4XYOA

Structure of agra lyttr domain
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
99
structure length
99
Chain Sequence
VETIELKRGSNSVYVQYDDIMFFESSTKSHRLIAHLDNRQIEFYGNLKELSQLDDRFFRCHNSFVVNRHNIESIDSKERIVYFKNKEHCYASVRNVKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Accessory gene regulator A
publication title Conformational features of the Staphylococcus aureus AgrA-promoter interactions rationalize quorum-sensing triggered gene expression
doi rcsb
source organism Staphylococcus aureus (strain col)
molecule tags Dna binding protein
total genus 28
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2015-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04397 LytTR LytTr DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1020 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4xyoA00
4XQJA 4XQNA 3BS1A 4XXEA 4XQQA 4XYQA 4XYOA 4CBVA 4G4KA
chains in the Genus database with same CATH superfamily
4DUYQ 1HZ9A 3GTJH 1RIPA 2A68C 4RWSC 4A3JH 5EKKA 1B7YB 1S72A 3M9BA 1MIUA 3NXWA 3QR8A 3RZDH 3P20A 1UUPA 2J7ZA 2KECA 4NXNL 4FP5D 4DR6Q 4LFAL 3GTLB 3RZOB 1RHPA 3LNNA 4DV3L 2F0MA 5C5MA 1YJNA 3CCEA 1M8AA 2L11A 5GAEC 2K5DA 1C7YA 1NUCA 4DPGA 4A3KG 4X65L 1VMCA 2Q8RE 2MFIA 2A6HD 2UXDQ 3O13A 4JBKA 1JICA 4MHEA 1TS4A 2J0TD 2CQAA 2A73B 2TMPA 3M7NA 2AWOA 4JC0A 1I6VC 3OW2A 3CXCA 3J80i 1YNNC 2UUBQ 1WI5A 1OXVA 3RZOH 3FPPA 4EVOA 2RDHA 4DXFA 1PH6A 1EWCA 3E6ZX 3C1EA 3I8ZA 1SNOA 1FGBD 1MGSA 1SNQA 4OHJA 3S15H 1PTOF 3S1NH 1EYDA 4YCWA 1LTSD 4A3BB 3ZYYX 1U4RA 3OHXC 4KD3A 1UE6A 2UUAL 4P72A 1EY8A 2I0QA 4XT3B 3NPPA 2K5QA 4IUVA 2NBFA 4ZUJA 1F9RA 3V96A 1D5ZC 4CKEA 2UXBL 3S16H 3U9OA 2Q8IB 2I5MX 4B9WA 4GKKQ 5IIFA 4A3BH 1K0SA 1U0LA 2WAQB 2YV5A 5M3FB 1MJEA 1MHWC 4QUFA 4AH6A 2H1EA 1PVOA 3LX0A 3L3OC 4M8AA 5D3IB 3AYHB 3RD4A 4KKUA 4DR7Q 2R7ZB 1EWIA 1WTVA 5I9OA 2QDLA 2MP1A 1NJIC 5C3WA 2SOBA 3R2TA 4NMZA 3HS0C 3OMCA 5LMNQ 4TRDA 2DUDA 2K32A 4GOPC 4B3TL 2KA7A 3U50C 4DNTB 4BY1H 1EWHA 5EPKA 1UNSA 1I3QH 3HOWG 2L5TA 4XQQA 1H95A 2RQXA 4IALA 1S4ZA 3PUWA 1L0WA 4DR4L 1SNPA 4XYOA 4LF6L 1ESFA 3T16A 1W6KA 2H5XA 2HIVA 5H1SE 2Z6KA 4CBVA 5KIXA 4XTCS 4JBMA 2VL6A 1ZEQX 3MZ5A 3PMFA 2B8FA 3RMHA 1E22A 5HGQA 2IL8A 1CFMA 2BE5C 4JBWA 1BQQT 2E76C 3NQTA 1H9SA 1I94L 3U4ZA 4KKTA 2K5NA 3KJOA 1GUOA 2XN9C 3C2PA 1KDCA 1EY4A 4NXML 1MSGA 4Y7NB 3DWPA 3J7AV 1UE1A 5IYCH 4DV4L 5JJIA 2JA6B 5CGKA 4MN3A 2GVBA 4LF8Q 5CR3A 1WTHA 4FF1A 4IUNA 5LMUL 3K5OA 4L63B 4X66Q 1ONLA 4C3JB 5T1IA 2B2VA 3PO3B 2Z0SA 4KD4A 1RJTA 4U68A 5KYIA 4C3IB 1Q12A 3PO2B 3HOUB 1L1OA 1EZ8A 4Y7NH 5JPMC 3S17B 4B3RQ 1IYVA 1K3RA 3ND9A 3FKIG 2JA6H 3UI2A 1WTXA 5JEAG 3C3LA 2JEBI 4A3DG 2A6EC 1JB3A 2D0OA 4AQYL 5EKLA 4M1UB 4JI5L 2Q2TA 2MGSA 2Z8LA 4A3FB 5LL6S 1BKBA 2F0LA 3TP8A 2K28A 1T5XD 2F0KA 1CQFA 1ENFA 2K03A 2B2TC 4YY3L 3HOUH 5FK9C 2JJQA 2G9HD 5ELOA 3CRLC 3NTIA 1CM9A 4A3CH 4YIJA 4R4OA 1HQMC 2Q8TA 1VQEA 4C3HH 1HH2P 1SXTA 4WJ4A 4A3FH 4A3LH 2BOSA 1Q3LA 2BH8A 5DLQE 4GNXA 2R92G 3T1YL 2E2JH 1XMQL 2J4XA 2X6GA 4JV5L 5FJ8H 2VQEL 4RGMA 2E2HH 2R3ZA 4L6TB 4BBSG 2EDGA 4JI3L 1LT6D 3GTQB 2AQ1B 3FPUB 2A5HA 4O1NA 2UUCQ 4DGZA 5A2QL 1F9QA 2EXDA 2JA8H 4JI6L 5IP9H 3AMUA 5GQOA 4DV1Q 3AFPA 1TWHB 5IGEA 4JI2L 3D0FA 1PFSA 3PUZA 5M5WH 3GTQH 1GHKA 3QOJA 1TQOA 1W6JA 1IBMQ 1YI2A 1HNWQ 1O7ZA 2EXZA 2FXQA 4DR1Q 1U4PA 1M4VA 2CW0D 1RF2D 1GUTA 4FXGC 4ZCKA 5EQ0A 5KRUA 3EIVA 3X3NA 4K5XA 4DR5Q 4A3EB 1ASZA 4JOIA 1FD7D 1AP0A 3BJUA 3JAME 4XQNA 2VW9A 2P5ZX 4A3MB 3I4MH 2K7VA 1HR0Q 4OX9L 4BY7B 3VA5A 2QW7A 2SDFA 4LF9Q 2B39A 1CT1D 3F2UA 4YWMA 2L4NA 1I6HB 2HUGA 4HSVA 4A3EH 1BBWA 3H3VC 2HT1A 3UE0A 1HNZL 4A4IA 4DR3L 1TWAB 5CBAE 5NUCA 1X9NA 5J22A 4A3MH 1E0BA 1IZ6A 2ES2A 5C4JB 3PIO3 4EQNA 4DV0L 4OONA 2Z6BA 3DWAA 3SK8A 3MHBA 1BCPB 1EIFA 1N32Q 3TEHB 3A8KE 4BBRB 4DUYL 3GQBA 3C46A 3K59A 2A8VA 1TWAH 3HKSA 1IBLQ 2EY6A 3HGBA 3NUCA 2XWJB 2WB1G 5FLXL 1AN8A 1UE7A 2YYZA 4FXDA 5C4JH 1PH5A 1HJPA 3RR5A 4DR6L 1XTCD 3BDCA 3E9HA 3A5ZB 3NBHB 4KY5A 1XNRQ 5L37A 3OTOQ 1GO3E 1V1PB 1C8CA 4QY7A 2CCZA 2M2LA 4GS3A 3GTKH 3I55A 2UXCL 2L12A 1RD9D 1SN8A 1EOVA 3F8TA 3HOZG 1H9MA 2ID0A 4QIWE 3E3XA 3W5OA 1B70B 3BG3A 1CI3M 2N3SA 3S1QB 2MO1A 1RCVD 4HMIA 1HA6A 2UUBL 2FHTA 3PSIA 4IFDJ 2KQ3A 4GOPA 2VUMG 3MC0B 4QL5A 3QOLA 4XYQA 1E2VA 5EJWA 3H0GG 5IT9c 4N8FA 4PMWA 4L5SA 2QA4A 4ZKBB 3QO2A 3X3MA 1F77A 1G2SA 1X3GA 4BA1I 1HTLD 3QWNA 3S1QH 4WORA 3I4NG 1A63A 1SRUA 1VS0A 2YTYA 3TP7A 5C0XJ 5COYA 4I65A 3GTOB 5C4ZA 1X56A 2BA1A 1QOHA 1DZ1A 4N9PA 5EPJA 1Y1VB 4GKKL 2R93G 2KBNA 4ZRZA 4X3UA 1NSNS 1K83B 4U673 5M5YB 1KLGD 2WIIB 1XXGA 2HCIA 4IN3A 4RAUC 3NENA 3IAYA 3M4OB 1IYJB 1STNA 1KTKA 4DR7L 1VQIA 1ESRA 1HRJA 1EIHA 2N8NA 4RKBA 2JE6I 4DAVA 4QCLA 4K6DA 1WYDA 5M5YH 3FDTA 5D14A 3PF4A 2LXKA 1Q86C 1NAPA 1O7IA 1QNKA 3J80c 4NXMQ 1MD2D 2B2UC 5E3FA 2D5DA 2F0IA 4A75A 1PYWD 3FHWA 1M1KC 1SYFA 1KNEA 1AW7A 3S2HB 3SK6A 1PZID 3K57A 1ASYA 4FXKC 1LUZA 1VQGA 4A3KB 1ILPA 2E2IB 1HZAA 1SNDA 1EQRA 1Y69U 3KF8A 5IP7G 2F52A 1SROA 1VQJA 3K0XA 1TWGB 3CKIB 5C4XG 1Y1WG 2HCCA 4ME5A 1ILQA 5ELNA 1EY5A 4UP9A 2QCPX 1QNUA 5IODA 4H7BA 2QEXA 2Z6KC 1STBA 1HFGA 3TDQA 1EQTA 2F03A 1CSQA 4FO2A 3CCVA 2N49A 2B63G 2LFNA 4DR2L 4KTAA 4CJ0B 2K5WA 2D0PA 2KEDA 2E5LL 1SMYC 2FMMA 3PUXA 4DU9A 4OWXB 1EL0A 4MIUA 4X66L 5M3MG 1V1OA 2WB1E 4L5TA 3T1YQ 1I5FA 3KF6A 3HOYG 4X62Q 1CK1A 5DNFA 1JMCA 5M5XB 5K5PA 2WP8J 1QZGA 1EFID 2B2YC 3T13A 2CWPA 1RDPD 1BUVT 3J7A5 4QGUA 2B2VC 1Q82C 4JI3Q 2QEJC 2V1CC 5IYDH 4NDXA 2YU9B 5CV9A 2N88A 1EU3A 2F0NA 1TY0A 1L1OC 2ENBA 4FYDA 4IUQA 1PRTC 4BWGB 1B9MA 4MZ9A 4MNOA 4F7XA 4JI6Q 5FLXc 2PZTA 2QILA 1YVCA 1FYCA 2JA5H 3TP5A 1F2YA 1BNZA 3I3CA 1CSPA 2Q2IA 1JWMD 2FJ2A 3V05A 3OIPA 2F0FA 3LWEA 3BDOA 3HOWB 1X3EA 2XNAC 1VF5C 3A7AB 5KNCA 1VQ9A 1TS2A 4HEDA 1GJXA 2BDNA 4H0LC 2IX3A 1PH3A 3K5LA 1TR5A 3EFXD 5K36G 1VDZA 4GNXC 2CHBD 1KC8C 1F2LA 1TKWB 1FNUA 1GUGA 4XQJA 1PFNA 1O7LA 2ZJQA 2UUCL 1TWFB 1DD2A 5C6AA 4IFDG 1I50B 4JCVE 1SBBB 3ONAB 1EY6A 2ATWA 3CD6A 2DNEA 1WCMG 1FJGQ 5CORA 4DV1L 2A6HC 3KYHC 3Q6SA 3ZJYC 3H3VH 1UAPA 1CQVA 4HCSA 3J7ZC 3MAQA 3PQIA 3VR3A 1NMFA 1IBML 2LY7A 1HTPA 1DCZA 1PTOH 3K80C 1HNWL 1ET6A 1R4PB 4DR1L 3EROA 1CKNB 1L0XB 1NY4A 3OSOA 2RA4A 1GHJA 5I2XA 4G7HC 2FFKB 2K75A 1GD7A 4DR5L 3JAML 2V4DA 5GADC 4ABNA 2JEAI 3GTPH 4PZ8A 2JQOA 1D5XC 3SHLA 1HR0L 1TWCB 4RHRA 4HIOA 4R4TA 2LSSA 3K58A 1A62A 4A93G 4LF9L 4QIWB 3S2DB 1K8OA 1STYA 3FKIB 4DNIA 1LT4D 3WWVA 4DF7A 2Z4IA 2EQSA 3A55A 1ET9A 3I2ZA 4C2MB 4A3DB 4JOIC 1G51A 3DLLA 4MTNA 3AFQA 1DGSA 4GN3B 2UXCQ 1IW7D 2NTTA 4X3TA 1JB7A 4CJ1B 2N55A 5C44G 3CCJA 2OCEA 1YHAA 5BN5A 4LFBL 1O7YA 3GDEA 4NKLA 2NN6I 2IX1A 2F3VA 3T1HQ 5C3XA 3S2DH 3FKIH 3GTLH 5JEAH 3NK9A 4OL7A 5EKIA 5JVH3 1D1KA 3DMUA 1N32L 2KJXA 4IQZA 3CPFA 3RNUA 3S14B 4DAPA 5LMNW 1N9WA 3L7ZC 1VQBA 2O2LD 2R92B 1IBLL 2IWHA 1KRSA 1STAA 4IUPA 3TS0A 1KRTA 3WOFA 5G3LD 3TP6A 2ZTEA 4GLAC 4P73A 2IHEA 3PIOA 3ER0A 3E0JA 3CMEA 4BBSB 2KENA 4B9XA 5JOBA 1KABA 1XNRL 2I5HA 3OTOL 1DOMA 3OYYA 3S14H 1LTLA 2NZOA 1B2TA 2EYPA 5IGGA 2R92H 1X32A 3PCOB 1YZ6A 3MXGA 3GTGB 4EQPA 3J81E 1O80A 2Z4HA 5JVG3 3E9IA 3ULPA 1SYEA 4DXGA 3H91A 1EUJA 1PFBA 1E1TA 1X3QA 1B44D 1VQAA 1C9OA 3CP0A 2B2UA 1SEBD 1A2TA 5ELCA 3FVQA 3I4LA 3CCUA 3GTGH 1DXMA 4OELB 1EIYB 2PZUA 4J1MA 4NB3A 5M3FH 2KHSA 4GN4B 2PW7A 2ICIA 1GVPA 1N36Q 4O42A 1VQOA 2NVXB 4CDFC 3GD7A 2OWOA 1PH9A 5I6YA 4K8JA 1PZJD 5A35A 1A2UA 1G6PA 2R7ZH 5BN4A 3CQZB 5FO9B 3NE5B 2CQOA 3GO5A 1B1ZA 2VXWA 2NVXH 1BCPD 5I2YA 4I7ZC 4IJLA 1SE2A 3CC2A 3B6YA 4DK3C 1FGUA 2CH4W 1SYGA 2GN5A 4LUZA 3CQZH 4UPAA 4IPGA 1IKMA 3V2TA 1H9SB 2RSNA 4WJ3M 2F4VQ 1K3BC 4JVZA 5DEHA 4L5RC 2WB1B 2Q2UA 4DR2Q 4RCNA 2E5LQ 1KXLA 4A3IG 4B3SL 2BCOA 5KNBA 2B2YA 4PZ6A 4GLVB 2LXJA 4UAIA 4UY8C 4A3JG 2K01A 3D31A 3CCSA 1RL2A 1L1OB 3STBD 3HOZB 3FRPB 4POFA 1T9HA 2OQ0A 3D4RA 2EVBA 1PRTB 1AZPA 5EPLA 1EZ6A 4V190 4IURA 1PV4A 2AKWB 3NQIA 1K8MA 1SFOB 3D3RA 2HD3A 4G7OC 1CA5A 4C3JH 2VUMB 1S5FD 4B3MQ 1OXUA 1K28A 2ICEC 3PO3H 4V0BA 3H0GB 4X64L 3R2IA 4C3IH 1A3VA 3I56A 3PO2H 1NMGA 2XGTA 2A69D 3S17H 2M9VA 1GKHA 1YNJD 2JXMB 3NEMA 4ODGA 4RFBA 3I70A 