4XZ3B

Ca. korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 (se-met derivative) in complex with coenzyme a and mg-amppcp, phosphohistidine segment pointing towards nucleotide binding site
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
228
structure length
228
Chain Sequence
b'SRDLLLKAKENGRKSLLEHEAKYFISSYGIPVTNIRLAKSEEEAVNFSREIGFPVVLKIVSPQVVHKSDVGGVKVNLRSEEEVRKAYREIIENVKRNVPNAEIEGILVQEFAPPGVELIIGLLRDPQFGPTVMFGLGGVFVELFRDVSFRVAPLSEQDAESMIKEVKAYKLLTGFRGMEPVDIEAIKDALIRAGRIGVENEEIAEMDLNPVIAYPKGIKVVDARIILR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl-CoA synthetase (NDP forming)
molecule tags Ligase
source organism Candidatus korarchaeum cryptofilum opf8
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
total genus 66
structure length 228
sequence length 228
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13549 ATP-grasp_5 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4xz3B01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4xz3B02
4HNTA 4HQ6A 4QSHA 1JKJB 3AX6A 2Z02A 2J9GA 4O4JF 5C1PA 2R86A 1Z2NX 5CAEB 4FFLA 4MV8A 4YJ3F 1GSAA 1CQJB 5CA1F 1CQIB 2SCUB 1EHIA 3VMMA 2NUAB 2W6MA 4ZQIA 1A9XA 1EZ1A 1PK8A 3R5XA 1M0WA 4MA0A 2P0AA 2W70A 4EGQA 4O7TA 3K5HA 5FNVF 5LP6F 3JRWA 3HO8A 5DMXA 5BPHA 4I50F 3V4ZA 4XYMB 2CNVA 2VR1A 2I87A 3G8DA 4O7WA 2GLTA 4O2BF 3MWDA 4O83A 3ETJA 3I12A 5JQGF 2ZDHA 3G8CA 3AW8A 4FFNA 1IOWA 4IWYA 1OBDA 5K2MA 4HNUA 4YJ2F 3JZIA 3JZFA 5KKNB 1KJJA 2QF7A 3VA7A 4FFOA 2R7KA 5LYJF 3DF7A 4O4LF 4E4TA 4I4TF 2YL2A 3ETHA 1W96A 2X0SA 4O7RA 3VPCA 4C5CA 4IWXA 5EZYF 4O4IF 4TUYF 2R87A 4YBZB 2W71A 2FPGB 1A48A 4M9UA 2ZDGA 2XCLA 1JLLB 2OLSA 2NU6B 2NU8B 2R7MA 2GPWA 3MJFA 4C5BA 1I7NA 2R84A 1GGOA 3WO0A 1WR2A 3K5IA 3ORQA 3VOTA 2YZNA 1DV1A 3U9TA 1I7LA 1BXRA 4FE2A 2YYAA 1B6SA 4XYLB 4ME6A 3N6RA 4IHJF 1KBLA 5JH7F 3KAJA 1M0TA 2W6ZA 5KX5F 4ZI7F 3GIDA 3RV3A 1KUTA 2R6FA 1DIKA 4C5AA 1EUCB 3U9SA 3TIIA 2W6OA 5IYZF 4TV9F 4O4HF 1B6RA 2V59A 4MV1A 2NU7B 3VPDA 3NUAA 3V4SA 2I8CA 4O84A 2CNUA 1GSHA 1C3OA 1VBGA 2FPIB 2V5AA 1C30A 4IIJF 5J2UF 4O7NA 4O7SA 2GPSA 2PBZA 3RFCA 3VPBA 1KJ8A 2NU9B 4FFPA 2PVPA 2YZGA 3RV4A 2QK4A 3TQTA 2I80A 1VKZA 3MWEA 2YWVA 2YW2A 5C8YF 1SCUB 1CS0A 1AUVA 1BNCA 3U54A 2Z04A 2HJWA 3TW6A 4XX0B 2DLNA 3R23A 4O7VA 5LA6F 5C1OA 1VBHA 1UC8A 3ORRA 4O2AF 2PN1A 2R82A 2XD4A 4O7YA 5BMVF 3KAKA 5CA0F 4DLKA 3UFXB 3U55A 3Q2OA 3E5NA 3KREA 4HNVA 4MV6A 5BPFA 5JVDF 2R7NA 3K3PA 4I55F 1KJQA 2W6NA 5HV6A 2YS6A 2HGSA 2IP4A 2DWCA 5H80A 5HBRB 3WNZA 4TV8F 5J2TF 4IZOA 4MA5A 3R5FA 3R5HA 3SE7A 2FP4B 5CB4F 2ZDQA 3QFFA 1JDBB 4EGJA 2C00A 2YRXA 2GQRA 4MAMA 4O82A 2W6PA 1DV2A 4MV9A 3RUPA 3OUUA 5LXTF 3KALA 2WYOA 4MV4A 1OBGA 4WD3A 1ULZA 1IOVA 4MV3A 3GLKA 3TINA 1Z2PX 2VPQA 5LOVF 3OUZA 4FU0A 2R7LA 2YZMA 2V58A 3N8DA 1KEEA 1GSOA 4EG0A 1W93A 3JRXA 1GLVA 5JVLA 2YRWA 2VQDA 3R9RA 4ZOLF 4MV7A 4O7ZA 4DIMA 5GONF 1E4EB 2CQYA 4XZ3B 2FPPB 3WO1A 2CZGA 1JDEA 1KJIA 4L1KA 1T36A 3HBLA 3BG5A 4O7LA 4Y8VB 3LP8A 4FFMA 1UC9A 4WBNF 1AUXA 1EUDB 2CNQA 3Q1KA 5JQWA 4YB8B 1KJ9A 2W6QA 3HB9A 5I47A 4HR7A 5D8DA 4YAJB 4NYEA 1E4EA 4RZQA 1M6VA 1KC7A 1EYZA 4YAKB 2YZLA 2R85A 1CE8A 2DZDA 4ZHQF 1Z2OX 2FB9A 4O81A 3TIGA 2DIKA 4FFRA 4FGRA 4O86A 3LWBA 2GQSA 2YS7A 1PX2A
chains in the Genus database with same CATH superfamily
4HNTA 4HQ6A 4QSHA 4CE5A 4YY3H 3RB6A 2Y0SE 1JKJB 3AX6A 2Z02A 2J9GA 3L2PA 1N48A 5EWFA 4O4JF 1T3NA 1RK5A 4ECSA 2WAQE 5C1PA 1TWCA 2R86A 1Z2NX 2UUCH 4LFBH 5CAEB 4FFLA 4MV8A 5KFWA 5KFPA 4ECRA 2JEIA 3BQ0A 1ZAUA 5KFKA 2J6SA 3UQ8A 4YJ3F 2C22A 3L4JA 4F4ZA 1XDNA 4GLXA 3PR5B 2RGVA 3W1BA 4J9RA 3PW2A 3RBDA 3H0GA 5LMUH 2W57A 4JV0A 4MTEA 2C2DA 2A1HA 2WAQA 2DPJA 2KSWA 1GSAA 2JEGA 2RGRA 3HOYG 4ED6A 2HHFB 2NVXA 1CQJB 5CA1F 3PR4A 3VNNA 2RF4A 2WE6A 4QWEA 5L1KA 2XGQA 3M4IA 4R8UA 1CQIB 3HOVG 5CE8A 2VA2A 1CKNA 2SCUB 1EHIA 3VMMA 4CMFA 5DQGA 2NUAB 2W6MA 4ZQIA 1TWAA 1A9XA 5DQIA 2V4RA 4A3FG 1ZETA 2JA7A 4J9LA 