4XYMB

Ca. korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 in complex with coenzyme a, ca-ampcp and hgcl+
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
229
structure length
229
Chain Sequence
SSRDLLLKAKENGRKSLLEHEAKYFISSYGIPVTNIRLAKSEEEAVNFSREIGFPVVLKIVSPQVVHKSDVGGVKVNLRSEEEVRKAYREIIENVKRNVPNAEIEGILVQEFAPPGVELIIGLLRDPQFGPTVMFGLGGVFVELFRDVSFRVAPLSEQDAESMIKEVKAYKLLTGFRGMEPVDIEAIKDALIRAGRIGVENEEIAEMDLNPVIAYPKGIKVVDARIILR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha subunit of Acyl-CoA synthetase (NDP forming)
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Korarchaeum cryptofilum (strain opf8)
molecule tags Ligase
total genus 73
structure length 229
sequence length 229
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13549 ATP-grasp_5 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4xymB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4xymB02
5BPFA 4XYLB 2GQSA 3MWEA 5LOVF 1M6VA 2YZLA 3JRXA 2DLNA 2YRWA 4O7LA 2DIKA 4RZQA 1VBGA 2FPPB 2I8CA 1KJ8A 2YL2A 4HQ6A 2V5AA 2XD4A 5JQGF 3WO0A 2CQYA 1VKZA 4DLKA 1OBDA 2YZGA 1KJIA 4YAJB 3R23A 3Q1KA 4O2BF 1JDBB 2R7LA 1GGOA 5LYJF 5LA6F 4HNTA 3VOTA 2GPSA 2YS7A 1T36A 4FU0A 1EHIA 3JZIA 4EGQA 1DV2A 4C5AA 2W6OA 3KREA 3R5FA 5C8YF 4MV8A 4L1KA 4ZQIA 1KJJA 3U55A 2R84A 1UC8A 2OLSA 4ZOLF 3GIDA 4MAMA 2ZDGA 4MV1A 5CA1F 2C00A 3U9SA 1BNCA 5HV6A 3R5XA 4O7YA 1KUTA 5LP6F 1M0WA 4IIJF 3RFCA 2R6FA 4FFRA 4O86A 4IWXA 1DV1A 1M0TA 4MV3A 1W96A 1PX2A 1JKJB 3TW6A 2GPWA 1C30A 4FFPA 2CNVA 2PBZA 2R87A 4O7SA 3U9TA 5J2UF 2P0AA 1KEEA 2CNUA 2YZNA 1GSOA 1B6RA 5BMVF 3R5HA 1PK8A 2ZDHA 2I80A 3G8DA 4O7TA 2XCLA 5K2MA 1KBLA 1IOVA 2YYAA 2NU8B 5JH7F 4O81A 4O7WA 5LXTF 5J2TF 5CAEB 3K5IA 3JZFA 3K5HA 1CE8A 1CQJB 3VPBA 2R7NA 3RUPA 3GLKA 3K3PA 2W6ZA 3N8DA 5CB4F 1IOWA 2NUAB 4IHJF 4TV8F 4YBZB 4QSHA 1A48A 2V58A 2FPGB 5I47A 1I7NA 4I4TF 1C3OA 2R82A 2NU6B 1GLVA 5H80A 3Q2OA 2W70A 2VPQA 3TQTA 4FFLA 4MV7A 2GQRA 5EZYF 1UC9A 5CA0F 2YW2A 2WYOA 3ETHA 5BPHA 1EUCB 3JRWA 4XZ3B 3MWDA 2QF7A 3HBLA 5JQWA 3KAJA 1KJ9A 2V59A 2DWCA 2VR1A 2FB9A 3WO1A 4O4JF 2YRXA 2NU9B 4O7ZA 3TIIA 3MJFA 4E4TA 2IP4A 4ME6A 1ULZA 3U54A 4O7NA 2W6NA 2W71A 4HNVA 4XX0B 3ORRA 2PN1A 2Z04A 4WBNF 2R7KA 4C5BA 4IWYA 4O4IF 4TUYF 4O82A 3OUZA 3VMMA 5GONF 3BG5A 1EUDB 2R85A 4EGJA 2FP4B 3VA7A 4FFOA 1BXRA 1W93A 3AX6A 1KJQA 1KC7A 4FE2A 4DIMA 5DMXA 1I7LA 3TIGA 1VBHA 3ETJA 4WD3A 2YZMA 3ORQA 4MA0A 2DZDA 4HNUA 3KAKA 2HGSA 3UFXB 3HB9A 3V4ZA 4ZHQF 2VQDA 2GLTA 2FPIB 3LWBA 4TV9F 4O4HF 4MV4A 4O84A 4O7VA 2R7MA 2PVPA 5D8DA 3KALA 3R9RA 1EYZA 2CNQA 4YJ2F 1JDEA 5C1PA 3WNZA 4FGRA 3TINA 2J9GA 4FFNA 4I55F 1Z2NX 4NYEA 4M9UA 4FFMA 3V4SA 2W6PA 3AW8A 5IYZF 1CS0A 5C1OA 3VPDA 4C5CA 2SCUB 2NU7B 3E5NA 3OUUA 4I50F 1AUVA 1GSAA 4YB8B 1SCUB 1WR2A 2QK4A 5JVDF 4MV9A 4O2AF 4Y8VB 1B6SA 1JLLB 3DF7A 3LP8A 1DIKA 1Z2OX 5KKNB 4O4LF 3QFFA 4MV6A 1A9XA 2YWVA 3NUAA 3VPCA 1AUXA 4XYMB 3RV3A 1CQIB 2YS6A 5KX5F 4HR7A 3G8CA 1OBGA 3N6RA 3RV4A 3SE7A 2CZGA 4ZI7F 2X0SA 4IZOA 3HO8A 4O7RA 2Z02A 3I12A 4O83A 2W6QA 5JVLA 4EG0A 2HJWA 1E4EA 4YJ3F 1Z2PX 4MA5A 5FNVF 1E4EB 4YAKB 5HBRB 2I87A 1EZ1A 2ZDQA 2W6MA 1GSHA 2R86A
chains in the Genus database with same CATH superfamily
2HHHH 2E2IA 5L1IA 2NVYA 5BPFA 4XYLB 3SGIA 1I94H 4FM9A 2GQSA 3MWEA 4EFBA 5LOVF 5FLXW 1M6VA 5F9NA 1XMQH 2R8IA 1IBMH 4ECRA 3T9CA 2YZLA 5DQGA 5I5TA 3JRXA 2FJZA 2DLNA 2YRWA 2V9WA 1N36H 4AYBA 4A93G 1I2LA 4O7LA 2COJA 2XGQA 3PW4A 2DIKA 3KTMA 4BBSG 4RZQA 4EBDA 1VBGA 2FPPB 2I8CA 1KJ8A 2YL2A 3FMAA 5KT6A 4ECUA 3IN5A 4HQ6A 4F4XA 4NXNH 2V5AA 2XD4A 2DABA 3WO0A 5JQGF 2W9AA 3GTJA 2CQYA 3PZPA 1VKZA 2VOBA 5KFQA 4M7EA 4DLKA 4ECTA 1OBDA 4A3MG 4HN2A 1E4GT 3UYYA 1I2KA 1X9NA 2YZGA 1XNRH 1KJIA 4YAJB 5I5VA 1JIHA 3KYHC 4Q43A 4FS1A 4B3TH 5DQIA 5BWVA 2VPSA 2X5RA 3T1HH 3R23A 4A3EG 1FJGH 3Q1KA 4DL7A 4O2BF 4Q4CA 1GO3E 3GIQA 1ET0A 3J80W 1TA8A 1JDBB 2QB5A 2R7LA 2F4VH 3RBDA 4DV6H 3TY8A 1GGOA 