4XZ3B

Ca. korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 (se-met derivative) in complex with coenzyme a and mg-amppcp, phosphohistidine segment pointing towards nucleotide binding site
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
228
structure length
228
Chain Sequence
SRDLLLKAKENGRKSLLEHEAKYFISSYGIPVTNIRLAKSEEEAVNFSREIGFPVVLKIVSPQVVHKSDVGGVKVNLRSEEEVRKAYREIIENVKRNVPNAEIEGILVQEFAPPGVELIIGLLRDPQFGPTVMFGLGGVFVELFRDVSFRVAPLSEQDAESMIKEVKAYKLLTGFRGMEPVDIEAIKDALIRAGRIGVENEEIAEMDLNPVIAYPKGIKVVDARIILR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Candidatus korarchaeum cryptofilum opf8
molecule tags Ligase
molecule keywords Acyl-CoA synthetase (NDP forming)
total genus 66
structure length 228
sequence length 228
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13549 ATP-grasp_5 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4xz3B01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4xz3B02
2PVPA 1UC9A 4EG0A 2C00A 2VPQA 2OLSA 4IZOA 5C8YF 4NYEA 3KAKA 3RFCA 4O7SA 3R5HA 4O7VA 5J2TF 2YRWA 5D8DA 1GLVA 5EZYF 4TV9F 5K2MA 1E4EA 4YJ2F 2PN1A 3E5NA 2YYAA 4YBZB 2ZDGA 2R84A 4MV3A 2DZDA 2R7LA 4MV6A 3TW6A 4HR7A 5H80A 3R23A 3SE7A 5JQWA 3U54A 4YAJB 4O7YA 2CNVA 3MWEA 4HNUA 1M0TA 2FPGB 4ZQIA 2YS6A 5BPFA 5C1PA 3GLKA 4MV7A 3Q1KA 3AX6A 2YS7A 3OUUA 3TQTA 4ZI7F 4O7WA 1B6SA 1C30A 4O84A 2R7MA 3ORRA 2R85A 2GPWA 5CA0F 2FPPB 3K3PA 4I50F 1EHIA 4C5AA 4O4HF 4WD3A 1GSHA 5KX5F 5CB4F 1KEEA 1CS0A 3JRXA 3G8DA 2CNQA 4XX0B 3AW8A 3DF7A 4MV4A 4FFLA 4HNVA 4C5BA 2NUAB 3ORQA 4I4TF 5KKNB 3R5XA 2W6ZA 1WR2A 1KJQA 2CQYA 3MJFA 4O81A 3TIIA 5GONF 2HJWA 4O7RA 4YJ3F 4L1KA 4FFRA 3GIDA 4HNTA 1AUXA 2DWCA 2W6PA 1KJJA 1A9XA 3K5HA 4XYLB 1KJIA 4FU0A 4HQ6A 2YRXA 5LXTF 3VPBA 3VA7A 4DLKA 4MV8A 3HB9A 3JRWA 1UC8A 5LOVF 2I8CA 4O7LA 1JLLB 3R5FA 1BXRA 1I7LA 2W6NA 3NUAA 2R82A 2SCUB 3VPCA 1JKJB 1SCUB 1ULZA 3R9RA 4FFPA 1DV1A 1W93A 4O7TA 2QF7A 2R7KA 4FFOA 4XZ3B 1W96A 3N8DA 4O7ZA 4FGRA 2HGSA 1PX2A 1T36A 3V4ZA 1VKZA 2VR1A 5CAEB 5HV6A 4DIMA 2W6OA 2PBZA 4O83A 4MAMA 5CA1F 3WO0A 4O86A 1GSAA 3JZFA 4IWYA 1PK8A 3RV4A 4WBNF 1OBDA 2FPIB 1Z2NX 2ZDQA 3Q2OA 4O82A 3U9TA 4O2AF 2QK4A 5LYJF 2YZLA 4IHJF 5HBRB 1BNCA 1Z2PX 2FB9A 1AUVA 2YZNA 1JDBB 3VPDA 2CZGA 1EZ1A 1OBGA 4MA0A 2Z02A 2V59A 1KBLA 2WYOA 3KAJA 4FFNA 2P0AA 5DMXA 1EYZA 4FE2A 4TV8F 2DLNA 3HO8A 3I12A 3TINA 2X0SA 1EUCB 5FNVF 5JH7F 1CQJB 4FFMA 1VBHA 4C5CA 3KALA 3MWDA 3WO1A 3U9SA 4XYMB 1KJ9A 2GQRA 3VOTA 2V5AA 1M6VA 2V58A 1KJ8A 1A48A 4TUYF 3U55A 2YW2A 1CE8A 1KC7A 5LP6F 1DV2A 1B6RA 1DIKA 2GPSA 1M0WA 4O7NA 3HBLA 2R7NA 3KREA 5JVLA 1EUDB 2FP4B 1CQIB 2NU8B 2YZMA 3LWBA 2VQDA 4YAKB 4ME6A 3JZIA 4ZOLF 3LP8A 3ETJA 3N6RA 5LA6F 2XCLA 3K5IA 1I7NA 3RUPA 4MA5A 1IOVA 1IOWA 2IP4A 2XD4A 2DIKA 2R87A 4I55F 2NU7B 3ETHA 5J2UF 1GGOA 1KUTA 4Y8VB 2YZGA 2W71A 3V4SA 4IIJF 4M9UA 4MV9A 3UFXB 5C1OA 2W6QA 4QSHA 2R86A 1E4EB 2YL2A 4YB8B 2R6FA 5BPHA 1GSOA 2YWVA 3G8CA 1VBGA 2J9GA 4RZQA 4EGQA 4O4LF 4MV1A 4EGJA 5JQGF 2GQSA 1Z2OX 4E4TA 2CNUA 5BMVF 3BG5A 3WNZA 2ZDHA 4O4IF 4ZHQF 4O2BF 2W6MA 3TIGA 5IYZF 3OUZA 2Z04A 2NU6B 1JDEA 3QFFA 1C3OA 2I87A 4O4JF 2I80A 3RV3A 4IWXA 2GLTA 2NU9B 5I47A 3VMMA 2W70A 5JVDF
chains in the Genus database with same CATH superfamily
4CHIA 3HKZA 5C5JA 2PVPA 3RF2A 3H4DA 4ED0A 2RGRA 1UC9A 4EG0A 3RBEA 2C00A 3NC0B 4X66H 2VPQA 4F50A 4ED2A 2R8KA 4RB1A 3PW4A 2JEFA 1VS0A 4LF8H 2R93A 2OLSA 4IZOA 1CKNA 4NYEA 3KAKA 5C8YF 4RAYA 5KFXA 1EKVA 3RFCA 4ECQA 4O7SA 4BY1G 4YQWA 3RB0A 3R5HA 5KFYA 4FS2A 2BQUA 2ODTX 4IRKA 4O7VA 1IYDA 5BWUA 3H40A 3MR2A 2ALZA 5J2TF 2YRWA 5D8DA 1GLVA 5EZYF 5L9XA 3GIPA 2VQEH 1JX4A 4TV9F 2COIA 5BWWA 2FLNA 5K2MA 3F8NA 1E4EA 4YJ2F 5IP7G 1I1KA 4FBUA 2PN1A 1XK5A 4YR2A 3GQCA 3E5NA 2Q2UA 2YYAA 2FK2A 3H20A 4RNOA 4YP3A 4UCVA 2C2RA 2HVQA 4UUGA 3NBZB 4YBZB 4CKEA 2ZDGA 2R84A 2FMAA 4F4XA 4A3EG 4MV3A 2DZDA 2R7LA 4MV6A 3TW6A 2MCTA 5L1LA 3GV8B 2VA2A 3HOUG 4HR7A 