5CR5A 4DV1H 4FM9A 3BQ2A 1IYEA 1A0GA 1EZ1A 3BACA 4APMA 2W9CA 1PK8A 2R8HA 3R5XA 1M0WA 4MA0A 2P0AA 2W70A 2Q7DA 4EGQA 5BWUA 2NVYA 3GIQA 4X66H 4O7TA 3GV8B 3T1HH 2EJ3A 3K5HA 5KT3A 4NXNH 3HOWG 5FNVF 5LP6F 4DL3A 1GYFA 3NBZB 3JRWA 3HO8A 5DMXA 1V9PA 5BPHA 5DQHA 4I50F 3V4ZA 5KFTA 5KG4A 4ECYA 1N36H 2FLPA 2ASDA 4XYMB 5BWTA 2DABA 2CNVA 4RNMA 4EYHB 2VR1A 3J80W 3J81W 3MR3A 3HOUG 2I87A 3G8DA 4O7WA 3BAAA 4GC6A 3PZPA 2GLTA 4O2BF 3S24A 4AQYH 2HGWA 3MWDA 3EPIA 5KFIA 3PO3G 3T1YH 4O83A 3FDSA 3W1GA 3ETJA 4AYBA 3I12A 5EDWA 4HYKA 5JQGF 5FD6A 1IBKH 2ZDHA 2VA3A 5I60A 3PN1A 3AW8A 3G8CA 4FFNA 1IOWA 4IWYA 5KFQA 2R7ZG 4BBSG 4YR0A 1OBDA 2UUBH 5K2MA 2CW7A 2HHFA 4HNUA 2VPSA 4YJ2F 3T9AA 2XCAA 4ECQA 2V9WA 4IR1A 3TY8A 1N56A 1IBLH 5KFNA 3JZIA 4J9OA 2ABJA 4RB2C 3JZFA 4FBUA 1SEIA 1S10A 4B3RH 1AN7A 3G6XA 2UU9H 1JX4A 4A3LG 5KKNB 1KJJA 2QF7A 3CVZA 4QWCA 5IYDG 5I5SA 2XC9A 5KFFA 4FFOA 2R7KA 3NC0B 5LYJF 3DF7A 3VA7A 2FMAA 3H40A 4O4LF 4E4TA 5KFXA 5JUMA 4I4TF 3GIKA 5FR9A 4LF8H 2C2EA 2YL2A 3EPGA 3ETHA 2ASJA 1WSCA 2R8KA 2Q2TA 2R8JA 2BQRA 2CKZB 1W96A 2X0SA 3N44B 5KT4A 5KFLA 1N32H 3DAAA 3W5OA 1TWHA 3V6KA 3SI8A 4C2MA 1VS0A 4O7RA 5E25A 4JI3H 3QZ7A 3VPCA 5KG1A 2BR0A 4DL5A 4C5CA 2HVSA 4DV0H 2UXBH 4BBRG 2PMZA 4O3NA 4DR1H 1RJPA 4ED0A 5IWAH 4IWXA 1HNZH 5IP9G 3C0FB 5EZYF 4O4IF 4UCVA 3MR5A 4IR9A 2VUMG 4O3PA 5KS8A 2FLLA 4TUYF 3RAQA 2R87A 4YBZB 4CKBA 5BWRA 3GTQA 1V51A 1J5EH 3PW5A 1G2WA 2ATLA 1B33N 4F4XA 3RB4A 4RCNA 3T5KA 3TW7A 2IBKA 4Q43A 4DR2H 4CC6A 2W71A 3KYHC 1S0MA 2FPGB 4EEYA 5LL6b 2FK2A 2CW8A 2W8KA 1A48A 3RAXA 2JA7G 3T7AA 1RYRA 4M9UA 1WCMG 4JI5H 2ZDGA 5I5TA 4UCTA 4RB1A 2XCLA 2FKLA 1XMOH 4YQWA 1JLLB 4X62H 2OLSA 4DR7H 2NU6B 4J9QA 2W9AA 4IRCA 3MR6A 3GQCA 2NU8B 4MTDA 5HNEA 1I1MA 2RDJA 1ZHSA 3N41B 4A3IG 4ECWA 2R7MA 5BYAA 4TQSA 5DLFA 2IMWP 4PZ7A 3FKIA 1HR0H 1I1KA 4JI6H 4JI0H 2GPWA 3MJFA 4C5BA 5KG2A 3M9OB 4A2AA 5BYBA 1I7NA 2R84A 3KHRA 4JI1H 3GIMA 1I6UA 1GGOA 4PZ8A 4ED3A 2EIYA 3WO0A 1A3GA 3T5HA 4K0KH 1WR2A 4LFAH 3K5IA 3ORQA 3VOTA 4Q4CA 4LFCH 4PDBA 5KFGA 2JA6A 5FPOA 1GO3E 2VQEH 2YZNA 5KFVA 2ZM6H 4ECVA 1Y1WG 3I4MG 4EBCA 1DV1A 3GV5B 3U9TA 4ED2A 5FPRA 1I7LA 4DR5H 2IA6A 3GTGA 1B04A 4CMDA 3IN5A 1BXRA 4FE2A 3GTJA 3N42B 1KT8A 5DAAA 2YYAA 4LF5H 4Q8FA 2AU0A 4UCOA 2W8LA 5IP7G 5KT5A 3GIPA 3BQ1A 1B6SA 4XYLB 4J9SA 4ME6A 3RGZA 4LSXA 4DL4A 3N6RA 4IHJF 5I5XA 1KBLA 5KFZA 4Q8EA 3T9FA 2ALZA 4JYAH 1KTAA 3T9EA 5EWGA 2R92A 3QWUA 5JH7F 1S68A 3CQZA 1RJQA 1P8LA 3SGIA 4NZOA 5KFJA 3KAJA 4PZ6A 4EFBA 1M0TA 2VQFH 2XCPA 2W6ZA 5KX5F 4BY1G 3MFHA 4DUYH 2E5LH 1FJGH 4A93G 2DAAA 1S03G 4DV4H 1CKNB 1ZQ7A 4EQ5A 4ZI7F 3GIDA 4NZNA 1T94A 3HKZA 4RAZA 3Q8SB 1EKPA 2ZGIA 3RV3A 3T9CA 1KUTA 4TQRA 4QWDA 2AGPA 3LQSA 5I5UA 2R6FA 3PO2G 4ECTA 1DIKA 2F4VH 3QQMA 3TY9A 4C5AA 3TY5A 1EUCB 3JSNA 3U9SA 3TIIA 1V4YA 2W6OA 2Y0SA 4DQNA 5IYZF 4ED8A 4TV9F 4LMYA 4DL7A 3GJXB 1OWTA 5KFHA 5FLMG 5DGAA 4O4HF 4ECUA 4DUZH 4CKCA 1I3QA 1JIHA 4JV2A 1I2KA 4EYIB 1B6RA 4TVIA 5IYBG 1X9NA 2EJ2A 2V59A 1S9FA 3GTLA 3SNOA 4MV1A 4A2BA 3RR5A 4DR3H 2NU7B 5D1PA 3H4BA 4UCUA 3VPDA 5C44G 2QB5A 1K1SA 2FK3A 5KFOA 3NUAA 3V4SA 4O3QA 1JXLA 2I8CA 4O84A 4JI2H 2R8IA 2CNUA 1GSHA 1C3OA 1VBGA 1SYXB 2FPIB 2UVVA 3PW7A 2JA8G 2V5AA 2COGA 1C30A 4IIJF 3UZOA 4CHIA 3GIJA 4O7NA 5J2UF 4LH7A 1MZBA 3HOZG 4O7SA 4GKKH 1HNWH 2GPSA 2PBZA 3RFCA 3VPBA 1KJ8A 2UVRA 2NU9B 4FFPA 2B63G 2PVPA 2YZGA 3KHGA 1DAAA 3RV4A 5KG6A 1E4FT 2YU9A 2QK4A 3K3VA 2HG8A 3TQTA 2I80A 5BWXA 3Q8PB 1VKZA 4ECZA 4NXMH 3MWEA 2YWVA 5L9XA 2YW2A 4JXUA 3M9MB 4DL2A 3PW0A 2FLNA 5C8YF 1SCUB 1CS0A 3HXLA 1I94H 4QIWE 1AUVA 1BNCA 3U54A 4Q44A 4EFEA 5BWVA 3GILA 1O75A 2Z04A 4YP3A 2HJWA 3LMLA 1S0OA 1SFOA 4JV1A 4LH6A 4LF4H 3TW6A 3WWJA 4FS1A 1TAEA 2Y4RA 4XX0B 3T54A 2DLNA 3R23A 2WDTA 2BQUA 5C4XG 5BWWA 5KT6A 2HDKA 4O7VA 5LA6F 5C1OA 3NGDA 1UC8A 1VBHA 2WTFA 5KFSA 1E4GT 3ORRA 5DG8A 4O2AF 2PN1A 1ZHQA 1S97A 3GDEA 4A3CG 2R82A 2HIVA 4J9KA 2XD4A 4O7YA 4KHPH 3JAMW 3PW4A 2AQ4A 5BMVF 