4XYMB

Ca. korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 in complex with coenzyme a, ca-ampcp and hgcl+
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
229
structure length
229
Chain Sequence
b'SSRDLLLKAKENGRKSLLEHEAKYFISSYGIPVTNIRLAKSEEEAVNFSREIGFPVVLKIVSPQVVHKSDVGGVKVNLRSEEEVRKAYREIIENVKRNVPNAEIEGILVQEFAPPGVELIIGLLRDPQFGPTVMFGLGGVFVELFRDVSFRVAPLSEQDAESMIKEVKAYKLLTGFRGMEPVDIEAIKDALIRAGRIGVENEEIAEMDLNPVIAYPKGIKVVDARIILR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha subunit of Acyl-CoA synthetase (NDP forming)
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Korarchaeum cryptofilum (strain opf8)
molecule tags Ligase
total genus 73
structure length 229
sequence length 229
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13549 ATP-grasp_5 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4xymB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4xymB02
2NUAB 1BXRA 1KBLA 3G8CA 1EUCB 4FE2A 4IIJF 4MA0A 2YZGA 3Q1KA 4HR7A 4M9UA 5JH7F 2OLSA 2PVPA 2GQRA 4IHJF 2PBZA 4E4TA 4IWXA 5CB4F 4YB8B 3MWEA 5HBRB 4ZQIA 1PK8A 1JKJB 4MA5A 1BNCA 3HO8A 2XCLA 3V4ZA 1OBDA 2YYAA 4FFPA 2CNUA 4O82A 3R5XA 4MAMA 1A48A 3KREA 5C1PA 3KAJA 2J9GA 1CQIB 1JLLB 3TW6A 3VPCA 1AUXA 5CA1F 2YL2A 3TINA 3JRXA 5DMXA 4NYEA 3OUUA 1VBHA 2DZDA 2GPWA 4FFLA 2R82A 3U55A 4FFNA 5JQWA 3BG5A 4FFRA 5LXTF 5H80A 2V5AA 2YRXA 2C00A 3AX6A 1E4EA 2YZMA 2FPGB 3WO0A 1DV1A 1KEEA 4O4JF 1UC8A 1DIKA 4ZHQF 2VR1A 4IWYA 5HV6A 1WR2A 1GGOA 3K3PA 1VBGA 1KJJA 4MV1A 3NUAA 4HNTA 1KJ8A 2I87A 4MV4A 2ZDGA 1C30A 4FFMA 4ZOLF 4IZOA 5IYZF 5GONF 3HB9A 3LP8A 3LWBA 1Z2NX 4O81A 2CNVA 3K5IA 2W6QA 2IP4A 2ZDHA 5LYJF 1CS0A 3E5NA 2VPQA 2X0SA 1JDBB 4MV7A 4HNVA 2V58A 4YJ2F 1KC7A 4XZ3B 1GSHA 2DWCA 2W70A 2QK4A 3ETHA 4FFOA 5LA6F 4O4LF 1T36A 1E4EB 2PN1A 3MWDA 4Y8VB 1B6SA 3R5HA 5BPFA 4I55F 5JVLA 1Z2OX 4C5CA 1DV2A 1EUDB 2W6NA 4TUYF 5KX5F 3ORRA 4I4TF 1EZ1A 3K5HA 5BPHA 2P0AA 4L1KA 5JQGF 4O4IF 2R87A 4XX0B 4YJ3F 2FPPB 1OBGA 2NU7B 1IOWA 2GLTA 2YWVA 3UFXB 2R6FA 2HJWA 2YW2A 1I7LA 2DIKA 2YZNA 2R7KA 4QSHA 5D8DA 5LOVF 3OUZA 5K2MA 1GLVA 4RZQA 1EYZA 2Z04A 4FU0A 3TIGA 2HGSA 4I50F 3U9SA 1I7NA 3Q2OA 4HQ6A 3VPBA 3VPDA 1ULZA 4MV3A 4O7RA 4O2AF 4C5AA 3ORQA 1GSAA 2VQDA 1IOVA 5KKNB 4O7YA 4O7TA 3JZFA 2NU9B 3TQTA 2ZDQA 2FPIB 2R85A 2GQSA 3ETJA 2GPSA 4YAJB 1EHIA 1C3OA 1CQJB 3JZIA 4EGJA 2SCUB 2FP4B 2QF7A 4EG0A 5J2TF 4MV6A 3KAKA 3RV3A 1KJQA 3VOTA 2Z02A 5C8YF 3RV4A 5C1OA 4XYMB 3SE7A 1W93A 1SCUB 3U54A 2W6MA 5BMVF 4O4HF 1AUVA 1JDEA 1KUTA 4DLKA 1VKZA 2R7NA 3U9TA 1CE8A 2R7MA 4O7ZA 2R7LA 1B6RA 4YBZB 2W6OA 3GIDA 3VMMA 5CA0F 1M6VA 4O7WA 1M0TA 4MV8A 4C5BA 4XYLB 1UC9A 4WD3A 4TV8F 2FB9A 2R84A 1M0WA 5EZYF 5FNVF 2I8CA 3WNZA 3V4SA 4TV9F 2V59A 5CAEB 2YRWA 3R9RA 2DLNA 3AW8A 4ME6A 1W96A 4FGRA 4O7VA 4ZI7F 1KJ9A 3KALA 4O7LA 4MV9A 2W71A 2W6PA 3HBLA 1Z2PX 1PX2A 3VA7A 1KJIA 4O2BF 3WO1A 3RUPA 3JRWA 2WYOA 1A9XA 2CQYA 5I47A 4O7SA 4EGQA 3R5FA 3QFFA 3TIIA 2W6ZA 2YS7A 2R86A 4O86A 2CZGA 2CNQA 4O7NA 4O83A 2I80A 2XD4A 4YAKB 2YZLA 3I12A 3G8DA 2YS6A 4O84A 2NU8B 5JVDF 3DF7A 2NU6B 5LP6F 3MJFA 3GLKA 1GSOA 3RFCA 3N8DA 4HNUA 3N6RA 4WBNF 4DIMA 5J2UF 3R23A
chains in the Genus database with same CATH superfamily
1S9FA 4LFBH 4DR1H 2NUAB 4IRCA 5C44G 5DGIA 4DUZH 1BXRA 5DQGA 4QIWE 1L2ZA 2ATLA 5LMUH 4YR3A 4J9NA 4CC5A 5DISC 5E25A 3TY9A 1KBLA 3G8CA 2QYZA 1EUCB 1ZQ7A 5JUMA 4GKKH 4FE2A 4YR0A 4IIJF 1XK5A 4PBCA 5CE8A 4J9QA 3PZPA 4F4WA 4MA0A 3PN1A 3J81W 2YZGA 3T9AA 2R8IA 1V9PA 3GTLA 2R93G 2W9BB 3Q1KA 4HR7A 3UQ8A 4A3LG 5KS8A 2Y0SA 4JI8H 5DG8A 4M9UA 1TA8A 4QWBA 5KT2A 2UUBH 2JEFA 5JH7F 2OLSA 4M0JA 3T54A 5KFYA 2PVPA 4DL6A 2X5RA 2GQRA 2FLLA 1XNRH 3H3VH 3FKIA 4IHJF 2PBZA 4E4TA 2PMZE 4RB2C 4IWXA 3HXLA 2R92A 4A3CG 5CB4F 4YB8B 3MWEA 2DABA 5HBRB 4F4ZA 4O3NA 2W7PA 2JEJA 4ZQIA 5DGHA 2UUAH 1PK8A 3DTFA 3G6VA 1JKJB 4MA5A 4IAJA 1HNZH 3HT5A 2BR0A 1BNCA 3HO8A 2XCLA 3V4ZA 3M9OB 2DPJA 5BWTA 