1I1MA 5H80A 5KFGA 4EFBA 3GV5B 3R23A 1XNRH 4MTEA 3SE7A 4GKKH 4UCSA 5I60A 4PZ6A 4CC5A 4A3IG 5JQWA 4DUYH 4R8UB 4DL5A 3U54A 4JI4H 1DGSA 4YAJB 4K0KH 3GTKA 2JA6A 1I6UA 3G6VA 5KT7A 3J80W 4O7YA 4E6NA 1ZQ7A 3KTMA 4ECRA 2CNVA 4RCNA 3G6XA 3MWEA 4ED6A 4HNUA 1T3NA 1I2LA 1M0TA 1K1QA 1I2KA 4C2MA 5KG5A 4AQYH 3S24A 2E5LH 2VOBA 2FPGB 4ZQIA 2YS6A 5BPFA 4A3CG 3V6JA 5C1PA 5A2QW 4A3JG 3TW7A 2EIYA 4LF9H 4CE5A 1EKPA 4U7CA 3PFFA 4PBCA 4J9PA 4MV7A 3GLKA 4RZRA 3Q1KA 3PW2A 3GTLA 3AX6A 4A3DG 1E4GT 1RK5A 5CR5A 2XGPA 2YS7A 4B3SH 3OUUA 2VUMA 3PZPA 3TQTA 2FJZA 5C3EG 3GIKA 2F4VH 4ZI7F 4O7WA 1O75A 1B6SA 1C30A 2YCHA 4O84A 2FK3A 3PN1A 4WHXA 5EWEA 5CE8A 4DR6H 5IT9W 5KT5A 4A93G 4DR1H 3M9MB 4EBEA 3J7AK 2R7MA 4GLXA 3ORRA 4QW8A 3T54A 2R85A 2ABJA 4QIWE 2GPWA 5KFRA 2FPPB 4CMDA 5CA0F 3K3PA 4LF6H 4I50F 4NZMA 3T7AA 1EHIA 4C5AA 4B3MH 4EYIB 5BWRA 4O4HF 1WH2A 2Y0SA 4JI3H 4MTDA 5DAAA 1JIHA 4DV2H 5KFDA 1S0MA 4WD3A 1Y14B 5BWVA 5JVDF 1SEIA 4DL6A 2AGPA 4DR4H 1GSHA 5KX5F 3OHAA 2R8HA 4ECXA 4NLGA 2X5RA 3T9BA 1S10A 5CB4F 3Q8SB 1KEEA 1CS0A 3GIQA 3JRXA 4F4ZA 2J6SA 3GTOA 5HNEA 3MR6A 5EWGA 4LH6A 2COJA 3G8DA 2CNQA 4XX0B 1AN7A 4QWEA 3AW8A 2UVUA 4OX9H 3DF7A 4HN2A 4JXUA 4MV4A 2W9BB 2VA3A 1RJPA 4DR5H 3L4KA 4JV0A 4ECTA 3HOWG 2RGVA 1RJQA 4FFLA 3H0GA 4HNVA 1DAAA 4C5BA 2NUAB 5KFZA 4ETSA 5DG7A 1IBKH 4JV2A 1Y1WA 3ORQA 4BWSC 4J9OA 4O3QA 3W1GA 2R7ZA 1JXLA 1S9FA 4I4TF 1FVIA 5KKNB 3N44B 3R5XA 2C28A 1B04A 2W6ZA 4B3TH 1N36H 1WR2A 5EOYA 2V4QA 3C0FB 3FKIG 1KJQA 2CQYA 4J9LA 2E2IA 3KHGA 3MJFA 4O81A 2NVXA 3TIIA 2JEGA 4FBTA 1HNWH 5GONF 2HJWA 4O7RA 3RR5A 2O03A 4BY7G 5K3WA 5JUMA 2BQRA 4EEQA 4A3GG 2YU9A 3N41B 4RB0A 4YJ3F 4L1KA 5KFCA 5E25A 3EYYA 4FFRA 4NXMH 3KYHC 2UVWA 3GIDA 4HNTA 2IA6A 1AUXA 3GV7B 2DWCA 4DV3H 4CMFA 4Q4CA 4RU9A 4BBSG 2W6PA 1P8LA 3TY5A 4JI2H 4QWAA 1KJJA 3K5HA 1A9XA 3RTXA 5LMNH 4XYLB 5KFUA 3HOXG 4IR9A 4IAJA 1S03G 3GB8B 5KG7A 3RB3A 2XCPA 1KJIA 4FU0A 4HQ6A 2YRXA 3T5HA 3GTQA 2V9WA 5C4XG 3LMLA 5D1OA 2WE6A 5LXTF 5DG8A 3G6YA 4DR3H 1XMQH 4DAAA 5L1JA 3VPBA 2ZGIA 1L2ZA 2Y0SE 3CSWA 2M05A 3VA7A 4DLKA 2EJ3A 4MV8A 5KG6A 3HB9A 3JRWA 1BGWA 1UC8A 5KT3A 1FKAH 3N40P 5LOVF 4F4YA 2I8CA 4J9KA 4O7LA 2C22A 1IYEA 1JLLB 2Q2TA 3R5FA 5DGBA 2ASLA 3BABA 5KT6A 1BXRA 1I7LA 2W6NA 4JI1H 5EWFA 4LF4H 3NUAA 2E2HA 2R82A 1OWTA 4QWCA 5IYCG 3M9NB 2SCUB 4UCTA 1SFOA 4KHPH 1A3GA 2BR0A 2UU9H 2ASJA 2ATLA 4AYBA 3T9EA 2CFMA 2NVYA 4IR1A 3VPCA 3GIMA 4G3IA 3JSNA 4A2AA 2R7ZG 5DGHA 3W1BA 2DPIA 3UZOA 1TA8A 1JKJB 1SCUB 1ULZA 3R9RA 2VPSA 3H4BA 4FFPA 1DV1A 1W93A 2AU0A 1IBMH 4EEYA 4J0MA 4O7TA 2W9CB 2BQ3A 5BYAA 5KG2A 3T9CA 2B63A 2UXCH 1N34H 3WWHA 5FLMG 2AGOA 4Q45A 4LF5H 1I3QA 2QF7A 2R7KA 4J9SA 5KFBA 4FFOA 4XZ3B 5KFJA 1W96A 3CEBA 2V4RA 3N8DA 1UNNC 2JEIA 1MZBA 4J9RA 4O7ZA 2B63G 5DLFA 1A0IA 4AYBE 2OWOA 3HOYG 2W9BA 4ECSA 4NZNA 3N42B 2EJ0A 5CM0A 1A0GA 3BAAA 5DISC 4FGRA 4DUZH 2HGSA 4DQNA 4DR2H 4Q8EA 4U6PA 2FE3A 3PO2G 5I5SA 1PX2A 1T36A 3K3VA 5KFTA 3V4ZA 3RAQA 2R92G 4LSXA 1VKZA 2VR1A 5KFLA 4ECVA 4ED3A 1V51A 5CAEB 5HV6A 1RJRA 3Q8RB 4DIMA 2FLLA 2W7PA 4EBDA 2HGXA 3RJ0A 2HIVA 4DV7H 4ECZA 2RDIA 4F4WA 1KTAA 2W6OA 4RB2C 2A1HA 2XIGA 3UYYA 4M0JA 3Q8PB 2PBZA 5DQGA 1FJGH 4B3RH 2R8JA 4LFBH 1Y1VA 3CVZA 5KFPA 4YR0A 4O83A 1J5EH 4MAMA 3QZ7A 5CA1F 3WO0A 3H0GG 4O86A 5KG1A 3H3VH 1GSAA 2UVVA 3JZFA 4ED7A 4DL4A 2VUGA 4IWYA 5KFWA 4GC6A 4DV5H 1PK8A 3RV4A 4WBNF 4LFAH 1OBDA 4EFEA 2FK1A 5BR8H 2WB1A 3RBDA 1XMOH 1WSCA 2FPIB 4RAZA 1Z2NX 2ZDQA 3Q2OA 4ECWA 1ET0A 4O82A 1M7JA 2W57A 3U9TA 4DRFA 2ASDA 4ED1A 5L1KA 4GKJH 4O2AF 3TEKA 5EDWA 5KFQA 5KFFA 2JA8G 2JEJA 2QK4A 4YR3A 5LYJF 3GILA 5I5WA 3KXYT 2YZLA 4IHJF 5HBRB 1BNCA 1Z2PX 2FB9A 2HG8A 4O3RA 4J9QA 1AUVA 4EBCA 4NZOA 2JA7G 4YHHH 4FM9A 3PR4A 2YZNA 1JDBB 3BA8A 5BYBA 1N48A 3VPDA 2CZGA 1XDNA 2ZJTA 2W7OA 2HVRA 3EPGA 2Y4RA 1EZ1A 1OBGA 3TY9A 3PW7A 4MA0A 2Z02A 3DAAA 4O3NA 2V59A 1CKMA 1KBLA 3PO3G 2FKLA 3T1HH 1HR0H 2WYOA 5I5XA 3T5JA 3T1YH 4BXXG 4IRCA 3KAJA 3WWIA 3HKZE 