2PMZE 4QIWA 5KG3A 3KAKA 3GTOA 4IAJA 5LMNH 2AGOA 2OWOA 3V6HA 3OSPA 5CA0F 3RBEA 1L2ZA 1Y1VG 3IG0A 4DLKA 3UFXB 1RJRA 4IRKA 3U55A 3T9DA 2AGQA 4J0MA 3Q2OA 5KT7A 2COJA 2J6TA 4NLGA 3E5NA 3KREA 4HNVA 5L1IA 2HGXA 2RDIA 4Q45A 5L1LA 4GKJH 3HKZE 3UZBA 4MV6A 2JA6G 1VAJA 3QZ8A 4J9NA 3RF2A 1DGSA 5EOYA 2C28A 1K1QA 3T5JA 5BPFA 5JVDF 2R7NA 3GTKA 1IYDA 1EKFA 3K3PA 2R93A 3N40P 4U7CA 4DR4H 2E2IA 3FKIG 4I55F 3NBYB 1KJQA 2VUGA 3V6JA 4A3KG 5C5JA 2UVUA 1UNNC 4A3DG 2W6NA 1XK5A 5HV6A 1CKOA 2YS6A 5K3WA 3KXYT 1RYSA 2UUAH 4RNNA 4F50A 5KFMA 2HGSA 1BGWA 4RUAA 2JEFA 4IRDA 4QW9A 4LF6H 4G3IA 5DGIA 2IP4A 5C3EG 3GTMA 3Q8QB 3RB3A 2X5RA 1TWFA 5I5WA 4ETSA 4QWAA 3PFFA 4BXXG 3N43B 4JV5H 2E2HA 5BR8H 2DWCA 2BQ3A 5H80A 5HBRB 3RGXA 4OX9H 4JI8H 5KG0A 3WNZA 1R9TA 3JZ6A 5DG9A 2WB1E 4TV8F 5J2TF 3RIZA 4UCRA 4IZOA 4EEQA 3T5LA 1N34H 2UXDH 3BA8A 1CKMA 4RNOA 4MA5A 3R5FA 2FE3A 2MCTA 3L4KA 3PVXA 4O3SA 3R5HA 3SE7A 2QYZA 4U6PA 2FP4B 5D1OA 3G6YA 4UFZA 4ED7A 5CB4F 2ZDQA 3H3VH 5KFEA 3QFFA 3WWIA 3HT5A 1JDBB 2CFMA 4B3MH 4QJFA 2R93G 2JA5G 4EGJA 3T99A 2C00A 2YRXA 4RB0A 3U0GA 1XMQH 3DTFA 4DR6H 3OSNA 4CC5A 3LULA 1TWGA 3CSWA 5A2QW 5L1JA 2DPIA 2GQRA 4MAMA 5FD5A 4O82A 1A0IA 2W6PA 1DV2A 4MV9A 3RUPA 4RAYA 4AYBE 3H4DA 3DTGA 2XGPA 4J9MA 2C2RA 4YHHH 5T14A 3OUUA 2R92G 5LXTF 4QWBA 3KALA 4E6NA 2HVRA 4X64H 1HNXH 2HIXA 4RU9A 4DL6A 2WYOA 4MV4A 1BJTA 1I2LA 5FLXW 4FS2A 3J7AK 4A3BG 4M7EA 2M05A 1OBGA 4LF9H 1M7JA 3AYHB 1ULZA 4WD3A 2J6UA 1IOVA 5FJ8G 4LF7H 1EKVA 4MV3A 3BABA 3GLKA 1Y1VA 2UVWA 3TINA 1Z2PX 2VPQA 2OH2A 5LOVF 2COIA 3OUZA 4FU0A 2R7LA 2YZMA 4JUZA 2V58A 3N8DA 1I50A 3KHLA 4EBEA 2JA5A 1KEEA 2O03A 1GSOA 4EG0A 4DV6H 3MR2A 4HN2A 3HOXG 3MFIA 3MWMA 4DV7H 1W93A 4PWQA 5F9LA 3JRXA 1GLVA 5JVLA 5KFUA 4RUCA 5DG7A 2W9CB 2YRWA 2VQDA 3R9RA 4DAAA 4RB3C 1XNRH 3T9BA 4ZOLF 4YR3A 3GIIA 4MV7A 3KTMA 3GTPA 2VUMA 4DV3H 2W7PA 1N33H 4O7ZA 4DIMA 5I5VA 4TM5A 5GONF 4UCSA 1E4EB 2CQYA 4XZ3B 2XIGA 5DGBA 2V4QA 4QW8A 2FPPB 1S0NA 2HHHH 3WO1A 4F4YA 4J9PA 1Y1WA 2CZGA 5KFRA 4DV5H 1JDEA 1KJIA 4F4WA 2FJZA 4B3TH 1IBMH 4L1KA 1T36A 5IT9W 3RTXA 1WH2A 2W9BA 3HBLA 5EWEA 5CM0A 1TA8A 3WWHA 3BG5A 4ED1A 5DLGA 2W7OA 2HVQA 5I5YA 2B63A 4O7LA 4O3OA 3EYYA 5KFAA 4Y8VB 4YR2A 3LP8A 3OTOH 4A3MG 3OHAA 4FFMA 4NZMA 4B3SH 4I7HA 3BA9A 4JI4H 1UC9A 3M9NB 3TQ1A 4WBNF 1Y14B 1WCMA 5KG7A 4EBDA 4Q0YA 5KFCA 4A3JG 1AUXA 3N6XA 2ZJTA 1XNQH 4GC7A 1FVIA 5KFYA 4A3EG 1EUDB 4A3GG 5DGHA 3GB8B 2EJ0A 1RK6A 1K83A 1I1LA 2CNQA 1FKAH 3Q1KA 5DISC 4WHXA 5JQWA 3Q8RB 3H0GG 5F9NA 4YB8B 1KJ9A 2W6QA 3TEKA 2Q2UA 2VOBA 3HB9A 4LSAA 5I47A 5IYCG 3G6VA 4HR7A 4DV2H 4O3RA 5D8DA 3H20A 4YAJB 2C35B 4R7RA 4BWSC 4ECXA 4NYEA 2JEJA 3UYYA 1E4EA 4CKEA 2UXCH 1ET0A 4M0JA 4RZQA 2YCHA 3JSLA 4BY7G 1M6VA 1KC7A 1EYZA 4YAKB 2YZLA 2R85A 2ODTX 4K6NA 5KG5A 2W9BB 3BJYA 4JI7H 3RJ0A 4R8UB 1CE8A 2DZDA 4ZHQF 4FBTA 3RB0A 4X65H 1Z2OX 3GV7B 2FB9A 4O81A 5KT2A 3TIGA 5D1OB 2DIKA 4UUGA 4DRFA 5KFBA 4GLWA 3OHBA 5KFDA 2WB1A 3CEBA 1P16A 4PBCA 3I4NG 3KHHA 4FFRA 4FGRA 2ASLA 4Q4DA 4O86A 3LWBA 1WRVA 3F8NA 2R7ZA 4RZRA 2R8GA 2GQSA 3FMAA 2YS7A 1PX2A 2FK1A
chains in the Genus database with same CATH topology
4HNTA 4HQ6A 4QSHA 1JKJB 3AX6A 2Z02A 2J9GA 4O4JF 5C1PA 2R86A 1Z2NX 5CAEB 4FFLA 4MV8A 4YJ3F 1GSAA 1CQJB 5CA1F 1CQIB 2SCUB 1EHIA 3VMMA 2NUAB 2W6MA 4ZQIA 1A9XA 1EZ1A 1PK8A 3R5XA 1M0WA 4MA0A 2P0AA 2W70A 4EGQA 4O7TA 3K5HA 5FNVF 5LP6F 3JRWA 3HO8A 5DMXA 5BPHA 4I50F 3V4ZA 4XYMB 2CNVA 2VR1A 2I87A 3G8DA 4O7WA 2GLTA 4O2BF 3MWDA 4O83A 3ETJA 3I12A 5JQGF 2ZDHA 3G8CA 3AW8A 4FFNA 1IOWA 4IWYA 1OBDA 5K2MA 4HNUA 4YJ2F 3JZIA 3JZFA 5KKNB 1KJJA 2QF7A 3VA7A 4FFOA 2R7KA 5LYJF 3DF7A 4O4LF 4E4TA 4I4TF 2YL2A 3ETHA 1W96A 2X0SA 4O7RA 3VPCA 4C5CA 4IWXA 5EZYF 4O4IF 4TUYF 2R87A 4YBZB 2W71A 2FPGB 1A48A 4M9UA 2ZDGA 2XCLA 1JLLB 2OLSA 2NU6B 2NU8B 2R7MA 2GPWA 3MJFA 4C5BA 1I7NA 2R84A 1GGOA 3WO0A 1WR2A 3K5IA 3ORQA 3VOTA 2YZNA 1DV1A 3U9TA 1I7LA 1BXRA 4FE2A 2YYAA 1B6SA 4XYLB 4ME6A 3N6RA 4IHJF 