4XYMB

Ca. korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 in complex with coenzyme a, ca-ampcp and hgcl+
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
229
structure length
229
Chain Sequence
SSRDLLLKAKENGRKSLLEHEAKYFISSYGIPVTNIRLAKSEEEAVNFSREIGFPVVLKIVSPQVVHKSDVGGVKVNLRSEEEVRKAYREIIENVKRNVPNAEIEGILVQEFAPPGVELIIGLLRDPQFGPTVMFGLGGVFVELFRDVSFRVAPLSEQDAESMIKEVKAYKLLTGFRGMEPVDIEAIKDALIRAGRIGVENEEIAEMDLNPVIAYPKGIKVVDARIILR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha subunit of Acyl-CoA synthetase (NDP forming)
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Korarchaeum cryptofilum (strain opf8)
molecule tags Ligase
total genus 73
structure length 229
sequence length 229
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13549 ATP-grasp_5 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4xymB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4xymB02
1VBHA 2WYOA 3G8DA 1W96A 2YRXA 5LYJF 5JH7F 3VPDA 1SCUB 1GSHA 3HO8A 4XYLB 3V4ZA 1JDEA 2GLTA 3RFCA 1CQJB 1GGOA 1KJ9A 4YJ3F 2V59A 1AUVA 3U9TA 4FFPA 1KJIA 3JZFA 3VPBA 1EHIA 2XCLA 2I87A 2YYAA 3RUPA 2FPPB 2YRWA 1EYZA 5LP6F 4O86A 4TUYF 2ZDHA 5FNVF 3TQTA 5LA6F 5GONF 5C8YF 1UC9A 3G8CA 4YBZB 3R9RA 1C3OA 1GLVA 5IYZF 2QF7A 3ETHA 1EUCB 4E4TA 4O7RA 5J2UF 1CS0A 5HBRB 1I7LA 3JZIA 4I4TF 1BNCA 2R82A 4O2BF 2FPGB 3JRXA 1GSAA 3ORQA 4O84A 2OLSA 2DIKA 3U9SA 3KALA 3U55A 2CQYA 2PN1A 4FFNA 2V58A 1BXRA 3OUZA 3TIGA 1M6VA 2ZDGA 1Z2PX 4O7ZA 4FE2A 1B6SA 3R5FA 2W6QA 1W93A 4MAMA 4YJ2F 1A9XA 5LXTF 4O81A 2R85A 3Q1KA 4O4LF 3R5HA 4EGJA 4C5AA 2I80A 5CA1F 1DV1A 2CNQA 4HNTA 2NUAB 4MV3A 2R84A 5K2MA 4MV6A 1PK8A 2VQDA 4MV8A 2YS6A 3K5HA 2YZNA 3TINA 5JQWA 3OUUA 4M9UA 2R7NA 4XYMB 2VR1A 4C5CA 3I12A 2VPQA 1AUXA 3MWEA 1KBLA 1GSOA 3UFXB 1KUTA 3MJFA 2PBZA 3TW6A 1Z2OX 2R87A 2W6MA 4O83A 1E4EB 3K3PA 2R7KA 4I55F 1OBDA 3KREA 4ZOLF 4FGRA 5H80A 4ZHQF 1CQIB 2YL2A 3RV3A 1EZ1A 4O7YA 2C00A 4NYEA 2YWVA 4YAKB 4O4JF 1UC8A 1CE8A 3AX6A 2W6OA 2W6ZA 3E5NA 4IHJF 4O7TA 4WBNF 5LOVF 4IWYA 2CNVA 5CA0F 3ORRA 5C1PA 2NU8B 4IWXA 3QFFA 3NUAA 2NU6B 1DV2A 4O7SA 5CAEB 3WO1A 2YZGA 4XX0B 2CNUA 4O4HF 4FFRA 2IP4A 4O4IF 2R7LA 3K5IA 1E4EA 2YZMA 3N8DA 2ZDQA 1DIKA 3WO0A 5CB4F 1VKZA 3HBLA 3SE7A 4MV1A 2FB9A 1IOVA 5JVLA 4DLKA 5KKNB 4YB8B 1ULZA 4MA5A 2NU7B 4O82A 4TV8F 4FU0A 5BPHA 2YZLA 5J2TF 4FFLA 5C1OA 1JKJB 2FP4B 3AW8A 5JQGF 1KJJA 2GPWA 4HQ6A 4MV4A 4O7VA 5EZYF 4TV9F 3VPCA 2W70A 1OBGA 1M0TA 2PVPA 1EUDB 5BMVF 2HJWA 3DF7A 2X0SA 3JRWA 2YW2A 3MWDA 3KAJA 3HB9A 1M0WA 4FFMA 2W71A 4FFOA 4MA0A 2P0AA 4O7WA 4DIMA 3GLKA 2V5AA 2W6NA 1T36A 1JLLB 2HGSA 1KEEA 4XZ3B 4QSHA 2GQSA 4L1KA 3R5XA 1KJQA 4RZQA 2GPSA 4ZI7F 5D8DA 2R86A 4I50F 3WNZA 3LP8A 4EG0A 2XD4A 4ME6A 4ZQIA 2CZGA 3ETJA 1WR2A 1IOWA 3Q2OA 4O7NA 4YAJB 2R6FA 1KJ8A 2Z04A 3BG5A 2DLNA 4C5BA 5HV6A 1JDBB 3V4SA 2W6PA 5KX5F 2QK4A 1Z2NX 1C30A 1A48A 2R7MA 4IZOA 2DZDA 1VBGA 3R23A 1I7NA 3TIIA 3KAKA 3RV4A 2YS7A 4MV9A 2I8CA 4HR7A 2SCUB 3GIDA 2GQRA 3VA7A 4O7LA 3VOTA 4WD3A 5I47A 3U54A 4MV7A 5BPFA 2DWCA 5DMXA 4EGQA 3LWBA 2NU9B 4Y8VB 3N6RA 1B6RA 4HNVA 4HNUA 2J9GA 4IIJF 1KC7A 3VMMA 1PX2A 2FPIB 2Z02A 5JVDF 4O2AF
chains in the Genus database with same CATH superfamily
1VBHA 2WYOA 1ZQ7A 4BBSG 3OHBA 2JA5G 5L1JA 1G2WA 3G8DA 1WSCA 1W96A 4MTEA 2YRXA 4ETSA 3RAQA 4DRFA 1IBLH 5LYJF 5KFHA 4B3TH 1GYFA 2YU9A 4DL4A 5JH7F 2JA6G 2B63A 3VPDA 4YY3H 3QZ8A 1SFOA 1SCUB 2FLPA 1GSHA 3HO8A 2FK1A 2CW8A 4J9LA 1JIHA 2WAQA 2FLNA 4XYLB 3V4ZA 4JI1H 1FJGH 4Q43A 1JDEA 1S0OA 3M9MB 2OWOA 4LF5H 4EEYA 3HOVG 4DV2H 2GLTA 3RFCA 1CQJB 1GGOA 1KJ9A 1ET0A 4O3RA 4YJ3F 3N41B 4B3MH 2R93G 5BWXA 3EYYA 3HKZA 2V59A 1AUVA 2UXCH 4UCSA 3U9TA 4FFPA 4F4WA 1Y1WG 1KJIA 3BABA 4M0JA 3JZFA 1S97A 2V9WA 3HOXG 3OSNA 1N33H 5FD5A 4LF6H 3VPBA 1HR0H 1EHIA 2W7PA 4M7EA 3GIQA 3H0GG 4O3PA 2XCLA 5KFYA 2I87A 4DR5H 4O3SA 4JV2A 1A0GA 2YYAA 1RJPA 1V51A 3HKZE 3AYHB 5I5YA 4I7HA 5DISC 3N43B 5IYBG 