3T53B 2E74C 3I4NB 2OQKA 1M90C 1VMPA 3M4QA 1HZBA 2VUMH 2HIXA 3W3AA 2CW0C 1VF7A 4GNXB 2BE5D 1EIGA 2IW3A 4GKJQ 4X62L 2ZJRA 2PQAA 2R93B 1XWEA 3NHHA 1Z7TA 2PQEA 4OWWB 2EYJA 1KLUD 3G71A 2OT2A 1IYUA 3K7AB 1IHZA 5IGDA 2PI2A 5JPNC 1LO5D 3WDNA 1K8AC 1IBKQ 4GZYC 2KEEA 4KN4C 3HOXG 4UDUC 1NE3A 1JT8A 1DYQA 3JC66 4X6AH 1TU2B 3G7LA 2ZXPA 1WJJA 4LF4L 4JI0L 1J5EQ 4QQBX 3CCRA 1XPRA 3R8BA 1S5ED 1VQ8A 1CHQD 3GP7A 3HOVG 1NCVA 5CBEE 4OWTB 3HZXA 1SJHD 3F1ZA 5ELBA 1PRTF 3FEWX 4FDBA 5ELEA 4L8JA 5CV8A 2AWNA 2PO4A 2X6LA 2HQEA 4C1NI 3H15A 3QIAA 1Y14B 1TWHH 1PYBA 4GLXA 5FLMH 1QVFA 2JP1A 2IT1A 1O78A 1FL0A 1XJVA 4BY1G 3MXPA 3NP8A 4AYBG 1VQ4A 1HFNA 3SK4A 1TY2A 1S40A 3CCMA 4OXPA 2VB2X 5C4XB 3U58A 1Y1WB 1S5BD 1Q1BA 3ICEA 1QVCA 3E0EA 3IKJA 1VQKA 2MO0A 3W2DA 3VYRA 2B8GA 1FJGL 4DK6C 1ICWA 2LS01 3BZCA 1QWYA 2XIWA 4OO1H 1X65A 1KAWA 4BY7H 2ZTCA 4LFBQ 1BBXC 5IWAQ 2B63B 3IL8A 4PZ7A 4CKBA 3RN2A 1I6HH 1SJED 1PZKD 2H4OA 5C4XH 3T51B 2F4IA 1C0AA 1LTID 2C5CA 4FNFA 2JA9A 1J9OA 1SDFA 2EIFA 4G57A 1MJCA 5M3MB 3KDFA 4HIKA 1JOQA 3GTMB 2HHHQ 3HOYB 3ITPA 3PUYA 2PCFB 1SNMA 4IOCA 2B63H 2CKZB 3IFDA 1U9RA 5I9PA 3DUZA 1JWUD 3TZDA 2K52A 2HDLA 4DV7Q 4R8NA 4XDXA 5BR8L 4BBRH 3BS1A 5M3MH 2KHJA 2MUYA 3ERQA 1I4PA 4RGTA 1STGA 2BA0A 4H44C 4YCVA 5HGTA 3NBIA 3HKZG 4QUCA 4CJ2C 3GTMH 3BYTB 3SXHA 2JN4A 1E2WA 4CHTB 1SLJA 4YCUA 3MVVA 5KGUA 3T1HL 3J7YW 2KHIA 3T56B 4KY7A 1YIJA 1BBUA 2EE1A 5IGFA 4GOPB 2ZXOA 4ZKCB 3D6CA 3EBEA 1SNCA 1WTOA 3BZKA 1HCZA 4IUUA 2L0CA 1LLRD 5JJZA 1U4MA 4HN7A 1C48A 1JJGA 2G9DA 1UE5A 1W3SA 5C3EG 2RCFA 3MWYW 2O5JC 2XVSA 4Q5VA 1KHIA 1CHPD 4CKCA 2Z1CA 1PTOD 4IOAA 4TKOB 1JE5A 3I90A 4C3HG 3F2BA 3NWTA 2SEBD 2DY8A 1GXDC 4A3LG 4OO1I 3A8IE 2NTSA 1HQRD 3J81L 2NVQB 2MJ8A 3N52A 1J8IA 3Q22A 2F1MA 2R6GA 2VZAA 3FP9A 3JAMi 3IFTA 3OPOA 3K0YA 5FJ8G 4NW2A 1AEXA 5E1FA 1WCMB 1VQCA 2AHOB 3I7FA 3Q8DA 3L0OA 3H94A 4POGA 1CTMA 1QE6A 5TSSA 3GTOH 2EOTA 1AE2A 3RLFA 5D65A 1FNWA 1Q81C 2NVQH 5AJ3Q 3Q24A 1VQ5A 2ZT9C 4YHHQ 2A19A 4HJ9A 1Y1VH 2QKIC 5CV5A 4IFDH 2JA8G 3MTSA 2K33A 5GAHC 1VQMA 1K83H 4J6HA 1X55A 2EJMA 2UU9L 1ZYRD 1N36L 2B29A 1DJRD 2CWAA 1HUNA 1D2BA 1SAPA 2IX0A 3M4OH 4BXXH 4A93B 1QUQA 2F0GA 1LABA 1XMOQ 4B3SQ 4JW0A 4ID6A 1QJOA 5IGBA 2WKCA 4PV1C 3SE0A 5C0XH 1SYBA 4TVAB 3P75A 5IYBG 4P71A 2PZWA 3EQLC 1XNQQ 2WINB 1G291 1YJ9A 1E24A 3KF8B 1PMRA 4AYBE 5C44B 3I4MG 2YTVA 2IPKD 3MXNA 1K8GA 3F2DA 1YNXA 1XX8A 1HZCA 1TIID 4L5QA 2PYKA 2K14A 3OW7A 2XRQD 3G6EA 3S2HH 2PPBC 2KCMA 2F4VL 4A3KH 4J15A 4CDDC 1JCKB 4X64Q 1MSHA 2E2IH 1G2TA 5C44H 3I4OA 5IT9E 4P2CB 1JOOA 3MA2B 1X3PA 2BDOA 1IL8A 4OGQC 4DA2A 1TWGH 1B3AA 2K05A 4KI0A 4R8IA 1U4LA 2A74C 3SGIA 4KHVA 3TS2A 2CH4A 5FOBB 1LV9A 3CCQA 4DV5Q 1WFQA 2F0EA 1TS3A 3L9AX 4F88A 4ZUIA 1YITA 4I7AA 1MKHA 3TQYA 3KF6B 5I4DA 1DOLA 3SVMA 1I4GA 4RH6A 2ALYB 1JQYD 1JC7A 3KLWA 4WFN3 1YJWA 2WFWA 4X3SA 3TN2A 2IY5B 3CMAA 3QB3A 1A15A 5DM73 4EGVA 5JJLA 3CPWA 2QF7A 4B3ML 2K4KA 1BF4A 3HKZE 3Q23A 3BVZA 1H9KA 2HQLA 3K5NA 4ALPA 2XWBB 2NZ1D 4DAYA 5EBCA 2JA7G 2K1BA 5M5XH 3S1MB 1Q7YC 4LF4Q 1VQFA 3GV3A 2MNAA 5J1ZA 4JI0Q 5DAUA 3KLRA 1N34Q 4G7ZC 1PH2A 3M3YB 4DN4M 2PNHA 1PH8A 2YU9H 3J80E 2B2WC 4GKJL 1GOZA 1YBYA 2NVYB 3AQQA 4HR7B 3S1MH 1P8LA 5CV7A 1YHQA 2GVAA 4EQOA 2L15A 1SMYD 4R1JA 3DXJC 4DV2L 1WOCA 3I73A 1OTCA 2E75C 3A7LA 3HOWH 1IBKL 4ZAIA 2L9HA 2NVYH 2XRSD 3BVGA 2NVTB 1CKMA 1IW7C 4KN7C 3RLOA 1EQVA 1AZQA 1E3PA 2NZHA 2K50A 2PI2E 1J5EL 1PDQA 4K14A 2JK8A 1CZGA 1D6EC 2DN8A 4DK0A 1J6QA 3L2PA 1F9PA 2TSSA 4NP5A 3CU7A 3MFYA 1XYIA 1TWFH 3VDYA 1I50H 3KJPA 4A3IB 3K8AA 4JI4Q 2WV6D 3NWSA 1ML0D 3NSWA 1SYCA 2VS1A 5HY6A 4Z9CB 2O5IC 4A3JB 4K6LA 2RF4A 2SNSA 4DUZQ 3DEPA 3VR2A 3RZDB 1JE4A 4TSSA 2F0OA 4RHSA 3TZUA 5IY0A 4JYAQ 4DV6Q 5ISRA 2C9OA 2RSOA 4IUTA 1B9NA 3R3OA 5BR8Q 4HJAA 1N33Q 1BVSA 3S9WA 1B8AA 2EYOA 5FKAC 1QZHA 1STHA 1EY7A 2RBMA 3EA6A 4X3KA 1STEA 3TMEA 2GA4B 1H9RA 5IOCA 1TWCH 5IWAL 3D6WA 1IL2A 5FLXE 1K9MC 1K0RA 4LF5L 4A3DH 3EN2A 4C2MH 5FO7B 4RKLA 2HDMA 1AH9A 4QB4A 5JAVA 3CHBD 2VB3X 1JJ2A 3KFUA 1EY9A 4P74A 3QG1A 3CAMA 2E2DC 5M9OA 2PNRC 3CC4A 1R4QB 2HHHL 3S15B 3S1NB 1V1QA 3DEOA 2MPMA 4K0KL 1EOTA 1LT3D 1S3OA 2WKDA 1I4QA 1X54A 4DV7L 3H3VI 3D4DA 3VR4A 2EJGC 3A74A 3A8JE 4ZQ3A 5C5LA 4G4KA 4PNYA 2EZVA 1QG7A 1VQDA 1SSOA 4IPCA 1QB5D 4LFCQ 4OEMB 2A68D 3S16B 2D9UA 5J3BA 2CVRA 3HOXB 1CKOA 1A3TA 3U9SA 3D8GA 3KBGA 5EAYA 2Z9HA 1BCPC 2C35B 1BXTA 4BBSH 2MHVA 3M4YA 2I07B 1SE3A 3KUPA 5IYDG 4HSPA 4WRDA 1U5KA 2DGYA 3HOVB 4AIMA 3HRZC 2Y0SG 4TQUS 1ICFB 1FVIA 1BDOA 3BDLA 4LAAA 4JI7Q 3HOXH 1PYSB 2R7DA 3MEFA 1OO9B 1IXRA 3J81j 3HG9A 2JA5G 5CC4A 2UU9Q 3EVQA 4HIDA 4DFAA 4K2KA 2I46A 2L1BA 2QGQA 1YNND 3BZDB 3HOVH 4BY1B 1PHJA 4XXEA 1ZXTA 4AYBB 1NBWA 1FNVA 3KOJA 1I3QB 1HUMA 1A0IA 4JK1C 1XTDA 2NN6G 2G5DA 1E1OA 4H13C 4A3GG 4HJ7A 3BVMA 1W2BA 3OWFA 2F0QA 3STBC 1LTTD 1DOKA 4FF4A 5E7NA 2EY1A 1TVXA 2R61A 3SEBA 4OIKA 3ULJA 1IKLA 1BO0A 3NELA 2WACA 1BR9A 3DWQA 1JR0D 4JI1Q 5AJ3L 1I4XA 2F0PA 4YHHL 1RKNA 4QMGA 1S5DD 3BYYB 3G48A 4KV6A 3H09A 1LM0A 5BN3A 2A69C 2RHQB 4F87A 1YNJC 1HNXQ 3OWEB 5D3DA 4KLKA 1JWSD 3LWUA 4ZK9B 5GROA 1Q1EA 1XMOL 2DJGC 3VA7A 4S3SA 1KL9A 1MBYA 2QDBA 3DM1A 1XNQL 2DJFC 1E7ZA 3E5SA 4XT1B 3HKZB 1KDBA 2KCTA 4KHPQ 4EQ5A 2IHFA 4YWLA 2EJFC 3W1GA 5KYLA 5KNDA 4UP8A 1JOKA 2JYOA 5IE8A 2OXPA 2F3WA 3VYSA 4R4CA 3J81i 1NR2A 5IT9L 3JAMc 5KEEA 2B2WA 3UDIA 1SR3A 2AQ2B 5C3EB 4JI8Q 3HOZH 3I91A 3MXUA 1HXYD 4IPDA 3GV6A 1NR4A 3P7JA 2D62A 4LUOA 1II3A 2VNUD 1OXXK 3VYTA 3MFGA 3SR1A 3C1FA 1RTOA 4C3HB 1SFOH 2YTXA 2KUMA 4O0AA 1HA5A 4DV5L 2Q2HA 3ND8A 4EX5A 3AEVA 1G6ZA 3OMGA 4LF7Q 3H0GH 4K8IA 2E2JB 1OXSC 3TSSA 2PQAB 4P75A 5C3EH 1HR0W 1LT5D 2OEOA 1LYLA 2E2HB 1V8QA 1A6XA 3QJYA 5CMDA 1WD1A 1EU4A 3I4NH 4WJWA 3N6RA 4HMJA 2F0SA 2ZM6Q 4DV2Q 3A0JA 3NTHA 1EQQA 4Q0FA 3HFZB 3PIP3 2NYZD 1PH4A 2R93H 4A3BG 4DKAC 1EY0A 1G8ZD 2JA8B 1X3FA 1Z9FA 3HP3A 2F0JA 4HTHA 3URYA 4K5WA 3DM3A 3J80L 3K7AH 1N34L 2Y0SE 3M7GA 1Q8IA 2A6ED 1TT2A 5M5WB 1EEID 4LWCA 3D4WA 1OXTA 1UEBA 1PLFA 3AU7A 1PH7A 2ZJPA 1NNXA 3BU2A 3LGJA 2WAQG 4F8MA 4KJOA 4Y52H 1HPCA 5M3FG 1EFWA 2EY5A 3I4MB 3CW2C 1KNAA 1SE4A 4ILWA 4E6IA 5JJKA 4CDCC 2R7FA 1VQLA 4UP7A 1I4HA 1WVLA 2R7ZG 1Y8OB 2VQFQ 5E4XA 2B3GA 1D5MC 2VY3A 5EBDA 1KQSA 3SK5A 2OTJA 1K73C 2X69A 2KVMA 5IYBH 4FF2A 3VR5A 2SNMA 5AFWA 4OIJA 4BA2I 3UDFA 3OOCA 1GUSA 2F0VA 5T1GA 1KD1C 2K04A 5IP7H 2K5VA 2EYMA 3KBXA 4NXNQ 2M00A 2KCCA 1WD0A 4KHZA 1V9PA 2EY2A 4LFAQ 3S24A 4LF5Q 1Y1WH 4DV3Q 4JI4L 3MEHA 2NB0A 4ZYSA 4KKSA 5ELDA 3KDFB 4HJ5A 4X65Q 4PQXA 4PG3A 1CA6A 2EYLA 3S1RB 1T5EA 1FR3A 1LTGD 4CGYB 1L0YB 4DUZL 1PTOC 5LHY1 5IYCG 1I4RA 3DHQA 4FF3A 4K0KQ 2AQ3B 4J8QA 4FVMA 2PMZE 1CUKA 2ZTDA 4JYAL 4KY6A 4DV6L 2RHSB 4KJNA 1N33L 3AB9A 1WTWA 3GTKB 2ASBA 2ZXRA 1PFMA 5G3LF 3S1RH 4JG2A 3HOYH 2NUCA 2DY7A 1PA6A 2JA7B 2NWGA 4IJHA 5CV4A 1H9JA 1RTNA 1QILA 2JA6G 2UUAQ 2F0DA 1LACA 3A5UA 4BS9A 3CRKC 3F2CA 2AMCB 3NBHA 4APVA 4IPHA 4C3JG 1V1PA 3IRBA 1D7QA 3PO3G 1A8VA 1WTQA 1HHVA 1EYGA 1AFPA 3RUZA 1C4QA 4C3IG 2UXBQ 3PO2G 3HOUG 2UXDL 3HEJA 2JA7H 5FO8B 2EYHA 1ZYRC 1MI2A 4A3CG 4YWKA 4KK7A 3M4PA 2FINB 2RKSA 4A3FG 1VQNA 1V43A 4IZ8A 1LTRD 1F2ZA 4LNQA 2FMCA 4PMBA 4LFCL 1SE8A 1E2ZA 3J7AF 1YHBA 3UDXA 3ULLA 4B3TQ 4RG1A 4ZLTF 5K36H 1QVGA 3I72A 1N8RC 4JPBW 1WTPA 1LTBD 4JI7L 2O4XA 2KCNA 2A1AA 1F2MA 3A54A 5IP9G 4DR4Q 1WCMH 1SMXA 1BCPF 1RODA 5F2DA 4LF6Q 2K5HA 4RA8A 4JBJA 3KLSX 4GN5A 5E4WC 3A56A 4LUVA 1QUQB 2OTLA 2WAQE 1ENAA 1LTAD 1VQHA 1I94Q 1Y8NB 2RCNA 5LMNL 1XPOA 3W1BA 2XSCA 1L2FA 5FLMG 2LKVA 4UHVA 1KAAA 3MXNB 1PXUA 1KIXA 1Q8KA 1VCIA 4DV4Q 5C4HA 4JI1L 4A93H 4MTKA 1X6OA 2F0TA 4PMCA 5LMUQ 1ENCA 2MQHA 2PW5A 4A3EG 2LMCB 3T4AC 4HIMA 2BH2A 3VYUA 5DM63 3TBIB 3WOEA 4RGOS 4A3MG 4OO1G 2XTIA 4BY7G 4LMQD 2K6AA 5HURA 1XPUA 4QJFA 1HNXL 3K6OA 4C56C 1D1IA 2B2TA 3FMCA 3KK7A 1DM0B 4ULLA 1B50A 2CFMA 4AQYQ 1PH1A 4JI5Q 1QCBD 1YEZA 4R4QA 1VQ6A 3K5MA 4LJZC 2E8GA 2RVLA 4LK1C 2OF1A 2EYFA 2RDGA 4YY3Q 4HCEA 4KHPL 1KDAA 4IFDI 2I5LX 1P16A 4IO9A 1F9SA 5CV6A 1Q46A 4LF8L 3PV0A 2F0HA 4QF4A 5I6WA 1BOSA 4BBRG 3K81C 2JSOA 1WTRA 3VR6A 4LW1A 2Y0SB 5CYUA 1G91A 1XMQQ 4DAYB 4RMFA 3UDGA 4HAEA 3OIQA 3ERSX 4RCOA 4JI8L 4JV5Q 3M85A 2RDFA 4O2DA 5GAGC 2N78A 2VQEQ 1R9TB 4B3RL 1Z6HA 4N8X1 5C0XI 3PF5A 2JA5B 4R9WA 1TS5A 3P1HA 1B4OA 1B53A 5IGCA 5J39A 3CC7A 1DONA 2F3IA 2AUJD 4NPSA 3TREA 3RN5A 3RLNA 1EYAA 3NTKA 4N9TA 4LF7L 1D8LA 3G6JB 1B3QA 3CCLA 2F0WA 1EYCA 2IJ0A 1JJCB 4A3GB 1Z47A 3UE1A 1R9TH 3CF5A 5A2QE 3EJIA 4KMUC 4DK1A 1UWVA 5C0XG 2L55A 1GUWA 2F0UA 4C1NK 1UEAB 4JI2Q 3SDZA 3M3YH 2ZM6L 2DNCA 4R4IA 1SYDA 3PUVA 2NN6H 1VQ7A 4A3GH 4XIGS 4DNRB 1AE3A 3H6MA 3R93A 2EPBA 4B08A 4H02A 4OX9Q 4K2LA 1ZKOA 3G4SA 1PTOB 2D2CC 4DAMA 4HJ8A 1NTGA 3J81c 3PIPA 1Y1VG 3KLSA 2NVTH 3TRZA 1Y8PB 1CZWA 2PMZB 1GM5A 1PRTD 5ELFA 1TXYA 1HNZQ 1Q90A 3GTJB 4DR3Q 3GTPB 4K5VA 5JEAJ 1JORA 1A3UA 3Q0AA 4A76A 3K7UC 2KOLA 4ME3A 1GUNA 1VQPA 4BXXG 4RGNA 3PGZA 4DV0Q 2AUKA 5LL6X 4CDEC 4A3IH 1CKNA 2VQFL 3U4VA 5EGTA 1S5CD 1EEFD