1KBLA 5JH7F 3KAJA 1M0TA 2W6ZA 5KX5F 4ZI7F 3GIDA 3RV3A 1KUTA 2R6FA 1DIKA 4C5AA 1EUCB 3U9SA 3TIIA 2W6OA 5IYZF 4TV9F 4O4HF 1B6RA 2V59A 4MV1A 2NU7B 3VPDA 3NUAA 3V4SA 2I8CA 4O84A 2CNUA 1GSHA 1C3OA 1VBGA 2FPIB 2V5AA 1C30A 4IIJF 5J2UF 4O7NA 4O7SA 2GPSA 2PBZA 3RFCA 3VPBA 1KJ8A 2NU9B 4FFPA 2PVPA 2YZGA 3RV4A 2QK4A 3TQTA 2I80A 1VKZA 3MWEA 2YWVA 2YW2A 5C8YF 1SCUB 1CS0A 1AUVA 1BNCA 3U54A 2Z04A 2HJWA 3TW6A 4XX0B 2DLNA 3R23A 4O7VA 5LA6F 5C1OA 1VBHA 1UC8A 3ORRA 4O2AF 2PN1A 2R82A 2XD4A 4O7YA 5BMVF 3KAKA 5CA0F 4DLKA 3UFXB 3U55A 3Q2OA 3E5NA 3KREA 4HNVA 4MV6A 5BPFA 5JVDF 2R7NA 3K3PA 4I55F 1KJQA 2W6NA 5HV6A 2YS6A 2HGSA 2IP4A 2DWCA 5H80A 5HBRB 3WNZA 4TV8F 5J2TF 4IZOA 4MA5A 3R5FA 3R5HA 3SE7A 2FP4B 5CB4F 2ZDQA 3QFFA 1JDBB 4EGJA 2C00A 2YRXA 2GQRA 4MAMA 4O82A 2W6PA 1DV2A 4MV9A 3RUPA 3OUUA 5LXTF 3KALA 2WYOA 4MV4A 1OBGA 4WD3A 1ULZA 1IOVA 4MV3A 3GLKA 3TINA 1Z2PX 2VPQA 5LOVF 3OUZA 4FU0A 2R7LA 2YZMA 2V58A 3N8DA 1KEEA 1GSOA 4EG0A 1W93A 3JRXA 1GLVA 5JVLA 2YRWA 2VQDA 3R9RA 4ZOLF 4MV7A 4O7ZA 4DIMA 5GONF 1E4EB 2CQYA 4XZ3B 2FPPB 3WO1A 2CZGA 1JDEA 1KJIA 4L1KA 1T36A 3HBLA 3BG5A 4O7LA 4Y8VB 3LP8A 4FFMA 1UC9A 4WBNF 1AUXA 1EUDB 2CNQA 3Q1KA 5JQWA 4YB8B 1KJ9A 2W6QA 3HB9A 5I47A 4HR7A 5D8DA 4YAJB 4NYEA 1E4EA 4RZQA 1M6VA 1KC7A 1EYZA 4YAKB 2YZLA 2R85A 1CE8A 2DZDA 4ZHQF 1Z2OX 2FB9A 4O81A 3TIGA 2DIKA 4FFRA 4FGRA 4O86A 3LWBA 2GQSA 2YS7A 1PX2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HNT A;  4HQ6 A;  4QSH A;  1JKJ B;  3AX6 A;  2Z02 A;  2J9G A;  4O4J F;  5C1P A;  2R86 A;  1Z2N X;  5CAE B;  4FFL A;  4MV8 A;  4YJ3 F;  1GSA A;  1CQJ B;  5CA1 F;  1CQI B;  2SCU B;  1EHI A;  3VMM A;  2NUA B;  2W6M A;  4ZQI A;  1A9X A;  1EZ1 A;  1PK8 A;  3R5X A;  1M0W A;  4MA0 A;  2P0A A;  2W70 A;  4EGQ A;  4O7T A;  3K5H A;  5FNV F;  5LP6 F;  3JRW A;  3HO8 A;  5DMX A;  5BPH A;  4I50 F;  3V4Z A;  4XYM B;  2CNV A;  2VR1 A;  2I87 A;  3G8D A;  4O7W A;  2GLT A;  4O2B F;  3MWD A;  4O83 A;  3ETJ A;  3I12 A;  5JQG F;  2ZDH A;  3G8C A;  3AW8 A;  4FFN A;  1IOW A;  4IWY A;  1OBD A;  5K2M A;  4HNU A;  4YJ2 F;  3JZI A;  3JZF A;  5KKN B;  1KJJ A;  2QF7 A;  3VA7 A;  4FFO A;  2R7K A;  5LYJ F;  3DF7 A;  4O4L F;  4E4T A;  4I4T F;  2YL2 A;  3ETH A;  1W96 A;  2X0S A;  4O7R A;  3VPC A;  4C5C A;  4IWX A;  5EZY F;  4O4I F;  4TUY F;  2R87 A;  4YBZ B;  2W71 A;  2FPG B;  1A48 A;  4M9U A;  2ZDG A;  2XCL A;  1JLL B;  2OLS A;  2NU6 B;  2NU8 B;  2R7M A;  2GPW A;  3MJF A;  4C5B A;  1I7N A;  2R84 A;  1GGO A;  3WO0 A;  1WR2 A;  3K5I A;  3ORQ A;  3VOT A;  2YZN A;  1DV1 A;  3U9T A;  1I7L A;  1BXR A;  4FE2 A;  2YYA A;  1B6S A;  4XYL B;  4ME6 A;  3N6R A;  4IHJ F;  1KBL A;  5JH7 F;  3KAJ A;  1M0T A;  2W6Z A;  5KX5 F;  4ZI7 F;  3GID A;  3RV3 A;  1KUT A;  2R6F A;  1DIK A;  4C5A A;  1EUC B;  3U9S A;  3TII A;  2W6O A;  5IYZ F;  4TV9 F;  4O4H F;  1B6R A;  2V59 A;  4MV1 A;  2NU7 B;  3VPD A;  3NUA A;  3V4S A;  2I8C A;  4O84 A;  2CNU A;  1GSH A;  1C3O A;  1VBG A;  2FPI B;  2V5A A;  1C30 A;  4IIJ F;  5J2U F;  4O7N A;  4O7S A;  2GPS A;  2PBZ A;  3RFC A;  3VPB A;  1KJ8 A;  2NU9 B;  4FFP A;  2PVP A;  2YZG A;  3RV4 A;  2QK4 A;  3TQT A;  2I80 A;  1VKZ A;  3MWE A;  2YWV A;  2YW2 A;  5C8Y F;  1SCU B;  1CS0 A;  1AUV A;  1BNC A;  3U54 A;  2Z04 A;  2HJW A;  3TW6 A;  4XX0 B;  2DLN A;  3R23 A;  4O7V A;  5LA6 F;  5C1O A;  1VBH A;  1UC8 A;  3ORR A;  4O2A F;  2PN1 A;  2R82 A;  2XD4 A;  4O7Y A;  5BMV F;  3KAK A;  5CA0 F;  4DLK A;  3UFX B;  3U55 A;  3Q2O A;  3E5N A;  3KRE A;  4HNV A;  4MV6 A;  5BPF A;  5JVD F;  2R7N A;  3K3P A;  4I55 F;  1KJQ A;  2W6N A;  5HV6 A;  2YS6 A;  2HGS A;  2IP4 A;  2DWC A;  5H80 A;  5HBR B;  3WNZ A;  4TV8 F;  5J2T F;  4IZO A;  4MA5 A;  3R5F A;  3R5H A;  3SE7 A;  2FP4 B;  5CB4 F;  2ZDQ A;  3QFF A;  1JDB B;  4EGJ A;  2C00 A;  2YRX A;  2GQR A;  4MAM A;  4O82 A;  2W6P A;  1DV2 A;  4MV9 A;  3RUP A;  3OUU A;  5LXT F;  3KAL A;  2WYO A;  4MV4 A;  