4XZ3B

Ca. korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 (se-met derivative) in complex with coenzyme a and mg-amppcp, phosphohistidine segment pointing towards nucleotide binding site
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
228
structure length
228
Chain Sequence
b'SRDLLLKAKENGRKSLLEHEAKYFISSYGIPVTNIRLAKSEEEAVNFSREIGFPVVLKIVSPQVVHKSDVGGVKVNLRSEEEVRKAYREIIENVKRNVPNAEIEGILVQEFAPPGVELIIGLLRDPQFGPTVMFGLGGVFVELFRDVSFRVAPLSEQDAESMIKEVKAYKLLTGFRGMEPVDIEAIKDALIRAGRIGVENEEIAEMDLNPVIAYPKGIKVVDARIILR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl-CoA synthetase (NDP forming)
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Candidatus korarchaeum cryptofilum opf8
molecule tags Ligase
total genus 66
structure length 228
sequence length 228
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13549 ATP-grasp_5 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4xz3B01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4xz3B02
3U9TA 2WYOA 4DIMA 2W6ZA 1Z2OX 5EZYF 2DWCA 3NUAA 4MV3A 2HJWA 2XCLA 4O7TA 2PN1A 1BNCA 4YJ2F 4YAJB 4FE2A 2CNVA 4HNUA 5JQWA 2FPIB 3K3PA 4O86A 2V5AA 2R82A 2QF7A 1KEEA 1M0TA 1GGOA 5H80A 1DV2A 1A9XA 1AUVA 2SCUB 2VQDA 2CNUA 3WO0A 3E5NA 5C8YF 4TV9F 1KJJA 2W6QA 5IYZF 5KX5F 2DZDA 4XYLB 2YS7A 4FFMA 1KJ9A 4O84A 2PVPA 3KAKA 1KC7A 2GLTA 4FFPA 2V59A 4QSHA 4DLKA 4MA5A 5LOVF 4O7LA 3AX6A 1EUCB 4C5BA 1EYZA 1EZ1A 3VPCA 2CNQA 3R5FA 5CA0F 1OBDA 2GPWA 2R85A 3WNZA 3GLKA 4C5CA 5JVLA 3SE7A 1CQIB 3R9RA 4XZ3B 2J9GA 4O7SA 1M6VA 1WR2A 4MAMA 1W93A 3ETHA 4O4LF 3KREA 4YAKB 1E4EB 3I12A 4MV8A 3RV4A 5C1OA 4FFLA 1M0WA 4O2AF 1DIKA 1C3OA 2I80A 1JLLB 1KJ8A 4I55F 3AW8A 2YRWA 1AUXA 4O7RA 1CS0A 2DLNA 2GPSA 4O7NA 1KJQA 4ZHQF 2C00A 3G8CA 4NYEA 2HGSA 5J2UF 2FP4B 2YRXA 3U55A 3Q1KA 2W6PA 5D8DA 3TINA 2Z02A 3HO8A 4ZI7F 1VBHA 3TIGA 3KAJA 3R23A 4O7ZA 2R7NA 3VOTA 2R87A 5C1PA 2ZDHA 4O4HF 1OBGA 3LP8A 1E4EA 3U9SA 1I7LA 3JZFA 3VPBA 2YL2A 3HB9A 4O4IF 4I4TF 5FNVF 4EG0A 4O7YA 2OLSA 4XX0B 3DF7A 4EGQA 2VR1A 2QK4A 2W6NA 4MV7A 4Y8VB 2W6MA 4FGRA 1UC8A 4IWXA 1GSHA 2VPQA 4HR7A 4O2BF 4FFRA 3VMMA 2ZDQA 1SCUB 2YYAA 3N8DA 2P0AA 3HBLA 2ZDGA 3V4SA 1Z2NX 2Z04A 1EUDB 4L1KA 2YZNA 4O82A 1GLVA 4EGJA 2IP4A 3RV3A 1DV1A 3MWDA 3G8DA 4IHJF 2NU6B 5LXTF 2YW2A 1KJIA 2DIKA 3Q2OA 4I50F 2R86A 5LP6F 1GSAA 4YJ3F 3JRWA 2NU7B 4O7WA 1KUTA 3U54A 5CB4F 4FFOA 1T36A 2GQSA 3TW6A 1W96A 4O83A 4O4JF 2V58A 4C5AA 4HNVA 4O81A 2FPGB 2W70A 2FB9A 1KBLA 5JVDF 2R7KA 4MV9A 4FU0A 3ORRA 4TUYF 3KALA 3R5XA 4FFNA 3BG5A 2YWVA 4HQ6A 3WO1A 2R7LA 1IOWA 5BMVF 3K5IA 1JDEA 3N6RA 5CAEB 5GONF 4XYMB 5HV6A 5K2MA 2XD4A 4MV4A 2W71A 5BPHA 4YBZB 1I7NA 4YB8B 4IWYA 1JDBB 3ETJA 1CE8A 1EHIA 5LA6F 1ULZA 3MJFA 3JRXA 3TIIA 1GSOA 1BXRA 3RUPA 2W6OA 4ZOLF 2R6FA 2X0SA 5LYJF 1A48A 1PK8A 3QFFA 1B6SA 1JKJB 4MV1A 3VA7A 4WD3A 2PBZA 4E4TA 4ZQIA 4ME6A 2NU9B 5CA1F 2NU8B 5DMXA 2FPPB 3MWEA 4IZOA 1UC9A 1VKZA 2R84A 2GQRA 4HNTA 3GIDA 2I87A 5KKNB 3UFXB 1VBGA 1B6RA 3ORQA 3RFCA 2YZMA 3LWBA 4IIJF 2NUAB 1Z2PX 5JQGF 2YZGA 1CQJB 4MA0A 4O7VA 1IOVA 5HBRB 3OUZA 2YS6A 4WBNF 2CQYA 3V4ZA 2R7MA 5JH7F 3TQTA 4M9UA 3VPDA 5J2TF 2I8CA 3OUUA 5I47A 3JZIA 5BPFA 4TV8F 2CZGA 4MV6A 1PX2A 3R5HA 1C30A 4RZQA 3K5HA 2YZLA
chains in the Genus database with same CATH superfamily
1XK5A 4NZNA 2CW7A 3U9TA 5KFQA 5KFAA 3RB4A 5KG7A 2WYOA 4DUYH 4DIMA 4LH7A 2W6ZA 3G6YA 1Z2OX 4LSXA 5EZYF 4RAZA 5KG4A 1XMQH 1HNZH 5I5SA 2DWCA 3NUAA 5CM0A 5BWWA 5C5JA 4MV3A 1IBKH 5DLGA 2HJWA 3BJYA 2FLLA 5DG9A 2ATLA 4Q45A 1Y14B 5DG7A 4DV6H 3LQSA 3RBEA 2XCLA 3TW7A 3GTPA 4O7TA 2PN1A 5KFLA 2EJ2A 1BNCA 3PW2A 4YJ2F 4YAJB 2W9CA 3PW0A 2VQFH 1N56A 2Q7DA 4DR5H 4DR3H 3T54A 4FE2A 2CNVA 4JUZA 4HNUA 5E25A 3T9EA 3W1BA 2FPIB 5JQWA 3MR3A 3K3PA 4DL2A 4O86A 4JI3H 3GV7B 5L1IA 3V6JA 3G6VA 2V5AA 5KG5A 3T5KA 2R82A 2DPIA 3M4IA 5DQIA 2QF7A 3WWHA 1KEEA 4JXUA 2OH2A 1M0TA 1GGOA 4QJFA 1FVIA 4PBCA 3GTKA 4QW8A 3F8NA 3BQ2A 2WDTA 