4XYOA

Structure of agra lyttr domain
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
99
structure length
99
Chain Sequence
b'VETIELKRGSNSVYVQYDDIMFFESSTKSHRLIAHLDNRQIEFYGNLKELSQLDDRFFRCHNSFVVNRHNIESIDSKERIVYFKNKEHCYASVRNVKKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Accessory gene regulator A
publication title Conformational features of the Staphylococcus aureus AgrA-promoter interactions rationalize quorum-sensing triggered gene expression
doi rcsb
source organism Staphylococcus aureus (strain col)
molecule tags Dna binding protein
total genus 28
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2015-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04397 LytTR LytTr DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1020 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4xyoA00
4CBVA 4XQJA 4XQQA 4XYOA 4XXEA 4XYQA 4G4KA 4XQNA 3BS1A
chains in the Genus database with same CATH superfamily
1ET9A 2KCCA 1OXUA 1CKMA 4X65Q 1S4ZA 4TSSA 5IODA 2PW7A 4X66L 1T9HA 1LTAD 1YNND 4JCVE 5GADC 2KA7A 1PYWD 2ATWA 5IY0A 2E5LQ 4YWLA 3CCUA 1WTHA 2HIXA 2Q8RE 2K52A 1MKHA 2K04A 4A3BB 3DM1A 3OMGA 1TWFB 1XNQQ 2NVYH 4U68A 1TXYA 2XVSA 5KNCA 2WACA 5BR8L 2NVXH 1EIHA 4A93H 4BY1B 3S1MH 4DV3L 2Z4IA 1YHBA 1E24A 2VQFQ 3CMEA 3JAMi 4PMWA 4LF4L 4C3IB 2NB0A 2CKZB 3ERQA 1VF5C 3I91A 1NBWA 1VQAA 4QUFA 1JE5A 3PIO3 4K2LA 1N34L 2L0CA 2YV5A 2HT1A 2BH8A 3PUXA 2RVLA 1I3QH 1SE3A 1A62A 1GUGA 1UNSA 2VZAA 1OXVA 2KBNA 5G3LF 2BE5D 4IOAA 3KDFB 2K4KA 4K6DA 1S40A 4H44C 1AW7A 3HOVH 3U9SA 5LMNQ 3I56A 2RA4A 2NZ1D 2PI2A 4HJAA 4RCNA 4OO1I 4YWMA 1GXDC 2Z1CA 4C3HB 1MBYA 2DY7A 4DR4L 5M3FG 4DV7Q 3M4OH 1ONLA 3OPOA 4M1UB 1EQQA 1YEZA 2H4OA 3Q23A 3SK6A 3K5MA 3AFQA 4LF8L 1ZXTA 5EPJA 4H0LC 1SRUA 1X65A 1G2SA 1YHQA 2A73B 4KHPQ 5CR3A 2CW0C 2R7DA 3FKIG 2QDLA 4LF9Q 1K73C 3AQQA 1Y1VG 1ENCA 1SMYD 1PH1A 2FMMA 1STGA 1TS4A 2EYHA 2Y0SG 5FLMG 2LMCB 5E3FA 2E5LL 5EPKA 5C3WA 2CHBD 5IYBG 1XTDA 4QUCA 3I8ZA 1Q46A 4GN4B 2MFIA 4RGTA 2QF7A 5JEAG 2VQEQ 2H5XA 3LWEA 2F0OA 4L5QA 2NVTB 5A35A 2B2TC 1R9TB 3A8IE 2B63H 4BBSG 5JPMC 1STNA 5JJKA 1VQKA 3CF5A 1HCZA 1Y1WB 4A75A 1KAAA 1UEBA 4POGA 3KDFA 1VQOA 4O0AA 5IT9c 4CHTB 4F7XA 2NUCA 1IL2A 1YI2A 2KCMA 3GD7A 4LUZA 4Y52H 1DOKA 3WOEA 3A8KE 2ICEC 2JSOA 4RMFA 3WOFA 3DXJC 4BXXG 2EY5A 2NZOA 3D3RA 1RJTA 2N8NA 1DGSA 4XDXA 3SGIA 3S1RB 2NVYB 1AE2A 3PUZA 3QWNA 4A3IB 2NVXB 1H9SB 3G48A 4DU9A 3G6EA 3HKZE 2TSSA 3S1MB 3CCEA 2F03A 3RMHA 4YY3Q 2E2HH 1X6OA 2A69D 3BVGA 4JI5Q 1B3QA 3E9HA 1OXXK 4B9WA 3EJIA 4DV5Q 1HXYD 4OHJA 3BU2A 1TWAH 3M85A 1JR0D 3KOJA 2UUAQ 2WAQG 2HCIA 4CGYB 3I3CA 1A15A 5IP7G 3HOWB 1D5MC 2ICIA 3VA7A 4G4KA 4IUNA 1U9RA 4DF7A 1J6QA 1DONA 2F0HA 2VUMG 1EY9A 4BY7G 2ES2A 2GVBA 3KK7A 3E9IA 1VQ7A 1W6JA 4DV4Q 5FLXc 3TMEA 3CC7A 4KHPL 4K0KQ 4WFN3 2KOLA 3D4RA 5FO8B 3BZDB 2B8GA 3URYA 1WTWA 3HOVB 4GLXA 2Z4HA 1SR3A 1GM5A 1QE6A 4L63B 1DXMA 2K1BA 1TS5A 4KTAA 4DV2L 3HGBA 5IGGA 1HPCA 4PZ7A 2PQEA 5JAVA 4BA2I 3K5NA 3SK4A 3HOYG 3M4OB 1DD2A 3MEHA 1A3UA 3HOXB 3D4WA 2GA4B 3D8GA 4DNIA 1C7YA 2M9VA 4A3JG 2AUJD 1SLJA 3A56A 2ASBA 3EFXD 3S16H 1HH2P 1MGSA 2E8GA 2R3ZA 1F77A 3LNNA 1A2TA 3H15A 4DR5Q 1KQSA 4OWWB 5FLXL 4X62Q 3CRLC 4JI8Q 4LW1A 4FXDA 2PW5A 4POFA 4K5VA 4ALPA 1Y8PB 4R4IA 2B63B 1H95A 4BBRG 1Q1EA 4DPGA 1DOLA 4JBWA 4G7HC 1RCVD 4OWXB 4EVOA 3D31A 2CH4W 4YY3L 1NUCA 1RTNA 2M00A 1TQOA 4XQJA 4IUUA 3GV3A 4QIWB 3FKIH 4KI0A 1Y1VH 2XIWA 1ET6A 4EX5A 4DV6Q 3U4ZA 4A3KG 4X3TA 2WP8J 2F0MA 1E2WA 5FLMH 4IJLA 5IIFA 2KVMA 5JEAH 1ESRA 2JXMB 2JP1A 1J5EQ 4K2KA 4K0KL 1G2TA 5C3EG 1C4QA 3A5UA 5C0XJ 1Q90A 5KRUA 1IZ6A 3L7ZC 4XT3B 4I7ZC 3S2DH 3PO3G 1GKHA 2Q8TA 3FVQA 3H6MA 1PTOH 4FDBA 3BG3A 1SYDA 2DUDA 4V0BA 4BXXH 4PQXA 3RLOA 2IX1A 4X3UA 3Q24A 4JI2Q 4DK3C 4U673 2MO1A 1JB3A 2NYZD 2O2LD 1EOTA 2IT1A 3H3VH 5AJ3L 3FEWX 1PRTB 4ZKCB 1K8MA 4NMZA 1XXGA 1PLFA 5KNDA 5FK9C 4N9TA 4DR3Q 2MHVA 4JOIC 2AMCB 1KTKA 2KCNA 3G7LA 3A8JE 4HIOA 2E2JB 1B70B 3MFYA 2CWAA 2A19A 1P8LA 2B39A 3VR4A 5IGFA 1XPUA 1SYEA 3M4QA 3NP8A 4MHEA 1XMOQ 2WB1E 2F0WA 2B2WC 5IP7H 4QY7A 5M5XH 5C4ZA 3NWTA 2OEOA 1IBMQ 4B3RL 2K14A 5FLXE 2I07B 3IFDA 2ZM6Q 1SNPA 1VQMA 1PXUA 1VF7A 1X55A 3S16B 3R2TA 4BY7H 4AYBG 4X3KA 4A3FB 4JI0Q 3GTJH 2KQ3A 3DUZA 1LTID 1YNNC 4K8IA 2DNCA 4R4TA 1D5XC 2OTLA 1BUVT 3VR2A 1U4RA 2KEDA 2KHIA 1BCPF 2QEXA 4X6AH 4DV6L 1KC8C 5FKAC 1LLRD 1UE6A 2XWBB 3NQTA 3J81j 2JJQA 5CV6A 5EKLA 1TR5A 5CYUA 3U9OA 2OQ0A 4B9XA 2PI2E 3NQIA 4NXNQ 1NNXA 5TSSA 1QZGA 2EYJA 1X3GA 3C1EA 4FF1A 3HOYH 1PH6A 2Q2HA 1WTRA 2QKIC 3PQIA 1B7YB 4NW2A 4A3JH 2LXKA 4EQOA 1I6VC 3CCVA 2VW9A 5AFWA 2VXWA 3ND8A 3FKIB 3OWFA 2XSCA 1JWUD 3CU7A 1D8LA 2F0NA 1WOCA 2E2DC 2SEBD 1Y1VB 1VQJA 3G71A 1C9OA 1QNUA 4L5TA 3KLSA 4H13C 1OXSC 1WCMG 1VQ6A 1XWEA 1SNDA 2QILA 5IOCA 2J0TD 1H9RA 2Q2IA 4PNYA 3CXCA 1FNWA 3JC66 3VDYA 4JI2L 3GP7A 4KJNA 4A3MG 2KCTA 2BE5C 4DV0L 3GTMH 4DK0A 4KN7C 2CVRA 3UE1A 1TWGH 4YCWA 1XMQQ 4MZ9A 3VYTA 4BBRH 1LUZA 4C3JH 3HOUG 1CZGA 1L0XB 4ILWA 2EYOA 3RZDH 1KL9A 3V96A 3S2DB 5IYCG 3CCJA 1Y8OB 5H1SE 2F0FA 1LACA 1PTOB 3EQLC 3PUYA 3Q22A 1EU3A 1BBXC 3ICEA 3T51B 1I6HB 4RGOS 2F0VA 4A3KH 1L1OB 1S5DD 4PZ8A 1AH9A 1OXTA 2RCNA 1KDCA 2CH4A 3MXNB 1SFOH 3KUPA 1IBML 2I5LX 1GUTA 1Q86C 1HZ9A 2ZM6L 1GUWA 4KD3A 1JC7A 2N88A 3C3LA 2O4XA 4LNQA 3ULJA 2EYLA 3SHLA 1SMYC 3GTPH 1AZPA 1TWHH 2IPKD 3A55A 1Q8KA 1RDPD 5C3EH 4DKAC 3KJPA 3PUVA 1JJCB 4KY6A 3IRBA 1O78A 3PO3H 4KV6A 3ULLA 1X9NA 1AN8A 2A8VA 2GVAA 4GOPB 4ID6A 4NXNL 4TKOB 2NN6I 1N8RC 1PH9A 5M5XB 1SNMA 2WV6D 1KDBA 2QCPX 1CZWA 4AIMA 3L9AX 2HQEA 1CSPA 2R93G 2I5MX 2Z8LA 4BY7B 3WWVA 1BVSA 3GTJB 1K8AC 5BR8Q 4KJOA 1L0YB 2A74C 2EYFA 1NSNS 2F0QA 2UU9L 4WJ4A 3CQZH 3GTOH 1TS3A 1WFQA 1NMGA 5EAYA 2B2WA 4G57A 1XYIA 4FVMA 3QB3A 4CJ2C 1ZYRD 5DM63 1JCKB 3D0FA 1N34Q 1QVCA 1D2BA 1V1PA 1SDFA 2N78A 3M9BA 2Q2UA 3AB9A 4P75A 1HA6A 1STYA 4KKTA 3VA5A 1L2FA 1LTRD 1VS0A 2SNMA 5CGKA 3BZKA 4A3JB 2A69C 2IHEA 3SE0A 5M5YH 1G6ZA 1EWCA 3GDEA 1A3VA 4GS3A 1SNOA 1ILQA 2DNEA 4HCSA 4HAEA 2PYKA 1HA5A 1HTPA 4MNOA 1RD9D 2IWHA 4MTNA 1HTLD 1K9MC 4RWSC 3I4NG 1U4LA 3L0OA 4IQZA 4DR4Q 4QF4A 1BF4A 4IFDG 2AQ2B 4AQYL 1Q82C 2EDGA 1YBYA 3GTMB 3TSSA 1F9PA 4FP5D 3MWYW 2E2IH 1LTLA 1IKLA 4ZLTF 2RQXA 1DZ1A 4C3JB 4LJZC 3PSIA 3RZDB 2Z9HA 1CKNB 1FNUA 1EY0A 2G9HD 1PHJA 4MTKA 5FJ8G 4ODGA 5M9OA 1FVIA 2WKCA 3C46A 1PH7A 2BDOA 4A3KB 1ASYA 1VQ4A 2ZTEA 3H0GG 1KLUD 1IHZA 2CQAA 2I46A 1IXRA 1QWYA 4IALA 1SFOB 1J9OA 3J7AF 3RN5A 4KY7A 5NUCA 3TEHB 1EIFA 2XRSD 2O5IC 2EVBA 4AH6A 1EEID 3NTIA 4C1NI 1UEAB 4A3MH 1TWCH 2EPBA 4LK1C 3KF8B 1XPRA 3GTPB 1SROA 2BCOA 1TWHB 4FNFA 1XPOA 4JG2A 5FO7B 2F0UA 3I4MG 4P72A 1KDAA 1RKNA 4ZQ3A 3HOUH 2JA5G 4R8IA 5C3EB 1HFNA 5CMDA 5C0XI 3N6RA 3PO3B 5IYCH 3EBEA 1NCVA 2K75A 3KFUA 2EOTA 4UHVA 4HSPA 2F0GA 1M8AA 2K6AA 1K83B 5J22A 1A3TA 1HNWQ 4A4IA 2A6EC 4DFAA 1CI3M 1E3PA 1KNEA 3K6OA 4IUVA 4M8AA 1PA6A 1NY4A 2PMZB 4DUZL 2YYZA 2K33A 1RL2A 4IOCA 3CKIB 2JE6I 5COYA 3T1HL 1GHJA 1X3QA 1BR9A 3UDGA 1CKNA 3S2HH 3NBHB 4HIDA 3FHWA 4JI7L 1K8OA 3TZDA 2LS01 4A3GG 3HKZG 2KHSA 4C1NK 4DNTB 5DAUA 1SJHD 1KRSA 3SK5A 1STHA 3KYHC 4LFCL 4DAMA 4C2MH 3O13A 1YZ6A 4JI6L 3VYUA 3DEOA 2IL8A 1PYBA 1Y8NB 3CC2A 5K36G 4EGVA 1R4PB 5M3MG 2L1BA 1MI2A 2RBMA 4LF5L 3Q8DA 5EBDA 3T56B 5M5YB 3SDZA 5BN5A 1OTCA 4IZ8A 5C44B 4AYBB 4CJ0B 1BBUA 2V1CC 4QB4A 5IP9G 1HFGA 5GAGC 1TY2A 3NK9A 4JI3L 1BKBA 5C6AA 1W3SA 3BS1A 3GTQH 4DV2Q 3IFTA 3VYRA 3KJOA 1A6XA 2YTXA 4NDXA 1EUJA 5JOBA 4UY8C 3C2PA 1ASZA 5EQ0A 1PYSB 1GOZA 3S15H 2JQOA 2B2VA 3QR8A 2MUYA 3K7AH 3CW2C 4K8JA 5C4JH 2E2IB 2QW7A 1VQHA 4DR2L 3J7ZC 1NMFA 2L12A 2EYMA 2F0TA 4HJ7A 1E0BA 3OYYA 1WTQA 5FOBB 4LFBL 4OX9L 5ELEA 3TN2A 2BA0A 2EYPA 4TRDA 4DGZA 1Q8IA 3VYSA 1HNXL 2L15A 1E22A 3ND9A 4JBJA 1SYBA 1T5XD 2UXCL 3K58A 4RAUC 1K0RA 2D5DA 3UDIA 1B1ZA 1HNWL 5EKIA 3V05A 2A1AA 3FPPA 2C35B 3I4NH 2EXDA 1N36Q 1O7YA 4IFDH 5C4XG 2EJFC 3MXUA 4A3MB 5KYLA 1U4MA 1TWCB 1EIYB 2RSNA 4LFAL 3P1HA 2RF4A 4A93B 1LABA 5L37A 5HY6A 2K5WA 1SSOA 1VQLA 4ZUJA 5ELBA 4LF7Q 2F0DA 1Q7YC 2OWOA 2B2YC 1UE1A 1X32A 5IT9L 5FJ8H 2JA7G 5DLQE 1DM0B 2CQOA 1I3QB 2FXQA 