4XZ3B

Ca. korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 (se-met derivative) in complex with coenzyme a and mg-amppcp, phosphohistidine segment pointing towards nucleotide binding site
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
228
structure length
228
Chain Sequence
SRDLLLKAKENGRKSLLEHEAKYFISSYGIPVTNIRLAKSEEEAVNFSREIGFPVVLKIVSPQVVHKSDVGGVKVNLRSEEEVRKAYREIIENVKRNVPNAEIEGILVQEFAPPGVELIIGLLRDPQFGPTVMFGLGGVFVELFRDVSFRVAPLSEQDAESMIKEVKAYKLLTGFRGMEPVDIEAIKDALIRAGRIGVENEEIAEMDLNPVIAYPKGIKVVDARIILR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl-CoA synthetase (NDP forming)
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Candidatus korarchaeum cryptofilum opf8
molecule tags Ligase
total genus 66
structure length 228
sequence length 228
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13549 ATP-grasp_5 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4xz3B01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4xz3B02
3K5HA 3LWBA 3WO0A 4TUYF 1B6SA 3VPDA 2ZDQA 4MV9A 2YS6A 4O7ZA 2R6FA 2QF7A 4ZI7F 3N8DA 3V4SA 4FGRA 2FPPB 1VKZA 5KKNB 4HNTA 2SCUB 5I47A 1IOVA 5BMVF 1BNCA 4MV3A 2R87A 4MA5A 3VPBA 3DF7A 2W6QA 4C5CA 4YJ3F 1CE8A 4O7VA 2WYOA 3GLKA 4C5AA 1M6VA 3I12A 4M9UA 1IOWA 1Z2OX 5JH7F 1E4EA 1CQIB 4WD3A 2PVPA 4IHJF 1M0WA 4E4TA 1T36A 2XCLA 2YZNA 4ME6A 2NUAB 3WO1A 3LP8A 1PX2A 4DLKA 4ZQIA 3TIGA 4TV8F 5BPHA 2R7NA 3K5IA 1W93A 1Z2PX 4MV7A 1EUDB 2W71A 2W6ZA 3OUZA 1KJ8A 2FPGB 3U55A 5JVLA 3ORRA 2CNVA 3U9TA 1AUXA 3KAKA 2V5AA 4O7NA 3TINA 4O4HF 4NYEA 1OBGA 3VPCA 1B6RA 1UC8A 2R7MA 4YAKB 2XD4A 4O81A 3MWDA 2R7KA 4HQ6A 1KJJA 5C8YF 2R82A 3Q1KA 2IP4A 4XX0B 3KREA 2FP4B 3QFFA 4O7TA 1JLLB 3TIIA 1JDEA 2DLNA 4Y8VB 5LP6F 2P0AA 2V59A 2HGSA 2R84A 4O84A 3OUUA 4TV9F 4XYMB 4MV6A 2CQYA 3R5HA 5IYZF 1GSOA 1KJ9A 2YZGA 2GPSA 4O82A 3RV4A 4IWXA 5KX5F 3Q2OA 3TW6A 5JVDF 1JKJB 1DV1A 