4AYBE 4O3NA 3RUPA 2FPPB 3J7AK 4EYHB 3RTXA 1RK6A 3KHGA 2YRWA 4LF7H 1EYZA 4A3DG 5LP6F 4O86A 4F4ZA 4RNOA 4TUYF 2J6TA 2OH2A 2ZDHA 5FNVF 3TQTA 5FD6A 3T9FA 3RB0A 1N56A 5LA6F 2XC9A 4CHIA 1TA8A 5GONF 1S03G 5C8YF 2W8LA 3RBEA 1UC9A 2BQRA 3G8CA 4DV7H 4YBZB 3R9RA 2EJ0A 3MR3A 1P8LA 2RDIA 3PW7A 3L2PA 1C3OA 1GLVA 4J9NA 1I2LA 5IYZF 4GLXA 2QF7A 4UCVA 3ETHA 2R93A 1EUCB 1FVIA 2HDKA 5D1OB 3T9EA 5DQHA 1XK5A 4E4TA 4O7RA 3UQ8A 5J2UF 5BWVA 1Y14B 2AGQA 2HGXA 1X9NA 1CS0A 1DAAA 4A3EG 5HBRB 2HVRA 5KFWA 1N32H 1I7LA 3JZIA 4I4TF 2UVUA 1BNCA 5BWWA 3OTOH 2R82A 4O2BF 3Q8PB 3FKIA 5KG3A 1WCMA 3T99A 3G6VA 4BY7G 2FLLA 2FPGB 3JRXA 4CKCA 4B3RH 3GTMA 4OX9H 1GSAA 3PO3G 4LFAH 3ORQA 5KFVA 4O84A 2OLSA 5C44G 3TY8A 1KTAA 4A3GG 4IRCA 4A3KG 2DIKA 4ECYA 3U9SA 1HNXH 2IMWP 1RK5A 3KALA 2JEJA 5DAAA 3HXLA 2VUGA 2JA6A 3U55A 2CQYA 5KFLA 4DAAA 4ECRA 2PN1A 2VA2A 3FDSA 4FFNA 5C3EG 2V58A 3IN5A 1M7JA 1BXRA 3OUZA 3TIGA 4MTDA 4EBCA 3SGIA 5DG7A 1M6VA 3KTMA 4RB3C 2ZDGA 4QWBA 4RUAA 3WWJA 2HVQA 3JSNA 5I5TA 5KFRA 1S0MA 1Z2PX 5DLFA 5IYDG 1ZAUA 4O7ZA 1RJQA 2B63G 4FE2A 1B6SA 3GTLA 4CKEA 3BQ1A 5D1PA 3R5FA 4J9PA 1J5EH 2E2HA 4GC6A 4UCTA 3K3VA 2W6QA 2DPJA 4JV1A 1W93A 4LH7A 4MAMA 4QWCA 3OHAA 3GILA 2UVVA 3T9CA 4U7CA 4ED3A 4YJ2F 1K83A 3DAAA 4ECZA 3LULA 4J9SA 3PVXA 5KFSA 1V4YA 4DV6H 4A3MG 1RYRA 2YCHA 3L4JA 1CKMA 1A9XA 5LXTF 4O81A 5BYAA 2WB1E 2DAAA 2R85A 4QIWA 2HVSA 5KG1A 4RB2C 4EEQA 3GV8B 5KG0A 3Q1KA 3MFHA 4O4LF 3R5HA 2ABJA 2WDTA 4EGJA 4C5AA 2I80A 3WWHA 1I2KA 5D1OA 2RGRA 4DL2A 5KFAA 4YHHH 5CA1F 2HHFB 2VUMG 5FLMG 5L1LA 3T5JA 1DV1A 3HOWG 5EWEA 2CNQA 4HNTA 5KFFA 2NUAB 4MV3A 2RGVA 4Q45A 5I60A 5I5SA 3CVZA 4ECVA 2M05A 1R9TA 1I94H 2R84A 4TQSA 3JSLA 4QW9A 2HIXA 1EKPA 5K2MA 1O75A 5KFJA 3BQ0A 4MV6A 1PK8A 2VQDA 3Q8SB 4MV8A 4A3JG 1I1LA 2FMAA 4JI4H 2YS6A 3K5HA 2C2DA 2YZNA 4IR1A 3RGZA 5FLXW 5BWRA 3TINA 2CW7A 2VQFH 5JQWA 3OUUA 5KFQA 4M9UA 2R7NA 3TY5A 3NGDA 3TQ1A 2R8KA 1XDNA 5KFKA 1XMQH 4XYMB 1TWGA 1MZBA 4DR7H 4QWAA 2VR1A 2VPSA 2PMZA 1I3QA 5KFIA 2Q2UA 3TEKA 4C5CA 4JI6H 5DGAA 4LF4H 2XGQA 1N48A 3I12A 1EKVA 2VPQA 4FBTA 4X64H 4DL7A 3T9AA 1AUXA 1Y1VG 3MWEA 3N44B 4QW8A 2CFMA 1KBLA 3GV7B 1GSOA 3BJYA 4DL3A 2ASJA 3UFXB 5I5XA 3WWIA 4DUZH 1KUTA 3MJFA 3PW4A 2PMZE 2W9CA 3BA8A 2COGA 2PBZA 3TW6A 4AYBA 1TWHA 2VQEH 2NVXA 3PR4A 1Z2OX 4TVIA 2R87A 2W6MA 4O83A 1E4EB 2HG8A 3K3PA 2R7KA 4I55F 2C2RA 4RAYA 2R8JA 1OBDA 3KREA 4DR6H 1A3GA 2FK3A 3PN1A 3FKIG 4R7RA 4BBRG 1WCMG 3EPGA 2BQ3A 1GO3E 5I5VA 2Y0SE 3H4BA 4ZOLF 4FGRA 2C35B 5DLGA 2ASDA 5H80A 4ZHQF 1OWTA 4UFZA 1CQIB 4NXMH 1S68A 2X5RA 4A3BG 2WE6A 4JYAH 4PBCA 5A2QW 3GDEA 2ZGIA 4JV0A 1S0NA 4Q0YA 2YL2A 4RCNA 4JUZA 5IP7G 5LL6b 2W9AA 4B3SH 4ED0A 4EQ5A 2KSWA 3RV3A 2C28A 5L9XA 1EZ1A 4O7YA 5EWGA 2C00A 4NYEA 2YWVA 4YAKB 4DV0H 4EBEA 3GTJA 4O4JF 3N6XA 4ECSA 4A3CG 1UC8A 1WH2A 2HHFA 1CE8A 1IYEA 5KG7A 1T3NA 3AX6A 2W6OA 2W6ZA 1XMOH 1RYSA 3E5NA 4IHJF 4O7TA 4EBDA 2UVWA 3JZ6A 2WTFA 4LFBH 4WBNF 1Y1VA 5LOVF 4IWYA 2CNVA 5EWFA 4RU9A 5KFXA 5CE8A 3RBDA 1I1MA 3JAMW 1I50A 4ED1A 3GTKA 5CA0F 3ORRA 5C1PA 4IWXA 2NU8B 4RAZA 3QFFA 2DABA 3T9DA 3NUAA 3GIIA 4NXNH 4BXXG 2EJ3A 4LSXA 5I5UA 1K1SA 3GIMA 2NU6B 3RGXA 4PDBA 1SYXB 3S24A 1DV2A 4O7SA 1TAEA 5CAEB 5KG4A 4A3FG 3WO1A 2UUAH 4J9MA 2YZGA 2EIYA 4EFBA 4Q44A 4XX0B 5LMUH 2CNUA 4O4HF 4PZ6A 3H20A 4YR3A 3N40P 3V6KA 1I6UA 2UXDH 2JA7A 4RNNA 3BACA 4X65H 4FFRA 5KT6A 4CMFA 2IP4A 2FKLA 4O4IF 2R7LA 5KFUA 1JX4A 3PR5B 3K5IA 2R8GA 3GTPA 1E4EA 2YZMA 3N8DA 3TW7A 3C0FB 4JI5H 5FJ8G 4LMYA 4TM5A 2ZDQA 1DIKA 4DUYH 3WO0A 5CB4F 5DG8A 1VKZA 2A1HA 3GIKA 3HBLA 3T5HA 3HT5A 5EOYA 5F9LA 1S9FA 2FK2A 3SE7A 4K6NA 3T5LA 4MV1A 4ED2A 4A3IG 1DGSA 4E6NA 2W9CB 2FE3A 2IBKA 3PO2G 2FB9A 1RJRA 3L4KA 2J6UA 3PW0A 3RR5A 3UYYA 4NZMA 4DV5H 2W7OA 1KT8A 1B04A 3HOZG 4F4YA 2WB1A 4GKJH 1HNWH 2IA6A 4ECXA 3M4IA 5KFTA 4LF8H 5KG2A 1IOVA 5JVLA 2QYZA 3HOUG 2VUMA 3MR2A 3W1GA 4DLKA 3G6YA 4UCUA 5KKNB 4YB8B 4DL5A 5DGBA 5BR8H 1ULZA 2BQUA 2UVRA 