chains in the Genus database with same CATH topology
2A68C 4RWSC 5EKKA 3NXWA 3P20A 1UUPA 2J7ZA 2KECA 4FP5D 3GTLB 3RZOB 1RHPA 3LNNA 2F0MA 5C5MA 1M8AA 2L11A 2K5DA 1NUCA 1VMCA 2Q8RE 2A6HD 3O13A 1JICA 4MHEA 1TS4A 2J0TD 2CQAA 2A73B 2TMPA 3M7NA 2AWOA 1I6VC 1YNNC 1OXVA 3FPPA 4EVOA 2RDHA 4DXFA 1EWCA 3E6ZX 3C1EA 3I8ZA 1SNOA 1FGBD 1MGSA 1SNQA 4OHJA 1PTOF 1EYDA 1LTSD 4A3BB 3ZYYX 1U4RA 3OHXC 4KD3A 1EY8A 4XT3B 3NPPA 2K5QA 4IUVA 2NBFA 4ZUJA 1F9RA 3V96A 1D5ZC 4CKEA 3U9OA 2Q8IB 4B9WA 5IIFA 2WAQB 5M3FB 4QUFA 2H1EA 3LX0A 3L3OC 4M8AA 5D3IB 3RD4A 4KKUA 2R7ZB 1WTVA 5I9OA 2MP1A 5C3WA 2SOBA 3R2TA 4NMZA 3HS0C 3OMCA 4TRDA 2K32A 2KA7A 4DNTB 1EWHA 5EPKA 1UNSA 2L5TA 4XQQA 2RQXA 4IALA 1S4ZA 3PUWA 1SNPA 4XYOA 1ESFA 3T16A 1W6KA 4CBVA 5KIXA 4XTCS 1ZEQX 3MZ5A 3PMFA 2B8FA 3RMHA 2IL8A 1CFMA 2BE5C 4JBWA 1BQQT 2E76C 3NQTA 1H9SA 4KKTA 1GUOA 2XN9C 3C2PA 1KDCA 1EY4A 1MSGA 4Y7NB 3DWPA 3J7AV 2JA6B 5CGKA 4MN3A 5CR3A 4FF1A 4IUNA 3K5OA 4L63B 1ONLA 4C3JB 5T1IA 2B2VA 3PO3B 4KD4A 1RJTA 4U68A 5KYIA 4C3IB 1Q12A 3PO2B 3HOUB 1EZ8A 5JPMC 3S17B 1IYVA 3ND9A 3UI2A 1WTXA 5JEAG 3C3LA 2JEBI 2A6EC 1JB3A 5EKLA 4M1UB 2MGSA 2Z8LA 4A3FB 5LL6S 2F0LA 3TP8A 2K28A 1T5XD 2F0KA 1CQFA 1ENFA 2K03A 2B2TC 5FK9C 2G9HD 3CRLC 3NTIA 1CM9A 4YIJA 1HQMC 2Q8TA 1SXTA 2BOSA 1Q3LA 2J4XA 2X6GA 4RGMA 2R3ZA 4L6TB 2EDGA 3GTQB 1LT6D 2AQ1B 3FPUB 2A5HA 4O1NA 4DGZA 5A2QL 1F9QA 3AMUA 1TWHB 5IGEA 3PUZA 1GHKA 3QOJA 1TQOA 1W6JA 1O7ZA 2EXZA 1U4PA 1M4VA 2CW0D 1RF2D 1GUTA 4FXGC 5EQ0A 5KRUA 3X3NA 4K5XA 4A3EB 1FD7D 1AP0A 3JAME 4XQNA 4A3MB 2K7VA 4BY7B 3VA5A 2SDFA 2B39A 1CT1D 3F2UA 1I6HB 2L4NA 2HUGA 4HSVA 3H3VC 1TWAB 5CBAE 5NUCA 5J22A 1E0BA 5C4JB 3PIO3 4EQNA 3DWAA 3SK8A 3MHBA 1BCPB 3A8KE 4BBRB 3GQBA 3C46A 3K59A 2EY6A 3HGBA 3NUCA 2XWJB 5FLXL 1AN8A 2YYZA 4FXDA 1XTCD 3BDCA 4KY5A 1V1PB 1C8CA 2M2LA 2L12A 1RD9D 1H9MA 2ID0A 3BG3A 1CI3M 3S1QB 1RCVD 4HMIA 1HA6A 2FHTA 4IFDJ 2KQ3A 3MC0B 3QOLA 4XYQA 1E2VA 5EJWA 4PMWA 4ZKBB 3QO2A 3X3MA 1F77A 1G2SA 4BA1I 1HTLD 3QWNA 4WORA 3TP7A 5C0XJ 5COYA 4I65A 3GTOB 5C4ZA 2BA1A 1QOHA 1DZ1A 4N9PA 5EPJA 1Y1VB 4ZRZA 4X3UA 1NSNS 1K83B 4U673 5M5YB 1KLGD 2WIIB 1XXGA 2HCIA 4IN3A 4RAUC 3IAYA 3M4OB 1STNA 1KTKA 1ESRA 1HRJA 1EIHA 4RKBA 2JE6I 4DAVA 4QCLA 4K6DA 3FDTA 5D14A 1NAPA 1QNKA 1MD2D 2B2UC 5E3FA 2D5DA 2F0IA 1PYWD 1SYFA 1KNEA 1AW7A 3S2HB 3SK6A 1PZID 3K57A 4FXKC 4A3KB 1ILPA 2E2IB 1SNDA 1Y69U 3KF8A 1TWGB 3CKIB 2HCCA 4ME5A 1ILQA 1EY5A 2QCPX 1QNUA 5IODA 4H7BA 1STBA 1HFGA 3TDQA 1EQTA 2F03A 4FO2A 2LFNA 4CJ0B 4KTAA 2K5WA 2KEDA 1SMYC 2FMMA 3PUXA 4DU9A 1EL0A 4MIUA 1V1OA 1CK1A 5DNFA 5M5XB 5K5PA 2WP8J 1EFID 2B2YC 3T13A 1RDPD 1BUVT 2B2VC 2QEJC 4NDXA 2YU9B 5CV9A 2N88A 1EU3A 2F0NA 1TY0A 2ENBA 4FYDA 4IUQA 1PRTC 4BWGB 1B9MA 4F7XA 2PZTA 2QILA 1FYCA 3TP5A 1F2YA 1BNZA 3I3CA 1JWMD 2FJ2A 3V05A 3OIPA 2F0FA 3LWEA 3BDOA 3HOWB 2XNAC 1VF5C 3A7AB 5KNCA 1TS2A 4HEDA 1GJXA 2BDNA 4H0LC 2IX3A 3K5LA 1TR5A 3EFXD 5K36G 1VDZA 2CHBD 1F2LA 1TKWB 1FNUA 1GUGA 4XQJA 1PFNA 1O7LA 1TWFB 1DD2A 5C6AA 4IFDG 1I50B 1SBBB 3ONAB 1EY6A 2DNEA 5CORA 2A6HC 3Q6SA 1UAPA 1CQVA 4HCSA 3MAQA 3VR3A 2LY7A 1HTPA 1DCZA 1PTOH 1ET6A 1R4PB 3EROA 1L0XB 3OSOA 2RA4A 1GHJA 5I2XA 4G7HC 2FFKB 3JAML 2V4DA 4ABNA 2JEAI 1D5XC 3SHLA 1TWCB 4RHRA 3K58A 4QIWB 3S2DB 1K8OA 1STYA 3FKIB 1LT4D 4DF7A 4A3DB 2Z4IA 3A55A 1ET9A 4C2MB 1IW7D 2NTTA 4X3TA 4CJ1B 2N55A 5BN5A 1O7YA 4NKLA 2NN6I 2IX1A 2F3VA 5C3XA 5JEAH 3NK9A 4OL7A 5EKIA 5JVH3 1D1KA 3DMUA 2KJXA 4IQZA 3S14B 4DAPA 3L7ZC 2O2LD 2R92B 2IWHA 1STAA 4IUPA 3WOFA 5G3LD 3TP6A 3E0JA 4BBSB 4B9XA 5JOBA 1KABA 1DOMA 1B2TA 2EYPA 5IGGA 1X32A 3MXGA 3GTGB 4EQPA 3J81E 1O80A 2Z4HA 5JVG3 1SYEA 4DXGA 3H91A 1PFBA 1X3QA 1B44D 2B2UA 1SEBD 1A2TA 5ELCA 3FVQA 3I4LA 1DXMA 2PZUA 4J1MA 2KHSA 2PW7A 2ICIA 4O42A 2NVXB 3GD7A 5I6YA 4K8JA 1PZJD 5A35A 1A2UA 5BN4A 3CQZB 5FO9B 3NE5B 3GO5A 1B1ZA 2VXWA 1BCPD 5I2YA 4I7ZC 1SE2A 1SYGA 1IKMA 3V2TA 1H9SB 2RSNA 5DEHA 2WB1B 4RCNA 2BCOA 5KNBA 2B2YA 4UAIA 2K01A 3D31A 3HOZB 3FRPB 3D4RA 2EVBA 1PRTB 1AZPA 5EPLA 1EZ6A 4V190 4IURA 3NQIA 1K8MA 1SFOB 3D3RA 4G7OC 1CA5A 2VUMB 1S5FD 1OXUA 2ICEC 4V0BA 3H0GB 3R2IA 1A3VA 2A69D 2M9VA 1YNJD 2JXMB 4RFBA 4ODGA 3I70A 3T53B 2E74C 3I4NB 1VMPA 3W3AA 2CW0C 1VF7A 2BE5D 1EIGA 2IW3A 2R93B 1XWEA 3NHHA 1Z7TA 2PQEA 2EYJA 1KLUD 2OT2A 1IYUA 3K7AB 1IHZA 5IGDA 5JPNC 1LO5D 3WDNA 4GZYC 2KEEA 4KN4C 4UDUC 1DYQA 1TU2B 3G7LA 2ZXPA 3R8BA 1S5ED 1CHQD 3GP7A 1NCVA 5CBEE 3HZXA 1SJHD 5ELBA 1PRTF 3FEWX 5ELEA 4L8JA 5CV8A 2AWNA 2PO4A 2X6LA 2HQEA 4C1NI 3QIAA 2JP1A 2IT1A 1O78A 3MXPA 3NP8A 1HFNA 3SK4A 1TY2A 2VB2X 5C4XB 1Y1WB 1S5BD 1Q1BA 3IKJA 3W2DA 3VYRA 2B8GA 1ICWA 2LS01 1QWYA 2XIWA 4OO1H 1BBXC 2B63B 3IL8A 4CKBA 1SJED 1PZKD 2H4OA 3T51B 2F4IA 1LTID 2C5CA 4FNFA 1J9OA 1SDFA 4G57A 5M3MB 1JOQA 3GTMB 3HOYB 3ITPA 3PUYA 2PCFB 1SNMA 3IFDA 1U9RA 5I9PA 3DUZA 1JWUD 3TZDA 2HDLA 4R8NA 4XDXA 3BS1A 2MUYA 3ERQA 1I4PA 4RGTA 1STGA 2BA0A 4H44C 5HGTA 3NBIA 4QUCA 4CJ2C 3BYTB 3SXHA 1E2WA 4CHTB 5KGUA 3MVVA 3J7YW 3T56B 4KY7A 2EE1A 5IGFA 2ZXOA 4ZKCB 3D6CA 1SNCA 1WTOA 1HCZA 4IUUA 2L0CA 1LLRD 5JJZA 1U4MA 4HN7A 1C48A 2G9DA 3MWYW 2O5JC 2XVSA 4Q5VA 1CHPD 4CKCA 2Z1CA 1PTOD 4TKOB 3I90A 4C3HG 3NWTA 2SEBD 2DY8A 1GXDC 4OO1I 3A8IE 2NTSA 1HQRD 3J81L 2NVQB 2MJ8A 3N52A 1J8IA 3Q22A 2F1MA 2R6GA 3IFTA 3OPOA 3K0YA 4NW2A 1AEXA 5E1FA 1WCMB 3H94A 1CTMA 1QE6A 5TSSA 2EOTA 3RLFA 5D65A 1FNWA 3Q24A 2ZT9C 5CV5A 2QKIC 4IFDH 3MTSA 2K33A 4J6HA 2EJMA 1ZYRD 1DJRD 1HUNA 1D2BA 1SAPA 2IX0A 4A93B 2F0GA 1LABA 4ID6A 5IGBA 1QJOA 2WKCA 4PV1C 3SE0A 5C0XH 1SYBA 3P75A 2PZWA 3EQLC 2WINB 1G291 1PMRA 5C44B 2IPKD 3MXNA 1XX8A 1TIID 2PYKA 3OW7A 2XRQD 2PPBC 1JCKB 1MSHA 1G2TA 5IT9E 4P2CB 1JOOA 3MA2B 1X3PA 2BDOA 1IL8A 4OGQC 4DA2A 1B3AA 2K05A 4KI0A 4R8IA 1U4LA 2A74C 4KHVA 5FOBB 1LV9A 2F0EA 1TS3A 3L9AX 4F88A 4ZUIA 5I4DA 1DOLA 3SVMA 1I4GA 4RH6A 1JQYD 1JC7A 4WFN3 4X3SA 3TN2A 3QB3A 1A15A 5DM73 4EGVA 2QF7A 1BF4A 3Q23A 3BVZA 1H9KA 3K5NA 2XWBB 2NZ1D 4DAYA 5EBCA 2K1BA 3S1MB 3GV3A 5J1ZA 5DAUA 3KLRA 4G7ZC 3M3YB 4DN4M 3J80E 2B2WC 1GOZA 2NVYB 4HR7B 5CV7A 4EQOA 1SMYD 3DXJC 3I73A 2E75C 3A7LA 4ZAIA 2L9HA 2XRSD 3BVGA 2NVTB 1IW7C 4KN7C 1EQVA 1AZQA 1PDQA 4K14A 1CZGA 1D6EC 2DN8A 4DK0A 1F9PA 2TSSA 4NP5A 3CU7A 3MFYA 1XYIA 4A3IB 2WV6D 3NWSA 1ML0D 3NSWA 1SYCA 4Z9CB 2O5IC 4A3JB 4K6LA 2SNSA 3DEPA 3VR2A 3RZDB 1JE4A 4TSSA 2F0OA 4RHSA 3TZUA 5ISRA 2C9OA 2RSOA 4IUTA 1B9NA 3R3OA 3S9WA 2EYOA 5FKAC 1STHA 1EY7A 2RBMA 3EA6A 4X3KA 1STEA 3TMEA 2GA4B 1H9RA 5IOCA 3D6WA 5FLXE 5FO7B 4RKLA 2HDMA 4QB4A 5JAVA 3CHBD 2VB3X 1EY9A 3QG1A 2E2DC 5M9OA 2PNRC 1R4QB 3S15B 3S1NB 3DEOA 2MPMA 1EOTA 1LT3D 2WKDA 1I4QA 3D4DA 3VR4A 2EJGC 4ZQ3A 3A8JE 5C5LA 4G4KA 4PNYA 2EZVA 1QG7A 1SSOA 1QB5D 3S16B 2A68D 2D9UA 2CVRA 3HOXB 1A3TA 3U9SA 3D8GA 3KBGA 1BCPC 1BXTA 2MHVA 3M4YA 2I07B 1SE3A 3KUPA 4HSPA 4WRDA 3HOVB 3HRZC 4TQUS 1BDOA 3BDLA 4LAAA 1OO9B 3HG9A 5CC4A 3EVQA 4DFAA 4K2KA 2I46A 2L1BA 1YNND 3BZDB 4BY1B 4XXEA 1ZXTA 4AYBB 1FNVA 1I3QB 1HUMA 4JK1C 2NN6G 4H13C 3BVMA 3OWFA 2F0QA 1LTTD 1DOKA 4FF4A 2EY1A 1TVXA 2R61A 3SEBA 4OIKA 1IKLA 1BO0A 2WACA 1BR9A 3DWQA 1JR0D 1I4XA 2F0PA 1RKNA 4QMGA 1S5DD 3BYYB 4KV6A 3H09A 5BN3A 2A69C 4F87A 1YNJC 3OWEB 5D3DA 1JWSD 3LWUA 4ZK9B 1Q1EA 3VA7A 4S3SA 1MBYA 2QDBA 