2RHSB 3H0GH 3W2DA 1VQIA 5M5WH 2CWPA 4GN3B 1FGUA 1D5ZC 4KKSA 4OO1G 4QCLA 4E6IA 5E7NA 5E4XA 1XJVA 1KAWA 4QMGA 3I4MH 1JQYD 4NKLA 1UUPA 2X6LA 1SYCA 1F2YA 3MFGA 1HNZL 2L4NA 2CCZA 3VR6A 1ICFB 3S24A 2K7VA 2SOBA 1PDQA 5J3BA 1H9SA 5JJLA 1MD2D 1W2BA 3K81C 5AJ3Q 3VR3A 5ELOA 1BCPD 4GKKQ 3W1GA 1PRTC 5IE8A 1YHAA 2R92G 3FDTA 4XT1B 2IW3A 1EY4A 3GTQB 1SEBD 1UAPA 1Q3LA 2DN8A 2V4DA 3MXPA 2QA4A 3EVQA 3H94A 4A3GH 1N32L 4DV1Q 3Q0AA 4RKBA 3S15B 2WINB 3CCRA 1EY6A 3K7AB 4B3SL 5J39A 5C4JB 1VQ5A 4HMIA 4QL5A 2VS1A 3PF5A 1N36L 4ME3A 5M3FH 3DWQA 3KF6B 4B3RQ 3EN2A 5DEHA 5K36H 4J6HA 4Q5VA 1II3A 2OCEA 2XGTA 1TVXA 1X3FA 2WB1G 2RDGA 3QG1A 4BA1I 4CBVA 3W5OA 3FPUB 3M7NA 3F1ZA 2XNAC 1NR4A 2MGSA 4LF7L 1VDZA 4Z9CB 1RODA 2PQAB 4JVZA 3NSWA 5IP9H 1DJRD 4CDFC 3J80c 5LMUL 4ZK9B 1YNJC 2NTSA 3DWPA 3ULPA 2K50A 3M4PA 2F4VL 4FXGC 4P73A 2FINB 5IYBH 1NR2A 4PG3A 1QILA 4IPDA 5JEAJ 2F52A 1PH3A 5I9PA 3HFZB 3CRKC 1LYLA 3E3XA 3G4SA 2ALYB 5IT9E 4BBSH 5EJWA 4CDEC 2UUCL 4IUQA 5I6YA 4N8FA 2AHOB 2E2HB 5ISRA 3PV0A 1EYAA 4WORA 5CV5A 3T13A 4L8JA 1TWAB 2BOSA 1AP0A 4XYOA 4OEMB 4JK1C 1ZYRC 4B3MQ 1QCBD 4X3SA 3CHBD 3FMCA 4DAPA 1CTMA 1K8GA 3K0YA 3STBD 4MN3A 1ML0D 3H0GB 1O7ZA 3M4YA 3ER0A 3F2BA 3OW2A 3J7YW 1IYVA 5M5WB 3RR5A 3J80L 1CA6A 3KF6A 4N9PA 1LM0A 3ITPA 4DV0Q 2KECA 1F9QA 1MSHA 3R2IA 3NEMA 4FO2A 1B8AA 4JYAQ 3PCOB 4HTHA 4GKKL 1VQPA 1JB7A 5CBEE 1ZEQX 3GTKH 4R4QA 3TS2A 3ERSX 2PQAA 1EWHA 2B2YA 1IW7D 1G8ZD 2FMCA 2K5HA 5LL6S 2QGQA 1Q12A 3HOZG 3MHBA 5I2XA 1PTOC 4CDCC 4DV1L 1AEXA 1WTVA 3BYYB 3SEBA 2JA7H 2JYOA 2F3WA 1L1OC 3T53B 1GHKA 1HUMA 3TS0A 4CKEA 2K03A 3NXWA 2NBFA 2VUMH 4P71A 3H3VC 4ZUIA 1RIPA 1QVFA 1NAPA 5GQOA 3LX0A 4JI4L 4DNRB 4OO1H 1K0SA 5E4WC 3MXGA 3UDFA 5HURA 3R93A 5I4DA 1B44D 1D1KA 5FO9B 3C1FA 4EQ5A 3TP7A 1S5FD 3I55A 4C56C 2E74C 4FXKC 3HKZB 1XX8A 1YITA 1UE7A 4LWCA 4GOPC 2IX3A 5M3FB 4NXML 4OIKA 2ZXRA 1O7IA 2P5ZX 1STEA 3NENA 1VMPA 3GTGH 2F0SA 4DAVA 3J7A5 2B2UC 1Q1BA 4HSVA 4XTCS 1CQVA 1U4PA 1JWSD 1XTCD 2UU9Q 3ZYYX 4RFBA 1I4HA 2R92H 1HQMC 2J7ZA 3TZUA 4B3ML 1K28A 4IJHA 1O80A 2F0LA 2Y0SB 1EEFD 3I7FA 2XTIA 1Y1WG 1I50H 3HP3A 1S3OA 1CKOA 4YCVA 2F0PA 4B3TL 1SNCA 2NWGA 3OIPA 1STBA 3B6YA 2PNHA 1JOQA 4BBSB 2F0EA 3J81c 2UXBL 1F2MA 1X3PA 1H9KA 4JYAL 4OGQC 3TDQA 2Z0SA 1FGBD 3GQBA 3E5SA 4YHHQ 3M3YH 3IL8A 5EBCA 1F2ZA 4LF6L 1BBWA 2F1MA 4DUYQ 1KRTA 2PCFB 2AQ3B 1PZJD 2OTJA 1FR3A 5IWAL 1PMRA 1N33L 2HUGA 4A3IG 1EIGA 4DR7L 3K7UC 1GUSA 4JPBW 4AQYQ 2R7ZG 1PFSA 3F2DA 4DAYB 1SJED 1VCIA 4XIGS 3GTKB 3Q6SA 1QG7A 1BNZA 2D2CC 1HR0Q 3HOWG 3AFPA 4GNXB 3J81L 3QJYA 1GD7A 1VQEA 1CUKA 1PFNA 1S72A 1NTGA 5ELFA 2E76C 3BVMA 4CJ1B 3X3NA 1LO5D 2WAQB 3G6JB 1EWIA 3A74A 4LAAA 3J7AV 1TWFH 1SYGA 3DWAA 2R7FA 5G3LD 3RN2A 1A63A 1PH5A 3HOVG 1C0AA 1FJGL 2VUMB 4JW0A 4PV1C 4Q0FA 3RNUA 1V9PA 1K3RA 3RD4A 1LTBD 2PO4A 2EY1A 1V1QA 1YJWA 2N55A 1CA5A 2YU9H 1LTSD 1DYQA 5A2QL 1TT2A 2IJ0A 2PPBC 1WTPA 2JA8G 1EQRA 2PZWA 4DN4M 3HOXG 3R8BA 2WIIB 2IHFA 2N3SA 1L1OA 4GKJL 2X6GA 1CHPD 2VY3A 1D1IA 3RLFA 3HOZH 3MXNA 1BXTA 4RG1A 3HOYB 2A6HD 5IGBA 4DAYA 2PZUA 5EKKA 4DUZQ 2B2VC 1VQFA 4HEDA 1HZBA 2D0OA 3GTGB 5I9OA 3ONAB 4YHHL 1HJPA 3GTLH 4DR6Q 1X54A 4GNXA 4K5XA 3T1HQ 2FJ2A 1WJJA 1TS2A 2ZTDA 4DUYL 1SE4A 1EY5A 2K32A 4EQNA 2R92B 4A3DG 4JI7Q 1JT8A 1WD0A 4JV5L 2AWOA 1Z47A 1Y14B 4GOPA 1BO0A 1LT3D 1C8CA 3I72A 4LFCQ 2IY5B 2LKVA 1ENAA 1VQ9A 4JI6Q 3TQYA 1G91A 1F2LA 3RLNA 2RDFA 4UP9A 5JPNC 1TWGB 1Z9FA 1B9MA 2O5JC 4LF5Q 2B2UA 4BBRB 2VB2X 3M3YB 3BDOA 2WB1B 2UUBQ 3A7LA 5IYDG 4K5WA 1SXTA 4K6LA 5IGDA 1HR0L 3UI2A 3CP0A 1JORA 3MEFA 1IYJB 2G5DA 2UXDL 3S1NH 5CBAE 4JI3Q 4O2DA 4HCEA 4IPHA 3GO5A 1D7QA 4IPGA 3RZOH 2Z6KC 2JA6G 3BJUA 1CK1A 3AMUA 4O1NA 2J4XA 1WCMH 2L9HA 3J81E 4KKUA 1FYCA 4DK1A 1IBKL 3N52A 1BCPC 4DR2Q 1I94L 4DR1L 2K5NA 1KIXA 3OOCA 1F9SA 4GLVB 3FRPB 3KLWA 2NN6G 4OIJA 4LFBQ 4OX9Q 1KNAA 3D6WA 1M1KC 1PRTF 2KJXA 4O42A 1HNXQ 3JAMc 3WDNA 1IBLQ 5JJZA 2UXCQ 3A5ZB 3OSOA 4GLAC 3E0EA 3OMCA 2EY2A 3S1RH 1GUOA 4LUVA 1H9MA 2AUKA 4X64Q 4A3IH 5D3IB 3DEPA 5A2QE 4XQNA 4ULLA 1GUNA 2ZT9C 4ZYSA 3BYTB 2R7ZH 3NE5B 3QO2A 1KABA 3EIVA 2YTVA 4LFAQ 3H3VI 4DR6L 4L5RC 1TKWB 2ZJRA 3OHXC 2YU9B 1T5EA 1WYDA 3CCSA 3CQZB 3U50C 1B3AA 3NELA 4OELB 3GTOB 1KXLA 2E75C 2XRQD 4TQUS 5CV8A 3HOWH 4UAIA 1SAPA 4KHZA 3T4AC 4QIWE 2EXZA 3HG9A 3HOZB 1EY7A 4A3FG 2FHTA 3JAML 2SDFA 4HJ5A 1YNXA 2LY7A 2WKDA 3NTHA 2HIVA 1EY8A 4DXFA 3KF8A 3I90A 3GTLB 1IL8A 2R93H 3DLLA 4XQQA 5HGQA 2UUBL 3OW7A 3IKJA 5F2DA 4WJ3M 3OTOQ 2FFKB 1VQDA 4KD4A 1EYDA 2ZJQA 1XNRL 3OIQA 1E2ZA 4K14A 1Z7TA 2ZTCA 3STBC 2JA8H 3SR1A 3PIPA 1PVOA 2L5TA 5EGTA 3CPWA 3DMUA 1Q81C 3HOXH 3MA2B 1TIID 4ME5A 2SNSA 3U4VA 1GJXA 4P74A 1HNZQ 2C5CA 4A3EG 3F8TA 4X65L 1BCPB 1IKMA 1PZID 3SK8A 1IYUA 2A68D 3SXHA 2AKWB 3LGJA 1JE4A 4MIUA 1IW7C 3D6CA 3NBHA 4JI1Q 5EPLA 1HHVA 3MAQA 1BQQT 3S1NB 2NVQH 2G9DA 1IBLL 4YIJA 3EROA 1ICWA 3RZOB 3F2UA 4A3DH 4WRDA 1XNQL 2QEJC 3TP5A 2ID0A 1N32Q 1PTOF 4X64L 1WCMB 2MPMA 3PO2G 3I73A 4B3SQ 2JEAI 1V1OA 3T1YQ 4IFDJ 5C0XG 2VQFL 3W1BA 5JVH3 2MJ8A 5LL6X 4WJWA 3CPFA 4RH6A 4R8NA 4CKCA 2DJFC 4RKLA 1U0LA 3HOUB 1J8IA 2RCFA 2QDBA 2Z6BA 1G6PA 4KY5A 2K28A 5IYDH 5I2YA 2TMPA 3AEVA 4B08A 4PMCA 2F3IA 1FD7D 4FYDA 2Z6KA 1VQ8A 2H1EA 1KHIA 3CAMA 3M7GA 2ZXPA 1UE5A 1S5CD 5LHY1 5LMUQ 1RTOA 5ELNA 1S5ED 3PIP3 2F4VQ 2ENBA 2X69A 3I4OA 2JA6H 1SE2A 4V190 2KUMA 1HR0W 4A3LG 2R7ZB 1MSGA 1ZKOA 3P75A 4YWKA 3I2ZA 3F2CA 5LMNL 1WD1A 1M90C 1GO3E 1YJ9A 2UUCQ 3OTOL 3KBXA 4I65A 2F0JA 3S2HB 4CKBA 1I4GA 3JAME 1P16A 1JICA 1BOSA 4R4OA 2NN6H 1GVPA 1D6EC 2JA5H 2OXPA 4DV7L 1FNVA 5GROA 3S9WA 3CCLA 4F87A 1QOHA 5D3DA 4C2MB 2EQSA 1ENFA 4HMJA 4IO9A 4JBKA 2Y0SE 4J1MA 5ELCA 2OF1A 4HIKA 4OONA 2LXJA 1E7ZA 4J15A 1EFWA 1CSQA 4ZRZA 3S14H 4QGUA 4LF9L 1EOVA 4NB3A 2R93B 2RDHA 4BS9A 1ILPA 5KNBA 4JI1L 2M2LA 3MTSA 2E2JH 1AE3A 4A3CG 2L11A 1EQVA 1V43A 5JVG3 2JA8B 2VQEL 2B3GA 4F8MA 2NTTA 5CORA 1JJGA 1TY0A 1G51A 1CHQD 5D65A 3TBIB 3GV6A 4L5SA 2KENA 4OXPA 3T1YL 3NBIA 2EIFA 3A0JA 4A3FH 1PFMA 4HN7A 5M3MH 3H91A 4FF3A 2JA9A 3KLRA 1EZ6A 4NPSA 5CV7A 2HD3A 3I70A 1LTTD 4GN5A 3KLSX 3IAYA 2CFMA 2F0KA 4JI4Q 4OL7A 1SN8A 2Q8IB 1E1OA 1QJOA 3SVMA 4BWGB 2NVQB 2PZTA 2AQ1B 2HHHQ 1U5KA 1NE3A 3H09A 3K5LA 1VMCA 3CC4A 4A3DB 1PH8A 1E2VA 1HZCA 2EE1A 4C3JG 1RF2D 3UE0A 2A6ED 1QNKA 2NZHA 2WAQE 3LWUA 5CV9A 3I4NB 4NXMQ 4JI5L 4A3EH 3NHHA 5IGEA 4HJ8A 1QZHA 1B53A 4DV5L 3TREA 4I7AA 4R4CA 3J80i 4KLKA 3S17H 5BN3A 2UUAL 2L55A 1VQNA 2ZJPA 3X3MA 3QIAA 1WVLA 3K59A 1S5BD 4EQPA 1I4XA 3HKSA 1B4OA 3PGZA 2B2TA 1E1TA 4UPAA 3MZ5A 4A3BG 1LV9A 2EZVA 1A2UA 5I6WA 2K5DA 1DOMA 1JOOA 3A7AB 2BA1A 1V8QA 3BZCA 2A6HC 1JWMD 2JA6B 1L0WA 2BDNA 4DV4L 2ZXOA 1EL0A 3NWSA 4KMUC 4BY1G 3L2PA 3CD6A 4B3TQ 1VQGA 5DM73 3T16A 3PO2H 2MO0A 3L3OC 4ZCKA 3EA6A 4C3IG 5C4XH 5C0XH 2UXBQ 1C48A 5JJIA 4S3SA 2CW0D 1F9RA 3KBGA 5KEEA 4HJ9A 1VQCA 1B50A 1B2TA 1MHWC 2JN4A 4DA2A 1EFID 3I4MB 1HUNA 3E0JA 4F88A 5CC4A 3PMFA 4LF6Q 2JA5B 5GAEC 1HZAA 1I6HH 4JBMA 5C5LA 2DY8A 5IWAQ 1VQBA 2AWNA 5DNFA 1N33Q 4N8X1 1UWVA 3P7JA 5T1GA 4DR7Q 4ABNA 5CV4A 1JMCA 3PF4A 3MVVA 3S14B 4KK7A 4UP8A 4A3LH 3K8AA 4DR5L 4X62L 4JI8L 3K5OA 1X56A 4HIMA 4ZAIA 1LTGD 4H02A 4C3HG 2HHHL 4RHSA 3K57A 4GNXC 4UDUC 3QOLA 1LT6D 4IUPA 3CCQA 4A3GB 3BDLA 5LMNW 2Q2TA 2BH2A 2DJGC 3AYHB 4IPCA 2HCCA 2JEBI 5C44G 3TP8A 1KD1C 2R61A 3K80C 1H9JA 3V2TA 1QUQB 1SE8A 5M3MB 1PFBA 1LT5D 3OWEB 1FJGQ 4KHVA 2MQHA 4RHRA 4G7ZC 4H7BA 2VB3X 1MJCA 1OO9B 2MNAA 1LT4D 4IURA 1WTXA 2XN9C 4OWTB 5ELDA 4FF4A 4A3CH 1I4RA 4R1JA 1A8VA 1QB5D 4TVAB 2OT2A 2KEEA 3U58A 2R6GA 2I0QA 2EJMA 4GKJQ 1J5EL 3HEJA 3NTKA 1WI5A 2YTYA 2K05A 4Y7NH 1CFMA 4R9WA 1YJNA 4A3EB 1KLGD 2D9UA 3S17B 3R3OA 4RA8A 3CCMA 5C3XA 3FP9A 2PMZE 1QVGA 4P2CB 3HS0C 1PH2A 1PH4A 4RGNA 3RUZA 1WTOA 3J80E 2DGYA 1JOKA 2RSOA 4JV5Q 2VL6A 3J81i 4RGMA 2HDLA 4A93G 1Z6HA 3S1QH 1QUQA 3TRZA 2LFNA 1HQRD 3PO2B 3W3AA 3CMAA 1I4QA 5KYIA 1R4QB 1RHPA 5T1IA 4IFDI 5C4XB 1Y69U 1N9WA 1EZ8A 1SMXA 2N49A 4DR3L 1NJIC 1PRTD 4XXEA 4PZ6A 3TP6A 3P20A 4NP5A 1XMOL 4XYQA 4AYBE 2UXDQ 1SNQA 3BDCA 3ZJYC 1V1PB 4DK6C 4A3BH 4KN4C 2K5QA 1CT1D 2JA7B 2A5HA 4JI0L 4CDDC 1M4VA 1DCZA 1X3EA 2F4IA 2A68C 2RHQB 4BY1H 3DHQA 1IBKQ 4RCOA 4X66Q 2GN5A 2PNRC 1I94Q 2EJGC 2F3VA 3MC0B 2OQKA 2EY6A 4DR1Q 4C3IH 4LMQD 1EQTA 3UDXA 4IUTA 1B9NA 1HRJA 1W6KA 5KGUA 1FL0A 1K83H 1YNJD 5BN4A 3AU7A 4LUOA 1I5FA 2HQLA 2WFWA 4ZKBB 3I4LA 2D0PA 1YIJA 3D4DA 2F0IA 2IX0A 2C9OA 2XWJB 2I5HA 5C4HA 4APVA 4JOIA 4PMBA 4DV3Q 2VNUD 4A76A 5HGTA 4LF4Q 2HDMA 5GAHC 1I4PA 2JK8A 1MJEA 4G7OC 3DM3A 3K0XA 4GZYC 1YVCA 4C3HH 2B63G 4UP7A 3HZXA 1I50B 5J1ZA 1CM9A 1BDOA 1EYGA 4FF2A 1XMQL 5C5MA 4Y7NB 4JC0A 1AZQA 2K5VA 5D14A 5IGCA 3QOJA 1MIUA 5C44H 4QQBX 1PZKD 2MP1A 4HR7B 3HRZC 3NUCA 4DXGA 2B8FA 3VR5A 4IN3A 2RKSA 3PIOA 1ESFA 3A54A 1SYFA 5K5PA 2LSSA 1AFPA 2K01A 1G291 1A0IA 1STAA 5KIXA 1XNRQ 3PUWA 5E1FA 1CQFA 4YCUA 3E6ZX 4L6TB 1PV4A 1JJ2A 3BVZA 1PTOD 1EU4A 3NPPA 2B29A 4J8QA 1K3BC 2KHJA 2NVTH 1R9TH 4QJFA 1EYCA 1O7LA 1TU2B 3S1QB 1Y1WH 4LF8Q 1SBBB 2D62A