3GJXB 1I2KA 4J0MA 4A3KG 5H80A 2RF4A 1DV2A 4C2MA 5KFOA 4B3SH 1A9XA 1AUVA 2WAQA 2SCUB 5KG1A 3EYYA 2VQDA 3HKZA 2CNUA 1V4YA 3FMAA 3QWUA 3UZBA 3T7AA 4APMA 3PFFA 1I3QA 1A3GA 4ECRA 1DGSA 1RJRA 1SYXB 3WO0A 2PMZA 1G2WA 5C4XG 1S68A 3E5NA 2XCAA 5C8YF 2NVXA 5KFIA 4PWQA 3BA9A 2RDIA 5IP7G 4TV9F 3Q8RB 4JYAH 1KTAA 2OWOA 4RAYA 1KJJA 2W6QA 5IYZF 5KX5F 2DZDA 4XYLB 4A3MG 1I1MA 3VNNA 5KT5A 3M9MB 4J9LA 1OWTA 5L9XA 4J9RA 1CKNB 2ODTX 2YS7A 5KFEA 4FFMA 4J9SA 1KJ9A 5LMUH 4DR7H 2X5RA 4O84A 2FJZA 2PVPA 3KAKA 4YP3A 4LF8H 1KC7A 4YR0A 4ECSA 3PW5A 4EFBA 2GLTA 4RZRA 4FFPA 2V59A 4QSHA 4DLKA 2VA2A 4UCVA 3KHLA 3L2PA 4MA5A 3RAQA 5LOVF 5I60A 5KFZA 3QZ8A 1S10A 1XNRH 4O7LA 2W57A 3AX6A 2Y0SE 2IMWP 1EUCB 4C5BA 1N36H 3UQ8A 1EYZA 1EZ1A 4EBEA 3W5OA 5I5VA 3VPCA 2CNQA 5KFSA 5KFRA 3R5FA 4ED1A 3CQZA 5FLXW 3HT5A 5CA0F 1OBDA 2DPJA 4LF6H 4TQSA 1WRVA 4FS2A 3H0GA 2GPWA 2R85A 4IAJA 5T14A 1I50A 2BQ3A 2FLPA 2R7ZA 3WNZA 3T5LA 4QIWE 4Q0YA 3GLKA 2W8LA 4C5CA 3KHRA 2RGVA 3V6HA 1GYFA 3SI8A 4YQWA 5K3WA 1ZAUA 1I6UA 5HNEA 3KHGA 5JVLA 3T9BA 1VAJA 3GIQA 3SE7A 4BWSC 1CQIB 3R9RA 4XZ3B 2XGPA 4ECVA 3RB0A 2J9GA 5BYBA 3G6XA 2JEJA 4FBUA 2NVYA 4A3GG 2JA8G 4O7SA 3GIMA 5F9NA 2ZM6H 4B3MH 3SNOA 4IR9A 4RUAA 1M6VA 1WR2A 3BAAA 2E2IA 2ZGIA 4J9QA 2M05A 2C28A 3H3VH 4MAMA 1W93A 5KFHA 5KG6A 3ETHA 4YR3A 4PDBA 4O4LF 3T9FA 4LF5H 4BY7G 3BA8A 3KREA 2UVRA 4J9OA 4YAKB 1E4EB 5KT3A 4WHXA 3I12A 4MV8A 5I5UA 1A0GA 4F4YA 3M9NB 4ECZA 3RV4A 2Q2UA 1JIHA 5C1OA 4FFLA 1M0WA 4O2AF 4R8UB 1DIKA 1C3OA 2COGA 2I80A 4O3SA 1JLLB 2EJ3A 4O3NA 2XCPA 3BQ1A 1KJ8A 1SEIA 4I55F 3AW8A 1S03G 3RB6A 2YRWA 1AUXA 1P16A 3T5JA 4K6NA 1X9NA 5F9LA 4K0KH 1P8LA 1T3NA 4O7RA 4NXMH 4LF4H 1CS0A 2DLNA 2VOBA 2GPSA 2FE3A 3HOYG 4O7NA 2WTFA 3NC0B 4RNOA 1KJQA 4ZHQF 5KG3A 2C00A 4IRKA 3KYHC 1BJTA 2FK3A 4G3IA 2JA6A 3G8CA 4NYEA 5D1PA 4ETSA 4RNMA 3IG0A 4UCSA 2R7ZG 3HOXG 3NBZB 1KT8A 4UCTA 2CFMA 4F4XA 1E4GT 4CE5A 2HGSA 5FD6A 3MR5A 5J2UF 2FP4B 2YRXA 3T99A 3U55A 4JV2A 1MZBA 3Q1KA 1FKAH 2W9AA 5FLMG 2EJ0A 2W6PA 5D8DA 3TINA 4EQ5A 4CC5A 5FD5A 4A2AA 4UFZA 3OSNA 4BBRG 2UVVA 4JI4H 2UXBH 2Z02A 5EWFA 3HO8A 4TQRA 3J80W 4ZI7F 2RGRA 1VBHA 3TIGA 3KAJA 3R23A 3H0GG 4RCNA 3TQ1A 2VQEH 4O7ZA 4UCUA 2R7NA 1S0MA 3MR2A 5EWEA 3VOTA 2R87A 5C1PA 2ZDHA 3GIPA 3W1GA 4RB0A 4O4HF 3KTMA 1OBGA 3LP8A 1E4EA 4R7RA 3FDSA 3PN1A 3N6XA 2B63G 3U9SA 4CMDA 1ZQ7A 4RB2C 1RYSA 1I7LA 5DGIA 2AQ4A 2R93A 4DL4A 4YHHH 3JZFA 3VPBA 2DABA 2YL2A 4LMYA 4YY3H 3SGIA 4R8UA 3WWIA 2AGPA 1RJQA 3HB9A 4DL3A 4O4IF 3N40P 3T1HH 4I4TF 4RUCA 4F4WA 2AGQA 5FNVF 4EG0A 5CR5A 3TY5A 4AYBE 4O7YA 2OLSA 4XX0B 3DF7A 3NBYB 3QQMA 4NZMA 5FPRA 1TAEA 4EGQA 2VR1A 1XDNA 4LSAA 5KFJA 4QWAA 2JA5A 5C44G 5KFCA 4U7CA 4JI1H 4DR1H 2QK4A 2HHFB 4CC6A 3U0GA 2W6NA 5KT2A 4QWEA 4MV7A 4EBDA 3JSLA 4Y8VB 5I5WA 2W6MA 5C3EG 2XIGA 2UUCH 4Q4DA 5CE8A 3Q8PB 1CKMA 1WSCA 3MWMA 4FGRA 5BYAA 4AYBA 3I4MG 4A3BG 1UC8A 1S97A 2YU9A 3J81W 4IWXA 1RYRA 4DR2H 2ASJA 1GSHA 3BACA 4Q44A 2ASDA 1Y1WA 3N42B 2WE6A 1V9PA 3H4BA 2VPQA 4PZ7A 5LMNH 4HR7A 5KFFA 1RK5A 1TWFA 4O2BF 3Q8SB 4FFRA 4X66H 5FPOA 4CKCA 4TVIA 5D1OB 1EKVA 1E4FT 4DUZH 2C2EA 5DISC 1S0NA 2B63A 4JI6H 5A2QW 2JA7A 2W7OA 3AYHB 3VMMA 3RF2A 5KFPA 3PVXA 1IYDA 2JA6G 2ZDQA 2VUMA 4J9MA 2J6SA 2HVRA 2UXDH 1Y1VA 3LMLA 1SCUB 2YYAA 3N8DA 4GLWA 3T9AA 5EDWA 2P0AA 3HBLA 2ZDGA 2Y0SA 2IBKA 4PZ8A 3V4SA 1Z2NX 3RGXA 1I1LA 5KT6A 4DR6H 2Z04A 1EUDB 4L1KA 4IRDA 5I5XA 4DRFA 2QYZA 2YZNA 5I5YA 3DAAA 3WWJA 3RJ0A 1IBMH 4O82A 4O3RA 4MTDA 5IP9G 5KFMA 4CMFA 4J9KA 1GLVA 3GB8B 5IYCG 3IN5A 4QW9A 4HYKA 4BY1G 2ASLA 2R8JA 4IRCA 2R92A 4QIWA 4EGJA 2IP4A 3RV3A 1DV1A 5DQHA 1K83A 2COIA 4U6PA 4CHIA 3MWDA 3EPGA 2HGWA 3G8DA 4IHJF 3TY8A 2WB1E 3M9OB 2HHFA 2NU6B 5LXTF 3N41B 4DL5A 4DQNA 2YW2A 5EOYA 3H20A 3KXYT 3MFIA 1KJIA 4A2BA 2DIKA 3Q2OA 4J9PA 4BBSG 2R93G 2AU0A 1A0IA 1DAAA 2R86A 4I50F 5LP6F 1GSAA 4YJ3F 1JX4A 1V51A 1XNQH 1UNNC 3EPIA 5EWGA 2FK2A 3K3VA 3JRWA 4RU9A 3H4DA 5KFWA 2NU7B 4O7WA 4LFCH 1TWHA 2C35B 