2P0AA 5DMXA 2PMZA 4QW9A 1EYZA 4FE2A 3DTFA 1GO3E 4TV8F 3CQZA 2DLNA 2WAQA 1K1SA 4LF7H 3SGIA 3GTGA 2Q7DA 3HO8A 3TQ1A 3I12A 3TINA 3I4MG 2X0SA 2W9CA 1EUCB 5FNVF 2WDTA 5JH7F 4LSAA 5KS8A 1CQJB 1VAJA 1CKNB 4FFMA 1VBHA 4C5CA 5IP9G 1HNXH 5I5YA 3GTJA 3KALA 3MWDA 5D1OB 5FD5A 4Q43A 3WO1A 1HNZH 3U9SA 3SNOA 3W5OA 1T94A 4APMA 5KFKA 1SYXB 3RGZA 5C44G 1TAEA 3BACA 4XYMB 1KJ9A 3TY8A 2HDKA 1WCMA 4NXNH 2GQRA 4TVIA 3VOTA 2UUCH 2V5AA 2XGQA 4A3MG 4JI6H 2JA5A 3KHRA 4R8UA 1M6VA 2V58A 3MFHA 4ED8A 1KJ8A 3MR3A 2W9AA 4UCUA 5D1PA 1A48A 4TUYF 2UVRA 3U55A 1BJTA 3M4IA 3RAXA 2YW2A 1N33H 5KG0A 2JA5G 1KT8A 4DL2A 1CE8A 4JI7H 4CKCA 1KC7A 5F9LA 2J6TA 4JV5H 3MR5A 5LP6F 4Q0YA 1DV2A 1B6RA 5DGIA 2HVSA 1DIKA 2GPSA 1M0WA 4O7NA 2HHFB 4RNMA 3HBLA 2CKZB 3AYHB 2R7NA 3KREA 5JVLA 2QYZA 3HXLA 5FR9A 3T5LA 4ECUA 1EUDB 2FP4B 4QJFA 2C2EA 3QWUA 3T5KA 3PW5A 2DPJA 1CQIB 2NU8B 4PZ7A 3OHBA 2W8LA 2YZMA 2DABA 2VQDA 3LWBA 4Q4DA 2WAQE 4YAKB 4O3OA 1TWCA 5KFIA 1Y1WG 1RYRA 5FPRA 4ME6A 3NGDA 4QIWA 3OSNA 4FS1A 3HOVG 4R7RA 2KSWA 4QWBA 3KHLA 3JZIA 4ZOLF 3LP8A 3FKIA 4DL7A 3ETJA 4IRDA 3N6RA 5FJ8G 4DV6H 4A3BG 5LA6F 3V6KA 2UUBH 2IMWP 1I1LA 2IBKA 1S0OA 2JA6G 1WCMG 5KFNA 1R9TA 4UCOA 5DQHA 2XCLA 2RDJA 5F9NA 3J81W 3K5IA 3EPIA 2R92A 1I7NA 4DV4H 3RUPA 1RYSA 4MA5A 5I5UA 1IOVA 1IOWA 1N56A 1IBLH 2IP4A 3T9DA 3Q8QB 4LFCH 2EJ2A 3GDEA 4JI0H 2XD4A 5KFVA 2DAAA 2DIKA 2R87A 3T9AA 3VNNA 1V9PA 3RB4A 2OH2A 4I55F 2XCAA 2W8KA 5KFOA 5IYDG 1S97A 1B33N 4GC7A 5KG4A 5KFEA 3NBYB 4K6NA 4X64H 2NU7B 4GLWA 4M7EA 1TWAA 3ETHA 5J2UF 1CKOA 3BJYA 3PR5B 1TWFA 5DGAA 1GGOA 3N6XA 1KUTA 2FLPA 4Y8VB 2YZGA 4JI5H 2WB1E 5KFAA 2W71A 4X62H 3V4SA 4LH7A 3MWMA 1I50A 1S68A 5T14A 4IIJF 3L2PA 4RUCA 4A2BA 4JI8H 4A3KG 4M9UA 4J9NA 4A3LG 3IG0A 4MV9A 3UFXB 5C1OA 4EQ5A 4A3FG 4TM5A 3PVXA 3RB6A 1ZETA 2AQ4A 4JYAH 1ZHQA 1GYFA 2J6UA 4YY3H 3LULA 3T9FA 2RF4A 2W6QA 4QSHA 2R86A 5KT4A 1E4EB 2YL2A 1Y1VG 1N32H 5FLXW 4YB8B 3IN5A 1TWHA 3U0GA 3BQ0A 4DV0H 3JSLA 4Q44A 1V4YA 2R6FA 5BPHA 3UQ8A 1GSOA 2ZM6H 3M9OB 5FPOA 1P16A 2QB5A 4TQRA 2YWVA 3JZ6A 1I94H 4DV1H 4RNNA 4Q8FA 3G8CA 4PZ8A 2UXBH 1VBGA 2HIXA 4CKBA 1X9NA 2UXDH 3SI8A 4I7HA 2J9GA 3BA9A 4RZQA 3L4JA 3OSPA 3GTMA 5BWXA 2HHFA 1S0NA 3PW0A 3RGXA 4ECYA 4O3SA 3HOZG 3KHHA 4EGQA 4RUAA 4O4LF 4MV1A 4EGJA 5JQGF 1WRVA 5FD6A 4X65H 1K83A 2GQSA 2UUAH 4PDBA 1EKFA 1Z2OX 4E4TA 5KFHA 4RB3C 2C35B 2CNUA 3HT5A 3GIIA 5BMVF 2R8GA 4BBRG 3BG5A 3WNZA 4JV1A 3T99A 1TWGA 2ZDHA 2COGA 4DR7H 2JA7A 1E4FT 3BQ2A 2AGQA 1G2WA 4O4IF 2XC9A 2PMZE 5DG9A 3GJXB 5KG3A 3FMAA 4ZHQF 4O2BF 3I4NG 2W6MA 3TIGA 4QWDA 4TQSA 3LQSA 5IYZF 3UZBA 1RK6A 1ZHSA 3OUZA 3N43B 5I5VA 5KFSA 3MFIA 4EYHB 2Z04A 3GIJA 3BQ1A 2NU6B 4HYKA 4DL3A 1XNQH 5KT2A 3GTPA 1JDEA 2CW8A 2CW7A 4UFZA 3QFFA 3FDSA 5DLGA 4UCRA 3RIZA 3OTOH 2C2DA 3JAMW 1C3OA 2VQFH 3DTGA 3QQMA 4O4JF 2I87A 1ZAUA 2I80A 3RV3A 4IWXA 4PWQA 3WWJA 2GLTA 4CC6A 5BWTA 2NU9B 5KFMA 5IWAH 5L1IA 5I47A 5DQIA 3QZ8A 5LMUH 4O3PA 2R8IA 3VMMA 2WTFA 2HHHH 4JUZA 4LMYA 2HGWA 2W70A 5LL6b 4J9MA 3V6HA 4FFNA 5IYBG 2R93G 5I5TA 2VUMG
chains in the Genus database with same CATH topology
2PVPA 1UC9A 4EG0A 2C00A 2VPQA 2OLSA 4IZOA 5C8YF 4NYEA 3KAKA 3RFCA 4O7SA 3R5HA 4O7VA 5J2TF 2YRWA 5D8DA 1GLVA 5EZYF 4TV9F 5K2MA 1E4EA 4YJ2F 2PN1A 3E5NA 2YYAA 4YBZB 2ZDGA 2R84A 4MV3A 2DZDA 2R7LA 4MV6A 3TW6A 4HR7A 5H80A 3R23A 3SE7A 5JQWA 3U54A 4YAJB 4O7YA 2CNVA 3MWEA 4HNUA 1M0TA 2FPGB 4ZQIA 2YS6A 5BPFA 5C1PA 3GLKA 4MV7A 3Q1KA 3AX6A 2YS7A 3OUUA 3TQTA 4ZI7F 4O7WA 1B6SA 1C30A 4O84A 2R7MA 3ORRA 2R85A 2GPWA 5CA0F 2FPPB 3K3PA 4I50F 1EHIA 4C5AA 4O4HF 4WD3A 1GSHA 5KX5F 5CB4F 1KEEA 1CS0A 3JRXA 3G8DA 2CNQA 4XX0B 3AW8A 3DF7A 4MV4A 4FFLA 4HNVA 4C5BA 2NUAB 3ORQA 4I4TF 5KKNB 3R5XA 2W6ZA 1WR2A 1KJQA 2CQYA 3MJFA 4O81A 3TIIA 5GONF 2HJWA 4O7RA 4YJ3F 4L1KA 4FFRA 3GIDA 4HNTA 1AUXA 2DWCA 2W6PA 1KJJA 1A9XA 3K5HA 4XYLB 1KJIA 4FU0A 4HQ6A 2YRXA 5LXTF 3VPBA 3VA7A 4DLKA 4MV8A 3HB9A 3JRWA 1UC8A 5LOVF 2I8CA 4O7LA 1JLLB 