5LYJF 3UQ8A 1RK5A 1Y1WA 2FLPA 2AU0A 5LA6F 3T9DA 4UCSA 3T5LA 4KHPH 4HNTA 3VOTA 2GPSA 2YS7A 2UVUA 3GIKA 1T36A 4FU0A 5DAAA 5KS8A 4NXMH 4HYKA 1EHIA 4UCVA 3JZIA 1EKFA 4EGQA 1DV2A 2Y0SE 1ZETA 1V9PA 4LF9H 4ED8A 5C4XG 1CKOA 4C5AA 3NGDA 2W6OA 3KREA 2RGRA 3R5FA 5D1PA 4JI5H 5C8YF 1A3GA 4MV8A 3PVXA 4L1KA 4ZQIA 4O3PA 3RAQA 1ZHSA 2WAQE 1KJJA 4CMDA 2R7ZG 5KG1A 4DV0H 3T5KA 1FKAH 4ECYA 2AGPA 3U55A 2XC9A 1I1LA 4LSAA 2R84A 2WB1A 3N6XA 5FLMG 5KFVA 1UC8A 4DR4H 2OLSA 2W57A 4ZOLF 3UZOA 4CHIA 3GIDA 3J7AK 4MAMA 2ZDGA 4MV1A 5CA1F 5KG0A 3QZ7A 4JUZA 2C00A 4J0MA 3U9SA 3C0FB 1BNCA 5HV6A 4DV3H 3R5XA 4QWEA 4O7YA 4Q8FA 2R8GA 4BXXG 1IYDA 1KUTA 3VNNA 5KG4A 1N34H 4NLGA 3H20A 5LP6F 3RB0A 3MFIA 1M0WA 1RYSA 4B3MH 3DAAA 4IIJF 5K3WA 3RFCA 3BA8A 4RB3C 4O3NA 2R6FA 5IYCG 4DR1H 3T99A 4RAZA 1V4YA 4DV7H 4FFRA 2R93G 3KHRA 4OX9H 4Q44A 4O86A 4WHXA 3GTOA 4IWXA 2E5LH 1DV1A 1WCMA 2HGXA 2WDTA 1M0TA 5KFIA 4MV3A 5C3EG 2DPIA 5BWWA 1W96A 5EWGA 3H0GA 4EBEA 1PX2A 3RGXA 4JV5H 1TAEA 4YQWA 3PO2G 1JKJB 3UZBA 4UUGA 3GV7B 3QQMA 3TW6A 4RU9A 5C44G 3BQ2A 2GPWA 2FK1A 2UXCH 2E2HA 1C30A 1XDNA 2CNVA 2PBZA 4FFPA 5DGIA 5I5SA 2HVRA 2W8LA 1V51A 2R87A 1N56A 4O7SA 4LH6A 3DTFA 3HKZA 3L2PA 4AQYH 2UXDH 1RJPA 3U9TA 2HVQA 3PR5B 5J2UF 5FD6A 3GTLA 2P0AA 4GLXA 4BY7G 4R7RA 3Q8PB 3GIPA 4IRDA 4DUYH 5I5YA 1KEEA 2M05A 4A3FG 2CNUA 4K6NA 1TWFA 2YZNA 3HKZE 3HOUG 1IBLH 2JA8G 4A3DG 3GTPA 2HVSA 1GSOA 3S24A 3RB3A 1B6RA 4B3RH 5BMVF 3PR4A 2RDJA 2IBKA 3R5HA 4F50A 1PK8A 3BA9A 2ZDHA 4J9NA 3JZ6A 2EIYA 4J9SA 5BWUA 2I80A 3G8DA 4O7TA 1UNNC 2XCLA 5D1OA 5DGBA 1K1QA 3T1YH 1I1MA 5K2MA 4J9QA 1XNQH 1KBLA 5E25A 2QYZA 3RAXA 1IOVA 1IBKH 4YY3H 3GQCA 2WE6A 5D1OB 2YYAA 2J6UA 4EYIB 5HNEA 2NU8B 4CC5A 5JH7F 5KFZA 3OHBA 4O81A 4O7WA 5LXTF 3M4IA 3QWUA 4TVIA 5J2TF 4MTDA 4DR5H 1S0MA 5CAEB 3K5IA 3JZFA 3K5HA 4JV0A 1P8LA 4ED7A 3BQ1A 1CE8A 1SYXB 1CQJB 3VPBA 4A2AA 5FD5A 2R7NA 3RUPA 1J5EH 2ASDA 2C2DA 4DL2A 2AGQA 2UUCH 3GLKA 4F4YA 4LF5H 3K3PA 2W6ZA 3N8DA 3F8NA 4DV5H 3HOWG 3PW7A 5KT4A 5LMUH 5KFAA 5CB4F 2XCPA 2Y4RA 2R7ZA 4J9PA 4ECXA 1IOWA 5KFHA 2NUAB 3LQSA 2JA5A 2W9CA 5DGAA 2AQ4A 1L2ZA 4IHJF 1BGWA 5DQHA 1ZAUA 4TV8F 4YBZB 1XMOH 4UCTA 1S03G 3PO3G 3RF2A 4IR1A 1K83A 5BYAA 3M9NB 1IYEA 4QSHA 1A48A 1SEIA 4R8UA 1ZQ7A 5A2QW 2W9CB 2V4QA 5LMNH 2UVRA 2MCTA 4B3SH 2Y0SA 2V58A 1T94A 5DG8A 4R8UB 3KHHA 4IR9A 2FPGB 4YP3A 2W8KA 3M9OB 4LF4H 2RGVA 1S68A 1I7NA 5I47A 4I4TF 3CEBA 5KFXA 4JI3H 5LL6b 4DR7H 1C3OA 2R82A 4E6NA 2CW7A 5BWRA 2WAQA 3H3VH 2NU6B 4DL5A 1FVIA 1GLVA 5H80A 2HHFA 3N42B 5DLGA 1S0OA 3N43B 3T7AA 3Q2OA 4RB1A 2XCAA 2W70A 3HOZG 2VPQA 2BQUA 4LF6H 3TQTA 3TQ1A 5F9LA 5IT9W 4DR2H 4TM5A 2HHFB 4FFLA 4MV7A 3TY9A 4U6PA 3V6JA 5KFPA 4EEQA 2GQRA 5EZYF 4O3RA 1UC9A 5CA0F 2YW2A 4X65H 3GV8B 4GC7A 2JA6G 2WYOA 5KFUA 4JV2A 4A3IG 2W9BA 3ETHA 3TEKA 4PZ6A 5BPHA 4ED1A 1JX4A 1EUCB 1KT8A 3RIZA 4CKEA 5CE8A 3JRWA 5EDWA 4XZ3B 2W9BB 3GV5B 3L4JA 3G6VA 3J81W 4DR6H 5EOYA 3MWDA 2QF7A 3HBLA 4LMYA 2J6SA 5JQWA 3KAJA 4QWAA 2VUMA 1GYFA 1KJ9A 2V59A 2PMZA 2ASJA 5KT7A 4QWDA 2DWCA 5DG9A 2VR1A 3L4KA 2VQEH 2C35B 2HIXA 4YHHH 1K1SA 3MR2A 3HXLA 3N40P 3JAMW 2FB9A 3WO1A 2PMZE 4YR2A 4A3JG 4QWCA 4O4JF 4DL3A 3NBYB 4IAJA 4RAYA 4ECVA 4JI6H 4CE5A 5IWAH 2YRXA 4MTEA 4FS2A 5BYBA 2EJ2A 2VUGA 4JXUA 4RUAA 1T3NA 2ZJTA 3MR5A 4J9LA 3T5HA 2NU9B 2OWOA 2BR0A 2ABJA 4O7ZA 3TIIA 4QIWE 1Y1WG 3MJFA 5I5WA 1VAJA 1Y1VG 5KT5A 2B63G 3TY5A 4E4TA 4ED3A 1HNXH 2IP4A 1SFOA 1BJTA 4ME6A 1B33N 4UCUA 4UCRA 1TWAA 2FMAA 1TWHA 4DR3H 2JEFA 4RNOA 5KFYA 4JI1H 2UUBH 1B04A 4X62H 4JI7H 1ULZA 2HIVA 1CKMA 4DV4H 2FK3A 2BQRA 2R93A 2BQ3A 3GJXB 3RGZA 5DISC 3U54A 1E4FT 4O7NA 3T54A 2W6NA 2C28A 2W71A 2R92G 4HNVA 4XX0B 3ORRA 2PN1A 2Z04A 5DLFA 2HGWA 3RBEA 4X64H 3FKIG 2ALZA 4ECZA 4DQNA 4WBNF 1HNWH 2NVXA 3G6YA 3HOYG 3JSLA 3TW7A 4PWQA 5KFWA 5KFFA 2R7KA 4C5BA 4NZNA 4IWYA 4O4IF 4CKCA 3KXYT 4QJFA 4YR0A 3Q8RB 1S0NA 4CKBA 2J6TA 4LFBH 1S9FA 4TUYF 4A3CG 4O82A 3OUZA 3VMMA 3OSNA 3HT5A 