4XZ3A

Ca. korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 (se-met derivative) in complex with coenzyme a and mg-amppcp, phosphohistidine segment pointing towards nucleotide binding site
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
463
structure length
463
Chain Sequence
NDLERLFNPSAIAVVGASKDPSKIGSQILRNLLSYGFKGKVYPINPTADELMGLKCYPKVSDVPDKVDVAVISVPSDKVLGVIDDCGKAGVKFAVVITSGFKEVGNEELEEELVRRAHSYGMRVLGPNIFGYLYAPARLNATFGPKDVLSGNVAFISQSGALGIALMGYTVVENIGISSIVSVGNKADLDDVDLLDFFDKDPNTGVIMIYLEGIAPGRGRMFIDVASRVSLRKPIIVIKAGRTEVGARAAASHTGSIAGSVAIYESAFKQSGILMAKSVEDAFDWTKALSWNPIPEGERLIVLTNGGGAGVQSTDTFADNGIYLSKPPESLIQEIKKFVPPFASFANPIDITGMAPDDWYYMGTLAALKNPDVDALTVLYCQTAVTTPIGVAKGIVDAIKEAGNSKPVTVGMVGGPEVAEAVSFLNKQRIAAYPTPERASSAMSALYAYARARSYVMKSLAVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Candidatus korarchaeum cryptofilum opf8
molecule tags Ligase
molecule keywords Acyl-CoA synthetase (NDP forming)
total genus 160
structure length 463
sequence length 463
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13380 CoA_binding_2 CoA binding domain
A PF13607 Succ_CoA_lig Succinyl-CoA ligase like flavodoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 4xz3A02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 4xz3A03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4xz3A01
3JD1A 1RM3A 2IEDA 3WX0A 3SVTA 5TT0A 1BW9A 1HYHA 3PHLA 4XQEA 4GX2A 4FCCA 1KETA 4AJEA 1LC3A 1ENZA 4CODB 1NFRA 3DHEA 3O26A 3N74A 3WIEA 1T4DA 2O50A 3C7DB 4AJPA 1Q0HA 1U4SA 1HSZA 4IIUA 3QY9A 4J1NA 1EE9A 1SB8A 4E5MA 1XWFA 1OC2A 3RFVA 2I3AA 3WYEA 1WVGA 3D3EA 1A9ZA 2NU6A 3W8FA 1XYGA 4TRRA 3V1TC 1TT5A 4LN1A 5JC8A 5IFLA 3DOOA 3DZBA 1BTOA 1YL7A 2AEMA 4YACA 3GQVA 3JD4A 4FDAA 5IN5A 1OI7A 1QYVA 4MVJE 4YWJA 1E3SA 1UZLA 3DAGA 3FI9A 1JVSA 3WMWA 3UH1A 1DC3A 4J4BA 1GY8A 1IOLA 2C29D 4RPKA 2D5CA 1PJQA 2C5EA 3D4OA 4MIEA 3OFSA 4TWRA 5B4TA 3IS3A 3BAZA 4GMFA 3ONEA 2JD1A 1GUFA 1UZNA 2YW9A 3CH6A 4RQTA 3CMMA 3GY0A 1JA9A 1FMCA 1QR6A 1Q1NA 1MC4A 4YTEA 5JBIA 1EUDA 3ANLA 3ETDA 4HKTA 3FWNA 1DSSG 3E6AA 3K96A 4MVJH 2CY0A 4OXKA 5CDGA 2J3IA 4RCVA 3GNSA 3TWOA 5GMOA 2DTEA 2Y0EA 2P9CA 2WYVA 3V2HA 2Y93A 3L4BA 5DF1A 3TZCA 3WS7A 3QWAA 3HJAA 5K9ZA 1E6EA 3INRA 1LDGA 3QWIA 1JKIA 2AA3A 2EXXA 4FQ8A 4XDYA 2QZZA 4UUPA 3ASUA 1PWZA 1I01A 1P1RA 1P0CA 4CV0A 4BO0A 1DIHA 4R9RA 3UHAA 3NV9A 5HM8A 1FK8A 4IUYA 5ENVA 3JQCA 3QW2A 2V6MA 3ON5A 4W9NA 3HUDA 4CM9A 4CMAA 3TFOA 4FFLA 1EVIA 2PD6A 3E1KA 2VNAA 4OSPA 5JLAA 5TSDA 3RC9A 3PFWO 4IDGA 1JTVA 5I9LA 2BMAA 4XYMA 3Q3CA 5AVOA 1AGNA 1LUAA 1UP6A 4DPLA 3MWDA 3C85A 1LDYA 4XIJA 4FIZA 4UUOA 3NKLA 2BGMA 3TZ6A 3KO8A 4E0BA 3NEPX 5MGBA 3DZHA 3Q0EA 1E77A 3DDNA 3LF2A 1VPDA 1IPFA 1H0KA 3DOCA 4NJMB 4KQWA 3U3XA 1NR1A 2ZCVA 4AG3A 3TPCA 5A05A 2EHDA 2LDBA 1M75A 2HK9A 4Z3KA 2CDCA 3GMSA 4GH5A 1QYDA 5TT1A 1WZIA 4CMIA 4QO7A 5HRUA 4NBUA 5G0VA 2Y66A 2D3TA 1I3NA 1ZW1A 4N7RA 1YDEA 4NBTA 2W2LA 4ZD6A 3E5MA 4WKGA 2X9NA 3RBZA 1AN9A 3LVFO 4DREA 4PVDA 3KETA 3RIHA 2AEFA 4PRKA 3P19A 3ZWMA 1DC6A 2JAHA 1AXGA 3I1JA 2O48X 3NT2A 3DL2A 7MDHA 3PGXA 1GYQA 1I3MA 4LRSB 4TQGA 4E2ZA 1P1KA 3E82A 3VTFA 4MVJM 4F46A 4INAA 1C0IA 1BG6A 1KVSA 3PPIA 2P5YA 2B4QA 3O8QA 1ZJYA 3G0OA 5BSHA 3NDIA 3GF4A 2VUSA 3HDJA 1L7EA 4QTZA 1ZO8A 4UEJA 3BHMA 4UEKA 5DBIA 4Y8VA 1MXHA 2JFGA 3DMYA 3AY7A 3GPIA 4II2A 2B35A 3L77A 2QZ9A 1PJ4A 4KWHA 3OJOA 1KEUA 1XHLA 2CF5A 4K1LA 2ZK7A 4E2XA 3DHNA 4DXHA 3VH4A 2HLPA 3PZRA 2C2XA 4HBGA 3HB4X 4Z3DA 1IHXA 2BLLA 4D44A 4ZQHA 5JDCC 4MO2A 1BVRA 1ML3A 5AXBA 1C0PA 3RBXA 2C82A 1GYPA 1X14A 1R4NA 5DCWA 1QRRA 1HDYA 3RUDA 3GA0A 4FFNA 5L4NA 2A92A 3ETEA 1PGOA 2Q46A 4OIMA 4NH4A 5JNLA 3GEDA 4IQ0A 3U9LA 3ZCXA 1LI4A 1C14A 3ZWXA 4IMRA 4KUGA 4WLVA 1N2SA 4PG7A 2VWQA 1HE5A 2CUKA 4J7UA 3P2OA 1GL3A 1D7OA 5IF3A 1ZEMA 5B4VA 2CZCA 3ZNPA 4YJDA 1HE3A 2VUUA 4GWKA 1NBOA 1T2CA 2VZ0A 3H4VA 2VHZA 5L53A 4BO7A 1E3EA 4L0QA 4RLSA 2D5AA 3KYDA 1Q0QA 2FHSA 1P44A 1PS9A 1HLDA 1QXSA 2SCUA 1BXGB 5TF4A 1XDWA 4E33A 2AG8A 2B4TO 3KUXA 3S55A 3D4NA 2R2GA 3NGXA 4WEQA 2QHXA 3ZV3A 1XKQA 5BT9A 1ISGA 2P9GA 2X8LA 3DB2A 4HX5A 4PLCA 4UEOA 1SEPA 4BNTA 4E5KA 4R5MA 1VKNA 2J3HA 1LTHR 1D1SA 3OETA 2PKQO 1HDXA 5FI3A 5C7OO 3UKOA 1RKXA 1R15A 2ZYDA 1UAYA 2OHXA 1T4BA 2NU9A 1U5AA 1YGYA 1VRWA 4DPKA 3IKTA 3GGPA 3BZUA 2OBNA 1LJ8A 3TL2A 3AUTA 2AHRA 4MVJP 3EYWA 2GSDA 3EC7A 4R01A 4CUZA 4GBJA 4FFOA 3WFJA 4XYEA 1I36A 3VHRA 2VWGA 2EW2A 5BNIA 1HSOA 4AJ2A 1T25A 5L95A 3V5NA 4AJLA 1PGJA 2QQ5A 4XGIA 4FGSA 4OOFA 2GZ1A 2QRJA 3F6YA 3S8MA 2HMUA 3VPFA 3JYQA 4QX6A 1UDCA 2ZTVA 4GLOA 2FPPB 2FN7A 4FS3A 1K89A 1HRDA 4M86A 3ORFA 5EL0A 1GDHA 4HNGA 4XWYA 5T8KA 1S7CA 2IYOA 2D8AA 1C1DB 3OMLA 4U7WA 5DULA 2NU7B 1R6DA 4II3A 1MV8A 3V8BA 5JAMA 2UYYA 3UXYA 2BKAA 3JD2A 3D3WB 1LDBA 3JQ8A 1GU7A 5J23A 3WWZA 4FC7A 2BFAA 3K31A 3RUAA 1B3BA 3O38A 3HN7A 2JCXA 2O3JA 4CM9D 1N7HA 3LZ6A 5TX7A 8LDHA 3OSUA 4MIOA 2EKQA 1C0LA 3FPLA 3MJEA 5JMPA 1R16A 1ZKMA 4Y6PA 5KJ6A 4B7UA 4N5MA 1HLPA 3VDQA 3PLNA 1A4UA 5T8KC 3OIFA 3VPXA 3ITDA 3PP8A 4CQLB 2TMDA 2HJSA 3D7LA 4FFPA 4EI2A 1U5CA 1F17A 5L4SA 2ZIZA 3WWYA 3K73O 3ZDFA 3LLVA 5A9RA 3ZN2A 3RFTA 4AJOA 1R4NB 2HAEA 4OAQA 2PR2A 5L51A 2VYVD 1V35A 1N7GA 2YQ4A 5KJFA 4K6CA 2UAGA 