1OBDA 2YYAA 4FFPA 2CNUA 1FKAH 4O82A 5IP9G 3OHBA 3GTKA 3JAMW 4FS2A 4QJFA 3S24A 3R5XA 2QB5A 5KFVA 3G6YA 4O3QA 4A3BG 4MAMA 2KSWA 1CKNB 3N6XA 1A48A 3KREA 4NXMH 4CC6A 4GLXA 4YHHH 4HYKA 4IR9A 4JXUA 2ASDA 4M7EA 5KT5A 5C1PA 3KAJA 1P16A 2J9GA 1FVIA 3W5OA 5KFNA 4YQWA 4ECRA 1JX4A 4RAYA 4RU9A 2R8GA 1CQIB 1JLLB 3W1BA 5BWXA 2FK3A 2VUMG 3WWIA 4QW9A 5BYAA 3TW6A 3VPCA 5KFMA 3QZ8A 3T9BA 3PW4A 1AUXA 5CA1F 2YL2A 5BWUA 3TINA 3T9CA 4EFBA 3M9MB 1FJGH 3JRXA 3K3VA 2V9WA 5DMXA 4NYEA 5DAAA 2FK1A 3OSNA 3OUUA 4AYBA 1Y14B 3KXYT 1VBHA 2DZDA 1SEIA 4KHPH 2GPWA 3BABA 4FFLA 4DV5H 2AGPA 2R82A 4ED1A 3OHAA 4FM9A 2ALZA 4X62H 2Q2UA 4CKEA 2UU9H 3MFHA 2WB1A 4DR5H 3U55A 4EEQA 4JV5H 4I7HA 1KTAA 1GO3E 4IR1A 2RF4A 3KHLA 3GILA 4LFCH 4JI6H 4FFNA 5JQWA 4ECUA 3MR3A 4ED0A 3BG5A 3EPGA 3J7AK 4FFRA 5FPRA 5I5YA 3KHRA 3BA8A 5LXTF 5H80A 1V4YA 3GIIA 2XC9A 2A1HA 3HKZE 4K6NA 4AQYH 2V5AA 2YRXA 1XNQH 2C00A 3AX6A 3KTMA 2VQEH 4NZNA 2WDTA 3HOYG 3OTOH 1E4EA 4BY1G 4Q4CA 3RB6A 4JV1A 1RJRA 2YZMA 3JSNA 3H4BA 2FPGB 2Q7DA 3WO0A 2VOBA 4DV6H 4DL7A 1DV1A 4K0KH 1B33N 1OWTA 1O75A 1UC8A 4NZMA 4O4JF 1KEEA 4YP3A 1DIKA 3BAAA 2VR1A 4IWYA 4ZHQF 5HV6A 1WR2A 1TWGA 3MFIA 1G2WA 1GGOA 1T94A 3K3PA 2FK2A 1K1SA 4CMDA 1VBGA 3AYHB 4A2BA 2JA5G 1KJJA 4MV1A 1N33H 1S0NA 3NUAA 4UCRA 4HNTA 4UFZA 4QIWA 5I5VA 1KJ8A 4Q43A 2I87A 2FKLA 2AU0A 2OH2A 4R8UA 4ED8A 4A3DG 2E2IA 2JEGA 1DGSA 4MV4A 1E4FT 3PW5A 2ZDGA 4JV2A 2WAQE 1S10A 4UCVA 4X65H 1C30A 4B3RH 3GDEA 1N48A 1S0OA 4FFMA 4ZOLF 3M9NB 5L9XA 3CSWA 4IZOA 5L1LA 4O3SA 5IYZF 5GONF 3HB9A 3W1GA 4A3FG 3LP8A 3LWBA 2YU9A 3NC0B 3TW7A 2HDKA 1Z2NX 5KFSA 5KFQA 4J9OA 5IWAH 4J0MA 1ZHSA 3H0GG 3MR6A 2AGQA 2M05A 4O81A 5KG6A 2W9CA 1I1LA 3PR4A 2CNVA 2VQFH 3K5IA 1I50A 2W6QA 1ZAUA 2IP4A 2ZDHA 4TQRA 2VUMA 2EJ0A 3BACA 3PW0A 4PDBA 3QQMA 5LYJF 2YCHA 5D1PA 3GIPA 1CS0A 3E5NA 3L4KA 5KFGA 3RIZA 2ZJTA 2C2RA 1DAAA 2VPQA 1JDBB 2X0SA 4MV7A 4HNVA 1EKVA 2C2EA 4C2MA 2UXBH 2V58A 4EBEA 4YJ2F 2XIGA 3T99A 3RGXA 5EWFA 4ECZA 2VPSA 1KC7A 3CQZA 3GTPA 4XZ3B 1J5EH 1GSHA 3RF2A 1HNXH 3KHHA 5KT4A 2Q2TA 4DUYH 2DWCA 2R8KA 2HGXA 2QK4A 2W70A 5KFCA 4RUAA 3GIMA 3BQ2A 4NLGA 3ETHA 5IYDG 3UZBA 2HHFB 3EPIA 4J9RA 4FFOA 5LA6F 1VAJA 3GV5B 4A3EG 3M4IA 5FLXW 5DGBA 3PW2A 4F4YA 5D1OB 2O03A 5KFTA 1CKMA 1WSCA 4O4LF 4TM5A 5KG4A 1HR0H 1T36A 1I2LA 1E4EB 2PN1A 3PR5B 4EBCA 3T5JA 2JA8G 3MWDA 4PZ6A 4UCUA 1JXLA 4Y8VB 3HOZG 1B6SA 2COJA 4A3IG 2DPIA 3WWHA 5I5XA 2EJ2A 3R5HA 5IYBG 2CW7A 5BPFA 4I55F 2UXCH 3GTGA 5JVLA 4BBRG 1Z2OX 4C5CA 1XMOH 3RB4A 1TWAA 5FD6A 2JA5A 3H20A 4A3GG 4Q44A 1DV2A 4ED6A 1EUDB 4E6NA 2W6NA 4R8UB 4GC7A 4YY3H 1ZETA 4Q8EA 4G3IA 4TUYF 5C4XG 2UVRA 2HIVA 5KX5F 5KG2A 1AN7A 3GTJA 4I4TF 2ODTX 1EZ1A 2VUGA 3ORRA 4ECWA 1K83A 4FBTA 3HOUG 2E2HA 2FJZA 2C2DA 3K5HA 5BPHA 2V4QA 3EYYA 3IG0A 3RGZA 1RK5A 2P0AA 2RGVA 5C3EG 4JI1H 5KFZA 2FLPA 2JA7G 4L1KA 3L2PA 1TAEA 5I5UA 4O4IF 5JQGF 2R87A 5BYBA 4DV7H 3PW7A 1HNWH 4XX0B 4YJ3F 4ECVA 3RBDA 1V51A 2FPPB 2HIXA 1Y1VG 1OBGA 4DV1H 2NU7B 1IOWA 3MR2A 3UZOA 2GLTA 2YWVA 3UFXB 1RJQA 3MWMA 2XCAA 3GQCA 2R6FA 2HJWA 2YW2A 5KFWA 2HG8A 1I7LA 5KFEA 5FJ8G 1RYRA 1N34H 4BWSC 4B3MH 2Y0SE 5KT7A 2DIKA 2YZNA 2R7KA 4QSHA 5D8DA 5LOVF 3OUZA 2MCTA 2CFMA 1WCMG 4QWAA 4EQ5A 5K2MA 2AGOA 5BR8H 1GLVA 4ED7A 5EDWA 1IBKH 1EYZA 4RZQA 4DL3A 2Z04A 4FU0A 2HGSA 4I50F 3TIGA 3U9SA 5KFFA 2FMAA 1I7NA 5KT6A 1Y1WG 1BGWA 4BY7G 3Q2OA 4O3PA 2R8HA 3Q8RB 4HQ6A 3VPDA 3VPBA 4CHIA 4DL2A 5FD5A 2COIA 1ULZA 4MV3A 5DQHA 2R93A 4O7RA 4O2AF 4C5AA 2IA6A 3ORQA 1E4GT 2CKZB 4F4XA 5KFOA 2B63G 4EFEA 4Q8FA 3GJXB 3PO3G 4O3RA 1GSAA 1I1MA 2VQDA 3N43B 3GIJA 2W9AA 1IOVA 5KKNB 4O7YA 4O7TA 4JV0A 4RB3C 4RNNA 3HOXG 3JZFA 2DAAA 2NU9B 1XMQH 1I6UA 4IRDA 3TQTA 1VS0A 5KG5A 2ZDQA 3FDSA 4UCTA 2FPIB 2R85A 5F9NA 2GQSA 3ETJA 3N44B 1WH2A 2GPSA 4JI4H 4YAJB 1M7JA 1IYEA 1EHIA 3FKIG 1C3OA 4TQSA 1CQJB 2R92G 5IT9W 4DR2H 4DR4H 5FPOA 3JZIA 4JI0H 4EGJA 2SCUB 3LMLA 3DAAA 3RBEA 2FP4B 2QF7A 3CVZA 4LSAA 5DGAA 4LF5H 2UUCH 