1OBG A;  4WD3 A;  1ULZ A;  1IOV A;  4MV3 A;  3GLK A;  3TIN A;  1Z2P X;  2VPQ A;  5LOV F;  3OUZ A;  4FU0 A;  2R7L A;  2YZM A;  2V58 A;  3N8D A;  1KEE A;  1GSO A;  4EG0 A;  1W93 A;  3JRX A;  1GLV A;  5JVL A;  2YRW A;  2VQD A;  3R9R A;  4ZOL F;  4MV7 A;  4O7Z A;  4DIM A;  5GON F;  1E4E B;  2CQY A;  4XZ3 B;  2FPP B;  3WO1 A;  2CZG A;  1JDE A;  1KJI A;  4L1K A;  1T36 A;  3HBL A;  3BG5 A;  4O7L A;  4Y8V B;  3LP8 A;  4FFM A;  1UC9 A;  4WBN F;  1AUX A;  1EUD B;  2CNQ A;  3Q1K A;  5JQW A;  4YB8 B;  1KJ9 A;  2W6Q A;  3HB9 A;  5I47 A;  4HR7 A;  5D8D A;  4YAJ B;  4NYE A;  1E4E A;  4RZQ A;  1M6V A;  1KC7 A;  1EYZ A;  4YAK B;  2YZL A;  2R85 A;  1CE8 A;  2DZD A;  4ZHQ F;  1Z2O X;  2FB9 A;  4O81 A;  3TIG A;  2DIK A;  4FFR A;  4FGR A;  4O86 A;  3LWB A;  2GQS A;  2YS7 A;  1PX2 A; 
#chains in the Genus database with same CATH topology
 4HNT A;  4HQ6 A;  4QSH A;  4CE5 A;  4YY3 H;  3RB6 A;  2Y0S E;  1JKJ B;  3AX6 A;  2Z02 A;  2J9G A;  3L2P A;  1N48 A;  5EWF A;  4O4J F;  1T3N A;  1RK5 A;  4ECS A;  2WAQ E;  5C1P A;  1TWC A;  2R86 A;  1Z2N X;  2UUC H;  4LFB H;  5CAE B;  4FFL A;  4MV8 A;  5KFW A;  5KFP A;  4ECR A;  2JEI A;  3BQ0 A;  1ZAU A;  5KFK A;  2J6S A;  3UQ8 A;  4YJ3 F;  2C22 A;  3L4J A;  4F4Z A;  1XDN A;  4GLX A;  3PR5 B;  2RGV A;  3W1B A;  4J9R A;  3PW2 A;  3RBD A;  3H0G A;  5LMU H;  2W57 A;  4JV0 A;  4MTE A;  2C2D A;  2A1H A;  2WAQ A;  2DPJ A;  2KSW A;  1GSA A;  2JEG A;  2RGR A;  3HOY G;  4ED6 A;  2HHF B;  2NVX A;  1CQJ B;  5CA1 F;  3PR4 A;  3VNN A;  2RF4 A;  2WE6 A;  4QWE A;  5L1K A;  2XGQ A;  3M4I A;  4R8U A;  1CQI B;  3HOV G;  5CE8 A;  2VA2 A;  1CKN A;  2SCU B;  1EHI A;  3VMM A;  4CMF A;  5DQG A;  2NUA B;  2W6M A;  4ZQI A;  1TWA A;  1A9X A;  5DQI A;  2V4R A;  4A3F G;  1ZET A;  2JA7 A;  4J9L A;  5CR5 A;  4DV1 H;  4FM9 A;  3BQ2 A;  1IYE A;  1A0G A;  1EZ1 A;  3BAC A;  4APM A;  2W9C A;  1PK8 A;  2R8H A;  3R5X A;  1M0W A;  4MA0 A;  2P0A A;  2W70 A;  2Q7D A;  4EGQ A;  5BWU A;  2NVY A;  3GIQ A;  4X66 H;  4O7T A;  3GV8 B;  3T1H H;  2EJ3 A;  3K5H A;  5KT3 A;  4NXN H;  3HOW G;  5FNV F;  5LP6 F;  4DL3 A;  1GYF A;  3NBZ B;  3JRW A;  3HO8 A;  5DMX A;  1V9P A;  5BPH A;  5DQH A;  4I50 F;  3V4Z A;  5KFT A;  5KG4 A;  4ECY A;  1N36 H;  2FLP A;  2ASD A;  4XYM B;  5BWT A;  2DAB A;  2CNV A;  4RNM A;  4EYH B;  2VR1 A;  3J80 W;  3J81 W;  3MR3 A;  3HOU G;  2I87 A;  3G8D A;  4O7W A;  3BAA A;  4GC6 A;  3PZP A;  2GLT A;  4O2B F;  3S24 A;  4AQY H;  2HGW A;  3MWD A;  3EPI A;  5KFI A;  3PO3 G;  3T1Y H;  4O83 A;  3FDS A;  3W1G A;  3ETJ A;  4AYB A;  3I12 A;  5EDW A;  4HYK A;  5JQG F;  5FD6 A;  1IBK H;  2ZDH A;  2VA3 A;  5I60 A;  3PN1 A;  3AW8 A;  3G8C A;  4FFN A;  1IOW A;  4IWY A;  5KFQ A;  2R7Z G;  4BBS G;  4YR0 A;  1OBD A;  2UUB H;  5K2M A;  2CW7 A;  2HHF A;  4HNU A;  2VPS A;  4YJ2 F;  3T9A A;  2XCA A;  4ECQ A;  2V9W A;  4IR1 A;  3TY8 A;  1N56 A;  1IBL H;  5KFN A;  3JZI A;  4J9O A;  2ABJ A;  4RB2 C;  3JZF A;  4FBU A;  1SEI A;  1S10 A;  4B3R H;  1AN7 A;  3G6X A;  2UU9 H;  1JX4 A;  4A3L G;  5KKN B;  1KJJ A;  2QF7 A;  3CVZ A;  4QWC A;  5IYD G;  5I5S A;  2XC9 A;  5KFF A;  4FFO A;  2R7K A;  3NC0 B;  5LYJ F;  3DF7 A;  3VA7 A;  2FMA A;  3H40 A;  4O4L F;  4E4T A;  5KFX A;  5JUM A;  4I4T F;  3GIK A;  5FR9 A;  4LF8 H;  2C2E A;  2YL2 A;  3EPG A;  3ETH A;  2ASJ A;  1WSC A;  2R8K A;  2Q2T A;  2R8J A;  2BQR A;  2CKZ B;  1W96 A;  2X0S A;  3N44 B;  5KT4 A;  5KFL A;  1N32 H;  3DAA A;  3W5O A;  1TWH A;  3V6K A;  3SI8 A;  4C2M A;  1VS0 A;  4O7R A;  5E25 A;  4JI3 H;  3QZ7 A;  3VPC A;  5KG1 A;  2BR0 A;  4DL5 A;  4C5C A;  2HVS A;  4DV0 H;  2UXB H;  4BBR G;  2PMZ A;  4O3N A;  4DR1 H;  1RJP A;  4ED0 A;  5IWA H;  4IWX A;  1HNZ H;  5IP9 G;  3C0F B;  5EZY F;  4O4I F;  4UCV A;  3MR5 A;  4IR9 A;  2VUM G;  4O3P A;  5KS8 A;  2FLL A;  4TUY F;  3RAQ A;  2R87 A;  4YBZ B;  4CKB A;  5BWR A;  3GTQ A;  1V51 A;  1J5E