4FFMA 1DV2A 2FPIB 4HNVA 4IWYA 4O2AF 4O2BF 4I50F 3RFCA 3VMMA 2W6OA 2CZGA 3G8DA 4EGQA 2NU6B 2YS7A 2Z02A 4O4LF 2W70A 3ORQA 4FFOA 1VBHA 4EG0A 3U9SA 1E4EB 4MAMA 2J9GA 5J2TF 2YW2A 5HBRB 3RV3A 5LYJF 2VR1A 2OLSA 4RZQA 2R85A 1KJQA 2GPWA 3RUPA 5CB4F 4O4JF 5JQGF 4O4IF 3JZIA 1KBLA 4FFNA 2VQDA 1GLVA 3JRWA 2ZDGA 3N6RA 2GQSA 1KJIA 1JDBB 1SCUB 2R86A 4O7LA 5C1PA 4EGJA 5K2MA 2W6MA 4MV4A 3TQTA 3ETJA 1C3OA 3VOTA 3WNZA 3AW8A 3AX6A 4QSHA 5CA0F 2PBZA 5GONF 4I55F 3BG5A 1CQJB 2I87A 1A9XA 4YAJB 2YYAA 3JZFA 2V58A 4WBNF 4IIJF 2CNUA 4YB8B 4YBZB 3VA7A 4MA0A 5CA1F 3UFXB 2PN1A 3U54A 5FNVF 2QK4A 1UC9A 5LXTF 1CS0A 5CAEB 2C00A 1BXRA 1DIKA 1WR2A 4YJ2F 2NU8B 3ETHA 4FFPA 1C30A 1EHIA 4I4TF 4MV1A 3KALA 5D8DA 1I7NA 1A48A 4O86A 3V4ZA 4L1KA 2CNQA 4DIMA 5C1OA 1W96A 2YRWA 1Z2NX 4FU0A 4ZHQF 2YWVA 4O7SA 4FE2A 3NUAA 5LOVF 2VPQA 3G8CA 4XYLB 2YRXA 1GSHA 1EUCB 2DZDA 2W6NA 1KEEA 3HBLA 1KUTA 1KC7A 2DWCA 3GIDA 4O7RA 1OBDA 2I80A 4HNUA 1VBGA 2W6PA 3R23A 5BPFA 5EZYF 2FB9A 4O7WA 2HJWA 3HB9A 3SE7A 1ULZA 3R5FA 3E5NA 4HR7A 1I7LA 1PK8A 4XZ3B 2ZDHA 1EYZA 3MJFA 1M0TA 5JQWA 1AUVA 4O83A 5H80A 3MWEA 2NU9B 4ZOLF 3HO8A 2R7LA 4FFRA 2YZLA 4IZOA 2YZMA 1EZ1A 2GLTA 2YL2A 3JRXA 5HV6A 2Z04A 2I8CA 4C5BA 3KAJA 4FFLA 1GSAA 4MV8A 3K3PA 5LA6F 1GGOA 2GQRA 2X0SA 5J2UF 2DIKA 5DMXA 2NU7B 3R5XA 3R9RA 4O7YA
chains in the Genus database with same CATH superfamily
3K5HA 5EWFA 3LWBA 3J7AK 3N41B 5FD6A 2EJ3A 2ZJTA 4ED6A 4IRKA 4JI7H 1KTAA 2JEJA 5KFHA 3WO0A 3T5KA 4TUYF 4G3IA 1B6SA 5DGHA 1FVIA 2ZGIA 2ZDQA 3RTXA 3VPDA 3HT5A 2YS6A 4MV9A 4O7ZA 3TEKA 2R6FA 4RZRA 4DL4A 2QF7A 2V9WA 1ZAUA 4DR4H 1TWGA 2FLLA 3NC0B 4NXMH 1AN7A 5KFMA 1BJTA 3PO3G 4CKCA 4ZI7F 5KT2A 4RNMA 2UU9H 2IBKA 2OH2A 3N8DA 1ZETA 3V4SA 2UXCH 3PO2G 4FGRA 3GDEA 1TWAA 1TAEA 4F4WA 2RGRA 4LF4H 3T54A 4WHXA 4Q44A 2C22A 4A3GG 4A3DG 2F4VH 3LQSA 5DG8A 2RDJA 2FPPB 1OWTA 3KHRA 5KFRA 3BABA 4M7EA 1RK6A 2JA7G 1MZBA 2CW8A 