2IA6A 5GONF 4ECSA 5JUMA 3BG5A 1EUDB 5KFDA 2R8JA 5FPRA 5KFCA 3BQ0A 2R85A 1O75A 3MWMA 3KHLA 3RB6A 2XIGA 1VS0A 4EGJA 2FP4B 2CKZB 3Q8QB 3MR6A 4TQRA 3VA7A 3OSPA 3EPGA 4RCNA 4GKKH 2DPJA 3W1BA 4QW8A 4FFOA 5KFSA 1BXRA 1A0IA 5KFOA 4PDBA 3M9MB 1W93A 3AX6A 2KSWA 1KJQA 3V6HA 5KG3A 3SNOA 3PW0A 2JA7G 4BWSC 5I5UA 1KC7A 2YCHA 4BY1G 4EBCA 3CQZA 4FE2A 4DIMA 5DMXA 3RTXA 4RB0A 1I7LA 3TIGA 1VBHA 3T9EA 2VQFH 4NZOA 3ETJA 3GIJA 2R8HA 3RB4A 3WWJA 4WD3A 3HOXG 5L1LA 2COIA 3KHGA 3GB8B 1KTAA 4LFCH 2YZMA 5IP9G 2JA6A 3ORQA 3CSWA 4GLWA 2YU9A 4FBTA 4F4ZA 4MA0A 2CFMA 2DZDA 4Q4DA 4HNUA 4EFEA 4JI2H 3H4DA 2ATLA 3KAKA 2HGSA 2C2RA 1WSCA 4NZMA 3UFXB 1JXLA 3HB9A 4QWBA 5KFRA 4X66H 3V4ZA 4A3GG 4A2BA 2UVWA 4ZHQF 1R9TA 4LH7A 2GLTA 2VQDA 3GDEA 4JI8H 2FPIB 3LWBA 1N32H 1P16A 4TV9F 1TWGA 4QW9A 1S97A 2HG8A 3GTGA 2DAAA 4O4HF 3EPIA 4MV4A 1WH2A 1I50A 3BACA 2Q2TA 4K0KH 4O84A 4BBRG 4O7VA 1DGSA 1MZBA 4AYBE 2OH2A 5BR8H 3T5JA 2R7MA 2PVPA 3LMLA 5D8DA 4EQ5A 2EJ0A 3PW2A 2VA2A 3KALA 5I60A 3R9RA 4O3QA 3GILA 4ED6A 1EYZA 2CNQA 5KFEA 4J9MA 3GIIA 1Y14B 3V6KA 4DL6A 4YJ2F 1JDEA 3I4NG 5KT3A 5C1PA 2UU9H 3T9BA 1N33H 3T9FA 3WNZA 2Q7DA 4FGRA 5CR5A 1HR0H 3TINA 4F4WA 1Y1VA 4A3KG 3GTKA 2B63A 1RYRA 3GTQA 2ASLA 4DRFA 2J9GA 5DGHA 4FBUA 4FFNA 5KFKA 3JSNA 5BWTA 2Q2UA 4I55F 5KG6A 1Z2NX 4NYEA 4M9UA 4PZ7A 1ZHQA 4RNNA 4FFMA 3V4SA 4RUCA 3Q8SB 3H40A 4PBCA 3K3VA 2ODTX 3N44B 4TQSA 4G3IA 4GKJH 2W6PA 3AW8A 5IYZF 1CS0A 3PW5A 5KFBA 5KFTA 5C1OA 3VPDA 1M7JA 4C5CA 3N41B 4ECQA 4JI4H 4O3SA 1G2WA 2SCUB 3FDSA 1I3QA 2NU7B 2ZM6H 3BABA 3SI8A 2R92A 1EKPA 2JA5G 1WRVA 3E5NA 3OUUA 3CVZA 3FKIA 4I50F 4QIWA 1S10A 2C2EA 3HOVG 2FE3A 3EYYA 1AUVA 1CKNA 1GSAA 3OHAA 3NC0B 4A3BG 4LSXA 5KT2A 4ETSA 4ECWA 2JEGA 4A3LG 4YB8B 4ED2A 4Q8EA 4GC6A 1SCUB 2EJ3A 1WR2A 2CW8A 1CKNB 2QK4A 5JVDF 4DL4A 5DG7A 4CMFA 5FJ8G 3MR3A 4J9RA 4UCOA 3WWIA 4I7HA 2VA3A 2R8KA 4LF8H 3BAAA 2WB1E 4EYHB 4MV9A 4O2AF 2JEJA 2VUMG 4JYAH 3W5OA 5KFNA 3AYHB 1RJQA 3MFHA 2FLNA 5IP7G 3NBZB 5I5XA 4YR3A 1XK5A 4Y8VB 4J9OA 2FLLA 1B6SA 2ZGIA 1AN7A 3RJ0A 1JLLB 4DV1H 3U0GA 3DTGA 1RK6A 3DF7A 3LP8A 4DUZH 3QZ8A 3IG0A 4DAAA 4ED0A 1DIKA 4LFAH 1Z2OX 5KKNB 5IYBG 3I4MG 2W7OA 4DV2H 1DAAA 4C2MA 4O4LF 5C5JA 5KG5A 4APMA 3QFFA 4MV6A 2XGPA 4PZ8A 5T14A 5L1KA 4M0JA 2JA7A 2AGOA 2A1HA 1A9XA 2YWVA 4O3OA 4RZRA 2UXBH 2RF4A 3NUAA 3VPCA 3LULA 4JI0H 1AUXA 4LF7H 4XYMB 5KFGA 4RB2C 3RV3A 5L1JA 1CQIB 2COGA 2YS6A 4CC6A 1EKVA 4RNMA 1I1KA 2IMWP 2O03A 5KX5F 4HR7A 2JEIA 3H4BA 5L9XA 1I6UA 3G8CA 1OBGA 3N6RA 3RV4A 1RJRA 4EEYA 5KFLA 1TWCA 3RR5A 4IRCA 3SE7A 2CZGA 4ZI7F 4U7CA 4Q45A 2X0SA 4IZOA 5FPOA 3W1GA 2WTFA 2C22A 2UVVA 3GIMA 1N48A 3HO8A 3T9AA 5KFJA 2W7PA 4O7RA 3G6XA 2Z02A 3I12A 4O83A 5BWXA 2W6QA 5JVLA 2V4RA 3BJYA 1OWTA 4Q0YA 5KG2A 4EG0A 3OTOH 2HJWA 1A0GA 1E4EA 2HDKA 3GTMA 4YJ3F 1Z2PX 1WCMG 4UFZA 4MA5A 5FNVF 1E4EB 4IRKA 2RDIA 3PFFA 5FR9A 5CM0A 3H0GG 4YAKB 2FKLA 2UUAH 4JV1A 5KFMA 5HBRB 5EWFA 2I87A 1EZ1A 1HNZH 2ZDQA 5EWEA 2W6MA 1GSHA 3WWHA 5KG7A 4J9KA 2R86A 3PN1A 2FK2A 5IYDG
chains in the Genus database with same CATH topology
5BPFA 4XYLB 2GQSA 3MWEA 5LOVF 1M6VA 2YZLA 3JRXA 2DLNA 2YRWA 4O7LA 2DIKA 4RZQA 1VBGA 2FPPB 2I8CA 1KJ8A 2YL2A 4HQ6A 2V5AA 2XD4A 5JQGF 3WO0A 2CQYA 1VKZA 4DLKA 1OBDA 2YZGA 1KJIA 4YAJB 3R23A 3Q1KA 4O2BF 1JDBB 2R7LA 1GGOA 5LYJF 5LA6F 4HNTA 3VOTA 2GPSA 2YS7A 1T36A 4FU0A 1EHIA 3JZIA 4EGQA 1DV2A 4C5AA 2W6OA 3KREA 3R5FA 5C8YF 4MV8A 4L1KA 4ZQIA 1KJJA 3U55A 2R84A 1UC8A 2OLSA 4ZOLF 3GIDA 4MAMA 2ZDGA 4MV1A 5CA1F 2C00A 3U9SA 1BNCA 5HV6A 3R5XA 4O7YA 1KUTA 5LP6F 1M0WA 4IIJF 3RFCA 2R6FA 4FFRA 4O86A 4IWXA 1DV1A 1M0TA 4MV3A 1W96A 1PX2A 1JKJB 3TW6A 2GPWA 1C30A 4FFPA 2CNVA 2PBZA 2R87A 4O7SA 3U9TA 5J2UF 2P0AA 1KEEA 2CNUA 2YZNA 1GSOA 1B6RA 5BMVF 3R5HA 1PK8A 2ZDHA 2I80A 3G8DA 4O7TA 2XCLA 5K2MA 1KBLA 1IOVA 2YYAA 2NU8B 5JH7F 4O81A 4O7WA 5LXTF 5J2TF 5CAEB 3K5IA 3JZFA 3K5HA 1CE8A 1CQJB 3VPBA 2R7NA 3RUPA 3GLKA 3K3PA 2W6ZA 3N8DA 5CB4F 1IOWA 