4XYOA

Structure of agra lyttr domain
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
99
structure length
99
Chain Sequence
VETIELKRGSNSVYVQYDDIMFFESSTKSHRLIAHLDNRQIEFYGNLKELSQLDDRFFRCHNSFVVNRHNIESIDSKERIVYFKNKEHCYASVRNVKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Accessory gene regulator A
publication title Conformational features of the Staphylococcus aureus AgrA-promoter interactions rationalize quorum-sensing triggered gene expression
doi rcsb
source organism Staphylococcus aureus (strain col)
molecule tags Dna binding protein
total genus 28
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2015-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04397 LytTR LytTr DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1020 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4xyoA00
4XQJA 4CBVA 4XYQA 4XQNA 4XXEA 4XYOA 4XQQA 3BS1A 4G4KA
chains in the Genus database with same CATH superfamily
2QW7A 1HPCA 1VQIA 1TWAB 4TVAB 3CPFA 2E2HH 3HZXA 5C3EB 2A6HC 2F0NA 4A3CG 1IW7D 3KLWA 1VQFA 1B3QA 2NN6I 3H15A 4X3UA 2PYKA 2F0GA 2F4VQ 5ELDA 4LF9Q 1LUZA 4DR2Q 5EJWA 3G71A 1CSPA 2XNAC 1NBWA 1LT4D 3VR4A 3HKZG 1TWAH 4HJ5A 2LSSA 5C3EH 1YJWA 1V43A 1GJXA 1Y1VG 3EROA 5EPJA 2CHBD 1KDAA 2H4OA 3KUPA 1O7LA 1QUQA 1B9MA 4OO1G 2MUYA 2A1AA 1PH5A 4A3DB 4MN3A 2R92B 5LHY1 2VS1A 1WCMB 1AP0A 2BA1A 4IQZA 3KFUA 3S1RB 4A3DH 2RDGA 1BBXC 2BE5D 4OWTB 1WD0A 2R92H 4JK1C 2B2WA 1H9SA 1QZHA 1SYGA 2G5DA 2NTSA 1VQ8A 4CJ2C 4C3JG 4ZYSA 2BH8A 3S1RH 1UE5A 3HOWG 1CTMA 1SR3A 4B08A 1PH3A 1D7QA 4DV6L 4RGMA 5C3WA 3GTOB 1STAA 4IPGA 4BS9A 1WTVA 3QOLA 4L63B 2A69C 3KLSX 4LW1A 2NN6H 4B3RQ 4K5VA 2ZXPA 3W3AA 3TS2A 5KNCA 1STYA 2UUCL 3GTOH 4XTCS 2KCNA 2WB1B 3FHWA 4DR7Q 3K6OA 4FXDA 4ZUIA 4K5XA 4LF4L 1G8ZD 1DD2A 4RHRA 4DUZL 1PZJD 3S14B 5IYBG 2IW3A 4IUPA 1JB3A 3ER0A 3NELA 1QCBD 1UAPA 1IKMA 1YEZA 4A3LH 5J39A 5LMNL 5ELBA 2EYLA 2F0WA 3S14H 4MTKA 2E2JH 3BYYB 4WFN3 1N33L 3PO3G 1LV9A 1SE2A 1UE7A 3KF8B 2R7ZB 1YHBA 3K7AB 5CV4A 2K28A 4KD4A 4A3MG 5KYLA 1HJPA 3T1YL 1LTLA 1JQYD 1F9QA 1PTOD 3J81c 5E1FA 3W5OA 2R7ZH 4NXNL 1N8RC 1IYJB 2Q8RE 3K7AH 1I94Q 2ALYB 1XX8A 3ND9A 1PZKD 3OIPA 2HHHQ 2YTYA 1J9OA 4PMWA 3VR6A 4JYAL 1C9OA 2B2TA 2HIXA 3DHQA 3GQBA 3IFDA 2PCFB 1EQVA 1EY7A 2UU9Q 3NQTA 3DXJC 1DZ1A 4A3JB 1HNWQ 3U9SA 1OXXK 2WINB 2CWPA 3BS1A 2SNMA 5JVH3 1AH9A 2G9HD 4HSVA 4BA2I 3NEMA 4HSPA 2QEXA 1C7YA 4HMJA 3SHLA 1TR5A 4CHTB 1K0SA 1R9TB 5C0XG 2EY6A 1K8GA 2I5HA 1D5MC 5E7NA 2XIWA 3NTIA 4A3JH 3H6MA 1KD1C 3HOVG 3GTQB 4LFAL 1KL9A 3TSSA 4EQPA 1IKLA 5CC4A 1EL0A 2XSCA 1BCPF 2F0HA 3RZDB 3X3MA 3KK7A 1R9TH 3R8BA 4OX9Q 4RH6A 3OW2A 4DN4M 4JI3Q 2GN5A 3GTQH 4R4QA 3HOZB 1OTCA 3DM3A 2I07B 2UUBL 2F0VA 5C44B 5BR8Q 3TP6A 2DJFC 4GZYC 4DNTB 2Q8IB 3E9HA 3RZDH 1EZ6A 1HNXL 4YIJA 1KLGD 1Y8OB 1PHJA 1QOHA 2CH4A 3DMUA 3T56B 3O13A 3HOZH 5JEAG 5LL6X 1E2WA 4L5SA 2AWOA 5C44H 4G7ZC 4UP8A 2D0OA 4RGOS 5LMUL 4QB4A 2B3GA 3GD7A 4P71A 3KDFA 2R61A 2L0CA 4G4KA 2ZM6Q 1ENCA 4A93G 4L5RC 4ZLTF 5C3XA 3PF4A 3S2DB 1K0RA 5DM63 1MJCA 5FLXc 5ELFA 5C0XJ 3Q23A 4CKBA 4XDXA 1PFNA 2Q8TA 2A69D 3K81C 2XWBB 1S3OA 3A8IE 4B3TQ 4EQOA 1LTID 2L11A 1GUSA 3OYYA 3S2DH 2F0JA 2R6GA 4IUQA 5ISRA 4KD3A 1IHZA 1GUOA 2IWHA 4A76A 2B2YC 1PMRA 2D2CC 3I70A 3HEJA 2RCNA 5IWAL 3KJPA 2FMCA 4FYDA 2AUJD 4EVOA 3NHHA 5AJ3L 3OWEB 2FJ2A 2AUKA 2IX3A 4Y7NB 4DR4Q 3OMCA 4CDEC 4F8MA 4A3KB 2Z0SA 2IL8A 4APVA 5JEAJ 4IFDG 3MAQA 2KQ3A 3NWSA 3KJOA 1SNMA 4R4IA 3ZJYC 3MXNB 3NPPA 4Y7NH 5LMNW 1KC8C 4QL5A 2JEAI 1XTCD 4A3KH 3KF6B 4ZAIA 3TZUA 2F4VL 2RBMA 1NMFA 2MHVA 4DR2L 4LF6Q 5IT9c 2CH4W 1CHPD 5T1IA 3SEBA 1CQVA 3FMCA 5C6AA 1VQCA 2CKZB 3I56A 3F8TA 4UHVA 1IL2A 1YI2A 1ENAA 4X62Q 2ENBA 1SYBA 1C48A 1SE8A 1A63A 5HURA 4YWLA 5KNBA 1V9PA 1HZBA 4NPSA 2F0UA 1QB5D 1VQAA 2WFWA 3EQLC 3OMGA 2A74C 4BY1B 4KKUA 2EYOA 4WRDA 4A3GH 3RN5A 4AYBE 2NVXB 2NTTA 1VQGA 4RMFA 1T9HA 3IFTA 3S1NB 1D5XC 4ILWA 5C4HA 2RQXA 1VQKA 2XWJB 4A3BG 5EKKA 3I4NG 4BY1H 1N9WA 1ILPA 3TP8A 4XXEA 1PVOA 3CMEA 4XIGS 1UE1A 2NVXH 1X6OA 3S1NH 4MTNA 4IFDJ 5IYDH 4KLKA 4ID6A 2KJXA 2L1BA 2JA8B 1EU3A 1ML0D 1V1PB 3E6ZX 4JI2L 5EKLA 4FVMA 1E0BA 4NP5A 1E2VA 3CCUA 4BBSG 1XXGA 2NBFA 4JI7Q 2JA8H 3SK5A 3MEHA 5GADC 4B3RL 4DUYQ 1E2ZA 5KEEA 4K6DA 5ELEA 4DV2Q 5D3DA 4B3SQ 4HCEA 4DR7L 1H9RA 5DEHA 1CM9A 1A3TA 2CQAA 3PO2B 1KQSA 1LABA 1TS4A 1AE2A 2RDFA 3D6WA 1CKNB 1Q7YC 4B3MQ 2ZJPA 3CRLC 5EPLA 5FO7B 1G291 2UXDL 4JBMA 1Y8NB 2Z6BA 3SGIA 5EGTA 1VQPA 1PH9A 3P7JA 3PO2H 3KOJA 1K73C 4V0BA 4YCVA 3HOUB 5M3FH 3M7NA 2LFNA 3GTLB 1GVPA 3CQZB 3MEFA 1DOMA 1F2LA 2GVBA 4P74A 3UDGA 3J80c 4RGNA 1CI3M 1MD2D 3A54A 1YNJD 1U4LA 3JAMc 3HOUH 4GN3B 4JBWA 1T5EA 3I90A 4F87A 1V8QA 3GTLH 2PZWA 3CQZH 3OOCA 1GHKA 1I94L 3I91A 2EY5A 1D1KA 1S5CD 4DPGA 1M90C 3H0GB 4OGQC 1II3A 1FR3A 4L5TA 2ZJRA 3LNNA 2AMCB 3STBC 3SXHA 1EY8A 4PMBA 4P2CB 3S1QB 4JOIA 1ASZA 3I7FA 5KRUA 5FJ8G 3H0GH 1HNWL 4WORA 2NZOA 1ET6A 1XTDA 1ZKOA 1SMYC 3OW7A 2E2IH 3N52A 1Y1WG 5EBCA 3BZCA 4LUOA 3CD6A 2TMPA 2JSOA 1C0AA 1RD9D 5K36G 2E8GA 1XJVA 1LM0A 3HKZE 1IW7C 4C1NK 4QUFA 1V1OA 4F88A 2DUDA 1D8LA 1KTKA 4M8AA 2NB0A 1EYDA 2XRSD 4PZ7A 1E1OA 3N6RA 1O80A 2V1CC 3PUVA 1TWHB 1I4PA 4JI3L 4UP9A 1PDQA 1YHQA 2B63B 1H95A 2N49A 4LFCL 3EN2A 4KK7A 2E2DC 3Q22A 2WACA 5COYA 2EYPA 3UDIA 2K33A 1A15A 3OPOA 4NDXA 5C5MA 4DK3C 1SAPA 1SBBB 5CR3A 3RNUA 3IRBA 4H44C 2FINB 1TWHH 1JWSD 5L37A 4A3FG 2B63H 3NSWA 4GN4B 2HUGA 1BNZA 4ME5A 1TY2A 2MJ8A 3CKIB 1ICFB 4WJWA 3A55A 1EOTA 4AYBG 1U0LA 3TEHB 2PQAA 4X64Q 1I4XA 1FJGQ 3CU7A 1CA6A 1N34Q 2ZXRA 2ZM6L 1BUVT 2KHSA 2K05A 5HY6A 4R8NA 2K5HA 1ZEQX 3S16B 4N8FA 2XRQD 4L6TB 3ULJA 3I4MG 1RTNA 1STNA 1Z9FA 1VQJA 2O5IC 3T1HL 1X3PA 4B3TL 4DK6C 3R2IA 1YHAA 2HD3A 1VQ5A 1P16A 4LUVA 5JPNC 2OQKA 2Y0SE 1B50A 3S15B 2E5LQ 3S16H 1EU4A 4EQ5A 1HUMA 1SRUA 1KRSA 1VQ4A 1L1OB 1TS2A 3WOEA 1PH7A 3S15H 1XNRQ 1F9RA 5I9PA 4DR4L 2RDHA 1YBYA 2AQ2B 3EJIA 4HIKA 1VQBA 3VYTA 4H02A 4BA1I 4X66L 1NY4A 4IURA 4BY7B 1PFBA 2UXBQ 1SROA 4LF6L 2JA6B 2GA4B 2KUMA 3RLNA 3VR2A 1RTOA 2ICEC 2L15A 4U673 4BY7H 3P1HA 3GDEA 4LUZA 2WKCA 4IUVA 3NBHB 4C3HB 2NVYB 4X62L 3J81j 4JI0Q 4QUCA 2B29A 3U50C 5KNDA 2K4KA 2JA6H 1E3PA 1B1ZA 3PMFA 2VQFQ 5EKIA 4KKSA 3QJYA 4RGTA 2O5JC 1BVSA 1BCPC 2E2HB 2K6AA 1JE4A 1MIUA 2WP8J 4C3IG 4HJ7A 3AEVA 4BBRH 2QF7A 2ZT9C 3D4WA 4I65A 4JI6L 4K0KQ 1SMYD 4YY3Q 4R4CA 2KCCA 3J7A5 2TSSA 4UPAA 1DGSA 2J0TD 3CP0A 1JOKA 2NYZD 2VZAA 4HIOA 4JW0A 1NJIC 1QNKA 1F2ZA 5DM73 2HQEA 2JE6I 3UDXA 1IBMQ 1LTRD 2F0DA 3NBIA 3H3VI 2CCZA 1XPOA 4TKOB 1ASYA 3D4DA 2D0PA 3E0JA 3LWEA 4Z9CB 4DV0Q 3M4YA 4WJ3M 4G57A 5G3LF 1SYDA 1SEBD 1IBKL 2UXCQ 4PMCA 1EWCA 4JI7L 1EIHA 1HQMC 2DGYA 2F3IA 2KHJA 4DUYL 2IHFA 3WOFA 1Y1VB 1EOVA 4FP5D 4C56C 4DV2L 4B3SL 4R8IA 1MI2A 1EY0A 2OQ0A 4HCSA 3NQIA 4A3DG 2RCFA 4H7BA 1ONLA 1F2MA 2R92G 2O2LD 4LAAA 2NVTH 1TY0A 2VW9A 1WCMG 2UUAQ 4OWWB 1K9MC 4NXMQ 1SYFA 1Y1VH 5KIXA 1JICA 3CCEA 3IKJA 1L0YB 1FNVA 2KECA 2MGSA 1T5XD 5M3MG 5IOCA 1O7IA 1MKHA 3ONAB 5LL6S 2KEEA 2SNSA 3D0FA 2E75C 2VNUD 1CZWA 4XT3B 3FDTA 1OO9B 4POGA 2PMZE 2EIFA 3BYTB 4KY7A 1Q3LA 1J5EQ 2VUMG 1STEA 5KYIA 1ESRA 2F1MA 1KXLA 5A2QL 2QDBA 1L2FA 1F9PA 1AZQA 4LF7L 3TP7A 3L0OA 2Z6KA 1CSQA 1PYBA 2ASBA 1VMCA 2Y0SG 3HOWB 1PTOB 3WWVA 3CCSA 3G6JB 3PIPA 3H3VH 4A4IA 1KABA 4G7OC 3TDQA 2XTIA 2XVSA 2E76C 1W6KA 4FO2A 3TQYA 4DV5Q 3C1FA 1HHVA 3UE1A 4XQJA 2E2JB 2XN9C 3VR5A 1HUNA 2RSOA 1UE6A 4C3JH 3HOWH 1PTOH 4R9WA 3BZKA 4IOCA 2VQEL 1JB7A 4DXGA 2K01A 3I55A 2C35B 1KIXA 4DU9A 4OELB 1FYCA 3A8KE 2X6LA 1EY4A 4LJZC 1NNXA 1BF4A 2N55A 4X3SA 5C0XI 2R7ZG 3GTKB 3BVMA 3MHBA 2QILA 3D8GA 3SK8A 3IAYA 4PNYA 2JN4A 1HFGA 2CWAA 5IYBH 3WDNA 4PZ6A 2B8FA 4JVZA 1N36L 3HOYB 3PO3B 1XNQL 1GD7A 2IJ0A 2C5CA 3G7LA 1SDFA 3GTKH 4GNXB 4POFA 1XMOQ 1G6ZA 2NUCA 1BCPD 3VYRA 4DAYB 2FXQA 1OXTA 1F77A 1Z47A 4JI1Q 3K7UC 3CF5A 3HOYH 3PO3H 1K3BC 4DR5Q 4QJFA 5GAGC 4GKJL 3G4SA 3E9IA 3J7YW 3PUYA 4X3TA 3J81L 3SVMA 4A3JG 2ZXOA 3BDOA 5IIFA 4IUNA 1S72A 2F0EA 1STBA 2AQ3B 3HP3A 1WTPA 3EBEA 4YWMA 2JA7G 4OL7A 1FJGL 1CT1D 4GOPB 3BZDB 5IE8A 1N34L 2K5DA 1G2TA 1A2TA 5FLMH 2AKWB 4LF8Q 3BG3A 3F2UA 3F1ZA 