3I4NG 3V6KA 1VKZA 4RUAA 3TY9A 1T94A 1IBMH 5CR5A 5L1LA 5KKNB 2AGPA 3CEBA 3EPGA 4YQWA 2R93A 4HNTA 2UXDH 2SCUB 5KT6A 1WCMG 5I47A 4A3JG 5KFLA 2UVRA 4CMDA 4J9LA 1IOVA 1XK5A 4YP3A 5BMVF 1BNCA 4TM5A 1RYSA 1IBKH 3BAAA 4X65H 1V4YA 2W9BA 3NBZB 2HIVA 4O3NA 4MV3A 2FLPA 3W1BA 4J9MA 1IYDA 4ECZA 3RB4A 1XNQH 2HDKA 2R87A 4MA5A 3GILA 5T14A 3SI8A 3RAQA 3VPBA 2X5RA 3DF7A 4UCUA 2W6QA 4C5CA 2HGXA 2WE6A 4ETSA 4YJ3F 4BXXG 1CE8A 4O7VA 3GB8B 2WYOA 4QIWE 3BACA 2W7PA 3GLKA 4C5AA 1M6VA 1I1LA 2HHHH 4U6PA 1I2KA 1B33N 2FKLA 3I12A 1HNXH 3CVZA 3JZ6A 4X64H 4M9UA 4EEQA 4RUCA 1TWCA 5KG1A 2R8IA 2HVQA 4DV3H 3M9OB 2HHFB 4UCOA 3PR5B 1IOWA 1Z2OX 5JH7F 1E4EA 1CQIB 4PZ6A 4RAYA 2JA7A 4CHIA 4QWCA 1N33H 3KHHA 2V4RA 5I5YA 5CE8A 3EYYA 4WD3A 2PVPA 4IHJF 3BA8A 1WCMA 5L1JA 3OHAA 4MTEA 1M0WA 1CKOA 4O3SA 1I1KA 4A2AA 2XCAA 4DR6H 5A2QW 4ECTA 4E4TA 1I50A 1XNRH 5BR8H 2R8KA 5KT7A 3N42B 1X9NA 4RB2C 3T5LA 1T36A 3CQZA 3K3VA 2XCLA 3Q8PB 2DPIA 2YZNA 4HN2A 4ME6A 3QZ7A 2NUAB 3WO1A 5I5VA 4BWSC 4B3MH 3V6JA 3LP8A 1PX2A 4DLKA 4CKBA 1FKAH 4ZQIA 3TIGA 4UFZA 3MFHA 5KFOA 4TV8F 5KFCA 4ED0A 4LF8H 5BWRA 5KFXA 5BPHA 2R7NA 1M7JA 5IP7G 4F4ZA 3K5IA 3JAMW 5DG9A 1W93A 1Z2PX 2W7OA 3RBEA 2FK2A 2Q7DA 4MV7A 5E25A 5CM0A 3PFFA 3H0GG 3OTOH 1EUDB 2OWOA 4O3OA 2W71A 1I2LA 2WDTA 1WSCA 2AU0A 1N32H 2W6ZA 5FPRA 1I3QA 3OUZA 2ODTX 4AYBA 2DAAA 5I5TA 5KFBA 3U0GA 2R7ZA 1CKMA 5IP9G 3GJXB 3WWIA 2KSWA 1KJ8A 2FPGB 5FLMG 3U55A 4EEYA 4A3FG 1HNWH 5JVLA 3PW0A 1N36H 3ORRA 4PWQA 3GQCA 4ECYA 2W57A 4JI6H 2W9CA 3T1YH 4A93G 2CNVA 4RB1A 4O3RA 3U9TA 2UUCH 5KFZA 4EYHB 4F50A 1AUXA 5DG7A 4B3RH 3KAKA 5BWTA 2V5AA 4O7NA 3TINA 2W8KA 1SFOA 5D1OA 5KG4A 2CFMA 1N34H 4O4HF 3HOYG 4NYEA 3LULA 1V51A 2XCPA 3BQ1A 3PW4A 1OBGA 4DRFA 5KFTA 1HNZH 1VAJA 3JSNA 3VPCA 4RNOA 3BQ0A 5D1OB 1B6RA 4OX9H 2VA2A 3N43B 3TY8A 3L4JA 3NBYB 3TY5A 1K1SA 4E6NA 3RBDA 3SNOA 3Q8QB 5FLXW 3H0GA 4JI8H 4J9SA 1SEIA 1TWFA 3GIIA 1UC8A 