1KUTA 3GDEA 3U54A 4YR2A 3GV8B 4QWCA 5CB4F 4AQYH 2UVWA 2W8KA 4FFOA 3HOZG 5KFTA 1T36A 1O75A 4CKBA 4FS1A 4A3JG 3RGZA 2JA5G 2GQSA 1EKFA 4FBTA 3TW6A 4E6NA 3PO3G 3GTGA 1W96A 4O83A 4I7HA 5JUMA 5D1OA 1ZETA 4NZOA 1WCMA 4O4JF 4F50A 2V58A 2BR0A 4C5AA 4HNVA 4O81A 2FPGB 4GLXA 3PZPA 1N33H 2W70A 2FB9A 1N34H 4KHPH 1KBLA 5JVDF 4Q43A 4Q8FA 2QB5A 3CSWA 2R7KA 4JI2H 4ED6A 1T94A 4J9NA 2R8KA 4LH6A 4MV9A 3S24A 4FU0A 4JI7H 1Y1WG 3OTOH 3ORRA 4TUYF 3KALA 3R5XA 1RJPA 4FFNA 4DV0H 4ECQA 2VUGA 3BG5A 4RB1A 4UUGA 4ED7A 1XMOH 2UVUA 4DV2H 2YWVA 4HQ6A 3WO1A 3PW7A 2R7LA 5L1JA 4JI0H 1L2ZA 1WH2A 1I94H 5IWAH 3OHAA 1IOWA 5BMVF 2JEIA 4UCOA 2JA7G 3HOVG 5IT9W 3K5IA 4M0JA 3KHHA 4A3FG 4O3QA 1IYEA 4A3DG 4LF7H 2VUMG 4BXXG 1JDEA 1K1QA 3N6RA 2XGQA 4A3IG 1Y1VG 3DTFA 4TM5A 5GONF 5CAEB 1HNXH 2E2HA 4XYMB 4ECTA 5KG0A 5I5TA 4DL6A 1S9FA 5HV6A 2HG8A 2UUBH 5LL6b 2V4RA 4ECXA 2BQUA 4ECYA 2Y4RA 4DR4H 4X64H 4DV4H 4DV1H 1IBLH 5FJ8G 4GC7A 4JV0A 5K2MA 4ED8A 1M7JA 4GKKH 2VPSA 1TA8A 2XD4A 4HN2A 1RK6A 5IYDG 4EFEA 3V6KA 2C2DA 1JXLA 4B3TH 3PR5B 2HDKA 2CW8A 2W71A 4MV4A 5BPHA 2WAQE 5FR9A 2R92G 2UU9H 4A3EG 1R9TA 3TY9A 4YBZB 1I7NA 2HIVA 5DGHA 4IWYA 4YB8B 5BWVA 3HKZE 5DLFA 1HNWH 3PW4A 1JDBB 3ETJA 3DTGA 5BWUA 1BGWA 3C0FB 3T5HA 1CE8A 1EHIA 5LA6F 2PMZE 2J6UA 4JI8H 2A1HA 4A3LG 4DAAA 3FKIA 4FM9A 3GTMA 1ULZA 4LFBH 4MTEA 3MJFA 3JRXA 3TIIA 4O3OA 4EBCA 5BWTA 4EEYA 1GSOA 3GTLA 3LULA 2F4VH 5BWXA 1TWGA 4ED3A 3HOWG 2EIYA 1BXRA 2HVQA 3RUPA 2W6OA 1ZHSA 2O03A 2W9BB 3NGDA 4ED0A 1S0OA 2JEGA 4ZOLF 2ALZA 3RR5A 2HGXA 5BWRA 2R6FA 4RB3C 2X0SA 5LYJF 1A48A 1PK8A 1I2LA 1ET0A 4ECUA 3RB3A 4Q8EA 3QFFA 5KFVA 1B6SA 2C2RA 1JKJB 4MV1A 4GC6A 3Q8QB 4NLGA 3RBDA 3VA7A 2AGOA 1I1KA 1FJGH 1HR0H 1WCMG 3RTXA 3L4JA 3UYYA 4WD3A 2IA6A 1J5EH 2PBZA 2CKZB 4QWDA 4E4TA 2FK1A 3HXLA 4ZQIA 3GTJA 4ME6A 5KFXA 2V9WA 5L1LA 4JI5H 2NU9B 5CA1F 3PO2G 3JSNA 3MR6A 4ED2A 2NU8B 4EYIB 1B04A 5DMXA 4EEQA 2FPPB 2FLNA 1N48A 4CKEA 1CKOA 3J7AK 3MWEA 5KFBA 2E5LH 4OX9H 1TWAA 5DGBA 4B3RH 1UC9A 4IZOA 1VKZA 2R84A 2W7PA 2GQRA 2C22A 4Q4CA 4HNTA 5IYBG 3GIDA 4ECWA 2I87A 3GTQA 2YCHA 5KKNB 2FKLA 4DV5H 2J6TA 4LF9H 3N43B 4DV3H 1EKPA 4NXNH 4UCRA 3QZ7A 3GILA 2Q2TA 3OSPA 2HHHH 4LFAH 5DQGA 2UXCH 3UFXB 1VBGA 2V4QA 4JV5H 1B6RA 3GV5B 3ORQA 3T9CA 3RFCA 1AN7A 2KSWA 5KFDA 2YZMA 3JAMW 3LWBA 4IIJF 2NUAB 3GIJA 1TWCA 3JZ6A 1GO3E 5L1KA 1VS0A 1Z2PX 3I4NG 5JQGF 2FMAA 4O3PA 2YZGA 5DG8A 2R8IA 3BABA 2COJA 1K1SA 5BR8H 2RDJA 5KS8A 4IR1A 4DV7H 4X62H 4A3CG 3N44B 2W9CB 3RIZA 1CQJB 2DAAA 4MA0A 2W9BA 3GIIA 4DL7A 2BQRA 3UZOA 3CEBA 4O7VA 3CVZA 2JEFA 2VA3A 2XC9A 5DGAA 4GKJH 1B33N 1IOVA 5HBRB 3OUZA 1N32H 5KT7A 2YS6A 4WBNF 3GTOA 5KFGA 3H40A 1SFOA 2CQYA 5KFUA 2WB1A 3V4ZA 2R7MA 5KFNA 3PR4A 5JH7F 2MCTA 3OHBA 5DAAA 3TQTA 2R8GA 4F4ZA 4M9UA 3FKIG 1ZHQA 3VPDA 5KFKA 3MFHA 5KFYA 4PZ6A 5J2TF 2UUAH 2I8CA 3T9DA 4JV1A 1CKNA 3OUUA 3BQ0A 2ABJA 3L4KA 5I47A 4A93G 2HVSA 3JZIA 2ZJTA 3HOUG 2HIXA 5BPFA 4TV8F 4M7EA 3TEKA 2CZGA 4RNNA 4MV6A 1PX2A 2R8HA 3R5HA 1C30A 5KT4A 4X65H 3GQCA 4RZQA 4EYHB 3T1YH 3K5HA 2YZLA 4QWBA 3RAXA 5KG2A 3GIKA
chains in the Genus database with same CATH topology
3U9TA 2WYOA 4DIMA 2W6ZA 1Z2OX 5EZYF 2DWCA 3NUAA 4MV3A 2HJWA 2XCLA 4O7TA 2PN1A 1BNCA 4YJ2F 4YAJB 4FE2A 2CNVA 4HNUA 5JQWA 2FPIB 3K3PA 4O86A 2V5AA 2R82A 2QF7A 1KEEA 1M0TA 1GGOA 5H80A 1DV2A 1A9XA 1AUVA 2SCUB 2VQDA 2CNUA 3WO0A 3E5NA 5C8YF 4TV9F 1KJJA 2W6QA 5IYZF 5KX5F 2DZDA 4XYLB 2YS7A 4FFMA 1KJ9A 4O84A 2PVPA 3KAKA 1KC7A 2GLTA 4FFPA 2V59A 4QSHA 4DLKA 4MA5A 5LOVF 4O7LA 3AX6A 1EUCB 4C5BA 1EYZA 1EZ1A 3VPCA 2CNQA 3R5FA 5CA0F 1OBDA 2GPWA 2R85A 3WNZA 3GLKA 4C5CA 5JVLA 3SE7A 1CQIB 3R9RA 4XZ3B 2J9GA 4O7SA 1M6VA 1WR2A 4MAMA 1W93A 3ETHA 4O4LF 3KREA 4YAKB 1E4EB 3I12A 4MV8A 3RV4A 5C1OA 4FFLA 1M0WA 4O2AF 1DIKA 1C3OA 2I80A 1JLLB 1KJ8A 4I55F 3AW8A 2YRWA 1AUXA 4O7RA 1CS0A 2DLNA 2GPSA 4O7NA 1KJQA 4ZHQF 2C00A 3G8CA 4NYEA 2HGSA 5J2UF 2FP4B 2YRXA 3U55A 3Q1KA 2W6PA 5D8DA 3TINA 2Z02A 3HO8A 