1VLJA 4GEGA 3C2QA 5EMHA 3O8OB 2FP4A 2CFOA 2CVPA 3QZUA 4KRXA 5BQ5A 1NXVA 1RAAA 3C48A 1NN0A 3EXEA 3QFSA 2HJVA 1YMUA 3FPSA 3CRRA 4JHXA 1EX7A 4K3VA 4PPQA 5CG1A 5CB8A 1YRBA 4R0MA 5JRDS 5KINB 1V8ZA 3M6WA 1U1FA 2I3GA 1KOJA 1V8OA 2ATCA 5ICGA 5JADA 3O94A 3TDKA 5IUJC 2OG1A 2WAXA 1I4OA 1W47A 3ABRB 1LJ8A 2RGXA 3L93A 4W82A 4Z9XA 5HDQA 4AZVA 1BN7A 2PJZA 4RH0A 2QYOA 1O4VA 2ZDHA 4FEEA 3SYTA 1Z2AA 1WDTA 5LSAA 3ZEIA 4UBKA 4BX0A 2ZG6A 3GU3A 1CUSA 1AV7A 2H2GA 3A27A 2GPJA 4WT7A 2CV0A 1TUIA 2JGMA 1J33A 2I3BA 3CNEA 4WH0A 4GICA 1GGFA 4PZLA 4KQ9A 4PQEA 1BC5A 3M5DA 4P98A 3T3GA 4A6PA 2A5DA 3B1KA 4D8TA 1FP1D 4HTFB 2AL7A 3R3HA 4DCTA 2GMWA 3NBYC 1AUOA 3V7UA 2H7VA 3OZBA 4C06A 2C7RA 1IN4A 1CDDA 3CKKA 1VMKA 3UJBA 1UBTS 3ECAA 1TAUA 2OFOA 1KMHA 4DLVA 2IU3A 4ZVRA 4EF5A 3JQPA 3D4NA 3ZNOA 5IJ9B 4RJJA 4O2AF 2FA9A 3C3KA 2HLDA 4H7PA 5TE9A 1C8BA 2XSZD 2XR1A 3HKBB 3OPYB 3HABA 5T6MA 3D6AA 3DLAA 4K9SA 4YHHB 4L74A 3KEQA 3KEGA 2XGGA 1WMSA 3EVZA 2PZEA 4I4CA 4WLNA 3ELUA 3PWTA 3ZUGA 1IQUA 1YACA 5EINA 2XUOA 4DY6A 4FKBA 2JNWA 4ZYYA 1BCRA 2PLWA 1E2JA 3P52A 1OXBB 4K46A 1S2IA 4FLMA 3ZW8A 3NANA 4YACA 1POXA 1WQ1R 4LG1A 3D6UA 4KL8S 4PIVA 3UYKA 1KEEA 1OH5A 5JSKA 2A5JA 1NMYA 1FFEA 2C98A 1O96B 1V5EA 3NNDA 4QNNA 3O4FA 3OHPA 1K4KA 2FUEA 3SZ3A 3I6BA 3ZWPA 2XJ4A 4HDNA 2W6ZA 3NHAA 3NTLA 4LNHA 2OAGA 1FY2A 4TT8A 4UTVA 3D64A 4YT4A 2W4IA 4IOKA 4X1YB 2SICE 3P4YA 1X1QA 3B3JA 4IDCA 1X3SA 1XZKA 3R41A 4GO1A 5T3YA 5ALQA 4C08A 4DM4A 1P75A 2WAOA 2BMAA 4DG5A 3F7TA 3UK1A 4QGAA 4M8SA 4OHVA 4RF3A 1WZNA 1L7NA 3HP1A 5EXDA 1OV6A 3IRVA 5J5CA 2BC9A 1VJ1A 2DHCA 4D9KA 1E1RA 4PPYA 1R5BA 3ED1A 1L7OA 1SKMA 3BGIA 2ORVA 4JP5A 1ID1A 4H1VA 3BMNA 3C6QA 4YIKA 4DUGD 3JQ9A 1QAOA 1WAMA 2EF1A 3PUXA 4WZ6A 4Z3KA 3ENQA 3AVWA 5JALA 4JYMA 4DB2A 5IP5A 3RRYA 4Q4DA 3ZY4A 4MV0A 