2PZTA 4A3IG 1EWHA 2Q2TA 2EY1A 2F0OA 1H9MA 4N8X1 3HKSA 2HCIA 3U58A 4JOIC 2ATWA 2Z4IA 4ZKBB 1Y69U 3ULPA 1O7YA 2E5LL 4MZ9A 5CORA 4CKEA 5C44G 4B9WA 1EIFA 1WYDA 1OXUA 4X65Q 5C0XH 3J80E 3DLLA 1K8OA 1GM5A 3HOVH 1KAAA 1XNRL 2OTJA 4DV7L 3CCMA 4QCLA 1S40A 5FO8B 1SNDA 2D9UA 3V05A 1X3QA 1YJNA 2HIVA 4DR3Q 3I3CA 5IGDA 1LO5D 4FF1A 5JAVA 2K50A 1TS3A 1Y14B 1XMQQ 1DYQA 4DR1L 3L3OC 5GAHC 4FF3A 4PQXA 5JEAH 1HZCA 4KKTA 2WV6D 1XPRA 1EY6A 2RHQB 3E0EA 3R2TA 2EYHA 3PIP3 1YNJC 2F0KA 2PQEA 2JK8A 4FXGC 2IY5B 3CC7A 1Q8IA 1RHPA 4DK0A 4RKLA 4DFAA 3MXPA 3CC4A 2VQFL 1UNSA 1GKHA 3CAMA 5FLXL 2R7FA 5GAEC 1I6HB 3L9AX 3V2TA 4A93H 5EBDA 2LXKA 4KY6A 4MNOA 5JJIA 2H5XA 2L55A 4KN4C 4ULLA 3KF8A 3A7LA 3I72A 5I2XA 4JV5L 5C4XB 3A0JA 3K57A 4DXFA 3S9WA 4IZ8A 1PRTB 1I6HH 1LT3D 4ALPA 2F3WA 5H1SE 1SYEA 3OHXC 4LF9L 1J8IA 5C4XH 1TWCB 1IBML 1H9JA 1B70B 4O0AA 4GNXA 1E22A 1M4VA 4CKCA 4YHHQ 1DJRD 3S17B 4GLAC 1PH1A 4A3GB 5E4XA 1EYCA 1RL2A 1TWCH 2UXCL 2ES2A 1I4HA 2KA7A 2PW5A 3I73A 3F2CA 1WTWA 4HIMA 3K59A 3QIAA 3S17H 1JJCB 4KY5A 5IT9L 1YZ6A 4BY1G 2DY8A 2N78A 4KJOA 5BN5A 3FKIG 3VDYA 3FPUB 3ICEA 1K83B 4K2LA 1D6EC 1RIPA 3FEWX 2UUAL 3JC66 1JWMD 4N9PA 3K5OA 1B53A 1X3FA 1A62A 1KHIA 2HQLA 3K80C 1K83H 1S5ED 2K14A 5M5XB 1PV4A 2F0MA 2MO0A 3MTSA 2SEBD 2A73B 2JA8G 1WJJA 1DONA 3RN2A 4QQBX 4GLVB 5EPKA 3EA6A 1IZ6A 1YIJA 1J5EL 2K32A 3SE0A 3TREA 1RJTA 3J7ZC 2NZ1D 5M5XH 3KLRA 1VQEA 4DV3Q 5JJZA 4F7XA 1QZGA 3I4NH 4BXXG 2OT2A 1RKNA 3ITPA 3FVQA 4LNQA 4XYOA 2K75A 1OXSC 3PF5A 5IY0A 1FD7D 3D31A 1I4QA 4BBSB 2K5WA 2NZHA 1RCVD 3IL8A 1IYUA 2QDLA 4JPBW 2NVQH 3ERSX 4OHJA 5M3FB 3PIOA 2JA5B 1PRTF 3CCJA 3LWUA 2YTVA 4BBSH 4X3KA 1ILQA 4RCOA 2R93B 2LXJA 4CDFC 1ZYRC 2A5HA 2JA5H 2DN8A 2FFKB 3M4PA 1J6QA 3HOUG 1LTAD 3U4ZA 4PZ8A 1VF7A 3SK6A 1NR4A 3AU7A 2R93H 5E3FA 3RUZA 5DNFA 5M5WB 3GO5A 4RCNA 5I2YA 1TU2B 3KBXA 5DLQE 1X3GA 1LT5D 1W2BA 1BQQT 4QMGA 1FGBD 4QIWE 2HHHL 3QB3A 4L5QA 4ZQ3A 1W6JA 2E2IB 4AQYQ 3H0GG 4JI1L 5M5WH 4DV6Q 1NR2A 1CZGA 3MXNA 1HRJA 3URYA 3EFXD 3CW2C 4DR5L 5M9OA 3J80L 2UU9L 3DEPA 3KF6A 1D1IA 3EIVA 3JAML 1VQMA 1EFWA 5IYCG 2PW7A 1L0WA 1BR9A 3RD4A 3I8ZA 1JOQA 1EY5A 2EPBA 4NB3A 2HT1A 1TXYA 1HA6A 2Z6KC 1LTBD 1ZXTA 4KTAA 4ZUJA 5IGGA 3NTKA 1AN8A 2RKSA 5JOBA 4AH6A 5A2QE 4LF8L 5LMNQ 4K8IA 4R4OA 4HEDA 4OX9L 3E3XA 3CXCA 3R3OA 1EUJA 5IGEA 1QVGA 1N33Q 5FJ8H 2B39A 2B63G 3TRZA 3SDZA 5BR8L 3CCVA 1Y1WH 2D5DA 3CCQA 1SMXA 1D2BA 3T1YQ 1Q86C 5K36H 1O78A 3RR5A 5IP9G 5BN3A 3GP7A 5CV6A 1WVLA 4DV1Q 3P20A 4TSSA 1M1KC 4E6IA 4QGUA 1VQDA 3T53B 1V1PA 1EIYB 5FK9C 1IXRA 4LFBQ 2RSNA 1EIGA 3UI2A 1YNND 3BDCA 4OWXB 4DR3L 3H91A 2XGTA 1AFPA 1GHJA 1K3RA 4NW2A 4HJ8A 5CYUA 2Q2UA 5I9OA 1QUQB 2F03A 1E7ZA 2RVLA 1XMQL 3K5LA 2EDGA 4AYBB 1VQNA 1LTSD 1XWEA 1SSOA 2WAQG 2KCTA 4J15A 1S5FD 2KHIA 4RFBA 4IALA 3PSIA 2F0SA 3DUZA 1CKNA 1IYVA 4CBVA 3TS0A 3CPWA 2WB1E 4I7ZC 1HQRD 2BDOA 1Q82C 3S2HB 4MHEA 1GUNA 3J81E 1AEXA 1FL0A 1H9SB 1BBWA 4IO9A 1JORA 3W1BA 1SNOA 5IP7G 1JT8A 2K7VA 3S2HH 2YV5A 3HG9A 3DM1A 4ZRZA 3HOXB 1K8MA 1ZYRD 4UY8C 5AFWA 3FP9A 3K0XA 3M7GA 2CQOA 2DNCA 3D6CA 2CW0D 3U9OA 4JI8Q 2N8NA 2F4IA 4UP7A 2R7DA 1HH2P 4BY7G 1SN8A 2LKVA 4X6AH 3HOXH 1I50B 3I2ZA 5CV7A 5LMUQ 1X32A 5ELNA 2EXZA 2JA6G 3HS0C 4FXKC 2WIIB 1A2UA 1WTXA 1YNXA 4BBRB 3K0YA 4IJLA 1MJEA 3V96A 2I5LX 2C9OA 4C3HG 1I50H 2KENA 4HN7A 4PG3A 4OIKA 5GQOA 2F0FA 2PZUA 4GN5A 3GTGB 5G3LD 2K52A 3OWFA 4RA8A 1PH6A 4A3EB 3CC2A 3H3VC 4GKKQ 4OO1I 1TKWB 4XQNA 1FVIA 2LMCB 3RLFA 3T16A 4RWSC 1PH8A 3GTGH 4ZKCB 1UUPA 1PH2A 1GOZA 3I4LA 4JI5Q 4A3EH 1PYWD 1UWVA 3GTPH 3RZOH 1KDCA 2RA4A 5K5PA 4GLXA 2BA0A 5E4WC 5AJ3Q 3T4AC 1AE3A 5C3EG 4DAPA 1V1QA 3QR8A 3TBIB 1HZAA 1I3QB 2X69A 2MFIA 2JXMB 1KAWA 3HRZC 1MHWC 1MSHA 1SNPA 1B44D 3G6EA 4C3IH 1KNAA 2M2LA 1I3QH 1SYCA 4V190 3MXGA 4DV3L 5FLXE 1JMCA 1PXUA 4WJ4A 2NVTB 3HKZB 3M9BA 1QVCA 4A3CH 3AQQA 2AQ1B 1U4PA 1I5FA 1DM0B 3MZ5A 4B3ML 4EGVA 1HNZQ 2E74C 4GNXC 1G51A 2IX0A 3M85A 1CUKA 4CDCC 2V4DA 4B9XA 1CQFA 3VR3A 2KEDA 2I5MX 1Q1BA 4OO1H 2H1EA 4HR7B 1X3EA 3NK9A 1N32Q 1Q90A 2NN6G 2G9DA 2DJGC 2HDLA 1TIID 1A3VA 4HJ9A 1EEID 1L1OA 2RHSB 4OXPA 2OXPA 4GOPC 5M3MB 2A19A 4O2DA 1VQLA 2L4NA 3NE5B 4DR6Q 1WCMH 4C3JB 2OEOA 5IT9E 2OWOA 3K5MA 1K8AC 4DV4Q 4JI2Q 3LX0A 3J81i 2VUMB 4KN7C 1A3UA 3T51B 4OONA 4AQYL 5M3MH 4A3LG 2WB1G 1SE3A 2ZTDA 1WTOA 3KDFB 3PUWA 1BCPB 1FNUA 3MFGA 4I7AA 4KHZA 3TMEA 3VA5A 5J22A 3K58A 2EYFA 2Y0SB 4JC0A 2VUMH 1Q1EA 5BN4A 2YYZA 3GV6A 3QOJA 5HGTA 3OTOQ 5HGQA 3C3LA 2PO4A 2Z1CA 1TVXA 3PV0A 3SR1A 1JC7A 2B2VA 3CRKC 2EY2A 4JI4Q 1VCIA 2IPKD 3NBHA 1EEFD 5IGFA 1I4GA 3KLSA 5JJLA 4JBJA 1NMGA 2UXDQ 2F0IA 2K04A 1JOOA 4ABNA 1BBUA 4P72A 1E1TA 1TQOA 2M9VA 1Y8PB 3PQIA 3VYSA 2P5ZX 2ZJQA 1HR0Q 3HOYG 1SJHD 1G91A 1EY9A 4A3MB 2EXDA 1X55A 4LK1C 2IX1A 4KHPQ 4EQNA 5CGKA 2IT1A 1PFMA 4IUTA 3VA7A 3W1GA 1EYGA 2K1BA 4K8JA 4A3MH 1X65A 2EJFC 4DV1L 4OEMB 3C2PA 2N3SA 1KDBA 1KNEA 3L7ZC 2QGQA 3ZYYX 5CMDA 4X64L 4LFBL 1CA5A 1Q12A 5FLMG 4HMIA 1M8AA 1JE5A 1U5KA 1SNCA 2JJQA 5CBAE 2Q2IA 2KBNA 1BO0A 1VQ6A 4L8JA 3CCLA 3GTMB 1QNUA 1AZPA 4KV6A 3D3RA 1LYLA 2MQHA 1VQ9A 1PRTC 2A6HD 3W2DA 4FF4A 1QE6A 2QKIC 3HFZB 1TWGB 3A56A 2JA7B 4UAIA 2EZVA 3ULLA 4XQQA 1F9SA 1U4MA 3HOVB 2Z4HA 2ZTCA 1PTOF 1MSGA 2ID0A 4Q5VA 3GTMH 3HOZG 5IGCA 1DOKA 5C4JB 1TWGH 4JG2A 4A3IB 2JA7H 1G2SA 1K28A 1GUWA 3C1EA 1PYSB 3AYHB 1GXDC 4RKBA 3JAME 2Z8LA 1L0XB 3I4OA 3MVVA 4LFCQ 2L5TA 1JR0D 3CHBD 3KBGA 5C4JH 4ME3A 4DK1A 4A3IH 1U9RA 4IPCA 3CCRA 2PI2A 4G7HC 1DOLA 3MWYW 1U4RA 1QVFA 4J1MA 3BVZA 4IFDI 5KGUA 3MC0B 1CHQD 2QA4A 2CFMA 4JI8L 1EZ8A 1CKMA 1EQTA 2UXBL 4IJHA 3J7AV 1HCZA 4HTHA 2MP1A 3PUXA 1VQOA 1B4OA 1A0IA 2J7ZA 1G6PA 3J7AF 4A93B 4Y52H 3P75A 5CBEE 4XT1B 4JI0L 3ND8A 3L2PA 4FNFA 1LT6D 2DY7A 4P75A 2IHEA 3M4OB 2PMZB 4GKKL 3B6YA 4PV1C 1WI5A 3BVGA 3T1HQ 2AHOB 3PCOB 1TS5A 4IN3A 1SLJA 4ZCKA 4K0KL 4YY3L 4A3KG 3QG1A 3M4OH 4OIJA 1XPUA 5I4DA 2EE1A 1ENFA 2K5NA 5J1ZA 4JI5L 5C4XG 5D3IB 4O42A 4FF2A 1C8CA 1LLRD 2JA9A 1JJ2A 4CDDC 1PZID 2EJMA 2OTLA 1LTGD 1EQRA 3C46A 2B2UC 4DAYA 1NTGA 4NMZA 4DV0L 1UEBA 3TP5A 3A5UA 1FGUA 1QILA 4X66Q 1RODA 2F0PA 1NE3A 1TT2A 4J6HA 3A7AB 4JCVE 4KJNA 4C1NI 5ELCA 4A3GG 2PPBC 4IFDH 1IBLQ 5D14A 2GVAA 1HXYD 2FMMA 1BXTA 4RHSA 1WFQA 4KMUC 5J3BA 2K5VA 2JP1A 4DAMA 1KRTA 2BCOA 1DCZA 3T13A 4GOPA 2MNAA 3CMAA 1JWUD 4LWCA 4IPHA 4K6LA 1HNZL 1CKOA 5EAYA 5IYDG 4NXML 3Q24A 5IODA 1HFNA 3NXWA 3MXUA 1YNNC 4LF5Q 2M00A 3F2BA 4O1NA 2PNRC 4ODGA 2X6GA 1EWIA 3FKIB 5CV9A 5F2DA 4JI6Q 1N32L 1VQ7A 1SE4A 2WAQE 1PRTD 2K03A 4A3BB 5D65A 3I4NB 3TN2A 1HTLD 4LMQD 4ZK9B 3OSOA 1HA5A 2VB3X 2VB2X 3MFYA 3NTHA 3Q8DA 3FKIH 4P73A 1OXVA 3Q6SA 4A3BH 4C2MB 4DR6L 3A74A 3S1MB 3J80i 2NVQB 1B3AA 2VXWA 4TQUS 3JAMi 2PQAB 1YITA 4YCWA 4DF7A 4H0LC 3SK4A 4DV4L 2F3VA 3DWQA 4DV5L 4FDBA 3H09A 2EQSA 4C2MH 1IBKQ 5FO9B 2KVMA 3S1MH 4XYQA 3PO2G 2BOSA 1CK1A 4HAEA 1BKBA 3AB9A 3MA2B 5M3FG 2A6EC 1I6VC 1E24A 2JA5G 2QCPX 2MPMA 5ELOA 1GO3E 4CJ1B 3K8AA 3OTOL 2F0QA 3UDFA 4GS3A 1O7ZA 1S5BD 1EFID 1TWFB 3GV3A 4JI4L 2A8VA 4BXXH 2F52A 2R93G 2Q2HA 3NWTA 4DKAC 1A8VA 4NKLA 2CW0C 1SFOB 4DA2A 1NAPA 4MIUA 3H94A 2MO1A 1P8LA 5C5LA 1SJED 3KYHC 1HZ9A 1TWFH 3QWNA 1AW7A 2EJGC 2HCCA 1B8AA 1Q46A 1SFOH 2L12A 4JBKA 2SOBA 3X3NA 1SNQA 1HR0L 1STGA 2OCEA 1XMOL 3E5SA 1SXTA 2SDFA 4KHPL 1RDPD 2DNEA 5JPMC 3K5NA 2J4XA 5JVG3 5JJKA 1C4QA 4HJAA 3NP8A 4LF7Q 3NENA 1WTRA 4IOAA 1Q8KA 1Z7TA 1EQQA 2A68C 1ESFA 1RF2D 1ET9A 3VYUA 1NUCA 2EYJA 2Z9HA 4R1JA 2UUCQ 1L1OC 1CFMA 1STHA 1VF5C 4AIMA 1QG7A 2OF1A 2LS01 1GUTA 2L9HA 1VDZA 4CJ0B 4LF4Q 3F2DA 4DUZQ 2B2WC 2KCMA 3S24A 4A75A 3EVQA 1MGSA 2LY7A 2AWNA 1WTHA 3FPPA 3G48A 3DWAA 3DWPA 4DGZA 1Y1WB 2I0QA 5I6WA 4HIDA 2VQEQ 2F0TA 4H13C 1S5DD 2EVBA 2HDMA 2FHTA 1H9KA 1ICWA 2CVRA 1YVCA 4KI0A 3S1QH 5T1GA 5IYCH 1R4PB 1WTQA 2JQOA 3D4RA 1B9NA 1D5ZC 1QJOA 2JYOA 4X65L 1GUGA 1VMPA 2B2VC 3DEOA 4EX5A 3M3YB 1N36Q 1WOCA 3QO2A 4NXNQ 1XNQQ 3M4QA 4R4TA 1IL8A 4YCUA 4U68A 4Q0FA 4UDUC 5C4ZA 4RG1A 1MBYA 1I4RA 4A3FB 1HTPA 5TSSA 4JYAQ 1BDOA 5GROA 1PH4A 3M3YH 4IUUA 3ERQA 1BOSA 4GKJQ 1LACA 5CV5A 1VS0A 2ZTEA 2PI2E 1DXMA 4A3FH 1YJ9A 4IPDA 1B7YB 5A35A 1X9NA 2B8GA 2B2YA 2K5QA 2YTXA 4N9TA 1B2TA 5DAUA 3GTJB 5IP9H 1QWYA 1PA6A 5EQ0A 4QY7A 1W3SA 4QF4A 2BE5C 4LFAQ 2RF4A 2BH2A 3TZDA 2EOTA 2B2UA 2WAQB 3I4MB 3GTJH 3FRPB 3RLOA 1VQHA 3PIO3 2B2TC 2VY3A 2KOLA 4DNRB 2A6ED 2UUBQ 2O4XA 3UE0A 4CGYB 4K2KA 3U4VA 3I4MH 1HNXQ 3AFPA 2I46A 3A8JE 5CV8A 2YU9B 3HOXG 3BU2A 4DV7Q 4TRDA 5I6YA 2F0LA 1Z6HA 2YU9H 3BJUA 4KHVA 4K5WA 2EYMA 1X54A 4YHHL 3NUCA 1A6XA 3LGJA 2N88A 4DNIA 1XYIA 5M5YB 2NWGA 2VL6A 1JCKB 3HGBA 2WKDA 3RMHA 3AFQA 1UEAB 1JJGA 5IP7H 4BBRG 2ICIA 1IBLL 4M1UB 4DR1Q 1X56A 1EYAA 1HR0W 2QEJC 5FKAC 2BDNA 5M5YH 3GTPB 3RZOB 4DAVA 4BWGB 5FOBB 4A3EG 2A68D 1Q81C 3R93A 1F2YA 3BDLA 4YWKA 4J8QA 4S3SA 1PTOC 2JEBI 3PUZA 3PGZA 2PNHA 5IWAQ 1PFSA 4QIWB 1LTTD 3STBD 1WD1A 3Q0AA 2R3ZA 5NUCA 3OIQA 4C3IB 1S4ZA 4LF5L 4C3HH 2NVYH 5IGBA 1KLUD 1NCVA 2D62A 1R4QB 1NSNS 1PLFA 4K14A 4RAUC 3AMUA 3A5ZB 4JV5Q 1FNWA