3C1TA 5T6BA 2J6IA 1IZ0A 3EW7A 3FBGA 3I4CA 2WDZA 3O8QB 5KIAA 4IINA 1JQBA 4AICA 1QYCA 2P2SA 1SB9A 1TXGA 2JD0A 4E2WA 2X5OA 8ADHA 2OXIA 5HS6A 4CMEA 1B14A 1N9GA 3GHHA 1PWXA 3TZHA 1Z7BA 3B1JA 3QVWA 1QSGA 1EUDB 3FBTA 1Y8RA 2OZPA 3U4CA 2PGJA 2ZATA 4J7XA 5KKAA 4ALKA 2PZJA 2IZZA 3BTVA 3U4HA 1UUFA 1B8PA 1X13A 5GY7A 4WOJA 4F6LA 3AJRA 5CEJA 1NPTO 2VRCA 4XX0B 3UICA 2W2KB 2B4RO 3IIEA 4FW8A 3BMOA 1PS0A 1XEAA 2WE7A 2EGHA 5TNXA 5CG2A 3OIGA 2AQIA 4R51A 1GQQA 4ND1A 4PLFA 1ZK4A 3DQPA 1R0KA 4TVBA 3WBFA 1HETA 2ZCUA 1VE9A 3FNGA 2Q99A 5A3VA 2GN6A 3FR8A 3ZWNA 1LSSA 4FOOA 2I9PA 3CXRA 3RCBA 4WEOA 1KS9A 1AHHA 1HE2A 1ZK2A 1EVZA 5DP1A 4PG4A 1ZEJA 3D64A 5CEEA 4CLOA 1EFKA 3DR3A 4MVJA 1YB4A 5L7TA 4DC0A 5JW6A 2NTNA 2FMUA 3ENNA 1B2LA 4EUFA 3QVOA 1E3WA 3MWDB 2XOXA 3AUAA 1QLHA 3GH3A 4G81A 2X4GA 5BQFA 2B0JA 2GD1O 2PFGA 4ALMA 5BSEA 3ZU5A 2AE2A 1GZ3A 3B1KA 3P7MA 3AWDA 2GO1A 1CERA 4JCOA 2IE0A 3JQFA 4RZHA 4D0SA 3PWZA 3WQRA 3RQSA 1T2AA 3ZWBA 5I7SA 1KERA 3JQBC 2J5KA 4U8GA 1IL0A 2J5RA 1CF2O 4GLLA 4AJ4A 2HDHA 4HP8A 1S6YA 3HDYA 2FSVA 4WCDA 4DBZA 1Y6JA 2HRZA 1ULUA 4CM6A 4FBGA 3OF2A 4HFNA 3JQ9C 3WGTA 5ADHA 3VPHA 5EIOA 4IS3A 4DC1A 3JQAB 2A4KA 4BO5A 4YQYA 2OOSA 4UVEA 3VH2A 1RM5A 4GKVA 4EJ6A 1Y8QA 4L8VA 4JK3A 3INTA 1VJTA 4NZ9A 4WLNA 4YRAA 2FPPA 5HA5A 3KM0A 2H5LA 4E30A 1HYGA 3LT1A 4AJJA 3I5MA 1OZAA 2FR1A 4D79A 3HSKA 3VPGA 4YVFA 5CDSA 5IDXA 4CM8A 4YT8A 5TLSA 2O3TA 4Y98A 1PJLA 1LNQA 1T1SA 1W73A 2D1YA 3INGA 4B3JA 2VNSA 2OBYA 5G0WA 4AJKA 1P1FA 4LVCA 4C7JA 2GYYA 1HL3A 1HDGO 1KEWA 1YWGO 2QYTA 3COSA 5H83A 3RUHA 1LXCA 2HQ1A 1XQ1A 4B3HA 3DBLB 1WXDA 2P9EA 4K26A 3Q9NA 2Z1NA 4TZTA 1YBVA 2GERA 4L74A 4WCFB 2YHUA 2ZKLA 4OYRA 4CR6A 4JROA 4B8ZA 3PZBA 2DC1A 1RPNA 4IQ8A 2VUTA 2D4AA 5B12A 5FEUA 4TRJA 1LRLA 4TVOA 4RV9A 4KTTE 1ZH8A 2CFCA 2B69A 3UFXA 5A3JA 3ZWAA 3MTGA 4XQGA 3LLSA 1YL5A 3OECA 1ISMA 5G0UA 3GFGA 4RF5A 1BXZA 3KYDB 4TRNA 4D41A 3FTPA 3QVSA 4X54A 1NAIA 1WP4A 2O3SA 5B1YA 2EJWA 2HJRA 2O7QA 2C20A 4QEDA 5DBGA 1WPQA 1O9BA 4RO0A 1YDWA 4QT0A 1KY4A 3FHLA 4KP7A 2O3UA 3WJAA 4XR9A 1EBUA 4O6VA 4RVGA 4CJXA 1J0XO 4YJHA 1XCBA 4EUHA 1O6ZA 1HE4A 1HEUA 2DFVA 2HMVA 3KXDA 3ZZNA 4CUJA 3ITKA 3VVBA 1W0CA 3RUIA 1ZFNA 4CV3A 3LT2A 4LSWA 1R4MA 1ZUD1 2BD0A 3DONA 1KOLA 1JLLA 2X58A 3HDQA 5A03A 4JNKA 1F8GA 1R37A 3GNQA 2I3GA 3UF0A 1A7AA 3AI3A 4BGUA 3ETGA 2EGGA 2YDXA 1ORRA 1GZ4A 4J91A 2YDYA 3T7CA 4CM4B 3ICPA 4XCVA 5TRTA 1ONPA 3L9XA 4J9UE 1LEHA 3VPSA 1DLIA 4L73A 1E1LA 3DBHB 4Z9XA 3ZI0A 1B0AA 1HT0A 2EJVA 2H9IA 4CQMD 1TI7A 4D45A 2VRBA 4UREA 1R0SA 2IODA 4ZVVA 1EUCB 4AJHA 2E37A 4JJIA 4HNHA 4Q9NA 4WUVA 4J6FA 2NVWA 4NNJA 4Q39A 1RM4A 3ANMA 2X9VA 1V6AA 2WTBA 5KJCA 1HDRA 1XU9A 3KYCB 3S2EA 3V2GA 2JKVA 3JTMA 2BF7A 1BDBA 4EZBA 4NDNE 4J3FA 4I9HA 5DCUA 5ILGA 5JXWA 1F06A 4CL8A 4FGWA 1GAEO 3CE6A 1R0LA 2NU7A 3KSZO 3OQBA 1E0DA 4JP3A 4BNVA 1Z6ZA 5A9TA 1P33A 3HFGA 4BOYA 3SJUA 3ZU3A 1NVTA 4I5FA 5EQDA 3TQHA 3GVPA 3QJ5A 4BO2A 4WLEA 1A9YA 2OMEA 1X15A 1BXKA 2DTDA 2HKIA 4BS9A 1U9JA 2YHIA 3DHYA 4XD2A 4KZPA 1O89A 3LT4A 1LLUA 1YOVA 4RZIA 2V7PA 4YR9A 4RDIA 4DQVA 5JS6A 3JQGB 1ZJZA 5LDGA 3ZWYA 5JO9A 2YHIB 3AOEC 4J49A 4NK5A 3OEYA 4TZKA 2ZTUA 2NNLD 3IDSA 1QKIA 3LQFA 3CKYA 1CQIB 1VLLA 1MB4A 1K0UA 3F5SA 5F5LA 3GGOA 3LU1A 4GAEA 4ND2A 2ET6A 2H63A 2VWHA 5JPIA 2WSBA 4JLWA 1AE1A 1LDNA 4RL6A 3UW3A 1N92A 2DKNA 2O2YA 1I2CA 4LISA 3WFIA 3H2ZA 1LSOA 4O5OA 3WSVA 1J6UA 3WR5A 5JY6A 4DLLA 3JQEA 1RJWA 4Z6KA 4OM8A 3S1LA 1UXGA 1E6UA 4MPDA 5T67A 3OP4A 3X2FA 1Y9EA 3HN2A 5CAEA 3WTBA 4DA9A 1YQXA 2WM3A 1H9BA 3HB5X 1PQUA 3PHGA 1FDTA 1DO8A 3I52A 4ALIA 3BTSA 1MGOA 4R4JA 1NFQA 1QYWA 1GFSA 4W4TA 4D46A 1CYDA 1CIVA 4Q3CA 4DUPA 4MP3A 2X0IA 5ILOA 4NBWA 2I99A 4RDHA 2DVMA 4RVFA 5DZSA 1M76A 1I10A 2Y67A 2JHFA 3MJ4A 3N7UA 2FWMX 3O03A 2GUGA 4CMHA 3OBBA 3DZFA 3L0DA 2POQX 3ZWWA 5F1KA 2CSUA 2X5KO 4I8XA 3FPCA 4WASA 3U62A 4G2NA 3UGKA 2R00C 5C7IO 1WWKA 4YXFA 3M1LA 2AMFA 1GTMA 5JAIA 4DYVA 4PZEA 1ARZA 3WLEA 4CMJA 3FNFA 4XQ9A 3QWBA 4BUCA 3ZWCA 4R1TA 4BNFA 3QP9A 3I9JA 5GZ1A 3WGGA 5L40A 1ZK1A 1DRUA 3C24A 4J1SA 1E1MA 5A1TA 3QE3A 5KVVA 1KY5A 4KOAA 5A5FA 1J5PA 2J5QA 2OL4A 2PK3A 3I9MA 4ALNA 1I32A 3E48A 2PGLA 1Q7GA 2DUUA 3G49A 2IZ1A 3G79A 3LT0A 1P1JA 3ZW8A 4WNIA 2ZTMA 5I7FA 2YZ7A 3BMCB 3CZRA 2QRKA 3WTCA 1MFPA 2NQTA 1HKUA 3NX4A 2B36A 3H5RA 1YRLA 1UJMA 3VC7A 2PKQP 3IUPA 1PZEA 4GWGA 4OOEA 5IDQA 5I8WA 1XGKA 5DCYA 4HXYA 1V0JA 3G1TA 4BMNA 3LF1A 1D8AA 2RIRA 3GPDG 2AQ8A 3TSCA 4D42A 5A04A 2ZJ0A 1I3LA 4WLFA 3DAFA 3WYCA 2W8ZA 5G2OA 2X0RA 2W4QA 4R1UA 5I7VA 4UVHA 4S1VA 2HU2A 2X22A 3FNHA 3BMQA 1L7DA 4YBZA 2CD9A 4PVCA 4E5PA 3PQEA 2B5VA 4GMGA 3RC1A 3M6IA 1H2BA 1U8FO 2CDBA 1ZSVA 4MVJD 1M2WA 5DDIP 2IDZA 4BIIA 1WLYA 1Y1PA 2VHWA 3EHEA 1D4FA 4E2YA 3UUWA 3IKVA 1B16A 1GCOA 2I66A 1EBFA 2FP4A 2JCYA 1Z82A 2O2SA 4DYDA 1E7YA 1XR3A 3MZ0A 4Q3AA 3WSWA 1B8VA 3VH1A 3F5QA 1V9LA 3DC2A 5IXSA 1Z73A 3RKUA 1ZSNA 4NHEA 3Q11A 1U4OA 4OQZA 3TZKA 1GQYA 4TKLA 1XU7A 4CMGA 5U4QA 4I1IA 1JDJA 1DRVA 3DZJA 2X5JO 3ZW9A 5BSFA 1H6AA 2G17A 4QUKA 5AXDA 4IJVA 1ID1A 2NVBA 1E1NA 1YO6A 2XXJA 5A9SB 4E5NA 4R3WA 4CLEA 2WD7A 2Y68A 2Q1UA 1N8KA 4EEXA 3PIDA 4KQXA 3K5PA 1ZZEA 2D2IA 5F1OA 4CMBA 5A4DA 3U09A 3RVDA 5F3RA 4GVXA 3SC4A 1KVUA 1DBVO 1I3KA 4LMPA 4Q3NA 4BNWA 