H;  3PW5 A;  1G2W A;  2ATL A;  1B33 N;  4F4X A;  3RB4 A;  4RCN A;  3T5K A;  3TW7 A;  2IBK A;  4Q43 A;  4DR2 H;  4CC6 A;  2W71 A;  3KYH C;  1S0M A;  2FPG B;  4EEY A;  5LL6 b;  2FK2 A;  2CW8 A;  2W8K A;  1A48 A;  3RAX A;  2JA7 G;  3T7A A;  1RYR A;  4M9U A;  1WCM G;  4JI5 H;  2ZDG A;  5I5T A;  4UCT A;  4RB1 A;  2XCL A;  2FKL A;  1XMO H;  4YQW A;  1JLL B;  4X62 H;  2OLS A;  4DR7 H;  2NU6 B;  4J9Q A;  2W9A A;  4IRC A;  3MR6 A;  3GQC A;  2NU8 B;  4MTD A;  5HNE A;  1I1M A;  2RDJ A;  1ZHS A;  3N41 B;  4A3I G;  4ECW A;  2R7M A;  5BYA A;  4TQS A;  5DLF A;  2IMW P;  4PZ7 A;  3FKI A;  1HR0 H;  1I1K A;  4JI6 H;  4JI0 H;  2GPW A;  3MJF A;  4C5B A;  5KG2 A;  3M9O B;  4A2A A;  5BYB A;  1I7N A;  2R84 A;  3KHR A;  4JI1 H;  3GIM A;  1I6U A;  1GGO A;  4PZ8 A;  4ED3 A;  2EIY A;  3WO0 A;  1A3G A;  3T5H A;  4K0K H;  1WR2 A;  4LFA H;  3K5I A;  3ORQ A;  3VOT A;  4Q4C A;  4LFC H;  4PDB A;  5KFG A;  2JA6 A;  5FPO A;  1GO3 E;  2VQE H;  2YZN A;  5KFV A;  2ZM6 H;  4ECV A;  1Y1W G;  3I4M G;  4EBC A;  1DV1 A;  3GV5 B;  3U9T A;  4ED2 A;  5FPR A;  1I7L A;  4DR5 H;  2IA6 A;  3GTG A;  1B04 A;  4CMD A;  3IN5 A;  1BXR A;  4FE2 A;  3GTJ A;  3N42 B;  1KT8 A;  5DAA A;  2YYA A;  4LF5 H;  4Q8F A;  2AU0 A;  4UCO A;  2W8L A;  5IP7 G;  5KT5 A;  3GIP A;  3BQ1 A;  1B6S A;  4XYL B;  4J9S A;  4ME6 A;  3RGZ A;  4LSX A;  4DL4 A;  3N6R A;  4IHJ F;  5I5X A;  1KBL A;  5KFZ A;  4Q8E A;  3T9F A;  2ALZ A;  4JYA H;  1KTA A;  3T9E A;  5EWG A;  2R92 A;  3QWU A;  5JH7 F;  1S68 A;  3CQZ A;  1RJQ A;  1P8L A;  3SGI A;  4NZO A;  5KFJ A;  3KAJ A;  4PZ6 A;  4EFB A;  1M0T A;  2VQF H;  2XCP A;  2W6Z A;  5KX5 F;  4BY1 G;  3MFH A;  4DUY H;  2E5L H;  1FJG H;  4A93 G;  2DAA A;  1S03 G;  4DV4 H;  1CKN B;  1ZQ7 A;  4EQ5 A;  4ZI7 F;  3GID A;  4NZN A;  1T94 A;  3HKZ A;  4RAZ A;  3Q8S B;  1EKP A;  2ZGI A;  3RV3 A;  3T9C A;  1KUT A;  4TQR A;  4QWD A;  2AGP A;  3LQS A;  5I5U A;  2R6F A;  3PO2 G;  4ECT A;  1DIK A;  2F4V H;  3QQM A;  3TY9 A;  4C5A A;  3TY5 A;  1EUC B;  3JSN A;  3U9S A;  3TII A;  1V4Y A;  2W6O A;  2Y0S A;  4DQN A;  5IYZ F;  4ED8 A;  4TV9 F;  4LMY A;  4DL7 A;  3GJX B;  1OWT A;  5KFH A;  5FLM G;  5DGA A;  4O4H F;  4ECU A;  4DUZ H;  4CKC A;  1I3Q A;  1JIH A;  4JV2 A;  1I2K A;  4EYI B;  1B6R A;  4TVI A;  5IYB G;  1X9N A;  2EJ2 A;  2V59 A;  1S9F A;  3GTL A;  3SNO A;  4MV1 A;  4A2B A;  3RR5 A;  4DR3 H;  2NU7 B;  5D1P A;  3H4B A;  4UCU A;  3VPD A;  5C44 G;  2QB5 A;  1K1S A;  2FK3 A;  5KFO A;  3NUA A;  3V4S A;  4O3Q A;  1JXL A;  2I8C A;  4O84 A;  4JI2 H;  2R8I A;  2CNU A;  1GSH A;  1C3O A;  1VBG A;  1SYX B;  2FPI B;  2UVV A;  3PW7 A;  2JA8 G;  2V5A A;  2COG A;  1C30 A;  4IIJ F;  3UZO A;  4CHI A;  3GIJ A;  4O7N A;  5J2U F;  4LH7 A;  1MZB A;  3HOZ G;  4O7S A;  4GKK H;  1HNW H;  2GPS A;  2PBZ A;  3RFC A;  3VPB A;  1KJ8 A;  2UVR A;  2NU9 B;  4FFP A;  2B63 G;  2PVP A;  2YZG A;  3KHG A;  1DAA A;  3RV4 A;  5KG6 A;  1E4F T;  2YU9 A;  2QK4 A;  3K3V A;  2HG8 A;  3TQT A;  2I80 A;  5BWX A;  3Q8P B;  1VKZ A;  4ECZ A;  4NXM H;  3MWE A;  2YWV A;  5L9X A;  2YW2 A;  4JXU A;  3M9M B;  4DL2 A;  3PW0 A;  2FLN A;  5C8Y F;  1SCU B;  1CS0 A;  3HXL A;  1I94 H;  4QIW E;  1AUV A;  1BNC A;  3U54 A;  4Q44 A;  4EFE A;  5BWV A;  3GIL A;  1O75 A;  2Z04 A;  4YP3 A;  2HJW A;  3LML A;  1S0O A;  1SFO A;  4JV1 A;  4LH6 A;  4LF4 H;  3TW6 A;  3WWJ A;  4FS1 A;  1TAE A;  2Y4R A;  4XX0 B;  3T54 A;  2DLN A;  3R23 A;  2WDT A;  2BQU A;  5C4X G;  5BWW A;  5KT6 A;  2HDK A;  4O7V A;  5LA6 F;  5C1O A;  3NGD A;  1UC8 A;  1VBH A;  2WTF A;  5KFS A;  1E4G T;  3ORR A;  5DG8 A;  4O2A F;  2PN1 A;  1ZHQ A;  1S97 A;  3GDE A;  4A3C G;  2R82 A;  2HIV A;  4J9K A;  2XD4 A;  4O7Y A;  4KHP H;  3JAM W;  3PW4 A;  2AQ4 A;  5BMV F;  2PMZ E;  4QIW A;  5KG3 A;  3KAK A;  3GTO A;  4IAJ A;  5LMN H;  2AGO A;  2OWO A;  3V6H A;  3OSP A;  5CA0 F;  3RBE A;  1L2Z A;  1Y1V G;  3IG0 A;  