3DM1A 3E5SA 4XT1B 3HKZB 1KDBA 2EJFC 5KYLA 5KNDA 1JOKA 2JYOA 2OXPA 2F3WA 3VYSA 1NR2A 5IT9L 5KEEA 2B2WA 5C3EB 2AQ2B 3I91A 3MXUA 1HXYD 3GV6A 1NR4A 3P7JA 2D62A 2VNUD 1II3A 1OXXK 3VYTA 3MFGA 3SR1A 3C1FA 1RTOA 4C3HB 2KUMA 1HA5A 3ND8A 1G6ZA 3OMGA 4K8IA 2E2JB 1OXSC 3TSSA 1LT5D 2OEOA 2E2HB 1V8QA 1A6XA 3QJYA 5CMDA 1WD1A 1EU4A 4WJWA 3N6RA 4HMJA 2F0SA 3NTHA 4Q0FA 3PIP3 2NYZD 1EY0A 1G8ZD 2JA8B 3HP3A 2F0JA 4HTHA 3URYA 4K5WA 3J80L 3M7GA 1Q8IA 2A6ED 1TT2A 5M5WB 1EEID 3D4WA 1OXTA 1PLFA 3AU7A 4F8MA 4KJOA 1HPCA 2EY5A 3I4MB 1KNAA 1SE4A 4ILWA 4E6IA 1I4HA 1WVLA 1Y8OB 5E4XA 5EBDA 1D5MC 3SK5A 2X69A 2KVMA 4FF2A 3VR5A 2SNMA 5AFWA 4OIJA 4BA2I 3OOCA 1GUSA 2F0VA 5T1GA 2K04A 3KBXA 2EYMA 2M00A 2KCCA 1WD0A 4KHZA 2EY2A 3MEHA 2NB0A 4ZYSA 4KKSA 5ELDA 4PQXA 1CA6A 2EYLA 3S1RB 1T5EA 1FR3A 1LTGD 4CGYB 1L0YB 1PTOC 5LHY1 1I4RA 3DHQA 4FF3A 2AQ3B 4J8QA 4FVMA 4KY6A 4KJNA 3AB9A 1WTWA 3GTKB 2ZXRA 1PFMA 5G3LF 2NUCA 2DY7A 2JA7B 2NWGA 5CV4A 1H9JA 1RTNA 1QILA 2F0DA 1LACA 4BS9A 3CRKC 3NBHA 4C3JG 1V1PA 1WTQA 1HHVA 1AFPA 3RUZA 1C4QA 4C3IG 3HEJA 5FO8B 2EYHA 1ZYRC 1MI2A 4KK7A 2FINB 2RKSA 1V43A 4IZ8A 1LTRD 1F2ZA 2FMCA 4PMBA 1E2ZA 3J7AF 4ZLTF 5K36H 3I72A 1WTPA 1LTBD 2O4XA 2KCNA 1F2MA 3A54A 1BCPF 1RODA 5F2DA 4RA8A 3KLSX 5E4WC 3A56A 1ENAA 1LTAD 1Y8NB 2XSCA 2LKVA 1KAAA 1PXUA 1VCIA 5C4HA 2F0TA 4PMCA 1ENCA 2PW5A 2LMCB 3T4AC 3VYUA 5DM63 3TBIB 3WOEA 4RGOS 4OO1G 5HURA 4LMQD 2K6AA 3K6OA 4C56C 1D1IA 2B2TA 3FMCA 3KK7A 1DM0B 4ULLA 1B50A 1QCBD 3K5MA 4LJZC 2RVLA 4LK1C 2OF1A 2EYFA 2RDGA 4HCEA 1KDAA 4IFDI 1F9SA 5CV6A 3PV0A 2F0HA 4QF4A 5I6WA 1BOSA 2JSOA 1WTRA 3VR6A 2Y0SB 5CYUA 1G91A 4HAEA 3OIQA 4RCOA 3M85A 2RDFA 1R9TB 1Z6HA 5C0XI 2JA5B 4R9WA 1TS5A 3P1HA 1B4OA 1B53A 5IGCA 5J39A 1DONA 2AUJD 1EYAA 3NTKA 4N9TA 3G6JB 2F0WA 1EYCA 2IJ0A 4A3GB 1Z47A 5A2QE 3EJIA 4KMUC 4DK1A 5C0XG 2L55A 1GUWA 2F0UA 4C1NK 1UEAB 3SDZA 2DNCA 1SYDA 3PUVA 2NN6H 4XIGS 4DNRB 3H6MA 3R93A 2EPBA 4B08A 4K2LA 1ZKOA 1PTOB 2D2CC 3KLSA 1Y8PB 1CZWA 2PMZB 1PRTD 5ELFA 1Q90A 3GTJB 3GTPB 4K5VA 5JEAJ 1JORA 1A3UA 3Q0AA 2KOLA 1GUNA 4RGNA 2AUKA 5LL6X 5EGTA 1S5CD 1EEFD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XQJ A;  4XQN A;  3BS1 A;  4XXE A;  4XQQ A;  4XYQ A;  4XYO A;  4CBV A;  4G4K A; 
#chains in the Genus database with same CATH topology
 4DUY Q;  1HZ9 A;  3GTJ H;  1RIP A;  2A68 C;  4RWS C;  4A3J H;  5EKK A;  1B7Y B;  1S72 A;  3M9B A;  1MIU A;  3NXW A;  3QR8 A;  3RZD H;  3P20 A;  1UUP A;  2J7Z A;  2KEC A;  4NXN L;  4FP5 D;  4DR6 Q;  4LFA L;  3GTL B;  3RZO B;  1RHP A;  3LNN A;  4DV3 L;  2F0M A;  5C5M A;  1YJN A;  3CCE A;  1M8A A;  2L11 A;  5GAE C;  2K5D A;  1C7Y A;  1NUC A;  4DPG A;  4A3K G;  4X65 L;  1VMC A;  2Q8R E;  2MFI A;  2A6H D;  2UXD Q;  3O13 A;  4JBK A;  1JIC A;  4MHE A;  1TS4 A;  2J0T D;  2CQA A;  2A73 B;  2TMP A;  3M7N A;  2AWO A;  4JC0 A;  1I6V C;  3OW2 A;  3CXC A;  3J80 i;  1YNN C;  2UUB Q;  1WI5 A;  1OXV A;  3RZO H;  3FPP A;  4EVO A;  2RDH A;  4DXF A;  1PH6 A;  1EWC A;  3E6Z X;  3C1E A;  3I8Z A;  1SNO A;  1FGB D;  1MGS A;  1SNQ A;  4OHJ A;  3S15 H;  1PTO F;  3S1N H;  1EYD A;  4YCW A;  1LTS D;  4A3B B;  3ZYY X;  1U4R A;  3OHX C;  4KD3 A;  1UE6 A;  2UUA L;  4P72 A;  1EY8 A;  2I0Q A;  4XT3 B;  3NPP A;  2K5Q A;  4IUV A;  2NBF A;  4ZUJ A;  1F9R A;  3V96 A;  1D5Z C;  4CKE A;  2UXB L;  3S16 H;  3U9O A;  2Q8I B;  2I5M X;  4B9W A;  4GKK Q;  5IIF A;  4A3B H;  1K0S A;  1U0L A;  2WAQ B;  2YV5 A;  5M3F B;  1MJE A;  1MHW C;  4QUF A;  4AH6 A;  2H1E A;  1PVO A;  3LX0 A;  3L3O C;  4M8A A;  5D3I B;  3AYH B;  3RD4 A;  4KKU A;  4DR7 Q;  2R7Z B;  1EWI A;  1WTV A;  5I9O A;  2QDL A;  2MP1 A;  1NJI C;  5C3W A;  2SOB A;  3R2T A;  4NMZ A;  3HS0 C;  3OMC A;  5LMN Q;  4TRD A;  2DUD A;  2K32 A;  4GOP C;  4B3T L;  2KA7 A;  3U50 C;  4DNT B;  4BY1 H;  1EWH A;  5EPK A;  1UNS A;  1I3Q H;  3HOW G;  2L5T A;  4XQQ A;  1H95 A;  2RQX A;  4IAL A;  1S4Z A;  3PUW A;  1L0W A;  4DR4 L;  1SNP A;  4XYO A;  4LF6 L;  1ESF A;  3T16 A;  1W6K A;  2H5X A;  2HIV A;  5H1S E;  2Z6K A;  4CBV A;  5KIX A;  4XTC S;  4JBM A;  2VL6 A;  1ZEQ X;  3MZ5 A;  3PMF A;  2B8F A;  3RMH A;  1E22 A;  5HGQ A;  2IL8 A;  1CFM A;  2BE5 C;  4JBW A;  1BQQ T;  2E76 C;  3NQT A;  1H9S A;  1I94 L;  3U4Z A;  4KKT A;  2K5N A;  3KJO A;  1GUO A;  2XN9 C;  3C2P A;  1KDC A;  1EY4 A;  4NXM L;  1MSG A;  4Y7N B;  3DWP A;  3J7A V;  1UE1 A;  5IYC H;  4DV4 L;  5JJI A;  2JA6 B;  5CGK A;  4MN3 A;  2GVB A;  4LF8 Q;  5CR3 A;  1WTH A;  4FF1 A;  4IUN A;  5LMU L;  3K5O A;  4L63 B;  4X66 Q;  1ONL A;  4C3J B;  5T1I A;  2B2V A;  3PO3 B;  2Z0S A;  4KD4 A;  1RJT A;  4U68 A;  5KYI A;  4C3I B;  1Q12 A;  3PO2 B;  3HOU B;  1L1O A;  1EZ8 A;  4Y7N H;  5JPM C;  3S17 B;  4B3R Q;  1IYV A;  1K3R A;  3ND9 A;  3FKI G;  2JA6 H;  3UI2 A;  1WTX A;  5JEA G;  3C3L A;  2JEB I;  4A3D G;  2A6E C;  1JB3 A;  2D0O A;  4AQY L;  5EKL A;  4M1U B;  4JI5 L;  2Q2T A;  2MGS A;  2Z8L A;  4A3F B;  5LL6 S;  1BKB A;  2F0L A;  3TP8 A;  2K28 A;  1T5X D;  2F0K A;  1CQF A;  1ENF A;  2K03 A;  2B2T C;  4YY3 L;  3HOU H;  5FK9 C;  2JJQ A;  2G9H D;  5ELO A;  3CRL C;  3NTI A;  1CM9 A;  4A3C H;  4YIJ A;  4R4O A;  1HQM C;  2Q8T A;  1VQE A;  4C3H H;  1HH2 P;  1SXT A;  4WJ4 A;  4A3F H;  4A3L H;  2BOS A;  1Q3L A;  2BH8 A;  5DLQ E;  4GNX A;  2R92 G;  3T1Y L;  2E2J H;  1XMQ L;  2J4X A;  2X6G A;  4JV5 L;  5FJ8 H;  2VQE L;  4RGM A;  2E2H H;  2R3Z A;  4L6T B;  4BBS G;  2EDG A;  4JI3 L;  1LT6 D;  3GTQ B;  2AQ1 B;  3FPU B;  2A5H A;  4O1N A;  2UUC Q;  4DGZ A;  5A2Q L;  1F9Q A;  2EXD A;  2JA8 H;  4JI6 L;  5IP9 H;  3AMU A;  5GQO A;  4DV1 Q;  3AFP A;  1TWH B;  5IGE A;  4JI2 L;  3D0F A;  1PFS A;  3PUZ A;  5M5W H;  3GTQ H;  1GHK A;  3QOJ A;  1TQO A;  1W6J A;  1IBM Q;  1YI2 A;  1HNW Q;  1O7Z A;  2EXZ A;  2FXQ A;  4DR1 Q;  1U4P A;  1M4V A;  2CW0 D;  1RF2 D;  1GUT A;  4FXG C;  4ZCK A;  5EQ0 A;  5KRU A;  3EIV A;  3X3N A;  4K5X A;  4DR5 Q;  4A3E B;  1ASZ A;  4JOI A;  1FD7 D;  1AP0 A;  3BJU A;  3JAM E;  4XQN A;  2VW9 A;  2P5Z X;  4A3M B;  3I4M H;  2K7V A;  1HR0 Q;  4OX9 L;  4BY7 B;  3VA5 A;  2QW7 A;  2SDF A;  4LF9 Q;  2B39 A;  1CT1 D;  3F2U A;  4YWM A;  2L4N A;  1I6H B;  2HUG A;  4HSV A;  4A3E H;  1BBW A;  3H3V C;  2HT1 A;  3UE0 A;  1HNZ L;  4A4I A;  4DR3 L;  1TWA B;  5CBA E;  5NUC A;  1X9N A;  5J22 A;  4A3M H;  1E0B A;  1IZ6 A;  2ES2 A;  5C4J B;  3PIO 3;  4EQN A;  4DV0 L;  4OON A;  2Z6B A;  3DWA A;  3SK8 A;  3MHB A;  1BCP B;  1EIF A;  1N32 Q;  3TEH B;  3A8K E;  4BBR B;  4DUY L;  3GQB A;  3C46 A;  3K59 A;  2A8V A;  1TWA H;  3HKS A;  1IBL Q;  2EY6 A;  3HGB A;  3NUC A;  2XWJ B;  2WB1 G;  5FLX L;  1AN8 A;  1UE7 A;  2YYZ A;  4FXD A;  5C4J H;  1PH5 A;  1HJP A;  3RR5 A;  4DR6 L;  1XTC D;  3BDC A;  3E9H A;  3A5Z B;  3NBH B;  4KY5 A;  1XNR Q;  5L37 A;  3OTO Q;  1GO3 E;  1V1P B;  1C8C A;  4QY7 A;  2CCZ A;  2M2L A;  4GS3 A;  3GTK H;  3I55 A;  2UXC L;  2L12 A;  1RD9 D;  1SN8 A;  1EOV A;  3F8T A;  3HOZ G;  1H9M A;  2ID0 A;  4QIW E;  3E3X A;  3W5O A;  1B70 B;  3BG3 A;  1CI3 M;  2N3S A;  3S1Q B;  2MO1 A;  1RCV D;  4HMI A;  1HA6 A;  2UUB L;  2FHT A;  3PSI A;  4IFD J;  2KQ3 A;  4GOP A;  2VUM G;  3MC0 B;  4QL5 A;  3QOL A;  4XYQ A;  1E2V A;  5EJW A;  3H0G G;  5IT9 c;  4N8F A;  4PMW A;  4L5S A;  2QA4 A;  4ZKB B;  3QO2 A;  3X3M A;  1F77 A;  1G2S A;  1X3G A;  4BA1 I;  1HTL D;  3QWN A;  3S1Q H;  4WOR A;  3I4N G;  1A63 A;  1SRU A;  1VS0 A;  2YTY A;  3TP7 A;  5C0X J;  5COY A;  4I65 A;  3GTO B;  5C4Z A;  1X56 A;  2BA1 A;  1QOH A;  1DZ1 A;  4N9P A;  5EPJ A;  1Y1V B;  4GKK L;  2R93 G;  2KBN A;  4ZRZ A;  4X3U A;  1NSN S;  1K83 B;  4U67 3;  5M5Y B;  1KLG D;  2WII B;  1XXG A;  2HCI A;  4IN3 A;  4RAU C;  3NEN A;  3IAY A;  3M4O B;  1IYJ B;  1STN A;  1KTK A;  4DR7 L;  1VQI A;  1ESR A;  1HRJ A;  1EIH A;  2N8N A;  4RKB A;  2JE6 I;  4DAV A;  4QCL A;  4K6D A;  1WYD A;  5M5Y H;  3FDT A;  5D14 A;  3PF4 A;  2LXK A;  1Q86 C;  1NAP A;  1O7I A;  1QNK A;  3J80 c;  4NXM Q;  1MD2 D;  2B2U C;  5E3F A;  2D5D A;  2F0I A;  4A75 A;  