chains in the Genus database with same CATH topology
1HPCA 1TWAB 3HZXA 5C3EB 2A6HC 2F0NA 1IW7D 2NN6I 4X3UA 2PYKA 2F0GA 5ELDA 5EJWA 2XNAC 1LT4D 3VR4A 1V43A 1GJXA 3EROA 5EPJA 2CHBD 1KDAA 2H4OA 3KUPA 1O7LA 1B9MA 4OO1G 2MUYA 4A3DB 4MN3A 2R92B 5LHY1 1WCMB 1AP0A 2BA1A 4IQZA 3S1RB 2RDGA 1BBXC 2BE5D 1WD0A 4JK1C 2B2WA 1H9SA 1SYGA 2NTSA 4CJ2C 4C3JG 4ZYSA 1CTMA 4B08A 4RGMA 5C3WA 3GTOB 1STAA 4BS9A 1WTVA 3QOLA 4L63B 2A69C 3KLSX 2NN6H 4K5VA 2ZXPA 3W3AA 5KNCA 1STYA 4XTCS 2KCNA 2WB1B 3K6OA 4FXDA 4ZUIA 4K5XA 1G8ZD 1DD2A 4RHRA 1PZJD 3S14B 2IW3A 4IUPA 1JB3A 1QCBD 1UAPA 1IKMA 5J39A 5ELBA 2EYLA 2F0WA 3BYYB 4WFN3 1LV9A 1SE2A 2R7ZB 3K7AB 5CV4A 2K28A 4KD4A 5KYLA 1JQYD 1F9QA 1PTOD 5E1FA 2Q8RE 1XX8A 3ND9A 1PZKD 3OIPA 1J9OA 4PMWA 3VR6A 2B2TA 3DHQA 3GQBA 3IFDA 2PCFB 1EQVA 1EY7A 3NQTA 3DXJC 1DZ1A 4A3JB 3U9SA 1OXXK 2WINB 3BS1A 2SNMA 5JVH3 2G9HD 4HSVA 4BA2I 4HSPA 4HMJA 3SHLA 1TR5A 4CHTB 1R9TB 5C0XG 2EY6A 1D5MC 2XIWA 3NTIA 3H6MA 3GTQB 3TSSA 4EQPA 1IKLA 5CC4A 1EL0A 2XSCA 1BCPF 2F0HA 3RZDB 3X3MA 3KK7A 3R8BA 4RH6A 4DN4M 3HOZB 2I07B 2F0VA 5C44B 3TP6A 4GZYC 4DNTB 2Q8IB 1EZ6A 4YIJA 1KLGD 1Y8OB 1QOHA 3DMUA 3T56B 3O13A 5JEAG 5LL6X 1E2WA 2AWOA 4G7ZC 4RGOS 4QB4A 3GD7A 2R61A 2L0CA 4G4KA 1ENCA 4ZLTF 5C3XA 3S2DB 5DM63 5ELFA 5C0XJ 3Q23A 4CKBA 4XDXA 1PFNA 2Q8TA 2A69D 2XWBB 3A8IE 4EQOA 1LTID 2L11A 1GUSA 2F0JA 2R6GA 4IUQA 5ISRA 4KD3A 1IHZA 1GUOA 2IWHA 2B2YC 1PMRA 2D2CC 3I70A 3HEJA 4FYDA 2FMCA 2AUJD 4EVOA 3NHHA 3OWEB 2FJ2A 2AUKA 2IX3A 4Y7NB 3OMCA 4F8MA 4A3KB 2IL8A 5JEAJ 4IFDG 3MAQA 2KQ3A 3NWSA 1SNMA 3NPPA 2JEAI 1XTCD 4ZAIA 3TZUA 2RBMA 2MHVA 1CHPD 5T1IA 3SEBA 1CQVA 3FMCA 5C6AA 1ENAA 2ENBA 1SYBA 1C48A 5HURA 5KNBA 2F0UA 1QB5D 3EQLC 3OMGA 2A74C 4BY1B 4KKUA 2EYOA 4WRDA 2NVXB 2NTTA 3S1NB 3IFTA 1D5XC 4ILWA 5C4HA 2RQXA 2XWJB 5EKKA 1ILPA 3TP8A 4XXEA 4XIGS 4IFDJ 4ID6A 2KJXA 2L1BA 2JA8B 1EU3A 1ML0D 1V1PB 3E6ZX 5EKLA 4FVMA 1E0BA 4NP5A 1E2VA 1XXGA 2NBFA 3SK5A 3MEHA 1E2ZA 5KEEA 4K6DA 5ELEA 5D3DA 4HCEA 1H9RA 5DEHA 1CM9A 1A3TA 2CQAA 3PO2B 1LABA 1TS4A 2RDFA 3D6WA 3CRLC 5EPLA 5FO7B 1G291 1Y8NB 5EGTA 3P7JA 4V0BA 3HOUB 3M7NA 2LFNA 3GTLB 3CQZB 1DOMA 1F2LA 4RGNA 1CI3M 1MD2D 3A54A 1YNJD 1U4LA 4JBWA 1T5EA 3I90A 4F87A 1V8QA 2PZWA 3OOCA 1GHKA 3I91A 2EY5A 1D1KA 1S5CD 3H0GB 4OGQC 1II3A 1FR3A 3LNNA 3SXHA 1EY8A 4PMBA 4P2CB 3S1QB 5KRUA 4WORA 1ET6A 3OW7A 1ZKOA 1SMYC 3N52A 5EBCA 2TMPA 2JSOA 1RD9D 5K36G 1IW7C 4C1NK 4QUFA 1V1OA 4F88A 1KTKA 4M8AA 2NB0A 1EYDA 2XRSD 3N6RA 1O80A 3PUVA 1TWHB 1I4PA 1PDQA 2B63B 4KK7A 2E2DC 3Q22A 2WACA 5COYA 2EYPA 2K33A 1A15A 3OPOA 4NDXA 5C5MA 1SAPA 1SBBB 5CR3A 4H44C 2FINB 1JWSD 3NSWA 2HUGA 1BNZA 4ME5A 1TY2A 2MJ8A 3CKIB 4WJWA 3A55A 1EOTA 1I4XA 3CU7A 1CA6A 2ZXRA 1BUVT 2KHSA 2K05A 4R8NA 1ZEQX 3S16B 2XRQD 4L6TB 1RTNA 1STNA 2O5IC 1X3PA 3R2IA 5JPNC 1B50A 3S15B 1EU4A 1HUMA 1TS2A 3WOEA 1F9RA 5I9PA 2RDHA 2AQ2B 3EJIA 3VYTA 4BA1I 4IURA 4BY7B 1PFBA 2JA6B 2GA4B 2KUMA 3VR2A 1RTOA 2ICEC 4U673 3P1HA 2WKCA 4IUVA 4C3HB 2NVYB 4QUCA 5KNDA 1B1ZA 3PMFA 5EKIA 4KKSA 3QJYA 4RGTA 2O5JC 1BCPC 2E2HB 2K6AA 1JE4A 2WP8J 4C3IG 2QF7A 2ZT9C 3D4WA 4I65A 1SMYD 2KCCA 2TSSA 2J0TD 1JOKA 2NYZD 1QNKA 1F2ZA 5DM73 2HQEA 2JE6I 1LTRD 2F0DA 3NBIA 4TKOB 3D4DA 3E0JA 3LWEA 4Z9CB 3M4YA 4G57A 5G3LF 1SYDA 1SEBD 4PMCA 1EWCA 1EIHA 1HQMC 3WOFA 1Y1VB 4FP5D 4C56C 4R8IA 1MI2A 1EY0A 4HCSA 3NQIA 4H7BA 1ONLA 1F2MA 2O2LD 4LAAA 1TY0A 1SYFA 5KIXA 1JICA 3IKJA 1L0YB 1FNVA 2KECA 2MGSA 1T5XD 5IOCA 3ONAB 5LL6S 2KEEA 2SNSA 2E75C 2VNUD 1CZWA 4XT3B 3FDTA 1OO9B 3BYTB 4KY7A 1Q3LA 1STEA 5KYIA 1ESRA 2F1MA 5A2QL 2QDBA 1F9PA 1AZQA 3TP7A 1VMCA 3HOWB 1PTOB 3G6JB 1KABA 4G7OC 3TDQA 2XVSA 2E76C 1W6KA 4FO2A 3C1FA 1HHVA 4XQJA 2E2JB 2XN9C 3VR5A 1HUNA 2RSOA 1PTOH 4R9WA 4DXGA 2K01A 4DU9A 1FYCA 3A8KE 2X6LA 1EY4A 4LJZC 1BF4A 2N55A 4X3SA 5C0XI 3GTKB 3BVMA 3MHBA 2QILA 3D8GA 3SK8A 3IAYA 4PNYA 1HFGA 3WDNA 2B8FA 3HOYB 3PO3B 2IJ0A 2C5CA 3G7LA 1SDFA 1G6ZA 2NUCA 1BCPD 3VYRA 1OXTA 1F77A 1Z47A 3J7YW 3PUYA 4X3TA 3J81L 3SVMA 2ZXOA 3BDOA 5IIFA 4IUNA 2F0EA 1STBA 2AQ3B 3HP3A 1WTPA 4OL7A 1CT1D 3BZDB 2K5DA 1G2TA 1A2TA 3BG3A 3F2UA 2PZTA 1EWHA 2EY1A 2F0OA 1H9MA 2HCIA 2Z4IA 4ZKBB 1Y69U 1O7YA 5CORA 4CKEA 4B9WA 1OXUA 5C0XH 3J80E 1K8OA 1KAAA 4QCLA 5FO8B 1SNDA 2D9UA 3V05A 1X3QA 3I3CA 5IGDA 1LO5D 4FF1A 5JAVA 1TS3A 1DYQA 3L3OC 4FF3A 4PQXA 5JEAH 4KKTA 2WV6D 1EY6A 3R2TA 2EYHA 3PIP3 1YNJC 2F0KA 2PQEA 4FXGC 1Q8IA 1RHPA 4DK0A 4RKLA 4DFAA 3MXPA 1UNSA 5FLXL 1I6HB 3V2TA 3L9AX 5EBDA 4KY6A 2L55A 4KN4C 4ULLA 3KF8A 3A7LA 3I72A 5I2XA 5C4XB 3K57A 4DXFA 3S9WA 4IZ8A 1PRTB 1LT3D 2F3WA 1SYEA 3OHXC 1J8IA 1TWCB 1H9JA 1M4VA 4CKCA 1DJRD 3S17B 4A3GB 5E4XA 1EYCA 1I4HA 2KA7A 2PW5A 3I73A 1WTWA 3K59A 3QIAA 4KY5A 5IT9L 2DY8A 4KJOA 5BN5A 3FPUB 1K83B 4K2LA 1D6EC 3FEWX 1JWMD 4N9PA 3K5OA 1B53A 1S5ED 5M5XB 2F0MA 3MTSA 2SEBD 2A73B 1DONA 5EPKA 3EA6A 2K32A 3SE0A 1RJTA 2NZ1D 3KLRA 5JJZA 4F7XA 2OT2A 1RKNA 3ITPA 3FVQA 4XYOA 1OXSC 1FD7D 3D31A 1I4QA 4BBSB 2K5WA 1RCVD 3IL8A 1IYUA 4OHJA 5M3FB 2JA5B 1PRTF 3LWUA 4X3KA 1ILQA 4RCOA 2R93B 1ZYRC 2A5HA 2DN8A 2FFKB 1LTAD 1VF7A 3SK6A 1NR4A 3AU7A 5E3FA 3RUZA 5DNFA 5M5WB 3GO5A 4RCNA 5I2YA 1TU2B 3KBXA 1LT5D 1BQQT 4QMGA 1FGBD 3QB3A 4ZQ3A 1W6JA 2E2IB 1NR2A 1CZGA 3MXNA 1HRJA 3URYA 3EFXD 5M9OA 3J80L 3DEPA 1D1IA 3JAML 2PW7A 1BR9A 3RD4A 3I8ZA 1JOQA 1EY5A 2EPBA 1HA6A 1LTBD 1ZXTA 4KTAA 4ZUJA 5IGGA 3NTKA 1AN8A 2RKSA 5JOBA 5A2QE 4K8IA 4HEDA 3R3OA 5IGEA 2B39A 3SDZA 2D5DA 1D2BA 5K36H 1O78A 5BN3A 3GP7A 5CV6A 1WVLA 3P20A 4TSSA 4E6IA 3T53B 1V1PA 5FK9C 2RSNA 1EIGA 3UI2A 1YNND 3BDCA 3H91A 1AFPA 1GHJA 4NW2A 5CYUA 5I9OA 2F03A 2RVLA 3K5LA 2EDGA 4AYBB 1LTSD 1XWEA 1SSOA 1S5FD 4RFBA 4IALA 2F0SA 3DUZA 1IYVA 4CBVA 4I7ZC 1HQRD 2BDOA 3S2HB 4MHEA 1GUNA 3J81E 1AEXA 1H9SB 1JORA 1SNOA 2K7VA 3HG9A 3DM1A 4ZRZA 3HOXB 1K8MA 1ZYRD 5AFWA 2DNCA 3D6CA 3M7GA 2CW0D 3U9OA 2F4IA 2LKVA 1I50B 5CV7A 1X32A 2EXZA 3HS0C 4FXKC 2WIIB 1A2UA 1WTXA 4BBRB 3K0YA 3V96A 2C9OA 4C3HG 4HN7A 4OIKA 2F0FA 2PZUA 3GTGB 5G3LD 3OWFA 4RA8A 4A3EB 3H3VC 4OO1I 1TKWB 4XQNA 2LMCB 3RLFA 3T16A 4RWSC 4ZKCB 1UUPA 1GOZA 3I4LA 1PYWD 1KDCA 2RA4A 5K5PA 2BA0A 5E4WC 3T4AC 4DAPA 3TBIB 1I3QB 2X69A 2JXMB 3HRZC 1MSHA 1SNPA 1B44D 1KNAA 2M2LA 1SYCA 4V190 3MXGA 5FLXE 1PXUA 2NVTB 3HKZB 2AQ1B 1U4PA 1DM0B 3MZ5A 4EGVA 2E74C 2IX0A 3M85A 2V4DA 4B9XA 1CQFA 3VR3A 2KEDA 1Q1BA 4OO1H 2H1EA 4HR7B 3NK9A 1Q90A 2NN6G 2G9DA 2HDLA 1TIID 1A3VA 1EEID 2OXPA 5M3MB 2L4NA 3NE5B 4C3JB 2OEOA 5IT9E 3K5MA 3LX0A 2VUMB 4KN7C 1A3UA 3T51B 1SE3A 1WTOA 3PUWA 1BCPB 1FNUA 3MFGA 4KHZA 3TMEA 5J22A 3VA5A 3K58A 2EYFA 2Y0SB 1Q1EA 5BN4A 2YYZA 3GV6A 3QOJA 5HGTA 3C3LA 2PO4A 2Z1CA 1TVXA 3PV0A 3SR1A 1JC7A 2B2VA 3CRKC 2EY2A 1VCIA 2IPKD 3NBHA 1EEFD 5IGFA 1I4GA 3KLSA 2F0IA 2K04A 1JOOA 4ABNA 1TQOA 2M9VA 1Y8PB 3VYSA 1SJHD 1G91A 1EY9A 4A3MB 4LK1C 2IX1A 4EQNA 5CGKA 2IT1A 1PFMA 4IUTA 3VA7A 2K1BA 4K8JA 2EJFC 3C2PA 1KDBA 1KNEA 3L7ZC 3ZYYX 5CMDA 1CA5A 1Q12A 4HMIA 1M8AA 1SNCA 5CBAE 1BO0A 4L8JA 3GTMB 1QNUA 1AZPA 4KV6A 3D3RA 1PRTC 2A6HD 3W2DA 4FF4A 1QE6A 2QKIC 1TWGB 3A56A 2JA7B 4UAIA 2EZVA 4XQQA 1F9SA 1U4MA 3HOVB 2Z4HA 4Q5VA 1PTOF 1MSGA 2ID0A 5IGCA 1DOKA 5C4JB 4A3IB 1G2SA 1GUWA 3C1EA 1GXDC 4RKBA 3JAME 2Z8LA 1L0XB 3MVVA 2L5TA 1JR0D 3CHBD 3KBGA 