2R7MA 2BR0A 4YAKB 2BQUA 3QWUA 5LMUH 3T5JA 1XMQH 3T9CA 3RB0A 1WH2A 1IYEA 2XD4A 4O81A 3Q8SB 2RDIA 3MWDA 5HNEA 4YR0A 3PW7A 2ASLA 3J80W 4IR9A 3GTOA 2R7KA 5K3WA 4HQ6A 4J0MA 2R8JA 4QW9A 1KJJA 5C8YF 3R9RA 2R82A 3Q1KA 4LFAH 2IP4A 2FMAA 4XX0B 5DAAA 3KREA 5C4XG 4FBUA 4Q4DA 5L1KA 1Y14B 2CKZB 3RB3A 2FP4B 3M4IA 4O3PA 3GIPA 3QFFA 3GV5B 4O7TA 4UCRA 1GO3E 2Y0SA 3H4BA 1JLLB 3W5OA 3TIIA 1JDEA 2DLNA 2C2RA 4Y8VB 2QB5A 2FE3A 5LP6F 2P0AA 2V59A 2HGSA 5DLFA 1ZHSA 4IR1A 1K1QA 2Q2TA 2R84A 4O84A 1JX4A 2XGPA 3OUUA 2UVVA 3HKZA 4FBTA 3GTLA 4TV9F 4XYMB 2ZM6H 4MV6A 2CQYA 2W9BB 3R5HA 4DV7H 2UUAH 5L9XA 5IYZF 1GSOA 1KJ9A 3BA9A 3OHBA 4ECUA 4A3BG 2YZGA 2W9AA 2GPSA 4O82A 2E2IA 3RV4A 4IWXA 4A3KG 5KX5F 3Q2OA 3TW6A 2C2DA 2PMZA 5JVDF 1JKJB 3N44B 1DV1A 5BYBA 4FFMA 4UUGA 4RU9A 4U7CA 2ATLA 4UCTA 3MFIA 3HOWG 4X66H 2XC9A 2VQEH 3PW5A 1DV2A 2FPIB 4EQ5A 4HNVA 4QWAA 3H3VH 4IWYA 4O2AF 4O2BF 4I50F 4GLXA 5KFQA 3RFCA 3F8NA 3VMMA 2W6OA 4RB0A 4A2BA 2CZGA 3G8DA 5I60A 4EGQA 4AYBE 3IG0A 3RGZA 5EDWA 5DLGA 2NU6B 5DGIA 3W1GA 4DV1H 5F9NA 4GC6A 2YS7A 2Z02A 2WTFA 3HOZG 4O4LF 2M05A 2W70A 3ORQA 4FFOA 1VBHA 4EG0A 2VUMG 2NVYA 3U9SA 4LF9H 1E4EB 3GTGA 5DQIA 2R7ZG 1B04A 4Q8EA 5KFGA 4A3CG 4MAMA 2J9GA 3QQMA 4CC6A 4DV4H 4DV6H 4ECSA 3IN5A 5J2TF 4QWEA 2YW2A 5HBRB 1N48A 3RV3A 5IWAH 5LYJF 2VR1A 3RF2A 4EBCA 4A3EG 1RJQA 2OLSA 5KFKA 4RZQA 5C44G 5KFAA 3L4KA 2R85A 1KJQA 3T9FA 3G6XA 2IMWP 4O3QA 4R8UA 5KFSA 2WAQA 4JUZA 4ECXA 4YY3H 4YHHH 4Q8FA 2GPWA 3DTGA 2JA5G 3RUPA 4LFCH 5CB4F 4LFBH 3T9BA 4O4JF 3WWJA 4ED1A 1JIHA 2YU9A 5JQGF 1O75A 5KG5A 5KFEA 4PZ8A 3MR5A 4O4IF 3EPIA 3OSPA 3HXLA 3JZIA 1A0IA 4DL5A 5JUMA 4ED8A 1KBLA 4LH7A 4FFNA 2VQDA 2O03A 5DQHA 1GLVA 2HVSA 2YCHA 3N40P 4UCVA 4DV5H 3RGXA 3RB6A 3JRWA 3UZBA 3Q8RB 3MR6A 2BQRA 3N6RA 4JYAH 2GQSA 3KYHC 4CKEA 3LMLA 4CMFA 2MCTA 4DV2H 1EKVA 3T99A 2XGQA 1T3NA 2DPJA 2VUMA 1KJIA 4JV1A 3QZ8A 2VUGA 2COJA 5KFFA 5KG3A 5IYBG 4RB3C 