1CDOA 3F4LA 2DUWA 2NADA 3N58A 3C8MA 4JQCA 3WQSB 3ZU4A 2YFHA 3IC5A 3K30A 4BNYA 4TROA 2EG9A 3OJFA 3UVEA 4FC6A 4PLYA 1TT7A 4Y9DA 4ND4A 1K3TA 4LCEA 3CMCO 4QXMA 3U0BA 5KTKA 1PS8A 2V6GA 2NVUA 5TQVA 5MDHA 2Q49A 2A35A 4KDFA 3C7AA 4EGFA 1YB5A 1SCUA 3BA1A 4GGOA 2W2LD 1U3VA 2RAFA 4IGEA 1B26A 1JW9B 1NTOA 2PWZA 5L7WA 1F0YA 3ASVA 4OSOA 5AQ1A 3FD8A 5GZ3A 1A5ZA 4ILKA 3PJFA 5DT9A 2ZB3A 2NU9B 4IDEA 1T2DA 2Y1CA 2GRAA 1V3UA 3TFQA 4GX5A 4JBIA 5FYDA 3RAJA 3WMXA 3DWFA 4JBHA 5LCXA 4D3DA 1SC6A 2GZ2A 1BW9B 4FJ1A 1H94A 2NTJA 3DEYX 5IAAA 5IG2A 3AI1A 4EBFA 1DLJA 1R12A 1PQPA 3L4BC 4XYLA 1LDEA 4I5EA 3ADOA 3GEMA 4BNKA 2A94A 2E6UX 4BGVA 2JFHA 1ADGA 3GZNB 3QA9A 1CEQA 1EE2A 2VTEA 1CQJB 1E5QA 2VHXA 1YS4A 1F12A 2Y1EA 4YRDA 1EDOA 1LRJA 2BGLA 4BKPA 5KVCA 2IEBA 1GPJA 1JU9A 4PLVA 3QVTA 4ROSA 3D5TA 1NNUA 3ZHBA 3DO5A 1ADCA 3HDHA 4W99A 4FSHA 4M8SA 4PG8A 2EP7A 1I5RA 3DOJA 4PLPA 2JFFA 3S2FA 1AHIA 1O5IA 5CDTA 1ENYA 3GZ4A 1CQIA 3RASA 3OICA 4CPDA 1GEEA 5JYDA 3NJ8A 3CZMA 4J7CA 3MJVA 4XB2A 2X23A 3PIIA 1BGVA 3EK2A 3RFXA 4IDDA 2Y99A 4J2HA 3NAQA 1E5LA 2JJYA 3NTRA 2Y1GA 4HFRA 2V65A 4BGEA 4XB1A 3L6OO 1U2DA 3ANNA 4DPMA 1XELA 3M2PA 4A27A 1EVYA 1V3TA 1JVBA 3FRJA 1ISIA 2GN9A 1LLQA 3C1AA 4OL9A 4ZICA 3WBBA 1NHGA 5KWEA 1K6XA 4E32A 1E7SA 2EEZA 2I76A 3PVZA 4MOWA 5FWNA 3KTDA 5THKA 5BR7A 1X7DA 4CV1A 3S2IA 4DRYA 1GV1A 1K2WA 4PLWA 3T4EA 2AE1A 4F45A 1PJTA 4YAKA 4L4SA 5DBFA 3WB9A 4CLRB 2DLDA 5K0ZA 1FF9A 2Z95A 3GUYA 4JGBA 9LDBA 4U5QA 1I2BA 4CL3A 1SZJG 1V3VA 2E49A 2WJPA 1SMKA 4XZ3A 3I6QA 2JCVA 2Q1SA 4NJMA 4PFJA 1P1IA 3UCEA 4CQMB 5IXYA 4YJGA 4NIMA 2X1HA 4D0RA 2PTGA 4EITA 5G4LA 3V1YA 4IIVA 3FSRA 1HYEA 3GNTA 4FR5A 1TLTA 1UXIA 4UUNA 1OAAA 3AM5A 4R1NA 1SEVA 1ZXBA 5KJ1A 4WE3A 3ROKA 2NACA 3F3SA 5ITWA 3WXBA 3PWKA 3L6DA 5THQA 1UP4A 4R16A 2Q2WA 2FR0A 4RQUA 4GX1A 5G4KB 4B4VA 5L3ZA 2EWMA 1IE3A 1I0ZA 1IB6A 2R6JA 4JX8A 5AYVA 2DPHA 1KVTA 4B79A 1FDSA 1I33A 3VDRA 5KVSA 1E3JA 3AU8A 5CP8A 3JYPA 3EUWA 3PEFA 4P22A 2NVUB 1WMAA 2C54A 3RJ9A 4FJ0A 1RM0A 2J3KA 4O0LA 5BSGA 2VT3A 1DHTA 3KEQA 2O3RA 1OOEA 2O3QA 4NFYA 4PRLA 4YRBA 3DZIA 2EKLA 1NWCA 4EJMA 4XRGA 4HY3A 2ZB8A 2Q1WA 1Y5RA 5JCXA 4RJTA 4J16A 1PJCA 2GGSA 3L9WA 4D3SA 2X0NA 3ABIA 3TN7A 2D0IA 3HADA 4RPHA 5DOZA 2Y1OA 5KVQA 4YAGA 1XSEA 5H81A 5COQA 3WOHA 1VSUA 4H16A 4R54A 1WAMA 1M67A 2Q4EA 1PJ3A 2Q45A 3RKRA 4RVHA 3E9MA 2FY8A 2GR9A 2YV2A 1TVEA 4Z9FA 3GEGA 3GG9A 3IUSA 4NJOA 4NQZA 4A10A 2RH8A 2ZYGA 4LSMA 2WYUA 4B8WA 1LBEA 3WGZA 3ZWPA 3R1IA 4ZN6A 5EPOA 1MLDA 3VZRA 4JIGA 4AJ1A 3I9LA 4OXNA 4BKOA 4W7IA 4C7KA 4R68A 4C4OA 3ONDA 4RPLA 4FD3A 3ZHXA 5AOVA 2PV7A 4ONEA 4BNMA 5U9CA 4RVSA 4JBGA 4K28A 1Y5MA 1WDLA 1EMDA 2VTDA 3DBRB 2FPGA 4YA6A 2JL1A 3RD5A 1XQ6A 3JQ7A 3VAZA 4XGKA 1YQDA 2VQ3A 1E1KA 3GUCA 5JFOA 2NQ8A 4CQLA 2C5AA 3ZWVA 4HFJA 1T2EA 4GI2A 1DHRA 1BMDA 4YAIA 2A9FA 4B4WA 3JQ7B 1NX6A 3TL3A 4CLHA 3H2SA 1U7HA 4J4TA 4ESOA 3GK3A 1UXJA 5EN4A 3I9NA 4IJUA 3OJEA 1DAPA 1QMGA 2DQ4A 1HZJA 3B20A 3RJ5A 5JDCA 1NM5A 3SX2A 1IYZA 1YONA 3WYBA 1W8DA 4J2OA 4ZGWA 4RF3A 2Q2QA 3UCXA 4YJFA 1GR0A 2RH4A 1N1GA 5ES3A 4MJLA 3H9JA 1ENOA 1EK5A 4XEHA 3WGHA 2E82A 3CPSA 1LSJA 2BGKA 2BRUA 2PNFA 4FJ2A 3ZGYA 1P45A 3RBVA 3GN2A 3GVIA 3KHUA 3QQPA 3X2EA 2XAAA 3L07A 1KC3A 1NP3A 1SBYA 5FF9A 4N5NA 2IZ0A 2UV8A 3AI2A 1B15A 2OP0A 3CIFA 3RUFA 1JKJB 1PJ2A 3EAGA 2FRDA 5TJHA 2VHYA 5IJZA 3W6UA 1JWAB 4LK3A 1PL8A 4W6ZA 4YT2A 3JQDA 4DL9A 4YB8A 1Y8QB 3F1LA 3WQQA 3OA0A 4GSKA 2Z5LA 1E7QA 1YH3A 5ICSA 4DTIA 4CM4A 3QIVA 4F3YA 2DBQA 1SNYA 4YEDA 3ST7A 1PGNA 4D43A 1OC4A 2F00A 1CETA 1PIWA 2I6TA 5JDIC 1GUYA 3TDKA 1ZK0A 2WE8A 3ZHYA 3WG9A 3GDOA 4AFNA 2PA3A 4BNLA 3MCVA 3WGOA 2HO5A 4H3VA 4J0EA 3AOEA 2RCYA 4J0FA 2HMSA 1ZMTA 4DLAA 2HK8A 2C7GA 3TOXA 3OJ0A 1DPGA 5JCJD 4UUMA 4BKQA 3KLMX 2WYWA 3RSHA 3HQ4O 3R0IA 1YXMA 1U3UA 3MJSA 3WIDA 4M55A 1VL0A 2NU6B 4DBVO 5EQFA 1ZIDA 4G5HA 1LLCA 3NRCA 3IAHA 3PLRA 4RVUA 5F1PA 3JQAA 3H6KA 4M1QA 9LDTA 3KBOA 5K6AA 4Q3DA 3TF5A 1ZNQO 3JD3A 1M66A 4IM7A 4U6SA 4YQZA 1EK6A 4RF4A 5TIIA 3EVNA 4LVUA 1WDMA 1IZ9A 4Z0TA 2XXBA 4ZQBA 1EFLA 1ONOA 2NSDA 3PYLA 2QYSA 3A4VA 2O4UX 3BHIA 4MP6A 1N5DA 3ZNQA 5C3MA 4DIFA 5JC1A 1BWSA 3B70A 2VYND 1C1DA 3PK0A 2QG4A 1SOVA 1PU2A 3K2BA 3WJ7A 4ZJUA 1TB4A 1P74A 5CPFA 5JCJA 3PRJA 5AXCA 4H15A 4NR0A 1IHYA 4ND5A 1Z74A 5TS3A 3A28A 4O1MA 3AY3A 3LC1O 1X1TA 2Q4BA 1DOHA 3DMTC 4WCFA 3STHA 3EVTA 4GL4A 1PJBA 3NT5A 3TOZA 3OM9A 4TSKA 4PIVA 2ZQYA 3QRWA 5HWSA 4W9NC 4P4NA 2NLOA 5IZCA 4NFHA 4F6CA 1LC0A 1EZ4A 2XPCA 2HUNA 4JXKA 2DM6A 3DFUA 1Z75A 1YB1A 3DXFA 3W6ZA 3PXXA 1Y81A 1YOVB 1GQ2A 3CEAA 3GAFA 4QFDA 1DIRA 1UP7A 4M49A 4A2CA 3I9OA 3H5NA 4YT4A 5A06A 3ICCA 3K2EA 1GV0A 1H6BA 2FR8A 2VRCD 5I9NA 2NUAA 4RPGA 3KB6A 1DXYA 2EV9A 4XJTA 1EDZA 4CMEC 5JY1A 4CUKA 1E7MA 4BB5A 1QP8A 2FPIA 1UZMA 5T57A 4OXYA 3B1FA 2PZLA 3H3FA 4IZIA 4FOSA 4R1SA 2WWRA 3F46A 2WEKA 3D0OA 1NWHA 3LC2O 1DEHA 5ER9A 2E48A 1NVMB 4FB5A 3BYZA 4ALJA 2V6FA 4HV4A 2B37A 1DJQA 1H6DA 1U2GA 4D3FA 1NHWA 4OKIA 1HTBA 3ROMA 1FJHA 3IJRA 1A7KA 3QWFA 4O59O 5A5EA 3JQ9A 1OBFO 1ONNA 2OORA 1GYRA 3WNQA 2RHRA 1HDOA 1WMBA 3KOUA 5T5QA 1YBMA 3EZLA 5JAQA 1BDMA 2YJZA 2PLAA 3S2GA 1NVGA 2UDPA 4HADA 3GT0A 4R9SA 2NU8B 2IYPA 4PLHA 1VJ0A 3V2UA 5CHEA 4CLDA 5JSFA 1BHSA 3VZPA 2GPTA 3VVCA 1E3WB 