4MA5A 4NLGA 4C2MA 2ATLA 2NU7B 3GB8B 4O82A 5FPRA 1VAJA 4TV8F 5L1IA 1SEIA 4JI3H 4YQWA 4QWEA 3QQMA 1P16A 4FU0A 5BPHA 4Q4CA 2YZLA 4RB1A 3T1YH 5J2TF 2JA8G 3NC0B 4FFLA 4FM9A 5FPOA 5C1OA 2CKZB 4FS1A 3T5KA 1IBKH 2UXBH 2W9BB 1CKNB 1T94A 1JKJB 3W5OA 4RUCA 3FMAA 1XNQH 3T7AA 3DTFA 5KFPA 2F4VH 5KFBA 4GKKH 4G3IA 3KXYT 2FP4B 2ALZA 3AW8A 5KT3A 4UUGA 3CSWA 4GLWA 5JQGF 5F9NA 3QZ7A 3KYHC 5E25A 3KHLA 4PZ8A 3MR5A 2QB5A 2J6SA 4IR9A 4LH6A 4FS2A 2R8IA 3KHRA 1VS0A 3UZBA 3MR6A 1KJJA 2GPWA 3J80W 2C2EA 2VOBA 4YR2A 5BWUA 5IP9G 4HQ6A 3MWMA 5T14A 1FKAH 3OSPA 4EFEA 4A2BA 4MV4A 3GTQA 2W57A 4O7VA 4APMA 5DQIA 4IRDA 5EZYF 5KFMA 2FJZA 4TV9F 3VNNA 3VPCA 3U0GA 1K1QA 2ZJTA 2W70A 1OBGA 2Y0SA 5KFOA 2E2IA 1M0TA 2PVPA 3LQSA 5KFEA 1EUDB 5BMVF 3H40A 2HJWA 4FBUA 3EPIA 4JV5H 3DF7A 1TWFA 5JUMA 4J9KA 1N34H 3I4MG 4F50A 2X0SA 3JRWA 2O03A 4J0MA 1CKOA 3RF2A 5KFNA 4J9OA 3RB6A 4NZOA 2ASLA 3H4DA 4DV3H 4WHXA 3H3VH 2YW2A 3I4NG 5KT4A 3MWDA 3KAJA 3HB9A 2COIA 4A3LG 1M0WA 4FFMA 2R92A 4CC6A 4DQNA 2W71A 1IYDA 2DPIA 1A0IA 4UCOA 4FFOA 4MA0A 4DR1H 4ECQA 2BR0A 5IT9W 2P0AA 3N42B 5KG6A 1WRVA 4O7WA 1TWCA 2JA7G 4DIMA 3GLKA 4QJFA 4R8UA 3DTGA 2V5AA 3Q8QB 2W6NA 4ED6A 2WAQE 1T36A 1JLLB 2NVYA 3PZPA 4ED8A 2HGSA 2HHHH 4LF9H 4X66H 1KEEA 4XZ3B 3BAAA 4CKBA 4QSHA 5KT2A 3Q8RB 2R7ZA 2W9BA 1CKNA 2Y4RA 2GQSA 3IG0A 3PW2A 4L1KA 2AGPA 3R5XA 1KJQA 3PW5A 4RZQA 3SI8A 4DV1H 1BJTA 4ECWA 2UUCH 5IYCG 2GPSA 5KFGA 4ZI7F 4A93G 5D8DA 5DQGA 4BWSC 2XCPA 2R86A 3NBYB 4I50F 4F4XA 4DL6A 3CEBA 2JA5A 4AQYH 3WNZA 3LP8A 3T9BA 2XD4A 4ME6A 4EG0A 2Q2TA 2E5LH 2HIVA 4PZ7A 3UZOA 4ZQIA 3J81W 3W1BA 3GIJA 4LSAA 2CZGA 5LMNH 3ETJA 2W8KA 3GQCA 1WR2A 1IOWA 3Q2OA 4Q8FA 4O7NA 1EKFA 3LMLA 4YAJB 2R6FA 5KT5A 2RDJA 5C4XG 1KJ8A 3BA9A 4JI7H 2Z04A 4KHPH 3BG5A 3NBZB 1TWAA 4O3OA 5KT7A 2DLNA 1HNZH 4C5BA 3QWUA 3T1HH 4LFCH 1ZETA 5BYBA 4PWQA 5DG9A 4RB0A 5HV6A 4IAJA 1JDBB 5IWAH 2XGPA 3V4SA 3GTOA 2W6PA 5KX5F 1Y1WA 1I1KA 5KFDA 3G6XA 4EYIB 4GC7A 3MFIA 2QK4A 2JEGA 4CE5A 1AN7A 1Z2NX 5CR5A 3GTGA 1C30A 1A48A 3CQZA 3H0GA 4J9RA 4HYKA 5HNEA 2AGOA 2R7MA 1JXLA 4O3QA 4UCRA 4CC5A 1B33N 3F8NA 1E4FT 1BGWA 4ECTA 4IRKA 3RIZA 1IBMH 4IZOA 2DZDA 1VBGA 3PFFA 4DR3H 1XNRH 2ODTX 4JXUA 4CMDA 3BQ2A 3R23A 1I7NA 3TIIA 2JEIA 5FR9A 3T54A 3KAKA 3RV4A 2YS7A 4YR0A 4DR4H 4MV9A 5C5JA 2I8CA 4RNMA 2COJA 4DV4H 4HN2A 4HR7A 5K3WA 2SCUB 5KG5A 3GIDA 4QWDA 2JEFA 2GQRA 2AQ4A 2Q7DA 1ZHSA 2RF4A 3GJXB 4R8UB 3VA7A 3RAXA 5EDWA 4ED7A 4O7LA 5DGHA 4BY1G 4RZRA 2UUBH 3VOTA 4WD3A 4K0KH 5I47A 1V9PA 1S10A 3U54A 5DGIA 3M9NB 4DR2H 4YP3A 4MV7A 3KHHA 5BPFA 2DWCA 2EJ2A 3SNOA 2HGWA 2AU0A 5CM0A 5DMXA 4EGQA 2R92G 3LWBA 3V6HA 2NU9B 2V4QA 3GV5B 5KFCA 5KS8A 1ZHQA 2UU9H 4Y8VB 3N6RA 5I5WA 3RJ0A 4TQRA 4ECUA 1B6RA 1UNNC 4HNVA 4J9QA 4Q8EA 2MCTA 2R8HA 4HNUA 2XCAA 4NZNA 2ZM6H 4X62H 4JI8H 2J9GA 4IIJF 4Q4DA 4U6PA 5L1KA 1KC7A 1E4GT 3RB4A 3VMMA 3GIPA 1PX2A 1L2ZA 2R7ZG 2FPIB 3TY9A 2V4RA 3V6JA 5KFZA 2Z02A 2XIGA 5JVDF 4A2AA 4JI0H 4O2AF 5BWTA 4JI2H 1N36H 4QIWE 2VA3A 3RB3A 3M9OB 2C22A 3HOYG
chains in the Genus database with same CATH topology
1VBHA 2WYOA 3G8DA 1W96A 2YRXA 5LYJF 5JH7F 3VPDA 1SCUB 1GSHA 3HO8A 4XYLB 3V4ZA 1JDEA 2GLTA 3RFCA 1CQJB 1GGOA 1KJ9A 4YJ3F 2V59A 1AUVA 3U9TA 4FFPA 1KJIA 3JZFA 3VPBA 1EHIA 2XCLA 2I87A 2YYAA 3RUPA 2FPPB 2YRWA 1EYZA 5LP6F 4O86A 4TUYF 2ZDHA 5FNVF 3TQTA 5LA6F 5GONF 5C8YF 1UC9A 3G8CA 4YBZB 3R9RA 1C3OA 1GLVA 5IYZF 2QF7A 3ETHA 1EUCB 4E4TA 4O7RA 5J2UF 1CS0A 5HBRB 1I7LA 3JZIA 4I4TF 1BNCA 2R82A 4O2BF 2FPGB 3JRXA 1GSAA 3ORQA 4O84A 2OLSA 2DIKA 3U9SA 3KALA 3U55A 2CQYA 2PN1A 4FFNA 2V58A 1BXRA 3OUZA 3TIGA 1M6VA 2ZDGA 1Z2PX 4O7ZA 4FE2A 1B6SA 3R5FA 2W6QA 1W93A 4MAMA 4YJ2F 1A9XA 5LXTF 4O81A 2R85A 3Q1KA 4O4LF 3R5HA 4EGJA 4C5AA 2I80A 5CA1F 1DV1A 2CNQA 4HNTA 2NUAB 4MV3A 2R84A 5K2MA 4MV6A 1PK8A 2VQDA 4MV8A 2YS6A 3K5HA 2YZNA 3TINA 5JQWA 3OUUA 4M9UA 2R7NA 4XYMB 2VR1A 4C5CA 3I12A 2VPQA 1AUXA 3MWEA 1KBLA 1GSOA 3UFXB 1KUTA 3MJFA 2PBZA 3TW6A 