chains in the Genus database with same CATH topology
1ET9A 2KCCA 1OXUA 1S4ZA 4TSSA 5IODA 2PW7A 1LTAD 1YNND 2KA7A 1PYWD 2Q8RE 2K04A 4A3BB 3DM1A 3OMGA 1TWFB 4U68A 2XVSA 5KNCA 2WACA 1EIHA 4BY1B 2Z4IA 4PMWA 4C3IB 2NB0A 3ERQA 1VF5C 3I91A 4QUFA 3PIO3 4K2LA 2L0CA 3PUXA 2RVLA 1SE3A 1GUGA 1UNSA 1OXVA 5G3LF 2BE5D 4K6DA 4H44C 1AW7A 3U9SA 2RA4A 2NZ1D 4RCNA 4OO1I 1GXDC 2Z1CA 4C3HB 1MBYA 2DY7A 1ONLA 3OPOA 4M1UB 2H4OA 3Q23A 3SK6A 3K5MA 1ZXTA 5EPJA 4H0LC 1G2SA 2A73B 5CR3A 2CW0C 1ENCA 1SMYD 2FMMA 1STGA 1TS4A 2EYHA 2LMCB 5E3FA 5EPKA 5C3WA 2CHBD 4QUCA 3I8ZA 4RGTA 2QF7A 5JEAG 3LWEA 2F0OA 2NVTB 5A35A 2B2TC 1R9TB 3A8IE 5JPMC 1STNA 1Y1WB 1HCZA 1KAAA 4CHTB 4F7XA 2NUCA 3GD7A 1DOKA 3WOEA 3A8KE 2ICEC 2JSOA 3WOFA 3DXJC 2EY5A 3D3RA 1RJTA 4XDXA 3S1RB 2NVYB 3PUZA 3QWNA 4A3IB 2NVXB 1H9SB 4DU9A 2TSSA 3S1MB 2F03A 3RMHA 2A69D 3BVGA 4B9WA 1OXXK 3EJIA 1HXYD 4OHJA 3M85A 1JR0D 2HCIA 4CGYB 3I3CA 1A15A 3HOWB 1D5MC 2ICIA 3VA7A 4G4KA 4IUNA 1U9RA 4DF7A 1DONA 2F0HA 1EY9A 3KK7A 1W6JA 3TMEA 4WFN3 2KOLA 3D4RA 5FO8B 3BZDB 2B8GA 3URYA 1WTWA 3HOVB 2Z4HA 1QE6A 4L63B 1DXMA 2K1BA 1TS5A 4KTAA 3HGBA 5IGGA 1HPCA 2PQEA 5JAVA 4BA2I 3K5NA 3SK4A 3M4OB 1DD2A 3MEHA 1A3UA 3HOXB 3D4WA 2GA4B 3D8GA 2M9VA 2AUJD 3A56A 3EFXD 1MGSA 2R3ZA 1F77A 3LNNA 1A2TA 5FLXL 3CRLC 4FXDA 2PW5A 4K5VA 1Y8PB 2B63B 1Q1EA 4G7HC 1DOLA 4JBWA 1RCVD 4EVOA 3D31A 1NUCA 1RTNA 2M00A 1TQOA 4XQJA 4IUUA 3GV3A 4QIWB 4KI0A 2XIWA 1ET6A 4X3TA 2WP8J 2F0MA 1E2WA 5IIFA 2KVMA 5JEAH 1ESRA 2JXMB 2JP1A 4K2KA 1G2TA 1C4QA 5C0XJ 1Q90A 5KRUA 3L7ZC 4XT3B 4I7ZC 2Q8TA 3FVQA 3H6MA 1PTOH 3BG3A 1SYDA 4V0BA 4PQXA 2IX1A 4X3UA 3Q24A 4U673 1JB3A 2NYZD 2O2LD 1EOTA 2IT1A 3FEWX 1PRTB 4ZKCB 1K8MA 4NMZA 1XXGA 1PLFA 5KNDA 5FK9C 4N9TA 2MHVA 1KTKA 2KCNA 3G7LA 3A8JE 2E2JB 3MFYA 2B39A 3VR4A 5IGFA 1SYEA 3NP8A 4MHEA 2F0WA 2B2WC 5C4ZA 3NWTA 2OEOA 5FLXE 2I07B 3IFDA 1SNPA 1PXUA 1VF7A 3S16B 3R2TA 4X3KA 4A3FB 2KQ3A 3DUZA 1LTID 1YNNC 4K8IA 2DNCA 1D5XC 1BUVT 3VR2A 1U4RA 2KEDA 1BCPF 5FKAC 1LLRD 3NQTA 2XWBB 5CV6A 5EKLA 1TR5A 5CYUA 3U9OA 4B9XA 3NQIA 5TSSA 2EYJA 3C1EA 4FF1A 1WTRA 2QKIC 4NW2A 4EQOA 1I6VC 5AFWA 2VXWA 3ND8A 3FKIB 3OWFA 2XSCA 1JWUD 2F0NA 3CU7A 2E2DC 2SEBD 1Y1VB 1QNUA 3KLSA 4H13C 1OXSC 1XWEA 1SNDA 2QILA 5IOCA 2J0TD 1H9RA 4PNYA 1FNWA 3GP7A 4KJNA 2BE5C 4DK0A 4KN7C 2CVRA 3VYTA 1CZGA 1L0XB 4ILWA 2EYOA 3V96A 3S2DB 1Y8OB 2F0FA 1LACA 1PTOB 3EQLC 3PUYA 3Q22A 1EU3A 1BBXC 3T51B 1I6HB 4RGOS 2F0VA 1S5DD 1OXTA 1KDCA 3KUPA 1GUTA 1GUWA 4KD3A 1JC7A 2N88A 3C3LA 2O4XA 2EYLA 3SHLA 1SMYC 1AZPA 2IPKD 3A55A 1RDPD 3PUVA 4KY6A 1O78A 4KV6A 1AN8A 4ID6A 4TKOB 2NN6I 5M5XB 1SNMA 2WV6D 1KDBA 2QCPX 1CZWA 3L9AX 2HQEA 2Z8LA 4BY7B 3GTJB 4KJOA 1L0YB 2A74C 2EYFA 1NSNS 2F0QA 1TS3A 2B2WA 4G57A 1XYIA 4FVMA 3QB3A 4CJ2C 1ZYRD 5DM63 1JCKB 1D2BA 1V1PA 1SDFA 3AB9A 1HA6A 1STYA 4KKTA 3VA5A 1LTRD 2SNMA 5CGKA 4A3JB 2A69C 3SE0A 1G6ZA 1EWCA 1A3VA 1SNOA 1ILQA 2DNEA 4HCSA 4HAEA 2PYKA 1HA5A 1HTPA 1RD9D 2IWHA 1HTLD 4RWSC 1U4LA 4IQZA 4QF4A 1BF4A 4IFDG 2AQ2B 2EDGA 3GTMB 3TSSA 1F9PA 4FP5D 3MWYW 1IKLA 4ZLTF 2RQXA 1DZ1A 4C3JB 4LJZC 3RZDB 1FNUA 1EY0A 2G9HD 4ODGA 5M9OA 2WKCA 3C46A 2BDOA 4A3KB 1KLUD 1IHZA 2CQAA 2I46A 1QWYA 4IALA 1SFOB 1J9OA 3J7AF 4KY7A 5NUCA 2XRSD 2O5IC 2EVBA 1EEID 3NTIA 4C1NI 1UEAB 2EPBA 4LK1C 3GTPB 2BCOA 1TWHB 4FNFA 5FO7B 2F0UA 1KDAA 1RKNA 4ZQ3A 4R8IA 5C3EB 1HFNA 5CMDA 5C0XI 3N6RA 3PO3B 1NCVA 2EOTA 4HSPA 2F0GA 1M8AA 2K6AA 1K83B 5J22A 1A3TA 2A6EC 4DFAA 1CI3M 1KNEA 3K6OA 4IUVA 4M8AA 2PMZB 2YYZA 2K33A 3CKIB 2JE6I 5COYA 1GHJA 1X3QA 1BR9A 1K8OA 3TZDA 2LS01 2KHSA 4C1NK 4DNTB 5DAUA 1SJHD 3SK5A 1STHA 3O13A 3VYUA 3DEOA 2IL8A 1Y8NB 5K36G 4EGVA 1R4PB 2L1BA 1MI2A 2RBMA 5EBDA 3T56B 5M5YB 3SDZA 5BN5A 4IZ8A 5C44B 4AYBB 4CJ0B 4QB4A 1HFGA 1TY2A 3NK9A 5C6AA 3BS1A 3IFTA 3VYRA 1A6XA 4NDXA 5JOBA 3C2PA 5EQ0A 1GOZA 2B2VA 2MUYA 4K8JA 2E2IB 2L12A 2EYMA 2F0TA 1E0BA 1WTQA 5FOBB 5ELEA 3TN2A 2BA0A 2EYPA 4TRDA 4DGZA 1Q8IA 3VYSA 3ND9A 1SYBA 1T5XD 3K58A 4RAUC 2D5DA 1B1ZA 5EKIA 3V05A 3FPPA 1O7YA 4IFDH 2EJFC 3MXUA 4A3MB 5KYLA 1U4MA 1TWCB 2RSNA 3P1HA 4A93B 1LABA 2K5WA 1SSOA 4ZUJA 5ELBA 2F0DA 2B2YC 5IT9L 1X32A 1DM0B 1I3QB 3W2DA 1D5ZC 4KKSA 4OO1G 4QCLA 4E6IA 5E4XA 4QMGA 1JQYD 4NKLA 1UUPA 2X6LA 1SYCA 1F2YA 3MFGA 2L4NA 3VR6A 2K7VA 2SOBA 1PDQA 1H9SA 1MD2D 3VR3A 1BCPD 1PRTC 3FDTA 4XT1B 2IW3A 1EY4A 3GTQB 1SEBD 1UAPA 1Q3LA 2DN8A 2V4DA 3MXPA 3EVQA 3H94A 3Q0AA 4RKBA 3S15B 2WINB 1EY6A 3K7AB 5J39A 5C4JB 4HMIA 3DWQA 5K36H 5DEHA 4J6HA 4Q5VA 1II3A 1TVXA 3QG1A 2RDGA 4BA1I 4CBVA 3FPUB 3M7NA 2XNAC 1NR4A 2MGSA 1VDZA 4Z9CB 1RODA 3NSWA 1DJRD 4ZK9B 1YNJC 2NTSA 3DWPA 4FXGC 2FINB 1NR2A 1QILA 5JEAJ 5I9PA 3CRKC 5IT9E 5EJWA 4IUQA 5I6YA 2E2HB 5ISRA 3PV0A 1EYAA 4WORA 5CV5A 3T13A 4L8JA 1TWAB 2BOSA 1AP0A 4XYOA 4JK1C 1ZYRC 1QCBD 4X3SA 3CHBD 3FMCA 4DAPA 1CTMA 3K0YA 4MN3A 1ML0D 3H0GB 1O7ZA 3M4YA 3J7YW 1IYVA 5M5WB 3J80L 1CA6A 4N9PA 3ITPA 2KECA 1F9QA 1MSHA 3R2IA 4FO2A 4HTHA 5CBEE 1ZEQX 1EWHA 2B2YA 1IW7D 1G8ZD 2FMCA 5LL6S 1Q12A 3MHBA 5I2XA 1PTOC 1AEXA 1WTVA 3BYYB 3SEBA 2JYOA 2F3WA 3T53B 1GHKA 1HUMA 4CKEA 2K03A 3NXWA 2NBFA 3H3VC 4ZUIA 1NAPA 3LX0A 4DNRB 4OO1H 5E4WC 3MXGA 5HURA 3R93A 5I4DA 1B44D 1D1KA 5FO9B 3C1FA 3TP7A 1S5FD 4C56C 2E74C 4FXKC 3HKZB 1XX8A 2IX3A 5M3FB 4OIKA 2ZXRA 1STEA 1VMPA 2F0SA 4DAVA 2B2UC 1Q1BA 4HSVA 4XTCS 1CQVA 1U4PA 1JWSD 1XTCD 3ZYYX 4RFBA 1I4HA 1HQMC 2J7ZA 3TZUA 1O80A 2F0LA 2Y0SB 1EEFD 3HP3A 2F0PA 1SNCA 2NWGA 3OIPA 1STBA 1JOQA 4BBSB 2F0EA 1F2MA 1X3PA 1H9KA 4OGQC 3TDQA 1FGBD 3GQBA 3E5SA 3IL8A 5EBCA 1F2ZA 2F1MA 2PCFB 2AQ3B 1PZJD 1FR3A 1PMRA 2HUGA 1EIGA 1GUSA 1SJED 1VCIA 4XIGS 3GTKB 3Q6SA 1QG7A 1BNZA 2D2CC 3J81L 3QJYA 1PFNA 5ELFA 2E76C 3BVMA 4CJ1B 3X3NA 1LO5D 2WAQB 3G6JB 4LAAA 3J7AV 1SYGA 3DWAA 5G3LD 2VUMB 4PV1C 4Q0FA 3RD4A 1LTBD 2PO4A 2EY1A 2N55A 1CA5A 1LTSD 1DYQA 5A2QL 1TT2A 2IJ0A 2PPBC 1WTPA 2PZWA 4DN4M 3R8BA 2WIIB 2X6GA 1CHPD 1D1IA 3RLFA 3MXNA 1BXTA 3HOYB 2A6HD 5IGBA 4DAYA 2PZUA 5EKKA 2B2VC 4HEDA 3GTGB 5I9OA 3ONAB 4K5XA 2FJ2A 1TS2A 1SE4A 1EY5A 2K32A 4EQNA 2R92B 1WD0A 2AWOA 1Z47A 1BO0A 1LT3D 1C8CA 3I72A 2LKVA 1ENAA 1G91A 1F2LA 2RDFA 5JPNC 1TWGB 1B9MA 2O5JC 2B2UA 4BBRB 2VB2X 3M3YB 3BDOA 2WB1B 3A7LA 4K5WA 1SXTA 4K6LA 5IGDA 3UI2A 1JORA 5CBAE 4HCEA 3GO5A 1CK1A 3AMUA 4O1NA 2J4XA 2L9HA 3J81E 4KKUA 1FYCA 4DK1A 3N52A 1BCPC 3OOCA 1F9SA 3FRPB 2NN6G 4OIJA 1KNAA 3D6WA 1PRTF 2KJXA 4O42A 3WDNA 5JJZA 3OMCA 3OSOA 2EY2A 1GUOA 1H9MA 2AUKA 5D3IB 3DEPA 5A2QE 4XQNA 4ULLA 1GUNA 2ZT9C 4ZYSA 3BYTB 3NE5B 3QO2A 1KABA 1TKWB 2YU9B 3OHXC 1T5EA 3CQZB 1B3AA 3GTOB 2E75C 2XRQD 4TQUS 5CV8A 4UAIA 1SAPA 4KHZA 3T4AC 2EXZA 3HG9A 3HOZB 1EY7A 2FHTA 3JAML 2SDFA 2LY7A 2WKDA 3NTHA 1EY8A 4DXFA 3KF8A 3I90A 3GTLB 1IL8A 4XQQA 3OW7A 3IKJA 5F2DA 2FFKB 4KD4A 1EYDA 3OIQA 1E2ZA 4K14A 1Z7TA 3SR1A 2L5TA 5EGTA 3DMUA 3MA2B 1TIID 4ME5A 2SNSA 1GJXA 2C5CA 1BCPB 1IKMA 1PZID 3SK8A 1IYUA 2A68D 3SXHA 1JE4A 4MIUA 1IW7C 3D6CA 3NBHA 5EPLA 1HHVA 3MAQA 1BQQT 3S1NB 2G9DA 4YIJA 3EROA 1ICWA 3RZOB 3F2UA 4WRDA 2QEJC 3TP5A 2ID0A 1PTOF 1WCMB 2MPMA 3I73A 2JEAI 1V1OA 4IFDJ 5C0XG 5JVH3 2MJ8A 5LL6X 4WJWA 4RH6A 4R8NA 4CKCA 4RKLA 3HOUB 1J8IA 2QDBA 4KY5A 2K28A 5I2YA 2TMPA 4B08A 4PMCA 4FYDA 1FD7D 2H1EA 3M7GA 2ZXPA 1S5CD 5LHY1 