1JDBB 1SCUB 2Y4RA 2R86A 4O7LA 3H40A 4J9NA 1N56A 2R8GA 5C1PA 3GIJA 4EGJA 4NLGA 5KG2A 5K2MA 1ZQ7A 2W6MA 4MV4A 5F9LA 3TQTA 3TW7A 2JEFA 3MWMA 3ETJA 3RAXA 4QJFA 1J5EH 1C3OA 3VOTA 3WNZA 3AW8A 1S9FA 4DAAA 3AX6A 4QSHA 5CA0F 2W9CB 2Y0SE 2PBZA 5GONF 4IAJA 4I55F 4JV5H 3BG5A 4EBEA 2JA5A 3VNNA 1G2WA 2WB1A 2W8LA 5L1IA 3TQ1A 3DAAA 4LF5H 1CQJB 2I87A 5DISC 4YAJB 2YYAA 1A9XA 3JZFA 1EKPA 2J6UA 3BJYA 1P16A 2V58A 4BBRG 3RIZA 5BWWA 1ET0A 4WBNF 4IIJF 2CNUA 3HKZE 1I1MA 4YB8B 5I5SA 5KFWA 3I4MG 4YBZB 4AQYH 3T9AA 3VA7A 2FK1A 4MA0A 5CA1F 3UFXB 4APMA 4R7RA 1DGSA 4DUZH 2JEIA 2PN1A 3U54A 5FNVF 1S0MA 5BWUA 4RAZA 1XDNA 4B3TH 2QK4A 2PMZE 1UC9A 5LXTF 4ED3A 1CS0A 5CAEB 5KFIA 1R9TA 2C00A 4LH6A 2JA6A 2VA3A 3HOVG 2ASDA 3KXYT 4JI4H 5C3EG 3MR2A 1E4FT 4JV2A 2B63G 4PDBA 4X62H 4F4YA 4ECQA 2AQ4A 4NZNA 2AGOA 1BXRA 1DIKA 3H4DA 1S03G 1WR2A 4YJ2F 1RJRA 2C28A 1EKFA 4JXUA 2NU8B 1TA8A 4YR2A 3ETHA 4FFPA 1C30A 1I6UA 5LL6b 3KHGA 1JXLA 1EHIA 1BGWA 1KT8A 4K6NA 4QWDA 4I4TF 4J9RA 1IBLH 1I94H 4MV1A 4RCNA 4JI2H 3KALA 5D8DA 4LSXA 4TVIA 5I5XA 1I7NA 3GTKA 3L2PA 1A48A 2AGQA 3T1HH 4O86A 4QWBA 2Q2UA 2WAQE 3V4ZA 1L2ZA 1K83A 4L1KA 2CNQA 2VQFH 2HIXA 5DGAA 4LMYA 4DIMA 4DL7A 1GYFA 5C1OA 3RR5A 1W96A 3CSWA 5KS8A 5DGBA 2COIA 2YRWA 3RJ0A 4J9KA 1Z2NX 4FU0A 4ZHQF 2E5LH 4NXNH 2YWVA 1RJPA 4LSAA 4O7SA 5C5JA 4DQNA 2B63A 2FLNA 5KG7A 5EWGA 2COGA 2JA8G 2DABA 4FE2A 1FJGH 3FKIG 4K0KH 4KHPH 3BQ2A 2EJ2A 2XIGA 2V4QA 4ED2A 4FS2A 3M9NB 3GV7B 2IA6A 4DR3H 3GTMA 5BWXA 3NUAA 4JV0A 1Y1WG 2FK3A 5LOVF 2VPQA 4CC5A 2CW7A 4Q0YA 3S24A 1HR0H 1A0GA 3G8CA 4MTDA 4EYIB 4XYLB 2HVRA 2J6SA 3GTPA 4ECWA 2YRXA 1GSHA 4UCSA 2QYZA 4ECVA 2J6TA 2A1HA 1P8LA 1EUCB 2HHFA 2DZDA 2W6NA 3T7AA 1KEEA 1DAAA 2HG8A 3HBLA 4Q4CA 3DTFA 4BY1G 1KUTA 1KC7A 2DWCA 5IYCG 3GIDA 3GTQA 4BBSG 3KTMA 2R92G 5FJ8G 2WB1E 3NGDA 3GIQA 4O7RA 4NZOA 1OBDA 5KFPA 2I80A 4HNUA 2RF4A 1VBGA 2W6PA 5KFYA 5KT3A 3J81W 3SGIA 4DL6A 