4ZI7F 1VBHA 3TIGA 3KAJA 3R23A 4O7ZA 2R7NA 3VOTA 2R87A 5C1PA 2ZDHA 4O4HF 1OBGA 3LP8A 1E4EA 3U9SA 1I7LA 3JZFA 3VPBA 2YL2A 3HB9A 4O4IF 4I4TF 5FNVF 4EG0A 4O7YA 2OLSA 4XX0B 3DF7A 4EGQA 2VR1A 2QK4A 2W6NA 4MV7A 4Y8VB 2W6MA 4FGRA 1UC8A 4IWXA 1GSHA 2VPQA 4HR7A 4O2BF 4FFRA 3VMMA 2ZDQA 1SCUB 2YYAA 3N8DA 2P0AA 3HBLA 2ZDGA 3V4SA 1Z2NX 2Z04A 1EUDB 4L1KA 2YZNA 4O82A 1GLVA 4EGJA 2IP4A 3RV3A 1DV1A 3MWDA 3G8DA 4IHJF 2NU6B 5LXTF 2YW2A 1KJIA 2DIKA 3Q2OA 4I50F 2R86A 5LP6F 1GSAA 4YJ3F 3JRWA 2NU7B 4O7WA 1KUTA 3U54A 5CB4F 4FFOA 1T36A 2GQSA 3TW6A 1W96A 4O83A 4O4JF 2V58A 4C5AA 4HNVA 4O81A 2FPGB 2W70A 2FB9A 1KBLA 5JVDF 2R7KA 4MV9A 4FU0A 3ORRA 4TUYF 3KALA 3R5XA 4FFNA 3BG5A 2YWVA 4HQ6A 3WO1A 2R7LA 1IOWA 5BMVF 3K5IA 1JDEA 3N6RA 5CAEB 5GONF 4XYMB 5HV6A 5K2MA 2XD4A 4MV4A 2W71A 5BPHA 4YBZB 1I7NA 4YB8B 4IWYA 1JDBB 3ETJA 1CE8A 1EHIA 5LA6F 1ULZA 3MJFA 3JRXA 3TIIA 1GSOA 1BXRA 3RUPA 2W6OA 4ZOLF 2R6FA 2X0SA 5LYJF 1A48A 1PK8A 3QFFA 1B6SA 1JKJB 4MV1A 3VA7A 4WD3A 2PBZA 4E4TA 4ZQIA 4ME6A 2NU9B 5CA1F 2NU8B 5DMXA 2FPPB 3MWEA 4IZOA 1UC9A 1VKZA 2R84A 2GQRA 4HNTA 3GIDA 2I87A 5KKNB 3UFXB 1VBGA 1B6RA 3ORQA 3RFCA 2YZMA 3LWBA 4IIJF 2NUAB 1Z2PX 5JQGF 2YZGA 1CQJB 4MA0A 4O7VA 1IOVA 5HBRB 3OUZA 2YS6A 4WBNF 2CQYA 3V4ZA 2R7MA 5JH7F 3TQTA 4M9UA 3VPDA 5J2TF 2I8CA 3OUUA 5I47A 3JZIA 5BPFA 4TV8F 2CZGA 4MV6A 1PX2A 3R5HA 1C30A 4RZQA 3K5HA 2YZLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U9T A;  2WYO A;  4DIM A;  2W6Z A;  1Z2O X;  5EZY F;  2DWC A;  3NUA A;  4MV3 A;  2HJW A;  2XCL A;  4O7T A;  2PN1 A;  1BNC A;  4YJ2 F;  4YAJ B;  4FE2 A;  2CNV A;  4HNU A;  5JQW A;  2FPI B;  3K3P A;  4O86 A;  2V5A A;  2R82 A;  2QF7 A;  1KEE A;  1M0T A;  1GGO A;  5H80 A;  1DV2 A;  1A9X A;  1AUV A;  2SCU B;  2VQD A;  2CNU A;  3WO0 A;  3E5N A;  5C8Y F;  4TV9 F;  1KJJ A;  2W6Q A;  5IYZ F;  5KX5 F;  2DZD A;  4XYL B;  2YS7 A;  4FFM A;  1KJ9 A;  4O84 A;  2PVP A;  3KAK A;  1KC7 A;  2GLT A;  4FFP A;  2V59 A;  4QSH A;  4DLK A;  4MA5 A;  5LOV F;  4O7L A;  3AX6 A;  1EUC B;  4C5B A;  1EYZ A;  1EZ1 A;  3VPC A;  2CNQ A;  3R5F A;  5CA0 F;  1OBD A;  2GPW A;  2R85 A;  3WNZ A;  3GLK A;  4C5C A;  5JVL A;  3SE7 A;  1CQI B;  3R9R A;  4XZ3 B;  2J9G A;  4O7S A;  1M6V A;  1WR2 A;  4MAM A;  1W93 A;  3ETH A;  4O4L F;  3KRE A;  4YAK B;  1E4E B;  3I12 A;  4MV8 A;  3RV4 A;  5C1O A;  4FFL A;  1M0W A;  4O2A F;  1DIK A;  1C3O A;  2I80 A;  1JLL B;  1KJ8 A;  4I55 F;  3AW8 A;  2YRW A;  1AUX A;  4O7R A;  1CS0 A;  2DLN A;  2GPS A;  4O7N A;  1KJQ A;  4ZHQ F;  2C00 A;  3G8C A;  4NYE A;  2HGS A;  5J2U F;  2FP4 B;  2YRX A;  3U55 A;  3Q1K A;  2W6P A;  5D8D A;  3TIN A;  2Z02 A;  3HO8 A;  4ZI7 F;  1VBH A;  3TIG A;  3KAJ A;  3R23 A;  4O7Z A;  2R7N A;  3VOT A;  2R87 A;  5C1P A;  2ZDH A;  4O4H F;  1OBG A;  3LP8 A;  1E4E A;  3U9S A;  1I7L A;  3JZF A;  3VPB A;  2YL2 A;  3HB9 A;  4O4I F;  4I4T F;  5FNV F;  4EG0 A;  4O7Y A;  2OLS A;  4XX0 B;  3DF7 A;  4EGQ A;  2VR1 A;  2QK4 A;  2W6N A;  4MV7 A;  4Y8V B;  2W6M A;  4FGR A;  1UC8 A;  4IWX A;  1GSH A;  2VPQ A;  4HR7 A;  4O2B F;  4FFR A;  3VMM A;  2ZDQ A;  1SCU B;  2YYA A;  3N8D A;  2P0A A;  3HBL A;  2ZDG A;  3V4S A;  1Z2N X;  2Z04 A;  1EUD B;  4L1K A;  2YZN A;  4O82 A;  1GLV A;  4EGJ A;  2IP4 A;  3RV3 A;  1DV1 A;  3MWD A;  3G8D A;  4IHJ F;  2NU6 B;  5LXT F;  2YW2 A;  1KJI A;  2DIK A;  3Q2O A;  4I50 F;  2R86 A;  5LP6 F;  1GSA A;  4YJ3 F;  3JRW A;  2NU7 B;  4O7W A;  1KUT A;  3U54 A;  5CB4 F;  4FFO A;  1T36 A;  2GQS A;  3TW6 A;  1W96 A;  4O83 A;  4O4J F;  2V58 A;  4C5A A;  4HNV A;  4O81 A;  2FPG B;  2W70 A;  2FB9 A;  1KBL A;  5JVD F;  2R7K A;  4MV9 A;  4FU0 A;  3ORR A;  4TUY F;  3KAL A;  3R5X A;  4FFN A;  3BG5 A;  2YWV A;  4HQ6 A;  3WO1 A;  2R7L A;  1IOW A;  5BMV F;  3K5I A;  1JDE A;  3N6R A;  5CAE B;  5GON F;  4XYM B;  5HV6 A;  5K2M A;  2XD4 A;  4MV4 A;  2W71 A;  5BPH A;  4YBZ B;  1I7N A;  4YB8 B;  4IWY A;  1JDB B;  