1RTOA 1S5ED 3PIP3 2ENBA 2X69A 1SE2A 4V190 2KUMA 2R7ZB 1MSGA 1ZKOA 3P75A 1WD1A 3KBXA 4I65A 2F0JA 3S2HB 4CKBA 1I4GA 3JAME 1JICA 1BOSA 2NN6H 1D6EC 2OXPA 1FNVA 3S9WA 4F87A 1QOHA 5D3DA 4C2MB 1ENFA 4HMJA 4J1MA 5ELCA 2OF1A 4ZRZA 2R93B 2RDHA 4BS9A 1ILPA 5KNBA 2M2LA 3MTSA 2L11A 1EQVA 1V43A 5JVG3 2JA8B 4F8MA 2NTTA 5CORA 1TY0A 1CHQD 5D65A 3TBIB 3GV6A 3NBIA 1PFMA 4HN7A 3H91A 4FF3A 3KLRA 1EZ6A 5CV7A 3I70A 1LTTD 3KLSX 3IAYA 2F0KA 4OL7A 2Q8IB 1QJOA 3SVMA 4BWGB 2NVQB 2PZTA 2AQ1B 3H09A 3K5LA 1VMCA 4A3DB 1E2VA 2EE1A 4C3JG 1RF2D 2A6ED 1QNKA 3LWUA 3I4NB 5CV9A 3NHHA 5IGEA 1B53A 5BN3A 2L55A 3X3MA 3QIAA 1WVLA 3K59A 1S5BD 4EQPA 1I4XA 1B4OA 2B2TA 3MZ5A 1LV9A 2EZVA 1A2UA 5I6WA 2K5DA 1DOMA 1JOOA 3A7AB 2BA1A 1V8QA 2A6HC 1JWMD 2JA6B 2BDNA 2ZXOA 1EL0A 3NWSA 4KMUC 5DM73 3T16A 3L3OC 3EA6A 4C3IG 5C0XH 1C48A 4S3SA 2CW0D 1F9RA 3KBGA 5KEEA 1B50A 1B2TA 4DA2A 1EFID 3I4MB 1HUNA 3E0JA 4F88A 5CC4A 3PMFA 2JA5B 5C5LA 2DY8A 2AWNA 5DNFA 3P7JA 5T1GA 4ABNA 5CV4A 3MVVA 3S14B 4KK7A 3K5OA 4ZAIA 1LTGD 4C3HG 4RHSA 3K57A 4UDUC 3QOLA 1LT6D 4IUPA 4A3GB 3BDLA 2HCCA 2JEBI 3TP8A 2R61A 1H9JA 3V2TA 5M3MB 1PFBA 1LT5D 3OWEB 4KHVA 4RHRA 4G7ZC 4H7BA 2VB3X 1OO9B 1LT4D 4IURA 1WTXA 2XN9C 5ELDA 4FF4A 1I4RA 1QB5D 2OT2A 2KEEA 2R6GA 2EJMA 3HEJA 3NTKA 2K05A 1CFMA 4R9WA 4A3EB 1KLGD 2D9UA 3S17B 3R3OA 4RA8A 5C3XA 4P2CB 3HS0C 4RGNA 3RUZA 1WTOA 3J80E 1JOKA 2RSOA 4RGMA 2HDLA 1Z6HA 2LFNA 1HQRD 3PO2B 3W3AA 1I4QA 5KYIA 1R4QB 1RHPA 5T1IA 4IFDI 5C4XB 1Y69U 1EZ8A 1PRTD 4XXEA 3TP6A 3P20A 4NP5A 4XYQA 1SNQA 3BDCA 1V1PB 4KN4C 2K5QA 1CT1D 2JA7B 2A5HA 1M4VA 1DCZA 2F4IA 2A68C 3DHQA 4RCOA 2PNRC 2EJGC 2F3VA 3MC0B 2EY6A 4LMQD 1EQTA 4IUTA 1B9NA 1HRJA 1W6KA 5KGUA 1YNJD 5BN4A 3AU7A 4ZKBB 3I4LA 3D4DA 2F0IA 2IX0A 2C9OA 2XWJB 5C4HA 4PMBA 2VNUD 5HGTA 2HDMA 1I4PA 4G7OC 4GZYC 3HZXA 1I50B 5J1ZA 1CM9A 1BDOA 4FF2A 5C5MA 4Y7NB 1AZQA 5D14A 5IGCA 3QOJA 1PZKD 2MP1A 4HR7B 3HRZC 3NUCA 4DXGA 2B8FA 3VR5A 4IN3A 2RKSA 1ESFA 3A54A 1SYFA 5K5PA 1AFPA 2K01A 1G291 5KIXA 1STAA 3PUWA 5E1FA 1CQFA 3E6ZX 4L6TB 3BVZA 1PTOD 1EU4A 3NPPA 4J8QA 1EYCA 1O7LA 1TU2B 3S1QB 1SBBB 2D62A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CBV A;  4XQJ A;  4XQQ A;  4XYO A;  4XXE A;  4XYQ A;  4G4K A;  4XQN A;  3BS1 A; 
#chains in the Genus database with same CATH topology
 1ET9 A;  2KCC A;  1OXU A;  1CKM A;  4X65 Q;  1S4Z A;  4TSS A;  5IOD A;  2PW7 A;  4X66 L;  1T9H A;  1LTA D;  1YNN D;  4JCV E;  5GAD C;  2KA7 A;  1PYW D;  2ATW A;  5IY0 A;  2E5L Q;  4YWL A;  3CCU A;  1WTH A;  2HIX A;  2Q8R E;  2K52 A;  1MKH A;  2K04 A;  4A3B B;  3DM1 A;  3OMG A;  1TWF B;  1XNQ Q;  2NVY H;  4U68 A;  1TXY A;  2XVS A;  5KNC A;  2WAC A;  5BR8 L;  2NVX H;  1EIH A;  4A93 H;  4BY1 B;  3S1M H;  4DV3 L;  2Z4I A;  1YHB A;  1E24 A;  2VQF Q;  3CME A;  3JAM i;  4PMW A;  4LF4 L;  4C3I B;  2NB0 A;  2CKZ B;  3ERQ A;  1VF5 C;  3I91 A;  1NBW A;  1VQA A;  4QUF A;  1JE5 A;  3PIO 3;  4K2L A;  1N34 L;  2L0C A;  2YV5 A;  2HT1 A;  2BH8 A;  3PUX A;  2RVL A;  1I3Q H;  1SE3 A;  1A62 A;  1GUG A;  1UNS A;  2VZA A;  1OXV A;  2KBN A;  5G3L F;  2BE5 D;  4IOA A;  3KDF B;  2K4K A;  4K6D A;  1S40 A;  4H44 C;  1AW7 A;  3HOV H;  3U9S A;  5LMN Q;  3I56 A;  2RA4 A;  2NZ1 D;  2PI2 A;  4HJA A;  4RCN A;  4OO1 I;  4YWM A;  1GXD C;  2Z1C A;  4C3H B;  1MBY A;  2DY7 A;  4DR4 L;  5M3F G;  4DV7 Q;  3M4O H;  1ONL A;  3OPO A;  4M1U B;  1EQQ A;  1YEZ A;  2H4O A;  3Q23 A;  3SK6 A;  3K5M A;  3AFQ A;  4LF8 L;  1ZXT A;  5EPJ A;  4H0L C;  1SRU A;  1X65 A;  1G2S A;  1YHQ A;  2A73 B;  4KHP Q;  5CR3 A;  2CW0 C;  2R7D A;  3FKI G;  2QDL A;  4LF9 Q;  1K73 C;  3AQQ A;  1Y1V G;  1ENC A;  1SMY D;  1PH1 A;  2FMM A;  1STG A;  1TS4 A;  2EYH A;  2Y0S G;  5FLM G;  2LMC B;  5E3F A;  2E5L L;  5EPK A;  5C3W A;  2CHB D;  5IYB G;  1XTD A;  4QUC A;  3I8Z A;  1Q46 A;  4GN4 B;  2MFI A;  4RGT A;  2QF7 A;  5JEA G;  2VQE Q;  2H5X A;  3LWE A;  2F0O A;  4L5Q A;  2NVT B;  5A35 A;  2B2T C;  1R9T B;  3A8I E;  2B63 H;  4BBS G;  5JPM C;  1STN A;  5JJK A;  1VQK A;  3CF5 A;  1HCZ A;  1Y1W B;  4A75 A;  1KAA A;  1UEB A;  4POG A;  3KDF A;  1VQO A;  4O0A A;  5IT9 c;  4CHT B;  4F7X A;  2NUC A;  1IL2 A;  1YI2 A;  2KCM A;  3GD7 A;  4LUZ A;  4Y52 H;  1DOK A;  3WOE A;  3A8K E;  2ICE C;  2JSO A;  4RMF A;  3WOF A;  3DXJ C;  4BXX G;  2EY5 A;  2NZO A;  3D3R A;  1RJT A;  2N8N A;  1DGS A;  4XDX A;  3SGI A;  3S1R B;  2NVY B;  1AE2 A;  3PUZ A;  3QWN A;  4A3I B;  2NVX B;  1H9S B;  3G48 A;  4DU9 A;  3G6E A;  3HKZ E;  2TSS A;  3S1M B;  3CCE A;  2F03 A;  3RMH A;  4YY3 Q;  2E2H H;  1X6O A;  2A69 D;  3BVG A;  4JI5 Q;  1B3Q A;  3E9H A;  1OXX K;  4B9W A;  3EJI A;  4DV5 Q;  1HXY D;  4OHJ A;  3BU2 A;  1TWA H;  3M85 A;  1JR0 D;  3KOJ A;  2UUA Q;  2WAQ G;  2HCI A;  4CGY B;  3I3C A;  1A15 A;  5IP7 G;  3HOW B;  1D5M C;  2ICI A;  3VA7 A;  4G4K A;  4IUN A;  1U9R A;  4DF7 A;  1J6Q A;  1DON A;  2F0H A;  2VUM G;  1EY9 A;  4BY7 G;  2ES2 A;  2GVB A;  3KK7 A;  3E9I A;  1VQ7 A;  1W6J A;  4DV4 Q;  5FLX c;  3TME A;  3CC7 A;  4KHP L;  4K0K Q;  4WFN 3;  2KOL A;  3D4R A;  5FO8 B;  3BZD B;  2B8G A;  3URY A;  1WTW A;  3HOV B;  4GLX A;  2Z4H A;  1SR3 A;  1GM5 A;  1QE6 A;  4L63 B;  1DXM A;  2K1B A;  1TS5 A;  4KTA A;  4DV2 L;  3HGB A;  5IGG A;  1HPC A;  4PZ7 A;  2PQE A;  5JAV A;  4BA2 I;  3K5N A;  3SK4 A;  3HOY G;  3M4O B;  1DD2 A;  3MEH A;  1A3U A;  3HOX B;  3D4W A;  2GA4 B;  3D8G A;  4DNI A;  1C7Y A;  2M9V A;  4A3J G;  2AUJ D;  1SLJ A;  3A56 A;  2ASB A;  3EFX D;  3S16 H;  1HH2 P;  1MGS A;  2E8G A;  2R3Z A;  1F77 A;  3LNN A;  1A2T A;  3H15 A;  4DR5 Q;  1KQS A;  4OWW B;  5FLX L;  4X62 Q;  3CRL C;  4JI8 Q;  4LW1 A;  4FXD A;  2PW5 A;  4POF A;  4K5V A;  4ALP A;  1Y8P B;  4R4I A;  2B63 B;  1H95 A;  4BBR G;  1Q1E A;  4DPG A;  1DOL A;  4JBW A;  4G7H C;  1RCV D;  4OWX B;  4EVO A;  3D31 A;  2CH4 W;  4YY3 L;  1NUC A;  1RTN A;  2M00 A;  1TQO A;  4XQJ A;  4IUU A;  3GV3 A;  4QIW B;  3FKI H;  4KI0 A;  1Y1V H;  2XIW A;  1ET6 A;  4EX5 A;  4DV6 Q;  3U4Z A;  4A3K G;  4X3T A;  2WP8 J;  2F0M A;  1E2W A;  5FLM H;  4IJL A;  5IIF A;  2KVM A;  5JEA H;  1ESR A;  2JXM B;  2JP1 A;  1J5E Q;  4K2K A;  4K0K L;  1G2T A;  5C3E G;  1C4Q A;  3A5U A;  5C0X J;  1Q90 A;  5KRU A;  1IZ6 A;  3L7Z C;  4XT3 B;  4I7Z C;  3S2D H;  3PO3 G;  1GKH A;  2Q8T A;  3FVQ A;  3H6M A;  1PTO H;  4FDB A;  3BG3 A;  1SYD A;  2DUD A;  4V0B A;  4BXX H;  4PQX A;  3RLO A;  2IX1 A;  4X3U A;  3Q24 A;  4JI2 Q;  4DK3 C;  4U67 3;  2MO1 A;  1JB3 A;  2NYZ D;  2O2L D;  1EOT A;  2IT1 A;  3H3V H;  5AJ3 L;  3FEW X;  1PRT B;  4ZKC B;  1K8M A;  4NMZ A;  1XXG A;  1PLF A;  5KND A;  5FK9 C;  4N9T A;  4DR3 Q;  2MHV A;  4JOI C;  2AMC B;  1KTK A;  2KCN A;  3G7L A;  3A8J E;  4HIO A;  2E2J B;  1B70 B;  3MFY A;  2CWA A;  2A19 A;  1P8L A;  2B39 A;  3VR4 A;  5IGF A;  1XPU A;  1SYE A;  3M4Q A;  3NP8 A;  4MHE A;  1XMO Q;  2WB1 E;  2F0W A;  2B2W C;  5IP7 H;  4QY7 A;  5M5X H;  5C4Z A;  3NWT A;  2OEO A;  1IBM Q;  4B3R L;  2K14 A;  5FLX E;  2I07 B;  3IFD A;  2ZM6 Q;  1SNP A;  1VQM A;  1PXU A;  1VF7 A;  1X55 A;  3S16 B;  3R2T A;  4BY7 H;  4AYB G;  4X3K A;  4A3F B;  4JI0 Q;  3GTJ H;  2KQ3 A;  3DUZ A;  1LTI D;  1YNN C;  4K8I A;  2DNC A;  4R4T A;  1D5X C;  2OTL A;  1BUV T;  3VR2 A;  1U4R A;  2KED A;  2KHI A;  1BCP F;  2QEX A;  4X6A H;  4DV6 L;  1KC8 C;  5FKA C;  1LLR D;  1UE6 A;  2XWB B;  3NQT A;  3J81 j;  2JJQ A;  5CV6 A;  5EKL A;  1TR5 A;  5CYU A;  3U9O A;  2OQ0 A;  4B9X A;  2PI2 E;  3NQI A;  4NXN Q;  1NNX A;  5TSS A;  1QZG A;  2EYJ A;  1X3G A;  3C1E A;  4FF1 A;  3HOY H;  1PH6 A;  2Q2H A;  1WTR A;  2QKI C;  3PQI A;  1B7Y B;  4NW2 A;  4A3J H;  2LXK A;  4EQO A;  1I6V C;  3CCV A;  2VW9 A;  5AFW A;  2VXW A;  3ND8 A;  3FKI B;  3OWF A;  2XSC A;  1JWU D;  3CU7 A;  1D8L A;  2F0N A;  1WOC A;  2E2D C;  2SEB D;  1Y1V B;  1VQJ A;  3G71 A;  1C9O A;  1QNU A;  4L5T A;  3KLS A;  4H13 C;  1OXS C;  1WCM G;  1VQ6 A;  1XWE A;  1SND A;  2QIL A;  5IOC A;  2J0T D;  1H9R A;  2Q2I A;  4PNY A;  3CXC A;  1FNW A;  3JC6 6;  3VDY A;  