2NUAB 4IHJF 4TV8F 4YBZB 4QSHA 1A48A 2V58A 2FPGB 5I47A 1I7NA 4I4TF 1C3OA 2R82A 2NU6B 1GLVA 5H80A 3Q2OA 2W70A 2VPQA 3TQTA 4FFLA 4MV7A 2GQRA 5EZYF 1UC9A 5CA0F 2YW2A 2WYOA 3ETHA 5BPHA 1EUCB 3JRWA 4XZ3B 3MWDA 2QF7A 3HBLA 5JQWA 3KAJA 1KJ9A 2V59A 2DWCA 2VR1A 2FB9A 3WO1A 4O4JF 2YRXA 2NU9B 4O7ZA 3TIIA 3MJFA 4E4TA 2IP4A 4ME6A 1ULZA 3U54A 4O7NA 2W6NA 2W71A 4HNVA 4XX0B 3ORRA 2PN1A 2Z04A 4WBNF 2R7KA 4C5BA 4IWYA 4O4IF 4TUYF 4O82A 3OUZA 3VMMA 5GONF 3BG5A 1EUDB 2R85A 4EGJA 2FP4B 3VA7A 4FFOA 1BXRA 1W93A 3AX6A 1KJQA 1KC7A 4FE2A 4DIMA 5DMXA 1I7LA 3TIGA 1VBHA 3ETJA 4WD3A 2YZMA 3ORQA 4MA0A 2DZDA 4HNUA 3KAKA 2HGSA 3UFXB 3HB9A 3V4ZA 4ZHQF 2VQDA 2GLTA 2FPIB 3LWBA 4TV9F 4O4HF 4MV4A 4O84A 4O7VA 2R7MA 2PVPA 5D8DA 3KALA 3R9RA 1EYZA 2CNQA 4YJ2F 1JDEA 5C1PA 3WNZA 4FGRA 3TINA 2J9GA 4FFNA 4I55F 1Z2NX 4NYEA 4M9UA 4FFMA 3V4SA 2W6PA 3AW8A 5IYZF 1CS0A 5C1OA 3VPDA 4C5CA 2SCUB 2NU7B 3E5NA 3OUUA 4I50F 1AUVA 1GSAA 4YB8B 1SCUB 1WR2A 2QK4A 5JVDF 4MV9A 4O2AF 4Y8VB 1B6SA 1JLLB 3DF7A 3LP8A 1DIKA 1Z2OX 5KKNB 4O4LF 3QFFA 4MV6A 1A9XA 2YWVA 3NUAA 3VPCA 1AUXA 4XYMB 3RV3A 1CQIB 2YS6A 5KX5F 4HR7A 3G8CA 1OBGA 3N6RA 3RV4A 3SE7A 2CZGA 4ZI7F 2X0SA 4IZOA 3HO8A 4O7RA 2Z02A 3I12A 4O83A 2W6QA 5JVLA 4EG0A 2HJWA 1E4EA 4YJ3F 1Z2PX 4MA5A 5FNVF 1E4EB 4YAKB 5HBRB 2I87A 1EZ1A 2ZDQA 2W6MA 1GSHA 2R86A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BPF A;  4XYL B;  2GQS A;  3MWE A;  5LOV F;  1M6V A;  2YZL A;  3JRX A;  2DLN A;  2YRW A;  4O7L A;  2DIK A;  4RZQ A;  1VBG A;  2FPP B;  2I8C A;  1KJ8 A;  2YL2 A;  4HQ6 A;  2V5A A;  2XD4 A;  5JQG F;  3WO0 A;  2CQY A;  1VKZ A;  4DLK A;  1OBD A;  2YZG A;  1KJI A;  4YAJ B;  3R23 A;  3Q1K A;  4O2B F;  1JDB B;  2R7L A;  1GGO A;  5LYJ F;  5LA6 F;  4HNT A;  3VOT A;  2GPS A;  2YS7 A;  1T36 A;  4FU0 A;  1EHI A;  3JZI A;  4EGQ A;  1DV2 A;  4C5A A;  2W6O A;  3KRE A;  3R5F A;  5C8Y F;  4MV8 A;  4L1K A;  4ZQI A;  1KJJ A;  3U55 A;  2R84 A;  1UC8 A;  2OLS A;  4ZOL F;  3GID A;  4MAM A;  2ZDG A;  4MV1 A;  5CA1 F;  2C00 A;  3U9S A;  1BNC A;  5HV6 A;  3R5X A;  4O7Y A;  1KUT A;  5LP6 F;  1M0W A;  4IIJ F;  3RFC A;  2R6F A;  4FFR A;  4O86 A;  4IWX A;  1DV1 A;  1M0T A;  4MV3 A;  1W96 A;  1PX2 A;  1JKJ B;  3TW6 A;  2GPW A;  1C30 A;  4FFP A;  2CNV A;  2PBZ A;  2R87 A;  4O7S A;  3U9T A;  5J2U F;  2P0A A;  1KEE A;  2CNU A;  2YZN A;  1GSO A;  1B6R A;  5BMV F;  3R5H A;  1PK8 A;  2ZDH A;  2I80 A;  3G8D A;  4O7T A;  2XCL A;  5K2M A;  1KBL A;  1IOV A;  2YYA A;  2NU8 B;  5JH7 F;  4O81 A;  4O7W A;  5LXT F;  5J2T F;  5CAE B;  3K5I A;  3JZF A;  3K5H A;  1CE8 A;  1CQJ B;  3VPB A;  2R7N A;  3RUP A;  3GLK A;  3K3P A;  2W6Z A;  3N8D A;  5CB4 F;  1IOW A;  2NUA B;  4IHJ F;  4TV8 F;  4YBZ B;  4QSH A;  1A48 A;  2V58 A;  2FPG B;  5I47 A;  1I7N A;  4I4T F;  1C3O A;  2R82 A;  2NU6 B;  1GLV A;  5H80 A;  3Q2O A;  2W70 A;  2VPQ A;  3TQT A;  4FFL A;  4MV7 A;  2GQR A;  5EZY F;  1UC9 A;  5CA0 F;  2YW2 A;  2WYO A;  3ETH A;  5BPH A;  1EUC B;  3JRW A;  4XZ3 B;  3MWD A;  2QF7 A;  3HBL A;  5JQW A;  3KAJ A;  1KJ9 A;  2V59 A;  2DWC A;  2VR1 A;  2FB9 A;  3WO1 A;  4O4J F;  2YRX A;  2NU9 B;  4O7Z A;  3TII A;  3MJF A;  4E4T A;  2IP4 A;  4ME6 A;  1ULZ A;  3U54 A;  4O7N A;  2W6N A;  2W71 A;  4HNV A;  4XX0 B;  3ORR A;  2PN1 A;  2Z04 A;  4WBN F;  2R7K A;  4C5B A;  4IWY A;  4O4I F;  4TUY F;  4O82 A;  3OUZ A;  3VMM A;  5GON F;  3BG5 A;  1EUD B;  2R85 A;  4EGJ A;  2FP4 B;  3VA7 A;  4FFO A;  1BXR A;  1W93 A;  3AX6 A;  1KJQ A;  1KC7 A;  4FE2 A;  4DIM A;  5DMX A;  1I7L A;  3TIG A;  1VBH A;  3ETJ A;  4WD3 A;  2YZM A;  3ORQ A;  4MA0 A;  2DZD A;  4HNU A;  3KAK A;  2HGS A;  3UFX B;  3HB9 A;  3V4Z A;  4ZHQ F;  2VQD A;  2GLT A;  2FPI B;  3LWB A;  4TV9 F;  4O4H F;  4MV4 A;  4O84 A;  4O7V A;  2R7M A;  2PVP A;  5D8D A;  3KAL A;  3R9R A;  1EYZ A;  2CNQ A;  4YJ2 F;  1JDE A;  5C1P A;  3WNZ A;  4FGR A;  3TIN A;  2J9G A;  4FFN A;  