4BBSG 4JYAH 5KFPA 4EG0A 2NVYA 3CEBA 5J2TF 4MV6A 3KAKA 4AYBE 4U6PA 4YR2A 4JI3H 5KFJA 3T1YH 5K3WA 3FMAA 5BWVA 2PMZA 2RGRA 3RV3A 5KFKA 1KJQA 3DTGA 3VOTA 3WWJA 3BQ0A 3QZ7A 2JA7A 5CR5A 1TWCA 2WB1E 1RYSA 2Z02A 5L1JA 1RJPA 4UCOA 5C8YF 1X9NA 3RV4A 1CKNA 1XDNA 4UCSA 4APMA 4QWEA 5C1OA 2BQUA 4DL4A 3RJ0A 4XYMB 4ECYA 2CW8A 4NXNH 2COGA 2RDIA 4B3TH 2J6TA 3SE7A 3H4DA 1W93A 5BWWA 3GIQA 4JUZA 2UVUA 1SCUB 3U54A 1N32H 3UYYA 1N56A 2W6MA 4J9PA 5BMVF 3GV7B 4O3OA 4O4HF 2AQ4A 1T3NA 5BWRA 4ETSA 3KHGA 5L1IA 1AUVA 1JDEA 1KUTA 3NBYB 4RNOA 2FE3A 3J80W 5KFHA 4JI7H 4DLKA 1VKZA 2E5LH 2XGPA 3N42B 1N36H 2R7NA 3U9TA 5KFIA 1CE8A 2R7MA 2W57A 4LF8H 4O7ZA 2R7LA 2C28A 2VA3A 5FLMG 1B6RA 4YBZB 3H40A 1I94H 5DQIA 5T14A 2W6OA 4R7RA 3GIDA 3U0GA 2B63A 3L4JA 3GB8B 3PVXA 1I1KA 3LULA 3VMMA 5CA0F 4MTDA 5KG3A 2BQRA 4JI5H 4GLWA 2XGQA 4EEYA 1A0GA 2Y4RA 2W8KA 4A93G 1M6VA 3QWUA 5EWGA 2J6UA 4ED3A 4O7WA 3TQ1A 1ZHQA 2WTFA 2JA6G 4Q0YA 4DV3H 1M0TA 4DQNA 3RB3A 4DRFA 4MV8A 3TY5A 4XYLB 4C5BA 3G6XA 4J9SA 1UC9A 4WD3A 2WE6A 4JI2H 4LF6H 4CE5A 3JZ6A 5KFAA 4CKCA 4TV8F 2UVVA 2FB9A 2R84A 4DV0H 4EYHB 1M0WA 3T9DA 3BJYA 4UUGA 2ASJA 1MZBA 2OWOA 5EZYF 3OSPA 3KYHC 3GTMA 5FNVF 3T5HA 2W8LA 3Q8PB 2C22A 1S68A 4DR7H 5KFUA 2XCPA 3HKZA 5FR9A 2I8CA 4J9LA 3RAQA 1SFOA 3WNZA 4B3SH 3NBZB 3V4SA 4PZ7A 2R7ZG 3H0GA 2ABJA 2W9CB 3LQSA 4TV9F 1I3QA 2V59A 2V4RA 4OX9H 3N40P 2FLNA 3HOVG 3SNOA 5CAEB 2YRWA 3R9RA 2DLNA 3AW8A 4ME6A 3IN5A 2J6SA 1W96A 1UNNC 1B04A 4HN2A 4RUCA 2F4VH 3TEKA 4FGRA 4O7VA 3RAXA 4ZI7F 1GYFA 5I5SA 5KG1A 1KJ9A 4RNMA 1EKFA 3T1HH 4A3JG 2IBKA 5DLGA 4CMFA 3KALA 1S0MA 5I5WA 4O7LA 4MV9A 1TWFA 2W71A 2WAQA 1A3GA 1BJTA 5I5TA 5EWEA 2W6PA 1CKOA 3HBLA 4LF9H 5KG0A 2NVXA 2C35B 2JEIA 5KT3A 3GTOA 5KG7A 1Z2PX 5KFXA 4Q45A 5IYCG 3BQ1A 4QWDA 5KFDA 3MR5A 4LF4H 1P8LA 1K1QA 4A3MG 5IP7G 4A3KG 3SI8A 1PX2A 3VA7A 1IBMH 4LMYA 1WRVA 4F50A 1KJIA 4DAAA 4O2BF 2EIYA 3TY8A 4X64H 1IBLH 5LL6b 5CM0A 4QWCA 2HVSA 2VA2A 3GIKA 3WO1A 5KFRA 3T7AA 3RUPA 4J9MA 3V6HA 2IMWP 2UVWA 2W9BA 4FS1A 3JRWA 4CKBA 3I4MG 4Q4DA 1TWHA 5KFBA 1S97A 2HHFA 2BQ3A 2EJ3A 4U7CA 4RZRA 1EKPA 2WYOA 2ZGIA 5KFLA 5F9LA 2RDJA 4DV4H 2R8JA 4RAZA 1A9XA 5D1OA 3GTQA 4RB0A 4TVIA 4BXXG 4PWQA 4RCNA 1SYXB 5I47A 2CQYA 4O7SA 2ZM6H 4EBDA 4IRKA 4EYIB 2JA6A 4NZOA 4EGQA 3R5FA 3T9FA 3VNNA 4GC6A 5DG7A 3QFFA 3TIIA 5A2QW 2W6ZA 2YS7A 2R86A 4ECXA 4RB1A 3PO2G 5C5JA 2HHHH 4O86A 4X66H 2CZGA 4ED2A 3T9EA 4FBUA 4LFAH 2CNQA 4O7NA 3HOWG 2HVQA 4O83A 1A0IA 2I80A 2HVRA 2XD4A 4DL5A 3Q8SB 5DG9A 3T5LA 5LMNH 4YAKB 1I2KA 2YZLA 3I12A 1IYDA 2YS6A 3G8DA 4O84A 5I60A 1RK6A 4LSXA 4DV2H 2NU8B 3JSLA 4WHXA 3RB0A 4DR6H 3N41B 5EOYA 4ECTA 5JVDF 5DLFA 3BA9A 3DF7A 2R7ZA 3SGIA 2NU6B 3V6KA 3T5KA 5LP6F 3MJFA 3PFFA 3GLKA 4LH7A 1Y1VA 1GSOA 1R9TA 2W7OA 1JIHA 4DR3H 1S03G 3C0FB 4ECQA 4PZ8A 3RFCA 4MTEA 4LH6A 3F8NA 4J9KA 3I4NG 4LF7H 3N8DA 2ASLA 3RR5A 4HNUA 3N6RA 3NGDA 4ECSA 4QW8A 3GV8B 1WCMA 3V6JA 4GKJH 4A2AA 4WBNF 4DIMA 1Y1WA 3RTXA 1ET0A 5L1KA 3Q8QB 2UXDH 1KT8A 5J2UF 5HNEA 3R23A 2HGWA
chains in the Genus database with same CATH topology
2NUAB 1BXRA 1KBLA 3G8CA 1EUCB 4FE2A 4IIJF 4MA0A 2YZGA 3Q1KA 4HR7A 4M9UA 5JH7F 2OLSA 2PVPA 2GQRA 4IHJF 2PBZA 4E4TA 4IWXA 5CB4F 4YB8B 3MWEA 5HBRB 4ZQIA 1PK8A 1JKJB 4MA5A 1BNCA 3HO8A 2XCLA 3V4ZA 1OBDA 2YYAA 4FFPA 2CNUA 4O82A 3R5XA 4MAMA 1A48A 3KREA 5C1PA 3KAJA 2J9GA 1CQIB 1JLLB 3TW6A 3VPCA 1AUXA 5CA1F 2YL2A 3TINA 3JRXA 5DMXA 4NYEA 3OUUA 1VBHA 2DZDA 2GPWA 4FFLA 2R82A 3U55A 4FFNA 5JQWA 3BG5A 4FFRA 5LXTF 5H80A 2V5AA 2YRXA 2C00A 3AX6A 1E4EA 2YZMA 2FPGB 3WO0A 1DV1A 1KEEA 4O4JF 1UC8A 1DIKA 4ZHQF 2VR1A 4IWYA 5HV6A 1WR2A 1GGOA 3K3PA 1VBGA 1KJJA 4MV1A 3NUAA 4HNTA 1KJ8A 2I87A 4MV4A 2ZDGA 1C30A 4FFMA 4ZOLF 4IZOA 5IYZF 5GONF 3HB9A 3LP8A 3LWBA 1Z2NX 4O81A 2CNVA 3K5IA 2W6QA 2IP4A 2ZDHA 5LYJF 1CS0A 3E5NA 2VPQA 2X0SA 1JDBB 4MV7A 4HNVA 2V58A 4YJ2F 1KC7A 4XZ3B 1GSHA 2DWCA 2W70A 2QK4A 3ETHA 4FFOA 5LA6F 4O4LF 1T36A 1E4EB 2PN1A 