4DK1A 1U9RA 4G7HC 1DOLA 3MWYW 1U4RA 4J1MA 3BVZA 4IFDI 5KGUA 3MC0B 1CHQD 1EZ8A 1EQTA 3J7AV 1HCZA 4HTHA 2MP1A 3PUXA 1B4OA 2J7ZA 3J7AF 4A93B 3P75A 5CBEE 4XT1B 3ND8A 4FNFA 1LT6D 2DY7A 3M4OB 2PMZB 4PV1C 3BVGA 1TS5A 4IN3A 3QG1A 4OIJA 5I4DA 2EE1A 1ENFA 5J1ZA 5D3IB 4O42A 4FF2A 1C8CA 1LLRD 1PZID 2EJMA 1LTGD 3C46A 2B2UC 4DAYA 4NMZA 3TP5A 1QILA 1RODA 2F0PA 1TT2A 4J6HA 3A7AB 4KJNA 4C1NI 5ELCA 2PPBC 4IFDH 5D14A 1HXYD 2FMMA 1BXTA 4RHSA 4KMUC 2JP1A 2BCOA 1DCZA 3T13A 1JWUD 4K6LA 3Q24A 5IODA 1HFNA 3NXWA 3MXUA 1YNNC 2M00A 4O1NA 2PNRC 4ODGA 2X6GA 3FKIB 5CV9A 5F2DA 1SE4A 1PRTD 2K03A 4A3BB 5D65A 3I4NB 3TN2A 1HTLD 4LMQD 4ZK9B 3OSOA 1HA5A 2VB3X 2VB2X 3MFYA 3NTHA 1OXVA 3Q6SA 4C2MB 3S1MB 2NVQB 1B3AA 2VXWA 4TQUS 4DF7A 4H0LC 3SK4A 2F3VA 3DWQA 3H09A 5FO9B 2KVMA 4XYQA 2BOSA 1CK1A 4HAEA 3AB9A 3MA2B 2A6EC 1I6VC 2QCPX 2MPMA 4CJ1B 2F0QA 1O7ZA 1S5BD 1EFID 1TWFB 3GV3A 3NWTA 4NKLA 2CW0C 1SFOB 4DA2A 1NAPA 4MIUA 3H94A 5C5LA 1SJED 3QWNA 1AW7A 2EJGC 2HCCA 2L12A 2SOBA 3X3NA 1SNQA 1STGA 3E5SA 1SXTA 2SDFA 1RDPD 2DNEA 5JPMC 3K5NA 2J4XA 5JVG3 1C4QA 3NP8A 1WTRA 1Z7TA 2A68C 1ESFA 1RF2D 1ET9A 3VYUA 1NUCA 2EYJA 1CFMA 1STHA 1VF5C 1QG7A 2OF1A 2LS01 1GUTA 2L9HA 1VDZA 4CJ0B 2B2WC 3EVQA 1MGSA 2LY7A 2AWNA 3FPPA 1Y1WB 3DWAA 3DWPA 4DGZA 5I6WA 2F0TA 4H13C 1S5DD 2EVBA 2HDMA 2FHTA 1H9KA 1ICWA 2CVRA 4KI0A 5T1GA 1R4PB 1WTQA 3D4RA 1B9NA 1D5ZC 1QJOA 2JYOA 1GUGA 1VMPA 2B2VC 3DEOA 3M3YB 3QO2A 1IL8A 4U68A 4Q0FA 4UDUC 5C4ZA 1MBYA 1I4RA 4A3FB 1HTPA 5TSSA 1BDOA 4IUUA 3ERQA 1BOSA 1LACA 5CV5A 1DXMA 5A35A 2B8GA 2B2YA 2K5QA 4N9TA 1B2TA 5DAUA 3GTJB 1QWYA 5EQ0A 4QF4A 2BE5C 3TZDA 2EOTA 2B2UA 2WAQB 3I4MB 3FRPB 3PIO3 2B2TC 2KOLA 4DNRB 2A6ED 2O4XA 4CGYB 4K2KA 2I46A 3A8JE 5CV8A 2YU9B 4TRDA 5I6YA 2F0LA 1Z6HA 4KHVA 4K5WA 2EYMA 3NUCA 1A6XA 2N88A 5M5YB 1XYIA 2NWGA 1JCKB 3HGBA 2WKDA 3RMHA 1UEAB 2ICIA 4M1UB 1EYAA 2QEJC 5FKAC 2BDNA 3GTPB 3RZOB 4DAVA 4BWGB 5FOBB 2A68D 3R93A 1F2YA 3BDLA 4J8QA 4S3SA 1PTOC 2JEBI 3PUZA 4QIWB 1LTTD 1WD1A 3Q0AA 2R3ZA 5NUCA 3OIQA 4C3IB 1S4ZA 5IGBA 1KLUD 1NCVA 2D62A 1R4QB 1NSNS 1PLFA 4K14A 4RAUC 3AMUA 1FNWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XQJ A;  4CBV A;  4XYQ A;  4XQN A;  4XXE A;  4XYO A;  4XQQ A;  3BS1 A;  4G4K A; 
#chains in the Genus database with same CATH topology
 2QW7 A;  1HPC A;  1VQI A;  1TWA B;  4TVA B;  3CPF A;  2E2H H;  3HZX A;  5C3E B;  2A6H C;  2F0N A;  4A3C G;  1IW7 D;  3KLW A;  1VQF A;  1B3Q A;  2NN6 I;  3H15 A;  4X3U A;  2PYK A;  2F0G A;  2F4V Q;  5ELD A;  4LF9 Q;  1LUZ A;  4DR2 Q;  5EJW A;  3G71 A;  1CSP A;  2XNA C;  1NBW A;  1LT4 D;  3VR4 A;  3HKZ G;  1TWA H;  4HJ5 A;  2LSS A;  5C3E H;  1YJW A;  1V43 A;  1GJX A;  1Y1V G;  3ERO A;  5EPJ A;  2CHB D;  1KDA A;  2H4O A;  3KUP A;  1O7L A;  1QUQ A;  1B9M A;  4OO1 G;  2MUY A;  2A1A A;  1PH5 A;  4A3D B;  4MN3 A;  2R92 B;  5LHY 1;  2VS1 A;  1WCM B;  1AP0 A;  2BA1 A;  4IQZ A;  3KFU A;  3S1R B;  4A3D H;  2RDG A;  1BBX C;  2BE5 D;  4OWT B;  1WD0 A;  2R92 H;  4JK1 C;  2B2W A;  1H9S A;  1QZH A;  1SYG A;  2G5D A;  2NTS A;  1VQ8 A;  4CJ2 C;  4C3J G;  4ZYS A;  2BH8 A;  3S1R H;  1UE5 A;  3HOW G;  1CTM A;  1SR3 A;  4B08 A;  1PH3 A;  1D7Q A;  4DV6 L;  4RGM A;  5C3W A;  3GTO B;  1STA A;  4IPG A;  4BS9 A;  1WTV A;  3QOL A;  4L63 B;  2A69 C;  3KLS X;  4LW1 A;  2NN6 H;  4B3R Q;  4K5V A;  2ZXP A;  3W3A A;  3TS2 A;  5KNC A;  1STY A;  2UUC L;  3GTO H;  4XTC S;  2KCN A;  2WB1 B;  3FHW A;  4DR7 Q;  3K6O A;  4FXD A;  4ZUI A;  4K5X A;  4LF4 L;  1G8Z D;  1DD2 A;  4RHR A;  4DUZ L;  1PZJ D;  3S14 B;  5IYB G;  2IW3 A;  4IUP A;  1JB3 A;  3ER0 A;  3NEL A;  1QCB D;  1UAP A;  1IKM A;  1YEZ A;  4A3L H;  5J39 A;  5LMN L;  5ELB A;  2EYL A;  2F0W A;  3S14 H;  4MTK A;  2E2J H;  3BYY B;  4WFN 3;  1N33 L;  3PO3 G;  1LV9 A;  1SE2 A;  1UE7 A;  3KF8 B;  2R7Z B;  1YHB A;  3K7A B;  5CV4 A;  2K28 A;  4KD4 A;  4A3M G;  5KYL A;  1HJP A;  3T1Y L;  1LTL A;  1JQY D;  1F9Q A;  1PTO D;  3J81 c;  5E1F A;  3W5O A;  2R7Z H;  4NXN L;  1N8R C;  1IYJ B;  2Q8R E;  3K7A H;  1I94 Q;  2ALY B;  1XX8 A;  3ND9 A;  1PZK D;  3OIP A;  2HHH Q;  2YTY A;  1J9O A;  4PMW A;  3VR6 A;  4JYA L;  1C9O A;  2B2T A;  2HIX A;  3DHQ A;  3GQB A;  3IFD A;  2PCF B;  1EQV A;  1EY7 A;  2UU9 Q;  3NQT A;  3DXJ C;  1DZ1 A;  4A3J B;  1HNW Q;  3U9S A;  1OXX K;  2WIN B;  2CWP A;  3BS1 A;  2SNM A;  5JVH 3;  1AH9 A;  2G9H D;  4HSV A;  4BA2 I;  3NEM A;  4HSP A;  2QEX A;  1C7Y A;  4HMJ A;  3SHL A;  1TR5 A;  4CHT B;  1K0S A;  1R9T B;  5C0X G;  2EY6 A;  1K8G A;  2I5H A;  1D5M C;  5E7N A;  2XIW A;  3NTI A;  4A3J H;  3H6M A;  1KD1 C;  3HOV G;  3GTQ B;  4LFA L;  1KL9 A;  3TSS A;  4EQP A;  1IKL A;  5CC4 A;  1EL0 A;  2XSC A;  1BCP F;  2F0H A;  3RZD B;  3X3M A;  3KK7 A;  1R9T H;  3R8B A;  4OX9 Q;  4RH6 A;  3OW2 A;  4DN4 M;  4JI3 Q;  2GN5 A;  3GTQ H;  4R4Q A;  3HOZ B;  1OTC A;  3DM3 A;  2I07 B;  2UUB L;  2F0V A;  5C44 B;  5BR8 Q;  3TP6 A;  2DJF C;  4GZY C;  4DNT B;  2Q8I B;  3E9H A;  3RZD H;  1EZ6 A;  1HNX L;  4YIJ A;  1KLG D;  1Y8O B;  1PHJ A;  1QOH A;  2CH4 A;  3DMU A;  3T56 B;  3O13 A;  3HOZ H;  5JEA G;  5LL6 X;  1E2W A;  4L5S A;  2AWO A;  5C44 H;  4G7Z C;  4UP8 A;  2D0O A;  4RGO S;  5LMU L;  4QB4 A;  2B3G A;  3GD7 A;  4P71 A;  3KDF A;  2R61 A;  2L0C A;  4G4K A;  2ZM6 Q;  1ENC A;  4A93 G;  4L5R C;  4ZLT F;  5C3X A;  3PF4 A;  3S2D B;  1K0R A;  5DM6 3;  1MJC A;  5FLX c;  5ELF A;  5C0X J;  3Q23 A;  4CKB A;  4XDX A;  1PFN A;  2Q8T A;  2A69 D;  3K81 C;  2XWB B;  1S3O A;  3A8I E;  4B3T Q;  4EQO A;  1LTI D;  2L11 A;  1GUS A;  3OYY A;  3S2D H;  2F0J A;  2R6G A;  4IUQ A;  5ISR A;  4KD3 A;  1IHZ A;  1GUO A;  2IWH A;  4A76 A;  2B2Y C;  1PMR A;  2D2C C;  3I70 A;  3HEJ A;  2RCN A;  5IWA L;  3KJP A;  2FMC A;  4FYD A;  2AUJ D;  4EVO A;  3NHH A;  5AJ3 L;  3OWE B;  2FJ2 A;  2AUK A;  2IX3 A;  4Y7N B;  4DR4 Q;  3OMC A;  4CDE C;  4F8M A;  4A3K B;  2Z0S A;  2IL8 A;  4APV A;  5JEA J;  4IFD G;  3MAQ A;  2KQ3 A;  3NWS A;  3KJO A;  1SNM A;  4R4I A;  3ZJY C;  3MXN B;  3NPP A;  4Y7N H;  5LMN W;  1KC8 C;  4QL5 A;  2JEA I;  1XTC D;  4A3K H;  3KF6 B;  4ZAI A;  3TZU A;  2F4V L;  2RBM A;  1NMF A;  2MHV A;  4DR2 L;  4LF6 Q;  5IT9 c;  2CH4 W;  1CHP D;  5T1I A;  3SEB A;  1CQV A;  3FMC A;  5C6A A;  1VQC A;  2CKZ B;  3I56 A;  3F8T A;  4UHV A;  1IL2 A;  1YI2 A;  1ENA A;  4X62 Q;  2ENB A;  1SYB A;  1C48 A;  1SE8 A;  1A63 A;  5HUR A;  4YWL A;  5KNB A;  1V9P A;  1HZB A;  4NPS A;  2F0U A;  1QB5 D;  1VQA A;  2WFW A;  3EQL C;  3OMG A;  2A74 C;  4BY1 B;  4KKU A;  2EYO A;  4WRD A;  4A3G H;  3RN5 A;  4AYB E;  2NVX B;  2NTT A;  1VQG A;  4RMF A;  1T9H A;  3IFT A;  3S1N B;  1D5X C;  4ILW A;  5C4H A;  2RQX A;  1VQK A;  2XWJ B;  4A3B G;  5EKK A;  3I4N G;  4BY1 H;  1N9W A;  1ILP A;  3TP8 A;  4XXE A;  1PVO A;  3CME A;  4XIG S;  1UE1 A;  2NVX H;  1X6O A;  3S1N H;  4MTN A;  4IFD J;  5IYD H;  4KLK A;  4ID6 A;  2KJX A;  2L1B A;  2JA8 B;  1EU3 A;  1ML0 D;  1V1P B;  3E6Z X;  4JI2 L;  5EKL A;  4FVM A;  1E0B A;  4NP5 A;  1E2V A;  3CCU A;  4BBS G;  1XXG A;  2NBF A;  4JI7 Q;  2JA8 H;  3SK5 A;  3MEH A;  5GAD C;  4B3R L;  4DUY Q;  1E2Z A;  5KEE A;  4K6D A;  5ELE A;  4DV2 Q;  5D3D A;  4B3S Q;  4HCE A;  4DR7 L;  1H9R A;  5DEH A;  1CM9 A;  1A3T A;  2CQA A;  3PO2 B;  1KQS A;  1LAB A;  1TS4 A;  1AE2 A;  2RDF A;  3D6W A;  1CKN B;  1Q7Y C;  4B3M Q;  2ZJP A;  3CRL C;  5EPL A;  5FO7 B;  1G29 1;  2UXD L;  4JBM A;  1Y8N B;  2Z6B A;  3SGI A;  5EGT A;  1VQP A;  1PH9 A;  3P7J A;  3PO2 H;  3KOJ A;  1K73 C;  4V0B A;  4YCV A;  3HOU B;  5M3F H;  3M7N A;  2LFN A;  3GTL B;  1GVP A;  3CQZ B;  3MEF A;  1DOM A;  1F2L A;  2GVB A;  4P74 A;  3UDG A;  3J80 c;  4RGN A;  1CI3 M;  1MD2 D;  3A54 A;  1YNJ D;  1U4L A;  3JAM c;  3HOU H;  4GN3 B;  4JBW A;  1T5E A;  3I90 A;  4F87 A;  1V8Q A;  3GTL H;  2PZW A;  3CQZ H;  3OOC A;  1GHK A;  1I94 L;  3I91 A;  2EY5 A;  1D1K A;  1S5C D;  4DPG A;  1M90 C;  3H0G B;  4OGQ C;  1II3 A;  1FR3 A;  4L5T A;  2ZJR A;  3LNN A;  2AMC B;  3STB C;  3SXH A;  1EY8 A;  