1N8KA 1UT5A 3C70A 2RB5A 3HUUA 4JBYA 3MRXA 1PF7E 1G2QA 1SUPA 5COBA 3WSWA 5IJZA 1G21E 2FETA 2Y99A 3SKVA 3FH0A 3JQGA 3KELA 4JB2A 3JQ9C 4FYWA 5MGBA 2AR7A 2PZ8A 1MD9A 3GI1A 4Y6RA 1KDZA 3HMKA 2GEDA 1NZJA 3ZS9A 4ER7A 3S8YA 3SMVA 2XGSA 2PWBA 3A6FA 4HDNB 2Q3CA 3F6CA 4TTAA 4WFKA 3ZBQA 3B6IA 3VZDA 3RG8A 3ZX4A 3HM9A 3GWZA 1YE3A 1U0LA 1UBFA 1JLRA 2O4CA 2VP4A 3AVOA 1WZCA 3FE2A 3IP8A 1HF3A 2W6JD 2WU8A 3PS9A 3P4UA 4C21A 2IEZA 1VHLA 3ENZA 2I2DA 4KBGA 3L8EA 3OM0A 3SDSA 4BP9A 1RADA 5BW5A 5AW2A 1ZRSA 2EW1A 3QFHA 2BJWA 4B3JA 3VKGA 1Q44A 3SJZA 5FEMA 4I9FA 1DBWA 4GP6A 2COKA 4FCCA 2PXXA 1RKVA 5D6OA 3PUVA 1O58A 3JW8A 4RM2A 3VPXA 1AQNA 3D5QA 4NZNA 5SZHB 3V4RA 2DWUA 1P74A 2OZVA 3SYLA 3LSYA 3E9NA 5JC8A 4TLMB 4D9HA 4FILA 5LP6F 4BDSA 3LUGA 3EXHB 2JLWA 5K9ZA 4O25A 3NAMA 4RVCA 2HU5A 4KSYA 2E4WA 3PFFA 2D06A 1QLWA 5JSUA 3Q6IA 1TK9A 2QTCA 2WSSA 2F67A 1PGPA 4HQRA 3TLKA 3SC3A 1CJTC 1XZCA 4L9SA 3UJ7A 4D4JA 5HFJA 4BE4A 2ZJ8A 4AMYA 4LJ6A 2QWXA 1C4XA 1UKEA 1TDJA 4KRGA 5TPZA 3WTCA 4G1VA 5BQFA 3MXOA 1NATA 4OHRA 4QUIA 3AY7A 4FFSA 5GJWC 2VEOA 4ZI7F 1ZZGA 3U3RA 1MNAA 3ZGNA 1V5GA 3ZQJA 5K99A 3DUFB 1HYEA 1FP6A 2XADA 3L8DA 3C8UA 3HADA 2FF5A 3MBKA 2QENA 5F33A 5ADHA 1VCIA 4EHJA 2XMSA 1QU3A 1Q6ZA 2N1BA 1Y42X 2EDCA 4V0RA 1GTG1 5L3ZA 2UAGA 1VMIA 1E2MA 2V3VA 5AOVA 5SICE 3RTAA 2G77B 2ODTX 4UTOA 1FLNA 1NW7A 2PBFA 4D3DA 4L4SA 5IPFA 3D59A 2V96A 5DM0A 3BFJA 3TW6A 5FBVB 3JWGA 5GGYA 4QA9A 5B3LA 2XUPA 1W52X 2D5LA 2Q3BA 3OPNA 1C3LA 3AFNA 3KTAB 2IHYA 3U26A 3ASYA 5DLEA 1BGWA 1C3EA 4LRWA 1JDZA 2Z8YA 5CXQA 3ASUA 4F3KA 4I5IA 4HSEA 1SB9A 1XB2A 1ZOLA 4MGZR 5DXFA 2OFWA 1XK6A 3DLIA 2IZ7A 1XEAA 3KUCA 2ENWA 4R84A 2IELA 4QFCA 3Q8LA 2EYQA 2FRVA 1O54A 2PG3A 2X77A 2FMIA 3C8DA 2OLJA 3CH5A 3NTQA 3PUJA 4BO1A 2BCJQ 1IJFA 2EU8A 2J45A 4NBKA 3DAGA 3ZN2A 