3MWDA 4Y8VB 1B6SA 3R5HA 5BPFA 4I55F 5JVLA 1Z2OX 4C5CA 1DV2A 1EUDB 2W6NA 4TUYF 5KX5F 3ORRA 4I4TF 1EZ1A 3K5HA 5BPHA 2P0AA 4L1KA 5JQGF 4O4IF 2R87A 4XX0B 4YJ3F 2FPPB 1OBGA 2NU7B 1IOWA 2GLTA 2YWVA 3UFXB 2R6FA 2HJWA 2YW2A 1I7LA 2DIKA 2YZNA 2R7KA 4QSHA 5D8DA 5LOVF 3OUZA 5K2MA 1GLVA 4RZQA 1EYZA 2Z04A 4FU0A 3TIGA 2HGSA 4I50F 3U9SA 1I7NA 3Q2OA 4HQ6A 3VPBA 3VPDA 1ULZA 4MV3A 4O7RA 4O2AF 4C5AA 3ORQA 1GSAA 2VQDA 1IOVA 5KKNB 4O7YA 4O7TA 3JZFA 2NU9B 3TQTA 2ZDQA 2FPIB 2R85A 2GQSA 3ETJA 2GPSA 4YAJB 1EHIA 1C3OA 1CQJB 3JZIA 4EGJA 2SCUB 2FP4B 2QF7A 4EG0A 5J2TF 4MV6A 3KAKA 3RV3A 1KJQA 3VOTA 2Z02A 5C8YF 3RV4A 5C1OA 4XYMB 3SE7A 1W93A 1SCUB 3U54A 2W6MA 5BMVF 4O4HF 1AUVA 1JDEA 1KUTA 4DLKA 1VKZA 2R7NA 3U9TA 1CE8A 2R7MA 4O7ZA 2R7LA 1B6RA 4YBZB 2W6OA 3GIDA 3VMMA 5CA0F 1M6VA 4O7WA 1M0TA 4MV8A 4C5BA 4XYLB 1UC9A 4WD3A 4TV8F 2FB9A 2R84A 1M0WA 5EZYF 5FNVF 2I8CA 3WNZA 3V4SA 4TV9F 2V59A 5CAEB 2YRWA 3R9RA 2DLNA 3AW8A 4ME6A 1W96A 4FGRA 4O7VA 4ZI7F 1KJ9A 3KALA 4O7LA 4MV9A 2W71A 2W6PA 3HBLA 1Z2PX 1PX2A 3VA7A 1KJIA 4O2BF 3WO1A 3RUPA 3JRWA 2WYOA 1A9XA 2CQYA 5I47A 4O7SA 4EGQA 3R5FA 3QFFA 3TIIA 2W6ZA 2YS7A 2R86A 4O86A 2CZGA 2CNQA 4O7NA 4O83A 2I80A 2XD4A 4YAKB 2YZLA 3I12A 3G8DA 2YS6A 4O84A 2NU8B 5JVDF 3DF7A 2NU6B 5LP6F 3MJFA 3GLKA 1GSOA 3RFCA 3N8DA 4HNUA 3N6RA 4WBNF 4DIMA 5J2UF 3R23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NUA B;  1BXR A;  1KBL A;  3G8C A;  1EUC B;  4FE2 A;  4IIJ F;  4MA0 A;  2YZG A;  3Q1K A;  4HR7 A;  4M9U A;  5JH7 F;  2OLS A;  2PVP A;  2GQR A;  4IHJ F;  2PBZ A;  4E4T A;  4IWX A;  5CB4 F;  4YB8 B;  3MWE A;  5HBR B;  4ZQI A;  1PK8 A;  1JKJ B;  4MA5 A;  1BNC A;  3HO8 A;  2XCL A;  3V4Z A;  1OBD A;  2YYA A;  4FFP A;  2CNU A;  4O82 A;  3R5X A;  4MAM A;  1A48 A;  3KRE A;  5C1P A;  3KAJ A;  2J9G A;  1CQI B;  1JLL B;  3TW6 A;  3VPC A;  1AUX A;  5CA1 F;  2YL2 A;  3TIN A;  3JRX A;  5DMX A;  4NYE A;  3OUU A;  1VBH A;  2DZD A;  2GPW A;  4FFL A;  2R82 A;  3U55 A;  4FFN A;  5JQW A;  3BG5 A;  4FFR A;  5LXT F;  5H80 A;  2V5A A;  2YRX A;  2C00 A;  3AX6 A;  1E4E A;  2YZM A;  2FPG B;  3WO0 A;  1DV1 A;  1KEE A;  4O4J F;  1UC8 A;  1DIK A;  4ZHQ F;  2VR1 A;  4IWY A;  5HV6 A;  1WR2 A;  1GGO A;  3K3P A;  1VBG A;  1KJJ A;  4MV1 A;  3NUA A;  4HNT A;  1KJ8 A;  2I87 A;  4MV4 A;  2ZDG A;  1C30 A;  4FFM A;  4ZOL F;  4IZO A;  5IYZ F;  5GON F;  3HB9 A;  3LP8 A;  3LWB A;  1Z2N X;  4O81 A;  2CNV A;  3K5I A;  2W6Q A;  2IP4 A;  2ZDH A;  5LYJ F;  1CS0 A;  3E5N A;  2VPQ A;  2X0S A;  1JDB B;  4MV7 A;  4HNV A;  2V58 A;  4YJ2 F;  1KC7 A;  4XZ3 B;  1GSH A;  2DWC A;  2W70 A;  2QK4 A;  3ETH A;  4FFO A;  5LA6 F;  4O4L F;  1T36 A;  1E4E B;  2PN1 A;  3MWD A;  4Y8V B;  1B6S A;  3R5H A;  5BPF A;  4I55 F;  5JVL A;  1Z2O X;  4C5C A;  1DV2 A;  1EUD B;  2W6N A;  4TUY F;  5KX5 F;  3ORR A;  4I4T F;  1EZ1 A;  3K5H A;  5BPH A;  2P0A A;  4L1K A;  5JQG F;  4O4I F;  2R87 A;  4XX0 B;  4YJ3 F;  2FPP B;  1OBG A;  2NU7 B;  1IOW A;  2GLT A;  2YWV A;  3UFX B;  2R6F A;  2HJW A;  2YW2 A;  1I7L A;  2DIK A;  2YZN A;  2R7K A;  4QSH A;  5D8D A;  5LOV F;  3OUZ A;  5K2M A;  1GLV A;  4RZQ A;  1EYZ A;  2Z04 A;  4FU0 A;  3TIG A;  2HGS A;  4I50 F;  3U9S A;  1I7N A;  3Q2O A;  4HQ6 A;  3VPB A;  3VPD A;  1ULZ A;  4MV3 A;  4O7R A;  4O2A F;  4C5A A;  3ORQ A;  1GSA A;  2VQD A;  1IOV A;  5KKN B;  4O7Y A;  4O7T A;  3JZF A;  2NU9 B;  3TQT A;  2ZDQ A;  2FPI B;  2R85 A;  2GQS A;  3ETJ A;  2GPS A;  4YAJ B;  1EHI A;  1C3O A;  1CQJ B;  3JZI A;  4EGJ A;  2SCU B;  2FP4 B;  2QF7 A;  4EG0 A;  5J2T F;  4MV6 A;  3KAK A;  3RV3 A;  1KJQ A;  3VOT A;  2Z02 A;  5C8Y F;  3RV4 A;  5C1O A;  4XYM B;  3SE7 A;  1W93 A;  1SCU B;  3U54 A;  2W6M A;  5BMV F;  4O4H F;  1AUV A;  1JDE A;  1KUT A;  4DLK A;  1VKZ A;  2R7N A;  3U9T A;  1CE8 A;  2R7M A;  4O7Z A;  2R7L A;  1B6R A;  4YBZ B;  2W6O A;  3GID A;  3VMM A;  5CA0 F;  1M6V A;  4O7W A;  1M0T A;  4MV8 A;  