3LC7O 2G76A 1NASA 2EKPA 5G4KA 4QFCA 2O4CA 4OJNA 3ULKA 2QW8A 3KZVA 3MWEA 2P5UA 4YYZA 2B5WA 1SO8A 3WICA 3H9UA 4GPD1 3O4RA 3A9WA 3MEQA 3RC2A 4WLUA 3FWZA 3JQ8B 2OGUA 3VKVA 3ENKA 4BNHA 2EIHA 3WLFA 4YJHB 3CTMA 5KKCA 3NJ4A 5KJEA 1P3DA 3BIOA 4CQMA 5HS4A 5I7EA 3AOGA 3OH8A 4CM8B 3SLGA 4CLXA 1ZVMA 5CDYA 1A4IA 3JSAA 1H6CA 2FZWA 4U0JA 3MTJA 1BVUA 1MXFA 1KVRA 1Y9AA 1H5QA 3A14A 3OA2A 4HWKA 3DTYA 4J9VA 4Z0PA 4AJIA 3UFXB 3TNLA 4PGFA 1V8BA 3SXPA 4ZA2A 3BMCA 4XR4A 1KIFA 1PZGA 3JQGA 3ZU2A 4CMIB 1QV7A 2DFDA 1X7GA 1ZCJA 3SJ7A 1KVQA 2CMDA 3W8DA 1NYTA 2YFQA 4IXTA 4XKJA 3R3JA 4IJKA 3K9QO 4WK6A 2PGDA 2VZ8A 2VT2A 2EW8A 4R69A 1DIGA 4JJFA 3R3SA 1BRMA 3FCOA 3E03A 3MJCA 3HHPA 2X86A 4IDFA 1HWYA 1EUCA 1NPYA 2P68A 4JN6B 2DU8A 1WNTA 4BVAA 4YPOA 3A06A 1ISJA 3AUUA 2Y1FA 4O63O 4MP8A 3SLKA 1H9AA 2YV1A 5C37A 2Q1TA 1OMOA 3GN1A 1MUUA 2VN8A 1JKFA 1LRKA 2WD8A 4OQYA 4DMMA 2AQHA 2B83A 3RUCA 4ZHSA 4NU6A 1T26A 4BHTA 1CRWG 1Y7TA 4PLTA 1X0VA 1IULA 4BQPA 1GPDG 4E3ZA 1XA0A 4WECA 1DFIA 1YVEI 3DAPA 5FI5A 4LW8A 3C7CB 5BNFA 1P9LA 3NDJA 1UDBA 4CMKA 5KCZA 1MC5A 2SCUB 1BXGA 1HXHA 1VM6A 3DZGA 4TKMA 4MKXA 2HRBA 3GVXA 1GD1O 4IY1A 1VL8A 4FN4A 3OJLA 1VL6A 1E7WA 1HDZA 2CNBA 4PN3A 3AK4A 4IZHA 4B3IA 1L1FA 4HFMA 4KUHA 4NK4A 4BO9A 4J90A 1NQTA 2RHCA 3NTOA 2NUAB 1A72A 1U8XX 1PZHA 3W4KA 4CR7A 1LQTA 4IDCA 4NU5A 1KYQA 2CVQA 4GX0A 3D3WA 1ZXLA 4L9RA 2CF6A 1QG6A 1W4ZA 4FFRA 1MP0A 1H2HA 1KC1A 3OHSX 3QWHA 1MG0A 4UAGA 3H5AA 2C59A 4XIYA 4ZU3A 3UCFA 1K6IA 1LA2A 4KDEA 3ZV4A 2AW5A 1T1RA 4XDZA 3BTUA 3WNVA 4Z0HO 3GHYA 3GMDA 3OQ6A 3PYMA 4XGNA 2HMTA 4RVDA 1W6UA 4TRMA 4MIYA 4BO1A 1NQAO 5B4UA 5ER6A 3OQ1A 3VOSA 4IBOA 3QLJA 4LRTB 4CLOB 4BV9A 1X7HA 3EDMA 2DPGA 1IY8A 3DBLA 4B7CA 3BXXA 3GLQA 5HBRA 1YL6A 4A7PA 1Z45A 4BV8A 3WGIA 4R3NA 3GZNA 1OFGA 2GCGA 4BNJA 4Y67A 1O94A 1ZBQA 2ZB7A 5EMHA 1JN0A 7ADHA 2HCTA 2V6BA 3E5RA 4NG5A 3GFBA 2AQKA 3NYWA 3H65A 4EEZA 4B4OA 2BELA 4ZRNA 5EJ2A 3WDSA 3RC7A 3KEOA 4EW6A 3G17A 3L4SO 1E3IA 2EP5A 1P31A 4MKZA 4KTVE 2UVDA 3GOHA 1KEVA 2VWPA 1CWUA 2I67A 4P38A 5TGDA 3TJRA 4BNXA 3HFSA 1GZ6A 2GZ3A 3PDJA 3NTQA 4I9UA 4UULA 4CM7A 2G1UA 3UN1A 3KSUA 2PD3A 4P8RA 3RI3A 1YBAA 3HE3A 3PWSA 4BNGA 1O8CA 1NPDA 3HG7A 1A71A 1A27A 3C3XA 1UXKA 1C1XB 1G0OA 3EZYA 2P4QA 4J1QA 2PH3A 1LX6A 3D1LA 1ISFA 2JAPA 2VHVA 1XIVA 2QIOA 3UAGA 2PKRA 2G82A 5GZ6A 2X7HA 4BL5A 2UUPA 4PZCA 4XA8A 2RBEA 4Y6RA 5BNTA 2DBZA 2YQ5A 3WGQA 4BQRA 4GGPA 1R4MB 4DVJA 1GCUA 5EESA 3HWRA 4MVJG 1P0FA 1RYEA 3K92A 4P4GA 1D3AA 1E7RA 1MFZA 4CMCA 3I3OA 4A03A 1O95A 1UDAA 5U1PA 5B37A 3VZSA 2GLXA 3U4DA 3FN4A 3M2TA 3GG2A 4OKNA 4WLOA 4LMRA 4B4UA 1GADO 3D4PA 4I5GA 1TT5B 1SAYA 2H1SA 1IUKA 4BNZA 1JWBB 4ND3A 2WD7B 5KNLA 4OO3A 3H3JA 2Q2VA 1PZFA 4RGBA 3ZH2A 4BO6A 5HTOA 4NFSA 4MDHA 2NM0A 3KSDO 1RWBA 3PDUA 5COAA 3Q1LA 3Q2KA 3I9KA 3LK7A 4IXWA 4RF2A 5JAZA 5IZCC 1DFHA 4XQCA 2G5CA 5KOIA 1F8FA 3E9QA 3T7EA 4DMLA 4ZQEA 2DAPA 3BHJA 4DIBA 4UVDA 1CJCA 2FPIB 1I24A 3PJEA 3DTTA 4EJ0A 4AVYA 1LLDA 3BMOB 3CSDA 4MVJF 1YKFA 2OP1A 2ZTLA 2F1KA 3EY4A 2W2KA 4XJSA 2C07A 2IRWA 5IDYA 1O0SA 1QYXA 2ZYAA 4NI5A 1KEPA 3A1NA 4IS2A 2Y1DA 2YYYA 3SBOA 4KMSA 2VOEA 4A5OA 4R5HA 3ZNNA 3R6DA 5JO0A 4K6FA 5JDIA 2VOJA 1H93A 5JYEA 5CEFA 4JP2A 4PCVA 4U0KA 5EERA 1EQUA 1Q7BA 1N9GB 3TZQA 1JKJA 3F4BA 4WPGA 4E12A 3ADPA 3PQFA 2C2YA 2BFPA 2Y05A 3NUGA 3ZHZA 4J1TA 1HZZA 6LDHA 1U28A 3MJTA 3MOIA 4L76A 4BKRA 4E21A 1GEGA 2GDZA 2NU8A 4L4RA 4CM3A 2PZMA 3NGLA 5EINA 2BFOA 1HF3A 1PL6A 5CFZA 4CLRA 3E9NA 4G65A 4W7HA 5ITVA 2Y0CA 4OMUA 4KUEA 3AFMA 4YAEA 4MKRA 3TRIA 3JD0A 4FFMA 2AG5A 4L75A 3NDRA 4RLHA 4I08A 1I2ZA 4E31A 1YJQA 4A0SA 3JQBA 4P4LA 1E92A 1QLJA 1JAXA 3JQFC 1LDMA 3G3EA 4Z9YA 3B6ZA 3KRTA 3PHHA 1SPXA 2YV3A 3DZKA 1T2FA 3P5SA 2Q50A 4UVIA 3VTZA 3ONFA 2GN4A 1K6JA 2NWQA 1LSUA 2X9GA 1WW8A 3DBRA 4NBRA 3KYBA 2P4HX 2BHLA 3PHJA 2ZQZA 2BI8A 2PH5A 1FXSA 4CV2A 5F5NA 1AXEA 1EEHA 1X0XA 3AY6A 2FSSA 3ZNOA 1SOWA 3LSYA 2DBVO 4DWVA 3W1VA 5JMWA 3IP3A 3V1UA 2I65A 2CVOA 5DN9A 3PJGA 5L45A 5LC1A 2UUOA 4PG6A 1PGQA 3Q9UA 1J49A 1MG5A 2GASA 5CDUA 4RORA 1M6HA 4Y6SA 1ULSA 2IXAA 3GC6A 1UH5A 1DIAA 3GGGA 2CVZA 5DP2A 5L9AA 4D7AA 3LDHA 1YE3A 4TMFA 3L6EA 5CG1A 1NAHA 3PYXA 4PZDA 4URFA 2W98A 3H8VA 5I9MA 3I23A 4FPXA 4DQXA 1DJNA 1IPEA 3FTNA 2QX7A 4OGWA 3F9IA 4WOKA 1Y8RB 5IN4A 1RYDA 4GSLA 1ADBA 4J43A 4YJFB 2TMGA 4N5LA 2AXQA 2DTXA 3BTOA 5DOVA 4B7XA 4E6PA 1FDVA 3FR7A 3RROA 4XX0A 1P77A 2EF1A 3PJDA 3RWBA 1ISHA 4WGGA 1UXHA 2VCYA 2DBRA 3QVXA 3SEFA 1PEDA 1PTJA 3M1AA 2AEJA 3H9QA 4WNCA 4I9NA 4CR8A 2VZ9A 3JQAD 2EERA 4N18A 4GVLA 2BFMA 3F47A 1BSVA 4BO8A 1B7GO 3GDFA 3RUEA 3ZWOA 1TEHA 4OH1A 3HNPA 4L4XA 3MWEB 4MINA 4QECA 4NBVA 1G1AA 2YY7A 3GR6A 3I6IA 4RPJA 3NT4A 4GQAA 1VC2A 2GN8A 4OHUA 4I5DA 1DB3A 4S3MA 1SCUB 1U3TA 1VKOA 1JLLB 1NQOA 3GAZA 5ICMA 5G0SA 4YCAA 3Q6IA 1PJSA 2Q3EA 4NMHA 1XLTA 1GUZA 3GRPA 2E4AA 4XRRA 2ZB4A 1EUZA 3FF4A 4DLBA 2XF8A 2G0TA 4DIOA 4IDBA 4ZQFA 4R41A 3I4FA 1QV6A 2JHGA 3F1KA 1R66A 2J8ZA 4BGIA 4YAJA 4EYEA 3K6JA 3C1OA 3E18A 2NTVA 3KLPX 2DT5A 3CUKA 4PLZA 3JQ6A 5TC4A 2R00A 3CINA 6ADHA 2JD2A 2Y0DA 3IMFA 4PG5A 3QSGA 2CDAA 1PR9A 1E6WA 2FOIA 5G0TA 4BO3A 3IOYA 1DFGA 5A9SA 2PD4A 1YJ8A 4YT5A 5K6AC 3IL2A 1XG5A 1U1IA 3AW9A 1MX3A 5LDHA 1PQWA 1AUPA 1U3WA 4XYGA 3PHIA 4M54A 3BMQB 