4DLK A;  3UFX B;  1RJR A;  4IRK A;  3U55 A;  3T9D A;  2AGQ A;  4J0M A;  3Q2O A;  5KT7 A;  2COJ A;  2J6T A;  4NLG A;  3E5N A;  3KRE A;  4HNV A;  5L1I A;  2HGX A;  2RDI A;  4Q45 A;  5L1L A;  4GKJ H;  3HKZ E;  3UZB A;  4MV6 A;  2JA6 G;  1VAJ A;  3QZ8 A;  4J9N A;  3RF2 A;  1DGS A;  5EOY A;  2C28 A;  1K1Q A;  3T5J A;  5BPF A;  5JVD F;  2R7N A;  3GTK A;  1IYD A;  1EKF A;  3K3P A;  2R93 A;  3N40 P;  4U7C A;  4DR4 H;  2E2I A;  3FKI G;  4I55 F;  3NBY B;  1KJQ A;  2VUG A;  3V6J A;  4A3K G;  5C5J A;  2UVU A;  1UNN C;  4A3D G;  2W6N A;  1XK5 A;  5HV6 A;  1CKO A;  2YS6 A;  5K3W A;  3KXY T;  1RYS A;  2UUA H;  4RNN A;  4F50 A;  5KFM A;  2HGS A;  1BGW A;  4RUA A;  2JEF A;  4IRD A;  4QW9 A;  4LF6 H;  4G3I A;  5DGI A;  2IP4 A;  5C3E G;  3GTM A;  3Q8Q B;  3RB3 A;  2X5R A;  1TWF A;  5I5W A;  4ETS A;  4QWA A;  3PFF A;  4BXX G;  3N43 B;  4JV5 H;  2E2H A;  5BR8 H;  2DWC A;  2BQ3 A;  5H80 A;  5HBR B;  3RGX A;  4OX9 H;  4JI8 H;  5KG0 A;  3WNZ A;  1R9T A;  3JZ6 A;  5DG9 A;  2WB1 E;  4TV8 F;  5J2T F;  3RIZ A;  4UCR A;  4IZO A;  4EEQ A;  3T5L A;  1N34 H;  2UXD H;  3BA8 A;  1CKM A;  4RNO A;  4MA5 A;  3R5F A;  2FE3 A;  2MCT A;  3L4K A;  3PVX A;  4O3S A;  3R5H A;  3SE7 A;  2QYZ A;  4U6P A;  2FP4 B;  5D1O A;  3G6Y A;  4UFZ A;  4ED7 A;  5CB4 F;  2ZDQ A;  3H3V H;  5KFE A;  3QFF A;  3WWI A;  3HT5 A;  1JDB B;  2CFM A;  4B3M H;  4QJF A;  2R93 G;  2JA5 G;  4EGJ A;  3T99 A;  2C00 A;  2YRX A;  4RB0 A;  3U0G A;  1XMQ H;  3DTF A;  4DR6 H;  3OSN A;  4CC5 A;  3LUL A;  1TWG A;  3CSW A;  5A2Q W;  5L1J A;  2DPI A;  2GQR A;  4MAM A;  5FD5 A;  4O82 A;  1A0I A;  2W6P A;  1DV2 A;  4MV9 A;  3RUP A;  4RAY A;  4AYB E;  3H4D A;  3DTG A;  2XGP A;  4J9M A;  2C2R A;  4YHH H;  5T14 A;  3OUU A;  2R92 G;  5LXT F;  4QWB A;  3KAL A;  4E6N A;  2HVR A;  4X64 H;  1HNX H;  2HIX A;  4RU9 A;  4DL6 A;  2WYO A;  4MV4 A;  1BJT A;  1I2L A;  5FLX W;  4FS2 A;  3J7A K;  4A3B G;  4M7E A;  2M05 A;  1OBG A;  4LF9 H;  1M7J A;  3AYH B;  1ULZ A;  4WD3 A;  2J6U A;  1IOV A;  5FJ8 G;  4LF7 H;  1EKV A;  4MV3 A;  3BAB A;  3GLK A;  1Y1V A;  2UVW A;  3TIN A;  1Z2P X;  2VPQ A;  2OH2 A;  5LOV F;  2COI A;  3OUZ A;  4FU0 A;  2R7L A;  2YZM A;  4JUZ A;  2V58 A;  3N8D A;  1I50 A;  3KHL A;  4EBE A;  2JA5 A;  1KEE A;  2O03 A;  1GSO A;  4EG0 A;  4DV6 H;  3MR2 A;  4HN2 A;  3HOX G;  3MFI A;  3MWM A;  4DV7 H;  1W93 A;  4PWQ A;  5F9L A;  3JRX A;  1GLV A;  5JVL A;  5KFU A;  4RUC A;  5DG7 A;  2W9C B;  2YRW A;  2VQD A;  3R9R A;  4DAA A;  4RB3 C;  1XNR H;  3T9B A;  4ZOL F;  4YR3 A;  3GII A;  4MV7 A;  3KTM A;  3GTP A;  2VUM A;  4DV3 H;  2W7P A;  1N33 H;  4O7Z A;  4DIM A;  5I5V A;  4TM5 A;  5GON F;  4UCS A;  1E4E B;  2CQY A;  4XZ3 B;  2XIG A;  5DGB A;  2V4Q A;  4QW8 A;  2FPP B;  1S0N A;  2HHH H;  3WO1 A;  4F4Y A;  4J9P A;  1Y1W A;  2CZG A;  5KFR A;  4DV5 H;  1JDE A;  1KJI A;  4F4W A;  2FJZ A;  4B3T H;  1IBM H;  4L1K A;  1T36 A;  5IT9 W;  3RTX A;  1WH2 A;  2W9B A;  3HBL A;  5EWE A;  5CM0 A;  1TA8 A;  3WWH A;  3BG5 A;  4ED1 A;  5DLG A;  2W7O A;  2HVQ A;  5I5Y A;  2B63 A;  4O7L A;  4O3O A;  3EYY A;  5KFA A;  4Y8V B;  4YR2 A;  3LP8 A;  3OTO H;  4A3M G;  3OHA A;  4FFM A;  4NZM A;  4B3S H;  4I7H A;  3BA9 A;  4JI4 H;  1UC9 A;  3M9N B;  3TQ1 A;  4WBN F;  1Y14 B;  1WCM A;  5KG7 A;  4EBD A;  4Q0Y A;  5KFC A;  4A3J G;  1AUX A;  3N6X A;  2ZJT A;  1XNQ H;  4GC7 A;  1FVI A;  5KFY A;  4A3E G;  1EUD B;  4A3G G;  5DGH A;  3GB8 B;  2EJ0 A;  1RK6 A;  1K83 A;  1I1L A;  2CNQ A;  1FKA H;  3Q1K A;  5DIS C;  4WHX A;  5JQW A;  3Q8R B;  3H0G G;  5F9N A;  4YB8 B;  1KJ9 A;  2W6Q A;  3TEK A;  2Q2U A;  2VOB A;  3HB9 A;  4LSA A;  5I47 A;  5IYC G;  3G6V A;  4HR7 A;  4DV2 H;  4O3R A;  5D8D A;  3H20 A;  4YAJ B;  2C35 B;  4R7R A;  4BWS C;  4ECX A;  4NYE A;  2JEJ A;  3UYY A;  1E4E A;  4CKE A;  2UXC H;  1ET0 A;  4M0J A;  4RZQ A;  2YCH A;  3JSL A;  4BY7 G;  1M6V A;  1KC7 A;  1EYZ A;  4YAK B;  2YZL A;  2R85 A;  2ODT X;  4K6N A;  5KG5 A;  2W9B B;  3BJY A;  4JI7 H;  3RJ0 A;  4R8U B;  1CE8 A;  2DZD A;  4ZHQ F;  4FBT A;  3RB0 A;  4X65 H;  1Z2O X;  3GV7 B;  2FB9 A;  4O81 A;  5KT2 A;  3TIG A;  5D1O B;  2DIK A;  4UUG A;  4DRF A;  5KFB A;  4GLW A;  3OHB A;  5KFD A;  2WB1 A;  3CEB A;  1P16 A;  4PBC A;  3I4N G;  3KHH A;  4FFR A;  4FGR A;  2ASL A;  4Q4D A;  4O86 A;  3LWB A;  1WRV A;  3F8N A;  2R7Z A;  4RZR A;  2R8G A;  2GQS A;  3FMA A;  2YS7 A;  1PX2 A;  2FK1 A; 