4MVYA 4IDPA 4U7TB 2GAIA 3BH6A 1UOEA 1ZN2A 1JQJC 2Q29A 2DM6A 2R00A 3IHLA 2WMDA 5JHGB 3KUKA 2O2JA 3WJ2A 4DV6B 1EX1A 1PWZA 3PEVA 4D3YA 1IRXA 4ZT3A 1QU2A 4AMZA 1HRKA 3DP7A 4OUKX 4XM1A 6ABPA 2M9MA 1KA9H 4J0GA 3V7FA 3V1UA 1BE1A 5K0ZA 1Y4DE 3P9SA 3C6BA 3GRKA 3RWMB 3H84A 3K8QA 2ZITA 5K3BA 3WYAA 1ZIDA 3GQBB 4U7DA 3ZTTA 2A58A 3MAJA 1YTUA 4QOGA 4QEZA 1UC5B 2OFFA 1LGYA 4EKGA 2VTDA 3K1JA 3PJFA 3WE7A 3VOTA 2NO9A 1YR9A 4ZTBA 2O50A 3EYWA 2GKOA 3G17A 3QY9A 1FQOA 4RK1A 3ITEA 5J4VA 1TK3A 4AO8A 3PFWO 5CJPA 1ZM7A 2ZIXA 3C6MA 1V48A 2ZSUA 3CRNA 4AMUA 5I4KA 4CIDA 4ZKEA 2XUKA 3U4GA 4B3CA 3HEBA 4IICA 4P0QB 3ZNPA 1Z6TA 3IVXA 2GS9A 5TXGA 3LDGA 3EZ6A 3E58A 4IL5A 3S68A 4FMPA 3THSA 1N75A 4TVBA 2Z95A 5HE9A 5A9SB 4MK4A 1JFRA 1L4NA 2PKEA 3C8MA 3FNIA 4OHWA 1Q20A 4JVSB 2SECE 4HH0A 2NYVA 3RKSA 3ER9A 2BHTA 4IF6A 2JVKA 4G9GA 2DBRA 3DVAB 1U8EA 2HDOA 3LCVB 4QJ4A 5CU7A 4YS6A 5A5GA 1XV5A 2QP4A 5LFAA 3UFBA 2ZIAA 4LHXA 3TSZA 3AIKA 4RVNA 2G88A 2Z3ZA 1TQ8A 2NYUA 1TUBA 3FPCA 1T8SA 4GWGA 4R81A 3IUSA 1BRTA 2EC5A 3LP8A 4XEHA 4CW7A 1Z4OA 4Z9YA 1UQRA 1PCXA 3HV2A 3HXKA 3B8EA 3WYDA 4D9JA 4IDFA 2QX7A 1N7JA 3EDOA 2QG4A 4Q7QA 4DRXA 3T5GA 5HQ3B 1KQ3A 1IK6A 4UVGA 1XZGA 2WTXA 1KTVA 3ROFA 3T9DA 2R68A 4N5LA 4DQ0A 1DRKA 3RVDA 3RS4A 2PO5A 3CUEF 1DTSA 1QV7A 2FAXA 2CBXA 3B9BA 2B8TA 2OLKA 3UKJA 3WXMA 4EY8A 4UU1A 1QLHA 3RVKA 3EJ6A 1NJGA 1AKNA 3GFFA 2FQXA 1Z28A 4WZBB 1KXZA 1DS6A 4GL2A 2BFEA 3V8PA 2BGTA 2ZRMA 2CMFA 3KZVA 1KPIA 2QR5A 5P21A 4RDCA 1LY1A 1YR1A 1DKQA 2QLBA 1T2EA 1LBEA 3SF8A 3V4VB 4OGGA 4RSHA 4DWVA 3V8VA 2ZB3A 3VJMA 3IAM1 3ZI7A 1ZVKA 1ZD1A 2ZM6B 1FVOA 1OGIA 5ALZA 2PRZA 1E59A 2FMUA 4ZQFA 3ROKA 4PW0A 4DWOA 1JE1A 1I14A 4Q4HB 4BO6A 1Z29A 2WZCA 4JNCA 1Z2NX 3FJYA 3M1YA 4U6SA 1MC4A 5DNAA 2LE0A 3OHSX 5JPDA 1XZPA 1KJYA 1KORA 3CF6R 3RPEA 