4IDAA 4DGSA 2HK7A 4E5YA 1T24A 1F14A 5DNAA 2HMWA 4ID9A 3EMKA 2PY6A 3IJPA 1K5HA 3OEWA 4M89A 1D1TA 3I83A 3BMNB 4N54A 3SC6A 4BB6A 4IGFA 5L7YA 1NFFA 2OUIA 3U4IA 4UVGA 4CM5A 3KV3O 1PGPA 2H6EA 5T64A 2ILTA 4BNIA 1PL7A 3DBVO 2Z1MA 1C1XA 5H82A 2OO5A 1Q7CA 3BMNA 1QORA 3ZV5A 2C7VA 4QSMA 5COBA 5JE8A 4BMVA 4A26A 1MA0A 4ZQGA 4YDRA 1I30A 1PR3A 2VYVA 4QO8A 3RU7A 1J4AA 2YUTA 1C0KA 1NR7A 5TJ9A 5IZ4A 3E8XA 1ADFA 3VZQA 4M87A 4E13A 4H7PA 2ZJ1A 4U6QA 1PX0A 1FDUA 4HUJA 3W8EA 2FPGB 4YJGB 3K8ZA 2I5PO 4E4YA 1DRWA 1C3VA 1VSVA 1YQGA 4IPTA 4Q3BA 3AU9A 5CPBA 4BKUA 5I8ZA 1PSDA 1VI2A 2O23A 3AM3A 3U5TA 2HSDA 1NQ5A 1FDWA 3U49A 2X0JA 1ENPA 2FZEA 1ZMOA 4NPCA 1X1EA 3D5QA 4DQUA 3PTZA 5F21A 3IQDB 1N1EA 3VH3A 2LDXA 4XYBA 4A73A 5C7LO 3JCZA 3PQDA 3GVCA 3KYCA 3W4JA 4W82A 3QV1A 4BMSA 3ROQA 3P2YA 3VKUA 1I8TA 3PI7A 3RU9A 1P1HA 3KVOA 3T4XA 1JAYA 1WZEA 2W90A 4GKBA 3MOGA 3H7AA 4ITUA 3OIDA 1Z7EA 4MVJI 1B8UA 3PGJA 4AL4A 5IDWA 2FP4B 3JYNA 3GRKA 4J4HA 3DMTA 3GVHA 4WCFC 4IJWA 5ENDA 2BH9A 4LCJA 3JV7A 4AJNA 3ROPA 1UAGA 3DBHA 1LQUA 4WJZA 2WMDA 3QHAA 4ZRMA 3WGYA 4CM1A 1Q0LA 3GDGA 5A02A 2OFPA 2VYNA 1VJ1A 4LGVA 2BI7A 2P91A 5C5IA 1E3LA 1Q2XA 4BNNA 1U7TA 3JYLA 4KWIA 4JJGA 3LYLA 5L4LA 1DDOA 2IXBA 2O7SA 2D59A 3AFNA 1EVJA 3JYOA 3PFFA 2PZKA 1DC5A 1WDKA 2X6TA 1KBZA 3O9ZA 3UOGA 3Q2IA 1TA4A 1G6KA 4EDFA 3AM4A 3G1UA 2QRLA 4QQRA 3ZV6A 1DC4A 5CAEB 3H9EO 1M6WA 1DAOA 1UR5A 4IMPA 4PLGA 5FFFA 3IP1A 4Q3EA 1LU9A 1EQ2A 1ZSYA 3FNEA 2C0CA 5AXAA 4BO4A 4EUEA 1ZK3A 3DFZA 1CQJA 3H9GA 2GF2A 1B3RA 3EGOA 1DIBA 3AUSA 3HZZA 1G0NA 4K9DA 2GNAA 4BNUA 2NV6A 4ALLA 1HDCA 2J3JA 4IQGA 3W4IA 1NXQA
chains in the Genus database with same CATH superfamily
4BDTA 1GZHB 2ON6A 3FYHA 3G9TA 1SVOA 1GL6A 3GIDA 3Q7TA 2GNPA 4NAHA 4P4SA 3PHLA 4GX2A 4A2WA 4F9TA 4UCFA 1EUQA 4QUGA 4GM0A 4AJEA 3DE3X 4QOIA 2YHBA 1V4VA 4B83A 1RHQA 2VPQA 1NFRA 4CODB 3HVIA 1UKCA 3G2IA 2VRWA 3C7DB 1WBJB 1P2UA 1DC8A 3ZVRA 4IIUA 5LOVB 1SB8A 2OE2A 2BKEA 1QHEA 1XWFA 1OHHD 1Z0KA 1JE0A 1OC2A 4RHCA 1TJ5A 4E5MA 1RKQA 3OHMA 2I3AA 2WNHA 3WYEA 5AHKA 3W8FA 4OPMA 5CFRA 3NCTA 2ZM5A 4KOEC 4BQFA 1UBHS 4PC2A 2FZGA 1OV6A 2CLSA 4S2UA 1F9EA 3DFMA 4PHFA 1ZUNA 2NT4A 3A3PA 3G8AA 3DOOA 3DZBA 5CGZA 1BTOA 1M33A 2AEMA 2ZRIA 4TTIA 4YACA 3SIPA 2IYXA 4NLLA 5CIYA 2C2WA 10MHA 5HCUA 2WFZA 3EGEA 4KAAA 1MKYA 1LW6E 2O2EA 1SHJA 4HDRA 4L2IB 3UH1A 1K4MA 3WLAA 1GY8A 4JHLA 1C80A 1AN0A 3I8SA 4F1WA 1D04A 3TQCA 4P86A 5K0SA 4H18A 4MRMB 1FS6A 1JT2A 2J48A 1LB1B 2PCJA 4EB3A 1UBFA 1UZNA 2YW9A 3LY8A 4R9NA 4HGRA 4LF7B 3GY0A 1W5BA 1SCQA 3DHVA 2OGZA 1GARA 2CSXA 3TRJA 2CJXA 1QR6A 1Z4MA 1MC4A 4YTEA 3WMGA 2QN1A 1N2CE 1EVLA 3H11B 4UCWA 1HNNA 1U7ZA 2YMPA 3ANLA 4N0MA 1DSSG 4ZOAA 3G0HA 5BN1A 1WB5A 4RCVA 5JJ5A 4ACAA 2XODA 1ISPA 2W6JD 3CT6A 4MR9A 2BGNA 2ZIVB 3AVOA 3MN1A 5DF1A 2WUVA 4UZSA 5A6SA 3QWAA 1GA1A 2DF8A 3BD7A 3VOBA 1E9DA 3INRA 3TMAA 4QUBA 3QU7A 1C1YA 2AA3A 2EXXA 4FQ8A 4HB3A 3E2PA 5EHZA 4PPGA 4KR7A 1UOQA 1JDVA 1P1RA 1ZGCA 1BA3A 4CV0A 3GLHB 3QVMA 3NM4A 2P2NA 1PYDA 4CVNA 1USUA 3RS4A 3T7DA 4LFBB 3P2EA 5EKXA 4RACA 1IZZA 1V9SA 1O2DA 2VUHB 2HHLA 1SOMA 3A1TA 4Q15A 4QICA 3QW2A 2V6MA 1PL0A 5DM1A 3W3AD 3HUDA 3R6GA 3HL0A 3NORA 4WKNA 1SC9A 2GPWA 1MIOB 1NDQA 3GJ5A 4JMPA 1QO7A 3M89A 5TSDA 3SE0A 2VNAA 1KU0A 2VYCA 4GT1A 5YASA 1O7JA 2ZRQA 4RPCA 2BTQA 2RDMA 4J1TC 3ORRA 3PU6A 3ZE2B 2JZNA 1JTVA 4PX2A 4GMDA 2QX6A 4N40A 2WWWA 3USES 1UP6A 3WLNA 2B5OA 3U4QA 2EKDA 4M8NE 5LYJB 4JHXA 1R64A 2QQGA 4UUOA 2ZT5A 7MHTA 3P9KA 2A6PA 2Z30A 1L2TA 1G98A 5LQDA 3UJDA 4TTAA 1MD9A 4DRXA 2CCKA 4XVUA 2OHHA 4HATA 4KQWA 4RJLA 5HQJA 3U3XA 1GSOA 2F17A 2MSNA 3NHWA 2RHOA 3OZ7A 4I9FA 2RHDA 2J7PA 4KQ2A 4JIMA 4B40A 2HK9A 2P0EA 3BJZA 1QYDA 4DMKA 4Q24A 1DUIA 1O94D 1ODJA 4FMDF 5G0VA 4NBTA 4KXXA 3IVMA 1GFWA 4LBWA 3M7IA 4OFBA 4R2XA 1SBHA 2OCPA 4NY1A 5D8DA 2J0QA 3VPBA 5K8LA 3LX8A 1AMOA 1E63A 3QTBA 3QEKA 3UJCA 4DREA 1JWLA 2LXNA 2Q28A 3F96A 3KETA 3RIHA 3UUEA 1FFBA 4A6EA 3H84A 2QBYA 1KR5A 2IBSA 3BREA 3UJ7A 4N48A 2BAGA 3B51X 2AX4A 2FG7C 4RK6A 2X0EA 3UJBA 1FP2A 2HMYB 4K9QA 1G4AE 4F46A 3IP7A 3I5AA 3L6RA 4KK3A 4U00A 5JNWA 5JY6A 1KVSA 2Q9UA 3CWCA 5PGMA 3OQIB 4YRKA 3P94A 3IEKA 5BSHA 3G0OA 3F5MA 4OMFG 4RFVA 1SVNA 3DD1A 2VUSA 1TEVA 5T3UA 3TQRA 4QTZA 3L93A 2ETXA 3H18A 5IMSA 4Q6WA 3UWKA 3FNQA 4E7OA 5F7JA 3MRXA 3GLVA 2O7RA 1FRFS 4BLTA 4C3OB 2QKYA 1VG9B 2JFGA 3RV3A 3FJYA 3O1JC 3NWPA 2IHNA 2ZRAA 1AZSC 1Y8AA 1PJ4A 2QZ9A 3DJFA 5TE9A 4KWHA 3UB2A 3OPVA 2HNBA 4PPQA 1DCKA 1KEUA 4B81A 4ZTZB 4V24A 3MRTA 3COYA 1VQ1A 2ZJ8A 4J0DA 2XDYA 1RE1A 2ZK7A 2BKLA 4DXHA 3VH4A 2HLPA 3PZRA 2C2XA 1CJTC 2VXCA 3CEHA 5HZHA 1KDTA 4R2KA 1XTQA 5E7IA 1P7ZA 2JVJA 4RKWA 4NULA 4NYJQ 2WWYA 4YCCA 4E08A 3NWJA 1R4NA 2D0PB 3DLCA 2EX1A 2PYZA 3RUDA 5HG0A 2IDKA 1ZAYA 5ALOA 2IQIA 1TYEB 1PGOA 2BR5A 2A8YA 4FT2A 4QUAA 1SQSA 5JNLA 1X3LA 9ATCA 3QU5A 4HYQA 4KPEC 1QKKA 1TECE 1Z34A 4IQ0A 4LQLA 1H5UA 4PV7A 3PD0A 3OD1A 4PAOA 4IMRA 4Q12A 4RZQA 3D3QA 4WLVA 2GAIA 3ETCA 2WWVD 2GILA 3F90A 3ZDRA 1E2GA 1TVKA 5GP1A 2VWQA 1HE5A 2GTHA 4BDSA 3C3WA 1A9QA 5JT1A 1P4SA 1ZEMA 2RHMA 1VHLA 2Y8EA 4JEIA 5B4VA 2Z5FA 3VO2A 4JLVA 5PNTA 3OCCA 1L7MA 2IF2A 3BEOA 4FEGA 4GWKA 2VZ0A 2YIJA 2FA9A 2VHZA 4R8KA 1VLJA 4W8GA 1E3EA 1WUTA 2FEAA 3KYDA 5C1OA 1YT5A 3JRWA 