4JI2 L;  3GP7 A;  4KJN A;  4A3M G;  2KCT A;  2BE5 C;  4DV0 L;  3GTM H;  4DK0 A;  4KN7 C;  2CVR A;  3UE1 A;  1TWG H;  4YCW A;  1XMQ Q;  4MZ9 A;  3VYT A;  4BBR H;  1LUZ A;  4C3J H;  3HOU G;  1CZG A;  1L0X B;  4ILW A;  2EYO A;  3RZD H;  1KL9 A;  3V96 A;  3S2D B;  5IYC G;  3CCJ A;  1Y8O B;  5H1S E;  2F0F A;  1LAC A;  1PTO B;  3EQL C;  3PUY A;  3Q22 A;  1EU3 A;  1BBX C;  3ICE A;  3T51 B;  1I6H B;  4RGO S;  2F0V A;  4A3K H;  1L1O B;  1S5D D;  4PZ8 A;  1AH9 A;  1OXT A;  2RCN A;  1KDC A;  2CH4 A;  3MXN B;  1SFO H;  3KUP A;  1IBM L;  2I5L X;  1GUT A;  1Q86 C;  1HZ9 A;  2ZM6 L;  1GUW A;  4KD3 A;  1JC7 A;  2N88 A;  3C3L A;  2O4X A;  4LNQ A;  3ULJ A;  2EYL A;  3SHL A;  1SMY C;  3GTP H;  1AZP A;  1TWH H;  2IPK D;  3A55 A;  1Q8K A;  1RDP D;  5C3E H;  4DKA C;  3KJP A;  3PUV A;  1JJC B;  4KY6 A;  3IRB A;  1O78 A;  3PO3 H;  4KV6 A;  3ULL A;  1X9N A;  1AN8 A;  2A8V A;  2GVA A;  4GOP B;  4ID6 A;  4NXN L;  4TKO B;  2NN6 I;  1N8R C;  1PH9 A;  5M5X B;  1SNM A;  2WV6 D;  1KDB A;  2QCP X;  1CZW A;  4AIM A;  3L9A X;  2HQE A;  1CSP A;  2R93 G;  2I5M X;  2Z8L A;  4BY7 B;  3WWV A;  1BVS A;  3GTJ B;  1K8A C;  5BR8 Q;  4KJO A;  1L0Y B;  2A74 C;  2EYF A;  1NSN S;  2F0Q A;  2UU9 L;  4WJ4 A;  3CQZ H;  3GTO H;  1TS3 A;  1WFQ A;  1NMG A;  5EAY A;  2B2W A;  4G57 A;  1XYI A;  4FVM A;  3QB3 A;  4CJ2 C;  1ZYR D;  5DM6 3;  1JCK B;  3D0F A;  1N34 Q;  1QVC A;  1D2B A;  1V1P A;  1SDF A;  2N78 A;  3M9B A;  2Q2U A;  3AB9 A;  4P75 A;  1HA6 A;  1STY A;  4KKT A;  3VA5 A;  1L2F A;  1LTR D;  1VS0 A;  2SNM A;  5CGK A;  3BZK A;  4A3J B;  2A69 C;  2IHE A;  3SE0 A;  5M5Y H;  1G6Z A;  1EWC A;  3GDE A;  1A3V A;  4GS3 A;  1SNO A;  1ILQ A;  2DNE A;  4HCS A;  4HAE A;  2PYK A;  1HA5 A;  1HTP A;  4MNO A;  1RD9 D;  2IWH A;  4MTN A;  1HTL D;  1K9M C;  4RWS C;  3I4N G;  1U4L A;  3L0O A;  4IQZ A;  4DR4 Q;  4QF4 A;  1BF4 A;  4IFD G;  2AQ2 B;  4AQY L;  1Q82 C;  2EDG A;  1YBY A;  3GTM B;  3TSS A;  1F9P A;  4FP5 D;  3MWY W;  2E2I H;  1LTL A;  1IKL A;  4ZLT F;  2RQX A;  1DZ1 A;  4C3J B;  4LJZ C;  3PSI A;  3RZD B;  2Z9H A;  1CKN B;  1FNU A;  1EY0 A;  2G9H D;  1PHJ A;  4MTK A;  5FJ8 G;  4ODG A;  5M9O A;  1FVI A;  2WKC A;  3C46 A;  1PH7 A;  2BDO A;  4A3K B;  1ASY A;  1VQ4 A;  2ZTE A;  3H0G G;  1KLU D;  1IHZ A;  2CQA A;  2I46 A;  1IXR A;  1QWY A;  4IAL A;  1SFO B;  1J9O A;  3J7A F;  3RN5 A;  4KY7 A;  5NUC A;  3TEH B;  1EIF A;  2XRS D;  2O5I C;  2EVB A;  4AH6 A;  1EEI D;  3NTI A;  4C1N I;  1UEA B;  4A3M H;  1TWC H;  2EPB A;  4LK1 C;  3KF8 B;  1XPR A;  3GTP B;  1SRO A;  2BCO A;  1TWH B;  4FNF A;  1XPO A;  4JG2 A;  5FO7 B;  2F0U A;  3I4M G;  4P72 A;  1KDA A;  1RKN A;  4ZQ3 A;  3HOU H;  2JA5 G;  4R8I A;  5C3E B;  1HFN A;  5CMD A;  5C0X I;  3N6R A;  3PO3 B;  5IYC H;  3EBE A;  1NCV A;  2K75 A;  3KFU A;  2EOT A;  4UHV A;  4HSP A;  2F0G A;  1M8A A;  2K6A A;  1K83 B;  5J22 A;  1A3T A;  1HNW Q;  4A4I A;  2A6E C;  4DFA A;  1CI3 M;  1E3P A;  1KNE A;  3K6O A;  4IUV A;  4M8A A;  1PA6 A;  1NY4 A;  2PMZ B;  4DUZ L;  2YYZ A;  2K33 A;  1RL2 A;  4IOC A;  3CKI B;  2JE6 I;  5COY A;  3T1H L;  1GHJ A;  1X3Q A;  1BR9 A;  3UDG A;  1CKN A;  3S2H H;  3NBH B;  4HID A;  3FHW A;  4JI7 L;  1K8O A;  3TZD A;  2LS0 1;  4A3G G;  3HKZ G;  2KHS A;  4C1N K;  4DNT B;  5DAU A;  1SJH D;  1KRS A;  3SK5 A;  1STH A;  3KYH C;  4LFC L;  4DAM A;  4C2M H;  3O13 A;  1YZ6 A;  4JI6 L;  3VYU A;  3DEO A;  2IL8 A;  1PYB A;  1Y8N B;  3CC2 A;  5K36 G;  4EGV A;  1R4P B;  5M3M G;  2L1B A;  1MI2 A;  2RBM A;  4LF5 L;  3Q8D A;  5EBD A;  3T56 B;  5M5Y B;  3SDZ A;  5BN5 A;  1OTC A;  4IZ8 A;  5C44 B;  4AYB B;  4CJ0 B;  1BBU A;  2V1C C;  4QB4 A;  5IP9 G;  1HFG A;  5GAG C;  1TY2 A;  3NK9 A;  4JI3 L;  1BKB A;  5C6A A;  1W3S A;  3BS1 A;  3GTQ H;  4DV2 Q;  3IFT A;  3VYR A;  3KJO A;  1A6X A;  2YTX A;  4NDX A;  1EUJ A;  5JOB A;  4UY8 C;  3C2P A;  1ASZ A;  5EQ0 A;  1PYS B;  1GOZ A;  3S15 H;  2JQO A;  2B2V A;  3QR8 A;  2MUY A;  3K7A H;  3CW2 C;  4K8J A;  5C4J H;  2E2I B;  2QW7 A;  1VQH A;  4DR2 L;  3J7Z C;  1NMF A;  2L12 A;  2EYM A;  2F0T A;  4HJ7 A;  1E0B A;  3OYY A;  1WTQ A;  5FOB B;  4LFB L;  4OX9 L;  5ELE A;  3TN2 A;  2BA0 A;  2EYP A;  4TRD A;  4DGZ A;  1Q8I A;  3VYS A;  1HNX L;  2L15 A;  1E22 A;  3ND9 A;  4JBJ A;  1SYB A;  1T5X D;  2UXC L;  3K58 A;  4RAU C;  1K0R A;  2D5D A;  3UDI A;  1B1Z A;  1HNW L;  5EKI A;  3V05 A;  2A1A A;  3FPP A;  2C35 B;  3I4N H;  2EXD A;  1N36 Q;  1O7Y A;  4IFD H;  5C4X G;  2EJF C;  3MXU A;  4A3M B;  5KYL A;  1U4M A;  1TWC B;  1EIY B;  2RSN A;  4LFA L;  3P1H A;  2RF4 A;  4A93 B;  1LAB A;  5L37 A;  5HY6 A;  2K5W A;  1SSO A;  1VQL A;  4ZUJ A;  5ELB A;  4LF7 Q;  2F0D A;  1Q7Y C;  2OWO A;  2B2Y C;  1UE1 A;  1X32 A;  5IT9 L;  5FJ8 H;  2JA7 G;  5DLQ E;  1DM0 B;  2CQO A;  1I3Q B;  2FXQ A;  2RHS B;  3H0G H;  3W2D A;  1VQI A;  5M5W H;  2CWP A;  4GN3 B;  1FGU A;  1D5Z C;  4KKS A;  4OO1 G;  4QCL A;  4E6I A;  5E7N A;  5E4X A;  1XJV A;  1KAW A;  4QMG A;  3I4M H;  1JQY D;  4NKL A;  1UUP A;  2X6L A;  1SYC A;  1F2Y A;  3MFG A;  1HNZ L;  2L4N A;  2CCZ A;  3VR6 A;  1ICF B;  3S24 A;  2K7V A;  2SOB A;  1PDQ A;  5J3B A;  1H9S A;  5JJL A;  1MD2 D;  1W2B A;  3K81 C;  5AJ3 Q;  3VR3 A;  5ELO A;  1BCP D;  4GKK Q;  3W1G A;  1PRT C;  5IE8 A;  1YHA A;  2R92 G;  3FDT A;  4XT1 B;  2IW3 A;  1EY4 A;  3GTQ B;  1SEB D;  1UAP A;  1Q3L A;  2DN8 A;  2V4D A;  3MXP A;  2QA4 A;  3EVQ A;  3H94 A;  4A3G H;  1N32 L;  4DV1 Q;  3Q0A A;  4RKB A;  3S15 B;  2WIN B;  3CCR A;  1EY6 A;  3K7A B;  4B3S L;  5J39 A;  5C4J B;  1VQ5 A;  4HMI A;  4QL5 A;  2VS1 A;  3PF5 A;  1N36 L;  4ME3 A;  5M3F H;  3DWQ A;  3KF6 B;  4B3R Q;  3EN2 A;  5DEH A;  5K36 H;  4J6H A;  4Q5V A;  1II3 A;  2OCE A;  2XGT A;  1TVX A;  1X3F A;  2WB1 G;  2RDG A;  3QG1 A;  4BA1 I;  4CBV A;  3W5O A;  3FPU B;  3M7N A;  3F1Z A;  2XNA C;  1NR4 A;  2MGS A;  4LF7 L;  1VDZ A;  4Z9C B;  1ROD A;  2PQA B;  4JVZ A;  3NSW A;  5IP9 H;  1DJR D;  4CDF C;  3J80 c;  5LMU L;  4ZK9 B;  1YNJ C;  2NTS A;  3DWP A;  3ULP A;  2K50 A;  3M4P A;  2F4V L;  4FXG C;  4P73 A;  2FIN B;  5IYB H;  1NR2 A;  4PG3 A;  1QIL A;  4IPD A;  5JEA J;  2F52 A;  1PH3 A;  5I9P A;  3HFZ B;  3CRK C;  1LYL A;  3E3X A;  3G4S A;  2ALY B;  5IT9 E;  4BBS H;  5EJW A;  4CDE C;  2UUC L;  4IUQ A;  5I6Y A;  4N8F A;  2AHO B;  2E2H B;  5ISR A;  3PV0 A;  1EYA A;  4WOR A;  5CV5 A;  3T13 A;  4L8J A;  1TWA B;  2BOS A;  1AP0 A;  4XYO A;  4OEM B;  4JK1 C;  1ZYR C;  4B3M Q;  1QCB D;  4X3S A;  3CHB D;  3FMC A;  4DAP A;  1CTM A;  1K8G A;  3K0Y A;  3STB D;  4MN3 A;  1ML0 D;  3H0G B;  1O7Z A;  3M4Y A;  3ER0 A;  3F2B A;  3OW2 A;  3J7Y W;  1IYV A;  5M5W B;  3RR5 A;  3J80 L;  1CA6 A;  3KF6 A;  4N9P A;  1LM0 A;  3ITP A;  4DV0 Q;  2KEC A;  1F9Q A;  1MSH A;  3R2I A;  3NEM A;  4FO2 A;  1B8A A;  4JYA Q;  3PCO B;  4HTH A;  4GKK L;  1VQP A;  1JB7 A;  5CBE E;  1ZEQ X;  3GTK H;  4R4Q A;  3TS2 A;  3ERS X;  2PQA A;  1EWH A;  2B2Y A;  1IW7 D;  1G8Z D;  2FMC A;  2K5H A;  5LL6 S;  2QGQ A;  1Q12 A;  3HOZ G;  3MHB A;  5I2X A;  1PTO C;  4CDC C;  4DV1 L;  1AEX A;  1WTV A;  3BYY B;  3SEB A;  2JA7 H;  2JYO A;  2F3W A;  1L1O C;  3T53 B;  1GHK A;  1HUM A;  3TS0 A;  4CKE A;  2K03 A;  3NXW A;  2NBF A;  2VUM H;  4P71 A;  3H3V C;  4ZUI A;  1RIP A;  1QVF A;  1NAP A;  5GQO A;  3LX0 A;  4JI4 L;  4DNR B;  4OO1 H;  1K0S A;  5E4W C;  3MXG A;  3UDF A;  5HUR A;  3R93 A;  5I4D A;  1B44 D;  1D1K A;  5FO9 B;  3C1F A;  4EQ5 A;  3TP7 A;  1S5F D;  3I55 A;  4C56 C;  2E74 C;  4FXK C;  3HKZ B;  1XX8 A;  1YIT A;  1UE7 A;  4LWC A;  4GOP C;  2IX3 A;  5M3F B;  4NXM L;  4OIK A;  2ZXR A;  1O7I A;  2P5Z X;  1STE A;  3NEN A;  1VMP A;  3GTG H;  2F0S A;  4DAV A;  3J7A 5;  2B2U C;  1Q1B A;  4HSV A;  4XTC S;  1CQV A;  1U4P A;  1JWS D;  1XTC D;  2UU9 Q;  3ZYY X;  4RFB A;  1I4H A;  2R92 H;  1HQM C;  2J7Z A;  3TZU A;  4B3M L;  1K28 A;  4IJH A;  1O80 A;  2F0L A;  2Y0S B;  1EEF D;  3I7F A;  2XTI A;  1Y1W G;  1I50 H;  3HP3 A;  1S3O A;  1CKO A;  4YCV A;  