1PYW D;  3FHW A;  1M1K C;  1SYF A;  1KNE A;  1AW7 A;  3S2H B;  3SK6 A;  1PZI D;  3K57 A;  1ASY A;  4FXK C;  1LUZ A;  1VQG A;  4A3K B;  1ILP A;  2E2I B;  1HZA A;  1SND A;  1EQR A;  1Y69 U;  3KF8 A;  5IP7 G;  2F52 A;  1SRO A;  1VQJ A;  3K0X A;  1TWG B;  3CKI B;  5C4X G;  1Y1W G;  2HCC A;  4ME5 A;  1ILQ A;  5ELN A;  1EY5 A;  4UP9 A;  2QCP X;  1QNU A;  5IOD A;  4H7B A;  2QEX A;  2Z6K C;  1STB A;  1HFG A;  3TDQ A;  1EQT A;  2F03 A;  1CSQ A;  4FO2 A;  3CCV A;  2N49 A;  2B63 G;  2LFN A;  4DR2 L;  4KTA A;  4CJ0 B;  2K5W A;  2D0P A;  2KED A;  2E5L L;  1SMY C;  2FMM A;  3PUX A;  4DU9 A;  4OWX B;  1EL0 A;  4MIU A;  4X66 L;  5M3M G;  1V1O A;  2WB1 E;  4L5T A;  3T1Y Q;  1I5F A;  3KF6 A;  3HOY G;  4X62 Q;  1CK1 A;  5DNF A;  1JMC A;  5M5X B;  5K5P A;  2WP8 J;  1QZG A;  1EFI D;  2B2Y C;  3T13 A;  2CWP A;  1RDP D;  1BUV T;  3J7A 5;  4QGU A;  2B2V C;  1Q82 C;  4JI3 Q;  2QEJ C;  2V1C C;  5IYD H;  4NDX A;  2YU9 B;  5CV9 A;  2N88 A;  1EU3 A;  2F0N A;  1TY0 A;  1L1O C;  2ENB A;  4FYD A;  4IUQ A;  1PRT C;  4BWG B;  1B9M A;  4MZ9 A;  4MNO A;  4F7X A;  4JI6 Q;  5FLX c;  2PZT A;  2QIL A;  1YVC A;  1FYC A;  2JA5 H;  3TP5 A;  1F2Y A;  1BNZ A;  3I3C A;  1CSP A;  2Q2I A;  1JWM D;  2FJ2 A;  3V05 A;  3OIP A;  2F0F A;  3LWE A;  3BDO A;  3HOW B;  1X3E A;  2XNA C;  1VF5 C;  3A7A B;  5KNC A;  1VQ9 A;  1TS2 A;  4HED A;  1GJX A;  2BDN A;  4H0L C;  2IX3 A;  1PH3 A;  3K5L A;  1TR5 A;  3EFX D;  5K36 G;  1VDZ A;  4GNX C;  2CHB D;  1KC8 C;  1F2L A;  1TKW B;  1FNU A;  1GUG A;  4XQJ A;  1PFN A;  1O7L A;  2ZJQ A;  2UUC L;  1TWF B;  1DD2 A;  5C6A A;  4IFD G;  1I50 B;  4JCV E;  1SBB B;  3ONA B;  1EY6 A;  2ATW A;  3CD6 A;  2DNE A;  1WCM G;  1FJG Q;  5COR A;  4DV1 L;  2A6H C;  3KYH C;  3Q6S A;  3ZJY C;  3H3V H;  1UAP A;  1CQV A;  4HCS A;  3J7Z C;  3MAQ A;  3PQI A;  3VR3 A;  1NMF A;  1IBM L;  2LY7 A;  1HTP A;  1DCZ A;  1PTO H;  3K80 C;  1HNW L;  1ET6 A;  1R4P B;  4DR1 L;  3ERO A;  1CKN B;  1L0X B;  1NY4 A;  3OSO A;  2RA4 A;  1GHJ A;  5I2X A;  4G7H C;  2FFK B;  2K75 A;  1GD7 A;  4DR5 L;  3JAM L;  2V4D A;  5GAD C;  4ABN A;  2JEA I;  3GTP H;  4PZ8 A;  2JQO A;  1D5X C;  3SHL A;  1HR0 L;  1TWC B;  4RHR A;  4HIO A;  4R4T A;  2LSS A;  3K58 A;  1A62 A;  4A93 G;  4LF9 L;  4QIW B;  3S2D B;  1K8O A;  1STY A;  3FKI B;  4DNI A;  1LT4 D;  3WWV A;  4DF7 A;  2Z4I A;  2EQS A;  3A55 A;  1ET9 A;  3I2Z A;  4C2M B;  4A3D B;  4JOI C;  1G51 A;  3DLL A;  4MTN A;  3AFQ A;  1DGS A;  4GN3 B;  2UXC Q;  1IW7 D;  2NTT A;  4X3T A;  1JB7 A;  4CJ1 B;  2N55 A;  5C44 G;  3CCJ A;  2OCE A;  1YHA A;  5BN5 A;  4LFB L;  1O7Y A;  3GDE A;  4NKL A;  2NN6 I;  2IX1 A;  2F3V A;  3T1H Q;  5C3X A;  3S2D H;  3FKI H;  3GTL H;  5JEA H;  3NK9 A;  4OL7 A;  5EKI A;  5JVH 3;  1D1K A;  3DMU A;  1N32 L;  2KJX A;  4IQZ A;  3CPF A;  3RNU A;  3S14 B;  4DAP A;  5LMN W;  1N9W A;  3L7Z C;  1VQB A;  2O2L D;  2R92 B;  1IBL L;  2IWH A;  1KRS A;  1STA A;  4IUP A;  3TS0 A;  1KRT A;  3WOF A;  5G3L D;  3TP6 A;  2ZTE A;  4GLA C;  4P73 A;  2IHE A;  3PIO A;  3ER0 A;  3E0J A;  3CME A;  4BBS B;  2KEN A;  4B9X A;  5JOB A;  1KAB A;  1XNR L;  2I5H A;  3OTO L;  1DOM A;  3OYY A;  3S14 H;  1LTL A;  2NZO A;  1B2T A;  2EYP A;  5IGG A;  2R92 H;  1X32 A;  3PCO B;  1YZ6 A;  3MXG A;  3GTG B;  4EQP A;  3J81 E;  1O80 A;  2Z4H A;  5JVG 3;  3E9I A;  3ULP A;  1SYE A;  4DXG A;  3H91 A;  1EUJ A;  1PFB A;  1E1T A;  1X3Q A;  1B44 D;  1VQA A;  1C9O A;  3CP0 A;  2B2U A;  1SEB D;  1A2T A;  5ELC A;  3FVQ A;  3I4L A;  3CCU A;  3GTG H;  1DXM A;  4OEL B;  1EIY B;  2PZU A;  4J1M A;  4NB3 A;  5M3F H;  2KHS A;  4GN4 B;  2PW7 A;  2ICI A;  1GVP A;  1N36 Q;  4O42 A;  1VQO A;  2NVX B;  4CDF C;  3GD7 A;  2OWO A;  1PH9 A;  5I6Y A;  4K8J A;  1PZJ D;  5A35 A;  1A2U A;  1G6P A;  2R7Z H;  5BN4 A;  3CQZ B;  5FO9 B;  3NE5 B;  2CQO A;  3GO5 A;  1B1Z A;  2VXW A;  2NVX H;  1BCP D;  5I2Y A;  4I7Z C;  4IJL A;  1SE2 A;  3CC2 A;  3B6Y A;  4DK3 C;  1FGU A;  2CH4 W;  1SYG A;  2GN5 A;  4LUZ A;  3CQZ H;  4UPA A;  4IPG A;  1IKM A;  3V2T A;  1H9S B;  2RSN A;  4WJ3 M;  2F4V Q;  1K3B C;  4JVZ A;  5DEH A;  4L5R C;  2WB1 B;  2Q2U A;  4DR2 Q;  4RCN A;  2E5L Q;  1KXL A;  4A3I G;  4B3S L;  2BCO A;  5KNB A;  2B2Y A;  4PZ6 A;  4GLV B;  2LXJ A;  4UAI A;  4UY8 C;  4A3J G;  2K01 A;  3D31 A;  3CCS A;  1RL2 A;  1L1O B;  3STB D;  3HOZ B;  3FRP B;  4POF A;  1T9H A;  2OQ0 A;  3D4R A;  2EVB A;  1PRT B;  1AZP A;  5EPL A;  1EZ6 A;  4V19 0;  4IUR A;  1PV4 A;  2AKW B;  3NQI A;  1K8M A;  1SFO B;  3D3R A;  2HD3 A;  4G7O C;  1CA5 A;  4C3J H;  2VUM B;  1S5F D;  4B3M Q;  1OXU A;  1K28 A;  2ICE C;  3PO3 H;  4V0B A;  3H0G B;  4X64 L;  3R2I A;  4C3I H;  1A3V A;  3I56 A;  3PO2 H;  1NMG A;  2XGT A;  2A69 D;  3S17 H;  2M9V A;  1GKH A;  1YNJ D;  2JXM B;  3NEM A;  4ODG A;  4RFB A;  3I70 A;  3T53 B;  2E74 C;  3I4N B;  2OQK A;  1M90 C;  1VMP A;  3M4Q A;  1HZB A;  2VUM H;  2HIX A;  3W3A A;  2CW0 C;  1VF7 A;  4GNX B;  2BE5 D;  1EIG A;  2IW3 A;  4GKJ Q;  4X62 L;  2ZJR A;  2PQA A;  2R93 B;  1XWE A;  3NHH A;  1Z7T A;  2PQE A;  4OWW B;  2EYJ A;  1KLU D;  3G71 A;  2OT2 A;  1IYU A;  3K7A B;  1IHZ A;  5IGD A;  2PI2 A;  5JPN C;  1LO5 D;  3WDN A;  1K8A C;  1IBK Q;  4GZY C;  2KEE A;  4KN4 C;  3HOX G;  4UDU C;  1NE3 A;  1JT8 A;  1DYQ A;  3JC6 6;  4X6A H;  1TU2 B;  3G7L A;  2ZXP A;  1WJJ A;  4LF4 L;  4JI0 L;  1J5E Q;  4QQB X;  3CCR A;  1XPR A;  3R8B A;  1S5E D;  1VQ8 A;  1CHQ D;  3GP7 A;  3HOV G;  1NCV A;  5CBE E;  4OWT B;  3HZX A;  1SJH D;  3F1Z A;  5ELB A;  1PRT F;  3FEW X;  4FDB A;  5ELE A;  4L8J A;  5CV8 A;  2AWN A;  2PO4 A;  2X6L A;  2HQE A;  4C1N I;  3H15 A;  3QIA A;  1Y14 B;  1TWH H;  1PYB A;  4GLX A;  5FLM H;  1QVF A;  2JP1 A;  2IT1 A;  1O78 A;  1FL0 A;  1XJV A;  4BY1 G;  3MXP A;  3NP8 A;  4AYB G;  1VQ4 A;  1HFN A;  3SK4 A;  1TY2 A;  1S40 A;  3CCM A;  4OXP A;  2VB2 X;  5C4X B;  3U58 A;  1Y1W B;  1S5B D;  1Q1B A;  3ICE A;  1QVC A;  3E0E A;  3IKJ A;  1VQK A;  2MO0 A;  3W2D A;  3VYR A;  2B8G A;  1FJG L;  4DK6 C;  1ICW A;  2LS0 1;  3BZC A;  1QWY A;  2XIW A;  4OO1 H;  1X65 A;  1KAW A;  4BY7 H;  2ZTC A;  4LFB Q;  1BBX C;  5IWA Q;  2B63 B;  3IL8 A;  4PZ7 A;  4CKB A;  3RN2 A;  1I6H H;  1SJE D;  1PZK D;  2H4O A;  5C4X H;  3T51 B;  2F4I A;  1C0A A;  1LTI D;  2C5C A;  4FNF A;  2JA9 A;  1J9O A;  1SDF A;  2EIF A;  4G57 A;  1MJC A;  5M3M B;  3KDF A;  4HIK A;  1JOQ A;  3GTM B;  2HHH Q;  3HOY B;  3ITP A;  3PUY A;  2PCF B;  1SNM A;  4IOC A;  2B63 H;  2CKZ B;  3IFD A;  1U9R A;  5I9P A;  3DUZ A;  1JWU D;  3TZD A;  2K52 A;  2HDL A;  4DV7 Q;  4R8N A;  4XDX A;  5BR8 L;  4BBR H;  3BS1 A;  5M3M H;  2KHJ A;  2MUY A;  3ERQ A;  1I4P A;  4RGT A;  1STG A;  2BA0 A;  4H44 C;  4YCV A;  5HGT A;  3NBI A;  3HKZ G;  4QUC A;  4CJ2 C;  3GTM H;  3BYT B;  3SXH A;  2JN4 A;  1E2W A;  4CHT B;  1SLJ A;  4YCU A;  3MVV A;  5KGU A;  3T1H L;  3J7Y W;  2KHI A;  3T56 B;  4KY7 A;  1YIJ A;  1BBU A;  2EE1 A;  5IGF A;  4GOP B;  2ZXO A;  4ZKC B;  3D6C A;  3EBE A;  1SNC A;  1WTO A;  3BZK A;  1HCZ A;  4IUU A;  2L0C A;  1LLR D;  5JJZ A;  1U4M A;  4HN7 A;  1C48 A;  1JJG A;  2G9D A;  1UE5 A;  1W3S A;  5C3E G;  2RCF A;  3MWY W;  2O5J C;  2XVS A;  4Q5V A;  1KHI A;  1CHP D;  4CKC A;  2Z1C A;  1PTO D;  4IOA A;  4TKO B;  1JE5 A;  3I90 A;  4C3H G;  3F2B A;  3NWT A;  2SEB D;  2DY8 A;  1GXD C;  4A3L G;  4OO1 I;  3A8I E;  2NTS A;  1HQR D;  3J81 L;  2NVQ B;  2MJ8 A;  3N52 A;  1J8I A;  3Q22 A;  2F1M A;  2R6G A;  2VZA A;  3FP9 A;  3JAM i;  3IFT A;  3OPO A;  3K0Y A;  5FJ8 G;  4NW2 A;  1AEX A;  5E1F A;  1WCM B;  1VQC A;  2AHO B;  3I7F A;  3Q8D A;  3L0O A;  3H94 A;  4POG A;  1CTM A;  1QE6 A;  5TSS A;  3GTO H;  2EOT A;  1AE2 A;  3RLF A;  5D65 A;  1FNW A;  1Q81 C;  2NVQ H;  5AJ3 Q;  3Q24 A;  1VQ5 A;  2ZT9 C;  4YHH Q;  2A19 A;  4HJ9 A;  1Y1V H;  2QKI C;  5CV5 A;  4IFD H;  2JA8 G;  3MTS A;  2K33 A;  5GAH C;  1VQM A;  1K83 H;  4J6H A;  1X55 A;  2EJM A;  2UU9 L;  1ZYR D;  1N36 L;  2B29 A;  1DJR D;  2CWA A;  1HUN A;  