1DCFA 4TQ9A 2ZRGA 4PZ0A 5LB2A 1DRKA 2CWWA 1XZMA 1W8IA 3FCYA 1HQDA 1OBHA 4B7ZA 3GB9A 4D57A 4OBBA 3VMMA 3SC3A 1BXGB 2JFUA 4LA4A 3W6NA 4X7PA 3OMWA 4KXMA 3D4NA 3FKJA 2QHXA 1AQNA 4AWBA 2H2WA 4TOIA 3U4MA 3P1JA 4HX5A 4PLCA 4R8LA 4R5MA 1NV9A 4G09A 4E5KA 1KQNA 4CFYA 1LTHR 1BCSA 2BISA 5ED0A 4H1WA 1HDXA 2IYLD 3A0RB 3KR9A 2ZYDA 1R15A 5C8YA 1GN9A 3GPLA 2WFAA 3DPUA 5L3SB 3RQIA 1YGYA 2NU9A 1M6VB 4DPKA 3D8TA 3UWMA 2WIGA 1NW8A 3EXHB 3W78A 3BQMB 3P9ZA 4HLCA 4DJTA 2AHRA 3N86A 4F60A 1XYYA 1WKVA 2JFBA 5M29A 2FN3A 4CUZA 3V6LA 3KKNA 3VHRA 1Q83A 3M3DA 3QVVA 5K0TA 2ZS7A 2PYDA 2PVCA 4JLBA 1LGYA 5LZ7A 1MX9A 4PE5B 1HSOA 1P2FA 2NN3C 2ZBVA 4UM5A 3K1AA 3LT5A 4MQMA 3JR7A 3HHEA 5L95A 2IS2A 3AFOA 2YS6A 2ZE8A 5AVKA 2HFKA 2YJ3A 4OOFA 1IQ0A 2QRJA 4PGHA 2W2MA 1SUFA 3AESB 3FI0A 3JYQA 2FN7A 1JTFA 3H5OA 4M9ZA 5KOHA 1HRDA 4NCKA 1TLLA 2JNWA 2OM6A 5EL0A 1RQXA 3EGXA 3QPVA 1R27A 3UAOA 3UAXA 1M34B 4XWYA 1YZTA 3FX2A 1S7CA 3OMLA 1QS0A 1C1DB 1JTEA 4U7WA 4WACA 1Y80A 1R6DA 2NU7B 4WI1A 4YRQA 5DYIA 3UHJA 5FWAA 1ICIA 3DC7A 3PPXA 4FWTA 2Q4DA 4N6GA 4QHYA 3BG5A 1VHQA 1VE5A 2BKAA 3JD2A 3WWDA 5IEBA 4LE0A 3PRKE 5ESRA 2PS1A 4LXTA 3WWZA 2IEYA 4FC7A 4EVSA 3VGPA 4B3FX 1RMYA 3KZNA 4D9JA 1FLNA 3O38A 4OUDA 4UM7A 3OVMA 4F7WA 3HN7A 1E89A 1K1EA 4CM9D 1N7HA 4B2LA 8LDHA 3BKWA 1J1ZA 3NHZA 3V1LA 4B87A 4BEBA 5CIQA 3IMEA 2EKQA 3MJEA 1R16A 4AL4A 1V71A 4TXNA 1QIHA 4N5MA 5D3ZA 5AO9A 1MO5A 3WL8A 1XTIA 3B53X 2CHQA 2PH1A 3S1AB 3SVLA 2VPPA 3JWHA 4LQ4A 5CUQA 4JKIA 2HX1A 3D7LA 4MR8A 1U5CA 1F17A 3JWJA 2C7RA 1P73A 3WWYA 4JITA 1XROA 2XKKA 2FOXA 2NYRA 3L4EA 2WZBA 3LLVA 3N0WA 3IBFA 3RFTA 5B7GA 3BIXA 2QR5A 4Y1EA 3EQ6A 3K5HA 3GBSA 3B3GA 5EUMA 1MC1A 1QOQB 4KVGA 2X14A 2I2CA 2PJRA 1CUSA 1J90A 5KJFA 4K6CA 1QPBA 1ZOOA 3QXHA 1ISSA 1KI9A 2J6IA 1RKBA 2J4DA 4HDCA 2W2NA 5T6BA 4ZJPA 1BE8A 1OTXA 1TYCA 3CF2A 2C5FA 4GOMD 1A9TA 1Z9BA 3AETB 4U2KA 2JD0A 4GQBA 1SU8A 1UPCA 5HS6A 2KQUA 2Y1XA 2VZEA 3K4PA 3L92A 4QYIB 2ZKIA 3GHHA 2N1BA 3TOCA 3ZLTA 5M34A 2PQ6A 2ZXEA 1Z7BA 4K7JA 4MW1A 1HA3A 4RHEA 4G0MA 1NLZA 2ZBGA 4HNRA 2P9BA 2PZEA 3FOEC 3T0IA 5CT6A 4FHDA 4RD0A 2PGJA 3FOWA 3U4CA 3UJAA 4BN0A 3I1FA 3C3AA 3U4HA 1UUFA 2ZIFA 4NYIQ 4MUBA 2CNNA 5GY7A 3AL2A 1Z25A 1XTKA 2GXQA 4WOJA 4JXJA 3A6FA 3AJRA 4M46A 4XX0B 1NKSA 3UICA 2B4RO 2IY9A 3A9TA 3QVLA 3DMFA 3IIEA 4JI8B 3HYRA 3DV0B 8MHTA 4HDNB 3BMOA 5KB3A 1X8JA 2CBXA 2EGHA 1UDWA 5TNXA 3MIIA 2P2ZA 2ZYWX 2DKOA 4NZMA 4ZHQF 2AQIA 2J45A 3HZRA 2IZ5A 4BAZA 4ND1A 3GGDA 4QM7A 3DQPA 3VSAA 3RGWS 1B6TA 1NBEA 1NT2A 1WULS 2FWPA 2B4YA 5LM3A 3TLGB 4CYMA 3VC3A 2XKAA 3B6JA 1EFRA 3FNGA 4QDUA 4B7AA 5FYQA 3UAYA 3ICQB 1YZGA 3FR8A 5FOTA 3IKLA 1AKVA 2GCEA 1WF6A 3AIKA 4FOOA 4IXMA 4M22A 4XAQA 3QLEA 3E3LA 2AHOA 1FSSA 1DXOA 2HEIA 2PU7A 1AD2A 3MXOA 4N03A 4URHA 4YMHA 1G64A 2V7EA 4PG4A 1B1AA 2HQBA 3P0RA 5CEEA 1ZMRA 3N8NA 3D3NA 3DZDA 4BRUA 1RLTA 2JLBA 2FMUA 1B2LA 2HPAA 4EUFA 4B31A 1K6MA 2X3FA 4H7HA 2XOXA 3MWDB 1QQ5A 5HTKA 4N39A 2PSJA 4IKPA 2B34A 1Z28A 2B0JA 2F43A 2RK4A 2VSQA 4UTVA 4YUYA 5BQFA 1GPYA 3ZU5A 1U9IA 1WV0A 3TB4A 4AO7A 1PZMA 1GZ3A 2P2GA 4R83A 4LKRA 5CJPA 4RA6B 4YRRA 1CIPA 1FPQA 2GO1A 2QMYA 3D6NB 4J6EA 5FP0A 1I6MA 3AEXA 3IT0A 5HR5A 1JFSA 1GZSA 1JS1X 3RQSA 1PFUA 3ZWBA 2I1QA 2A0KA 4DUYB 1QP0A 2SECE 3H19A 2JI8A 4U8GA 4C06A 4D4HA 1IL0A 1BCSB 2HDHA 1YB6A 5BR1A 3MJDA 3EXEA 4GICA 5ALWA 4BQIA 2YFYA 2FZLA 1RYMA 4DLWA 3CS3A 3F98A 3RH0A 2ISSD 3LPNA 4G0ZA 4WCDA 3CZAA 2ZIAA 1DQPA 3OF2A 2V7VA 4HFNA 3KEMA 5HKLA 5LUBA 5C8VA 3L7CA 3L40A 4IVQA 1BVHA 2OV8A 4RELA 3CG0A 1Q12A 2C5BA 4IS3A 2WA1A 1ILWA 1FTYA 2BOVA 2CMKA 4N3GA 2A4KA 5AHRA 1SELA 5H9VA 3SS9X 4PPYA 4HUQB 2FPMA 3KVVA 2FTKE 1U80A 2XB9A 5F3DA 4BY9E 1RM5A 1G1MA 2FQ1A 4EJ6A 3HXQA 1CP3A 1RRMA 3INTA 3O47A 1RHKA 1KA9H 4NS1A 3DYBA 3P52A 3UH0A 1AQIA 1DAGA 2FPPA 4L7QA 4FEEA 1NUAA 3AUJB 5D3QA 3KM0A 2W2VA 2D13A 2H5LA 3AR3A 3PUVA 4TQAA 3LGAA 4WXEA 5DHAA 2CEKA 3T4UA 2QQEA 4IIHA 3D6UA 2FR1A 5KYUA 3AJDA 3VI4B 4QTYA 5D2CA 1SCAA 4X8OA 5C31A 1X94A 3LTNC 1K9SA 2J9FB 1J9EA 4B3JA 4EVRA 4B5KA 3HABA 3GJ0A 4IIJB 4NFLA 4P5EA 1T8UA 2GYYA 1YWGO 5LP6A 5KS2A 1YJ5A 3FJOA 5TARA 5JS2A 2TYSB 1AMNA 4MQ6A 1Z5NA 3PR2B 2GM4A 1WXDA 5EHQA 1ID8A 2OXEA 1E2KA 2MSEB 3L8YA 4N7MA 1ECPA 2Z1NA 5DMHA 4Z1MD 2EX0A 5IJXA 1YBVA 5J3JA 4L74A 2HLDA 2ZKLA 4OYRA 4CR6A 2Q5EA 3GO4A 2P78A 3SR4A 4N49A 4DNPA 4LIPD 2PLNA 4ZYZA 1X38A 3ESDA 1RPNA 3M6FA 1T9GR 4RYLA 2YWHA 1SD1A 1XAGA 2C1EA 2VHEA 5CVVA 3REQA 5FEUA 2ZFUA 5G02A 3CHYA 1KARA 1LRLA 1OW3B 5ILQA 3WNBA 4RKFA 3VR3D 4CFZA 1A50B 3ZWAA 1DBWA 4Q9LA 3MTGA 4XQGA 4OHRA 1H2ZA 1IUOA 1ISMA 1NQUA 5BSUA 4A8JA 3FLAA 1RQLA 1V2GA 4HN4B 4XD7D 4KLAA 3VJRA 4B71A 4H59A 2KBFA 4X54A 5DLDA 3L4KA 1WP4A 2FF5A 2O3SA 2RH9B 1BGXT 5DBGA 3FRHA 3P2IA 4MYSA 1RXWA 1O9BA 1O5TA 1MZVA 1WHSA 3QXXA 4HAZA 4KP7A 4UHBA 4MDFA 5IJAA 1GVHA 1R6UA 3ERCA 2Q7DA 2QRPA 3GBPA 1J0XO 4RVGA 4CJXA 2QZJA 1XCBA 1R6VA 3OE7D 3W5UA 3CCCA 2D7DA 4MYCA 3DE1X 2BFEB 2AXEA 5B55A 3ZZNA 3KXDA 3ESRA 4HRXA 3Q10A 1W0CA 1QDLB 1ZU5A 2O05A 2PGXA 2ZRJA 1H1LB 2GHIA 1ZFNA 4DG5A 4TSFD 4LSWA 4RHTA 3NIBA 4UBKA 4C6SA 2BDUA 4EKEA 3FUUA 3HDQA 3V8QA 1ZRMA 3MT0A 1AUXA 1F8GA 3EZXA 4GPEA 4HWGA 2OFWA 1Z5VA 5D87A 1EIWA 1WCXA 2QVCA 3UF0A 1S02A 1A7AA 1K98A 3ETGA 2WKWA 3EBLA 