4I55 F;  1Z2N X;  4NYE A;  4M9U A;  4FFM A;  3V4S A;  2W6P A;  3AW8 A;  5IYZ F;  1CS0 A;  5C1O A;  3VPD A;  4C5C A;  2SCU B;  2NU7 B;  3E5N A;  3OUU A;  4I50 F;  1AUV A;  1GSA A;  4YB8 B;  1SCU B;  1WR2 A;  2QK4 A;  5JVD F;  4MV9 A;  4O2A F;  4Y8V B;  1B6S A;  1JLL B;  3DF7 A;  3LP8 A;  1DIK A;  1Z2O X;  5KKN B;  4O4L F;  3QFF A;  4MV6 A;  1A9X A;  2YWV A;  3NUA A;  3VPC A;  1AUX A;  4XYM B;  3RV3 A;  1CQI B;  2YS6 A;  5KX5 F;  4HR7 A;  3G8C A;  1OBG A;  3N6R A;  3RV4 A;  3SE7 A;  2CZG A;  4ZI7 F;  2X0S A;  4IZO A;  3HO8 A;  4O7R A;  2Z02 A;  3I12 A;  4O83 A;  2W6Q A;  5JVL A;  4EG0 A;  2HJW A;  1E4E A;  4YJ3 F;  1Z2P X;  4MA5 A;  5FNV F;  1E4E B;  4YAK B;  5HBR B;  2I87 A;  1EZ1 A;  2ZDQ A;  2W6M A;  1GSH A;  2R86 A; 
#chains in the Genus database with same CATH topology
 2HHH H;  2E2I A;  5L1I A;  2NVY A;  5BPF A;  4XYL B;  3SGI A;  1I94 H;  4FM9 A;  2GQS A;  3MWE A;  4EFB A;  5LOV F;  5FLX W;  1M6V A;  5F9N A;  1XMQ H;  2R8I A;  1IBM H;  4ECR A;  3T9C A;  2YZL A;  5DQG A;  5I5T A;  3JRX A;  2FJZ A;  2DLN A;  2YRW A;  2V9W A;  1N36 H;  4AYB A;  4A93 G;  1I2L A;  4O7L A;  2COJ A;  2XGQ A;  3PW4 A;  2DIK A;  3KTM A;  4BBS G;  4RZQ A;  4EBD A;  1VBG A;  2FPP B;  2I8C A;  1KJ8 A;  2YL2 A;  3FMA A;  5KT6 A;  4ECU A;  3IN5 A;  4HQ6 A;  4F4X A;  4NXN H;  2V5A A;  2XD4 A;  2DAB A;  3WO0 A;  5JQG F;  2W9A A;  3GTJ A;  2CQY A;  3PZP A;  1VKZ A;  2VOB A;  5KFQ A;  4M7E A;  4DLK A;  4ECT A;  1OBD A;  4A3M G;  4HN2 A;  1E4G T;  3UYY A;  1I2K A;  1X9N A;  2YZG A;  1XNR H;  1KJI A;  4YAJ B;  5I5V A;  1JIH A;  3KYH C;  4Q43 A;  4FS1 A;  4B3T H;  5DQI A;  5BWV A;  2VPS A;  2X5R A;  3T1H H;  3R23 A;  4A3E G;  1FJG H;  3Q1K A;  4DL7 A;  4O2B F;  4Q4C A;  1GO3 E;  3GIQ A;  1ET0 A;  3J80 W;  1TA8 A;  1JDB B;  2QB5 A;  2R7L A;  2F4V H;  3RBD A;  4DV6 H;  3TY8 A;  1GGO A;  5LYJ F;  3UQ8 A;  1RK5 A;  1Y1W A;  2FLP A;  2AU0 A;  5LA6 F;  3T9D A;  4UCS A;  3T5L A;  4KHP H;  4HNT A;  3VOT A;  2GPS A;  2YS7 A;  2UVU A;  3GIK A;  1T36 A;  4FU0 A;  5DAA A;  5KS8 A;  4NXM H;  4HYK A;  1EHI A;  4UCV A;  3JZI A;  1EKF A;  4EGQ A;  1DV2 A;  2Y0S E;  1ZET A;  1V9P A;  4LF9 H;  4ED8 A;  5C4X G;  1CKO A;  4C5A A;  3NGD A;  2W6O A;  3KRE A;  2RGR A;  3R5F A;  5D1P A;  4JI5 H;  5C8Y F;  1A3G A;  4MV8 A;  3PVX A;  4L1K A;  4ZQI A;  4O3P A;  3RAQ A;  1ZHS A;  2WAQ E;  1KJJ A;  4CMD A;  2R7Z G;  5KG1 A;  4DV0 H;  3T5K A;  1FKA H;  4ECY A;  2AGP A;  3U55 A;  2XC9 A;  1I1L A;  4LSA A;  2R84 A;  2WB1 A;  3N6X A;  5FLM G;  5KFV A;  1UC8 A;  4DR4 H;  2OLS A;  2W57 A;  4ZOL F;  3UZO A;  4CHI A;  3GID A;  3J7A K;  4MAM A;  2ZDG A;  4MV1 A;  5CA1 F;  5KG0 A;  3QZ7 A;  4JUZ A;  2C00 A;  4J0M A;  3U9S A;  3C0F B;  1BNC A;  5HV6 A;  4DV3 H;  3R5X A;  4QWE A;  4O7Y A;  4Q8F A;  2R8G A;  4BXX G;  1IYD A;  1KUT A;  3VNN A;  5KG4 A;  1N34 H;  4NLG A;  3H20 A;  5LP6 F;  3RB0 A;  3MFI A;  1M0W A;  1RYS A;  4B3M H;  3DAA A;  4IIJ F;  5K3W A;  3RFC A;  3BA8 A;  4RB3 C;  4O3N A;  2R6F A;  5IYC G;  4DR1 H;  3T99 A;  4RAZ A;  1V4Y A;  4DV7 H;  4FFR A;  2R93 G;  3KHR A;  4OX9 H;  4Q44 A;  4O86 A;  4WHX A;  3GTO A;  4IWX A;  2E5L H;  1DV1 A;  1WCM A;  2HGX A;  2WDT A;  1M0T A;  5KFI A;  4MV3 A;  5C3E G;  2DPI A;  5BWW A;  1W96 A;  5EWG A;  3H0G A;  4EBE A;  1PX2 A;  3RGX A;  4JV5 H;  1TAE A;  4YQW A;  3PO2 G;  1JKJ B;  3UZB A;  4UUG A;  3GV7 B;  3QQM A;  3TW6 A;  4RU9 A;  5C44 G;  3BQ2 A;  2GPW A;  2FK1 A;  2UXC H;  2E2H A;  1C30 A;  1XDN A;  2CNV A;  2PBZ A;  4FFP A;  5DGI A;  5I5S A;  2HVR A;  2W8L A;  1V51 A;  2R87 A;  1N56 A;  4O7S A;  4LH6 A;  3DTF A;  3HKZ A;  3L2P A;  4AQY H;  2UXD H;  1RJP A;  3U9T A;  2HVQ A;  3PR5 B;  5J2U F;  5FD6 A;  3GTL A;  2P0A A;  4GLX A;  4BY7 G;  4R7R A;  3Q8P B;  3GIP A;  4IRD A;  4DUY H;  5I5Y A;  1KEE A;  2M05 A;  4A3F G;  2CNU A;  4K6N A;  1TWF A;  