1Z2OX 2R87A 2W6MA 4O83A 1E4EB 3K3PA 2R7KA 4I55F 1OBDA 3KREA 4ZOLF 4FGRA 5H80A 4ZHQF 1CQIB 2YL2A 3RV3A 1EZ1A 4O7YA 2C00A 4NYEA 2YWVA 4YAKB 4O4JF 1UC8A 1CE8A 3AX6A 2W6OA 2W6ZA 3E5NA 4IHJF 4O7TA 4WBNF 5LOVF 4IWYA 2CNVA 5CA0F 3ORRA 5C1PA 2NU8B 4IWXA 3QFFA 3NUAA 2NU6B 1DV2A 4O7SA 5CAEB 3WO1A 2YZGA 4XX0B 2CNUA 4O4HF 4FFRA 2IP4A 4O4IF 2R7LA 3K5IA 1E4EA 2YZMA 3N8DA 2ZDQA 1DIKA 3WO0A 5CB4F 1VKZA 3HBLA 3SE7A 4MV1A 2FB9A 1IOVA 5JVLA 4DLKA 5KKNB 4YB8B 1ULZA 4MA5A 2NU7B 4O82A 4TV8F 4FU0A 5BPHA 2YZLA 5J2TF 4FFLA 5C1OA 1JKJB 2FP4B 3AW8A 5JQGF 1KJJA 2GPWA 4HQ6A 4MV4A 4O7VA 5EZYF 4TV9F 3VPCA 2W70A 1OBGA 1M0TA 2PVPA 1EUDB 5BMVF 2HJWA 3DF7A 2X0SA 3JRWA 2YW2A 3MWDA 3KAJA 3HB9A 1M0WA 4FFMA 2W71A 4FFOA 4MA0A 2P0AA 4O7WA 4DIMA 3GLKA 2V5AA 2W6NA 1T36A 1JLLB 2HGSA 1KEEA 4XZ3B 4QSHA 2GQSA 4L1KA 3R5XA 1KJQA 4RZQA 2GPSA 4ZI7F 5D8DA 2R86A 4I50F 3WNZA 3LP8A 4EG0A 2XD4A 4ME6A 4ZQIA 2CZGA 3ETJA 1WR2A 1IOWA 3Q2OA 4O7NA 4YAJB 2R6FA 1KJ8A 2Z04A 3BG5A 2DLNA 4C5BA 5HV6A 1JDBB 3V4SA 2W6PA 5KX5F 2QK4A 1Z2NX 1C30A 1A48A 2R7MA 4IZOA 2DZDA 1VBGA 3R23A 1I7NA 3TIIA 3KAKA 3RV4A 2YS7A 4MV9A 2I8CA 4HR7A 2SCUB 3GIDA 2GQRA 3VA7A 4O7LA 3VOTA 4WD3A 5I47A 3U54A 4MV7A 5BPFA 2DWCA 5DMXA 4EGQA 3LWBA 2NU9B 4Y8VB 3N6RA 1B6RA 4HNVA 4HNUA 2J9GA 4IIJF 1KC7A 3VMMA 1PX2A 2FPIB 2Z02A 5JVDF 4O2AF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VBH A;  2WYO A;  3G8D A;  1W96 A;  2YRX A;  5LYJ F;  5JH7 F;  3VPD A;  1SCU B;  1GSH A;  3HO8 A;  4XYL B;  3V4Z A;  1JDE A;  2GLT A;  3RFC A;  1CQJ B;  1GGO A;  1KJ9 A;  4YJ3 F;  2V59 A;  1AUV A;  3U9T A;  4FFP A;  1KJI A;  3JZF A;  3VPB A;  1EHI A;  2XCL A;  2I87 A;  2YYA A;  3RUP A;  2FPP B;  2YRW A;  1EYZ A;  5LP6 F;  4O86 A;  4TUY F;  2ZDH A;  5FNV F;  3TQT A;  5LA6 F;  5GON F;  5C8Y F;  1UC9 A;  3G8C A;  4YBZ B;  3R9R A;  1C3O A;  1GLV A;  5IYZ F;  2QF7 A;  3ETH A;  1EUC B;  4E4T A;  4O7R A;  5J2U F;  1CS0 A;  5HBR B;  1I7L A;  3JZI A;  4I4T F;  1BNC A;  2R82 A;  4O2B F;  2FPG B;  3JRX A;  1GSA A;  3ORQ A;  4O84 A;  2OLS A;  2DIK A;  3U9S A;  3KAL A;  3U55 A;  2CQY A;  2PN1 A;  4FFN A;  2V58 A;  1BXR A;  3OUZ A;  3TIG A;  1M6V A;  2ZDG A;  1Z2P X;  4O7Z A;  4FE2 A;  1B6S A;  3R5F A;  2W6Q A;  1W93 A;  4MAM A;  4YJ2 F;  1A9X A;  5LXT F;  4O81 A;  2R85 A;  3Q1K A;  4O4L F;  3R5H A;  4EGJ A;  4C5A A;  2I80 A;  5CA1 F;  1DV1 A;  2CNQ A;  4HNT A;  2NUA B;  4MV3 A;  2R84 A;  5K2M A;  4MV6 A;  1PK8 A;  2VQD A;  4MV8 A;  2YS6 A;  3K5H A;  2YZN A;  3TIN A;  5JQW A;  3OUU A;  4M9U A;  2R7N A;  4XYM B;  2VR1 A;  4C5C A;  3I12 A;  2VPQ A;  1AUX A;  3MWE A;  1KBL A;  1GSO A;  3UFX B;  1KUT A;  3MJF A;  2PBZ A;  3TW6 A;  1Z2O X;  2R87 A;  2W6M A;  4O83 A;  1E4E B;  3K3P A;  2R7K A;  4I55 F;  1OBD A;  3KRE A;  4ZOL F;  4FGR A;  5H80 A;  4ZHQ F;  1CQI B;  2YL2 A;  3RV3 A;  1EZ1 A;  4O7Y A;  2C00 A;  4NYE A;  2YWV A;  4YAK B;  4O4J F;  1UC8 A;  1CE8 A;  3AX6 A;  2W6O A;  2W6Z A;  3E5N A;  4IHJ F;  4O7T A;  4WBN F;  5LOV F;  4IWY A;  2CNV A;  5CA0 F;  3ORR A;  5C1P A;  2NU8 B;  4IWX A;  3QFF A;  3NUA A;  2NU6 B;  1DV2 A;  4O7S A;  5CAE B;  3WO1 A;  2YZG A;  4XX0 B;  2CNU A;  4O4H F;  4FFR A;  2IP4 A;  4O4I F;  2R7L A;  3K5I A;  1E4E A;  2YZM A;  3N8D A;  2ZDQ A;  1DIK A;  3WO0 A;  5CB4 F;  1VKZ A;  3HBL A;  3SE7 A;  4MV1 A;  2FB9 A;  1IOV A;  5JVL A;  4DLK A;  5KKN B;  4YB8 B;  1ULZ A;  4MA5 A;  2NU7 B;  4O82 A;  4TV8 F;  4FU0 A;  5BPH A;  2YZL A;  5J2T F;  4FFL A;  5C1O A;  1JKJ B;  2FP4 B;  3AW8 A;  5JQG F;  1KJJ A;  2GPW A;  4HQ6 A;  4MV4 A;  4O7V A;  5EZY F;  4TV9 F;  3VPC A;  2W70 A;  1OBG A;  1M0T A;  2PVP A;  1EUD B;  5BMV F;  2HJW A;  3DF7 A;  2X0S A;  3JRW A;  2YW2 A;  3MWD A;  3KAJ A;  3HB9 A;  1M0W A;  4FFM A;  2W71 A;  4FFO A;  4MA0 A;  2P0A A;  4O7W A;  4DIM A;  3GLK A;  2V5A A;  2W6N A;  1T36 A;  1JLL B;  2HGS A;  1KEE A;  4XZ3 B;  4QSH A;  