4C5B A;  4XYL B;  1UC9 A;  4WD3 A;  4TV8 F;  2FB9 A;  2R84 A;  1M0W A;  5EZY F;  5FNV F;  2I8C A;  3WNZ A;  3V4S A;  4TV9 F;  2V59 A;  5CAE B;  2YRW A;  3R9R A;  2DLN A;  3AW8 A;  4ME6 A;  1W96 A;  4FGR A;  4O7V A;  4ZI7 F;  1KJ9 A;  3KAL A;  4O7L A;  4MV9 A;  2W71 A;  2W6P A;  3HBL A;  1Z2P X;  1PX2 A;  3VA7 A;  1KJI A;  4O2B F;  3WO1 A;  3RUP A;  3JRW A;  2WYO A;  1A9X A;  2CQY A;  5I47 A;  4O7S A;  4EGQ A;  3R5F A;  3QFF A;  3TII A;  2W6Z A;  2YS7 A;  2R86 A;  4O86 A;  2CZG A;  2CNQ A;  4O7N A;  4O83 A;  2I80 A;  2XD4 A;  4YAK B;  2YZL A;  3I12 A;  3G8D A;  2YS6 A;  4O84 A;  2NU8 B;  5JVD F;  3DF7 A;  2NU6 B;  5LP6 F;  3MJF A;  3GLK A;  1GSO A;  3RFC A;  3N8D A;  4HNU A;  3N6R A;  4WBN F;  4DIM A;  5J2U F;  3R23 A; 
#chains in the Genus database with same CATH topology
 1S9F A;  4LFB H;  4DR1 H;  2NUA B;  4IRC A;  5C44 G;  5DGI A;  4DUZ H;  1BXR A;  5DQG A;  4QIW E;  1L2Z A;  2ATL A;  5LMU H;  4YR3 A;  4J9N A;  4CC5 A;  5DIS C;  5E25 A;  3TY9 A;  1KBL A;  3G8C A;  2QYZ A;  1EUC B;  1ZQ7 A;  5JUM A;  4GKK H;  4FE2 A;  4YR0 A;  4IIJ F;  1XK5 A;  4PBC A;  5CE8 A;  4J9Q A;  3PZP A;  4F4W A;  4MA0 A;  3PN1 A;  3J81 W;  2YZG A;  3T9A A;  2R8I A;  1V9P A;  3GTL A;  2R93 G;  2W9B B;  3Q1K A;  4HR7 A;  3UQ8 A;  4A3L G;  5KS8 A;  2Y0S A;  4JI8 H;  5DG8 A;  4M9U A;  1TA8 A;  4QWB A;  5KT2 A;  2UUB H;  2JEF A;  5JH7 F;  2OLS A;  4M0J A;  3T54 A;  5KFY A;  2PVP A;  4DL6 A;  2X5R A;  2GQR A;  2FLL A;  1XNR H;  3H3V H;  3FKI A;  4IHJ F;  2PBZ A;  4E4T A;  2PMZ E;  4RB2 C;  4IWX A;  3HXL A;  2R92 A;  4A3C G;  5CB4 F;  4YB8 B;  3MWE A;  2DAB A;  5HBR B;  4F4Z A;  4O3N A;  2W7P A;  2JEJ A;  4ZQI A;  5DGH A;  2UUA H;  1PK8 A;  3DTF A;  3G6V A;  1JKJ B;  4MA5 A;  4IAJ A;  1HNZ H;  3HT5 A;  2BR0 A;  1BNC A;  3HO8 A;  2XCL A;  3V4Z A;  3M9O B;  2DPJ A;  5BWT A;  1OBD A;  2YYA A;  4FFP A;  2CNU A;  1FKA H;  4O82 A;  5IP9 G;  3OHB A;  3GTK A;  3JAM W;  4FS2 A;  4QJF A;  3S24 A;  3R5X A;  2QB5 A;  5KFV A;  3G6Y A;  4O3Q A;  4A3B G;  4MAM A;  2KSW A;  1CKN B;  3N6X A;  1A48 A;  3KRE A;  4NXM H;  4CC6 A;  4GLX A;  4YHH H;  4HYK A;  4IR9 A;  4JXU A;  2ASD A;  4M7E A;  5KT5 A;  5C1P A;  3KAJ A;  1P16 A;  2J9G A;  1FVI A;  3W5O A;  5KFN A;  4YQW A;  4ECR A;  1JX4 A;  4RAY A;  4RU9 A;  2R8G A;  1CQI B;  1JLL B;  3W1B A;  5BWX A;  2FK3 A;  2VUM G;  3WWI A;  4QW9 A;  5BYA A;  3TW6 A;  3VPC A;  5KFM A;  3QZ8 A;  3T9B A;  3PW4 A;  1AUX A;  5CA1 F;  2YL2 A;  5BWU A;  3TIN A;  3T9C A;  4EFB A;  3M9M B;  1FJG H;  3JRX A;  3K3V A;  2V9W A;  5DMX A;  4NYE A;  5DAA A;  2FK1 A;  3OSN A;  3OUU A;  4AYB A;  1Y14 B;  3KXY T;  1VBH A;  2DZD A;  1SEI A;  4KHP H;  2GPW A;  3BAB A;  4FFL A;  4DV5 H;  2AGP A;  2R82 A;  4ED1 A;  3OHA A;  4FM9 A;  2ALZ A;  4X62 H;  2Q2U A;  4CKE A;  2UU9 H;  3MFH A;  2WB1 A;  4DR5 H;  3U55 A;  4EEQ A;  4JV5 H;  4I7H A;  1KTA A;  1GO3 E;  4IR1 A;  2RF4 A;  3KHL A;  3GIL A;  4LFC H;  4JI6 H;  4FFN A;  5JQW A;  4ECU A;  3MR3 A;  4ED0 A;  3BG5 A;  3EPG A;  3J7A K;  4FFR A;  5FPR A;  5I5Y A;  3KHR A;  3BA8 A;  5LXT F;  5H80 A;  1V4Y A;  3GII A;  2XC9 A;  2A1H A;  3HKZ E;  4K6N A;  4AQY H;  2V5A A;  2YRX A;  1XNQ H;  2C00 A;  3AX6 A;  3KTM A;  2VQE H;  4NZN A;  2WDT A;  3HOY G;  3OTO H;  1E4E A;  4BY1 G;  4Q4C A;  3RB6 A;  4JV1 A;  1RJR A;  2YZM A;  3JSN A;  3H4B A;  2FPG B;  2Q7D A;  3WO0 A;  2VOB A;  4DV6 H;  4DL7 A;  1DV1 A;  4K0K H;  1B33 N;  1OWT A;  1O75 A;  1UC8 A;  4NZM A;  4O4J F;  1KEE A;  4YP3 A;  1DIK A;  3BAA A;  2VR1 A;  4IWY A;  4ZHQ F;  5HV6 A;  1WR2 A;  1TWG A;  3MFI A;  1G2W A;  1GGO A;  1T94 A;  3K3P A;  2FK2 A;  1K1S A;  4CMD A;  1VBG A;  3AYH B;  4A2B A;  2JA5 G;  1KJJ A;  4MV1 A;  1N33 H;  1S0N A;  3NUA A;  4UCR A;  4HNT A;  4UFZ A;  4QIW A;  5I5V A;  1KJ8 A;  4Q43 A;  2I87 A;  2FKL A;  2AU0 A;  2OH2 A;  4R8U A;  4ED8 A;  