3R5FA 1BXRA 1I7LA 2W6NA 3NUAA 2R82A 2SCUB 3VPCA 1JKJB 1SCUB 1ULZA 3R9RA 4FFPA 1DV1A 1W93A 4O7TA 2QF7A 2R7KA 4FFOA 4XZ3B 1W96A 3N8DA 4O7ZA 4FGRA 2HGSA 1PX2A 1T36A 3V4ZA 1VKZA 2VR1A 5CAEB 5HV6A 4DIMA 2W6OA 2PBZA 4O83A 4MAMA 5CA1F 3WO0A 4O86A 1GSAA 3JZFA 4IWYA 1PK8A 3RV4A 4WBNF 1OBDA 2FPIB 1Z2NX 2ZDQA 3Q2OA 4O82A 3U9TA 4O2AF 2QK4A 5LYJF 2YZLA 4IHJF 5HBRB 1BNCA 1Z2PX 2FB9A 1AUVA 2YZNA 1JDBB 3VPDA 2CZGA 1EZ1A 1OBGA 4MA0A 2Z02A 2V59A 1KBLA 2WYOA 3KAJA 4FFNA 2P0AA 5DMXA 1EYZA 4FE2A 4TV8F 2DLNA 3HO8A 3I12A 3TINA 2X0SA 1EUCB 5FNVF 5JH7F 1CQJB 4FFMA 1VBHA 4C5CA 3KALA 3MWDA 3WO1A 3U9SA 4XYMB 1KJ9A 2GQRA 3VOTA 2V5AA 1M6VA 2V58A 1KJ8A 1A48A 4TUYF 3U55A 2YW2A 1CE8A 1KC7A 5LP6F 1DV2A 1B6RA 1DIKA 2GPSA 1M0WA 4O7NA 3HBLA 2R7NA 3KREA 5JVLA 1EUDB 2FP4B 1CQIB 2NU8B 2YZMA 3LWBA 2VQDA 4YAKB 4ME6A 3JZIA 4ZOLF 3LP8A 3ETJA 3N6RA 5LA6F 2XCLA 3K5IA 1I7NA 3RUPA 4MA5A 1IOVA 1IOWA 2IP4A 2XD4A 2DIKA 2R87A 4I55F 2NU7B 3ETHA 5J2UF 1GGOA 1KUTA 4Y8VB 2YZGA 2W71A 3V4SA 4IIJF 4M9UA 4MV9A 3UFXB 5C1OA 2W6QA 4QSHA 2R86A 1E4EB 2YL2A 4YB8B 2R6FA 5BPHA 1GSOA 2YWVA 3G8CA 1VBGA 2J9GA 4RZQA 4EGQA 4O4LF 4MV1A 4EGJA 5JQGF 2GQSA 1Z2OX 4E4TA 2CNUA 5BMVF 3BG5A 3WNZA 2ZDHA 4O4IF 4ZHQF 4O2BF 2W6MA 3TIGA 5IYZF 3OUZA 2Z04A 2NU6B 1JDEA 3QFFA 1C3OA 2I87A 4O4JF 2I80A 3RV3A 4IWXA 2GLTA 2NU9B 5I47A 3VMMA 2W70A 5JVDF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PVP A;  1UC9 A;  4EG0 A;  2C00 A;  2VPQ A;  2OLS A;  4IZO A;  5C8Y F;  4NYE A;  3KAK A;  3RFC A;  4O7S A;  3R5H A;  4O7V A;  5J2T F;  2YRW A;  5D8D A;  1GLV A;  5EZY F;  4TV9 F;  5K2M A;  1E4E A;  4YJ2 F;  2PN1 A;  3E5N A;  2YYA A;  4YBZ B;  2ZDG A;  2R84 A;  4MV3 A;  2DZD A;  2R7L A;  4MV6 A;  3TW6 A;  4HR7 A;  5H80 A;  3R23 A;  3SE7 A;  5JQW A;  3U54 A;  4YAJ B;  4O7Y A;  2CNV A;  3MWE A;  4HNU A;  1M0T A;  2FPG B;  4ZQI A;  2YS6 A;  5BPF A;  5C1P A;  3GLK A;  4MV7 A;  3Q1K A;  3AX6 A;  2YS7 A;  3OUU A;  3TQT A;  4ZI7 F;  4O7W A;  1B6S A;  1C30 A;  4O84 A;  2R7M A;  3ORR A;  2R85 A;  2GPW A;  5CA0 F;  2FPP B;  3K3P A;  4I50 F;  1EHI A;  4C5A A;  4O4H F;  4WD3 A;  1GSH A;  5KX5 F;  5CB4 F;  1KEE A;  1CS0 A;  3JRX A;  3G8D A;  2CNQ A;  4XX0 B;  3AW8 A;  3DF7 A;  4MV4 A;  4FFL A;  4HNV A;  4C5B A;  2NUA B;  3ORQ A;  4I4T F;  5KKN B;  3R5X A;  2W6Z A;  1WR2 A;  1KJQ A;  2CQY A;  3MJF A;  4O81 A;  3TII A;  5GON F;  2HJW A;  4O7R A;  4YJ3 F;  4L1K A;  4FFR A;  3GID A;  4HNT A;  1AUX A;  2DWC A;  2W6P A;  1KJJ A;  1A9X A;  3K5H A;  4XYL B;  1KJI A;  4FU0 A;  4HQ6 A;  2YRX A;  5LXT F;  3VPB A;  3VA7 A;  4DLK A;  4MV8 A;  3HB9 A;  3JRW A;  1UC8 A;  5LOV F;  2I8C A;  4O7L A;  1JLL B;  3R5F A;  1BXR A;  1I7L A;  2W6N A;  3NUA A;  2R82 A;  2SCU B;  3VPC A;  1JKJ B;  1SCU B;  1ULZ A;  3R9R A;  4FFP A;  1DV1 A;  1W93 A;  4O7T A;  2QF7 A;  2R7K A;  4FFO A;  4XZ3 B;  1W96 A;  3N8D A;  4O7Z A;  4FGR A;  2HGS A;  1PX2 A;  1T36 A;  3V4Z A;  1VKZ A;  2VR1 A;  5CAE B;  5HV6 A;  4DIM A;  2W6O A;  2PBZ A;  4O83 A;  4MAM A;  5CA1 F;  3WO0 A;  4O86 A;  1GSA A;  3JZF A;  4IWY A;  1PK8 A;  3RV4 A;  4WBN F;  1OBD A;  2FPI B;  1Z2N X;  2ZDQ A;  3Q2O A;  4O82 A;  3U9T A;  4O2A F;  2QK4 A;  5LYJ F;  2YZL A;  4IHJ F;  5HBR B;  1BNC A;  1Z2P X;  2FB9 A;  1AUV A;  2YZN A;  1JDB B;  3VPD A;  2CZG A;  1EZ1 A;  1OBG A;  4MA0 A;  2Z02 A;  2V59 A;  1KBL A;  2WYO A;  3KAJ A;  4FFN A;  2P0A A;  5DMX A;  1EYZ A;  4FE2 A;  4TV8 F;  2DLN A;  3HO8 A;  3I12 A;  3TIN A;  2X0S A;  1EUC B;  5FNV F;  5JH7 F;  1CQJ B;  4FFM A;  1VBH A;  4C5C A;  3KAL A;  3MWD A;  3WO1 A;  3U9S A;  4XYM B;  1KJ9 A;  2GQR A;  3VOT A;  2V5A A;  1M6V A;  2V58 A;  1KJ8 A;  1A48 A;  4TUY F;  3U55 A;  2YW2 A;  1CE8 A;  1KC7 A;  5LP6 F;  1DV2 A;  1B6R A;  1DIK A;  2GPS A;  1M0W A;  4O7N A;  3HBL A;  2R7N A;  3KRE A;  5JVL A;  1EUD B;  2FP4 B;  1CQI B;  2NU8 B;  2YZM A;  3LWB A;  2VQD A;  4YAK B;  