2F0P A;  4B3T L;  1SNC A;  2NWG A;  3OIP A;  1STB A;  3B6Y A;  2PNH A;  1JOQ A;  4BBS B;  2F0E A;  3J81 c;  2UXB L;  1F2M A;  1X3P A;  1H9K A;  4JYA L;  4OGQ C;  3TDQ A;  2Z0S A;  1FGB D;  3GQB A;  3E5S A;  4YHH Q;  3M3Y H;  3IL8 A;  5EBC A;  1F2Z A;  4LF6 L;  1BBW A;  2F1M A;  4DUY Q;  1KRT A;  2PCF B;  2AQ3 B;  1PZJ D;  2OTJ A;  1FR3 A;  5IWA L;  1PMR A;  1N33 L;  2HUG A;  4A3I G;  1EIG A;  4DR7 L;  3K7U C;  1GUS A;  4JPB W;  4AQY Q;  2R7Z G;  1PFS A;  3F2D A;  4DAY B;  1SJE D;  1VCI A;  4XIG S;  3GTK B;  3Q6S A;  1QG7 A;  1BNZ A;  2D2C C;  1HR0 Q;  3HOW G;  3AFP A;  4GNX B;  3J81 L;  3QJY A;  1GD7 A;  1VQE A;  1CUK A;  1PFN A;  1S72 A;  1NTG A;  5ELF A;  2E76 C;  3BVM A;  4CJ1 B;  3X3N A;  1LO5 D;  2WAQ B;  3G6J B;  1EWI A;  3A74 A;  4LAA A;  3J7A V;  1TWF H;  1SYG A;  3DWA A;  2R7F A;  5G3L D;  3RN2 A;  1A63 A;  1PH5 A;  3HOV G;  1C0A A;  1FJG L;  2VUM B;  4JW0 A;  4PV1 C;  4Q0F A;  3RNU A;  1V9P A;  1K3R A;  3RD4 A;  1LTB D;  2PO4 A;  2EY1 A;  1V1Q A;  1YJW A;  2N55 A;  1CA5 A;  2YU9 H;  1LTS D;  1DYQ A;  5A2Q L;  1TT2 A;  2IJ0 A;  2PPB C;  1WTP A;  2JA8 G;  1EQR A;  2PZW A;  4DN4 M;  3HOX G;  3R8B A;  2WII B;  2IHF A;  2N3S A;  1L1O A;  4GKJ L;  2X6G A;  1CHP D;  2VY3 A;  1D1I A;  3RLF A;  3HOZ H;  3MXN A;  1BXT A;  4RG1 A;  3HOY B;  2A6H D;  5IGB A;  4DAY A;  2PZU A;  5EKK A;  4DUZ Q;  2B2V C;  1VQF A;  4HED A;  1HZB A;  2D0O A;  3GTG B;  5I9O A;  3ONA B;  4YHH L;  1HJP A;  3GTL H;  4DR6 Q;  1X54 A;  4GNX A;  4K5X A;  3T1H Q;  2FJ2 A;  1WJJ A;  1TS2 A;  2ZTD A;  4DUY L;  1SE4 A;  1EY5 A;  2K32 A;  4EQN A;  2R92 B;  4A3D G;  4JI7 Q;  1JT8 A;  1WD0 A;  4JV5 L;  2AWO A;  1Z47 A;  1Y14 B;  4GOP A;  1BO0 A;  1LT3 D;  1C8C A;  3I72 A;  4LFC Q;  2IY5 B;  2LKV A;  1ENA A;  1VQ9 A;  4JI6 Q;  3TQY A;  1G91 A;  1F2L A;  3RLN A;  2RDF A;  4UP9 A;  5JPN C;  1TWG B;  1Z9F A;  1B9M A;  2O5J C;  4LF5 Q;  2B2U A;  4BBR B;  2VB2 X;  3M3Y B;  3BDO A;  2WB1 B;  2UUB Q;  3A7L A;  5IYD G;  4K5W A;  1SXT A;  4K6L A;  5IGD A;  1HR0 L;  3UI2 A;  3CP0 A;  1JOR A;  3MEF A;  1IYJ B;  2G5D A;  2UXD L;  3S1N H;  5CBA E;  4JI3 Q;  4O2D A;  4HCE A;  4IPH A;  3GO5 A;  1D7Q A;  4IPG A;  3RZO H;  2Z6K C;  2JA6 G;  3BJU A;  1CK1 A;  3AMU A;  4O1N A;  2J4X A;  1WCM H;  2L9H A;  3J81 E;  4KKU A;  1FYC A;  4DK1 A;  1IBK L;  3N52 A;  1BCP C;  4DR2 Q;  1I94 L;  4DR1 L;  2K5N A;  1KIX A;  3OOC A;  1F9S A;  4GLV B;  3FRP B;  3KLW A;  2NN6 G;  4OIJ A;  4LFB Q;  4OX9 Q;  1KNA A;  3D6W A;  1M1K C;  1PRT F;  2KJX A;  4O42 A;  1HNX Q;  3JAM c;  3WDN A;  1IBL Q;  5JJZ A;  2UXC Q;  3A5Z B;  3OSO A;  4GLA C;  3E0E A;  3OMC A;  2EY2 A;  3S1R H;  1GUO A;  4LUV A;  1H9M A;  2AUK A;  4X64 Q;  4A3I H;  5D3I B;  3DEP A;  5A2Q E;  4XQN A;  4ULL A;  1GUN A;  2ZT9 C;  4ZYS A;  3BYT B;  2R7Z H;  3NE5 B;  3QO2 A;  1KAB A;  3EIV A;  2YTV A;  4LFA Q;  3H3V I;  4DR6 L;  4L5R C;  1TKW B;  2ZJR A;  3OHX C;  2YU9 B;  1T5E A;  1WYD A;  3CCS A;  3CQZ B;  3U50 C;  1B3A A;  3NEL A;  4OEL B;  3GTO B;  1KXL A;  2E75 C;  2XRQ D;  4TQU S;  5CV8 A;  3HOW H;  4UAI A;  1SAP A;  4KHZ A;  3T4A C;  4QIW E;  2EXZ A;  3HG9 A;  3HOZ B;  1EY7 A;  4A3F G;  2FHT A;  3JAM L;  2SDF A;  4HJ5 A;  1YNX A;  2LY7 A;  2WKD A;  3NTH A;  2HIV A;  1EY8 A;  4DXF A;  3KF8 A;  3I90 A;  3GTL B;  1IL8 A;  2R93 H;  3DLL A;  4XQQ A;  5HGQ A;  2UUB L;  3OW7 A;  3IKJ A;  5F2D A;  4WJ3 M;  3OTO Q;  2FFK B;  1VQD A;  4KD4 A;  1EYD A;  2ZJQ A;  1XNR L;  3OIQ A;  1E2Z A;  4K14 A;  1Z7T A;  2ZTC A;  3STB C;  2JA8 H;  3SR1 A;  3PIP A;  1PVO A;  2L5T A;  5EGT A;  3CPW A;  3DMU A;  1Q81 C;  3HOX H;  3MA2 B;  1TII D;  4ME5 A;  2SNS A;  3U4V A;  1GJX A;  4P74 A;  1HNZ Q;  2C5C A;  4A3E G;  3F8T A;  4X65 L;  1BCP B;  1IKM A;  1PZI D;  3SK8 A;  1IYU A;  2A68 D;  3SXH A;  2AKW B;  3LGJ A;  1JE4 A;  4MIU A;  1IW7 C;  3D6C A;  3NBH A;  4JI1 Q;  5EPL A;  1HHV A;  3MAQ A;  1BQQ T;  3S1N B;  2NVQ H;  2G9D A;  1IBL L;  4YIJ A;  3ERO A;  1ICW A;  3RZO B;  3F2U A;  4A3D H;  4WRD A;  1XNQ L;  2QEJ C;  3TP5 A;  2ID0 A;  1N32 Q;  1PTO F;  4X64 L;  1WCM B;  2MPM A;  3PO2 G;  3I73 A;  4B3S Q;  2JEA I;  1V1O A;  3T1Y Q;  4IFD J;  5C0X G;  2VQF L;  3W1B A;  5JVH 3;  2MJ8 A;  5LL6 X;  4WJW A;  3CPF A;  4RH6 A;  4R8N A;  4CKC A;  2DJF C;  4RKL A;  1U0L A;  3HOU B;  1J8I A;  2RCF A;  2QDB A;  2Z6B A;  1G6P A;  4KY5 A;  2K28 A;  5IYD H;  5I2Y A;  2TMP A;  3AEV A;  4B08 A;  4PMC A;  2F3I A;  1FD7 D;  4FYD A;  2Z6K A;  1VQ8 A;  2H1E A;  1KHI A;  3CAM A;  3M7G A;  2ZXP A;  1UE5 A;  1S5C D;  5LHY 1;  5LMU Q;  1RTO A;  5ELN A;  1S5E D;  3PIP 3;  2F4V Q;  2ENB A;  2X69 A;  3I4O A;  2JA6 H;  1SE2 A;  4V19 0;  2KUM A;  1HR0 W;  4A3L G;  2R7Z B;  1MSG A;  1ZKO A;  3P75 A;  4YWK A;  3I2Z A;  3F2C A;  5LMN L;  1WD1 A;  1M90 C;  1GO3 E;  1YJ9 A;  2UUC Q;  3OTO L;  3KBX A;  4I65 A;  2F0J A;  3S2H B;  4CKB A;  1I4G A;  3JAM E;  1P16 A;  1JIC A;  1BOS A;  4R4O A;  2NN6 H;  1GVP A;  1D6E C;  2JA5 H;  2OXP A;  4DV7 L;  1FNV A;  5GRO A;  3S9W A;  3CCL A;  4F87 A;  1QOH A;  5D3D A;  4C2M B;  2EQS A;  1ENF A;  4HMJ A;  4IO9 A;  4JBK A;  2Y0S E;  4J1M A;  5ELC A;  2OF1 A;  4HIK A;  4OON A;  2LXJ A;  1E7Z A;  4J15 A;  1EFW A;  1CSQ A;  4ZRZ A;  3S14 H;  4QGU A;  4LF9 L;  1EOV A;  4NB3 A;  2R93 B;  2RDH A;  4BS9 A;  1ILP A;  5KNB A;  4JI1 L;  2M2L A;  3MTS A;  2E2J H;  1AE3 A;  4A3C G;  2L11 A;  1EQV A;  1V43 A;  5JVG 3;  2JA8 B;  2VQE L;  2B3G A;  4F8M A;  2NTT A;  5COR A;  1JJG A;  1TY0 A;  1G51 A;  1CHQ D;  5D65 A;  3TBI B;  3GV6 A;  4L5S A;  2KEN A;  4OXP A;  3T1Y L;  3NBI A;  2EIF A;  3A0J A;  4A3F H;  1PFM A;  4HN7 A;  5M3M H;  3H91 A;  4FF3 A;  2JA9 A;  3KLR A;  1EZ6 A;  4NPS A;  5CV7 A;  2HD3 A;  3I70 A;  1LTT D;  4GN5 A;  3KLS X;  3IAY A;  2CFM A;  2F0K A;  4JI4 Q;  4OL7 A;  1SN8 A;  2Q8I B;  1E1O A;  1QJO A;  3SVM A;  4BWG B;  2NVQ B;  2PZT A;  2AQ1 B;  2HHH Q;  1U5K A;  1NE3 A;  3H09 A;  3K5L A;  1VMC A;  3CC4 A;  4A3D B;  1PH8 A;  1E2V A;  1HZC A;  2EE1 A;  4C3J G;  1RF2 D;  3UE0 A;  2A6E D;  1QNK A;  2NZH A;  2WAQ E;  3LWU A;  5CV9 A;  3I4N B;  4NXM Q;  4JI5 L;  4A3E H;  3NHH A;  5IGE A;  4HJ8 A;  1QZH A;  1B53 A;  4DV5 L;  3TRE A;  4I7A A;  4R4C A;  3J80 i;  4KLK A;  3S17 H;  5BN3 A;  2UUA L;  2L55 A;  1VQN A;  2ZJP A;  3X3M A;  3QIA A;  1WVL A;  3K59 A;  1S5B D;  4EQP A;  1I4X A;  3HKS A;  1B4O A;  3PGZ A;  2B2T A;  1E1T A;  4UPA A;  3MZ5 A;  4A3B G;  1LV9 A;  2EZV A;  1A2U A;  5I6W A;  2K5D A;  1DOM A;  1JOO A;  3A7A B;  2BA1 A;  1V8Q A;  3BZC A;  2A6H C;  1JWM D;  2JA6 B;  1L0W A;  2BDN A;  4DV4 L;  2ZXO A;  1EL0 A;  3NWS A;  4KMU C;  4BY1 G;  3L2P A;  3CD6 A;  4B3T Q;  1VQG A;  5DM7 3;  3T16 A;  3PO2 H;  2MO0 A;  3L3O C;  4ZCK A;  3EA6 A;  4C3I G;  5C4X H;  5C0X H;  2UXB Q;  1C48 A;  5JJI A;  4S3S A;  2CW0 D;  1F9R A;  3KBG A;  5KEE A;  4HJ9 A;  1VQC A;  1B50 A;  1B2T A;  1MHW C;  2JN4 A;  4DA2 A;  1EFI D;  3I4M B;  1HUN A;  3E0J A;  4F88 A;  5CC4 A;  3PMF A;  4LF6 Q;  2JA5 B;  5GAE C;  1HZA A;  1I6H H;  4JBM A;  5C5L A;  2DY8 A;  5IWA Q;  1VQB A;  2AWN A;  5DNF A;  1N33 Q;  4N8X 1;  1UWV A;  3P7J A;  5T1G A;  4DR7 Q;  4ABN A;  5CV4 A;  1JMC A;  3PF4 A;  3MVV A;  3S14 B;  4KK7 A;  4UP8 A;  4A3L H;  3K8A A;  4DR5 L;  4X62 L;  4JI8 L;  3K5O A;  1X56 A;  4HIM A;  4ZAI A;  1LTG D;  4H02 A;  4C3H G;  2HHH L;  4RHS A;  3K57 A;  4GNX C;  4UDU C;  3QOL A;  1LT6 D;  4IUP A;  3CCQ A;  4A3G B;  3BDL A;  5LMN W;  2Q2T A;  2BH2 A;  2DJG C;  3AYH B;  4IPC A;  2HCC A;  2JEB I;  5C44 G;  3TP8 A;  1KD1 C;  2R61 A;  3K80 C;  1H9J A;  3V2T A;  1QUQ B;  1SE8 A;  5M3M B;  1PFB A;  1LT5 D;  3OWE B;  1FJG Q;  4KHV A;  2MQH A;  4RHR A;  4G7Z C;  4H7B A;  2VB3 X;  1MJC A;  1OO9 B;  2MNA A;  1LT4 D;  4IUR A;  1WTX A;  2XN9 C;  4OWT B;  5ELD A;  4FF4 A;  4A3C H;  1I4R A;  4R1J A;  1A8V A;  1QB5 D;  4TVA B;  2OT2 A;  2KEE A;  3U58 A;  2R6G A;  2I0Q A;  2EJM A;  4GKJ Q;  1J5E L;  