4A3D G;  2E2I A;  2JEG A;  1DGS A;  4MV4 A;  1E4F T;  3PW5 A;  2ZDG A;  4JV2 A;  2WAQ E;  1S10 A;  4UCV A;  4X65 H;  1C30 A;  4B3R H;  3GDE A;  1N48 A;  1S0O A;  4FFM A;  4ZOL F;  3M9N B;  5L9X A;  3CSW A;  4IZO A;  5L1L A;  4O3S A;  5IYZ F;  5GON F;  3HB9 A;  3W1G A;  4A3F G;  3LP8 A;  3LWB A;  2YU9 A;  3NC0 B;  3TW7 A;  2HDK A;  1Z2N X;  5KFS A;  5KFQ A;  4J9O A;  5IWA H;  4J0M A;  1ZHS A;  3H0G G;  3MR6 A;  2AGQ A;  2M05 A;  4O81 A;  5KG6 A;  2W9C A;  1I1L A;  3PR4 A;  2CNV A;  2VQF H;  3K5I A;  1I50 A;  2W6Q A;  1ZAU A;  2IP4 A;  2ZDH A;  4TQR A;  2VUM A;  2EJ0 A;  3BAC A;  3PW0 A;  4PDB A;  3QQM A;  5LYJ F;  2YCH A;  5D1P A;  3GIP A;  1CS0 A;  3E5N A;  3L4K A;  5KFG A;  3RIZ A;  2ZJT A;  2C2R A;  1DAA A;  2VPQ A;  1JDB B;  2X0S A;  4MV7 A;  4HNV A;  1EKV A;  2C2E A;  4C2M A;  2UXB H;  2V58 A;  4EBE A;  4YJ2 F;  2XIG A;  3T99 A;  3RGX A;  5EWF A;  4ECZ A;  2VPS A;  1KC7 A;  3CQZ A;  3GTP A;  4XZ3 B;  1J5E H;  1GSH A;  3RF2 A;  1HNX H;  3KHH A;  5KT4 A;  2Q2T A;  4DUY H;  2DWC A;  2R8K A;  2HGX A;  2QK4 A;  2W70 A;  5KFC A;  4RUA A;  3GIM A;  3BQ2 A;  4NLG A;  3ETH A;  5IYD G;  3UZB A;  2HHF B;  3EPI A;  4J9R A;  4FFO A;  5LA6 F;  1VAJ A;  3GV5 B;  4A3E G;  3M4I A;  5FLX W;  5DGB A;  3PW2 A;  4F4Y A;  5D1O B;  2O03 A;  5KFT A;  1CKM A;  1WSC A;  4O4L F;  4TM5 A;  5KG4 A;  1HR0 H;  1T36 A;  1I2L A;  1E4E B;  2PN1 A;  3PR5 B;  4EBC A;  3T5J A;  2JA8 G;  3MWD A;  4PZ6 A;  4UCU A;  1JXL A;  4Y8V B;  3HOZ G;  1B6S A;  2COJ A;  4A3I G;  2DPI A;  3WWH A;  5I5X A;  2EJ2 A;  3R5H A;  5IYB G;  2CW7 A;  5BPF A;  4I55 F;  2UXC H;  3GTG A;  5JVL A;  4BBR G;  1Z2O X;  4C5C A;  1XMO H;  3RB4 A;  1TWA A;  5FD6 A;  2JA5 A;  3H20 A;  4A3G G;  4Q44 A;  1DV2 A;  4ED6 A;  1EUD B;  4E6N A;  2W6N A;  4R8U B;  4GC7 A;  4YY3 H;  1ZET A;  4Q8E A;  4G3I A;  4TUY F;  5C4X G;  2UVR A;  2HIV A;  5KX5 F;  5KG2 A;  1AN7 A;  3GTJ A;  4I4T F;  2ODT X;  1EZ1 A;  2VUG A;  3ORR A;  4ECW A;  1K83 A;  4FBT A;  3HOU G;  2E2H A;  2FJZ A;  2C2D A;  3K5H A;  5BPH A;  2V4Q A;  3EYY A;  3IG0 A;  3RGZ A;  1RK5 A;  2P0A A;  2RGV A;  5C3E G;  4JI1 H;  5KFZ A;  2FLP A;  2JA7 G;  4L1K A;  3L2P A;  1TAE A;  5I5U A;  4O4I F;  5JQG F;  2R87 A;  5BYB A;  4DV7 H;  3PW7 A;  1HNW H;  4XX0 B;  4YJ3 F;  4ECV A;  3RBD A;  1V51 A;  2FPP B;  2HIX A;  1Y1V G;  1OBG A;  4DV1 H;  2NU7 B;  1IOW A;  3MR2 A;  3UZO A;  2GLT A;  2YWV A;  3UFX B;  1RJQ A;  3MWM A;  2XCA A;  3GQC A;  2R6F A;  2HJW A;  2YW2 A;  5KFW A;  2HG8 A;  1I7L A;  5KFE A;  5FJ8 G;  1RYR A;  1N34 H;  4BWS C;  4B3M H;  2Y0S E;  5KT7 A;  2DIK A;  2YZN A;  2R7K A;  4QSH A;  5D8D A;  5LOV F;  3OUZ A;  2MCT A;  2CFM A;  1WCM G;  4QWA A;  4EQ5 A;  5K2M A;  2AGO A;  5BR8 H;  1GLV A;  4ED7 A;  5EDW A;  1IBK H;  1EYZ A;  4RZQ A;  4DL3 A;  2Z04 A;  4FU0 A;  2HGS A;  4I50 F;  3TIG A;  3U9S A;  5KFF A;  2FMA A;  1I7N A;  5KT6 A;  1Y1W G;  1BGW A;  4BY7 G;  3Q2O A;  4O3P A;  2R8H A;  3Q8R B;  4HQ6 A;  3VPD A;  3VPB A;  4CHI A;  4DL2 A;  5FD5 A;  2COI A;  1ULZ A;  4MV3 A;  5DQH A;  2R93 A;  4O7R A;  4O2A F;  4C5A A;  2IA6 A;  3ORQ A;  1E4G T;  2CKZ B;  4F4X A;  5KFO A;  2B63 G;  4EFE A;  4Q8F A;  3GJX B;  3PO3 G;  4O3R A;  1GSA A;  1I1M A;  2VQD A;  3N43 B;  3GIJ A;  2W9A A;  1IOV A;  5KKN B;  4O7Y A;  4O7T A;  4JV0 A;  4RB3 C;  4RNN A;  3HOX G;  3JZF A;  2DAA A;  2NU9 B;  1XMQ H;  1I6U A;  4IRD A;  3TQT A;  1VS0 A;  5KG5 A;  2ZDQ A;  3FDS A;  4UCT A;  2FPI B;  2R85 A;  5F9N A;  2GQS A;  3ETJ A;  3N44 B;  1WH2 A;  2GPS A;  4JI4 H;  4YAJ B;  1M7J A;  1IYE A;  1EHI A;  3FKI G;  1C3O A;  4TQS A;  1CQJ B;  2R92 G;  5IT9 W;  4DR2 H;  4DR4 H;  5FPO A;  3JZI A;  4JI0 H;  4EGJ A;  2SCU B;  3LML A;  3DAA A;  3RBE A;  2FP4 B;  2QF7 A;  3CVZ A;  4LSA A;  5DGA A;  4LF5 H;  2UUC H;  4BBS G;  4JYA H;  5KFP A;  4EG0 A;  2NVY A;  3CEB A;  5J2T F;  