1D2B A;  1SAP A;  2IX0 A;  3M4O H;  4BXX H;  4A93 B;  1QUQ A;  2F0G A;  1LAB A;  1XMO Q;  4B3S Q;  4JW0 A;  4ID6 A;  1QJO A;  5IGB A;  2WKC A;  4PV1 C;  3SE0 A;  5C0X H;  1SYB A;  4TVA B;  3P75 A;  5IYB G;  4P71 A;  2PZW A;  3EQL C;  1XNQ Q;  2WIN B;  1G29 1;  1YJ9 A;  1E24 A;  3KF8 B;  1PMR A;  4AYB E;  5C44 B;  3I4M G;  2YTV A;  2IPK D;  3MXN A;  1K8G A;  3F2D A;  1YNX A;  1XX8 A;  1HZC A;  1TII D;  4L5Q A;  2PYK A;  2K14 A;  3OW7 A;  2XRQ D;  3G6E A;  3S2H H;  2PPB C;  2KCM A;  2F4V L;  4A3K H;  4J15 A;  4CDD C;  1JCK B;  4X64 Q;  1MSH A;  2E2I H;  1G2T A;  5C44 H;  3I4O A;  5IT9 E;  4P2C B;  1JOO A;  3MA2 B;  1X3P A;  2BDO A;  1IL8 A;  4OGQ C;  4DA2 A;  1TWG H;  1B3A A;  2K05 A;  4KI0 A;  4R8I A;  1U4L A;  2A74 C;  3SGI A;  4KHV A;  3TS2 A;  2CH4 A;  5FOB B;  1LV9 A;  3CCQ A;  4DV5 Q;  1WFQ A;  2F0E A;  1TS3 A;  3L9A X;  4F88 A;  4ZUI A;  1YIT A;  4I7A A;  1MKH A;  3TQY A;  3KF6 B;  5I4D A;  1DOL A;  3SVM A;  1I4G A;  4RH6 A;  2ALY B;  1JQY D;  1JC7 A;  3KLW A;  4WFN 3;  1YJW A;  2WFW A;  4X3S A;  3TN2 A;  2IY5 B;  3CMA A;  3QB3 A;  1A15 A;  5DM7 3;  4EGV A;  5JJL A;  3CPW A;  2QF7 A;  4B3M L;  2K4K A;  1BF4 A;  3HKZ E;  3Q23 A;  3BVZ A;  1H9K A;  2HQL A;  3K5N A;  4ALP A;  2XWB B;  2NZ1 D;  4DAY A;  5EBC A;  2JA7 G;  2K1B A;  5M5X H;  3S1M B;  1Q7Y C;  4LF4 Q;  1VQF A;  3GV3 A;  2MNA A;  5J1Z A;  4JI0 Q;  5DAU A;  3KLR A;  1N34 Q;  4G7Z C;  1PH2 A;  3M3Y B;  4DN4 M;  2PNH A;  1PH8 A;  2YU9 H;  3J80 E;  2B2W C;  4GKJ L;  1GOZ A;  1YBY A;  2NVY B;  3AQQ A;  4HR7 B;  3S1M H;  1P8L A;  5CV7 A;  1YHQ A;  2GVA A;  4EQO A;  2L15 A;  1SMY D;  4R1J A;  3DXJ C;  4DV2 L;  1WOC A;  3I73 A;  1OTC A;  2E75 C;  3A7L A;  3HOW H;  1IBK L;  4ZAI A;  2L9H A;  2NVY H;  2XRS D;  3BVG A;  2NVT B;  1CKM A;  1IW7 C;  4KN7 C;  3RLO A;  1EQV A;  1AZQ A;  1E3P A;  2NZH A;  2K50 A;  2PI2 E;  1J5E L;  1PDQ A;  4K14 A;  2JK8 A;  1CZG A;  1D6E C;  2DN8 A;  4DK0 A;  1J6Q A;  3L2P A;  1F9P A;  2TSS A;  4NP5 A;  3CU7 A;  3MFY A;  1XYI A;  1TWF H;  3VDY A;  1I50 H;  3KJP A;  4A3I B;  3K8A A;  4JI4 Q;  2WV6 D;  3NWS A;  1ML0 D;  3NSW A;  1SYC A;  2VS1 A;  5HY6 A;  4Z9C B;  2O5I C;  4A3J B;  4K6L A;  2RF4 A;  2SNS A;  4DUZ Q;  3DEP A;  3VR2 A;  3RZD B;  1JE4 A;  4TSS A;  2F0O A;  4RHS A;  3TZU A;  5IY0 A;  4JYA Q;  4DV6 Q;  5ISR A;  2C9O A;  2RSO A;  4IUT A;  1B9N A;  3R3O A;  5BR8 Q;  4HJA A;  1N33 Q;  1BVS A;  3S9W A;  1B8A A;  2EYO A;  5FKA C;  1QZH A;  1STH A;  1EY7 A;  2RBM A;  3EA6 A;  4X3K A;  1STE A;  3TME A;  2GA4 B;  1H9R A;  5IOC A;  1TWC H;  5IWA L;  3D6W A;  1IL2 A;  5FLX E;  1K9M C;  1K0R A;  4LF5 L;  4A3D H;  3EN2 A;  4C2M H;  5FO7 B;  4RKL A;  2HDM A;  1AH9 A;  4QB4 A;  5JAV A;  3CHB D;  2VB3 X;  1JJ2 A;  3KFU A;  1EY9 A;  4P74 A;  3QG1 A;  3CAM A;  2E2D C;  5M9O A;  2PNR C;  3CC4 A;  1R4Q B;  2HHH L;  3S15 B;  3S1N B;  1V1Q A;  3DEO A;  2MPM A;  4K0K L;  1EOT A;  1LT3 D;  1S3O A;  2WKD A;  1I4Q A;  1X54 A;  4DV7 L;  3H3V I;  3D4D A;  3VR4 A;  2EJG C;  3A74 A;  3A8J E;  4ZQ3 A;  5C5L A;  4G4K A;  4PNY A;  2EZV A;  1QG7 A;  1VQD A;  1SSO A;  4IPC A;  1QB5 D;  4LFC Q;  4OEM B;  2A68 D;  3S16 B;  2D9U A;  5J3B A;  2CVR A;  3HOX B;  1CKO A;  1A3T A;  3U9S A;  3D8G A;  3KBG A;  5EAY A;  2Z9H A;  1BCP C;  2C35 B;  1BXT A;  4BBS H;  2MHV A;  3M4Y A;  2I07 B;  1SE3 A;  3KUP A;  5IYD G;  4HSP A;  4WRD A;  1U5K A;  2DGY A;  3HOV B;  4AIM A;  3HRZ C;  2Y0S G;  4TQU S;  1ICF B;  1FVI A;  1BDO A;  3BDL A;  4LAA A;  4JI7 Q;  3HOX H;  1PYS B;  2R7D A;  3MEF A;  1OO9 B;  1IXR A;  3J81 j;  3HG9 A;  2JA5 G;  5CC4 A;  2UU9 Q;  3EVQ A;  4HID A;  4DFA A;  4K2K A;  2I46 A;  2L1B A;  2QGQ A;  1YNN D;  3BZD B;  3HOV H;  4BY1 B;  1PHJ A;  4XXE A;  1ZXT A;  4AYB B;  1NBW A;  1FNV A;  3KOJ A;  1I3Q B;  1HUM A;  1A0I A;  4JK1 C;  1XTD A;  2NN6 G;  2G5D A;  1E1O A;  4H13 C;  4A3G G;  4HJ7 A;  3BVM A;  1W2B A;  3OWF A;  2F0Q A;  3STB C;  1LTT D;  1DOK A;  4FF4 A;  5E7N A;  2EY1 A;  1TVX A;  2R61 A;  3SEB A;  4OIK A;  3ULJ A;  1IKL A;  1BO0 A;  3NEL A;  2WAC A;  1BR9 A;  3DWQ A;  1JR0 D;  4JI1 Q;  5AJ3 L;  1I4X A;  2F0P A;  4YHH L;  1RKN A;  4QMG A;  1S5D D;  3BYY B;  3G48 A;  4KV6 A;  3H09 A;  1LM0 A;  5BN3 A;  2A69 C;  2RHQ B;  4F87 A;  1YNJ C;  1HNX Q;  3OWE B;  5D3D A;  4KLK A;  1JWS D;  3LWU A;  4ZK9 B;  5GRO A;  1Q1E A;  1XMO L;  2DJG C;  3VA7 A;  4S3S A;  1KL9 A;  1MBY A;  2QDB A;  3DM1 A;  1XNQ L;  2DJF C;  1E7Z A;  3E5S A;  4XT1 B;  3HKZ B;  1KDB A;  2KCT A;  4KHP Q;  4EQ5 A;  2IHF A;  4YWL A;  2EJF C;  3W1G A;  5KYL A;  5KND A;  4UP8 A;  1JOK A;  2JYO A;  5IE8 A;  2OXP A;  2F3W A;  3VYS A;  4R4C A;  3J81 i;  1NR2 A;  5IT9 L;  3JAM c;  5KEE A;  2B2W A;  3UDI A;  1SR3 A;  2AQ2 B;  5C3E B;  4JI8 Q;  3HOZ H;  3I91 A;  3MXU A;  1HXY D;  4IPD A;  3GV6 A;  1NR4 A;  3P7J A;  2D62 A;  4LUO A;  1II3 A;  2VNU D;  1OXX K;  3VYT A;  3MFG A;  3SR1 A;  3C1F A;  1RTO A;  4C3H B;  1SFO H;  2YTX A;  2KUM A;  4O0A A;  1HA5 A;  4DV5 L;  2Q2H A;  3ND8 A;  4EX5 A;  3AEV A;  1G6Z A;  3OMG A;  4LF7 Q;  3H0G H;  4K8I A;  2E2J B;  1OXS C;  3TSS A;  2PQA B;  4P75 A;  5C3E H;  1HR0 W;  1LT5 D;  2OEO A;  1LYL A;  2E2H B;  1V8Q A;  1A6X A;  3QJY A;  5CMD A;  1WD1 A;  1EU4 A;  3I4N H;  4WJW A;  3N6R A;  4HMJ A;  2F0S A;  2ZM6 Q;  4DV2 Q;  3A0J A;  3NTH A;  1EQQ A;  4Q0F A;  3HFZ B;  3PIP 3;  2NYZ D;  1PH4 A;  2R93 H;  4A3B G;  4DKA C;  1EY0 A;  1G8Z D;  2JA8 B;  1X3F A;  1Z9F A;  3HP3 A;  2F0J A;  4HTH A;  3URY A;  4K5W A;  3DM3 A;  3J80 L;  3K7A H;  1N34 L;  2Y0S E;  3M7G A;  1Q8I A;  2A6E D;  1TT2 A;  5M5W B;  1EEI D;  4LWC A;  3D4W A;  1OXT A;  1UEB A;  1PLF A;  3AU7 A;  1PH7 A;  2ZJP A;  1NNX A;  3BU2 A;  3LGJ A;  2WAQ G;  4F8M A;  4KJO A;  4Y52 H;  1HPC A;  5M3F G;  1EFW A;  2EY5 A;  3I4M B;  3CW2 C;  1KNA A;  1SE4 A;  4ILW A;  4E6I A;  5JJK A;  4CDC C;  2R7F A;  1VQL A;  4UP7 A;  1I4H A;  1WVL A;  2R7Z G;  1Y8O B;  2VQF Q;  5E4X A;  2B3G A;  1D5M C;  2VY3 A;  5EBD A;  1KQS A;  3SK5 A;  2OTJ A;  1K73 C;  2X69 A;  2KVM A;  5IYB H;  4FF2 A;  3VR5 A;  2SNM A;  5AFW A;  4OIJ A;  4BA2 I;  3UDF A;  3OOC A;  1GUS A;  2F0V A;  5T1G A;  1KD1 C;  2K04 A;  5IP7 H;  2K5V A;  2EYM A;  3KBX A;  4NXN Q;  2M00 A;  2KCC A;  1WD0 A;  4KHZ A;  1V9P A;  2EY2 A;  4LFA Q;  3S24 A;  4LF5 Q;  1Y1W H;  4DV3 Q;  4JI4 L;  3MEH A;  2NB0 A;  4ZYS A;  4KKS A;  5ELD A;  3KDF B;  4HJ5 A;  4X65 Q;  4PQX A;  4PG3 A;  1CA6 A;  2EYL A;  3S1R B;  1T5E A;  1FR3 A;  1LTG D;  4CGY B;  1L0Y B;  4DUZ L;  1PTO C;  5LHY 1;  5IYC G;  1I4R A;  3DHQ A;  4FF3 A;  4K0K Q;  2AQ3 B;  4J8Q A;  4FVM A;  2PMZ E;  1CUK A;  2ZTD A;  4JYA L;  4KY6 A;  4DV6 L;  2RHS B;  4KJN A;  1N33 L;  3AB9 A;  1WTW A;  3GTK B;  2ASB A;  2ZXR A;  1PFM A;  5G3L F;  3S1R H;  4JG2 A;  3HOY H;  2NUC A;  2DY7 A;  1PA6 A;  2JA7 B;  2NWG A;  4IJH A;  5CV4 A;  1H9J A;  1RTN A;  1QIL A;  2JA6 G;  2UUA Q;  2F0D A;  1LAC A;  3A5U A;  4BS9 A;  3CRK C;  3F2C A;  2AMC B;  3NBH A;  4APV A;  4IPH A;  4C3J G;  1V1P A;  3IRB A;  1D7Q A;  3PO3 G;  1A8V A;  1WTQ A;  1HHV A;  1EYG A;  1AFP A;  3RUZ A;  1C4Q A;  4C3I G;  2UXB Q;  3PO2 G;  3HOU G;  2UXD L;  3HEJ A;  2JA7 H;  5FO8 B;  2EYH A;  1ZYR C;  1MI2 A;  4A3C G;  4YWK A;  4KK7 A;  3M4P A;  2FIN B;  2RKS A;  4A3F G;  1VQN A;  1V43 A;  4IZ8 A;  1LTR D;  1F2Z A;  4LNQ A;  2FMC A;  4PMB A;  4LFC L;  1SE8 A;  1E2Z A;  3J7A F;  1YHB A;  3UDX A;  3ULL A;  4B3T Q;  4RG1 A;  4ZLT F;  5K36 H;  1QVG A;  3I72 A;  1N8R C;  4JPB W;  1WTP A;  1LTB D;  4JI7 L;  2O4X A;  2KCN A;  2A1A A;  1F2M A;  3A54 A;  5IP9 G;  4DR4 Q;  1WCM H;  1SMX A;  1BCP F;  1ROD A;  5F2D A;  4LF6 Q;  2K5H A;  4RA8 A;  4JBJ A;  3KLS X;  4GN5 A;  5E4W C;  3A56 A;  4LUV A;  1QUQ B;  2OTL A;  2WAQ E;  1ENA A;  1LTA D;  1VQH A;  1I94 Q;  1Y8N B;  2RCN A;  5LMN L;  1XPO A;  3W1B A;  2XSC A;  1L2F A;  5FLM G;  2LKV A;  4UHV A;  1KAA A;  3MXN B;  1PXU A;  1KIX A;  