4PMB A;  4P2C B;  3S1Q B;  4JOI A;  1ASZ A;  3I7F A;  5KRU A;  5FJ8 G;  3H0G H;  1HNW L;  4WOR A;  2NZO A;  1ET6 A;  1XTD A;  1ZKO A;  1SMY C;  3OW7 A;  2E2I H;  3N52 A;  1Y1W G;  5EBC A;  3BZC A;  4LUO A;  3CD6 A;  2TMP A;  2JSO A;  1C0A A;  1RD9 D;  5K36 G;  2E8G A;  1XJV A;  1LM0 A;  3HKZ E;  1IW7 C;  4C1N K;  4QUF A;  1V1O A;  4F88 A;  2DUD A;  1D8L A;  1KTK A;  4M8A A;  2NB0 A;  1EYD A;  2XRS D;  4PZ7 A;  1E1O A;  3N6R A;  1O80 A;  2V1C C;  3PUV A;  1TWH B;  1I4P A;  4JI3 L;  4UP9 A;  1PDQ A;  1YHQ A;  2B63 B;  1H95 A;  2N49 A;  4LFC L;  3EN2 A;  4KK7 A;  2E2D C;  3Q22 A;  2WAC A;  5COY A;  2EYP A;  3UDI A;  2K33 A;  1A15 A;  3OPO A;  4NDX A;  5C5M A;  4DK3 C;  1SAP A;  1SBB B;  5CR3 A;  3RNU A;  3IRB A;  4H44 C;  2FIN B;  1TWH H;  1JWS D;  5L37 A;  4A3F G;  2B63 H;  3NSW A;  4GN4 B;  2HUG A;  1BNZ A;  4ME5 A;  1TY2 A;  2MJ8 A;  3CKI B;  1ICF B;  4WJW A;  3A55 A;  1EOT A;  4AYB G;  1U0L A;  3TEH B;  2PQA A;  4X64 Q;  1I4X A;  1FJG Q;  3CU7 A;  1CA6 A;  1N34 Q;  2ZXR A;  2ZM6 L;  1BUV T;  2KHS A;  2K05 A;  5HY6 A;  4R8N A;  2K5H A;  1ZEQ X;  3S16 B;  4N8F A;  2XRQ D;  4L6T B;  3ULJ A;  3I4M G;  1RTN A;  1STN A;  1Z9F A;  1VQJ A;  2O5I C;  3T1H L;  1X3P A;  4B3T L;  4DK6 C;  3R2I A;  1YHA A;  2HD3 A;  1VQ5 A;  1P16 A;  4LUV A;  5JPN C;  2OQK A;  2Y0S E;  1B50 A;  3S15 B;  2E5L Q;  3S16 H;  1EU4 A;  4EQ5 A;  1HUM A;  1SRU A;  1KRS A;  1VQ4 A;  1L1O B;  1TS2 A;  3WOE A;  1PH7 A;  3S15 H;  1XNR Q;  1F9R A;  5I9P A;  4DR4 L;  2RDH A;  1YBY A;  2AQ2 B;  3EJI A;  4HIK A;  1VQB A;  3VYT A;  4H02 A;  4BA1 I;  4X66 L;  1NY4 A;  4IUR A;  4BY7 B;  1PFB A;  2UXB Q;  1SRO A;  4LF6 L;  2JA6 B;  2GA4 B;  2KUM A;  3RLN A;  3VR2 A;  1RTO A;  2ICE C;  2L15 A;  4U67 3;  4BY7 H;  3P1H A;  3GDE A;  4LUZ A;  2WKC A;  4IUV A;  3NBH B;  4C3H B;  2NVY B;  4X62 L;  3J81 j;  4JI0 Q;  4QUC A;  2B29 A;  3U50 C;  5KND A;  2K4K A;  2JA6 H;  1E3P A;  1B1Z A;  3PMF A;  2VQF Q;  5EKI A;  4KKS A;  3QJY A;  4RGT A;  2O5J C;  1BVS A;  1BCP C;  2E2H B;  2K6A A;  1JE4 A;  1MIU A;  2WP8 J;  4C3I G;  4HJ7 A;  3AEV A;  4BBR H;  2QF7 A;  2ZT9 C;  3D4W A;  4I65 A;  4JI6 L;  4K0K Q;  1SMY D;  4YY3 Q;  4R4C A;  2KCC A;  3J7A 5;  2TSS A;  4UPA A;  1DGS A;  2J0T D;  3CP0 A;  1JOK A;  2NYZ D;  2VZA A;  4HIO A;  4JW0 A;  1NJI C;  1QNK A;  1F2Z A;  5DM7 3;  2HQE A;  2JE6 I;  3UDX A;  1IBM Q;  1LTR D;  2F0D A;  3NBI A;  3H3V I;  2CCZ A;  1XPO A;  4TKO B;  1ASY A;  3D4D A;  2D0P A;  3E0J A;  3LWE A;  4Z9C B;  4DV0 Q;  3M4Y A;  4WJ3 M;  4G57 A;  5G3L F;  1SYD A;  1SEB D;  1IBK L;  2UXC Q;  4PMC A;  1EWC A;  4JI7 L;  1EIH A;  1HQM C;  2DGY A;  2F3I A;  2KHJ A;  4DUY L;  2IHF A;  3WOF A;  1Y1V B;  1EOV A;  4FP5 D;  4C56 C;  4DV2 L;  4B3S L;  4R8I A;  1MI2 A;  1EY0 A;  2OQ0 A;  4HCS A;  3NQI A;  4A3D G;  2RCF A;  4H7B A;  1ONL A;  1F2M A;  2R92 G;  2O2L D;  4LAA A;  2NVT H;  1TY0 A;  2VW9 A;  1WCM G;  2UUA Q;  4OWW B;  1K9M C;  4NXM Q;  1SYF A;  1Y1V H;  5KIX A;  1JIC A;  3CCE A;  3IKJ A;  1L0Y B;  1FNV A;  2KEC A;  2MGS A;  1T5X D;  5M3M G;  5IOC A;  1O7I A;  1MKH A;  3ONA B;  5LL6 S;  2KEE A;  2SNS A;  3D0F A;  2E75 C;  2VNU D;  1CZW A;  4XT3 B;  3FDT A;  1OO9 B;  4POG A;  2PMZ E;  2EIF A;  3BYT B;  4KY7 A;  1Q3L A;  1J5E Q;  2VUM G;  1STE A;  5KYI A;  1ESR A;  2F1M A;  1KXL A;  5A2Q L;  2QDB A;  1L2F A;  1F9P A;  1AZQ A;  4LF7 L;  3TP7 A;  3L0O A;  2Z6K A;  1CSQ A;  1PYB A;  2ASB A;  1VMC A;  2Y0S G;  3HOW B;  1PTO B;  3WWV A;  3CCS A;  3G6J B;  3PIP A;  3H3V H;  4A4I A;  1KAB A;  4G7O C;  3TDQ A;  2XTI A;  2XVS A;  2E76 C;  1W6K A;  4FO2 A;  3TQY A;  4DV5 Q;  3C1F A;  1HHV A;  3UE1 A;  4XQJ A;  2E2J B;  2XN9 C;  3VR5 A;  1HUN A;  2RSO A;  1UE6 A;  4C3J H;  3HOW H;  1PTO H;  4R9W A;  3BZK A;  4IOC A;  2VQE L;  1JB7 A;  4DXG A;  2K01 A;  3I55 A;  2C35 B;  1KIX A;  4DU9 A;  4OEL B;  1FYC A;  3A8K E;  2X6L A;  1EY4 A;  4LJZ C;  1NNX A;  1BF4 A;  2N55 A;  4X3S A;  5C0X I;  2R7Z G;  3GTK B;  3BVM A;  3MHB A;  2QIL A;  3D8G A;  3SK8 A;  3IAY A;  4PNY A;  2JN4 A;  1HFG A;  2CWA A;  5IYB H;  3WDN A;  4PZ6 A;  2B8F A;  4JVZ A;  1N36 L;  3HOY B;  3PO3 B;  1XNQ L;  1GD7 A;  2IJ0 A;  2C5C A;  3G7L A;  1SDF A;  3GTK H;  4GNX B;  4POF A;  1XMO Q;  1G6Z A;  2NUC A;  1BCP D;  3VYR A;  4DAY B;  2FXQ A;  1OXT A;  1F77 A;  1Z47 A;  4JI1 Q;  3K7U C;  3CF5 A;  3HOY H;  3PO3 H;  1K3B C;  4DR5 Q;  4QJF A;  5GAG C;  4GKJ L;  3G4S A;  3E9I A;  3J7Y W;  3PUY A;  4X3T A;  3J81 L;  3SVM A;  4A3J G;  2ZXO A;  3BDO A;  5IIF A;  4IUN A;  1S72 A;  2F0E A;  1STB A;  2AQ3 B;  3HP3 A;  1WTP A;  3EBE A;  4YWM A;  2JA7 G;  4OL7 A;  1FJG L;  1CT1 D;  4GOP B;  3BZD B;  5IE8 A;  1N34 L;  2K5D A;  1G2T A;  1A2T A;  5FLM H;  2AKW B;  4LF8 Q;  3BG3 A;  3F2U A;  3F1Z A;  2PZT A;  4A3I G;  1EWH A;  2Q2T A;  2EY1 A;  2F0O A;  1H9M A;  4N8X 1;  3HKS A;  2HCI A;  3U58 A;  4JOI C;  2ATW A;  2Z4I A;  4ZKB B;  1Y69 U;  3ULP A;  1O7Y A;  2E5L L;  4MZ9 A;  5COR A;  4CKE A;  5C44 G;  4B9W A;  1EIF A;  1WYD A;  1OXU A;  4X65 Q;  5C0X H;  3J80 E;  3DLL A;  1K8O A;  1GM5 A;  3HOV H;  1KAA A;  1XNR L;  2OTJ A;  4DV7 L;  3CCM A;  4QCL A;  1S40 A;  5FO8 B;  1SND A;  2D9U A;  3V05 A;  1X3Q A;  1YJN A;  2HIV A;  4DR3 Q;  3I3C A;  5IGD A;  1LO5 D;  4FF1 A;  5JAV A;  2K50 A;  1TS3 A;  1Y14 B;  1XMQ Q;  1DYQ A;  4DR1 L;  3L3O C;  5GAH C;  4FF3 A;  4PQX A;  5JEA H;  1HZC A;  4KKT A;  2WV6 D;  1XPR A;  1EY6 A;  2RHQ B;  3E0E A;  3R2T A;  2EYH A;  3PIP 3;  1YNJ C;  2F0K A;  2PQE A;  2JK8 A;  4FXG C;  2IY5 B;  3CC7 A;  1Q8I A;  1RHP A;  4DK0 A;  4RKL A;  4DFA A;  3MXP A;  3CC4 A;  2VQF L;  1UNS A;  1GKH A;  3CAM A;  5FLX L;  2R7F A;  5GAE C;  1I6H B;  3L9A X;  3V2T A;  4A93 H;  5EBD A;  2LXK A;  4KY6 A;  4MNO A;  5JJI A;  2H5X A;  2L55 A;  4KN4 C;  4ULL A;  3KF8 A;  3A7L A;  3I72 A;  5I2X A;  4JV5 L;  5C4X B;  3A0J A;  3K57 A;  4DXF A;  3S9W A;  4IZ8 A;  1PRT B;  1I6H H;  1LT3 D;  4ALP A;  2F3W A;  5H1S E;  1SYE A;  3OHX C;  4LF9 L;  1J8I A;  5C4X H;  1TWC B;  1IBM L;  1H9J A;  1B70 B;  4O0A A;  4GNX A;  1E22 A;  1M4V A;  4CKC A;  4YHH Q;  1DJR D;  3S17 B;  4GLA C;  1PH1 A;  4A3G B;  5E4X A;  1EYC A;  1RL2 A;  1TWC H;  2UXC L;  2ES2 A;  1I4H A;  2KA7 A;  2PW5 A;  3I73 A;  3F2C A;  1WTW A;  4HIM A;  3K59 A;  3QIA A;  3S17 H;  1JJC B;  4KY5 A;  5IT9 L;  1YZ6 A;  4BY1 G;  2DY8 A;  2N78 A;  4KJO A;  5BN5 A;  3FKI G;  3VDY A;  3FPU B;  3ICE A;  1K83 B;  4K2L A;  1D6E C;  1RIP A;  3FEW X;  2UUA L;  3JC6 6;  1JWM D;  4N9P A;  3K5O A;  1B53 A;  1X3F A;  1A62 A;  1KHI A;  2HQL A;  3K80 C;  1K83 H;  1S5E D;  2K14 A;  5M5X B;  1PV4 A;  2F0M A;  2MO0 A;  3MTS A;  2SEB D;  2A73 B;  2JA8 G;  1WJJ A;  1DON A;  3RN2 A;  4QQB X;  4GLV B;  5EPK A;  3EA6 A;  1IZ6 A;  1YIJ A;  1J5E L;  2K32 A;  3SE0 A;  3TRE A;  1RJT A;  3J7Z C;  2NZ1 D;  5M5X H;  3KLR A;  1VQE A;  4DV3 Q;  5JJZ A;  4F7X A;  1QZG A;  3I4N H;  4BXX G;  2OT2 A;  1RKN A;  3ITP A;  3FVQ A;  4LNQ A;  4XYO A;  2K75 A;  1OXS C;  3PF5 A;  5IY0 A;  1FD7 D;  3D31 A;  1I4Q A;  4BBS B;  2K5W A;  2NZH A;  1RCV D;  3IL8 A;  1IYU A;  2QDL A;  4JPB W;  2NVQ H;  3ERS X;  4OHJ A;  5M3F B;  3PIO A;  2JA5 B;  1PRT F;  3CCJ A;  3LWU A;  2YTV A;  4BBS H;  4X3K A;  1ILQ A;  4RCO A;  2R93 B;  2LXJ A;  4CDF C;  1ZYR C;  2A5H A;  2JA5 H;  2DN8 A;  2FFK B;  3M4P A;  1J6Q A;  3HOU G;  1LTA D;  3U4Z A;  4PZ8 A;  1VF7 A;  3SK6 A;  1NR4 A;  3AU7 A;  2R93 H;  5E3F A;  3RUZ A;  5DNF A;  5M5W B;  3GO5 A;  4RCN A;  5I2Y A;  1TU2 B;  3KBX A;  5DLQ E;  1X3G A;  1LT5 D;  1W2B A;  1BQQ T;  4QMG A;  1FGB D;  4QIW E;  2HHH L;  3QB3 A;  4L5Q A;  4ZQ3 A;  1W6J A;  2E2I B;  4AQY Q;  3H0G G;  4JI1 L;  5M5W H;  4DV6 Q;  1NR2 A;  1CZG A;  3MXN A;  1HRJ A;  3URY A;  3EFX D;  3CW2 C;  4DR5 L;  5M9O A;  3J80 L;  2UU9 L;  3DEP A;  3KF6 A;  1D1I A;  3EIV A;  3JAM L;  1VQM A;  1EFW A;  5IYC G;  2PW7 A;  1L0W A;  1BR9 A;  3RD4 A;  3I8Z A;  