3FJ1A 4HNVA 5TQ0B 3T7CA 4HGOA 4JL8A 1P8AA 1GG2A 4I99A 4LCBA 1YTLA 4C20A 1JHPA 2HEGA 1J09A 3ONVA 5KDLA 3PQCA 3L9XA 1LEHA 1WTAA 3DLPX 3O74A 4GPBA 5DM0A 3DBHB 3HBMA 4WT7A 1FMJA 4NL4H 1XA4A 4P3YA 3HS3A 3DOHA 3T5CA 3Q8XB 5IKMA 2FLVA 3DNMA 3KOMA 1HT0A 3UKDA 3ZTWA 3IESA 1TI7A 5AK5A 4C4ZA 4F97A 5HVNA 1JZTA 4L3VA 2VRBA 4KB5A 2IODA 4YALA 4ZVVA 3LL4A 3UMVA 4I7EA 2E37A 2C5HA 1C0EA 3LJKA 5ALNA 4AJHA 2GK3A 3M83A 4Q9NA 2WT9A 3VAYA 4J6FA 3QHPA 4FSXA 1P5RA 3WIOA 5F7OA 2XJ4A 4KACA 2QJFA 4FK8A 4LNUA 1V5EA 4F1JA 3ANMA 1KHTA 5KDDA 2WTBA 1GKYA 1D2CA 4B6QA 1DARA 3KYCB 3UJ9A 2XVYA 1YJAA 2JKVA 3JTMA 3W1EA 5LBTA 1WUHS 3H5LA 5AESA 2JARA 1IH8A 3HJBA 3K05A 4UXIA 2NAPA 3K3PA 4ZOQI 5AUOB 1DAHA 1CEEA 3SJAA 3K0CA 1YR2A 1WCIA 5ILGA 1T2VA 2VDJA 1C1HA 2NSJA 3EGXB 3C3YA 3PEEA 4J3JA 4CL8A 4OGKA 1UM9B 2B2CA 1TC1A 3RG8A 2JG3A 1M0SA 2LIVA 3F6BX 3HB0A 1LFDB 5I8PA 3MJHA 4B3SB 3CR3C 5IKOA 2ZYUX 3EQZA 2QTLA 1P33A 1CJSA 3HGTA 2FMIA 1FY2A 1ZHHA 1JEYA 3TQSA 1NVTA 4K9PA 2YMMA 4LYFA 1QTIA 5EQDA 3ZBQA 1UC8A 2OCDA 3QJ5A 5HRAA 1G3IA 2HKIA 1VZ2A 1X15A 3TEFA 2DTDA 4BS9A 2JKZA 1X92A 1I51A 3KLOA 3V4OA 4ARZA 2BHNA 4O4LF 2FZCA 4LUCA 4RZIA 1CZHA 2A67A 1VXOA 3TTUA 3O8BA 4NZPA 2OYRA 4BX8A 4BFXA 1D6MA 4DQVA 2R9VA 3ROEA 3T1NA 621PA 2ZG6A 5JO9A 5JJIA 2LCFA 2VI5A 3OLXA 1T1IA 5CD1A 1H8HA 2ZTUA 1RDFA 5IVIA 4Z5XA 1YHZA 3EX7C 5HK9A 3HL4A 5LNK6 1JSZA 3ZXIA 4H1HA 1CQIB 2C58A 2XUOA 4QE3A 1U8EA 1VLLA 2CFTA 1E2IA 1L8QA 1MB4A 1K0UA 1BA2A 3F5SA 3OFVA 2A9KA 4OHPA 5J63A 5L6LB 4H60A 4ND2A 4GAEA 3KV1A 1DJPA 2OFXA 4ZPXA 3WIVA 2AEEA 1QGYA 4E2FA 1LDNA 1T5TA 2QEQA 1UADA 4Q4AB 5KBYA 2I8CA 4LISA 4O5OA 5EYPA 1V25A 3WSVA 1JQDA 4GQIA 4C0XA 4M6WB 5H70A 3R0XA 2H18A 4DLLA 2CB0A 1RJWA 1D4ZA 2H07A 3IR5A 4E5UA 2VDKB 3FFWA 2W4IA 1ZJJA 2HCJB 4C1BA 1HQKA 3KD3A 3A6LA 1CJMA 2EL9A 4MPDA 5CGQB 2ZI5A 2R65A 3HN2A 1HO3A 3LAWA 5J2TF 1Z8NA 4BFVA 3DG9A 2PNJA 2QMEA 2I33A 5K01A 4HN9A 5JXJA 1F6WA 4GGMX 2NZXA 4EB6A 3LP5A 4Z4GA 4LRXA 1DO8A 3TVTA 4LYYA 3CZPA 1WU7A 1L5KA 1UBGA 3RODA 1XFDA 1THTA 3I45A 1L7XA 3UKJA 3AYZB 1FP7A 4OP2A 3GP3A 3O6VA 5FHRA 3WZLA 3VU9A 4DUPA 5FBVB 1D6NA 3E05A 2IXFA 1ZZGA 3LCUA 5IJ0B 2I99A 4D25A 2XSZA 3K1YA 2RK3A 3IJEB 4FINA 1EJ6A 2H3HA 2JCBA 3IVGA 4FE3A 4FT4A 4GOLD 1VLMA 1TCVA 2WJIA 2JHFA 4KYIB 4RAQA 3W9YA 1ZNZA 4OJKA 2DR0A 2XRFA 3NYIA 4MTLA 1QIKA 1KJQA 5F1KA 4C0SA 1A8QA 1QLWA 1T3HA 5CTAA 1AH2A 1COWD 2FEWB 3B13B 1LPSA 4TMYA 3OPQA 4G2NA 4MVWA 4MMXB 3HCWA 4C4TA 1H2WA 2DWPA 4B6EA 4QNMA 1HG1A 4P53A 4DYVA 2I80A 1ZIOA 3PD1A 5EJ9A 3WLEA 4CMJA 1Y6FA 2Q9AA 4D9FA 5E1DA 4XQ9A 1KIMA 1EFAA 2IIPA 1S7GA 4ZOLA 3QIAA 3CLSC 3KZKA 5CVUA 2FAXA 2W2QA 2JRCA 3P0FA 5ES4B 4RTKA 1YI1A 2FEKA 3QU9A 5ALGA 2WSIA 4R8SA 2XQJA 4D1YA 3L8DA 5A1TA 2WVJA 3QE3A 4URWR 1KY5A 3BL6A 3DF7A 1X1CA 2IYQA 3CRQA 3PF8A 2OL4A 2PK3A 3I9MA 1JQ5A 4ALNA 1E6LA 3U61B 1BCRA 2QBYB 1B4DA 3RT1A 3HB9A 3ZDQA 3G49A 1R0YA 1R8XA 2OZKA 5H3LA 1RLJA 4JLJA 2PUCA 3EA0A 4O2BF 3OOEA 1GU0A 5IJWA 1M1YA 3DCYA 5LOVA 5I6DA 1MJGA 2R751 2DQYA 5EZ6B 3WTCA 1NRIA 3R0VA 2NQTA 1E4VA 1HKUA 5F12A 4QGSA 2GWHA 3A10A 1YRLA 1T3SA 3DLHA 3MF4A 5FNVF 4WY5A 3I6YA 2AG0A 4U39A 1X74A 4OOEA 1CEYA 5IDQA 1JIXA 4DC1A 4KBYA 1E2UA 1D7AA 2BH2A 5HX7A 2RIRA 4YAUA 3HC7A 5E2AA 1Q91A 1E9FA 1TZCA 1EFPA 5TMEA 3PNOA 3VJKA 4DVGA 3L8GA 4KFRA 4OJTA 2OSVA 4EEKA 2W8ZA 5IYZB 3G0DA 5JRJA 1NC1A 1ZUHA 2X0RA 4P3NA 4DMUB 4R1UA 4R84A 5FTMA 4GW3A 2ZBPA 2HU2A 3Q0IA 4D56A 4ZFNA 2YZGA 3W2IA 3VKHA 2JDID 3BMQA 1O0CA 2CD9A 1CK4A 2H08A 1PP4A 2Q5QA 4G0YA 4PVCA 4YBZA 4EO4A 2NMVA 3PQEA 4H4CA 2F3QA 3OZUA 4F56A 2JGDB 3ED1A 1ZSVA 1PI3A 1M2WA 3OBIA 2IYAA 4L2IA 2EYUA 1Y1PA 3L0IB 1JB1A 5DDIP 2N3ZA 2XHZA 5ALUA 3TLBA 1BFUA 4QTUB 1D4FA 3HCRA 4ZCTA 2AFIB 1B16A 1O6FA 5JCOA 2QN7A 2RGGA 3A4YA 1UJCA 2QTFA 2C2BA 2B4AA 3AHCA 2G1AA 3OPYB 3MZ0A 4Q3AA 1FYDA 3WSWA 5HUHA 2NO9A 4R7GA 2BGTA 1U1DA 1YK1A 3IP6A 3KTAB 4UHKA 1FCJA 3DC2A 1SHLA 3OX2A 4EF5A 5IXSA 1EXDA 1U4OA 4YBRA 5IM5A 1FSFA 1PNTA 4LGYA 1XA3A 4CMGA 2VXYA 2W6IA 4I1IA 3X1MA 2H7CA 4CIBA 1N8NA 2EJBA 2X5JO 4OM7A 4XPIB 5BSFA 2OKGA 4QUKA 5LNK1 4IJVA 4YRPA 2QRHA 1BROA 3WSTA 3EIHA 1CFZA 1J8FA 3E84A 3HCCA 2G63A 2FWAA 1GLVA 3FAZA 1E1NA 4OTZA 1I4EB 2XXJA 1NJ5A 4LZLA 4KHZA 4OHKA 1ATZA 2WJVA 1RRGA 1SG9A 1T8YA 3WL5A 1V43A 3LCVB 1MNAA 3QE4A 2Q1UA 4V3BA 1N8KA 4EEXA 3SEQA 1PD1A 3WRYC 3RAFC 1ZZEA 2BKXA 5F1OA 5A4DA 3VU8A 5G3ZA 1ZVQA 4OB8A 2XMPA 3WO1A 5FEMA 2E2WA 2GK7A 1CSEE 3ZGNA 1MAAA 2DUWA 3CN9A 3IC5A 2A59A 5KC8A 2LGJA 1ORWA 3PENA 4TMXA 5LU9A 4MB0A 4TMZA 4Y9DA 2BUCA 1Y89A 4U7GA 3F8TA 4LCEA 3B1WA 3OX1A 3W7AA 2GQ0A 4KQFA 3EPRA 1QFXA 5JNRA 1W2GA 1PS8A 2BTQB 4UAJA 3RFCA 3N75A 4R9UC 2Q49A 3KKQA 3QEMB 3C7AA 5HE8A 5IUKC 5TPZA 3I04A 3S70A 3BWDD 3OPNA 4DKXA 1CIJA 4B0OA 1XVLA 3GJRA 4JJ7A 2BPOA 1M2JA 2W2LD 4PYRA 4OFZA 2PT9A 3ECSA 1E2LA 3KAKA 3NM5A 5E3JA 4MNTA 5HCNA 1TQ8A 3T1HB 1EFCA 2PWZA 3GCZA 3WDMA 2OGWA 5L7WA 5F1YA 1Z4IA 3BE6A 3LQ4A 4Q7EA 1MTZA 1FYXA 3OE4A 1T3LA 2HSWA 5AQ1A 2HHHB 4QYTA 4NOJA 2XGSA 2XVAA 3PUXA 1IQRA 1BQ4A 1T2DA 4IDEA 4EHJA 2Y1CA 2F62A 5IX8A 1RLMA 3MA0A 3WMXA 2AI1A 5LCXA 1SC6A 1H94A 1II9A 5IAAA 2VF2A 3TNJA 5BYJA 3U3JA 1EM8A 1JQKA 1T5LA 5BMVB 2WIAA 3G9UA 3HBJA 3M4JA 4LFCB 1E79D 4HTFB 4I3GA 3ZDXB 5AFSA 5ALHA 