3ETJ A;  1CE8 A;  1EHI A;  5LA6 F;  1ULZ A;  3MJF A;  3JRX A;  3TII A;  1GSO A;  1BXR A;  3RUP A;  2W6O A;  4ZOL F;  2R6F A;  2X0S A;  5LYJ F;  1A48 A;  1PK8 A;  3QFF A;  1B6S A;  1JKJ B;  4MV1 A;  3VA7 A;  4WD3 A;  2PBZ A;  4E4T A;  4ZQI A;  4ME6 A;  2NU9 B;  5CA1 F;  2NU8 B;  5DMX A;  2FPP B;  3MWE A;  4IZO A;  1UC9 A;  1VKZ A;  2R84 A;  2GQR A;  4HNT A;  3GID A;  2I87 A;  5KKN B;  3UFX B;  1VBG A;  1B6R A;  3ORQ A;  3RFC A;  2YZM A;  3LWB A;  4IIJ F;  2NUA B;  1Z2P X;  5JQG F;  2YZG A;  1CQJ B;  4MA0 A;  4O7V A;  1IOV A;  5HBR B;  3OUZ A;  2YS6 A;  4WBN F;  2CQY A;  3V4Z A;  2R7M A;  5JH7 F;  3TQT A;  4M9U A;  3VPD A;  5J2T F;  2I8C A;  3OUU A;  5I47 A;  3JZI A;  5BPF A;  4TV8 F;  2CZG A;  4MV6 A;  1PX2 A;  3R5H A;  1C30 A;  4RZQ A;  3K5H A;  2YZL A; 
#chains in the Genus database with same CATH topology
 1XK5 A;  4NZN A;  2CW7 A;  3U9T A;  5KFQ A;  5KFA A;  3RB4 A;  5KG7 A;  2WYO A;  4DUY H;  4DIM A;  4LH7 A;  2W6Z A;  3G6Y A;  1Z2O X;  4LSX A;  5EZY F;  4RAZ A;  5KG4 A;  1XMQ H;  1HNZ H;  5I5S A;  2DWC A;  3NUA A;  5CM0 A;  5BWW A;  5C5J A;  4MV3 A;  1IBK H;  5DLG A;  2HJW A;  3BJY A;  2FLL A;  5DG9 A;  2ATL A;  4Q45 A;  1Y14 B;  5DG7 A;  4DV6 H;  3LQS A;  3RBE A;  2XCL A;  3TW7 A;  3GTP A;  4O7T A;  2PN1 A;  5KFL A;  2EJ2 A;  1BNC A;  3PW2 A;  4YJ2 F;  4YAJ B;  2W9C A;  3PW0 A;  2VQF H;  1N56 A;  2Q7D A;  4DR5 H;  4DR3 H;  3T54 A;  4FE2 A;  2CNV A;  4JUZ A;  4HNU A;  5E25 A;  3T9E A;  3W1B A;  2FPI B;  5JQW A;  3MR3 A;  3K3P A;  4DL2 A;  4O86 A;  4JI3 H;  3GV7 B;  5L1I A;  3V6J A;  3G6V A;  2V5A A;  5KG5 A;  3T5K A;  2R82 A;  2DPI A;  3M4I A;  5DQI A;  2QF7 A;  3WWH A;  1KEE A;  4JXU A;  2OH2 A;  1M0T A;  1GGO A;  4QJF A;  1FVI A;  4PBC A;  3GTK A;  4QW8 A;  3F8N A;  3BQ2 A;  2WDT A;  3GJX B;  1I2K A;  4J0M A;  4A3K G;  5H80 A;  2RF4 A;  1DV2 A;  4C2M A;  5KFO A;  4B3S H;  1A9X A;  1AUV A;  2WAQ A;  2SCU B;  5KG1 A;  3EYY A;  2VQD A;  3HKZ A;  2CNU A;  1V4Y A;  3FMA A;  3QWU A;  3UZB A;  3T7A A;  4APM A;  3PFF A;  1I3Q A;  1A3G A;  4ECR A;  1DGS A;  1RJR A;  1SYX B;  3WO0 A;  2PMZ A;  1G2W A;  5C4X G;  1S68 A;  3E5N A;  2XCA A;  5C8Y F;  2NVX A;  5KFI A;  4PWQ A;  3BA9 A;  2RDI A;  5IP7 G;  4TV9 F;  3Q8R B;  4JYA H;  1KTA A;  2OWO A;  4RAY A;  1KJJ A;  2W6Q A;  5IYZ F;  5KX5 F;  2DZD A;  4XYL B;  4A3M G;  1I1M A;  3VNN A;  5KT5 A;  3M9M B;  4J9L A;  1OWT A;  5L9X A;  4J9R A;  1CKN B;  2ODT X;  2YS7 A;  5KFE A;  4FFM A;  4J9S A;  1KJ9 A;  5LMU H;  4DR7 H;  2X5R A;  4O84 A;  2FJZ A;  2PVP A;  3KAK A;  4YP3 A;  4LF8 H;  1KC7 A;  4YR0 A;  4ECS A;  3PW5 A;  4EFB A;  2GLT A;  4RZR A;  4FFP A;  2V59 A;  4QSH A;  4DLK A;  2VA2 A;  4UCV A;  3KHL A;  3L2P A;  4MA5 A;  3RAQ A;  5LOV F;  5I60 A;  5KFZ A;  3QZ8 A;  1S10 A;  1XNR H;  4O7L A;  2W57 A;  3AX6 A;  2Y0S E;  2IMW P;  1EUC B;  4C5B A;  1N36 H;  3UQ8 A;  1EYZ A;  1EZ1 A;  4EBE A;  3W5O A;  5I5V A;  3VPC A;  2CNQ A;  5KFS A;  5KFR A;  3R5F A;  4ED1 A;  3CQZ A;  5FLX W;  3HT5 A;  5CA0 F;  1OBD A;  2DPJ A;  4LF6 H;  4TQS A;  1WRV A;  4FS2 A;  3H0G A;  2GPW A;  2R85 A;  4IAJ A;  5T14 A;  1I50 A;  2BQ3 A;  2FLP A;  2R7Z A;  3WNZ A;  3T5L A;  4QIW E;  4Q0Y A;  3GLK A;  2W8L A;  4C5C A;  3KHR A;  2RGV A;  3V6H A;  1GYF A;  3SI8 A;  4YQW A;  5K3W A;  1ZAU A;  1I6U A;  5HNE A;  3KHG A;  5JVL A;  3T9B A;  1VAJ A;  3GIQ A;  3SE7 A;  4BWS C;  1CQI B;  3R9R A;  4XZ3 B;  2XGP A;  4ECV A;  3RB0 A;  2J9G A;  5BYB A;  3G6X A;  2JEJ A;  4FBU A;  2NVY A;  4A3G G;  2JA8 G;  4O7S A;  3GIM A;  5F9N A;  2ZM6 H;  4B3M H;  3SNO A;  4IR9 A;  4RUA A;  1M6V A;  1WR2 A;  3BAA A;  2E2I A;  2ZGI A;  4J9Q A;  2M05 A;  2C28 A;  3H3V H;  4MAM A;  1W93 A;  5KFH A;  5KG6 A;  3ETH A;  4YR3 A;  4PDB A;  4O4L F;  3T9F A;  4LF5 H;  4BY7 G;  3BA8 A;  3KRE A;  2UVR A;  4J9O A;  4YAK B;  1E4E B;  5KT3 A;  4WHX A;  3I12 A;  