1JOQ A;  1EY5 A;  2EPB A;  4NB3 A;  2HT1 A;  1TXY A;  1HA6 A;  2Z6K C;  1LTB D;  1ZXT A;  4KTA A;  4ZUJ A;  5IGG A;  3NTK A;  1AN8 A;  2RKS A;  5JOB A;  4AH6 A;  5A2Q E;  4LF8 L;  5LMN Q;  4K8I A;  4R4O A;  4HED A;  4OX9 L;  3E3X A;  3CXC A;  3R3O A;  1EUJ A;  5IGE A;  1QVG A;  1N33 Q;  5FJ8 H;  2B39 A;  2B63 G;  3TRZ A;  3SDZ A;  5BR8 L;  3CCV A;  1Y1W H;  2D5D A;  3CCQ A;  1SMX A;  1D2B A;  3T1Y Q;  1Q86 C;  5K36 H;  1O78 A;  3RR5 A;  5IP9 G;  5BN3 A;  3GP7 A;  5CV6 A;  1WVL A;  4DV1 Q;  3P20 A;  4TSS A;  1M1K C;  4E6I A;  4QGU A;  1VQD A;  3T53 B;  1V1P A;  1EIY B;  5FK9 C;  1IXR A;  4LFB Q;  2RSN A;  1EIG A;  3UI2 A;  1YNN D;  3BDC A;  4OWX B;  4DR3 L;  3H91 A;  2XGT A;  1AFP A;  1GHJ A;  1K3R A;  4NW2 A;  4HJ8 A;  5CYU A;  2Q2U A;  5I9O A;  1QUQ B;  2F03 A;  1E7Z A;  2RVL A;  1XMQ L;  3K5L A;  2EDG A;  4AYB B;  1VQN A;  1LTS D;  1XWE A;  1SSO A;  2WAQ G;  2KCT A;  4J15 A;  1S5F D;  2KHI A;  4RFB A;  4IAL A;  3PSI A;  2F0S A;  3DUZ A;  1CKN A;  1IYV A;  4CBV A;  3TS0 A;  3CPW A;  2WB1 E;  4I7Z C;  1HQR D;  2BDO A;  1Q82 C;  3S2H B;  4MHE A;  1GUN A;  3J81 E;  1AEX A;  1FL0 A;  1H9S B;  1BBW A;  4IO9 A;  1JOR A;  3W1B A;  1SNO A;  5IP7 G;  1JT8 A;  2K7V A;  3S2H H;  2YV5 A;  3HG9 A;  3DM1 A;  4ZRZ A;  3HOX B;  1K8M A;  1ZYR D;  4UY8 C;  5AFW A;  3FP9 A;  3K0X A;  3M7G A;  2CQO A;  2DNC A;  3D6C A;  2CW0 D;  3U9O A;  4JI8 Q;  2N8N A;  2F4I A;  4UP7 A;  2R7D A;  1HH2 P;  4BY7 G;  1SN8 A;  2LKV A;  4X6A H;  3HOX H;  1I50 B;  3I2Z A;  5CV7 A;  5LMU Q;  1X32 A;  5ELN A;  2EXZ A;  2JA6 G;  3HS0 C;  4FXK C;  2WII B;  1A2U A;  1WTX A;  1YNX A;  4BBR B;  3K0Y A;  4IJL A;  1MJE A;  3V96 A;  2I5L X;  2C9O A;  4C3H G;  1I50 H;  2KEN A;  4HN7 A;  4PG3 A;  4OIK A;  5GQO A;  2F0F A;  2PZU A;  4GN5 A;  3GTG B;  5G3L D;  2K52 A;  3OWF A;  4RA8 A;  1PH6 A;  4A3E B;  3CC2 A;  3H3V C;  4GKK Q;  4OO1 I;  1TKW B;  4XQN A;  1FVI A;  2LMC B;  3RLF A;  3T16 A;  4RWS C;  1PH8 A;  3GTG H;  4ZKC B;  1UUP A;  1PH2 A;  1GOZ A;  3I4L A;  4JI5 Q;  4A3E H;  1PYW D;  1UWV A;  3GTP H;  3RZO H;  1KDC A;  2RA4 A;  5K5P A;  4GLX A;  2BA0 A;  5E4W C;  5AJ3 Q;  3T4A C;  1AE3 A;  5C3E G;  4DAP A;  1V1Q A;  3QR8 A;  3TBI B;  1HZA A;  1I3Q B;  2X69 A;  2MFI A;  2JXM B;  1KAW A;  3HRZ C;  1MHW C;  1MSH A;  1SNP A;  1B44 D;  3G6E A;  4C3I H;  1KNA A;  2M2L A;  1I3Q H;  1SYC A;  4V19 0;  3MXG A;  4DV3 L;  5FLX E;  1JMC A;  1PXU A;  4WJ4 A;  2NVT B;  3HKZ B;  3M9B A;  1QVC A;  4A3C H;  3AQQ A;  2AQ1 B;  1U4P A;  1I5F A;  1DM0 B;  3MZ5 A;  4B3M L;  4EGV A;  1HNZ Q;  2E74 C;  4GNX C;  1G51 A;  2IX0 A;  3M85 A;  1CUK A;  4CDC C;  2V4D A;  4B9X A;  1CQF A;  3VR3 A;  2KED A;  2I5M X;  1Q1B A;  4OO1 H;  2H1E A;  4HR7 B;  1X3E A;  3NK9 A;  1N32 Q;  1Q90 A;  2NN6 G;  2G9D A;  2DJG C;  2HDL A;  1TII D;  1A3V A;  4HJ9 A;  1EEI D;  1L1O A;  2RHS B;  4OXP A;  2OXP A;  4GOP C;  5M3M B;  2A19 A;  4O2D A;  1VQL A;  2L4N A;  3NE5 B;  4DR6 Q;  1WCM H;  4C3J B;  2OEO A;  5IT9 E;  2OWO A;  3K5M A;  1K8A C;  4DV4 Q;  4JI2 Q;  3LX0 A;  3J81 i;  2VUM B;  4KN7 C;  1A3U A;  3T51 B;  4OON A;  4AQY L;  5M3M H;  4A3L G;  2WB1 G;  1SE3 A;  2ZTD A;  1WTO A;  3KDF B;  3PUW A;  1BCP B;  1FNU A;  3MFG A;  4I7A A;  4KHZ A;  3TME A;  3VA5 A;  5J22 A;  3K58 A;  2EYF A;  2Y0S B;  4JC0 A;  2VUM H;  1Q1E A;  5BN4 A;  2YYZ A;  3GV6 A;  3QOJ A;  5HGT A;  3OTO Q;  5HGQ A;  3C3L A;  2PO4 A;  2Z1C A;  1TVX A;  3PV0 A;  3SR1 A;  1JC7 A;  2B2V A;  3CRK C;  2EY2 A;  4JI4 Q;  1VCI A;  2IPK D;  3NBH A;  1EEF D;  5IGF A;  1I4G A;  3KLS A;  5JJL A;  4JBJ A;  1NMG A;  2UXD Q;  2F0I A;  2K04 A;  1JOO A;  4ABN A;  1BBU A;  4P72 A;  1E1T A;  1TQO A;  2M9V A;  1Y8P B;  3PQI A;  3VYS A;  2P5Z X;  2ZJQ A;  1HR0 Q;  3HOY G;  1SJH D;  1G91 A;  1EY9 A;  4A3M B;  2EXD A;  1X55 A;  4LK1 C;  2IX1 A;  4KHP Q;  4EQN A;  5CGK A;  2IT1 A;  1PFM A;  4IUT A;  3VA7 A;  3W1G A;  1EYG A;  2K1B A;  4K8J A;  4A3M H;  1X65 A;  2EJF C;  4DV1 L;  4OEM B;  3C2P A;  2N3S A;  1KDB A;  1KNE A;  3L7Z C;  2QGQ A;  3ZYY X;  5CMD A;  4X64 L;  4LFB L;  1CA5 A;  1Q12 A;  5FLM G;  4HMI A;  1M8A A;  1JE5 A;  1U5K A;  1SNC A;  2JJQ A;  5CBA E;  2Q2I A;  2KBN A;  1BO0 A;  1VQ6 A;  4L8J A;  3CCL A;  3GTM B;  1QNU A;  1AZP A;  4KV6 A;  3D3R A;  1LYL A;  2MQH A;  1VQ9 A;  1PRT C;  2A6H D;  3W2D A;  4FF4 A;  1QE6 A;  2QKI C;  3HFZ B;  1TWG B;  3A56 A;  2JA7 B;  4UAI A;  2EZV A;  3ULL A;  4XQQ A;  1F9S A;  1U4M A;  3HOV B;  2Z4H A;  2ZTC A;  1PTO F;  1MSG A;  2ID0 A;  4Q5V A;  3GTM H;  3HOZ G;  5IGC A;  1DOK A;  5C4J B;  1TWG H;  4JG2 A;  4A3I B;  2JA7 H;  1G2S A;  1K28 A;  1GUW A;  3C1E A;  1PYS B;  3AYH B;  1GXD C;  4RKB A;  3JAM E;  2Z8L A;  1L0X B;  3I4O A;  3MVV A;  4LFC Q;  2L5T A;  1JR0 D;  3CHB D;  3KBG A;  5C4J H;  4ME3 A;  4DK1 A;  4A3I H;  1U9R A;  4IPC A;  3CCR A;  2PI2 A;  4G7H C;  1DOL A;  3MWY W;  1U4R A;  1QVF A;  4J1M A;  3BVZ A;  4IFD I;  5KGU A;  3MC0 B;  1CHQ D;  2QA4 A;  2CFM A;  4JI8 L;  1EZ8 A;  1CKM A;  1EQT A;  2UXB L;  4IJH A;  3J7A V;  1HCZ A;  4HTH A;  2MP1 A;  3PUX A;  1VQO A;  1B4O A;  1A0I A;  2J7Z A;  1G6P A;  3J7A F;  4A93 B;  4Y52 H;  3P75 A;  5CBE E;  4XT1 B;  4JI0 L;  3ND8 A;  3L2P A;  4FNF A;  1LT6 D;  2DY7 A;  4P75 A;  2IHE A;  3M4O B;  2PMZ B;  4GKK L;  3B6Y A;  4PV1 C;  1WI5 A;  3BVG A;  3T1H Q;  2AHO B;  3PCO B;  1TS5 A;  4IN3 A;  1SLJ A;  4ZCK A;  4K0K L;  4YY3 L;  4A3K G;  3QG1 A;  3M4O H;  4OIJ A;  1XPU A;  5I4D A;  2EE1 A;  1ENF A;  2K5N A;  5J1Z A;  4JI5 L;  5C4X G;  5D3I B;  4O42 A;  4FF2 A;  1C8C A;  1LLR D;  2JA9 A;  1JJ2 A;  4CDD C;  1PZI D;  2EJM A;  2OTL A;  1LTG D;  1EQR A;  3C46 A;  2B2U C;  4DAY A;  1NTG A;  4NMZ A;  4DV0 L;  1UEB A;  3TP5 A;  3A5U A;  1FGU A;  1QIL A;  4X66 Q;  1ROD A;  2F0P A;  1NE3 A;  1TT2 A;  4J6H A;  3A7A B;  4JCV E;  4KJN A;  4C1N I;  5ELC A;  4A3G G;  2PPB C;  4IFD H;  1IBL Q;  5D14 A;  2GVA A;  1HXY D;  2FMM A;  1BXT A;  4RHS A;  1WFQ A;  4KMU C;  5J3B A;  2K5V A;  2JP1 A;  4DAM A;  1KRT A;  2BCO A;  1DCZ A;  3T13 A;  4GOP A;  2MNA A;  3CMA A;  1JWU D;  4LWC A;  4IPH A;  4K6L A;  1HNZ L;  1CKO A;  5EAY A;  5IYD G;  4NXM L;  3Q24 A;  5IOD A;  1HFN A;  3NXW A;  3MXU A;  1YNN C;  4LF5 Q;  2M00 A;  3F2B A;  4O1N A;  2PNR C;  4ODG A;  2X6G A;  1EWI A;  3FKI B;  5CV9 A;  5F2D A;  4JI6 Q;  1N32 L;  1VQ7 A;  1SE4 A;  2WAQ E;  1PRT D;  2K03 A;  4A3B B;  5D65 A;  3I4N B;  3TN2 A;  1HTL D;  4LMQ D;  4ZK9 B;  3OSO A;  1HA5 A;  2VB3 X;  2VB2 X;  3MFY A;  3NTH A;  3Q8D A;  3FKI H;  4P73 A;  1OXV A;  3Q6S A;  4A3B H;  4C2M B;  4DR6 L;  3A74 A;  3S1M B;  3J80 i;  2NVQ B;  1B3A A;  2VXW A;  4TQU S;  3JAM i;  2PQA B;  1YIT A;  4YCW A;  4DF7 A;  4H0L C;  3SK4 A;  4DV4 L;  2F3V A;  3DWQ A;  4DV5 L;  4FDB A;  3H09 A;  2EQS A;  4C2M H;  1IBK Q;  5FO9 B;  2KVM A;  3S1M H;  4XYQ A;  3PO2 G;  2BOS A;  1CK1 A;  4HAE A;  1BKB A;  3AB9 A;  3MA2 B;  5M3F G;  2A6E C;  1I6V C;  1E24 A;  2JA5 G;  2QCP X;  2MPM A;  5ELO A;  1GO3 E;  4CJ1 B;  3K8A A;  3OTO L;  2F0Q A;  3UDF A;  4GS3 A;  1O7Z A;  1S5B D;  1EFI D;  1TWF B;  3GV3 A;  4JI4 L;  2A8V A;  4BXX H;  2F52 A;  2R93 G;  2Q2H A;  3NWT A;  4DKA C;  1A8V A;  4NKL A;  2CW0 C;  1SFO B;  4DA2 A;  1NAP A;  4MIU A;  3H94 A;  2MO1 A;  1P8L A;  5C5L A;  1SJE D;  3KYH C;  1HZ9 A;  1TWF H;  3QWN A;  1AW7 A;  2EJG C;  2HCC A;  1B8A A;  1Q46 A;  1SFO H;  2L12 A;  4JBK A;  2SOB A;  3X3N A;  1SNQ A;  1HR0 L;  1STG A;  2OCE A;  1XMO L;  3E5S A;  1SXT A;  2SDF A;  4KHP L;  1RDP D;  2DNE A;  5JPM C;  3K5N A;  2J4X A;  5JVG 3;  5JJK A;  1C4Q A;  4HJA A;  3NP8 A;  4LF7 Q;  3NEN A;  1WTR A;  4IOA A;  1Q8K A;  1Z7T A;  1EQQ A;  2A68 C;  1ESF A;  1RF2 D;  1ET9 A;  3VYU A;  1NUC A;  2EYJ A;  2Z9H A;  4R1J A;  2UUC Q;  1L1O C;  1CFM A;  1STH A;  1VF5 C;  4AIM A;  1QG7 A;  2OF1 A;  2LS0 1;  1GUT A;  2L9H A;  1VDZ A;  4CJ0 B;  4LF4 Q;  3F2D A;  4DUZ Q;  2B2W C;  2KCM A;  3S24 A;  