2YZN A;  3HKZ E;  3HOU G;  1IBL H;  2JA8 G;  4A3D G;  3GTP A;  2HVS A;  1GSO A;  3S24 A;  3RB3 A;  1B6R A;  4B3R H;  5BMV F;  3PR4 A;  2RDJ A;  2IBK A;  3R5H A;  4F50 A;  1PK8 A;  3BA9 A;  2ZDH A;  4J9N A;  3JZ6 A;  2EIY A;  4J9S A;  5BWU A;  2I80 A;  3G8D A;  4O7T A;  1UNN C;  2XCL A;  5D1O A;  5DGB A;  1K1Q A;  3T1Y H;  1I1M A;  5K2M A;  4J9Q A;  1XNQ H;  1KBL A;  5E25 A;  2QYZ A;  3RAX A;  1IOV A;  1IBK H;  4YY3 H;  3GQC A;  2WE6 A;  5D1O B;  2YYA A;  2J6U A;  4EYI B;  5HNE A;  2NU8 B;  4CC5 A;  5JH7 F;  5KFZ A;  3OHB A;  4O81 A;  4O7W A;  5LXT F;  3M4I A;  3QWU A;  4TVI A;  5J2T F;  4MTD A;  4DR5 H;  1S0M A;  5CAE B;  3K5I A;  3JZF A;  3K5H A;  4JV0 A;  1P8L A;  4ED7 A;  3BQ1 A;  1CE8 A;  1SYX B;  1CQJ B;  3VPB A;  4A2A A;  5FD5 A;  2R7N A;  3RUP A;  1J5E H;  2ASD A;  2C2D A;  4DL2 A;  2AGQ A;  2UUC H;  3GLK A;  4F4Y A;  4LF5 H;  3K3P A;  2W6Z A;  3N8D A;  3F8N A;  4DV5 H;  3HOW G;  3PW7 A;  5KT4 A;  5LMU H;  5KFA A;  5CB4 F;  2XCP A;  2Y4R A;  2R7Z A;  4J9P A;  4ECX A;  1IOW A;  5KFH A;  2NUA B;  3LQS A;  2JA5 A;  2W9C A;  5DGA A;  2AQ4 A;  1L2Z A;  4IHJ F;  1BGW A;  5DQH A;  1ZAU A;  4TV8 F;  4YBZ B;  1XMO H;  4UCT A;  1S03 G;  3PO3 G;  3RF2 A;  4IR1 A;  1K83 A;  5BYA A;  3M9N B;  1IYE A;  4QSH A;  1A48 A;  1SEI A;  4R8U A;  1ZQ7 A;  5A2Q W;  2W9C B;  2V4Q A;  5LMN H;  2UVR A;  2MCT A;  4B3S H;  2Y0S A;  2V58 A;  1T94 A;  5DG8 A;  4R8U B;  3KHH A;  4IR9 A;  2FPG B;  4YP3 A;  2W8K A;  3M9O B;  4LF4 H;  2RGV A;  1S68 A;  1I7N A;  5I47 A;  4I4T F;  3CEB A;  5KFX A;  4JI3 H;  5LL6 b;  4DR7 H;  1C3O A;  2R82 A;  4E6N A;  2CW7 A;  5BWR A;  2WAQ A;  3H3V H;  2NU6 B;  4DL5 A;  1FVI A;  1GLV A;  5H80 A;  2HHF A;  3N42 B;  5DLG A;  1S0O A;  3N43 B;  3T7A A;  3Q2O A;  4RB1 A;  2XCA A;  2W70 A;  3HOZ G;  2VPQ A;  2BQU A;  4LF6 H;  3TQT A;  3TQ1 A;  5F9L A;  5IT9 W;  4DR2 H;  4TM5 A;  2HHF B;  4FFL A;  4MV7 A;  3TY9 A;  4U6P A;  3V6J A;  5KFP A;  4EEQ A;  2GQR A;  5EZY F;  4O3R A;  1UC9 A;  5CA0 F;  2YW2 A;  4X65 H;  3GV8 B;  4GC7 A;  2JA6 G;  2WYO A;  5KFU A;  4JV2 A;  4A3I G;  2W9B A;  3ETH A;  3TEK A;  4PZ6 A;  5BPH A;  4ED1 A;  1JX4 A;  1EUC B;  1KT8 A;  3RIZ A;  4CKE A;  5CE8 A;  3JRW A;  5EDW A;  4XZ3 B;  2W9B B;  3GV5 B;  3L4J A;  3G6V A;  3J81 W;  4DR6 H;  5EOY A;  3MWD A;  2QF7 A;  3HBL A;  4LMY A;  2J6S A;  5JQW A;  3KAJ A;  4QWA A;  2VUM A;  1GYF A;  1KJ9 A;  2V59 A;  2PMZ A;  2ASJ A;  5KT7 A;  4QWD A;  2DWC A;  5DG9 A;  2VR1 A;  3L4K A;  2VQE H;  2C35 B;  2HIX A;  4YHH H;  1K1S A;  3MR2 A;  3HXL A;  3N40 P;  3JAM W;  2FB9 A;  3WO1 A;  2PMZ E;  4YR2 A;  4A3J G;  4QWC A;  4O4J F;  4DL3 A;  3NBY B;  4IAJ A;  4RAY A;  4ECV A;  4JI6 H;  4CE5 A;  5IWA H;  2YRX A;  4MTE A;  4FS2 A;  5BYB A;  2EJ2 A;  2VUG A;  4JXU A;  4RUA A;  1T3N A;  2ZJT A;  3MR5 A;  4J9L A;  3T5H A;  2NU9 B;  2OWO A;  2BR0 A;  2ABJ A;  4O7Z A;  3TII A;  4QIW E;  1Y1W G;  3MJF A;  5I5W A;  1VAJ A;  1Y1V G;  5KT5 A;  2B63 G;  3TY5 A;  4E4T A;  4ED3 A;  1HNX H;  2IP4 A;  1SFO A;  1BJT A;  4ME6 A;  1B33 N;  4UCU A;  4UCR A;  1TWA A;  2FMA A;  1TWH A;  4DR3 H;  2JEF A;  4RNO A;  5KFY A;  4JI1 H;  2UUB H;  1B04 A;  4X62 H;  4JI7 H;  1ULZ A;  2HIV A;  1CKM A;  4DV4 H;  2FK3 A;  2BQR A;  2R93 A;  2BQ3 A;  3GJX B;  3RGZ A;  5DIS C;  3U54 A;  1E4F T;  4O7N A;  3T54 A;  2W6N A;  2C28 A;  2W71 A;  2R92 G;  4HNV A;  4XX0 B;  3ORR A;  2PN1 A;  2Z04 A;  5DLF A;  2HGW A;  3RBE A;  4X64 H;  3FKI G;  2ALZ A;  4ECZ A;  4DQN A;  4WBN F;  1HNW H;  2NVX A;  3G6Y A;  3HOY G;  3JSL A;  3TW7 A;  4PWQ A;  5KFW A;  5KFF A;  2R7K A;  4C5B A;  4NZN A;  4IWY A;  4O4I F;  4CKC A;  3KXY T;  4QJF A;  4YR0 A;  3Q8R B;  1S0N A;  4CKB A;  2J6T A;  4LFB H;  1S9F A;  4TUY F;  4A3C G;  4O82 A;  3OUZ A;  3VMM A;  3OSN A;  3HT5 A;  2IA6 A;  5GON F;  4ECS A;  5JUM A;  3BG5 A;  1EUD B;  5KFD A;  2R8J