2GQS A;  4L1K A;  3R5X A;  1KJQ A;  4RZQ A;  2GPS A;  4ZI7 F;  5D8D A;  2R86 A;  4I50 F;  3WNZ A;  3LP8 A;  4EG0 A;  2XD4 A;  4ME6 A;  4ZQI A;  2CZG A;  3ETJ A;  1WR2 A;  1IOW A;  3Q2O A;  4O7N A;  4YAJ B;  2R6F A;  1KJ8 A;  2Z04 A;  3BG5 A;  2DLN A;  4C5B A;  5HV6 A;  1JDB B;  3V4S A;  2W6P A;  5KX5 F;  2QK4 A;  1Z2N X;  1C30 A;  1A48 A;  2R7M A;  4IZO A;  2DZD A;  1VBG A;  3R23 A;  1I7N A;  3TII A;  3KAK A;  3RV4 A;  2YS7 A;  4MV9 A;  2I8C A;  4HR7 A;  2SCU B;  3GID A;  2GQR A;  3VA7 A;  4O7L A;  3VOT A;  4WD3 A;  5I47 A;  3U54 A;  4MV7 A;  5BPF A;  2DWC A;  5DMX A;  4EGQ A;  3LWB A;  2NU9 B;  4Y8V B;  3N6R A;  1B6R A;  4HNV A;  4HNU A;  2J9G A;  4IIJ F;  1KC7 A;  3VMM A;  1PX2 A;  2FPI B;  2Z02 A;  5JVD F;  4O2A F; 
#chains in the Genus database with same CATH topology
 1VBH A;  2WYO A;  1ZQ7 A;  4BBS G;  3OHB A;  2JA5 G;  5L1J A;  1G2W A;  3G8D A;  1WSC A;  1W96 A;  4MTE A;  2YRX A;  4ETS A;  3RAQ A;  4DRF A;  1IBL H;  5LYJ F;  5KFH A;  4B3T H;  1GYF A;  2YU9 A;  4DL4 A;  5JH7 F;  2JA6 G;  2B63 A;  3VPD A;  4YY3 H;  3QZ8 A;  1SFO A;  1SCU B;  2FLP A;  1GSH A;  3HO8 A;  2FK1 A;  2CW8 A;  4J9L A;  1JIH A;  2WAQ A;  2FLN A;  4XYL B;  3V4Z A;  4JI1 H;  1FJG H;  4Q43 A;  1JDE A;  1S0O A;  3M9M B;  2OWO A;  4LF5 H;  4EEY A;  3HOV G;  4DV2 H;  2GLT A;  3RFC A;  1CQJ B;  1GGO A;  1KJ9 A;  1ET0 A;  4O3R A;  4YJ3 F;  3N41 B;  4B3M H;  2R93 G;  5BWX A;  3EYY A;  3HKZ A;  2V59 A;  1AUV A;  2UXC H;  4UCS A;  3U9T A;  4FFP A;  4F4W A;  1Y1W G;  1KJI A;  3BAB A;  4M0J A;  3JZF A;  1S97 A;  2V9W A;  3HOX G;  3OSN A;  1N33 H;  5FD5 A;  4LF6 H;  3VPB A;  1HR0 H;  1EHI A;  2W7P A;  4M7E A;  3GIQ A;  3H0G G;  4O3P A;  2XCL A;  5KFY A;  2I87 A;  4DR5 H;  4O3S A;  4JV2 A;  1A0G A;  2YYA A;  1RJP A;  1V51 A;  3HKZ E;  3AYH B;  5I5Y A;  4I7H A;  5DIS C;  3N43 B;  5IYB G;  4AYB E;  4O3N A;  3RUP A;  2FPP B;  3J7A K;  4EYH B;  3RTX A;  1RK6 A;  3KHG A;  2YRW A;  4LF7 H;  1EYZ A;  4A3D G;  5LP6 F;  4O86 A;  4F4Z A;  4RNO A;  4TUY F;  2J6T A;  2OH2 A;  2ZDH A;  5FNV F;  3TQT A;  5FD6 A;  3T9F A;  3RB0 A;  1N56 A;  5LA6 F;  2XC9 A;  4CHI A;  1TA8 A;  5GON F;  1S03 G;  5C8Y F;  2W8L A;  3RBE A;  1UC9 A;  2BQR A;  3G8C A;  4DV7 H;  4YBZ B;  3R9R A;  2EJ0 A;  3MR3 A;  1P8L A;  2RDI A;  3PW7 A;  3L2P A;  1C3O A;  1GLV A;  4J9N A;  1I2L A;  5IYZ F;  4GLX A;  2QF7 A;  4UCV A;  3ETH A;  2R93 A;  1EUC B;  1FVI A;  2HDK A;  5D1O B;  3T9E A;  5DQH A;  1XK5 A;  4E4T A;  4O7R A;  3UQ8 A;  5J2U F;  5BWV A;  1Y14 B;  2AGQ A;  2HGX A;  1X9N A;  1CS0 A;  1DAA A;  4A3E G;  5HBR B;  2HVR A;  5KFW A;  1N32 H;  1I7L A;  3JZI A;  4I4T F;  2UVU A;  1BNC A;  5BWW A;  3OTO H;  2R82 A;  4O2B F;  3Q8P B;  3FKI A;  5KG3 A;  1WCM A;  3T99 A;  3G6V A;  4BY7 G;  2FLL A;  2FPG B;  3JRX A;  4CKC A;  4B3R H;  3GTM A;  4OX9 H;  1GSA A;  3PO3 G;  4LFA H;  3ORQ A;  5KFV A;  4O84 A;  2OLS A;  5C44 G;  3TY8 A;  1KTA A;  4A3G G;  4IRC A;  4A3K G;  2DIK A;  4ECY A;  3U9S A;  1HNX H;  2IMW P;  1RK5 A;  3KAL A;  2JEJ A;  5DAA A;  3HXL A;  2VUG A;  2JA6 A;  3U55 A;  2CQY A;  5KFL A;  4DAA A;  4ECR A;  2PN1 A;  2VA2 A;  3FDS A;  4FFN A;  5C3E G;  2V58 A;  3IN5 A;  1M7J A;  1BXR A;  3OUZ A;  3TIG A;  4MTD A;  4EBC A;  3SGI A;  5DG7 A;  1M6V A;  3KTM A;  4RB3 C;  2ZDG A;  4QWB A;  4RUA A;  3WWJ A;  2HVQ A;  3JSN A;  5I5T A;  5KFR A;  1S0M A;  1Z2P X;  5DLF A;  5IYD G;  1ZAU A;  4O7Z A;  1RJQ A;  2B63 G;  4FE2 A;  1B6S A;  3GTL A;  4CKE A;  3BQ1 A;  5D1P A;  3R5F A;  4J9P A;  1J5E H;  2E2H A;  4GC6 A;  4UCT A;  3K3V A;  2W6Q A;  2DPJ A;  4JV1 A;  1W93 A;  4LH7 A;  4MAM A;  4QWC A;  3OHA A;  3GIL A;  2UVV A;  3T9C A;  4U7C A;  4ED3 A;  4YJ2 F;  1K83 A;  3DAA A;  4ECZ A;  3LUL A;  4J9S A;  3PVX A;  5KFS A;  1V4Y A;  4DV6 H;  4A3M G;  1RYR A;  2YCH A;  3L4J A;  1CKM A;  1A9X A;  5LXT F;  4O81 A;  