3HEJ A;  3NTK A;  1WI5 A;  2YTY A;  2K05 A;  4Y7N H;  1CFM A;  4R9W A;  1YJN A;  4A3E B;  1KLG D;  2D9U A;  3S17 B;  3R3O A;  4RA8 A;  3CCM A;  5C3X A;  3FP9 A;  2PMZ E;  1QVG A;  4P2C B;  3HS0 C;  1PH2 A;  1PH4 A;  4RGN A;  3RUZ A;  1WTO A;  3J80 E;  2DGY A;  1JOK A;  2RSO A;  4JV5 Q;  2VL6 A;  3J81 i;  4RGM A;  2HDL A;  4A93 G;  1Z6H A;  3S1Q H;  1QUQ A;  3TRZ A;  2LFN A;  1HQR D;  3PO2 B;  3W3A A;  3CMA A;  1I4Q A;  5KYI A;  1R4Q B;  1RHP A;  5T1I A;  4IFD I;  5C4X B;  1Y69 U;  1N9W A;  1EZ8 A;  1SMX A;  2N49 A;  4DR3 L;  1NJI C;  1PRT D;  4XXE A;  4PZ6 A;  3TP6 A;  3P20 A;  4NP5 A;  1XMO L;  4XYQ A;  4AYB E;  2UXD Q;  1SNQ A;  3BDC A;  3ZJY C;  1V1P B;  4DK6 C;  4A3B H;  4KN4 C;  2K5Q A;  1CT1 D;  2JA7 B;  2A5H A;  4JI0 L;  4CDD C;  1M4V A;  1DCZ A;  1X3E A;  2F4I A;  2A68 C;  2RHQ B;  4BY1 H;  3DHQ A;  1IBK Q;  4RCO A;  4X66 Q;  2GN5 A;  2PNR C;  1I94 Q;  2EJG C;  2F3V A;  3MC0 B;  2OQK A;  2EY6 A;  4DR1 Q;  4C3I H;  4LMQ D;  1EQT A;  3UDX A;  4IUT A;  1B9N A;  1HRJ A;  1W6K A;  5KGU A;  1FL0 A;  1K83 H;  1YNJ D;  5BN4 A;  3AU7 A;  4LUO A;  1I5F A;  2HQL A;  2WFW A;  4ZKB B;  3I4L A;  2D0P A;  1YIJ A;  3D4D A;  2F0I A;  2IX0 A;  2C9O A;  2XWJ B;  2I5H A;  5C4H A;  4APV A;  4JOI A;  4PMB A;  4DV3 Q;  2VNU D;  4A76 A;  5HGT A;  4LF4 Q;  2HDM A;  5GAH C;  1I4P A;  2JK8 A;  1MJE A;  4G7O C;  3DM3 A;  3K0X A;  4GZY C;  1YVC A;  4C3H H;  2B63 G;  4UP7 A;  3HZX A;  1I50 B;  5J1Z A;  1CM9 A;  1BDO A;  1EYG A;  4FF2 A;  1XMQ L;  5C5M A;  4Y7N B;  4JC0 A;  1AZQ A;  2K5V A;  5D14 A;  5IGC A;  3QOJ A;  1MIU A;  5C44 H;  4QQB X;  1PZK D;  2MP1 A;  4HR7 B;  3HRZ C;  3NUC A;  4DXG A;  2B8F A;  3VR5 A;  4IN3 A;  2RKS A;  3PIO A;  1ESF A;  3A54 A;  1SYF A;  5K5P A;  2LSS A;  1AFP A;  2K01 A;  1G29 1;  1A0I A;  1STA A;  5KIX A;  1XNR Q;  3PUW A;  5E1F A;  1CQF A;  4YCU A;  3E6Z X;  4L6T B;  1PV4 A;  1JJ2 A;  3BVZ A;  1PTO D;  1EU4 A;  3NPP A;  2B29 A;  4J8Q A;  1K3B C;  2KHJ A;  2NVT H;  1R9T H;  4QJF A;  1EYC A;  1O7L A;  1TU2 B;  3S1Q B;  1Y1W H;  4LF8 Q;  1SBB B;  2D62 A; 
#chains in the Genus database with same CATH homology
 1ET9 A;  2KCC A;  1OXU A;  1S4Z A;  4TSS A;  5IOD A;  2PW7 A;  1LTA D;  1YNN D;  2KA7 A;  1PYW D;  2Q8R E;  2K04 A;  4A3B B;  3DM1 A;  3OMG A;  1TWF B;  4U68 A;  2XVS A;  5KNC A;  2WAC A;  1EIH A;  4BY1 B;  2Z4I A;  4PMW A;  4C3I B;  2NB0 A;  3ERQ A;  1VF5 C;  3I91 A;  4QUF A;  3PIO 3;  4K2L A;  2L0C A;  3PUX A;  2RVL A;  1SE3 A;  1GUG A;  1UNS A;  1OXV A;  5G3L F;  2BE5 D;  4K6D A;  4H44 C;  1AW7 A;  3U9S A;  2RA4 A;  2NZ1 D;  4RCN A;  4OO1 I;  1GXD C;  2Z1C A;  4C3H B;  1MBY A;  2DY7 A;  1ONL A;  3OPO A;  4M1U B;  2H4O A;  3Q23 A;  3SK6 A;  3K5M A;  1ZXT A;  5EPJ A;  4H0L C;  1G2S A;  2A73 B;  5CR3 A;  2CW0 C;  1ENC A;  1SMY D;  2FMM A;  1STG A;  1TS4 A;  2EYH A;  2LMC B;  5E3F A;  5EPK A;  5C3W A;  2CHB D;  4QUC A;  3I8Z A;  4RGT A;  2QF7 A;  5JEA G;  3LWE A;  2F0O A;  2NVT B;  5A35 A;  2B2T C;  1R9T B;  3A8I E;  5JPM C;  1STN A;  1Y1W B;  1HCZ A;  1KAA A;  4CHT B;  4F7X A;  2NUC A;  3GD7 A;  1DOK A;  3WOE A;  3A8K E;  2ICE C;  2JSO A;  3WOF A;  3DXJ C;  2EY5 A;  3D3R A;  1RJT A;  4XDX A;  3S1R B;  2NVY B;  3PUZ A;  3QWN A;  4A3I B;  2NVX B;  1H9S B;  4DU9 A;  2TSS A;  3S1M B;  2F03 A;  3RMH A;  2A69 D;  3BVG A;  4B9W A;  1OXX K;  3EJI A;  1HXY D;  4OHJ A;  3M85 A;  1JR0 D;  2HCI A;  4CGY B;  3I3C A;  1A15 A;  3HOW B;  1D5M C;  2ICI A;  3VA7 A;  4G4K A;  4IUN A;  1U9R A;  4DF7 A;  1DON A;  2F0H A;  1EY9 A;  3KK7 A;  1W6J A;  3TME A;  4WFN 3;  2KOL A;  3D4R A;  5FO8 B;  3BZD B;  2B8G A;  3URY A;  1WTW A;  3HOV B;  2Z4H A;  1QE6 A;  4L63 B;  1DXM A;  2K1B A;  1TS5 A;  4KTA A;  3HGB A;  5IGG A;  1HPC A;  2PQE A;  5JAV A;  4BA2 I;  3K5N A;  3SK4 A;  3M4O B;  1DD2 A;  3MEH A;  1A3U A;  3HOX B;  3D4W A;  2GA4 B;  3D8G A;  2M9V A;  2AUJ D;  3A56 A;  3EFX D;  1MGS A;  2R3Z A;  1F77 A;  3LNN A;  1A2T A;  5FLX L;  3CRL C;  4FXD A;  2PW5 A;  4K5V A;  1Y8P B;  2B63 B;  1Q1E A;  4G7H C;  1DOL A;  4JBW A;  1RCV D;  4EVO A;  3D31 A;  1NUC A;  1RTN A;  2M00 A;  1TQO A;  4XQJ A;  4IUU A;  3GV3 A;  4QIW B;  4KI0 A;  2XIW A;  1ET6 A;  4X3T A;  2WP8 J;  2F0M A;  1E2W A;  5IIF A;  2KVM A;  5JEA H;  1ESR A;  2JXM B;  2JP1 A;  4K2K A;  1G2T A;  1C4Q A;  5C0X J;  1Q90 A;  5KRU A;  3L7Z C;  4XT3 B;  4I7Z C;  2Q8T A;  3FVQ A;  3H6M A;  1PTO H;  3BG3 A;  1SYD A;  4V0B A;  4PQX A;  2IX1 A;  4X3U A;  3Q24 A;  4U67 3;  1JB3 A;  2NYZ D;  2O2L D;  1EOT A;  2IT1 A;  3FEW X;  1PRT B;  4ZKC B;  1K8M A;  4NMZ A;  1XXG A;  1PLF A;  5KND A;  5FK9 C;  4N9T A;  2MHV A;  1KTK A;  2KCN A;  3G7L A;  3A8J E;  2E2J B;  3MFY A;  2B39 A;  3VR4 A;  5IGF A;  1SYE A;  3NP8 A;  4MHE A;  2F0W A;  2B2W C;  5C4Z A;  3NWT A;  2OEO A;  5FLX E;  2I07 B;  3IFD A;  1SNP A;  1PXU A;  1VF7 A;  3S16 B;  3R2T A;  4X3K A;  4A3F B;  2KQ3 A;  3DUZ A;  1LTI D;  1YNN C;  4K8I A;  2DNC A;  1D5X C;  1BUV T;  3VR2 A;  1U4R A;  2KED A;  1BCP F;  5FKA C;  1LLR D;  3NQT A;  2XWB B;  5CV6 A;  5EKL A;  1TR5 A;  5CYU A;  3U9O A;  4B9X A;  3NQI A;  5TSS A;  2EYJ A;  3C1E A;  4FF1 A;  1WTR A;  2QKI C;  4NW2 A;  4EQO A;  1I6V C;  5AFW A;  2VXW A;  3ND8 A;  3FKI B;  3OWF A;  2XSC A;  1JWU D;  2F0N A;  3CU7 A;  2E2D C;  2SEB D;  1Y1V B;  1QNU A;  3KLS A;  4H13 C;  1OXS C;  1XWE A;  1SND A;  2QIL A;  5IOC A;  2J0T D;  1H9R A;  4PNY A;  1FNW A;  3GP7 A;  4KJN A;  2BE5 C;  4DK0 A;  4KN7 C;  2CVR A;  3VYT A;  1CZG A;  1L0X B;  4ILW A;  2EYO A;  3V96 A;  3S2D B;  1Y8O B;  2F0F A;  1LAC A;  1PTO B;  3EQL C;  3PUY A;  3Q22 A;  1EU3 A;  1BBX C;  3T51 B;  1I6H B;  4RGO S;  2F0V A;  1S5D D;  1OXT A;  1KDC A;  3KUP A;  1GUT A;  1GUW A;  4KD3 A;  1JC7 A;  2N88 A;  3C3L A;  2O4X A;  2EYL A;  3SHL A;  1SMY C;  1AZP A;  2IPK D;  3A55 A;  1RDP D;  3PUV A;  4KY6 A;  1O78 A;  4KV6 A;  1AN8 A;  4ID6 A;  4TKO B;  2NN6 I;  5M5X B;  1SNM A;  2WV6 D;  1KDB A;  2QCP X;  1CZW A;  3L9A X;  2HQE A;  2Z8L A;  4BY7 B;  3GTJ B;  4KJO A;  1L0Y B;  2A74 C;  2EYF A;  1NSN S;  2F0Q A;  1TS3 A;  2B2W A;  4G57 A;  1XYI A;  4FVM A;  3QB3 A;  4CJ2 C;  1ZYR D;  5DM6 3;  1JCK B;  1D2B A;  1V1P A;  1SDF A;  3AB9 A;  1HA6 A;  1STY A;  4KKT A;  3VA5 A;  1LTR D;  2SNM A;  5CGK A;  4A3J B;  2A69 C;  3SE0 A;  1G6Z A;  1EWC A;  1A3V A;  1SNO A;  1ILQ A;  2DNE A;  4HCS A;  4HAE A;  2PYK A;  1HA5 A;  1HTP A;  1RD9 D;  2IWH A;  1HTL D;  4RWS C;  1U4L A;  4IQZ A;  4QF4 A;  1BF4 A;  4IFD G;  2AQ2 B;  2EDG A;  3GTM B;  3TSS A;  1F9P A;  4FP5 D;  3MWY W;  1IKL A;  4ZLT F;  2RQX A;  1DZ1 A;  4C3J B;  4LJZ C;  3RZD B;  1FNU A;  1EY0 A;  2G9H D;  4ODG A;  5M9O A;  2WKC A;  3C46 A;  2BDO A;  4A3K B;  1KLU D;  1IHZ A;  2CQA A;  2I46 A;  1QWY A;  4IAL A;  1SFO B;  1J9O A;  3J7A F;  4KY7 A;  5NUC A;  2XRS D;  2O5I C;  2EVB A;  1EEI D;  3NTI A;  4C1N I;  1UEA B;  2EPB A;  4LK1 C;  3GTP B;  2BCO A;  1TWH B;  4FNF A;  5FO7 B;  2F0U A;  1KDA A;  1RKN A;  4ZQ3 A;  4R8I A;  5C3E B;  1HFN A;  5CMD A;  5C0X I;  3N6R A;  3PO3 B;  1NCV A;  2EOT A;  4HSP A;  2F0G A;  1M8A A;  2K6A A;  1K83 B;  5J22 A;  1A3T A;  2A6E C;  4DFA A;  1CI3 M;  1KNE A;  3K6O A;  4IUV A;  4M8A A;  2PMZ B;  2YYZ A;  2K33 A;  3CKI B;  2JE6 I;  5COY A;  1GHJ A;  1X3Q A;  1BR9 A;  1K8O A;  3TZD A;  2LS0 1;  2KHS A;  4C1N K;  4DNT B;  5DAU A;  1SJH D;  3SK5 A;  1STH A;  3O13 A;  3VYU A;  3DEO A;  2IL8 A;  1Y8N B;  5K36 G;  4EGV A;  1R4P B;  2L1B A;  1MI2 A;  2RBM A;  5EBD A;  3T56 B;  5M5Y B;  3SDZ A;  5BN5 A;  4IZ8 A;  5C44 B;  4AYB B;  4CJ0 B;  4QB4 A;  1HFG A;  1TY2 A;  3NK9 A;  5C6A A;  3BS1 A;  3IFT A;  3VYR A;  1A6X A;  4NDX A;  5JOB A;  3C2P A;  5EQ0 A;  1GOZ A;  2B2V A;  2MUY A;  4K8J A;  2E2I B;  2L12 A;  2EYM A;  2F0T A;  1E0B A;  1WTQ A;  5FOB B;  5ELE A;  3TN2 A;  2BA0 A;  2EYP A;  4TRD A;  4DGZ A;  1Q8I A;  3VYS A;  3ND9 A;  1SYB A;  1T5X D;  3K58 A;  4RAU C;  2D5D