A;  5FPR A;  5KFC A;  3BQ0 A;  2R85 A;  1O75 A;  3MWM A;  3KHL A;  3RB6 A;  2XIG A;  1VS0 A;  4EGJ A;  2FP4 B;  2CKZ B;  3Q8Q B;  3MR6 A;  4TQR A;  3VA7 A;  3OSP A;  3EPG A;  4RCN A;  4GKK H;  2DPJ A;  3W1B A;  4QW8 A;  4FFO A;  5KFS A;  1BXR A;  1A0I A;  5KFO A;  4PDB A;  3M9M B;  1W93 A;  3AX6 A;  2KSW A;  1KJQ A;  3V6H A;  5KG3 A;  3SNO A;  3PW0 A;  2JA7 G;  4BWS C;  5I5U A;  1KC7 A;  2YCH A;  4BY1 G;  4EBC A;  3CQZ A;  4FE2 A;  4DIM A;  5DMX A;  3RTX A;  4RB0 A;  1I7L A;  3TIG A;  1VBH A;  3T9E A;  2VQF H;  4NZO A;  3ETJ A;  3GIJ A;  2R8H A;  3RB4 A;  3WWJ A;  4WD3 A;  3HOX G;  5L1L A;  2COI A;  3KHG A;  3GB8 B;  1KTA A;  4LFC H;  2YZM A;  5IP9 G;  2JA6 A;  3ORQ A;  3CSW A;  4GLW A;  2YU9 A;  4FBT A;  4F4Z A;  4MA0 A;  2CFM A;  2DZD A;  4Q4D A;  4HNU A;  4EFE A;  4JI2 H;  3H4D A;  2ATL A;  3KAK A;  2HGS A;  2C2R A;  1WSC A;  4NZM A;  3UFX B;  1JXL A;  3HB9 A;  4QWB A;  5KFR A;  4X66 H;  3V4Z A;  4A3G G;  4A2B A;  2UVW A;  4ZHQ F;  1R9T A;  4LH7 A;  2GLT A;  2VQD A;  3GDE A;  4JI8 H;  2FPI B;  3LWB A;  1N32 H;  1P16 A;  4TV9 F;  1TWG A;  4QW9 A;  1S97 A;  2HG8 A;  3GTG A;  2DAA A;  4O4H F;  3EPI A;  4MV4 A;  1WH2 A;  1I50 A;  3BAC A;  2Q2T A;  4K0K H;  4O84 A;  4BBR G;  4O7V A;  1DGS A;  1MZB A;  4AYB E;  2OH2 A;  5BR8 H;  3T5J A;  2R7M A;  2PVP A;  3LML A;  5D8D A;  4EQ5 A;  2EJ0 A;  3PW2 A;  2VA2 A;  3KAL A;  5I60 A;  3R9R A;  4O3Q A;  3GIL A;  4ED6 A;  1EYZ A;  2CNQ A;  5KFE A;  4J9M A;  3GII A;  1Y14 B;  3V6K A;  4DL6 A;  4YJ2 F;  1JDE A;  3I4N G;  5KT3 A;  5C1P A;  2UU9 H;  3T9B A;  1N33 H;  3T9F A;  3WNZ A;  2Q7D A;  4FGR A;  5CR5 A;  1HR0 H;  3TIN A;  4F4W A;  1Y1V A;  4A3K G;  3GTK A;  2B63 A;  1RYR A;  3GTQ A;  2ASL A;  4DRF A;  2J9G A;  5DGH A;  4FBU A;  4FFN A;  5KFK A;  3JSN A;  5BWT A;  2Q2U A;  4I55 F;  5KG6 A;  1Z2N X;  4NYE A;  4M9U A;  4PZ7 A;  1ZHQ A;  4RNN A;  4FFM A;  3V4S A;  4RUC A;  3Q8S B;  3H40 A;  4PBC A;  3K3V A;  2ODT X;  3N44 B;  4TQS A;  4G3I A;  4GKJ H;  2W6P A;  3AW8 A;  5IYZ F;  1CS0 A;  3PW5 A;  5KFB A;  5KFT A;  5C1O A;  3VPD A;  1M7J A;  4C5C A;  3N41 B;  4ECQ A;  4JI4 H;  4O3S A;  1G2W A;  2SCU B;  3FDS A;  1I3Q A;  2NU7 B;  2ZM6 H;  3BAB A;  3SI8 A;  2R92 A;  1EKP A;  2JA5 G;  1WRV A;  3E5N A;  3OUU A;  3CVZ A;  3FKI A;  4I50 F;  4QIW A;  1S10 A;  2C2E A;  3HOV G;  2FE3 A;  3EYY A;  1AUV A;  1CKN A;  1GSA A;  3OHA A;  3NC0 B;  4A3B G;  4LSX A;  5KT2 A;  4ETS A;  4ECW A;  2JEG A;  4A3L G;  4YB8 B;  4ED2 A;  4Q8E A;  4GC6 A;  1SCU B;  2EJ3 A;  1WR2 A;  2CW8 A;  1CKN B;  2QK4 A;  5JVD F;  4DL4 A;  5DG7 A;  4CMF A;  5FJ8 G;  3MR3 A;  4J9R A;  4UCO A;  3WWI A;  4I7H A;  2VA3 A;  2R8K A;  4LF8 H;  3BAA A;  2WB1 E;  4EYH B;  4MV9 A;  4O2A F;  2JEJ A;  2VUM G;  4JYA H;  3W5O A;  5KFN A;  3AYH B;  1RJQ A;  3MFH A;  2FLN A;  5IP7 G;  3NBZ B;  5I5X A;  4YR3 A;  1XK5 A;  4Y8V B;  4J9O A;  2FLL A;  1B6S A;  2ZGI A;  1AN7 A;  3RJ0 A;  1JLL B;  4DV1 H;  3U0G A;  3DTG A;  1RK6 A;  3DF7 A;  3LP8 A;  4DUZ H;  3QZ8 A;  3IG0 A;  4DAA A;  4ED0 A;  1DIK A;  4LFA H;  1Z2O X;  5KKN B;  5IYB G;  3I4M G;  2W7O A;  4DV2 H;  1DAA A;  4C2M A;  4O4L F;  5C5J A;  5KG5 A;  4APM A;  3QFF A;  4MV6 A;  2XGP A;  4PZ8 A;  5T14 A;  5L1K A;  4M0J A;  2JA7 A;  2AGO A;  2A1H A;  1A9X A;  2YWV A;  4O3O A;  4RZR A;  2UXB H;  2RF4 A;  3NUA A;  3VPC A;  3LUL A;  4JI0 H;  1AUX A;  4LF7 H;  4XYM B;  5KFG A;  4RB2 C;  3RV3 A;  5L1J A;  1CQI B;  2COG A;  2YS6 A;  4CC6 A;  1EKV A;  4RNM A;  1I1K A;  2IMW P;  2O03 A;  5KX5 F;  4HR7 A;  2JEI A;  3H4B A;  5L9X A;  1I6U A;  3G8C A;  1OBG A;  3N6R A;  3RV4 A;  1RJR A;  4EEY A;  5KFL A;  1TWC A;  3RR5 A;  4IRC A;  3SE7 A;  2CZG A;  4ZI7 F;  4U7C A;  4Q45 A;  2X0S A;  4IZO A;  5FPO A;  3W1G A;  2WTF A;  2C22 A;  2UVV A;  3GIM A;  1N48 A;  3HO8 A;  3T9A A;  5KFJ A;  2W7P A;  4O7R A;  3G6X A;  2Z02 A;  3I12 A;  4O83 A;  5BWX A;  2W6Q A;  5JVL A;  2V4R A;  3BJY A;  1OWT A;  4Q0Y A;  5KG2 A;  4EG0 A;  3OTO H;  2HJW A;  1A0G A;  1E4E A;  2HDK A;  3GTM A;  4YJ3 F;  1Z2P X;  1WCM G;  4UFZ A;  4MA5 A;  5FNV F;  1E4E B;  4IRK A;  2RDI A;  3PFF A;  5FR9 A;  5CM0 A;  3H0G G;  4YAK B;  2FKL A;  2UUA H;  4JV1 A;  5KFM A;  5HBR B;  5EWF A;  2I87 A;  1EZ1 A;  1HNZ H;  2ZDQ A;  5EWE A;  2W6M A;  1GSH A;  3WWH A;  5KG7 A;  4J9K A;  2R86 A;  3PN1 A;  2FK2 A;  5IYD G; 