5BYA A;  2WB1 E;  2DAA A;  2R85 A;  4QIW A;  2HVS A;  5KG1 A;  4RB2 C;  4EEQ A;  3GV8 B;  5KG0 A;  3Q1K A;  3MFH A;  4O4L F;  3R5H A;  2ABJ A;  2WDT A;  4EGJ A;  4C5A A;  2I80 A;  3WWH A;  1I2K A;  5D1O A;  2RGR A;  4DL2 A;  5KFA A;  4YHH H;  5CA1 F;  2HHF B;  2VUM G;  5FLM G;  5L1L A;  3T5J A;  1DV1 A;  3HOW G;  5EWE A;  2CNQ A;  4HNT A;  5KFF A;  2NUA B;  4MV3 A;  2RGV A;  4Q45 A;  5I60 A;  5I5S A;  3CVZ A;  4ECV A;  2M05 A;  1R9T A;  1I94 H;  2R84 A;  4TQS A;  3JSL A;  4QW9 A;  2HIX A;  1EKP A;  5K2M A;  1O75 A;  5KFJ A;  3BQ0 A;  4MV6 A;  1PK8 A;  2VQD A;  3Q8S B;  4MV8 A;  4A3J G;  1I1L A;  2FMA A;  4JI4 H;  2YS6 A;  3K5H A;  2C2D A;  2YZN A;  4IR1 A;  3RGZ A;  5FLX W;  5BWR A;  3TIN A;  2CW7 A;  2VQF H;  5JQW A;  3OUU A;  5KFQ A;  4M9U A;  2R7N A;  3TY5 A;  3NGD A;  3TQ1 A;  2R8K A;  1XDN A;  5KFK A;  1XMQ H;  4XYM B;  1TWG A;  1MZB A;  4DR7 H;  4QWA A;  2VR1 A;  2VPS A;  2PMZ A;  1I3Q A;  5KFI A;  2Q2U A;  3TEK A;  4C5C A;  4JI6 H;  5DGA A;  4LF4 H;  2XGQ A;  1N48 A;  3I12 A;  1EKV A;  2VPQ A;  4FBT A;  4X64 H;  4DL7 A;  3T9A A;  1AUX A;  1Y1V G;  3MWE A;  3N44 B;  4QW8 A;  2CFM A;  1KBL A;  3GV7 B;  1GSO A;  3BJY A;  4DL3 A;  2ASJ A;  3UFX B;  5I5X A;  3WWI A;  4DUZ H;  1KUT A;  3MJF A;  3PW4 A;  2PMZ E;  2W9C A;  3BA8 A;  2COG A;  2PBZ A;  3TW6 A;  4AYB A;  1TWH A;  2VQE H;  2NVX A;  3PR4 A;  1Z2O X;  4TVI A;  2R87 A;  2W6M A;  4O83 A;  1E4E B;  2HG8 A;  3K3P A;  2R7K A;  4I55 F;  2C2R A;  4RAY A;  2R8J A;  1OBD A;  3KRE A;  4DR6 H;  1A3G A;  2FK3 A;  3PN1 A;  3FKI G;  4R7R A;  4BBR G;  1WCM G;  3EPG A;  2BQ3 A;  1GO3 E;  5I5V A;  2Y0S E;  3H4B A;  4ZOL F;  4FGR A;  2C35 B;  5DLG A;  2ASD A;  5H80 A;  4ZHQ F;  1OWT A;  4UFZ A;  1CQI B;  4NXM H;  1S68 A;  2X5R A;  4A3B G;  2WE6 A;  4JYA H;  4PBC A;  5A2Q W;  3GDE A;  2ZGI A;  4JV0 A;  1S0N A;  4Q0Y A;  2YL2 A;  4RCN A;  4JUZ A;  5IP7 G;  5LL6 b;  2W9A A;  4B3S H;  4ED0 A;  4EQ5 A;  2KSW A;  3RV3 A;  2C28 A;  5L9X A;  1EZ1 A;  4O7Y A;  5EWG A;  2C00 A;  4NYE A;  2YWV A;  4YAK B;  4DV0 H;  4EBE A;  3GTJ A;  4O4J F;  3N6X A;  4ECS A;  4A3C G;  1UC8 A;  1WH2 A;  2HHF A;  1CE8 A;  1IYE A;  5KG7 A;  1T3N A;  3AX6 A;  2W6O A;  2W6Z A;  1XMO H;  1RYS A;  3E5N A;  4IHJ F;  4O7T A;  4EBD A;  2UVW A;  3JZ6 A;  2WTF A;  4LFB H;  4WBN F;  1Y1V A;  5LOV F;  4IWY A;  2CNV A;  5EWF A;  4RU9 A;  5KFX A;  5CE8 A;  3RBD A;  1I1M A;  3JAM W;  1I50 A;  4ED1 A;  3GTK A;  5CA0 F;  3ORR A;  5C1P A;  4IWX A;  2NU8 B;  4RAZ A;  3QFF A;  2DAB A;  3T9D A;  3NUA A;  3GII A;  4NXN H;  4BXX G;  2EJ3 A;  4LSX A;  5I5U A;  1K1S A;  3GIM A;  2NU6 B;  3RGX A;  4PDB A;  1SYX B;  3S24 A;  1DV2 A;  4O7S A;  1TAE A;  5CAE B;  5KG4 A;  4A3F G;  3WO1 A;  2UUA H;  4J9M A;  2YZG A;  2EIY A;  4EFB A;  4Q44 A;  4XX0 B;  5LMU H;  2CNU A;  4O4H F;  4PZ6 A;  3H20 A;  4YR3 A;  3N40 P;  3V6K A;  1I6U A;  2UXD H;  2JA7 A;  4RNN A;  3BAC A;  4X65 H;  4FFR A;  5KT6 A;  4CMF A;  2IP4 A;  2FKL A;  4O4I F;  2R7L A;  5KFU A;  1JX4 A;  3PR5 B;  3K5I A;  2R8G A;  3GTP A;  1E4E A;  2YZM A;  3N8D A;  3TW7 A;  3C0F B;  4JI5 H;  5FJ8 G;  4LMY A;  4TM5 A;  2ZDQ A;  1DIK A;  4DUY H;  3WO0 A;  5CB4 F;  5DG8 A;  1VKZ A;  2A1H A;  3GIK A;  3HBL A;  3T5H A;  3HT5 A;  5EOY A;  5F9L A;  1S9F A;  2FK2 A;  3SE7 A;  4K6N A;  3T5L A;  4MV1 A;  4ED2 A;  4A3I G;  1DGS A;  4E6N A;  2W9C B;  2FE3 A;  2IBK A;  3PO2 G;  2FB9 A;  1RJR A;  3L4K A;  2J6U A;  3PW0 A;  3RR5 A;  3UYY A;  4NZM A;  4DV5 H;  2W7O A;  1KT8 A;  1B04 A;  3HOZ G;  4F4Y A;  2WB1 A;  4GKJ H;  1HNW H;  2IA6 A;  4ECX A;  3M4I A;  5KFT A;  4LF8 H;  5KG2 A;  1IOV A;  5JVL A;  2QYZ A;  3HOU G;  2VUM A;  3MR2 A;  3W1G A;  4DLK A;  3G6Y A;  4UCU A;  5KKN B;  4YB8 B;  4DL5 A;  5DGB A;  5BR8 H;  1ULZ A;  2BQU A;  2UVR A;  4MA5 A;  4NLG A;  4C2M A;  2ATL A;  2NU7 B;  3GB8 B;  4O82 A;  5FPR