4ME6 A;  3JZI A;  4ZOL F;  3LP8 A;  3ETJ A;  3N6R A;  5LA6 F;  2XCL A;  3K5I A;  1I7N A;  3RUP A;  4MA5 A;  1IOV A;  1IOW A;  2IP4 A;  2XD4 A;  2DIK A;  2R87 A;  4I55 F;  2NU7 B;  3ETH A;  5J2U F;  1GGO A;  1KUT A;  4Y8V B;  2YZG A;  2W71 A;  3V4S A;  4IIJ F;  4M9U A;  4MV9 A;  3UFX B;  5C1O A;  2W6Q A;  4QSH A;  2R86 A;  1E4E B;  2YL2 A;  4YB8 B;  2R6F A;  5BPH A;  1GSO A;  2YWV A;  3G8C A;  1VBG A;  2J9G A;  4RZQ A;  4EGQ A;  4O4L F;  4MV1 A;  4EGJ A;  5JQG F;  2GQS A;  1Z2O X;  4E4T A;  2CNU A;  5BMV F;  3BG5 A;  3WNZ A;  2ZDH A;  4O4I F;  4ZHQ F;  4O2B F;  2W6M A;  3TIG A;  5IYZ F;  3OUZ A;  2Z04 A;  2NU6 B;  1JDE A;  3QFF A;  1C3O A;  2I87 A;  4O4J F;  2I80 A;  3RV3 A;  4IWX A;  2GLT A;  2NU9 B;  5I47 A;  3VMM A;  2W70 A;  5JVD F; 
#chains in the Genus database with same CATH topology
 4CHI A;  3HKZ A;  5C5J A;  2PVP A;  3RF2 A;  3H4D A;  4ED0 A;  2RGR A;  1UC9 A;  4EG0 A;  3RBE A;  2C00 A;  3NC0 B;  4X66 H;  2VPQ A;  4F50 A;  4ED2 A;  2R8K A;  4RB1 A;  3PW4 A;  2JEF A;  1VS0 A;  4LF8 H;  2R93 A;  2OLS A;  4IZO A;  1CKN A;  4NYE A;  3KAK A;  5C8Y F;  4RAY A;  5KFX A;  1EKV A;  3RFC A;  4ECQ A;  4O7S A;  4BY1 G;  4YQW A;  3RB0 A;  3R5H A;  5KFY A;  4FS2 A;  2BQU A;  2ODT X;  4IRK A;  4O7V A;  1IYD A;  5BWU A;  3H40 A;  3MR2 A;  2ALZ A;  5J2T F;  2YRW A;  5D8D A;  1GLV A;  5EZY F;  5L9X A;  3GIP A;  2VQE H;  1JX4 A;  4TV9 F;  2COI A;  5BWW A;  2FLN A;  5K2M A;  3F8N A;  1E4E A;  4YJ2 F;  5IP7 G;  1I1K A;  4FBU A;  2PN1 A;  1XK5 A;  4YR2 A;  3GQC A;  3E5N A;  2Q2U A;  2YYA A;  2FK2 A;  3H20 A;  4RNO A;  4YP3 A;  4UCV A;  2C2R A;  2HVQ A;  4UUG A;  3NBZ B;  4YBZ B;  4CKE A;  2ZDG A;  2R84 A;  2FMA A;  4F4X A;  4A3E G;  4MV3 A;  2DZD A;  2R7L A;  4MV6 A;  3TW6 A;  2MCT A;  5L1L A;  3GV8 B;  2VA2 A;  3HOU G;  4HR7 A;  1I1M A;  5H80 A;  5KFG A;  4EFB A;  3GV5 B;  3R23 A;  1XNR H;  4MTE A;  3SE7 A;  4GKK H;  4UCS A;  5I60 A;  4PZ6 A;  4CC5 A;  4A3I G;  5JQW A;  4DUY H;  4R8U B;  4DL5 A;  3U54 A;  4JI4 H;  1DGS A;  4YAJ B;  4K0K H;  3GTK A;  2JA6 A;  1I6U A;  3G6V A;  5KT7 A;  3J80 W;  4O7Y A;  4E6N A;  1ZQ7 A;  3KTM A;  4ECR A;  2CNV A;  4RCN A;  3G6X A;  3MWE A;  4ED6 A;  4HNU A;  1T3N A;  1I2L A;  1M0T A;  1K1Q A;  1I2K A;  4C2M A;  5KG5 A;  4AQY H;  3S24 A;  2E5L H;  2VOB A;  2FPG B;  4ZQI A;  2YS6 A;  5BPF A;  4A3C G;  3V6J A;  5C1P A;  5A2Q W;  4A3J G;  3TW7 A;  2EIY A;  4LF9 H;  4CE5 A;  1EKP A;  4U7C A;  3PFF A;  4PBC A;  4J9P A;  4MV7 A;  3GLK A;  4RZR A;  3Q1K A;  3PW2 A;  3GTL A;  3AX6 A;  4A3D G;  1E4G T;  1RK5 A;  5CR5 A;  2XGP A;  2YS7 A;  4B3S H;  3OUU A;  2VUM A;  3PZP A;  3TQT A;  2FJZ A;  5C3E G;  3GIK A;  2F4V H;  4ZI7 F;  4O7W A;  1O75 A;  1B6S A;  1C30 A;  2YCH A;  4O84 A;  2FK3 A;  3PN1 A;  4WHX A;  5EWE A;  5CE8 A;  4DR6 H;  5IT9 W;  5KT5 A;  4A93 G;  4DR1 H;  3M9M B;  4EBE A;  3J7A K;  2R7M A;  4GLX A;  3ORR A;  4QW8 A;  3T54 A;  2R85 A;  2ABJ A;  4QIW E;  2GPW A;  5KFR A;  2FPP B;  4CMD A;  5CA0 F;  3K3P A;  4LF6 H;  4I50 F;  4NZM A;  3T7A A;  1EHI A;  4C5A A;  4B3M H;  4EYI B;  5BWR A;  4O4H F;  1WH2 A;  2Y0S A;  4JI3 H;  4MTD A;  5DAA A;  1JIH A;  4DV2 H;  5KFD A;  1S0M A;  4WD3 A;  1Y14 B;  5BWV A;  5JVD F;  1SEI A;  4DL6 A;  2AGP A;  4DR4 H;  1GSH A;  5KX5 F;  3OHA A;  2R8H A;  4ECX A;  4NLG A;  2X5R A;  3T9B A;  1S10 A;  5CB4 F;  3Q8S B;  1KEE A;  1CS0 A;  3GIQ A;  3JRX A;  4F4Z A;  2J6S A;  3GTO A;  5HNE A;  3MR6 A;  5EWG A;  4LH6 A;  2COJ A;  3G8D A;  2CNQ A;  4XX0 B;  1AN7 A;  4QWE A;  3AW8 A;  2UVU A;  4OX9 H;  3DF7 A;  4HN2 A;  4JXU A;  4MV4 A;  2W9B B;  2VA3 A;  1RJP A;  4DR5 H;  3L4K A;  4JV0 A;  4ECT A;  3HOW G;  2RGV A;  1RJQ A;  4FFL A;  3H0G A;  4HNV A;  1DAA A;  4C5B A;  2NUA B;  5KFZ A;  4ETS A;  5DG7 A;  1IBK H;  4JV2 A;  1Y1W A;  3ORQ A;  4BWS C;  4J9O A;  4O3Q A;  3W1G A;  2R7Z A;  1JXL