4MV6 A;  3KAK A;  4AYB E;  4U6P A;  4YR2 A;  4JI3 H;  5KFJ A;  3T1Y H;  5K3W A;  3FMA A;  5BWV A;  2PMZ A;  2RGR A;  3RV3 A;  5KFK A;  1KJQ A;  3DTG A;  3VOT A;  3WWJ A;  3BQ0 A;  3QZ7 A;  2JA7 A;  5CR5 A;  1TWC A;  2WB1 E;  1RYS A;  2Z02 A;  5L1J A;  1RJP A;  4UCO A;  5C8Y F;  1X9N A;  3RV4 A;  1CKN A;  1XDN A;  4UCS A;  4APM A;  4QWE A;  5C1O A;  2BQU A;  4DL4 A;  3RJ0 A;  4XYM B;  4ECY A;  2CW8 A;  4NXN H;  2COG A;  2RDI A;  4B3T H;  2J6T A;  3SE7 A;  3H4D A;  1W93 A;  5BWW A;  3GIQ A;  4JUZ A;  2UVU A;  1SCU B;  3U54 A;  1N32 H;  3UYY A;  1N56 A;  2W6M A;  4J9P A;  5BMV F;  3GV7 B;  4O3O A;  4O4H F;  2AQ4 A;  1T3N A;  5BWR A;  4ETS A;  3KHG A;  5L1I A;  1AUV A;  1JDE A;  1KUT A;  3NBY B;  4RNO A;  2FE3 A;  3J80 W;  5KFH A;  4JI7 H;  4DLK A;  1VKZ A;  2E5L H;  2XGP A;  3N42 B;  1N36 H;  2R7N A;  3U9T A;  5KFI A;  1CE8 A;  2R7M A;  2W57 A;  4LF8 H;  4O7Z A;  2R7L A;  2C28 A;  2VA3 A;  5FLM G;  1B6R A;  4YBZ B;  3H40 A;  1I94 H;  5DQI A;  5T14 A;  2W6O A;  4R7R A;  3GID A;  3U0G A;  2B63 A;  3L4J A;  3GB8 B;  3PVX A;  1I1K A;  3LUL A;  3VMM A;  5CA0 F;  4MTD A;  5KG3 A;  2BQR A;  4JI5 H;  4GLW A;  2XGQ A;  4EEY A;  1A0G A;  2Y4R A;  2W8K A;  4A93 G;  1M6V A;  3QWU A;  5EWG A;  2J6U A;  4ED3 A;  4O7W A;  3TQ1 A;  1ZHQ A;  2WTF A;  2JA6 G;  4Q0Y A;  4DV3 H;  1M0T A;  4DQN A;  3RB3 A;  4DRF A;  4MV8 A;  3TY5 A;  4XYL B;  4C5B A;  3G6X A;  4J9S A;  1UC9 A;  4WD3 A;  2WE6 A;  4JI2 H;  4LF6 H;  4CE5 A;  3JZ6 A;  5KFA A;  4CKC A;  4TV8 F;  2UVV A;  2FB9 A;  2R84 A;  4DV0 H;  4EYH B;  1M0W A;  3T9D A;  3BJY A;  4UUG A;  2ASJ A;  1MZB A;  2OWO A;  5EZY F;  3OSP A;  3KYH C;  3GTM A;  5FNV F;  3T5H A;  2W8L A;  3Q8P B;  2C22 A;  1S68 A;  4DR7 H;  5KFU A;  2XCP A;  3HKZ A;  5FR9 A;  2I8C A;  4J9L A;  3RAQ A;  1SFO A;  3WNZ A;  4B3S H;  3NBZ B;  3V4S A;  4PZ7 A;  2R7Z G;  3H0G A;  2ABJ A;  2W9C B;  3LQS A;  4TV9 F;  1I3Q A;  2V59 A;  2V4R A;  4OX9 H;  3N40 P;  2FLN A;  3HOV G;  3SNO A;  5CAE B;  2YRW A;  3R9R A;  2DLN A;  3AW8 A;  4ME6 A;  3IN5 A;  2J6S A;  1W96 A;  1UNN C;  1B04 A;  4HN2 A;  4RUC A;  2F4V H;  3TEK A;  4FGR A;  4O7V A;  3RAX A;  4ZI7 F;  1GYF A;  5I5S A;  5KG1 A;  1KJ9 A;  4RNM A;  1EKF A;  3T1H H;  4A3J G;  2IBK A;  5DLG A;  4CMF A;  3KAL A;  1S0M A;  5I5W A;  4O7L A;  4MV9 A;  1TWF A;  2W71 A;  2WAQ A;  1A3G A;  1BJT A;  5I5T A;  5EWE A;  2W6P A;  1CKO A;  3HBL A;  4LF9 H;  5KG0 A;  2NVX A;  2C35 B;  2JEI A;  5KT3 A;  3GTO A;  5KG7 A;  1Z2P X;  5KFX A;  4Q45 A;  5IYC G;  3BQ1 A;  4QWD A;  5KFD A;  3MR5 A;  4LF4 H;  1P8L A;  1K1Q A;  4A3M G;  5IP7 G;  4A3K G;  3SI8 A;  1PX2 A;  3VA7 A;  1IBM H;  4LMY A;  1WRV A;  4F50 A;  1KJI A;  4DAA A;  4O2B F;  2EIY A;  3TY8 A;  4X64 H;  1IBL H;  5LL6 b;  5CM0 A;  4QWC A;  2HVS A;  2VA2 A;  3GIK A;  3WO1 A;  5KFR A;  3T7A A;  3RUP A;  4J9M A;  3V6H A;  2IMW P;  2UVW A;  2W9B A;  4FS1 A;  3JRW A;  4CKB A;  3I4M G;  4Q4D A;  1TWH A;  5KFB A;  1S97 A;  2HHF A;  2BQ3 A;  2EJ3 A;  4U7C A;  4RZR A;  1EKP A;  2WYO A;  2ZGI A;  5KFL A;  5F9L A;  2RDJ A;  4DV4 H;  2R8J A;  4RAZ A;  1A9X A;  5D1O A;  3GTQ A;  4RB0 A;  4TVI A;  4BXX G;  4PWQ A;  4RCN A;  1SYX B;  5I47 A;  2CQY A;  4O7S A;  2ZM6 H;  4EBD A;  4IRK A;  4EYI B;  2JA6 A;  4NZO A;  4EGQ A;  3R5F A;  3T9F A;  3VNN A;  4GC6 A;  5DG7 A;  3QFF A;  3TII A;  5A2Q W;  2W6Z A;  2YS7 A;  2R86 A;  4ECX A;  4RB1 A;  3PO2 G;  5C5J A;  2HHH H;  4O86 A;  4X66 H;  2CZG A;  4ED2 A;  3T9E A;  4FBU A;  4LFA H;  2CNQ A;  4O7N A;  3HOW G;  2HVQ A;  4O83 A;  1A0I A;  2I80 A;  2HVR A;  2XD4 A;  4DL5 A;  3Q8S B;  5DG9 A;  3T5L A;  5LMN H;  4YAK B;  1I2K A;  2YZL A;  3I12 A;  1IYD A;  2YS6 A;  3G8D A;  4O84 A;  5I60 A;  1RK6 A;  4LSX A;  4DV2 H;  2NU8 B;  3JSL A;  4WHX A;  3RB0 A;  4DR6 H;  3N41 B;  5EOY A;  4ECT A;  5JVD F;  5DLF A;  3BA9 A;  3DF7 A;  2R7Z A;  3SGI A;  2NU6 B;  3V6K A;  3T5K A;  5LP6 F;  3MJF A;  3PFF A;  3GLK A;  4LH7 A;  1Y1V A;  1GSO A;  1R9T A;  2W7O A;  1JIH A;  4DR3 H;  1S03 G;  3C0F B;  4ECQ A;  4PZ8 A;  3RFC A;  4MTE A;  4LH6 A;  3F8N A;  4J9K A;  3I4N G;  4LF7 H;  3N8D A;  2ASL A;  3RR5 A;  4HNU A;  3N6R A;  3NGD A;  4ECS A;  4QW8 A;  3GV8 B;  1WCM A;  3V6J A;  4GKJ H;  4A2A A;  4WBN F;  4DIM A;  1Y1W A;  3RTX A;  1ET0 A;  5L1K A;  3Q8Q B;  2UXD H;  1KT8 A;  5J2U F;  5HNE A;  3R23 A;  2HGW A; 