A;  1B1Z A;  5EKI A;  3V05 A;  3FPP A;  1O7Y A;  4IFD H;  2EJF C;  3MXU A;  4A3M B;  5KYL A;  1U4M A;  1TWC B;  2RSN A;  3P1H A;  4A93 B;  1LAB A;  2K5W A;  1SSO A;  4ZUJ A;  5ELB A;  2F0D A;  2B2Y C;  5IT9 L;  1X32 A;  1DM0 B;  1I3Q B;  3W2D A;  1D5Z C;  4KKS A;  4OO1 G;  4QCL A;  4E6I A;  5E4X A;  4QMG A;  1JQY D;  4NKL A;  1UUP A;  2X6L A;  1SYC A;  1F2Y A;  3MFG A;  2L4N A;  3VR6 A;  2K7V A;  2SOB A;  1PDQ A;  1H9S A;  1MD2 D;  3VR3 A;  1BCP D;  1PRT C;  3FDT A;  4XT1 B;  2IW3 A;  1EY4 A;  3GTQ B;  1SEB D;  1UAP A;  1Q3L A;  2DN8 A;  2V4D A;  3MXP A;  3EVQ A;  3H94 A;  3Q0A A;  4RKB A;  3S15 B;  2WIN B;  1EY6 A;  3K7A B;  5J39 A;  5C4J B;  4HMI A;  3DWQ A;  5K36 H;  5DEH A;  4J6H A;  4Q5V A;  1II3 A;  1TVX A;  3QG1 A;  2RDG A;  4BA1 I;  4CBV A;  3FPU B;  3M7N A;  2XNA C;  1NR4 A;  2MGS A;  1VDZ A;  4Z9C B;  1ROD A;  3NSW A;  1DJR D;  4ZK9 B;  1YNJ C;  2NTS A;  3DWP A;  4FXG C;  2FIN B;  1NR2 A;  1QIL A;  5JEA J;  5I9P A;  3CRK C;  5IT9 E;  5EJW A;  4IUQ A;  5I6Y A;  2E2H B;  5ISR A;  3PV0 A;  1EYA A;  4WOR A;  5CV5 A;  3T13 A;  4L8J A;  1TWA B;  2BOS A;  1AP0 A;  4XYO A;  4JK1 C;  1ZYR C;  1QCB D;  4X3S A;  3CHB D;  3FMC A;  4DAP A;  1CTM A;  3K0Y A;  4MN3 A;  1ML0 D;  3H0G B;  1O7Z A;  3M4Y A;  3J7Y W;  1IYV A;  5M5W B;  3J80 L;  1CA6 A;  4N9P A;  3ITP A;  2KEC A;  1F9Q A;  1MSH A;  3R2I A;  4FO2 A;  4HTH A;  5CBE E;  1ZEQ X;  1EWH A;  2B2Y A;  1IW7 D;  1G8Z D;  2FMC A;  5LL6 S;  1Q12 A;  3MHB A;  5I2X A;  1PTO C;  1AEX A;  1WTV A;  3BYY B;  3SEB A;  2JYO A;  2F3W A;  3T53 B;  1GHK A;  1HUM A;  4CKE A;  2K03 A;  3NXW A;  2NBF A;  3H3V C;  4ZUI A;  1NAP A;  3LX0 A;  4DNR B;  4OO1 H;  5E4W C;  3MXG A;  5HUR A;  3R93 A;  5I4D A;  1B44 D;  1D1K A;  5FO9 B;  3C1F A;  3TP7 A;  1S5F D;  4C56 C;  2E74 C;  4FXK C;  3HKZ B;  1XX8 A;  2IX3 A;  5M3F B;  4OIK A;  2ZXR A;  1STE A;  1VMP A;  2F0S A;  4DAV A;  2B2U C;  1Q1B A;  4HSV A;  4XTC S;  1CQV A;  1U4P A;  1JWS D;  1XTC D;  3ZYY X;  4RFB A;  1I4H A;  1HQM C;  2J7Z A;  3TZU A;  1O80 A;  2F0L A;  2Y0S B;  1EEF D;  3HP3 A;  2F0P A;  1SNC A;  2NWG A;  3OIP A;  1STB A;  1JOQ A;  4BBS B;  2F0E A;  1F2M A;  1X3P A;  1H9K A;  4OGQ C;  3TDQ A;  1FGB D;  3GQB A;  3E5S A;  3IL8 A;  5EBC A;  1F2Z A;  2F1M A;  2PCF B;  2AQ3 B;  1PZJ D;  1FR3 A;  1PMR A;  2HUG A;  1EIG A;  1GUS A;  1SJE D;  1VCI A;  4XIG S;  3GTK B;  3Q6S A;  1QG7 A;  1BNZ A;  2D2C C;  3J81 L;  3QJY A;  1PFN A;  5ELF A;  2E76 C;  3BVM A;  4CJ1 B;  3X3N A;  1LO5 D;  2WAQ B;  3G6J B;  4LAA A;  3J7A V;  1SYG A;  3DWA A;  5G3L D;  2VUM B;  4PV1 C;  4Q0F A;  3RD4 A;  1LTB D;  2PO4 A;  2EY1 A;  2N55 A;  1CA5 A;  1LTS D;  1DYQ A;  5A2Q L;  1TT2 A;  2IJ0 A;  2PPB C;  1WTP A;  2PZW A;  4DN4 M;  3R8B A;  2WII B;  2X6G A;  1CHP D;  1D1I A;  3RLF A;  3MXN A;  1BXT A;  3HOY B;  2A6H D;  5IGB A;  4DAY A;  2PZU A;  5EKK A;  2B2V C;  4HED A;  3GTG B;  5I9O A;  3ONA B;  4K5X A;  2FJ2 A;  1TS2 A;  1SE4 A;  1EY5 A;  2K32 A;  4EQN A;  2R92 B;  1WD0 A;  2AWO A;  1Z47 A;  1BO0 A;  1LT3 D;  1C8C A;  3I72 A;  2LKV A;  1ENA A;  1G91 A;  1F2L A;  2RDF A;  5JPN C;  1TWG B;  1B9M A;  2O5J C;  2B2U A;  4BBR B;  2VB2 X;  3M3Y B;  3BDO A;  2WB1 B;  3A7L A;  4K5W A;  1SXT A;  4K6L A;  5IGD A;  3UI2 A;  1JOR A;  5CBA E;  4HCE A;  3GO5 A;  1CK1 A;  3AMU A;  4O1N A;  2J4X A;  2L9H A;  3J81 E;  4KKU A;  1FYC A;  4DK1 A;  3N52 A;  1BCP C;  3OOC A;  1F9S A;  3FRP B;  2NN6 G;  4OIJ A;  1KNA A;  3D6W A;  1PRT F;  2KJX A;  4O42 A;  3WDN A;  5JJZ A;  3OMC A;  3OSO A;  2EY2 A;  1GUO A;  1H9M A;  2AUK A;  5D3I B;  3DEP A;  5A2Q E;  4XQN A;  4ULL A;  1GUN A;  2ZT9 C;  4ZYS A;  3BYT B;  3NE5 B;  3QO2 A;  1KAB A;  1TKW B;  2YU9 B;  3OHX C;  1T5E A;  3CQZ B;  1B3A A;  3GTO B;  2E75 C;  2XRQ D;  4TQU S;  5CV8 A;  4UAI A;  1SAP A;  4KHZ A;  3T4A C;  2EXZ A;  3HG9 A;  3HOZ B;  1EY7 A;  2FHT A;  3JAM L;  2SDF A;  2LY7 A;  2WKD A;  3NTH A;  1EY8 A;  4DXF A;  3KF8 A;  3I90 A;  3GTL B;  1IL8 A;  4XQQ A;  3OW7 A;  3IKJ A;  5F2D A;  2FFK B;  4KD4 A;  1EYD A;  3OIQ A;  1E2Z A;  4K14 A;  1Z7T A;  3SR1 A;  2L5T A;  5EGT A;  3DMU A;  3MA2 B;  1TII D;  4ME5 A;  2SNS A;  1GJX A;  2C5C A;  1BCP B;  1IKM A;  1PZI D;  3SK8 A;  1IYU A;  2A68 D;  3SXH A;  1JE4 A;  4MIU A;  1IW7 C;  3D6C A;  3NBH A;  5EPL A;  1HHV A;  3MAQ A;  1BQQ T;  3S1N B;  2G9D A;  4YIJ A;  3ERO A;  1ICW A;  3RZO B;  3F2U A;  4WRD A;  2QEJ C;  3TP5 A;  2ID0 A;  1PTO F;  1WCM B;  2MPM A;  3I73 A;  2JEA I;  1V1O A;  4IFD J;  5C0X G;  5JVH 3;  2MJ8 A;  5LL6 X;  4WJW A;  4RH6 A;  4R8N A;  4CKC A;  4RKL A;  3HOU B;  1J8I A;  2QDB A;  4KY5 A;  2K28 A;  5I2Y A;  2TMP A;  4B08 A;  4PMC A;  4FYD A;  1FD7 D;  2H1E A;  3M7G A;  2ZXP A;  1S5C D;  5LHY 1;  1RTO A;  1S5E D;  3PIP 3;  2ENB A;  2X69 A;  1SE2 A;  4V19 0;  2KUM A;  2R7Z B;  1MSG A;  1ZKO A;  3P75 A;  1WD1 A;  3KBX A;  4I65 A;  2F0J A;  3S2H B;  4CKB A;  1I4G A;  3JAM E;  1JIC A;  1BOS A;  2NN6 H;  1D6E C;  2OXP A;  1FNV A;  3S9W A;  4F87 A;  1QOH A;  5D3D A;  4C2M B;  1ENF A;  4HMJ A;  4J1M A;  5ELC A;  2OF1 A;  4ZRZ A;  2R93 B;  2RDH A;  4BS9 A;  1ILP A;  5KNB A;  2M2L A;  3MTS A;  2L11 A;  1EQV A;  1V43 A;  5JVG 3;  2JA8 B;  4F8M A;  2NTT A;  5COR A;  1TY0 A;  1CHQ D;  5D65 A;  3TBI B;  3GV6 A;  3NBI A;  1PFM A;  4HN7 A;  3H91 A;  4FF3 A;  3KLR A;  1EZ6 A;  5CV7 A;  3I70 A;  1LTT D;  3KLS X;  3IAY A;  2F0K A;  4OL7 A;  2Q8I B;  1QJO A;  3SVM A;  4BWG B;  2NVQ B;  2PZT A;  2AQ1 B;  3H09 A;  3K5L A;  1VMC A;  4A3D B;  1E2V A;  2EE1 A;  4C3J G;  1RF2 D;  2A6E D;  1QNK A;  3LWU A;  3I4N B;  5CV9 A;  3NHH A;  5IGE A;  1B53 A;  5BN3 A;  2L55 A;  3X3M A;  3QIA A;  1WVL A;  3K59 A;  1S5B D;  4EQP A;  1I4X A;  1B4O A;  2B2T A;  3MZ5 A;  1LV9 A;  2EZV A;  1A2U A;  5I6W A;  2K5D A;  1DOM A;  1JOO A;  3A7A B;  2BA1 A;  1V8Q A;  2A6H C;  1JWM D;  2JA6 B;  2BDN A;  2ZXO A;  1EL0 A;  3NWS A;  4KMU C;  5DM7 3;  3T16 A;  3L3O C;  3EA6 A;  4C3I G;  5C0X H;  1C48 A;  4S3S A;  2CW0 D;  1F9R A;  3KBG A;  5KEE A;  1B50 A;  1B2T A;  4DA2 A;  1EFI D;  3I4M B;  1HUN A;  3E0J A;  4F88 A;  5CC4 A;  3PMF A;  2JA5 B;  5C5L A;  2DY8 A;  2AWN A;  5DNF A;  3P7J A;  5T1G A;  4ABN A;  5CV4 A;  3MVV A;  3S14 B;  4KK7 A;  3K5O A;  4ZAI A;  1LTG D;  4C3H G;  4RHS A;  3K57 A;  4UDU C;  3QOL A;  1LT6 D;  4IUP A;  4A3G B;  3BDL A;  2HCC A;  2JEB I;  3TP8 A;  2R61 A;  1H9J A;  3V2T A;  5M3M B;  1PFB A;  1LT5 D;  3OWE B;  4KHV A;  4RHR A;  4G7Z C;  4H7B A;  2VB3 X;  1OO9 B;  1LT4 D;  4IUR A;  1WTX A;  2XN9 C;  5ELD A;  4FF4 A;  1I4R A;  1QB5 D;  2OT2 A;  2KEE A;  2R6G A;  2EJM A;  3HEJ A;  3NTK A;  2K05 A;  1CFM A;  4R9W A;  4A3E B;  1KLG D;  2D9U A;  3S17 B;  3R3O A;  4RA8 A;  5C3X A;  4P2C B;  3HS0 C;  4RGN A;  3RUZ A;  1WTO A;  3J80 E;  1JOK A;  2RSO A;  4RGM A;  2HDL A;  1Z6H A;  2LFN A;  1HQR D;  3PO2 B;  3W3A A;  1I4Q A;  5KYI A;  1R4Q B;  1RHP A;  5T1I A;  4IFD I;  5C4X B;  1Y69 U;  1EZ8 A;  1PRT D;  4XXE A;  3TP6 A;  3P20 A;  4NP5 A;  4XYQ A;  1SNQ A;  3BDC A;  1V1P B;  4KN4 C;  2K5Q A;  1CT1 D;  2JA7 B;  2A5H A;  1M4V A;  1DCZ A;  2F4I A;  2A68 C;  3DHQ A;  4RCO A;  2PNR C;  2EJG C;  2F3V A;  3MC0 B;  2EY6 A;  4LMQ D;  1EQT A;  4IUT A;  1B9N A;  1HRJ A;  1W6K A;  5KGU A;  1YNJ D;  5BN4 A;  3AU7 A;  4ZKB B;  3I4L A;  3D4D A;  2F0I A;  2IX0 A;  2C9O A;  2XWJ B;  5C4H A;  4PMB A;  2VNU D;  5HGT A;  2HDM A;  1I4P A;  4G7O C;  4GZY C;  3HZX A;  1I50 B;  5J1Z A;  1CM9 A;  1BDO A;  4FF2 A;  5C5M A;  4Y7N B;  1AZQ A;  5D14 A;  5IGC A;  3QOJ A;  1PZK D;  2MP1 A;  4HR7 B;  3HRZ C;  3NUC A;  4DXG A;  2B8F A;  3VR5 A;  4IN3 A;  2RKS A;  1ESF A;  3A54 A;  1SYF A;  5K5P A;  1AFP A;  2K01 A;  1G29 1;  5KIX A;  1STA A;  3PUW A;  5E1F A;  1CQF A;  3E6Z X;  4L6T B;  3BVZ A;  1PTO D;  1EU4 A;  3NPP A;  4J8Q A;  1EYC A;  1O7L A;  1TU2 B;  3S1Q B;  1SBB B;  2D62 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...