A;  1S9F A;  4I4T F;  1FVI A;  5KKN B;  3N44 B;  3R5X A;  2C28 A;  1B04 A;  2W6Z A;  4B3T H;  1N36 H;  1WR2 A;  5EOY A;  2V4Q A;  3C0F B;  3FKI G;  1KJQ A;  2CQY A;  4J9L A;  2E2I A;  3KHG A;  3MJF A;  4O81 A;  2NVX A;  3TII A;  2JEG A;  4FBT A;  1HNW H;  5GON F;  2HJW A;  4O7R A;  3RR5 A;  2O03 A;  4BY7 G;  5K3W A;  5JUM A;  2BQR A;  4EEQ A;  4A3G G;  2YU9 A;  3N41 B;  4RB0 A;  4YJ3 F;  4L1K A;  5KFC A;  5E25 A;  3EYY A;  4FFR A;  4NXM H;  3KYH C;  2UVW A;  3GID A;  4HNT A;  2IA6 A;  1AUX A;  3GV7 B;  2DWC A;  4DV3 H;  4CMF A;  4Q4C A;  4RU9 A;  4BBS G;  2W6P A;  1P8L A;  3TY5 A;  4JI2 H;  4QWA A;  1KJJ A;  3K5H A;  1A9X A;  3RTX A;  5LMN H;  4XYL B;  5KFU A;  3HOX G;  4IR9 A;  4IAJ A;  1S03 G;  3GB8 B;  5KG7 A;  3RB3 A;  2XCP A;  1KJI A;  4FU0 A;  4HQ6 A;  2YRX A;  3T5H A;  3GTQ A;  2V9W A;  5C4X G;  3LML A;  5D1O A;  2WE6 A;  5LXT F;  5DG8 A;  3G6Y A;  4DR3 H;  1XMQ H;  4DAA A;  5L1J A;  3VPB A;  2ZGI A;  1L2Z A;  2Y0S E;  3CSW A;  2M05 A;  3VA7 A;  4DLK A;  2EJ3 A;  4MV8 A;  5KG6 A;  3HB9 A;  3JRW A;  1BGW A;  1UC8 A;  5KT3 A;  1FKA H;  3N40 P;  5LOV F;  4F4Y A;  2I8C A;  4J9K A;  4O7L A;  2C22 A;  1IYE A;  1JLL B;  2Q2T A;  3R5F A;  5DGB A;  2ASL A;  3BAB A;  5KT6 A;  1BXR A;  1I7L A;  2W6N A;  4JI1 H;  5EWF A;  4LF4 H;  3NUA A;  2E2H A;  2R82 A;  1OWT A;  4QWC A;  5IYC G;  3M9N B;  2SCU B;  4UCT A;  1SFO A;  4KHP H;  1A3G A;  2BR0 A;  2UU9 H;  2ASJ A;  2ATL A;  4AYB A;  3T9E A;  2CFM A;  2NVY A;  4IR1 A;  3VPC A;  3GIM A;  4G3I A;  3JSN A;  4A2A A;  2R7Z G;  5DGH A;  3W1B A;  2DPI A;  3UZO A;  1TA8 A;  1JKJ B;  1SCU B;  1ULZ A;  3R9R A;  2VPS A;  3H4B A;  4FFP A;  1DV1 A;  1W93 A;  2AU0 A;  1IBM H;  4EEY A;  4J0M A;  4O7T A;  2W9C B;  2BQ3 A;  5BYA A;  5KG2 A;  3T9C A;  2B63 A;  2UXC H;  1N34 H;  3WWH A;  5FLM G;  2AGO A;  4Q45 A;  4LF5 H;  1I3Q A;  2QF7 A;  2R7K A;  4J9S A;  5KFB A;  4FFO A;  4XZ3 B;  5KFJ A;  1W96 A;  3CEB A;  2V4R A;  3N8D A;  1UNN C;  2JEI A;  1MZB A;  4J9R A;  4O7Z A;  2B63 G;  5DLF A;  1A0I A;  4AYB E;  2OWO A;  3HOY G;  2W9B A;  4ECS A;  4NZN A;  3N42 B;  2EJ0 A;  5CM0 A;  1A0G A;  3BAA A;  5DIS C;  4FGR A;  4DUZ H;  2HGS A;  4DQN A;  4DR2 H;  4Q8E A;  4U6P A;  2FE3 A;  3PO2 G;  5I5S A;  1PX2 A;  1T36 A;  3K3V A;  5KFT A;  3V4Z A;  3RAQ A;  2R92 G;  4LSX A;  1VKZ A;  2VR1 A;  5KFL A;  4ECV A;  4ED3 A;  1V51 A;  5CAE B;  5HV6 A;  1RJR A;  3Q8R B;  4DIM A;  2FLL A;  2W7P A;  4EBD A;  2HGX A;  3RJ0 A;  2HIV A;  4DV7 H;  4ECZ A;  2RDI A;  4F4W A;  1KTA A;  2W6O A;  4RB2 C;  2A1H A;  2XIG A;  3UYY A;  4M0J A;  3Q8P B;  2PBZ A;  5DQG A;  1FJG H;  4B3R H;  2R8J A;  4LFB H;  1Y1V A;  3CVZ A;  5KFP A;  4YR0 A;  4O83 A;  1J5E H;  4MAM A;  3QZ7 A;  5CA1 F;  3WO0 A;  3H0G G;  4O86 A;  5KG1 A;  3H3V H;  1GSA A;  2UVV A;  3JZF A;  4ED7 A;  4DL4 A;  2VUG A;  4IWY A;  5KFW A;  4GC6 A;  4DV5 H;  1PK8 A;  3RV4 A;  4WBN F;  4LFA H;  1OBD A;  4EFE A;  2FK1 A;  5BR8 H;  2WB1 A;  3RBD A;  1XMO H;  1WSC A;  2FPI B;  4RAZ A;  1Z2N X;  2ZDQ A;  3Q2O A;  4ECW A;  1ET0 A;  4O82 A;  1M7J A;  2W57 A;  3U9T A;  4DRF A;  2ASD A;  4ED1 A;  5L1K A;  4GKJ H;  4O2A F;  3TEK A;  5EDW A;  5KFQ A;  5KFF A;  2JA8 G;  2JEJ A;  2QK4 A;  4YR3 A;  5LYJ F;  3GIL A;  5I5W A;  3KXY T;  2YZL A;  4IHJ F;  5HBR B;  1BNC A;  1Z2P X;  2FB9 A;  2HG8 A;  4O3R A;  4J9Q A;  1AUV A;  4EBC A;  4NZO A;  2JA7 G;  4YHH H;  4FM9 A;  3PR4 A;  2YZN A;  1JDB B;  3BA8 A;  5BYB A;  1N48 A;  3VPD A;  2CZG A;  1XDN A;  2ZJT A;  2W7O A;  2HVR A;  3EPG A;  2Y4R A;  1EZ1 A;  1OBG A;  3TY9 A;  3PW7 A;  4MA0 A;  2Z02 A;  3DAA A;  4O3N A;  2V59 A;  1CKM A;  1KBL A;  3PO3 G;  2FKL A;  3T1H H;  1HR0 H;  2WYO A;  5I5X A;  3T5J A;  3T1Y H;  4BXX G;  4IRC A;  3KAJ A;  3WWI A;  3HKZ E;  2P0A A;  5DMX A;  2PMZ A;  4QW9 A;  1EYZ A;  4FE2 A;  3DTF A;  1GO3 E;  4TV8 F;  3CQZ A;  2DLN