1Q8K A;  1VCI A;  4DV4 Q;  5C4H A;  4JI1 L;  4A93 H;  4MTK A;  1X6O A;  2F0T A;  4PMC A;  5LMU Q;  1ENC A;  2MQH A;  2PW5 A;  4A3E G;  2LMC B;  3T4A C;  4HIM A;  2BH2 A;  3VYU A;  5DM6 3;  3TBI B;  3WOE A;  4RGO S;  4A3M G;  4OO1 G;  2XTI A;  4BY7 G;  4LMQ D;  2K6A A;  5HUR A;  1XPU A;  4QJF A;  1HNX L;  3K6O A;  4C56 C;  1D1I A;  2B2T A;  3FMC A;  3KK7 A;  1DM0 B;  4ULL A;  1B50 A;  2CFM A;  4AQY Q;  1PH1 A;  4JI5 Q;  1QCB D;  1YEZ A;  4R4Q A;  1VQ6 A;  3K5M A;  4LJZ C;  2E8G A;  2RVL A;  4LK1 C;  2OF1 A;  2EYF A;  2RDG A;  4YY3 Q;  4HCE A;  4KHP L;  1KDA A;  4IFD I;  2I5L X;  1P16 A;  4IO9 A;  1F9S A;  5CV6 A;  1Q46 A;  4LF8 L;  3PV0 A;  2F0H A;  4QF4 A;  5I6W A;  1BOS A;  4BBR G;  3K81 C;  2JSO A;  1WTR A;  3VR6 A;  4LW1 A;  2Y0S B;  5CYU A;  1G91 A;  1XMQ Q;  4DAY B;  4RMF A;  3UDG A;  4HAE A;  3OIQ A;  3ERS X;  4RCO A;  4JI8 L;  4JV5 Q;  3M85 A;  2RDF A;  4O2D A;  5GAG C;  2N78 A;  2VQE Q;  1R9T B;  4B3R L;  1Z6H A;  4N8X 1;  5C0X I;  3PF5 A;  2JA5 B;  4R9W A;  1TS5 A;  3P1H A;  1B4O A;  1B53 A;  5IGC A;  5J39 A;  3CC7 A;  1DON A;  2F3I A;  2AUJ D;  4NPS A;  3TRE A;  3RN5 A;  3RLN A;  1EYA A;  3NTK A;  4N9T A;  4LF7 L;  1D8L A;  3G6J B;  1B3Q A;  3CCL A;  2F0W A;  1EYC A;  2IJ0 A;  1JJC B;  4A3G B;  1Z47 A;  3UE1 A;  1R9T H;  3CF5 A;  5A2Q E;  3EJI A;  4KMU C;  4DK1 A;  1UWV A;  5C0X G;  2L55 A;  1GUW A;  2F0U A;  4C1N K;  1UEA B;  4JI2 Q;  3SDZ A;  3M3Y H;  2ZM6 L;  2DNC A;  4R4I A;  1SYD A;  3PUV A;  2NN6 H;  1VQ7 A;  4A3G H;  4XIG S;  4DNR B;  1AE3 A;  3H6M A;  3R93 A;  2EPB A;  4B08 A;  4H02 A;  4OX9 Q;  4K2L A;  1ZKO A;  3G4S A;  1PTO B;  2D2C C;  4DAM A;  4HJ8 A;  1NTG A;  3J81 c;  3PIP A;  1Y1V G;  3KLS A;  2NVT H;  3TRZ A;  1Y8P B;  1CZW A;  2PMZ B;  1GM5 A;  1PRT D;  5ELF A;  1TXY A;  1HNZ Q;  1Q90 A;  3GTJ B;  4DR3 Q;  3GTP B;  4K5V A;  5JEA J;  1JOR A;  1A3U A;  3Q0A A;  4A76 A;  3K7U C;  2KOL A;  4ME3 A;  1GUN A;  1VQP A;  4BXX G;  4RGN A;  3PGZ A;  4DV0 Q;  2AUK A;  5LL6 X;  4CDE C;  4A3I H;  1CKN A;  2VQF L;  3U4V A;  5EGT A;  1S5C D;  1EEF D; 
#chains in the Genus database with same CATH homology
 2A68 C;  4RWS C;  5EKK A;  3NXW A;  3P20 A;  1UUP A;  2J7Z A;  2KEC A;  4FP5 D;  3GTL B;  3RZO B;  1RHP A;  3LNN A;  2F0M A;  5C5M A;  1M8A A;  2L11 A;  2K5D A;  1NUC A;  1VMC A;  2Q8R E;  2A6H D;  3O13 A;  1JIC A;  4MHE A;  1TS4 A;  2J0T D;  2CQA A;  2A73 B;  2TMP A;  3M7N A;  2AWO A;  1I6V C;  1YNN C;  1OXV A;  3FPP A;  4EVO A;  2RDH A;  4DXF A;  1EWC A;  3E6Z X;  3C1E A;  3I8Z A;  1SNO A;  1FGB D;  1MGS A;  1SNQ A;  4OHJ A;  1PTO F;  1EYD A;  1LTS D;  4A3B B;  3ZYY X;  1U4R A;  3OHX C;  4KD3 A;  1EY8 A;  4XT3 B;  3NPP A;  2K5Q A;  4IUV A;  2NBF A;  4ZUJ A;  1F9R A;  3V96 A;  1D5Z C;  4CKE A;  3U9O A;  2Q8I B;  4B9W A;  5IIF A;  2WAQ B;  5M3F B;  4QUF A;  2H1E A;  3LX0 A;  3L3O C;  4M8A A;  5D3I B;  3RD4 A;  4KKU A;  2R7Z B;  1WTV A;  5I9O A;  2MP1 A;  5C3W A;  2SOB A;  3R2T A;  4NMZ A;  3HS0 C;  3OMC A;  4TRD A;  2K32 A;  2KA7 A;  4DNT B;  1EWH A;  5EPK A;  1UNS A;  2L5T A;  4XQQ A;  2RQX A;  4IAL A;  1S4Z A;  3PUW A;  1SNP A;  4XYO A;  1ESF A;  3T16 A;  1W6K A;  4CBV A;  5KIX A;  4XTC S;  1ZEQ X;  3MZ5 A;  3PMF A;  2B8F A;  3RMH A;  2IL8 A;  1CFM A;  2BE5 C;  4JBW A;  1BQQ T;  2E76 C;  3NQT A;  1H9S A;  4KKT A;  1GUO A;  2XN9 C;  3C2P A;  1KDC A;  1EY4 A;  1MSG A;  4Y7N B;  3DWP A;  3J7A V;  2JA6 B;  5CGK A;  4MN3 A;  5CR3 A;  4FF1 A;  4IUN A;  3K5O A;  4L63 B;  1ONL A;  4C3J B;  5T1I A;  2B2V A;  3PO3 B;  4KD4 A;  1RJT A;  4U68 A;  5KYI A;  4C3I B;  1Q12 A;  3PO2 B;  3HOU B;  1EZ8 A;  5JPM C;  3S17 B;  1IYV A;  3ND9 A;  3UI2 A;  1WTX A;  5JEA G;  3C3L A;  2JEB I;  2A6E C;  1JB3 A;  5EKL A;  4M1U B;  2MGS A;  2Z8L A;  4A3F B;  5LL6 S;  2F0L A;  3TP8 A;  2K28 A;  1T5X D;  2F0K A;  1CQF A;  1ENF A;  2K03 A;  2B2T C;  5FK9 C;  2G9H D;  3CRL C;  3NTI A;  1CM9 A;  4YIJ A;  1HQM C;  2Q8T A;  1SXT A;  2BOS A;  1Q3L A;  2J4X A;  2X6G A;  4RGM A;  2R3Z A;  4L6T B;  2EDG A;  3GTQ B;  1LT6 D;  2AQ1 B;  3FPU B;  2A5H A;  4O1N A;  4DGZ A;  5A2Q L;  1F9Q A;  3AMU A;  1TWH B;  5IGE A;  3PUZ A;  1GHK A;  3QOJ A;  1TQO A;  1W6J A;  1O7Z A;  2EXZ A;  1U4P A;  1M4V A;  2CW0 D;  1RF2 D;  1GUT A;  4FXG C;  5EQ0 A;  5KRU A;  3X3N A;  4K5X A;  4A3E B;  1FD7 D;  1AP0 A;  3JAM E;  4XQN A;  4A3M B;  2K7V A;  4BY7 B;  3VA5 A;  2SDF A;  2B39 A;  1CT1 D;  3F2U A;  1I6H B;  2L4N A;  2HUG A;  4HSV A;  3H3V C;  1TWA B;  5CBA E;  5NUC A;  5J22 A;  1E0B A;  5C4J B;  3PIO 3;  4EQN A;  3DWA A;  3SK8 A;  3MHB A;  1BCP B;  3A8K E;  4BBR B;  3GQB A;  3C46 A;  3K59 A;  2EY6 A;  3HGB A;  3NUC A;  2XWJ B;  5FLX L;  1AN8 A;  2YYZ A;  4FXD A;  1XTC D;  3BDC A;  4KY5 A;  1V1P B;  1C8C A;  2M2L A;  2L12 A;  1RD9 D;  1H9M A;  2ID0 A;  3BG3 A;  1CI3 M;  3S1Q B;  1RCV D;  4HMI A;  1HA6 A;  2FHT A;  4IFD J;  2KQ3 A;  3MC0 B;  3QOL A;  4XYQ A;  1E2V A;  5EJW A;  4PMW A;  4ZKB B;  3QO2 A;  3X3M A;  1F77 A;  1G2S A;  4BA1 I;  1HTL D;  3QWN A;  4WOR A;  3TP7 A;  5C0X J;  5COY A;  4I65 A;  3GTO B;  5C4Z A;  2BA1 A;  1QOH A;  1DZ1 A;  4N9P A;  5EPJ A;  1Y1V B;  4ZRZ A;  4X3U A;  1NSN S;  1K83 B;  4U67 3;  5M5Y B;  1KLG D;  2WII B;  1XXG A;  2HCI A;  4IN3 A;  4RAU C;  3IAY A;  3M4O B;  1STN A;  1KTK A;  1ESR A;  1HRJ A;  1EIH A;  4RKB A;  2JE6 I;  4DAV A;  4QCL A;  4K6D A;  3FDT A;  5D14 A;  1NAP A;  1QNK A;  1MD2 D;  2B2U C;  5E3F A;  2D5D A;  2F0I A;  1PYW D;  1SYF A;  1KNE A;  1AW7 A;  3S2H B;  3SK6 A;  1PZI D;  3K57 A;  4FXK C;  4A3K B;  1ILP A;  2E2I B;  1SND A;  1Y69 U;  3KF8 A;  1TWG B;  3CKI B;  2HCC A;  4ME5 A;  1ILQ A;  1EY5 A;  2QCP X;  1QNU A;  5IOD A;  4H7B A;  1STB A;  1HFG A;  3TDQ A;  1EQT A;  2F03 A;  4FO2 A;  2LFN A;  4CJ0 B;  4KTA A;  2K5W A;  2KED A;  1SMY C;  2FMM A;  3PUX A;  4DU9 A;  1EL0 A;  4MIU A;  1V1O A;  1CK1 A;  5DNF A;  5M5X B;  5K5P A;  2WP8 J;  1EFI D;  2B2Y C;  3T13 A;  1RDP D;  1BUV T;  2B2V C;  2QEJ C;  4NDX A;  2YU9 B;  5CV9 A;  2N88 A;  1EU3 A;  2F0N A;  1TY0 A;  2ENB A;  4FYD A;  4IUQ A;  1PRT C;  4BWG B;  1B9M A;  4F7X A;  2PZT A;  2QIL A;  1FYC A;  3TP5 A;  1F2Y A;  1BNZ A;  3I3C A;  1JWM D;  2FJ2 A;  3V05 A;  3OIP A;  2F0F A;  3LWE A;  3BDO A;  3HOW B;  2XNA C;  1VF5 C;  3A7A B;  5KNC A;  1TS2 A;  4HED A;  1GJX A;  2BDN A;  4H0L C;  2IX3 A;  3K5L A;  1TR5 A;  3EFX D;  5K36 G;  1VDZ A;  2CHB D;  1F2L A;  1TKW B;  1FNU A;  1GUG A;  4XQJ A;  1PFN A;  1O7L A;  1TWF B;  1DD2 A;  5C6A A;  4IFD G;  1I50 B;  1SBB B;  3ONA B;  1EY6 A;  2DNE A;  5COR A;  2A6H C;  3Q6S A;  1UAP A;  1CQV A;  4HCS A;  3MAQ A;  3VR3 A;  2LY7 A;  1HTP A;  1DCZ A;  1PTO H;  1ET6 A;  1R4P B;  3ERO A;  1L0X B;  3OSO A;  2RA4 A;  1GHJ A;  5I2X A;  4G7H C;  2FFK B;  3JAM L;  2V4D A;  4ABN A;  2JEA I;  1D5X C;  3SHL A;  1TWC B;  4RHR A;  3K58 A;  4QIW B;  3S2D B;  1K8O A;  1STY A;  3FKI B;  1LT4 D;  4DF7 A;  4A3D B;  2Z4I A;  3A55 A;  1ET9 A;  4C2M B;  1IW7 D;  2NTT A;  4X3T A;  4CJ1 B;  2N55 A;  5BN5 A;  1O7Y A;  4NKL A;  2NN6 I;  2IX1 A;  2F3V A;  5C3X A;  5JEA H;  3NK9 A;  4OL7 A;  5EKI A;  5JVH 3;  1D1K A;  3DMU A;  2KJX A;  4IQZ A;  3S14 B;  4DAP A;  3L7Z C;  2O2L D;  2R92 B;  2IWH A;  1STA A;  4IUP A;  3WOF A;  5G3L D;  3TP6 A;  3E0J A;  4BBS B;  4B9X A;  5JOB A;  1KAB A;  1DOM A;  1B2T A;  2EYP A;  5IGG A;  1X32 A;  3MXG A;  3GTG B;  4EQP A;  3J81 E;  1O80 A;  2Z4H A;  5JVG 3;  1SYE A;  4DXG A;  3H91 A;  1PFB A;  1X3Q A;  1B44 D;  2B2U A;  1SEB D;  1A2T A;  5ELC A;  3FVQ A;  3I4L A;  1DXM A;  2PZU A;  4J1M A;  2KHS A;  2PW7 A;  2ICI A;  4O42 A;  2NVX B;  3GD7 A;  5I6Y A;  4K8J A;  1PZJ D;  5A35 A;  1A2U A;  5BN4 A;  3CQZ B;  5FO9 B;  3NE5 B;  3GO5 A;  1B1Z A;  2VXW A;  1BCP D;  5I2Y A;  4I7Z C;  1SE2 A;  1SYG A;  1IKM A;  3V2T A;  1H9S B;  2RSN A;  5DEH A;  2WB1 B;  4RCN A;  2BCO A;  5KNB A;  2B2Y A;  4UAI A;  2K01 A;  3D31 A;  3HOZ B;  3FRP B;  