4MV8 A;  5I5U A;  1A0G A;  4F4Y A;  3M9N B;  4ECZ A;  3RV4 A;  2Q2U A;  1JIH A;  5C1O A;  4FFL A;  1M0W A;  4O2A F;  4R8U B;  1DIK A;  1C3O A;  2COG A;  2I80 A;  4O3S A;  1JLL B;  2EJ3 A;  4O3N A;  2XCP A;  3BQ1 A;  1KJ8 A;  1SEI A;  4I55 F;  3AW8 A;  1S03 G;  3RB6 A;  2YRW A;  1AUX A;  1P16 A;  3T5J A;  4K6N A;  1X9N A;  5F9L A;  4K0K H;  1P8L A;  1T3N A;  4O7R A;  4NXM H;  4LF4 H;  1CS0 A;  2DLN A;  2VOB A;  2GPS A;  2FE3 A;  3HOY G;  4O7N A;  2WTF A;  3NC0 B;  4RNO A;  1KJQ A;  4ZHQ F;  5KG3 A;  2C00 A;  4IRK A;  3KYH C;  1BJT A;  2FK3 A;  4G3I A;  2JA6 A;  3G8C A;  4NYE A;  5D1P A;  4ETS A;  4RNM A;  3IG0 A;  4UCS A;  2R7Z G;  3HOX G;  3NBZ B;  1KT8 A;  4UCT A;  2CFM A;  4F4X A;  1E4G T;  4CE5 A;  2HGS A;  5FD6 A;  3MR5 A;  5J2U F;  2FP4 B;  2YRX A;  3T99 A;  3U55 A;  4JV2 A;  1MZB A;  3Q1K A;  1FKA H;  2W9A A;  5FLM G;  2EJ0 A;  2W6P A;  5D8D A;  3TIN A;  4EQ5 A;  4CC5 A;  5FD5 A;  4A2A A;  4UFZ A;  3OSN A;  4BBR G;  2UVV A;  4JI4 H;  2UXB H;  2Z02 A;  5EWF A;  3HO8 A;  4TQR A;  3J80 W;  4ZI7 F;  2RGR A;  1VBH A;  3TIG A;  3KAJ A;  3R23 A;  3H0G G;  4RCN A;  3TQ1 A;  2VQE H;  4O7Z A;  4UCU A;  2R7N A;  1S0M A;  3MR2 A;  5EWE A;  3VOT A;  2R87 A;  5C1P A;  2ZDH A;  3GIP A;  3W1G A;  4RB0 A;  4O4H F;  3KTM A;  1OBG A;  3LP8 A;  1E4E A;  4R7R A;  3FDS A;  3PN1 A;  3N6X A;  2B63 G;  3U9S A;  4CMD A;  1ZQ7 A;  4RB2 C;  1RYS A;  1I7L A;  5DGI A;  2AQ4 A;  2R93 A;  4DL4 A;  4YHH H;  3JZF A;  3VPB A;  2DAB A;  2YL2 A;  4LMY A;  4YY3 H;  3SGI A;  4R8U A;  3WWI A;  2AGP A;  1RJQ A;  3HB9 A;  4DL3 A;  4O4I F;  3N40 P;  3T1H H;  4I4T F;  4RUC A;  4F4W A;  2AGQ A;  5FNV F;  4EG0 A;  5CR5 A;  3TY5 A;  4AYB E;  4O7Y A;  2OLS A;  4XX0 B;  3DF7 A;  3NBY B;  3QQM A;  4NZM A;  5FPR A;  1TAE A;  4EGQ A;  2VR1 A;  1XDN A;  4LSA A;  5KFJ A;  4QWA A;  2JA5 A;  5C44 G;  5KFC A;  4U7C A;  4JI1 H;  4DR1 H;  2QK4 A;  2HHF B;  4CC6 A;  3U0G A;  2W6N A;  5KT2 A;  4QWE A;  4MV7 A;  4EBD A;  3JSL A;  4Y8V B;  5I5W A;  2W6M A;  5C3E G;  2XIG A;  2UUC H;  4Q4D A;  5CE8 A;  3Q8P B;  1CKM A;  1WSC A;  3MWM A;  4FGR A;  5BYA A;  4AYB A;  3I4M G;  4A3B G;  1UC8 A;  1S97 A;  2YU9 A;  3J81 W;  4IWX A;  1RYR A;  4DR2 H;  2ASJ A;  1GSH A;  3BAC A;  4Q44 A;  2ASD A;  1Y1W A;  3N42 B;  2WE6 A;  1V9P A;  3H4B A;  2VPQ A;  4PZ7 A;  5LMN H;  4HR7 A;  5KFF A;  1RK5 A;  1TWF A;  4O2B F;  3Q8S B;  4FFR A;  4X66 H;  5FPO A;  4CKC A;  4TVI A;  5D1O B;  1EKV A;  1E4F T;  4DUZ H;  2C2E A;  5DIS C;  1S0N A;  2B63 A;  4JI6 H;  5A2Q W;  2JA7 A;  2W7O A;  3AYH B;  3VMM A;  3RF2 A;  5KFP A;  3PVX A;  1IYD A;  2JA6 G;  2ZDQ A;  2VUM A;  4J9M A;  2J6S A;  2HVR A;  2UXD H;  1Y1V A;  3LML A;  1SCU B;  2YYA A;  3N8D A;  4GLW A;  3T9A A;  5EDW A;  2P0A A;  3HBL A;  2ZDG A;  2Y0S A;  2IBK A;  4PZ8 A;  3V4S A;  1Z2N X;  3RGX A;  1I1L A;  5KT6 A;  4DR6 H;  2Z04 A;  1EUD B;  4L1K A;  4IRD A;  5I5X A;  4DRF A;  2QYZ A;  2YZN A;  5I5Y A;  3DAA A;  3WWJ A;  3RJ0 A;  1IBM H;  4O82 A;  4O3R A;  4MTD A;  5IP9 G;  5KFM A;  4CMF A;  4J9K A;  1GLV A;  3GB8 B;  5IYC G;  3IN5 A;  4QW9 A;  4HYK A;  4BY1 G;  2ASL A;  2R8J A;  4IRC A;  2R92 A;  4QIW A;  4EGJ A;  2IP4 A;  3RV3 A;  1DV1 A;  5DQH A;  1K83 A;  2COI A;  4U6P A;  4CHI A;  3MWD A;  3EPG A;  2HGW A;  3G8D A;  4IHJ F;  3TY8 A;  2WB1 E;  3M9O B;  2HHF A;  2NU6 B;  5LXT F;  3N41 B;  4DL5 A;  4DQN A;  2YW2 A;  5EOY A;  3H20 A;  3KXY T;  3MFI A;  1KJI A;  4A2B A;  2DIK A;  3Q2O A;  4J9P A;  4BBS G;  2R93 G;  2AU0 A;  1A0I A;  1DAA A;  2R86 A;  4I50 F;  5LP6 F;  1GSA A;  4YJ3 F;  1JX4 A;  1V51 A;  1XNQ H;  1UNN C;  3EPI A;  5EWG A;  2FK2 A;  3K3V A;  3JRW A;  4RU9 A;  3H4D A;  5KFW A;  2NU7 B;  4O7W A;  4LFC H;  1TWH A;  2C35 B;  1KUT A;  3GDE A;  3U54 A;  4YR2 A;  3GV8 B;  4QWC A;  5CB4 F;  4AQY H;  2UVW A;  2W8K A;  4FFO A;  3HOZ G;  5KFT A;  1T36 A;  1O75 