A;  2WAQ A;  1K1S A;  4LF7 H;  3SGI A;  3GTG A;  2Q7D A;  3HO8 A;  3TQ1 A;  3I12 A;  3TIN A;  3I4M G;  2X0S A;  2W9C A;  1EUC B;  5FNV F;  2WDT A;  5JH7 F;  4LSA A;  5KS8 A;  1CQJ B;  1VAJ A;  1CKN B;  4FFM A;  1VBH A;  4C5C A;  5IP9 G;  1HNX H;  5I5Y A;  3GTJ A;  3KAL A;  3MWD A;  5D1O B;  5FD5 A;  4Q43 A;  3WO1 A;  1HNZ H;  3U9S A;  3SNO A;  3W5O A;  1T94 A;  4APM A;  5KFK A;  1SYX B;  3RGZ A;  5C44 G;  1TAE A;  3BAC A;  4XYM B;  1KJ9 A;  3TY8 A;  2HDK A;  1WCM A;  4NXN H;  2GQR A;  4TVI A;  3VOT A;  2UUC H;  2V5A A;  2XGQ A;  4A3M G;  4JI6 H;  2JA5 A;  3KHR A;  4R8U A;  1M6V A;  2V58 A;  3MFH A;  4ED8 A;  1KJ8 A;  3MR3 A;  2W9A A;  4UCU A;  5D1P A;  1A48 A;  4TUY F;  2UVR A;  3U55 A;  1BJT A;  3M4I A;  3RAX A;  2YW2 A;  1N33 H;  5KG0 A;  2JA5 G;  1KT8 A;  4DL2 A;  1CE8 A;  4JI7 H;  4CKC A;  1KC7 A;  5F9L A;  2J6T A;  4JV5 H;  3MR5 A;  5LP6 F;  4Q0Y A;  1DV2 A;  1B6R A;  5DGI A;  2HVS A;  1DIK A;  2GPS A;  1M0W A;  4O7N A;  2HHF B;  4RNM A;  3HBL A;  2CKZ B;  3AYH B;  2R7N A;  3KRE A;  5JVL A;  2QYZ A;  3HXL A;  5FR9 A;  3T5L A;  4ECU A;  1EUD B;  2FP4 B;  4QJF A;  2C2E A;  3QWU A;  3T5K A;  3PW5 A;  2DPJ A;  1CQI B;  2NU8 B;  4PZ7 A;  3OHB A;  2W8L A;  2YZM A;  2DAB A;  2VQD A;  3LWB A;  4Q4D A;  2WAQ E;  4YAK B;  4O3O A;  1TWC A;  5KFI A;  1Y1W G;  1RYR A;  5FPR A;  4ME6 A;  3NGD A;  4QIW A;  3OSN A;  4FS1 A;  3HOV G;  4R7R A;  2KSW A;  4QWB A;  3KHL A;  3JZI A;  4ZOL F;  3LP8 A;  3FKI A;  4DL7 A;  3ETJ A;  4IRD A;  3N6R A;  5FJ8 G;  4DV6 H;  4A3B G;  5LA6 F;  3V6K A;  2UUB H;  2IMW P;  1I1L A;  2IBK A;  1S0O A;  2JA6 G;  1WCM G;  5KFN A;  1R9T A;  4UCO A;  5DQH A;  2XCL A;  2RDJ A;  5F9N A;  3J81 W;  3K5I A;  3EPI A;  2R92 A;  1I7N A;  4DV4 H;  3RUP A;  1RYS A;  4MA5 A;  5I5U A;  1IOV A;  1IOW A;  1N56 A;  1IBL H;  2IP4 A;  3T9D A;  3Q8Q B;  4LFC H;  2EJ2 A;  3GDE A;  4JI0 H;  2XD4 A;  5KFV A;  2DAA A;  2DIK A;  2R87 A;  3T9A A;  3VNN A;  1V9P A;  3RB4 A;  2OH2 A;  4I55 F;  2XCA A;  2W8K A;  5KFO A;  5IYD G;  1S97 A;  1B33 N;  4GC7 A;  5KG4 A;  5KFE A;  3NBY B;  4K6N A;  4X64 H;  2NU7 B;  4GLW A;  4M7E A;  1TWA A;  3ETH A;  5J2U F;  1CKO A;  3BJY A;  3PR5 B;  1TWF A;  5DGA A;  1GGO A;  3N6X A;  1KUT A;  2FLP A;  4Y8V B;  2YZG A;  4JI5 H;  2WB1 E;  5KFA A;  2W71 A;  4X62 H;  3V4S A;  4LH7 A;  3MWM A;  1I50 A;  1S68 A;  5T14 A;  4IIJ F;  3L2P A;  4RUC A;  4A2B A;  4JI8 H;  4A3K G;  4M9U A;  4J9N A;  4A3L G;  3IG0 A;  4MV9 A;  3UFX B;  5C1O A;  4EQ5 A;  4A3F G;  4TM5 A;  3PVX A;  3RB6 A;  1ZET A;  2AQ4 A;  4JYA H;  1ZHQ A;  1GYF A;  2J6U A;  4YY3 H;  3LUL A;  3T9F A;  2RF4 A;  2W6Q A;  4QSH A;  2R86 A;  5KT4 A;  1E4E B;  2YL2 A;  1Y1V G;  1N32 H;  5FLX W;  4YB8 B;  3IN5 A;  1TWH A;  3U0G A;  3BQ0 A;  4DV0 H;  3JSL A;  4Q44 A;  1V4Y A;  2R6F A;  5BPH A;  3UQ8 A;  1GSO A;  2ZM6 H;  3M9O B;  5FPO A;  1P16 A;  2QB5 A;  4TQR A;  2YWV A;  3JZ6 A;  1I94 H;  4DV1 H;  4RNN A;  4Q8F A;  3G8C A;  4PZ8 A;  2UXB H;  1VBG A;  2HIX A;  4CKB A;  1X9N A;  2UXD H;  3SI8 A;  4I7H A;  2J9G A;  3BA9 A;  4RZQ A;  3L4J A;  3OSP A;  3GTM A;  5BWX A;  2HHF A;  1S0N A;  3PW0 A;  3RGX A;  4ECY A;  4O3S A;  3HOZ G;  3KHH A;  4EGQ A;  4RUA A;  4O4L F;  4MV1 A;  4EGJ A;  5JQG F;  1WRV A;  5FD6 A;  4X65 H;  1K83 A;  2GQS A;  2UUA H;  4PDB A;  1EKF A;  1Z2O X;  4E4T A;  5KFH A;  4RB3 C;  2C35 B;  2CNU A;  3HT5 A;  3GII A;  5BMV F;  2R8G A;  4BBR G;  3BG5 A;  3WNZ A;  4JV1 A;  3T99 A;  1TWG A;  2ZDH A;  2COG A;  4DR7 H;  2JA7 A;  1E4F T;  3BQ2 A;  2AGQ A;  1G2W A;  4O4I F;  2XC9 A;  2PMZ E;  5DG9 A;  3GJX B;  5KG3 A;  3FMA A;  4ZHQ F;  4O2B F;  3I4N G;  2W6M A;  3TIG A;  4QWD A;  4TQS A;  3LQS A;  5IYZ F;  3UZB A;  1RK6 A;  1ZHS A;  3OUZ A;  3N43 B;  5I5V A;  5KFS A;  3MFI A;  4EYH B;  2Z04 A;  3GIJ A;  3BQ1 A;  2NU6 B;  4HYK A;  4DL3 A;  1XNQ H;  5KT2 A;  3GTP A;  1JDE A;  2CW8 A;  2CW7 A;  4UFZ A;  3QFF A;  3FDS A;  5DLG A;  4UCR A;  3RIZ A;  3OTO H;  2C2D A;  3JAM W;  1C3O A;  2VQF H;  3DTG A;  3QQM A;  4O4J F;  2I87 A;  1ZAU A;  2I80 A;  3RV3 A;  4IWX A;  4PWQ A;  3WWJ A;  2GLT A;  4CC6 A;  5BWT A;  2NU9 B;  5KFM A;  5IWA H;  5L1I A;  5I47 A;  5DQI A;  3QZ8 A;  5LMU H;  4O3P A;  2R8I A;  3VMM A;  2WTF A;  2HHH H;  4JUZ A;  4LMY A;  2HGW A;  2W70 A;  5LL6 b;  4J9M A;  3V6H A;  4FFN A;  5IYB G;  2R93 G;  5I5T A;  2VUM G; 