3TQHA 1V4NA 4DCJA 3E1KA 4GI7A 3Q11A 1X1CA 2JCYA 1N25A 2A0XA 4FXPA 1NQXA 2GHQA 2XUGA 1NJSA 4GPBA 4JHLA 4RMNA 3U7IA 4TV9A 5AKZA 1H05A 1T2CA 5BN1A 1FP4A 1E6MA 2FQQA 3EDQA 2QTVB 3BGDA 1FP7A 2PWAA 2E5WA 3DV9A 3N0WA 3EPLA 1KKMA 3OETA 2Z6QA 2NUAB 4P5DA 4WBNA 3LT5A 4MCJA 3Q5DA 5EESA 3KBOA 1QFZA 1OILA 1Y1KE 3N7AA 4JNKA 4F91B 3G9XA 3MGGA 2OO3A 1CETA 3R3UA 4XM2A 5LB4A 1YUBA 2XMPA 2W0SA 1QYCA 4LBZA 1PEYA 2C97A 2YTZA 4GM1A 1ONPA 2QBYB 3EXEB 2ZTMA 1O5OA 3E7DA 3NGLA 2B5WA 4OKNA 4JLSA 1FEZA 3B78A 5JS6A 3KJZA 3TL6A 1J97A 4CMIA 2D2EA 3FYUA 2YXEA 3P2MA 4GI3A 3GEPA 4OP2A 3WB0A 2VPIA 1TVKB 3KFXA 2D2FA 3RR2A 1AQYA 4JASB 4DLZA 1K88A 1N2BA 4IXDA 1PT5A 2H2WA 3NXKA 5B7GA 1U0OC 4DR3B 4G2TA 3P0RA 1FMTA 4YRIA 3A9RA 1J0CA 2PCJA 4BU1A 4D43A 5IRCD 2DWPA 4LYGA 1HWYA 4P53A 1YB5A 1VGRA 4ACBA 2CZGA 3BBLA 4MTCA 3WJ7A 3L6RA 4CT4B 3PDHA 1IZYA 2PV0A 2WDPA 1G0OA 1VZ2A 3ZE7A 1ZISA 1M8KA 1SUWA 1U1DA 4IIXA 4Z86A 3A3PA 3VDNB 2LR0A 4KMOA 4LSMA 1E9BA 1V1RA 2BRUC 2JEOA 4IMJB 2WIBA 1SUEA 2J59A 3M6UA 4DKJA 3PD7A 1WMAA 3L0DA 4OQXA 1NQ5A 1EB9A 4R9RA 2X19A 4ZV9A 1ZN8A 2EQ5A 4I6EA 4RLSA 1SZPA 3RHZA 1TT7A 2AOWA 3GMTA 4K9QA 4LWZA 4EIWA 4CKCA 1JR4A 4RJIA 2HHHB 3CF4G 5BSHA 2XOKA 2O9JA 2NU8A 1MGOA 1TX4B 2RGAA 5CCEA 1NAHA 4MR8B 1W8IA 4ETWA 3OPXA 4D0GA 3WL8A 4A6DA 1QAMA 4PAMA 4O4HF 2BMWA 2CWDA 3ZY3A 4QBKA 4EMBA 3UBMA 4OM7A 4Q9KA 3C6ZA 5FPKA 2NYRA 1ISMA 4S05A 3KYJB 1I0ZA 3L7YA 1PJTA 4TTPA 4D4MA 4ZT6A 4Z0NA 1A9XA 3VPSA 1MOQA 1XZ8A 1HA3A 4P86A 4QYMA 4GI1A 4JLMA 3WFIA 3OLVA 4HB0A 4TUYB 4JC5A 1T9GS 4BVJA 1IVNA 1H94A 1XI2A 4YV1A 3FBTA 4JFRA 1VYTA 3D4OA 2Y3IA 3VPGA 4Z1OA 1KJJA 3K2BA 4C2UA 3LW8A 2YVUA 1JIKA 1XRNA 2BHRA 3VVCA 1OAAA 3PFBA 2IP1A 4TLAA 1N0VC 3T6KA 4RA6A 1TLFA 2XCOA 4X1IB 3W5UA 2WF7A 2HT1A 4H6WA 4MA5A 3ZD9A 5FL3A 2IYTA 1T3TA 