#chains in the Genus database with same CATH homology
 4HNT A;  4HQ6 A;  4QSH A;  1JKJ B;  3AX6 A;  2Z02 A;  2J9G A;  4O4J F;  5C1P A;  2R86 A;  1Z2N X;  5CAE B;  4FFL A;  4MV8 A;  4YJ3 F;  1GSA A;  1CQJ B;  5CA1 F;  1CQI B;  2SCU B;  1EHI A;  3VMM A;  2NUA B;  2W6M A;  4ZQI A;  1A9X A;  1EZ1 A;  1PK8 A;  3R5X A;  1M0W A;  4MA0 A;  2P0A A;  2W70 A;  4EGQ A;  4O7T A;  3K5H A;  5FNV F;  5LP6 F;  3JRW A;  3HO8 A;  5DMX A;  5BPH A;  4I50 F;  3V4Z A;  4XYM B;  2CNV A;  2VR1 A;  2I87 A;  3G8D A;  4O7W A;  2GLT A;  4O2B F;  3MWD A;  4O83 A;  3ETJ A;  3I12 A;  5JQG F;  2ZDH A;  3G8C A;  3AW8 A;  4FFN A;  1IOW A;  4IWY A;  1OBD A;  5K2M A;  4HNU A;  4YJ2 F;  3JZI A;  3JZF A;  5KKN B;  1KJJ A;  2QF7 A;  3VA7 A;  4FFO A;  2R7K A;  5LYJ F;  3DF7 A;  4O4L F;  4E4T A;  4I4T F;  2YL2 A;  3ETH A;  1W96 A;  2X0S A;  4O7R A;  3VPC A;  4C5C A;  4IWX A;  5EZY F;  4O4I F;  4TUY F;  2R87 A;  4YBZ B;  2W71 A;  2FPG B;  1A48 A;  4M9U A;  2ZDG A;  2XCL A;  1JLL B;  2OLS A;  2NU6 B;  2NU8 B;  2R7M A;  2GPW A;  3MJF A;  4C5B A;  1I7N A;  2R84 A;  1GGO A;  3WO0 A;  1WR2 A;  3K5I A;  3ORQ A;  3VOT A;  2YZN A;  1DV1 A;  3U9T A;  1I7L A;  1BXR A;  4FE2 A;  2YYA A;  1B6S A;  4XYL B;  4ME6 A;  3N6R A;  4IHJ F;  1KBL A;  5JH7 F;  3KAJ A;  1M0T A;  2W6Z A;  5KX5 F;  4ZI7 F;  3GID A;  3RV3 A;  1KUT A;  2R6F A;  1DIK A;  4C5A A;  1EUC B;  3U9S A;  3TII A;  2W6O A;  5IYZ F;  4TV9 F;  4O4H F;  1B6R A;  2V59 A;  4MV1 A;  2NU7 B;  3VPD A;  3NUA A;  3V4S A;  2I8C A;  4O84 A;  2CNU A;  1GSH A;  1C3O A;  1VBG A;  2FPI B;  2V5A A;  1C30 A;  4IIJ F;  5J2U F;  4O7N A;  4O7S A;  2GPS A;  2PBZ A;  3RFC A;  3VPB A;  1KJ8 A;  2NU9 B;  4FFP A;  2PVP A;  2YZG A;  3RV4 A;  2QK4 A;  3TQT A;  2I80 A;  1VKZ A;  3MWE A;  2YWV A;  2YW2 A;  5C8Y F;  1SCU B;  1CS0 A;  1AUV A;  1BNC A;  3U54 A;  2Z04 A;  2HJW A;  3TW6 A;  4XX0 B;  2DLN A;  3R23 A;  4O7V A;  5LA6 F;  5C1O A;  1VBH A;  1UC8 A;  3ORR A;  4O2A F;  2PN1 A;  2R82 A;  2XD4 A;  4O7Y A;  5BMV F;  3KAK A;  5CA0 F;  4DLK A;  3UFX B;  3U55 A;  3Q2O A;  3E5N A;  3KRE A;  4HNV A;  4MV6 A;  5BPF A;  5JVD F;  2R7N A;  3K3P A;  4I55 F;  1KJQ A;  2W6N A;  5HV6 A;  2YS6 A;  2HGS A;  2IP4 A;  2DWC A;  5H80 A;  5HBR B;  3WNZ A;  4TV8 F;  5J2T F;  4IZO A;  4MA5 A;  3R5F A;  3R5H A;  3SE7 A;  2FP4 B;  5CB4 F;  2ZDQ A;  3QFF A;  1JDB B;  4EGJ A;  2C00 A;  2YRX A;  2GQR A;  4MAM A;  4O82 A;  2W6P A;  1DV2 A;  4MV9 A;  3RUP A;  3OUU A;  5LXT F;  3KAL A;  2WYO A;  4MV4 A;  1OBG A;  4WD3 A;  1ULZ A;  1IOV A;  4MV3 A;  3GLK A;  3TIN A;  1Z2P X;  2VPQ A;  5LOV F;  3OUZ A;  4FU0 A;  2R7L A;  2YZM A;  2V58 A;  3N8D A;  1KEE A;  1GSO A;  4EG0 A;  1W93 A;  3JRX A;  1GLV A;  5JVL A;  2YRW A;  2VQD A;  3R9R A;  4ZOL F;  4MV7 A;  4O7Z A;  4DIM A;  5GON F;  1E4E B;  2CQY A;  4XZ3 B;  2FPP B;  3WO1 A;  2CZG A;  1JDE A;  1KJI A;  4L1K A;  1T36 A;  3HBL A;  3BG5 A;  4O7L A;  4Y8V B;  3LP8 A;  4FFM A;  1UC9 A;  4WBN F;  1AUX A;  1EUD B;  2CNQ A;  3Q1K A;  5JQW A;  4YB8 B;  1KJ9 A;  2W6Q A;  3HB9 A;  5I47 A;  4HR7 A;  5D8D A;  4YAJ B;  4NYE A;  1E4E A;  4RZQ A;  1M6V A;  1KC7 A;  1EYZ A;  4YAK B;  2YZL A;  2R85 A;  1CE8 A;  2DZD A;  4ZHQ F;  1Z2O X;  2FB9 A;  4O81 A;  3TIG A;  2DIK A;  4FFR A;  4FGR A;  4O86 A;  3LWB A;  2GQS A;  2YS7 A;  1PX2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...