4A75 A;  3EVQ A;  1MGS A;  2LY7 A;  2AWN A;  1WTH A;  3FPP A;  3G48 A;  3DWA A;  3DWP A;  4DGZ A;  1Y1W B;  2I0Q A;  5I6W A;  4HID A;  2VQE Q;  2F0T A;  4H13 C;  1S5D D;  2EVB A;  2HDM A;  2FHT A;  1H9K A;  1ICW A;  2CVR A;  1YVC A;  4KI0 A;  3S1Q H;  5T1G A;  5IYC H;  1R4P B;  1WTQ A;  2JQO A;  3D4R A;  1B9N A;  1D5Z C;  1QJO A;  2JYO A;  4X65 L;  1GUG A;  1VMP A;  2B2V C;  3DEO A;  4EX5 A;  3M3Y B;  1N36 Q;  1WOC A;  3QO2 A;  4NXN Q;  1XNQ Q;  3M4Q A;  4R4T A;  1IL8 A;  4YCU A;  4U68 A;  4Q0F A;  4UDU C;  5C4Z A;  4RG1 A;  1MBY A;  1I4R A;  4A3F B;  1HTP A;  5TSS A;  4JYA Q;  1BDO A;  5GRO A;  1PH4 A;  3M3Y H;  4IUU A;  3ERQ A;  1BOS A;  4GKJ Q;  1LAC A;  5CV5 A;  1VS0 A;  2ZTE A;  2PI2 E;  1DXM A;  4A3F H;  1YJ9 A;  4IPD A;  1B7Y B;  5A35 A;  1X9N A;  2B8G A;  2B2Y A;  2K5Q A;  2YTX A;  4N9T A;  1B2T A;  5DAU A;  3GTJ B;  5IP9 H;  1QWY A;  1PA6 A;  5EQ0 A;  4QY7 A;  1W3S A;  4QF4 A;  2BE5 C;  4LFA Q;  2RF4 A;  2BH2 A;  3TZD A;  2EOT A;  2B2U A;  2WAQ B;  3I4M B;  3GTJ H;  3FRP B;  3RLO A;  1VQH A;  3PIO 3;  2B2T C;  2VY3 A;  2KOL A;  4DNR B;  2A6E D;  2UUB Q;  2O4X A;  3UE0 A;  4CGY B;  4K2K A;  3U4V A;  3I4M H;  1HNX Q;  3AFP A;  2I46 A;  3A8J E;  5CV8 A;  2YU9 B;  3HOX G;  3BU2 A;  4DV7 Q;  4TRD A;  5I6Y A;  2F0L A;  1Z6H A;  2YU9 H;  3BJU A;  4KHV A;  4K5W A;  2EYM A;  1X54 A;  4YHH L;  3NUC A;  1A6X A;  3LGJ A;  2N88 A;  4DNI A;  1XYI A;  5M5Y B;  2NWG A;  2VL6 A;  1JCK B;  3HGB A;  2WKD A;  3RMH A;  3AFQ A;  1UEA B;  1JJG A;  5IP7 H;  4BBR G;  2ICI A;  1IBL L;  4M1U B;  4DR1 Q;  1X56 A;  1EYA A;  1HR0 W;  2QEJ C;  5FKA C;  2BDN A;  5M5Y H;  3GTP B;  3RZO B;  4DAV A;  4BWG B;  5FOB B;  4A3E G;  2A68 D;  1Q81 C;  3R93 A;  1F2Y A;  3BDL A;  4YWK A;  4J8Q A;  4S3S A;  1PTO C;  2JEB I;  3PUZ A;  3PGZ A;  2PNH A;  5IWA Q;  1PFS A;  4QIW B;  1LTT D;  3STB D;  1WD1 A;  3Q0A A;  2R3Z A;  5NUC A;  3OIQ A;  4C3I B;  1S4Z A;  4LF5 L;  4C3H H;  2NVY H;  5IGB A;  1KLU D;  1NCV A;  2D62 A;  1R4Q B;  1NSN S;  1PLF A;  4K14 A;  4RAU C;  3AMU A;  3A5Z B;  4JV5 Q;  1FNW A; 
#chains in the Genus database with same CATH homology
 1HPC A;  1TWA B;  3HZX A;  5C3E B;  2A6H C;  2F0N A;  1IW7 D;  2NN6 I;  4X3U A;  2PYK A;  2F0G A;  5ELD A;  5EJW A;  2XNA C;  1LT4 D;  3VR4 A;  1V43 A;  1GJX A;  3ERO A;  5EPJ A;  2CHB D;  1KDA A;  2H4O A;  3KUP A;  1O7L A;  1B9M A;  4OO1 G;  2MUY A;  4A3D B;  4MN3 A;  2R92 B;  5LHY 1;  1WCM B;  1AP0 A;  2BA1 A;  4IQZ A;  3S1R B;  2RDG A;  1BBX C;  2BE5 D;  1WD0 A;  4JK1 C;  2B2W A;  1H9S A;  1SYG A;  2NTS A;  4CJ2 C;  4C3J G;  4ZYS A;  1CTM A;  4B08 A;  4RGM A;  5C3W A;  3GTO B;  1STA A;  4BS9 A;  1WTV A;  3QOL A;  4L63 B;  2A69 C;  3KLS X;  2NN6 H;  4K5V A;  2ZXP A;  3W3A A;  5KNC A;  1STY A;  4XTC S;  2KCN A;  2WB1 B;  3K6O A;  4FXD A;  4ZUI A;  4K5X A;  1G8Z D;  1DD2 A;  4RHR A;  1PZJ D;  3S14 B;  2IW3 A;  4IUP A;  1JB3 A;  1QCB D;  1UAP A;  1IKM A;  5J39 A;  5ELB A;  2EYL A;  2F0W A;  3BYY B;  4WFN 3;  1LV9 A;  1SE2 A;  2R7Z B;  3K7A B;  5CV4 A;  2K28 A;  4KD4 A;  5KYL A;  1JQY D;  1F9Q A;  1PTO D;  5E1F A;  2Q8R E;  1XX8 A;  3ND9 A;  1PZK D;  3OIP A;  1J9O A;  4PMW A;  3VR6 A;  2B2T A;  3DHQ A;  3GQB A;  3IFD A;  2PCF B;  1EQV A;  1EY7 A;  3NQT A;  3DXJ C;  1DZ1 A;  4A3J B;  3U9S A;  1OXX K;  2WIN B;  3BS1 A;  2SNM A;  5JVH 3;  2G9H D;  4HSV A;  4BA2 I;  4HSP A;  4HMJ A;  3SHL A;  1TR5 A;  4CHT B;  1R9T B;  5C0X G;  2EY6 A;  1D5M C;  2XIW A;  3NTI A;  3H6M A;  3GTQ B;  3TSS A;  4EQP A;  1IKL A;  5CC4 A;  1EL0 A;  2XSC A;  1BCP F;  2F0H A;  3RZD B;  3X3M A;  3KK7 A;  3R8B A;  4RH6 A;  4DN4 M;  3HOZ B;  2I07 B;  2F0V A;  5C44 B;  3TP6 A;  4GZY C;  4DNT B;  2Q8I B;  1EZ6 A;  4YIJ A;  1KLG D;  1Y8O B;  1QOH A;  3DMU A;  3T56 B;  3O13 A;  5JEA G;  5LL6 X;  1E2W A;  2AWO A;  4G7Z C;  4RGO S;  4QB4 A;  3GD7 A;  2R61 A;  2L0C A;  4G4K A;  1ENC A;  4ZLT F;  5C3X A;  3S2D B;  5DM6 3;  5ELF A;  5C0X J;  3Q23 A;  4CKB A;  4XDX A;  1PFN A;  2Q8T A;  2A69 D;  2XWB B;  3A8I E;  4EQO A;  1LTI D;  2L11 A;  1GUS A;  2F0J A;  2R6G A;  4IUQ A;  5ISR A;  4KD3 A;  1IHZ A;  1GUO A;  2IWH A;  2B2Y C;  1PMR A;  2D2C C;  3I70 A;  3HEJ A;  4FYD A;  2FMC A;  2AUJ D;  4EVO A;  3NHH A;  3OWE B;  2FJ2 A;  2AUK A;  2IX3 A;  4Y7N B;  3OMC A;  4F8M A;  4A3K B;  2IL8 A;  5JEA J;  4IFD G;  3MAQ A;  2KQ3 A;  3NWS A;  1SNM A;  3NPP A;  2JEA I;  1XTC D;  4ZAI A;  3TZU A;  2RBM A;  2MHV A;  1CHP D;  5T1I A;  3SEB A;  1CQV A;  3FMC A;  5C6A A;  1ENA A;  2ENB A;  1SYB A;  1C48 A;  5HUR A;  5KNB A;  2F0U A;  1QB5 D;  3EQL C;  3OMG A;  2A74 C;  4BY1 B;  4KKU A;  2EYO A;  4WRD A;  2NVX B;  2NTT A;  3S1N B;  3IFT A;  1D5X C;  4ILW A;  5C4H A;  2RQX A;  2XWJ B;  5EKK A;  1ILP A;  3TP8 A;  4XXE A;  4XIG S;  4IFD J;  4ID6 A;  2KJX A;  2L1B A;  2JA8 B;  1EU3 A;  1ML0 D;  1V1P B;  3E6Z X;  5EKL A;  4FVM A;  1E0B A;  4NP5 A;  1E2V A;  1XXG A;  2NBF A;  3SK5 A;  3MEH A;  1E2Z A;  5KEE A;  4K6D A;  5ELE A;  5D3D A;  4HCE A;  1H9R A;  5DEH A;  1CM9 A;  1A3T A;  2CQA A;  3PO2 B;  1LAB A;  1TS4 A;  2RDF A;  3D6W A;  3CRL C;  5EPL A;  5FO7 B;  1G29 1;  1Y8N B;  5EGT A;  3P7J A;  4V0B A;  3HOU B;  3M7N A;  2LFN A;  3GTL B;  3CQZ B;  1DOM A;  1F2L A;  4RGN A;  1CI3 M;  1MD2 D;  3A54 A;  1YNJ D;  1U4L A;  4JBW A;  1T5E A;  3I90 A;  4F87 A;  1V8Q A;  2PZW A;  3OOC A;  1GHK A;  3I91 A;  2EY5 A;  1D1K A;  1S5C D;  3H0G B;  4OGQ C;  1II3 A;  1FR3 A;  3LNN A;  3SXH A;  1EY8 A;  4PMB A;  4P2C B;  3S1Q B;  5KRU A;  4WOR A;  1ET6 A;  3OW7 A;  1ZKO A;  1SMY C;  3N52 A;  5EBC A;  2TMP A;  2JSO A;  1RD9 D;  5K36 G;  1IW7 C;  4C1N K;  4QUF A;  1V1O A;  4F88 A;  1KTK A;  4M8A A;  2NB0 A;  1EYD A;  2XRS D;  3N6R A;  1O80 A;  3PUV A;  1TWH B;  1I4P A;  1PDQ A;  2B63 B;  4KK7 A;  2E2D C;  3Q22 A;  2WAC A;  5COY A;  2EYP A;  2K33 A;  1A15 A;  3OPO A;  4NDX A;  5C5M A;  1SAP A;  1SBB B;  5CR3 A;  4H44 C;  2FIN B;  1JWS D;  3NSW A;  2HUG A;  1BNZ A;  4ME5 A;  1TY2 A;  2MJ8 A;  3CKI B;  4WJW A;  3A55 A;  1EOT A;  1I4X A;  3CU7 A;  1CA6 A;  2ZXR A;  1BUV T;  2KHS A;  2K05 A;  4R8N A;  1ZEQ X;  3S16 B;  2XRQ D;  4L6T B;  1RTN A;  1STN A;  2O5I C;  1X3P A;  3R2I A;  5JPN C;  1B50 A;  3S15 B;  1EU4 A;  1HUM A;  1TS2 A;  3WOE A;  1F9R A;  5I9P A;  2RDH A;  2AQ2 B;  3EJI A;  3VYT A;  4BA1 I;  4IUR A;  4BY7 B;  1PFB A;  2JA6 B;  2GA4 B;  2KUM A;  3VR2 A;  1RTO A;  2ICE C;  4U67 3;  3P1H A;  2WKC A;  4IUV A;  4C3H B;  2NVY B;  4QUC A;  5KND A;  1B1Z A;  3PMF A;  5EKI A;  4KKS A;  3QJY A;  4RGT A;  2O5J C;  1BCP C;  2E2H B;  2K6A A;  1JE4 A;  2WP8 J;  4C3I G;  2QF7 A;  2ZT9 C;  3D4W A;  4I65 A;  1SMY D;  2KCC A;  2TSS A;  2J0T D;  1JOK A;  2NYZ D;  1QNK A;  1F2Z A;  5DM7 3;  2HQE A;  2JE6 I;  1LTR D;  2F0D A;  3NBI A;  4TKO B;  3D4D A;  3E0J A;  3LWE A;  4Z9C B;  3M4Y A;  4G57 A;  5G3L F;  1SYD A;  1SEB D;  4PMC A;  1EWC A;  1EIH A;  1HQM C;  3WOF A;  1Y1V B;  4FP5 D;  4C56 C;  4R8I A;  1MI2 A;  1EY0 A;  4HCS A;  3NQI A;  4H7B A;  1ONL A;  1F2M A;  2O2L D;  4LAA A;  1TY0 A;  1SYF A;  5KIX A;  1JIC A;  3IKJ A;  1L0Y B;  1FNV A;  2KEC A;  2MGS A;  1T5X D;  5IOC A;  3ONA B;  5LL6 S;  2KEE A;  2SNS A;  2E75 C;  2VNU D;  1CZW A;  4XT3 B;  3FDT A;  1OO9 B;  3BYT B;  4KY7 A;  1Q3L A;  1STE A;  5KYI A;  1ESR A;  2F1M A;  5A2Q L;  2QDB A;  1F9P A;  1AZQ A;  3TP7 A;  1VMC A;  3HOW B;  1PTO B;  3G6J B;  1KAB A;  4G7O C;  3TDQ A;  2XVS A;  2E76 C;  1W6K A;  4FO2 A;  3C1F A;  1HHV A;  4XQJ A;  2E2J B;  2XN9 C;  3VR5 A;  1HUN A;  2RSO A;  1PTO H;  4R9W A;  4DXG A;  2K01 A;  4DU9 A;  1FYC A;  3A8K E;  2X6L A;  1EY4 A;  4LJZ C;  1BF4 A;  2N55 A;  4X3S A;  5C0X I;  3GTK B;  3BVM A;  3MHB A;  2QIL A;  3D8G A;  3SK8 A;  3IAY A;  4PNY A;  1HFG A;  3WDN A;  2B8F A;  3HOY B;  3PO3 B;  2IJ0 A;  2C5C A;  3G7L A;  1SDF A;  1G6Z A;  2NUC A;  1BCP D;  3VYR A;  1OXT A;  1F77 A;  1Z47 A;  3J7Y W;  3PUY A;  4X3T