A;  4CKB A;  4FS1 A;  4A3J G;  3RGZ A;  2JA5 G;  2GQS A;  1EKF A;  4FBT A;  3TW6 A;  4E6N A;  3PO3 G;  3GTG A;  1W96 A;  4O83 A;  4I7H A;  5JUM A;  5D1O A;  1ZET A;  4NZO A;  1WCM A;  4O4J F;  4F50 A;  2V58 A;  2BR0 A;  4C5A A;  4HNV A;  4O81 A;  2FPG B;  4GLX A;  3PZP A;  1N33 H;  2W70 A;  2FB9 A;  1N34 H;  4KHP H;  1KBL A;  5JVD F;  4Q43 A;  4Q8F A;  2QB5 A;  3CSW A;  2R7K A;  4JI2 H;  4ED6 A;  1T94 A;  4J9N A;  2R8K A;  4LH6 A;  4MV9 A;  3S24 A;  4FU0 A;  4JI7 H;  1Y1W G;  3OTO H;  3ORR A;  4TUY F;  3KAL A;  3R5X A;  1RJP A;  4FFN A;  4DV0 H;  4ECQ A;  2VUG A;  3BG5 A;  4RB1 A;  4UUG A;  4ED7 A;  1XMO H;  2UVU A;  4DV2 H;  2YWV A;  4HQ6 A;  3WO1 A;  3PW7 A;  2R7L A;  5L1J A;  4JI0 H;  1L2Z A;  1WH2 A;  1I94 H;  5IWA H;  3OHA A;  1IOW A;  5BMV F;  2JEI A;  4UCO A;  2JA7 G;  3HOV G;  5IT9 W;  3K5I A;  4M0J A;  3KHH A;  4A3F G;  4O3Q A;  1IYE A;  4A3D G;  4LF7 H;  2VUM G;  4BXX G;  1JDE A;  1K1Q A;  3N6R A;  2XGQ A;  4A3I G;  1Y1V G;  3DTF A;  4TM5 A;  5GON F;  5CAE B;  1HNX H;  2E2H A;  4XYM B;  4ECT A;  5KG0 A;  5I5T A;  4DL6 A;  1S9F A;  5HV6 A;  2HG8 A;  2UUB H;  5LL6 b;  2V4R A;  4ECX A;  2BQU A;  4ECY A;  2Y4R A;  4DR4 H;  4X64 H;  4DV4 H;  4DV1 H;  1IBL H;  5FJ8 G;  4GC7 A;  4JV0 A;  5K2M A;  4ED8 A;  1M7J A;  4GKK H;  2VPS A;  1TA8 A;  2XD4 A;  4HN2 A;  1RK6 A;  5IYD G;  4EFE A;  3V6K A;  2C2D A;  1JXL A;  4B3T H;  3PR5 B;  2HDK A;  2CW8 A;  2W71 A;  4MV4 A;  5BPH A;  2WAQ E;  5FR9 A;  2R92 G;  2UU9 H;  4A3E G;  1R9T A;  3TY9 A;  4YBZ B;  1I7N A;  2HIV A;  5DGH A;  4IWY A;  4YB8 B;  5BWV A;  3HKZ E;  5DLF A;  1HNW H;  3PW4 A;  1JDB B;  3ETJ A;  3DTG A;  5BWU A;  1BGW A;  3C0F B;  3T5H A;  1CE8 A;  1EHI A;  5LA6 F;  2PMZ E;  2J6U A;  4JI8 H;  2A1H A;  4A3L G;  4DAA A;  3FKI A;  4FM9 A;  3GTM A;  1ULZ A;  4LFB H;  4MTE A;  3MJF A;  3JRX A;  3TII A;  4O3O A;  4EBC A;  5BWT A;  4EEY A;  1GSO A;  3GTL A;  3LUL A;  2F4V H;  5BWX A;  1TWG A;  4ED3 A;  3HOW G;  2EIY A;  1BXR A;  2HVQ A;  3RUP A;  2W6O A;  1ZHS A;  2O03 A;  2W9B B;  3NGD A;  4ED0 A;  1S0O A;  2JEG A;  4ZOL F;  2ALZ A;  3RR5 A;  2HGX A;  5BWR A;  2R6F A;  4RB3 C;  2X0S A;  5LYJ F;  1A48 A;  1PK8 A;  1I2L A;  1ET0 A;  4ECU A;  3RB3 A;  4Q8E A;  3QFF A;  5KFV A;  1B6S A;  2C2R A;  1JKJ B;  4MV1 A;  4GC6 A;  3Q8Q B;  4NLG A;  3RBD A;  3VA7 A;  2AGO A;  1I1K A;  1FJG H;  1HR0 H;  1WCM G;  3RTX A;  3L4J A;  3UYY A;  4WD3 A;  2IA6 A;  1J5E H;  2PBZ A;  2CKZ B;  4QWD A;  4E4T A;  2FK1 A;  3HXL A;  4ZQI A;  3GTJ A;  4ME6 A;  5KFX A;  2V9W A;  5L1L A;  4JI5 H;  2NU9 B;  5CA1 F;  3PO2 G;  3JSN A;  3MR6 A;  4ED2 A;  2NU8 B;  4EYI B;  1B04 A;  5DMX A;  4EEQ A;  2FPP B;  2FLN A;  1N48 A;  4CKE A;  1CKO A;  3J7A K;  3MWE A;  5KFB A;  2E5L H;  4OX9 H;  1TWA A;  5DGB A;  4B3R H;  1UC9 A;  4IZO A;  1VKZ A;  2R84 A;  2W7P A;  2GQR A;  2C22 A;  4Q4C A;  4HNT A;  5IYB G;  3GID A;  4ECW A;  2I87 A;  3GTQ A;  2YCH A;  5KKN B;  2FKL A;  4DV5 H;  2J6T A;  4LF9 H;  3N43 B;  4DV3 H;  1EKP A;  4NXN H;  4UCR A;  3QZ7 A;  3GIL A;  2Q2T A;  3OSP A;  2HHH H;  4LFA H;  5DQG A;  2UXC H;  3UFX B;  1VBG A;  2V4Q A;  4JV5 H;  1B6R A;  3GV5 B;  3ORQ A;  3T9C A;  3RFC A;  1AN7 A;  2KSW A;  5KFD A;  2YZM A;  3JAM W;  3LWB A;  4IIJ F;  2NUA B;  3GIJ A;  1TWC A;  3JZ6 A;  1GO3 E;  5L1K A;  1VS0 A;  1Z2P X;  3I4N G;  5JQG F;  2FMA A;  4O3P A;  2YZG A;  5DG8 A;  2R8I A;  3BAB A;  2COJ A;  1K1S A;  5BR8 H;  2RDJ A;  5KS8 A;  4IR1 A;  4DV7 H;  4X62 H;  4A3C G;  3N44 B;  2W9C B;  3RIZ A;  1CQJ B;  2DAA A;  4MA0 A;  2W9B A;  3GII A;  4DL7 A;  2BQR A;  3UZO A;  3CEB A;  4O7V A;  3CVZ A;  2JEF A;  2VA3 A;  2XC9 A;  5DGA A;  4GKJ H;  1B33 N;  1IOV A;  5HBR B;  3OUZ A;  1N32 H;  5KT7 A;  2YS6 A;  4WBN F;  3GTO A;  5KFG A;  3H40 A;  1SFO A;  2CQY A;  5KFU A;  2WB1 A;  3V4Z A;  2R7M A;  5KFN A;  3PR4 A;  5JH7 F;  2MCT A;  3OHB A;  5DAA A;  3TQT A;  2R8G A;  4F4Z A;  4M9U A;  3FKI G;  1ZHQ A;  3VPD A;  5KFK A;  3MFH A;  5KFY A;  4PZ6 A;  5J2T F;  2UUA H;  2I8C A;  3T9D A;  4JV1 A;  1CKN A;  3OUU A;  3BQ0 A;  2ABJ A;  3L4K A;  5I47 A;  4A93 G;  2HVS A;  3JZI A;  2ZJT A;  3HOU G;  2HIX A;  5BPF A;  4TV8 F;  4M7E A;  3TEK A;  2CZG A;  4RNN A;  4MV6 A;  1PX2 A;  2R8H A;  3R5H A;  1C30 A;  5KT4 A;  4X65 H;  3GQC A;  4RZQ A;  4EYH B;  3T1Y H;  3K5H A;  2YZL A;  4QWB A;  3RAX A;  5KG2 A;  3GIK A; 