#chains in the Genus database with same CATH homology
 2NUA B;  1BXR A;  1KBL A;  3G8C A;  1EUC B;  4FE2 A;  4IIJ F;  4MA0 A;  2YZG A;  3Q1K A;  4HR7 A;  4M9U A;  5JH7 F;  2OLS A;  2PVP A;  2GQR A;  4IHJ F;  2PBZ A;  4E4T A;  4IWX A;  5CB4 F;  4YB8 B;  3MWE A;  5HBR B;  4ZQI A;  1PK8 A;  1JKJ B;  4MA5 A;  1BNC A;  3HO8 A;  2XCL A;  3V4Z A;  1OBD A;  2YYA A;  4FFP A;  2CNU A;  4O82 A;  3R5X A;  4MAM A;  1A48 A;  3KRE A;  5C1P A;  3KAJ A;  2J9G A;  1CQI B;  1JLL B;  3TW6 A;  3VPC A;  1AUX A;  5CA1 F;  2YL2 A;  3TIN A;  3JRX A;  5DMX A;  4NYE A;  3OUU A;  1VBH A;  2DZD A;  2GPW A;  4FFL A;  2R82 A;  3U55 A;  4FFN A;  5JQW A;  3BG5 A;  4FFR A;  5LXT F;  5H80 A;  2V5A A;  2YRX A;  2C00 A;  3AX6 A;  1E4E A;  2YZM A;  2FPG B;  3WO0 A;  1DV1 A;  1KEE A;  4O4J F;  1UC8 A;  1DIK A;  4ZHQ F;  2VR1 A;  4IWY A;  5HV6 A;  1WR2 A;  1GGO A;  3K3P A;  1VBG A;  1KJJ A;  4MV1 A;  3NUA A;  4HNT A;  1KJ8 A;  2I87 A;  4MV4 A;  2ZDG A;  1C30 A;  4FFM A;  4ZOL F;  4IZO A;  5IYZ F;  5GON F;  3HB9 A;  3LP8 A;  3LWB A;  1Z2N X;  4O81 A;  2CNV A;  3K5I A;  2W6Q A;  2IP4 A;  2ZDH A;  5LYJ F;  1CS0 A;  3E5N A;  2VPQ A;  2X0S A;  1JDB B;  4MV7 A;  4HNV A;  2V58 A;  4YJ2 F;  1KC7 A;  4XZ3 B;  1GSH A;  2DWC A;  2W70 A;  2QK4 A;  3ETH A;  4FFO A;  5LA6 F;  4O4L F;  1T36 A;  1E4E B;  2PN1 A;  3MWD A;  4Y8V B;  1B6S A;  3R5H A;  5BPF A;  4I55 F;  5JVL A;  1Z2O X;  4C5C A;  1DV2 A;  1EUD B;  2W6N A;  4TUY F;  5KX5 F;  3ORR A;  4I4T F;  1EZ1 A;  3K5H A;  5BPH A;  2P0A A;  4L1K A;  5JQG F;  4O4I F;  2R87 A;  4XX0 B;  4YJ3 F;  2FPP B;  1OBG A;  2NU7 B;  1IOW A;  2GLT A;  2YWV A;  3UFX B;  2R6F A;  2HJW A;  2YW2 A;  1I7L A;  2DIK A;  2YZN A;  2R7K A;  4QSH A;  5D8D A;  5LOV F;  3OUZ A;  5K2M A;  1GLV A;  4RZQ A;  1EYZ A;  2Z04 A;  4FU0 A;  3TIG A;  2HGS A;  4I50 F;  3U9S A;  1I7N A;  3Q2O A;  4HQ6 A;  3VPB A;  3VPD A;  1ULZ A;  4MV3 A;  4O7R A;  4O2A F;  4C5A A;  3ORQ A;  1GSA A;  2VQD A;  1IOV A;  5KKN B;  4O7Y A;  4O7T A;  3JZF A;  2NU9 B;  3TQT A;  2ZDQ A;  2FPI B;  2R85 A;  2GQS A;  3ETJ A;  2GPS A;  4YAJ B;  1EHI A;  1C3O A;  1CQJ B;  3JZI A;  4EGJ A;  2SCU B;  2FP4 B;  2QF7 A;  4EG0 A;  5J2T F;  4MV6 A;  3KAK A;  3RV3 A;  1KJQ A;  3VOT A;  2Z02 A;  5C8Y F;  3RV4 A;  5C1O A;  4XYM B;  3SE7 A;  1W93 A;  1SCU B;  3U54 A;  2W6M A;  5BMV F;  4O4H F;  1AUV A;  1JDE A;  1KUT A;  4DLK A;  1VKZ A;  2R7N A;  3U9T A;  1CE8 A;  2R7M A;  4O7Z A;  2R7L A;  1B6R A;  4YBZ B;  2W6O A;  3GID A;  3VMM A;  5CA0 F;  1M6V A;  4O7W A;  1M0T A;  4MV8 A;  4C5B A;  4XYL B;  1UC9 A;  4WD3 A;  4TV8 F;  2FB9 A;  2R84 A;  1M0W A;  5EZY F;  5FNV F;  2I8C A;  3WNZ A;  3V4S A;  4TV9 F;  2V59 A;  5CAE B;  2YRW A;  3R9R A;  2DLN A;  3AW8 A;  4ME6 A;  1W96 A;  4FGR A;  4O7V A;  4ZI7 F;  1KJ9 A;  3KAL A;  4O7L A;  4MV9 A;  2W71 A;  2W6P A;  3HBL A;  1Z2P X;  1PX2 A;  3VA7 A;  1KJI A;  4O2B F;  3WO1 A;  3RUP A;  3JRW A;  2WYO A;  1A9X A;  2CQY A;  5I47 A;  4O7S A;  4EGQ A;  3R5F A;  3QFF A;  3TII A;  2W6Z A;  2YS7 A;  2R86 A;  4O86 A;  2CZG A;  2CNQ A;  4O7N A;  4O83 A;  2I80 A;  2XD4 A;  4YAK B;  2YZL A;  3I12 A;  3G8D A;  2YS6 A;  4O84 A;  2NU8 B;  5JVD F;  3DF7 A;  2NU6 B;  5LP6 F;  3MJF A;  3GLK A;  1GSO A;  3RFC A;  3N8D A;  4HNU A;  3N6R A;  4WBN F;  4DIM A;  5J2U F;  3R23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...