1MOSA 1OT3A 1Z06A 5H59A 3QLTA 4I5EA 4MV3A 4XYLA 1S3SA 2WZQA 1KOGA 3GEMA 4QU5A 4BNKA 2A94A 2E6UX 3PUHA 4L5CA 2JFHA 5BR8B 1QQTA 1U2QA 3URMA 1Z3IX 3MFQA 2W6JA 3KJFA 3EWNA 3J81k 1F12A 4W63A 4B43A 1O8BA 1EDOA 1USVA 1NN3A 2RKBA 2SKCA 3F9RA 4KVZA 4R1QA 3CX4A 2E85A 3ZE8A 4X41A 2XGJA 4BKPA 3L79A 4MYDA 1N2HA 3CH5A 4O1HA 4Q3LA 5AIAA 1M83A 1XXHE 2HJ9A 4PLVA 4DLVA 2XSZD 2DJ5A 1NNUA 4L08A 4BTEA 1DWOA 5ALFA 2QAGC 4IRXA 3G2QA 1IZ7A 4TMVA 1VIVA 2FEXA 5C1DA 4W99A 3OC6A 4PWZA 4IVRA 5HJ7A 1KDPA 2UZ4A 1WSDA 2HWWA 1I5RA 5K0NA 3IBSA 4A3SA 3NLLA 2JFFA 4HNAB 2Z2IA 1AHIA 1II8A 1L0BA 1O5IA 1UMDA 3FGPA 3RPEA 4FYYA 1ENYA 3G6WA 1JT9A 2G09A 1CQIA 1MENA 1O4VA 1GPBA 3RASA 5GONF 1CC1S 3OICA 4LHSA 4R9VA 1F60A 1JYEA 4AZ3B 5JAMA 2KMLA 5BO5A 6NULA 3K5WA 4LC1A 3ZU6A 5CCBA 1XLWA 3NJ8A 3E9YA 3OPMA 4J7CA 2QJOA 1JHMA 3MJVA 4YRIA 1UCFA 2XVZA 2G83A 3PIIA 2NXEA 4H0NA 1FVXA 1B0UA 3AG5A 1X7YA 4IDDA 4J2HA 4PINA 3LIIA 2QUKA 3SIWA 2Y1GA 4LXHA 3TPFA 3TS1A 5B57C 2W43A 4XB1A 5C1PA 3L6OO 1U2DA 4CFSA 2GF0A 4CKEA 4AZVA 2R0QC 4HGPA 4A27A 1P0QA 3RSOA 4O8ZA 1CR1A 1JVBA 4ZICA 1ISIA 1QTQA 4ZPJA 2ZJ2A 3ZDEA 2G08A 4DNFA 2NO7A 3J7TA 1K6XA 3A9CA 2G28A 2J7KA 2VAWA 1E7SA 3RYHA 2EEZA 1KHHA 1YU9A 4G4GA 1WY7A 5FWNA 2FDCA 4XH9B 5ALDA 2YWJA 5BR7A 2AD1A 3D6FA 1FRVA 4IUBS 5LQKA 2OPHA 4RHUA 3S2IA 2Q8NA 2A9VA 2QJWA 4CG3A 4DRYA 3K70D 1K2WA 3UOWA 4S35A 2AE1A 3TSWA 4B8YA 1H8HD 3E3AA 3ZHVA 5LQCA 3L0ZA 4M1MA 4GC9A 3WP1B 5BUSA 5LSAA 3HEAA 3UENA 1AB5A 4YQEA 2L2QA 1R8SA 4ES6A 4FHCA 4LK2A 4CL3A 2E49A 2JH8A 3R5TA 2CLIB 4XZ3A 3Q87B 2Q1SA 4NJMA 4PFJA 2V97A 4Z4IA 4GYKA 4HGNA 4BLPA 3E9CA 3ITEA 2C9BA 2IL1A 3Q3EA 1TYZA 4AP5A 1SCKA 2ZS9A 4D6YA 4KR9A 2CHFA 2ERXA 2RB4A 4IIVA 3V6MA 4QDJA 5I4KA 1E5DA 3P4XA 2EARA 3HCEA 2FXVA 4UUNA 1C9KA 4R1NA 3KKEA 2F1RA 3NG1A 2FPOA 2F43B 4WE3A 3R0QA 1DKMA 1Q20A 4ND6A 3LRTA 1C7RA 2XQKA 3F3SA 2P41A 3KOWA 3Q0TA 2IIBA 4Q1CA 4O4JB 5GIOE 4EQ6A 2PSFA 4UMEA 4BNDA 3DEHA 1U7OA 4CG2A 2O0KA 3KZ1E 4X62B 1P2GA 5G4KB 4DLSA 2VUIB 4B4VA 3QLUC 4UPVA 2XIQA 1OH8A 1T2UA 1R5OA 1ZPDA 3LHKA 4M3NA 1LBIA 2OHOA 4JI2B 1KVTA 4U6NA 1I33A 3EAQA 4NAUA 2XUJA 3RS3A 2L42A 1KEZA 1G18A 1QFJA 3DCIA 5C8YF 1UOEA 3N8HA 4FJ0A 5C5EA 2C5LA 4KRGA 1DHTA 3KEQA 2O3RA 1QGZA 1GAWA 1Z5GA 1C41A 3RIXA 2WP8J 4LV6A 4C0WA 2YN4A 4EJMA 2OUKA 4WXHA 5JCXA 4OHZA 4HUQA 3TRKA 1W36C 2UXCB 5DISB 1V96A 2VVTA 3A2MA 1JHXA 3ABIA 3I42A 2D0IA 3TN7A 4TTSA 5JATA 1AA6A 1SWWA 1E96A 4XVQA 3IODA 1XSEA 2NNWB 1A8SA 1YASA 4R54A 1J2TA 1CUGA 1M67A 3RYCB 3RKRA 4QODA 5IT4A 1XJ5A 3C45A 3OSZA 1OROA 2ASEA 4X9XA 1FX1A 5TEVA 2ZRHA 2GR9A 3TSOA 2AS0A 4OK3A 2B6HA 4EKYA 3EXFB 4L15A 3GT3A 3GEGA 4XM2A 4IMJB 4G1BA 4CCSA 3OLWA 4A10A 3VKFA 3T99A 2WYUA 3EZ6A 3K53A 2VSFA 1LBEA 5AI0A 4B8WA 1P2SA 4V0MA 3R1IA 3IURA 1N7IA 1MLDA 1TIBA 2DQSA 3BPSA 1MF7A 4JIGA 2Z04A 3DLIA 4B3GA 4OXNA 3IVXA 5HW0A 4WESB 2QY9A 2ZI7A 4W7IA 4R68A 4C7KA 4F04A 3UOAB 2H65A 2FK7A 3EDQA 1JL3A 5FL7D 4RPLA 1GZ7A 5KQRA 3C5VA 4FD3A 3ZHXA 4BNMA 1UFVA 3AINA 2EL7A 2I87A 1H2EA 1EJBA 5DM60 4KC0A 1W87A 1I3CA 3FCXA 4YA6A 5LKRA 1XQ6A 3VAZA 3ZK8A 5MF6A 3IAFA 1E1KA 2VDWB 3GUCA 2C5AA 2O0MA 1UFQA 3HV0A 2KJQA 1Z7WA 1BMDA 1LH0A 3RTGA 2A9FA 1Z6QA 4IHJA 2PBZA 4FHFA 2GJ9A 3TL3A 2IS1A 3IQXA 4IFEA 1WMFA 4FNAA 3HU1A 3GK3A 1S4MA 3HUFA 4HNUA 2D1QA 3II6X 1JJFA 3OJEA 2A9PA 1U2DC 3RB8A 2YXNA 1LBHA 2VQ6A 2XTZA 4OUDB 3RJ5A 3GPCA 5ITZA 2BCJQ 5JDCA 4F4HA 1JP7A 4FYKA 3RT7A 3GJZA 3TINA 3CIOA 1W1WA 3CEPB 4P98A 1Y33E 3UG6A 1WBBA 1EUYA 1Q22A 3HXTA 4MA4A 1ENOA 4QULA 3WGHA 1C8BA 1OSNA 3H2JA 3R5KA 1GJRA 3CPSA 1LSJA 2BGKA 3K20A 1N77A 3FTEA 3FHTA 1P45A 5E1OA 4DR5B 2WUFA 3GN2A 1MT0A 4MI3A 3KJGA 5CX4A 5JHGB 3X2EA 2XAAA 2IPLA 3E4DA 4TGLA 4H7JA 3R6WA 1SBYA 2IKSA 4OHVA 2WKSA 4PS0A 3GZTB 4XIFA 4DV1B 4I36A 2SKEA 4FZVA 1JIVA 3GI1A 2C3OA 2HA4A 2W2TA 2ZIEA 5BN5A 2OCBA 4BQEA 3OM0A 4ZJYA 4M1EA 4EELA 5IJZA 2IPOA 4GU5A 3NOQA 4W6ZA 5I9TA 3UXEA 1TZJA 2I1VB 3MTIA 5C0OE 1ZKDA 4WAUA 3OA0A 4HDAA 2EQ5A 1QK4A 2SICE 1YH3A 3O4JA 4YPVA 1LPPA 4ZYUA 3TCXB 4EYOA 2G5PA 1SQFA 5HIAA 5BV7A 4YV1A 3SN6A 4EJ2A 4D43A 4ZAVA 2R7LA 3A9SA 4FYIA 3LQ2A 3RVMA 3S5UA 4IRMA 4QXQA 2PA0A 1CS0B 5FA5A 3GDOA 1JDUA 4CNQA 3MCWA 2EFEB 2PA3A 1Q50A 4BNLA 4X1IB 4H3VA 4J0EA 2GDJA 4IX9A 2X9LA 5JXGA 3Q5DA 3A6GA 3PT9A 2UVQA 2W83A 2ANCA 3TOXA 1TRHA 2VCHA 3M6VA 1WLSA 3IP5A 1RABA 4REOA 3AW8A 4V0OA 4L78A 3ER9A 5DNEA 1ZC4A 1ZIDA 2ONZA 3JQRA 3KFVA 3MS7A 4I50B 2J6CA 1VMKA 4P84A 1MEEA 2QLNA 3DE6X 3KUDA 3RG2A 2HSGA 1G8AA 1AG9A 3H6KA 4KLRA 2B30A 1WMSA 4F4IA 1WM1A 3N53A 4G9BA 1NZJA 2VDQB 5DIFA 4IM7A 3NI2A 4U6SA 4RF4A 2JJ1D 5EQTA 3G7SA 3B6IA 1KOJA 1WDMA 4M38A 5CFNA 2LUOA 3KQUA 1PNOA 1WKCA 4Z0TA 3IV9A 1VKZA 1EFPB 3PFHA 3SXUA 1VXRA 1H1TA 3HDTA 5BMVA 2O6HA 3PYLA 4FU0A 4ZT3A 2QYSA 3A4VA 3G0BA 2O4UX 3BHIA 4D8YA 4F5EA 4C5AA 1N5DA 2WJ3A 3GJ7A 4AUMA 5FO0A 3HDGA 1NJ8A 1U0HC 2YJ6A 4EBBA 1W30A 4KK4A 1CZUA 1C1DA 1T34A 1UJ5A 4UJ3A 1IAVA 2QG4A 3HO1A 1SOVA 4CT5A 1D2HA 7AT1A 1K5DA 2MINB 3H0CA 3QI7A 3W2GA 1P74A 5CPFA 3KOOA 3QPDA 1A5TA 1QM5A 4NOLA 3IB3A 3PRJA 4HQKA 5EI5A 5AXCA 3UFBA 1VL1A 3ZKAA 2LRHA 1PLKA 3SYLA 4UTPA 3LDFA 3W90A 2OECA 4O1MA 3AR5A 2W11A 3I6MA 1TD9A 2NW6A 3ZY5A 5JBQA 1TCUA 1ODKA 1UT6A 1ZD1A 4WCFA 3TX6A 1KJZA 4QQ8A 3STHA 3HCFA