5C7OO 1H4VB 2DQYA 2DPLA 2HZ7A 2GAJA 3KAQA 4N3AA 3PUWA 4Y9DA 5HXAA 3SF0A 1RMQA 1SWWA 1U2DC 2IGBA 3WDMA 1L5OA 2OXRA 3TE7A 2PGXA 1GTZA 1RAHA 3QQ5A 1TGVA 1VI5A 2WKWA 3QX8A 4LVOA 3AZQA 2I4TA 1F2UB 4N1AA 3SIPA 3HA7A 1WR8A 3OFND 1R6BX 4MS1A 4RH1A 1SKQA 2C5GA 1EK1A 1Y9AA 1WKBA 3Q4GA 4NFYA 5ERGB 1NVVQ 2J9GA 1RHRA 3OZXA 5HCIA 4BVLA 4DR6B 1U5BB 1TW2A 3N0RA 5MFZA 2W6PA 1NGSA 3FNFA 4CEIB 1X15A 3H5TA 5EYPA 2O7VA 1LVHA 1CEYA 2QZ4A 4YJFA 4KLNA 2AJDA 2QX9A 2ZU6A 3IILA 1MV5A 4PNZA 1XZEA 3NGXA 3LGSA 3HA3A 4JJFA 5AM4A 1WCIB 1PDOA 2QTTA 4H59A 4JC0A 1ONNA 3T1NA 4ZO9A 5JY6A 3UPUA 2VLIA 1RZRA 3TXAA 1FDIA 1BHSA 3OHMA 5HRAA 2C58A 5G0SA 2FHSA 1SUAA 3ZXYA 1USIA 1GTJ1 2UVPA 1U1IA 2A59A 2R47A 1II9A 4Z7JA 4L9RA 5EKTA 1MO3A 1RAGA 1F7VA 3HV0A 4PLCA 2OUKA 3CZ5A 2A1UB 2Q5EA 1FDRA 1WVGA 2QAJA 3OJXA 4ANFA 2Y76A 5I7OA 2EKLA 4G5SA 3PJRA 1ZH8A 5EIAA 5FKJA 4TVOA 4XFJA 1QZTA 3EULA 2NM0A 3GJZA 4H16A 4B1FA 2ZAIA 3HYLA 3L1UA 1XCPA 2MOKA 4R8VA 4F21A 2OQ2A 1DOHA 2W6CX 1V9SA 2IHJA 3I05A 4H4CA 1W1IA 3PICA 1KYVA 1ND6A 1EM6A 3FFAA 2JVIA 3FUUA 1N4AA 2CXTA 2O1SA 3ORHA 3UKOA 3ZXIA 5CA0F 1WTCA 4W9NA 1XXHA 3W5AA 2JIZA 2XA9A 4ENRA 3KSUA 4D0RA 2IQIA 4H0NA 3AL0C 2AG1A 5ARDA 3D7RA 2ZUBA 3EVBA 1QUFA 3WGOA 1HL7A 1YUMA 3GMSA 2PUBA 1ISIA 2WUEA 1KPGA 4A2WA 4WA8A 4YLGA 4Z7QB 2VATA 4V0KA 2GI4A 4ZAZA 1S89A 5JYEA 1VM6A 1WCIA 3OE4A 1ZHOA 3H1EA 3L8GA 1E8NA 1NDHA 1SCUA 3PJGA 4TS9A 1C81A 3K9FC 1Z7EA 1RQLA 1P72A 2IU6A 3B38A 1B74A 2BEWA 3GBSA 5CDHA 4C3OB 2VS1A 3JCZA 3N05A 2A3RA 2X6RA 3IUQA 2OBMA 1Y1TA 3FSGA 4MR8A 3TAXA 3IBTA 3GEHA 1F0NA 2FP3A 3SD7A 4Q4AB 4WN9B 3FETA 4C0WA 5C1BA 2PKQO 5IT0A 3SN6A 3W5VA 3NMUF 1THTA 2B0JA 3P9CA 4F7WA 2J9RA 4MJ7A 4PFKA 4LZWA 5E6UA 1Y3AA 2ATXA 4HNTA 3I9KA 1QGZA 3BE6A 4FINA 3IVMA 2A8YA 2D4HA 2N3ZA 3KR1A 1KIMA 4GS5A 4N0EA 