A;  3J81 L;  3SVM A;  2ZXO A;  3BDO A;  5IIF A;  4IUN A;  2F0E A;  1STB A;  2AQ3 B;  3HP3 A;  1WTP A;  4OL7 A;  1CT1 D;  3BZD B;  2K5D A;  1G2T A;  1A2T A;  3BG3 A;  3F2U A;  2PZT A;  1EWH A;  2EY1 A;  2F0O A;  1H9M A;  2HCI A;  2Z4I A;  4ZKB B;  1Y69 U;  1O7Y A;  5COR A;  4CKE A;  4B9W A;  1OXU A;  5C0X H;  3J80 E;  1K8O A;  1KAA A;  4QCL A;  5FO8 B;  1SND A;  2D9U A;  3V05 A;  1X3Q A;  3I3C A;  5IGD A;  1LO5 D;  4FF1 A;  5JAV A;  1TS3 A;  1DYQ A;  3L3O C;  4FF3 A;  4PQX A;  5JEA H;  4KKT A;  2WV6 D;  1EY6 A;  3R2T A;  2EYH A;  3PIP 3;  1YNJ C;  2F0K A;  2PQE A;  4FXG C;  1Q8I A;  1RHP A;  4DK0 A;  4RKL A;  4DFA A;  3MXP A;  1UNS A;  5FLX L;  1I6H B;  3V2T A;  3L9A X;  5EBD A;  4KY6 A;  2L55 A;  4KN4 C;  4ULL A;  3KF8 A;  3A7L A;  3I72 A;  5I2X A;  5C4X B;  3K57 A;  4DXF A;  3S9W A;  4IZ8 A;  1PRT B;  1LT3 D;  2F3W A;  1SYE A;  3OHX C;  1J8I A;  1TWC B;  1H9J A;  1M4V A;  4CKC A;  1DJR D;  3S17 B;  4A3G B;  5E4X A;  1EYC A;  1I4H A;  2KA7 A;  2PW5 A;  3I73 A;  1WTW A;  3K59 A;  3QIA A;  4KY5 A;  5IT9 L;  2DY8 A;  4KJO A;  5BN5 A;  3FPU B;  1K83 B;  4K2L A;  1D6E C;  3FEW X;  1JWM D;  4N9P A;  3K5O A;  1B53 A;  1S5E D;  5M5X B;  2F0M A;  3MTS A;  2SEB D;  2A73 B;  1DON A;  5EPK A;  3EA6 A;  2K32 A;  3SE0 A;  1RJT A;  2NZ1 D;  3KLR A;  5JJZ A;  4F7X A;  2OT2 A;  1RKN A;  3ITP A;  3FVQ A;  4XYO A;  1OXS C;  1FD7 D;  3D31 A;  1I4Q A;  4BBS B;  2K5W A;  1RCV D;  3IL8 A;  1IYU A;  4OHJ A;  5M3F B;  2JA5 B;  1PRT F;  3LWU A;  4X3K A;  1ILQ A;  4RCO A;  2R93 B;  1ZYR C;  2A5H A;  2DN8 A;  2FFK B;  1LTA D;  1VF7 A;  3SK6 A;  1NR4 A;  3AU7 A;  5E3F A;  3RUZ A;  5DNF A;  5M5W B;  3GO5 A;  4RCN A;  5I2Y A;  1TU2 B;  3KBX A;  1LT5 D;  1BQQ T;  4QMG A;  1FGB D;  3QB3 A;  4ZQ3 A;  1W6J A;  2E2I B;  1NR2 A;  1CZG A;  3MXN A;  1HRJ A;  3URY A;  3EFX D;  5M9O A;  3J80 L;  3DEP A;  1D1I A;  3JAM L;  2PW7 A;  1BR9 A;  3RD4 A;  3I8Z A;  1JOQ A;  1EY5 A;  2EPB A;  1HA6 A;  1LTB D;  1ZXT A;  4KTA A;  4ZUJ A;  5IGG A;  3NTK A;  1AN8 A;  2RKS A;  5JOB A;  5A2Q E;  4K8I A;  4HED A;  3R3O A;  5IGE A;  2B39 A;  3SDZ A;  2D5D A;  1D2B A;  5K36 H;  1O78 A;  5BN3 A;  3GP7 A;  5CV6 A;  1WVL A;  3P20 A;  4TSS A;  4E6I A;  3T53 B;  1V1P A;  5FK9 C;  2RSN A;  1EIG A;  3UI2 A;  1YNN D;  3BDC A;  3H91 A;  1AFP A;  1GHJ A;  4NW2 A;  5CYU A;  5I9O A;  2F03 A;  2RVL A;  3K5L A;  2EDG A;  4AYB B;  1LTS D;  1XWE A;  1SSO A;  1S5F D;  4RFB A;  4IAL A;  2F0S A;  3DUZ A;  1IYV A;  4CBV A;  4I7Z C;  1HQR D;  2BDO A;  3S2H B;  4MHE A;  1GUN A;  3J81 E;  1AEX A;  1H9S B;  1JOR A;  1SNO A;  2K7V A;  3HG9 A;  3DM1 A;  4ZRZ A;  3HOX B;  1K8M A;  1ZYR D;  5AFW A;  2DNC A;  3D6C A;  3M7G A;  2CW0 D;  3U9O A;  2F4I A;  2LKV A;  1I50 B;  5CV7 A;  1X32 A;  2EXZ A;  3HS0 C;  4FXK C;  2WII B;  1A2U A;  1WTX A;  4BBR B;  3K0Y A;  3V96 A;  2C9O A;  4C3H G;  4HN7 A;  4OIK A;  2F0F A;  2PZU A;  3GTG B;  5G3L D;  3OWF A;  4RA8 A;  4A3E B;  3H3V C;  4OO1 I;  1TKW B;  4XQN A;  2LMC B;  3RLF A;  3T16 A;  4RWS C;  4ZKC B;  1UUP A;  1GOZ A;  3I4L A;  1PYW D;  1KDC A;  2RA4 A;  5K5P A;  2BA0 A;  5E4W C;  3T4A C;  4DAP A;  3TBI B;  1I3Q B;  2X69 A;  2JXM B;  3HRZ C;  1MSH A;  1SNP A;  1B44 D;  1KNA A;  2M2L A;  1SYC A;  4V19 0;  3MXG A;  5FLX E;  1PXU A;  2NVT B;  3HKZ B;  2AQ1 B;  1U4P A;  1DM0 B;  3MZ5 A;  4EGV A;  2E74 C;  2IX0 A;  3M85 A;  2V4D A;  4B9X A;  1CQF A;  3VR3 A;  2KED A;  1Q1B A;  4OO1 H;  2H1E A;  4HR7 B;  3NK9 A;  1Q90 A;  2NN6 G;  2G9D A;  2HDL A;  1TII D;  1A3V A;  1EEI D;  2OXP A;  5M3M B;  2L4N A;  3NE5 B;  4C3J B;  2OEO A;  5IT9 E;  3K5M A;  3LX0 A;  2VUM B;  4KN7 C;  1A3U A;  3T51 B;  1SE3 A;  1WTO A;  3PUW A;  1BCP B;  1FNU A;  3MFG A;  4KHZ A;  3TME A;  5J22 A;  3VA5 A;  3K58 A;  2EYF A;  2Y0S B;  1Q1E A;  5BN4 A;  2YYZ A;  3GV6 A;  3QOJ A;  5HGT A;  3C3L A;  2PO4 A;  2Z1C A;  1TVX A;  3PV0 A;  3SR1 A;  1JC7 A;  2B2V A;  3CRK C;  2EY2 A;  1VCI A;  2IPK D;  3NBH A;  1EEF D;  5IGF A;  1I4G A;  3KLS A;  2F0I A;  2K04 A;  1JOO A;  4ABN A;  1TQO A;  2M9V A;  1Y8P B;  3VYS A;  1SJH D;  1G91 A;  1EY9 A;  4A3M B;  4LK1 C;  2IX1 A;  4EQN A;  5CGK A;  2IT1 A;  1PFM A;  4IUT A;  3VA7 A;  2K1B A;  4K8J A;  2EJF C;  3C2P A;  1KDB A;  1KNE A;  3L7Z C;  3ZYY X;  5CMD A;  1CA5 A;  1Q12 A;  4HMI A;  1M8A A;  1SNC A;  5CBA E;  1BO0 A;  4L8J A;  3GTM B;  1QNU A;  1AZP A;  4KV6 A;  3D3R A;  1PRT C;  2A6H D;  3W2D A;  4FF4 A;  1QE6 A;  2QKI C;  1TWG B;  3A56 A;  2JA7 B;  4UAI A;  2EZV A;  4XQQ A;  1F9S A;  1U4M A;  3HOV B;  2Z4H A;  4Q5V A;  1PTO F;  1MSG A;  2ID0 A;  5IGC A;  1DOK A;  5C4J B;  4A3I B;  1G2S A;  1GUW A;  3C1E A;  1GXD C;  4RKB A;  3JAM E;  2Z8L A;  1L0X B;  3MVV A;  2L5T A;  1JR0 D;  3CHB D;  3KBG A;  4DK1 A;  1U9R A;  4G7H C;  1DOL A;  3MWY W;  1U4R A;  4J1M A;  3BVZ A;  4IFD I;  5KGU A;  3MC0 B;  1CHQ D;  1EZ8 A;  1EQT A;  3J7A V;  1HCZ A;  4HTH A;  2MP1 A;  3PUX A;  1B4O A;  2J7Z A;  3J7A F;  4A93 B;  3P75 A;  5CBE E;  4XT1 B;  3ND8 A;  4FNF A;  1LT6 D;  2DY7 A;  3M4O B;  2PMZ B;  4PV1 C;  3BVG A;  1TS5 A;  4IN3 A;  3QG1 A;  4OIJ A;  5I4D A;  2EE1 A;  1ENF A;  5J1Z A;  5D3I B;  4O42 A;  4FF2 A;  1C8C A;  1LLR D;  1PZI D;  2EJM A;  1LTG D;  3C46 A;  2B2U C;  4DAY A;  4NMZ A;  3TP5 A;  1QIL A;  1ROD A;  2F0P A;  1TT2 A;  4J6H A;  3A7A B;  4KJN A;  4C1N I;  5ELC A;  2PPB C;  4IFD H;  5D14 A;  1HXY D;  2FMM A;  1BXT A;  4RHS A;  4KMU C;  2JP1 A;  2BCO A;  1DCZ A;  3T13 A;  1JWU D;  4K6L A;  3Q24 A;  5IOD A;  1HFN A;  3NXW A;  3MXU A;  1YNN C;  2M00 A;  4O1N A;  2PNR C;  4ODG A;  2X6G A;  3FKI B;  5CV9 A;  5F2D A;  1SE4 A;  1PRT D;  2K03 A;  4A3B B;  5D65 A;  3I4N B;  3TN2 A;  1HTL D;  4LMQ D;  4ZK9 B;  3OSO A;  1HA5 A;  2VB3 X;  2VB2 X;  3MFY A;  3NTH A;  1OXV A;  3Q6S A;  4C2M B;  3S1M B;  2NVQ B;  1B3A A;  2VXW A;  4TQU S;  4DF7 A;  4H0L C;  3SK4 A;  2F3V A;  3DWQ A;  3H09 A;  5FO9 B;  2KVM A;  4XYQ A;  2BOS A;  1CK1 A;  4HAE A;  3AB9 A;  3MA2 B;  2A6E C;  1I6V C;  2QCP X;  2MPM A;  4CJ1 B;  2F0Q A;  1O7Z A;  1S5B D;  1EFI D;  1TWF B;  3GV3 A;  3NWT A;  4NKL A;  2CW0 C;  1SFO B;  4DA2 A;  1NAP A;  4MIU A;  3H94 A;  5C5L A;  1SJE D;  3QWN A;  1AW7 A;  2EJG C;  2HCC A;  2L12 A;  2SOB A;  3X3N A;  1SNQ A;  1STG A;  3E5S A;  1SXT A;  2SDF A;  1RDP D;  2DNE A;  5JPM C;  3K5N A;  2J4X A;  5JVG 3;  1C4Q A;  3NP8 A;  1WTR A;  1Z7T A;  2A68 C;  1ESF A;  1RF2 D;  1ET9 A;  3VYU A;  1NUC A;  2EYJ A;  1CFM A;  1STH A;  1VF5 C;  1QG7 A;  2OF1 A;  2LS0 1;  1GUT A;  2L9H A;  1VDZ A;  4CJ0 B;  2B2W C;  3EVQ A;  1MGS A;  2LY7 A;  2AWN A;  3FPP A;  1Y1W B;  3DWA A;  3DWP A;  4DGZ A;  5I6W A;  2F0T A;  4H13 C;  1S5D D;  2EVB A;  2HDM A;  2FHT A;  1H9K A;  1ICW A;  2CVR A;  4KI0 A;  5T1G A;  1R4P B;  1WTQ A;  3D4R A;  1B9N A;  1D5Z C;  1QJO A;  2JYO A;  1GUG A;  1VMP A;  2B2V C;  3DEO A;  3M3Y B;  3QO2 A;  1IL8 A;  4U68 A;  4Q0F A;  4UDU C;  5C4Z A;  1MBY A;  1I4R A;  4A3F B;  1HTP A;  5TSS A;  1BDO A;  4IUU A;  3ERQ A;  1BOS A;  1LAC A;  5CV5 A;  1DXM A;  5A35 A;  2B8G A;  2B2Y A;  2K5Q A;  4N9T A;  1B2T A;  5DAU A;  3GTJ B;  1QWY A;  5EQ0 A;  4QF4 A;  2BE5 C;  3TZD A;  2EOT A;  2B2U A;  2WAQ B;  3I4M B;  3FRP B;  3PIO 3;  2B2T C;  2KOL A;  4DNR B;  2A6E D;  2O4X A;  4CGY B;  4K2K A;  2I46 A;  3A8J E;  5CV8 A;  2YU9 B;  4TRD A;  5I6Y A;  2F0L A;  1Z6H A;  4KHV A;  4K5W A;  2EYM A;  3NUC A;  1A6X A;  2N88 A;  5M5Y B;  1XYI A;  2NWG A;  1JCK B;  3HGB A;  2WKD A;  3RMH A;  1UEA B;  2ICI A;  4M1U B;  1EYA A;  2QEJ C;  5FKA C;  2BDN A;  3GTP B;  3RZO B;  4DAV A;  4BWG B;  5FOB B;  2A68 D;  3R93 A;  1F2Y A;  3BDL A;  4J8Q A;  4S3S A;  1PTO C;  2JEB I;  3PUZ A;  4QIW B;  1LTT D;  1WD1 A;  3Q0A A;  2R3Z A;  5NUC A;  3OIQ A;  4C3I B;  1S4Z A;  5IGB A;  1KLU D;  1NCV A;  2D62 A;  1R4Q B;  1NSN S;  1PLF A;  4K14 A;  4RAU C;  3AMU A;  1FNW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...