A;  1VAJ A;  4TV8 F;  5L1I A;  1SEI A;  4JI3 H;  4YQW A;  4QWE A;  3QQM A;  1P16 A;  4FU0 A;  5BPH A;  4Q4C A;  2YZL A;  4RB1 A;  3T1Y H;  5J2T F;  2JA8 G;  3NC0 B;  4FFL A;  4FM9 A;  5FPO A;  5C1O A;  2CKZ B;  4FS1 A;  3T5K A;  1IBK H;  2UXB H;  2W9B B;  1CKN B;  1T94 A;  1JKJ B;  3W5O A;  4RUC A;  3FMA A;  1XNQ H;  3T7A A;  3DTF A;  5KFP A;  2F4V H;  5KFB A;  4GKK H;  4G3I A;  3KXY T;  2FP4 B;  2ALZ A;  3AW8 A;  5KT3 A;  4UUG A;  3CSW A;  4GLW A;  5JQG F;  5F9N A;  3QZ7 A;  3KYH C;  5E25 A;  3KHL A;  4PZ8 A;  3MR5 A;  2QB5 A;  2J6S A;  4IR9 A;  4LH6 A;  4FS2 A;  2R8I A;  3KHR A;  1VS0 A;  3UZB A;  3MR6 A;  1KJJ A;  2GPW A;  3J80 W;  2C2E A;  2VOB A;  4YR2 A;  5BWU A;  5IP9 G;  4HQ6 A;  3MWM A;  5T14 A;  1FKA H;  3OSP A;  4EFE A;  4A2B A;  4MV4 A;  3GTQ A;  2W57 A;  4O7V A;  4APM A;  5DQI A;  4IRD A;  5EZY F;  5KFM A;  2FJZ A;  4TV9 F;  3VNN A;  3VPC A;  3U0G A;  1K1Q A;  2ZJT A;  2W70 A;  1OBG A;  2Y0S A;  5KFO A;  2E2I A;  1M0T A;  2PVP A;  3LQS A;  5KFE A;  1EUD B;  5BMV F;  3H40 A;  2HJW A;  4FBU A;  3EPI A;  4JV5 H;  3DF7 A;  1TWF A;  5JUM A;  4J9K A;  1N34 H;  3I4M G;  4F50 A;  2X0S A;  3JRW A;  2O03 A;  4J0M A;  1CKO A;  3RF2 A;  5KFN A;  4J9O A;  3RB6 A;  4NZO A;  2ASL A;  3H4D A;  4DV3 H;  4WHX A;  3H3V H;  2YW2 A;  3I4N G;  5KT4 A;  3MWD A;  3KAJ A;  3HB9 A;  2COI A;  4A3L G;  1M0W A;  4FFM A;  2R92 A;  4CC6 A;  4DQN A;  2W71 A;  1IYD A;  2DPI A;  1A0I A;  4UCO A;  4FFO A;  4MA0 A;  4DR1 H;  4ECQ A;  2BR0 A;  5IT9 W;  2P0A A;  3N42 B;  5KG6 A;  1WRV A;  4O7W A;  1TWC A;  2JA7 G;  4DIM A;  3GLK A;  4QJF A;  4R8U A;  3DTG A;  2V5A A;  3Q8Q B;  2W6N A;  4ED6 A;  2WAQ E;  1T36 A;  1JLL B;  2NVY A;  3PZP A;  4ED8 A;  2HGS A;  2HHH H;  4LF9 H;  4X66 H;  1KEE A;  4XZ3 B;  3BAA A;  4CKB A;  4QSH A;  5KT2 A;  3Q8R B;  2R7Z A;  2W9B A;  1CKN A;  2Y4R A;  2GQS A;  3IG0 A;  3PW2 A;  4L1K A;  2AGP A;  3R5X A;  1KJQ A;  3PW5 A;  4RZQ A;  3SI8 A;  4DV1 H;  1BJT A;  4ECW A;  2UUC H;  5IYC G;  2GPS A;  5KFG A;  4ZI7 F;  4A93 G;  5D8D A;  5DQG A;  4BWS C;  2XCP A;  2R86 A;  3NBY B;  4I50 F;  4F4X A;  4DL6 A;  3CEB A;  2JA5 A;  4AQY H;  3WNZ A;  3LP8 A;  3T9B A;  2XD4 A;  4ME6 A;  4EG0 A;  2Q2T A;  2E5L H;  2HIV A;  4PZ7 A;  3UZO A;  4ZQI A;  3J81 W;  3W1B A;  3GIJ A;  4LSA A;  2CZG A;  5LMN H;  3ETJ A;  2W8K A;  3GQC A;  1WR2 A;  1IOW A;  3Q2O A;  4Q8F A;  4O7N A;  1EKF A;  3LML A;  4YAJ B;  2R6F A;  5KT5 A;  2RDJ A;  5C4X G;  1KJ8 A;  3BA9 A;  4JI7 H;  2Z04 A;  4KHP H;  3BG5 A;  3NBZ B;  1TWA A;  4O3O A;  5KT7 A;  2DLN A;  1HNZ H;  4C5B A;  3QWU A;  3T1H H;  4LFC H;  1ZET A;  5BYB A;  4PWQ A;  5DG9 A;  4RB0 A;  5HV6 A;  4IAJ A;  1JDB B;  5IWA H;  2XGP A;  3V4S A;  3GTO A;  2W6P A;  5KX5 F;  1Y1W A;  1I1K A;  5KFD A;  3G6X A;  4EYI B;  4GC7 A;  3MFI A;  2QK4 A;  2JEG A;  4CE5 A;  1AN7 A;  1Z2N X;  5CR5 A;  3GTG A;  1C30 A;  1A48 A;  3CQZ A;  3H0G A;  4J9R A;  4HYK A;  5HNE A;  2AGO A;  2R7M A;  1JXL A;  4O3Q A;  4UCR A;  4CC5 A;  1B33 N;  3F8N A;  1E4F T;  1BGW A;  4ECT A;  4IRK A;  3RIZ A;  1IBM H;  4IZO A;  2DZD A;  1VBG A;  3PFF A;  4DR3 H;  1XNR H;  2ODT X;  4JXU A;  4CMD A;  3BQ2 A;  3R23 A;  1I7N A;  3TII A;  2JEI A;  5FR9 A;  3T54 A;  3KAK A;  3RV4 A;  2YS7 A;  4YR0 A;  4DR4 H;  4MV9 A;  5C5J A;  2I8C A;  4RNM A;  2COJ A;  4DV4 H;  4HN2 A;  4HR7 A;  5K3W A;  2SCU B;  5KG5 A;  3GID A;  4QWD A;  2JEF A;  2GQR A;  2AQ4 A;  2Q7D A;  1ZHS A;  2RF4 A;  3GJX B;  4R8U B;  3VA7 A;  3RAX A;  5EDW A;  4ED7 A;  4O7L A;  5DGH A;  4BY1 G;  4RZR A;  2UUB H;  3VOT A;  4WD3 A;  4K0K H;  5I47 A;  1V9P A;  1S10 A;  3U54 A;  5DGI A;  3M9N B;  4DR2 H;  4YP3 A;  4MV7 A;  3KHH A;  5BPF A;  2DWC A;  2EJ2 A;  3SNO A;  2HGW A;  2AU0 A;  5CM0 A;  5DMX A;  4EGQ A;  2R92 G;  3LWB A;  3V6H A;  2NU9 B;  2V4Q A;  3GV5 B;  5KFC A;  5KS8 A;  1ZHQ A;  2UU9 H;  4Y8V B;  3N6R A;  5I5W A;  3RJ0 A;  4TQR A;  4ECU A;  1B6R A;  1UNN C;  4HNV A;  4J9Q A;  4Q8E A;  2MCT A;  2R8H A;  4HNU A;  2XCA A;  4NZN A;  2ZM6 H;  4X62 H;  4JI8 H;  2J9G A;  4IIJ F;  4Q4D A;  4U6P A;  5L1K A;  1KC7 A;  1E4G T;  3RB4 A;  3VMM A;  3GIP A;  1PX2 A;  1L2Z A;  2R7Z G;  2FPI B;  3TY9 A;  2V4R A;  3V6J A;  5KFZ A;  2Z02 A;  2XIG A;  5JVD F;  4A2A A;  4JI0 H;  4O2A F;  5BWT A;  4JI2 H;  1N36 H;  4QIW E;  2VA3 A;  3RB3 A;  3M9O B;  2C22 A;  3HOY G; 