3QYAA 3S81A 2H1HA 4IZHA 1VIYA 4X6XA 3CW9A 1VGQA 2C9CA 4MUIA 3EGXA 4LK2A 1TFUA 4CKCB 2YWHA 3QYPA 4FPXA 1OPRA 1ZOIA 4WZAA 3U7QB 3VR6H 3O3MB 2FZKA 2QW0X 1O2DA 4QDTA 4L8GA 4C78A 2X76A 3WNVA 3RTGA 1LZLA 3NPAA 3PNOA 2XA1A 4DUPA 4ZDIA 3ZD8A 1IBCA 2ONCA 3D5TA 1Q1AA 3O3CA 3MK31 3CVYA 4LF8B 4ZAXA 3RABA 1W0CA 2Q0QA 1V9CA 3DBLB 5E4YA 2YFKA 3ZV6A 3FB1A 1NVAA 3ZZ1A 1M3SA 2NSHA 1J42A 2VZ8A 3MD0A 4XWTA 5JI3E 1UM8A 5JZMA 4D82A 3AUYA 2B4RO 1QCYA 2CLMB 1LSSA 2P9TA 4WVFA 3ZDAA 3JU3A 3GRVA 1TJ4A 1I80A 4OJMX 3AR6A 1NVFA 1QFYA 2Z4TA 4QTZA 1F4PA 4CR6A 1O0SA 4CEIA 1NF3A 1MO6A 3WGNA 3FFTA 2Z09A 3KT8A 1CQIA 2Y93A 4GI2A 1D2AA 3V00A 3UHOA 3GRPA 4AKEA 4F9EA 2G9VA 4XCVA 5AI9A 2DR0A 3HRKA 3WVNA 2UZ4A 2QT1A 4A23A 5DM1A 3RUCA 4K8OA 1PJQA 4DMHA 6LDHA 2ZB8A 4IWNA 4EQ6B 1WUIS 2X5NA 2DLDA 2RHBA 1KDOA 3X1ZA 3HJGA 3I5YA 4H15A 5JQGA 1LWOA 3AKDA 4AWBA 4JOBA 2E48A 4JKOA 5BT9A 1DQZA 5JS7A 3KLOA 1HTWA 3TIIA 2VRCA 3OT4A 1E6EA 1QFJA 3C39A 2DFPA 4MMZB 5FNVF 4IQ0A 3ANLA 3PU6A 2QXUA 4QARA 2XF2A 4N0MA 1UJ2A 3DHNA 3CPHA 1J2UA 4UUOA 3UOAB 3DBLA 3NEJA 1E1RD 5HEKA 4FGLA 2IZ0A 4L51A 3KWJA 5CM9C 1RRGA 1I5OA 1RBYA 2W42A 2OM6A 3GJ6A 2GK6A 4DUGA 3NALA 1NDQA 4RE5A 3VNQA 4F6CA 1VFPA 1GG9A 3GV0A 1EHCA 3V7NA 1OXUA 2QPTA 1KEVA 3VOAA 2WJ3A 2DFDA 3ONDA 3G2LA 3UG6A 1EFVB 4HNGA 3RU3A 2ZKLA 1PT7A 2VOEA 4GW3A 2IOQA 1E4OA 2Y2UA 1Q0RA 2JI8A 3CCBA 3GF4A 3FDZB 3EH1A 1EE2A 4EECA 2H57A 5DSXA 4CQLB 5LQUA 1DQNA 1T9AA 1PLJA 2RHMA 3AVQA 4RIFA 3SZUA 4WN3A 4DLKA 3TRKA 2XKJE 3RSSA 2OTCA 2P4UA 2VBGA 3A3NA 3V1LA 3A1EA 1J8QA 2O3SA 3A05A 2V4UA 3GD7A 4EP1A 2BEWB 4PY2A 3QA9A 1DPFA 1UAGA 4RE6A 5AUQA 1SKAA 2ZQYA 2FPRA 3EN0A 4PSAA 4UBJA 3FGOA 3FPEA 4OP1A 2P30A 4OAQA 1MQ9A 4QJ5A 5E8JA 5KQRA 2PE5A 4AM8A 1Y6JA 2I54A 4G01B 3RGGA 1HEUA 3ET5A 2G0TA 4DT1A 4RYDA 4LE0A 