3D4R A;  2EVB A;  1PRT B;  1AZP A;  5EPL A;  1EZ6 A;  4V19 0;  4IUR A;  3NQI A;  1K8M A;  1SFO B;  3D3R A;  4G7O C;  1CA5 A;  2VUM B;  1S5F D;  1OXU A;  2ICE C;  4V0B A;  3H0G B;  3R2I A;  1A3V A;  2A69 D;  2M9V A;  1YNJ D;  2JXM B;  4RFB A;  4ODG A;  3I70 A;  3T53 B;  2E74 C;  3I4N B;  1VMP A;  3W3A A;  2CW0 C;  1VF7 A;  2BE5 D;  1EIG A;  2IW3 A;  2R93 B;  1XWE A;  3NHH A;  1Z7T A;  2PQE A;  2EYJ A;  1KLU D;  2OT2 A;  1IYU A;  3K7A B;  1IHZ A;  5IGD A;  5JPN C;  1LO5 D;  3WDN A;  4GZY C;  2KEE A;  4KN4 C;  4UDU C;  1DYQ A;  1TU2 B;  3G7L A;  2ZXP A;  3R8B A;  1S5E D;  1CHQ D;  3GP7 A;  1NCV A;  5CBE E;  3HZX A;  1SJH D;  5ELB A;  1PRT F;  3FEW X;  5ELE A;  4L8J A;  5CV8 A;  2AWN A;  2PO4 A;  2X6L A;  2HQE A;  4C1N I;  3QIA A;  2JP1 A;  2IT1 A;  1O78 A;  3MXP A;  3NP8 A;  1HFN A;  3SK4 A;  1TY2 A;  2VB2 X;  5C4X B;  1Y1W B;  1S5B D;  1Q1B A;  3IKJ A;  3W2D A;  3VYR A;  2B8G A;  1ICW A;  2LS0 1;  1QWY A;  2XIW A;  4OO1 H;  1BBX C;  2B63 B;  3IL8 A;  4CKB A;  1SJE D;  1PZK D;  2H4O A;  3T51 B;  2F4I A;  1LTI D;  2C5C A;  4FNF A;  1J9O A;  1SDF A;  4G57 A;  5M3M B;  1JOQ A;  3GTM B;  3HOY B;  3ITP A;  3PUY A;  2PCF B;  1SNM A;  3IFD A;  1U9R A;  5I9P A;  3DUZ A;  1JWU D;  3TZD A;  2HDL A;  4R8N A;  4XDX A;  3BS1 A;  2MUY A;  3ERQ A;  1I4P A;  4RGT A;  1STG A;  2BA0 A;  4H44 C;  5HGT A;  3NBI A;  4QUC A;  4CJ2 C;  3BYT B;  3SXH A;  1E2W A;  4CHT B;  5KGU A;  3MVV A;  3J7Y W;  3T56 B;  4KY7 A;  2EE1 A;  5IGF A;  2ZXO A;  4ZKC B;  3D6C A;  1SNC A;  1WTO A;  1HCZ A;  4IUU A;  2L0C A;  1LLR D;  5JJZ A;  1U4M A;  4HN7 A;  1C48 A;  2G9D A;  3MWY W;  2O5J C;  2XVS A;  4Q5V A;  1CHP D;  4CKC A;  2Z1C A;  1PTO D;  4TKO B;  3I90 A;  4C3H G;  3NWT A;  2SEB D;  2DY8 A;  1GXD C;  4OO1 I;  3A8I E;  2NTS A;  1HQR D;  3J81 L;  2NVQ B;  2MJ8 A;  3N52 A;  1J8I A;  3Q22 A;  2F1M A;  2R6G A;  3IFT A;  3OPO A;  3K0Y A;  4NW2 A;  1AEX A;  5E1F A;  1WCM B;  3H94 A;  1CTM A;  1QE6 A;  5TSS A;  2EOT A;  3RLF A;  5D65 A;  1FNW A;  3Q24 A;  2ZT9 C;  5CV5 A;  2QKI C;  4IFD H;  3MTS A;  2K33 A;  4J6H A;  2EJM A;  1ZYR D;  1DJR D;  1HUN A;  1D2B A;  1SAP A;  2IX0 A;  4A93 B;  2F0G A;  1LAB A;  4ID6 A;  5IGB A;  1QJO A;  2WKC A;  4PV1 C;  3SE0 A;  5C0X H;  1SYB A;  3P75 A;  2PZW A;  3EQL C;  2WIN B;  1G29 1;  1PMR A;  5C44 B;  2IPK D;  3MXN A;  1XX8 A;  1TII D;  2PYK A;  3OW7 A;  2XRQ D;  2PPB C;  1JCK B;  1MSH A;  1G2T A;  5IT9 E;  4P2C B;  1JOO A;  3MA2 B;  1X3P A;  2BDO A;  1IL8 A;  4OGQ C;  4DA2 A;  1B3A A;  2K05 A;  4KI0 A;  4R8I A;  1U4L A;  2A74 C;  4KHV A;  5FOB B;  1LV9 A;  2F0E A;  1TS3 A;  3L9A X;  4F88 A;  4ZUI A;  5I4D A;  1DOL A;  3SVM A;  1I4G A;  4RH6 A;  1JQY D;  1JC7 A;  4WFN 3;  4X3S A;  3TN2 A;  3QB3 A;  1A15 A;  5DM7 3;  4EGV A;  2QF7 A;  1BF4 A;  3Q23 A;  3BVZ A;  1H9K A;  3K5N A;  2XWB B;  2NZ1 D;  4DAY A;  5EBC A;  2K1B A;  3S1M B;  3GV3 A;  5J1Z A;  5DAU A;  3KLR A;  4G7Z C;  3M3Y B;  4DN4 M;  3J80 E;  2B2W C;  1GOZ A;  2NVY B;  4HR7 B;  5CV7 A;  4EQO A;  1SMY D;  3DXJ C;  3I73 A;  2E75 C;  3A7L A;  4ZAI A;  2L9H A;  2XRS D;  3BVG A;  2NVT B;  1IW7 C;  4KN7 C;  1EQV A;  1AZQ A;  1PDQ A;  4K14 A;  1CZG A;  1D6E C;  2DN8 A;  4DK0 A;  1F9P A;  2TSS A;  4NP5 A;  3CU7 A;  3MFY A;  1XYI A;  4A3I B;  2WV6 D;  3NWS A;  1ML0 D;  3NSW A;  1SYC A;  4Z9C B;  2O5I C;  4A3J B;  4K6L A;  2SNS A;  3DEP A;  3VR2 A;  3RZD B;  1JE4 A;  4TSS A;  2F0O A;  4RHS A;  3TZU A;  5ISR A;  2C9O A;  2RSO A;  4IUT A;  1B9N A;  3R3O A;  3S9W A;  2EYO A;  5FKA C;  1STH A;  1EY7 A;  2RBM A;  3EA6 A;  4X3K A;  1STE A;  3TME A;  2GA4 B;  1H9R A;  5IOC A;  3D6W A;  5FLX E;  5FO7 B;  4RKL A;  2HDM A;  4QB4 A;  5JAV A;  3CHB D;  2VB3 X;  1EY9 A;  3QG1 A;  2E2D C;  5M9O A;  2PNR C;  1R4Q B;  3S15 B;  3S1N B;  3DEO A;  2MPM A;  1EOT A;  1LT3 D;  2WKD A;  1I4Q A;  3D4D A;  3VR4 A;  2EJG C;  4ZQ3 A;  3A8J E;  5C5L A;  4G4K A;  4PNY A;  2EZV A;  1QG7 A;  1SSO A;  1QB5 D;  3S16 B;  2A68 D;  2D9U A;  2CVR A;  3HOX B;  1A3T A;  3U9S A;  3D8G A;  3KBG A;  1BCP C;  1BXT A;  2MHV A;  3M4Y A;  2I07 B;  1SE3 A;  3KUP A;  4HSP A;  4WRD A;  3HOV B;  3HRZ C;  4TQU S;  1BDO A;  3BDL A;  4LAA A;  1OO9 B;  3HG9 A;  5CC4 A;  3EVQ A;  4DFA A;  4K2K A;  2I46 A;  2L1B A;  1YNN D;  3BZD B;  4BY1 B;  4XXE A;  1ZXT A;  4AYB B;  1FNV A;  1I3Q B;  1HUM A;  4JK1 C;  2NN6 G;  4H13 C;  3BVM A;  3OWF A;  2F0Q A;  1LTT D;  1DOK A;  4FF4 A;  2EY1 A;  1TVX A;  2R61 A;  3SEB A;  4OIK A;  1IKL A;  1BO0 A;  2WAC A;  1BR9 A;  3DWQ A;  1JR0 D;  1I4X A;  2F0P A;  1RKN A;  4QMG A;  1S5D D;  3BYY B;  4KV6 A;  3H09 A;  5BN3 A;  2A69 C;  4F87 A;  1YNJ C;  3OWE B;  5D3D A;  1JWS D;  3LWU A;  4ZK9 B;  1Q1E A;  3VA7 A;  4S3S A;  1MBY A;  2QDB A;  3DM1 A;  3E5S A;  4XT1 B;  3HKZ B;  1KDB A;  2EJF C;  5KYL A;  5KND A;  1JOK A;  2JYO A;  2OXP A;  2F3W A;  3VYS A;  1NR2 A;  5IT9 L;  5KEE A;  2B2W A;  5C3E B;  2AQ2 B;  3I91 A;  3MXU A;  1HXY D;  3GV6 A;  1NR4 A;  3P7J A;  2D62 A;  2VNU D;  1II3 A;  1OXX K;  3VYT A;  3MFG A;  3SR1 A;  3C1F A;  1RTO A;  4C3H B;  2KUM A;  1HA5 A;  3ND8 A;  1G6Z A;  3OMG A;  4K8I A;  2E2J B;  1OXS C;  3TSS A;  1LT5 D;  2OEO A;  2E2H B;  1V8Q A;  1A6X A;  3QJY A;  5CMD A;  1WD1 A;  1EU4 A;  4WJW A;  3N6R A;  4HMJ A;  2F0S A;  3NTH A;  4Q0F A;  3PIP 3;  2NYZ D;  1EY0 A;  1G8Z D;  2JA8 B;  3HP3 A;  2F0J A;  4HTH A;  3URY A;  4K5W A;  3J80 L;  3M7G A;  1Q8I A;  2A6E D;  1TT2 A;  5M5W B;  1EEI D;  3D4W A;  1OXT A;  1PLF A;  3AU7 A;  4F8M A;  4KJO A;  1HPC A;  2EY5 A;  3I4M B;  1KNA A;  1SE4 A;  4ILW A;  4E6I A;  1I4H A;  1WVL A;  1Y8O B;  5E4X A;  5EBD A;  1D5M C;  3SK5 A;  2X69 A;  2KVM A;  4FF2 A;  3VR5 A;  2SNM A;  5AFW A;  4OIJ A;  4BA2 I;  3OOC A;  1GUS A;  2F0V A;  5T1G A;  2K04 A;  3KBX A;  2EYM A;  2M00 A;  2KCC A;  1WD0 A;  4KHZ A;  2EY2 A;  3MEH A;  2NB0 A;  4ZYS A;  4KKS A;  5ELD A;  4PQX A;  1CA6 A;  2EYL A;  3S1R B;  1T5E A;  1FR3 A;  1LTG D;  4CGY B;  1L0Y B;  1PTO C;  5LHY 1;  1I4R A;  3DHQ A;  4FF3 A;  2AQ3 B;  4J8Q A;  4FVM A;  4KY6 A;  4KJN A;  3AB9 A;  1WTW A;  3GTK B;  2ZXR A;  1PFM A;  5G3L F;  2NUC A;  2DY7 A;  2JA7 B;  2NWG A;  5CV4 A;  1H9J A;  1RTN A;  1QIL A;  2F0D A;  1LAC A;  4BS9 A;  3CRK C;  3NBH A;  4C3J G;  1V1P A;  1WTQ A;  1HHV A;  1AFP A;  3RUZ A;  1C4Q A;  4C3I G;  3HEJ A;  5FO8 B;  2EYH A;  1ZYR C;  1MI2 A;  4KK7 A;  2FIN B;  2RKS A;  1V43 A;  4IZ8 A;  1LTR D;  1F2Z A;  2FMC A;  4PMB A;  1E2Z A;  3J7A F;  4ZLT F;  5K36 H;  3I72 A;  1WTP A;  1LTB D;  2O4X A;  2KCN A;  1F2M A;  3A54 A;  1BCP F;  1ROD A;  5F2D A;  4RA8 A;  3KLS X;  5E4W C;  3A56 A;  1ENA A;  1LTA D;  1Y8N B;  2XSC A;  2LKV A;  1KAA A;  1PXU A;  1VCI A;  5C4H A;  2F0T A;  4PMC A;  1ENC A;  2PW5 A;  2LMC B;  3T4A C;  3VYU A;  5DM6 3;  3TBI B;  3WOE A;  4RGO S;  4OO1 G;  5HUR A;  4LMQ D;  2K6A A;  3K6O A;  4C56 C;  1D1I A;  2B2T A;  3FMC A;  3KK7 A;  1DM0 B;  4ULL A;  1B50 A;  1QCB D;  3K5M A;  4LJZ C;  2RVL A;  4LK1 C;  2OF1 A;  2EYF A;  2RDG A;  4HCE A;  1KDA A;  4IFD I;  1F9S A;  5CV6 A;  3PV0 A;  2F0H A;  4QF4 A;  5I6W A;  1BOS A;  2JSO A;  1WTR A;  3VR6 A;  2Y0S B;  5CYU A;  1G91 A;  4HAE A;  3OIQ A;  4RCO A;  3M85 A;  2RDF A;  1R9T B;  1Z6H A;  5C0X I;  2JA5 B;  4R9W A;  1TS5 A;  3P1H A;  1B4O A;  1B53 A;  5IGC A;  5J39 A;  1DON A;  2AUJ D;  1EYA A;  3NTK A;  4N9T A;  3G6J B;  2F0W A;  1EYC A;  2IJ0 A;  4A3G B;  1Z47 A;  5A2Q E;  3EJI A;  4KMU C;  4DK1 A;  5C0X G;  2L55 A;  1GUW A;  2F0U A;  4C1N K;  1UEA B;  3SDZ A;  2DNC A;  1SYD A;  3PUV A;  2NN6 H;  4XIG S;  4DNR B;  3H6M A;  3R93 A;  2EPB A;  4B08 A;  4K2L A;  1ZKO A;  1PTO B;  2D2C C;  3KLS A;  1Y8P B;  1CZW A;  2PMZ B;  1PRT D;  5ELF A;  1Q90 A;  3GTJ B;  3GTP B;  4K5V A;  5JEA J;  1JOR A;  1A3U A;  3Q0A A;  2KOL A;  1GUN A;  4RGN A;  2AUK A;  5LL6 X;  5EGT A;  1S5C D;  1EEF D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...