#chains in the Genus database with same CATH homology
 2PVP A;  1UC9 A;  4EG0 A;  2C00 A;  2VPQ A;  2OLS A;  4IZO A;  5C8Y F;  4NYE A;  3KAK A;  3RFC A;  4O7S A;  3R5H A;  4O7V A;  5J2T F;  2YRW A;  5D8D A;  1GLV A;  5EZY F;  4TV9 F;  5K2M A;  1E4E A;  4YJ2 F;  2PN1 A;  3E5N A;  2YYA A;  4YBZ B;  2ZDG A;  2R84 A;  4MV3 A;  2DZD A;  2R7L A;  4MV6 A;  3TW6 A;  4HR7 A;  5H80 A;  3R23 A;  3SE7 A;  5JQW A;  3U54 A;  4YAJ B;  4O7Y A;  2CNV A;  3MWE A;  4HNU A;  1M0T A;  2FPG B;  4ZQI A;  2YS6 A;  5BPF A;  5C1P A;  3GLK A;  4MV7 A;  3Q1K A;  3AX6 A;  2YS7 A;  3OUU A;  3TQT A;  4ZI7 F;  4O7W A;  1B6S A;  1C30 A;  4O84 A;  2R7M A;  3ORR A;  2R85 A;  2GPW A;  5CA0 F;  2FPP B;  3K3P A;  4I50 F;  1EHI A;  4C5A A;  4O4H F;  4WD3 A;  1GSH A;  5KX5 F;  5CB4 F;  1KEE A;  1CS0 A;  3JRX A;  3G8D A;  2CNQ A;  4XX0 B;  3AW8 A;  3DF7 A;  4MV4 A;  4FFL A;  4HNV A;  4C5B A;  2NUA B;  3ORQ A;  4I4T F;  5KKN B;  3R5X A;  2W6Z A;  1WR2 A;  1KJQ A;  2CQY A;  3MJF A;  4O81 A;  3TII A;  5GON F;  2HJW A;  4O7R A;  4YJ3 F;  4L1K A;  4FFR A;  3GID A;  4HNT A;  1AUX A;  2DWC A;  2W6P A;  1KJJ A;  1A9X A;  3K5H A;  4XYL B;  1KJI A;  4FU0 A;  4HQ6 A;  2YRX A;  5LXT F;  3VPB A;  3VA7 A;  4DLK A;  4MV8 A;  3HB9 A;  3JRW A;  1UC8 A;  5LOV F;  2I8C A;  4O7L A;  1JLL B;  3R5F A;  1BXR A;  1I7L A;  2W6N A;  3NUA A;  2R82 A;  2SCU B;  3VPC A;  1JKJ B;  1SCU B;  1ULZ A;  3R9R A;  4FFP A;  1DV1 A;  1W93 A;  4O7T A;  2QF7 A;  2R7K A;  4FFO A;  4XZ3 B;  1W96 A;  3N8D A;  4O7Z A;  4FGR A;  2HGS A;  1PX2 A;  1T36 A;  3V4Z A;  1VKZ A;  2VR1 A;  5CAE B;  5HV6 A;  4DIM A;  2W6O A;  2PBZ A;  4O83 A;  4MAM A;  5CA1 F;  3WO0 A;  4O86 A;  1GSA A;  3JZF A;  4IWY A;  1PK8 A;  3RV4 A;  4WBN F;  1OBD A;  2FPI B;  1Z2N X;  2ZDQ A;  3Q2O A;  4O82 A;  3U9T A;  4O2A F;  2QK4 A;  5LYJ F;  2YZL A;  4IHJ F;  5HBR B;  1BNC A;  1Z2P X;  2FB9 A;  1AUV A;  2YZN A;  1JDB B;  3VPD A;  2CZG A;  1EZ1 A;  1OBG A;  4MA0 A;  2Z02 A;  2V59 A;  1KBL A;  2WYO A;  3KAJ A;  4FFN A;  2P0A A;  5DMX A;  1EYZ A;  4FE2 A;  4TV8 F;  2DLN A;  3HO8 A;  3I12 A;  3TIN A;  2X0S A;  1EUC B;  5FNV F;  5JH7 F;  1CQJ B;  4FFM A;  1VBH A;  4C5C A;  3KAL A;  3MWD A;  3WO1 A;  3U9S A;  4XYM B;  1KJ9 A;  2GQR A;  3VOT A;  2V5A A;  1M6V A;  2V58 A;  1KJ8 A;  1A48 A;  4TUY F;  3U55 A;  2YW2 A;  1CE8 A;  1KC7 A;  5LP6 F;  1DV2 A;  1B6R A;  1DIK A;  2GPS A;  1M0W A;  4O7N A;  3HBL A;  2R7N A;  3KRE A;  5JVL A;  1EUD B;  2FP4 B;  1CQI B;  2NU8 B;  2YZM A;  3LWB A;  2VQD A;  4YAK B;  4ME6 A;  3JZI A;  4ZOL F;  3LP8 A;  3ETJ A;  3N6R A;  5LA6 F;  2XCL A;  3K5I A;  1I7N A;  3RUP A;  4MA5 A;  1IOV A;  1IOW A;  2IP4 A;  2XD4 A;  2DIK A;  2R87 A;  4I55 F;  2NU7 B;  3ETH A;  5J2U F;  1GGO A;  1KUT A;  4Y8V B;  2YZG A;  2W71 A;  3V4S A;  4IIJ F;  4M9U A;  4MV9 A;  3UFX B;  5C1O A;  2W6Q A;  4QSH A;  2R86 A;  1E4E B;  2YL2 A;  4YB8 B;  2R6F A;  5BPH A;  1GSO A;  2YWV A;  3G8C A;  1VBG A;  2J9G A;  4RZQ A;  4EGQ A;  4O4L F;  4MV1 A;  4EGJ A;  5JQG F;  2GQS A;  1Z2O X;  4E4T A;  2CNU A;  5BMV F;  3BG5 A;  3WNZ A;  2ZDH A;  4O4I F;  4ZHQ F;  4O2B F;  2W6M A;  3TIG A;  5IYZ F;  3OUZ A;  2Z04 A;  2NU6 B;  1JDE A;  3QFF A;  1C3O A;  2I87 A;  4O4J F;  2I80 A;  3RV3 A;  4IWX A;  2GLT A;  2NU9 B;  5I47 A;  3VMM A;  2W70 A;  5JVD F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...