#chains in the Genus database with same CATH homology
 3U9T A;  2WYO A;  4DIM A;  2W6Z A;  1Z2O X;  5EZY F;  2DWC A;  3NUA A;  4MV3 A;  2HJW A;  2XCL A;  4O7T A;  2PN1 A;  1BNC A;  4YJ2 F;  4YAJ B;  4FE2 A;  2CNV A;  4HNU A;  5JQW A;  2FPI B;  3K3P A;  4O86 A;  2V5A A;  2R82 A;  2QF7 A;  1KEE A;  1M0T A;  1GGO A;  5H80 A;  1DV2 A;  1A9X A;  1AUV A;  2SCU B;  2VQD A;  2CNU A;  3WO0 A;  3E5N A;  5C8Y F;  4TV9 F;  1KJJ A;  2W6Q A;  5IYZ F;  5KX5 F;  2DZD A;  4XYL B;  2YS7 A;  4FFM A;  1KJ9 A;  4O84 A;  2PVP A;  3KAK A;  1KC7 A;  2GLT A;  4FFP A;  2V59 A;  4QSH A;  4DLK A;  4MA5 A;  5LOV F;  4O7L A;  3AX6 A;  1EUC B;  4C5B A;  1EYZ A;  1EZ1 A;  3VPC A;  2CNQ A;  3R5F A;  5CA0 F;  1OBD A;  2GPW A;  2R85 A;  3WNZ A;  3GLK A;  4C5C A;  5JVL A;  3SE7 A;  1CQI B;  3R9R A;  4XZ3 B;  2J9G A;  4O7S A;  1M6V A;  1WR2 A;  4MAM A;  1W93 A;  3ETH A;  4O4L F;  3KRE A;  4YAK B;  1E4E B;  3I12 A;  4MV8 A;  3RV4 A;  5C1O A;  4FFL A;  1M0W A;  4O2A F;  1DIK A;  1C3O A;  2I80 A;  1JLL B;  1KJ8 A;  4I55 F;  3AW8 A;  2YRW A;  1AUX A;  4O7R A;  1CS0 A;  2DLN A;  2GPS A;  4O7N A;  1KJQ A;  4ZHQ F;  2C00 A;  3G8C A;  4NYE A;  2HGS A;  5J2U F;  2FP4 B;  2YRX A;  3U55 A;  3Q1K A;  2W6P A;  5D8D A;  3TIN A;  2Z02 A;  3HO8 A;  4ZI7 F;  1VBH A;  3TIG A;  3KAJ A;  3R23 A;  4O7Z A;  2R7N A;  3VOT A;  2R87 A;  5C1P A;  2ZDH A;  4O4H F;  1OBG A;  3LP8 A;  1E4E A;  3U9S A;  1I7L A;  3JZF A;  3VPB A;  2YL2 A;  3HB9 A;  4O4I F;  4I4T F;  5FNV F;  4EG0 A;  4O7Y A;  2OLS A;  4XX0 B;  3DF7 A;  4EGQ A;  2VR1 A;  2QK4 A;  2W6N A;  4MV7 A;  4Y8V B;  2W6M A;  4FGR A;  1UC8 A;  4IWX A;  1GSH A;  2VPQ A;  4HR7 A;  4O2B F;  4FFR A;  3VMM A;  2ZDQ A;  1SCU B;  2YYA A;  3N8D A;  2P0A A;  3HBL A;  2ZDG A;  3V4S A;  1Z2N X;  2Z04 A;  1EUD B;  4L1K A;  2YZN A;  4O82 A;  1GLV A;  4EGJ A;  2IP4 A;  3RV3 A;  1DV1 A;  3MWD A;  3G8D A;  4IHJ F;  2NU6 B;  5LXT F;  2YW2 A;  1KJI A;  2DIK A;  3Q2O A;  4I50 F;  2R86 A;  5LP6 F;  1GSA A;  4YJ3 F;  3JRW A;  2NU7 B;  4O7W A;  1KUT A;  3U54 A;  5CB4 F;  4FFO A;  1T36 A;  2GQS A;  3TW6 A;  1W96 A;  4O83 A;  4O4J F;  2V58 A;  4C5A A;  4HNV A;  4O81 A;  2FPG B;  2W70 A;  2FB9 A;  1KBL A;  5JVD F;  2R7K A;  4MV9 A;  4FU0 A;  3ORR A;  4TUY F;  3KAL A;  3R5X A;  4FFN A;  3BG5 A;  2YWV A;  4HQ6 A;  3WO1 A;  2R7L A;  1IOW A;  5BMV F;  3K5I A;  1JDE A;  3N6R A;  5CAE B;  5GON F;  4XYM B;  5HV6 A;  5K2M A;  2XD4 A;  4MV4 A;  2W71 A;  5BPH A;  4YBZ B;  1I7N A;  4YB8 B;  4IWY A;  1JDB B;  3ETJ A;  1CE8 A;  1EHI A;  5LA6 F;  1ULZ A;  3MJF A;  3JRX A;  3TII A;  1GSO A;  1BXR A;  3RUP A;  2W6O A;  4ZOL F;  2R6F A;  2X0S A;  5LYJ F;  1A48 A;  1PK8 A;  3QFF A;  1B6S A;  1JKJ B;  4MV1 A;  3VA7 A;  4WD3 A;  2PBZ A;  4E4T A;  4ZQI A;  4ME6 A;  2NU9 B;  5CA1 F;  2NU8 B;  5DMX A;  2FPP B;  3MWE A;  4IZO A;  1UC9 A;  1VKZ A;  2R84 A;  2GQR A;  4HNT A;  3GID A;  2I87 A;  5KKN B;  3UFX B;  1VBG A;  1B6R A;  3ORQ A;  3RFC A;  2YZM A;  3LWB A;  4IIJ F;  2NUA B;  1Z2P X;  5JQG F;  2YZG A;  1CQJ B;  4MA0 A;  4O7V A;  1IOV A;  5HBR B;  3OUZ A;  2YS6 A;  4WBN F;  2CQY A;  3V4Z A;  2R7M A;  5JH7 F;  3TQT A;  4M9U A;  3VPD A;  5J2T F;  2I8C A;  3OUU A;  5I47 A;  3JZI A;  5BPF A;  4TV8 F;  2CZG A;  4MV6 A;  1PX2 A;  3R5H A;  1C30 A;  4RZQ A;  3K5H A;  2YZL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...