1WL8A 1ZA2A 3IE0A 4UCFA 3SDBA 2HMSA 5J43A 5DHQA 1JKXA 3JZAA 3TIXB 2A5GA 2QTRA 3IXMA 4IX1A 4YPVA 2AN5A 2HFKA 1UBEA 2B6HA 3ZJTA 4Y2SA 1CLEA 3COVA 1Q0TA 4YRZA 3ND8A 3WZLA 3A36A 2UUCB 1VPLA 5J2TF 1O96A 3GN1A 3ADCA 1F8XA 1XBTA 3AV0B 3T54A 4I66A 1JHAA 2C29D 3U48A 3AVPA 1RWVA 2Q0XA 3HDJA 2QN9A 4F9GA 3CW2A 3GHHA 1X8XA 1SUSA 4K81B 4MQFB 3PXBA 4WHMA 1RC8A 1BTOA 5DT2A 3PC6A 5IARA 3SIRA 1X94A 5A3RA 1H6BA 3LY9A 1FFXB 1W2HA 4HKTA 1U0RA 1J90A 1E1DA 1BWSA 4C3ZA 1WOMA 1OCEA 3FMOB 3C87A 5AJVB 5KC8A 4G0UA 1ZC3A 4OXYA 2WUGA 5IT5A 1L7BA 2BI8A 3HR8A 5BSUA 1J5EB 3NBFA 3PI7A 1B8OA 3IJ5A 3SS9X 1MJGM 5CR9A 3T5AA 2P78A 1PVOA 3VKFA 2BP7B 4Z4IA 3AF4A 4L02A 1ANKA 4WK6A 2AC7A 2XA2A 5K5EA 7YASA 2GPYA 3CNQS 2JFWA 4JROA 1GQSA 4CVNA 1KRWA 2C57A 3U60B 2Y0EA 3VTKA 3KYIB 1R7RA 5ECGC 1MENA 1DRWA 4LFBB 2OHVA 4GQIA 3ZVKA 4UNSA 4AN1A 1QCZA 3IL2A 3EEBA 4FI3F 4HQ6A 1O0BA 4N76A 4J0FA 2VJLA 5FULA 4GSYA 4HEA1 4QBTA 1CZUA 5H3HA 1V2GA 1VPDA 4G1EB 4BX9A 2RH5A 1O95D 1DBRA 3TJMA 3RJMA 4B4UA 5KNLA 2VDRB 4JL5A 1RFGE 5GZ6A 3GEGA 2RHCA 4YP5A 4LXIA 5CNMA 5DT9A 2BZGA 3IDSA 4ZT5A 1D4ZA 4YONB 4IIJA 4EKEA 3SGLA 2R25B 1PJAA 3PFHA 4IGEA 5E9JA 1N6PA 3SBEA 4D6XA 5JEDA 3L6CA 2Q49A 2WD7B 2XW6A 3G02A 4L08A 4M87A 1ETHA 2EKDA 1YDEA 1CQPA 2Q1WA 3H2KA 3OOHA 1S8FA 2HI0A 3OIUA 4ZXPA 3WQQA 2Q3FA 1RKBA 1Z75A 3TPFA 1W2WB 2WSSD 4X90A 3EZLA 3C3WA 4FYYA 4UBIA 4MQUA 3D7NA 4QOSA 4B85A 4J1TA 3HUFA 4QIHA 2GPWA 4CM8A 5JNVA 2BZ1A 4GE0A 2Q7OE 2H65A 5AR1A 3GGPA 1AGXA 4UVEA 1B0ZA 4IYRA 2YJTD 4LSWA 4DANA 3L8HA 3EQ6A 2XUFA 4MKRA 1MQ8B 4FKMA 4K87A 4O4LA 5DHRA 5L9AA 4ESOA 3OO1A 2R66A 3X1JA 1U2RA 2P3QA 2AFHB 3NHYA 4X71A 4MYHA 4B3FX 1M8JA 4EBFA 4JI7B 3E8MA 1J2RA 4XW2A 3NUGA 3WLKX 3IKTA 3PHLA 4HWTA 1O7JA 1JQDA 1TZMA 1YI1A 4FGSA 4MSUA 2PJRA 4CM4A 2NSYA 4LPKA 4I9UA