#chains in the Genus database with same CATH homology
 1VBH A;  2WYO A;  3G8D A;  1W96 A;  2YRX A;  5LYJ F;  5JH7 F;  3VPD A;  1SCU B;  1GSH A;  3HO8 A;  4XYL B;  3V4Z A;  1JDE A;  2GLT A;  3RFC A;  1CQJ B;  1GGO A;  1KJ9 A;  4YJ3 F;  2V59 A;  1AUV A;  3U9T A;  4FFP A;  1KJI A;  3JZF A;  3VPB A;  1EHI A;  2XCL A;  2I87 A;  2YYA A;  3RUP A;  2FPP B;  2YRW A;  1EYZ A;  5LP6 F;  4O86 A;  4TUY F;  2ZDH A;  5FNV F;  3TQT A;  5LA6 F;  5GON F;  5C8Y F;  1UC9 A;  3G8C A;  4YBZ B;  3R9R A;  1C3O A;  1GLV A;  5IYZ F;  2QF7 A;  3ETH A;  1EUC B;  4E4T A;  4O7R A;  5J2U F;  1CS0 A;  5HBR B;  1I7L A;  3JZI A;  4I4T F;  1BNC A;  2R82 A;  4O2B F;  2FPG B;  3JRX A;  1GSA A;  3ORQ A;  4O84 A;  2OLS A;  2DIK A;  3U9S A;  3KAL A;  3U55 A;  2CQY A;  2PN1 A;  4FFN A;  2V58 A;  1BXR A;  3OUZ A;  3TIG A;  1M6V A;  2ZDG A;  1Z2P X;  4O7Z A;  4FE2 A;  1B6S A;  3R5F A;  2W6Q A;  1W93 A;  4MAM A;  4YJ2 F;  1A9X A;  5LXT F;  4O81 A;  2R85 A;  3Q1K A;  4O4L F;  3R5H A;  4EGJ A;  4C5A A;  2I80 A;  5CA1 F;  1DV1 A;  2CNQ A;  4HNT A;  2NUA B;  4MV3 A;  2R84 A;  5K2M A;  4MV6 A;  1PK8 A;  2VQD A;  4MV8 A;  2YS6 A;  3K5H A;  2YZN A;  3TIN A;  5JQW A;  3OUU A;  4M9U A;  2R7N A;  4XYM B;  2VR1 A;  4C5C A;  3I12 A;  2VPQ A;  1AUX A;  3MWE A;  1KBL A;  1GSO A;  3UFX B;  1KUT A;  3MJF A;  2PBZ A;  3TW6 A;  1Z2O X;  2R87 A;  2W6M A;  4O83 A;  1E4E B;  3K3P A;  2R7K A;  4I55 F;  1OBD A;  3KRE A;  4ZOL F;  4FGR A;  5H80 A;  4ZHQ F;  1CQI B;  2YL2 A;  3RV3 A;  1EZ1 A;  4O7Y A;  2C00 A;  4NYE A;  2YWV A;  4YAK B;  4O4J F;  1UC8 A;  1CE8 A;  3AX6 A;  2W6O A;  2W6Z A;  3E5N A;  4IHJ F;  4O7T A;  4WBN F;  5LOV F;  4IWY A;  2CNV A;  5CA0 F;  3ORR A;  5C1P A;  2NU8 B;  4IWX A;  3QFF A;  3NUA A;  2NU6 B;  1DV2 A;  4O7S A;  5CAE B;  3WO1 A;  2YZG A;  4XX0 B;  2CNU A;  4O4H F;  4FFR A;  2IP4 A;  4O4I F;  2R7L A;  3K5I A;  1E4E A;  2YZM A;  3N8D A;  2ZDQ A;  1DIK A;  3WO0 A;  5CB4 F;  1VKZ A;  3HBL A;  3SE7 A;  4MV1 A;  2FB9 A;  1IOV A;  5JVL A;  4DLK A;  5KKN B;  4YB8 B;  1ULZ A;  4MA5 A;  2NU7 B;  4O82 A;  4TV8 F;  4FU0 A;  5BPH A;  2YZL A;  5J2T F;  4FFL A;  5C1O A;  1JKJ B;  2FP4 B;  3AW8 A;  5JQG F;  1KJJ A;  2GPW A;  4HQ6 A;  4MV4 A;  4O7V A;  5EZY F;  4TV9 F;  3VPC A;  2W70 A;  1OBG A;  1M0T A;  2PVP A;  1EUD B;  5BMV F;  2HJW A;  3DF7 A;  2X0S A;  3JRW A;  2YW2 A;  3MWD A;  3KAJ A;  3HB9 A;  1M0W A;  4FFM A;  2W71 A;  4FFO A;  4MA0 A;  2P0A A;  4O7W A;  4DIM A;  3GLK A;  2V5A A;  2W6N A;  1T36 A;  1JLL B;  2HGS A;  1KEE A;  4XZ3 B;  4QSH A;  2GQS A;  4L1K A;  3R5X A;  1KJQ A;  4RZQ A;  2GPS A;  4ZI7 F;  5D8D A;  2R86 A;  4I50 F;  3WNZ A;  3LP8 A;  4EG0 A;  2XD4 A;  4ME6 A;  4ZQI A;  2CZG A;  3ETJ A;  1WR2 A;  1IOW A;  3Q2O A;  4O7N A;  4YAJ B;  2R6F A;  1KJ8 A;  2Z04 A;  3BG5 A;  2DLN A;  4C5B A;  5HV6 A;  1JDB B;  3V4S A;  2W6P A;  5KX5 F;  2QK4 A;  1Z2N X;  1C30 A;  1A48 A;  2R7M A;  4IZO A;  2DZD A;  1VBG A;  3R23 A;  1I7N A;  3TII A;  3KAK A;  3RV4 A;  2YS7 A;  4MV9 A;  2I8C A;  4HR7 A;  2SCU B;  3GID A;  2GQR A;  3VA7 A;  4O7L A;  3VOT A;  4WD3 A;  5I47 A;  3U54 A;  4MV7 A;  5BPF A;  2DWC A;  5DMX A;  4EGQ A;  3LWB A;  2NU9 B;  4Y8V B;  3N6R A;  1B6R A;  4HNV A;  4HNU A;  2J9G A;  4IIJ F;  1KC7 A;  3VMM A;  1PX2 A;  2FPI B;  2Z02 A;  5JVD F;  4O2A F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...