#chains in the Genus database with same CATH homology
 5BPF A;  4XYL B;  2GQS A;  3MWE A;  5LOV F;  1M6V A;  2YZL A;  3JRX A;  2DLN A;  2YRW A;  4O7L A;  2DIK A;  4RZQ A;  1VBG A;  2FPP B;  2I8C A;  1KJ8 A;  2YL2 A;  4HQ6 A;  2V5A A;  2XD4 A;  5JQG F;  3WO0 A;  2CQY A;  1VKZ A;  4DLK A;  1OBD A;  2YZG A;  1KJI A;  4YAJ B;  3R23 A;  3Q1K A;  4O2B F;  1JDB B;  2R7L A;  1GGO A;  5LYJ F;  5LA6 F;  4HNT A;  3VOT A;  2GPS A;  2YS7 A;  1T36 A;  4FU0 A;  1EHI A;  3JZI A;  4EGQ A;  1DV2 A;  4C5A A;  2W6O A;  3KRE A;  3R5F A;  5C8Y F;  4MV8 A;  4L1K A;  4ZQI A;  1KJJ A;  3U55 A;  2R84 A;  1UC8 A;  2OLS A;  4ZOL F;  3GID A;  4MAM A;  2ZDG A;  4MV1 A;  5CA1 F;  2C00 A;  3U9S A;  1BNC A;  5HV6 A;  3R5X A;  4O7Y A;  1KUT A;  5LP6 F;  1M0W A;  4IIJ F;  3RFC A;  2R6F A;  4FFR A;  4O86 A;  4IWX A;  1DV1 A;  1M0T A;  4MV3 A;  1W96 A;  1PX2 A;  1JKJ B;  3TW6 A;  2GPW A;  1C30 A;  4FFP A;  2CNV A;  2PBZ A;  2R87 A;  4O7S A;  3U9T A;  5J2U F;  2P0A A;  1KEE A;  2CNU A;  2YZN A;  1GSO A;  1B6R A;  5BMV F;  3R5H A;  1PK8 A;  2ZDH A;  2I80 A;  3G8D A;  4O7T A;  2XCL A;  5K2M A;  1KBL A;  1IOV A;  2YYA A;  2NU8 B;  5JH7 F;  4O81 A;  4O7W A;  5LXT F;  5J2T F;  5CAE B;  3K5I A;  3JZF A;  3K5H A;  1CE8 A;  1CQJ B;  3VPB A;  2R7N A;  3RUP A;  3GLK A;  3K3P A;  2W6Z A;  3N8D A;  5CB4 F;  1IOW A;  2NUA B;  4IHJ F;  4TV8 F;  4YBZ B;  4QSH A;  1A48 A;  2V58 A;  2FPG B;  5I47 A;  1I7N A;  4I4T F;  1C3O A;  2R82 A;  2NU6 B;  1GLV A;  5H80 A;  3Q2O A;  2W70 A;  2VPQ A;  3TQT A;  4FFL A;  4MV7 A;  2GQR A;  5EZY F;  1UC9 A;  5CA0 F;  2YW2 A;  2WYO A;  3ETH A;  5BPH A;  1EUC B;  3JRW A;  4XZ3 B;  3MWD A;  2QF7 A;  3HBL A;  5JQW A;  3KAJ A;  1KJ9 A;  2V59 A;  2DWC A;  2VR1 A;  2FB9 A;  3WO1 A;  4O4J F;  2YRX A;  2NU9 B;  4O7Z A;  3TII A;  3MJF A;  4E4T A;  2IP4 A;  4ME6 A;  1ULZ A;  3U54 A;  4O7N A;  2W6N A;  2W71 A;  4HNV A;  4XX0 B;  3ORR A;  2PN1 A;  2Z04 A;  4WBN F;  2R7K A;  4C5B A;  4IWY A;  4O4I F;  4TUY F;  4O82 A;  3OUZ A;  3VMM A;  5GON F;  3BG5 A;  1EUD B;  2R85 A;  4EGJ A;  2FP4 B;  3VA7 A;  4FFO A;  1BXR A;  1W93 A;  3AX6 A;  1KJQ A;  1KC7 A;  4FE2 A;  4DIM A;  5DMX A;  1I7L A;  3TIG A;  1VBH A;  3ETJ A;  4WD3 A;  2YZM A;  3ORQ A;  4MA0 A;  2DZD A;  4HNU A;  3KAK A;  2HGS A;  3UFX B;  3HB9 A;  3V4Z A;  4ZHQ F;  2VQD A;  2GLT A;  2FPI B;  3LWB A;  4TV9 F;  4O4H F;  4MV4 A;  4O84 A;  4O7V A;  2R7M A;  2PVP A;  5D8D A;  3KAL A;  3R9R A;  1EYZ A;  2CNQ A;  4YJ2 F;  1JDE A;  5C1P A;  3WNZ A;  4FGR A;  3TIN A;  2J9G A;  4FFN A;  4I55 F;  1Z2N X;  4NYE A;  4M9U A;  4FFM A;  3V4S A;  2W6P A;  3AW8 A;  5IYZ F;  1CS0 A;  5C1O A;  3VPD A;  4C5C A;  2SCU B;  2NU7 B;  3E5N A;  3OUU A;  4I50 F;  1AUV A;  1GSA A;  4YB8 B;  1SCU B;  1WR2 A;  2QK4 A;  5JVD F;  4MV9 A;  4O2A F;  4Y8V B;  1B6S A;  1JLL B;  3DF7 A;  3LP8 A;  1DIK A;  1Z2O X;  5KKN B;  4O4L F;  3QFF A;  4MV6 A;  1A9X A;  2YWV A;  3NUA A;  3VPC A;  1AUX A;  4XYM B;  3RV3 A;  1CQI B;  2YS6 A;  5KX5 F;  4HR7 A;  3G8C A;  1OBG A;  3N6R A;  3RV4 A;  3SE7 A;  2CZG A;  4ZI7 F;  2X0S A;  4IZO A;  3HO8 A;  4O7R A;  2Z02 A;  3I12 A;  4O83 A;  2W6Q A;  5JVL A;  4EG0 A;  2HJW A;  1E4E A;  4YJ3 F;  1Z2P X;  4MA5 A;  5FNV F;  1E4E B;  4YAK B;  5HBR B;  2I87 A;  1EZ1 A;  2ZDQ A;  2W6M A;  1GSH A;  2R86 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...