4IRDA 3R23A 5BPFA 1RYRA 3C0FB 4TQSA 3HOXG 5EZYF 4A3MG 2FB9A 4EBDA 2NVXA 4O7WA 4R8UB 1VS0A 2HJWA 1S97A 1WRVA 3HB9A 4BY7G 3H20A 1Y1VG 1S68A 5D1PA 1RK5A 3FKIA 3T9DA 3GIMA 2ASJA 2JEGA 4M0JA 5FR9A 5KFNA 4HYKA 4JI1H 2HGWA 3SE7A 1ULZA 3PVXA 1S0OA 4Q45A 3R5FA 3E5NA 2VPSA 3AYHB 4GKJH 3PW2A 1Y1WA 2R8HA 4HR7A 1I7LA 3GIKA 1PK8A 5KFDA 4XZ3B 2ZDHA 1EYZA 3MJFA 1M0TA 3FDSA 4ED7A 3PR4A 5JQWA 4Q43A 3G6VA 1AUVA 4DR5H 4O83A 4GLWA 4J9PA 1A3GA 1SYXB 4PBCA 2E2HA 5FD5A 4JI3H 4DUYH 5H80A 3G6YA 5EOYA 3HOUG 2JA6G 2C2EA 3MWEA 3T9EA 2NU9B 4QIWA 4ZOLF 2FJZA 4J9OA 3T5HA 2R92A 3HO8A 4LF6H 2VOBA 4NZMA 1TWHA 5LMNH 4A3IG 4JI0H 2R7LA 5DQGA 1CKNA 3OSNA 4ECRA 5KG6A 4FFRA 2YZLA 4FM9A 4IZOA 5IYDG 4DR1H 4J9QA 5IT9W 3UQ8A 2YZMA 1EZ1A 4PZ7A 3MR3A 2GLTA 2BQ3A 2RGVA 2YL2A 4YR3A 1UNNC 5KFUA 1CKNB 4DL3A 4B3SH 4JI5H 4LF7H 1S10A 3JRXA 4DL2A 3PZPA 5HV6A 1Y1VA 5KT5A 3WWHA 2UVWA 3JSLA 5KG0A 1E4GT 4CE5A 2Z04A 2I8CA 1S0NA 4EFEA 4GKKH 4DR2H 4FS1A 5FPOA 4QW8A 4FFLA 3KAJA 4C5BA 5I5UA 3GTJA 5I5WA 1GSAA 2EJ0A 5BYAA 4RNNA 4MV8A 1XMOH 4I7HA 5EWEA 1ZHQA 3GV8B 4IRCA 4GC7A 2UUBH 4C2MA 4F4XA 3K3PA 5LA6F 4TQRA 2UXBH 3M9MB 1GGOA 2GQRA 2X0SA 5BWVA 3KHLA 5KT4A 5KFVA 2EIYA 4EFBA 4DV0H 2UVUA 5J2UF 3UZOA 3FMAA 2ALZA 2ABJA 2DIKA 4DR7H 1V9PA 5DMXA 2NU7B 2C35B 3N6XA 4A3LG 3UYYA 2R93G 3PN1A 3V6HA 5KFJA 3R5XA 2ZDGA 4O7YA
chains in the Genus database with same CATH topology
3K5HA 3LWBA 3WO0A 4TUYF 1B6SA 3VPDA 2ZDQA 4MV9A 2YS6A 4O7ZA 2R6FA 2QF7A 4ZI7F 3N8DA 3V4SA 4FGRA 2FPPB 1VKZA 5KKNB 4HNTA 2SCUB 5I47A 1IOVA 5BMVF 1BNCA 4MV3A 2R87A 4MA5A 3VPBA 3DF7A 2W6QA 4C5CA 4YJ3F 1CE8A 4O7VA 2WYOA 3GLKA 4C5AA 1M6VA 3I12A 4M9UA 1IOWA 1Z2OX 5JH7F 1E4EA 1CQIB 4WD3A 2PVPA 4IHJF 1M0WA 4E4TA 1T36A 2XCLA 2YZNA 4ME6A 2NUAB 3WO1A 3LP8A 1PX2A 4DLKA 4ZQIA 3TIGA 4TV8F 5BPHA 2R7NA 3K5IA 1W93A 1Z2PX 4MV7A 1EUDB 2W71A 2W6ZA 3OUZA 1KJ8A 2FPGB 3U55A 5JVLA 3ORRA 2CNVA 3U9TA 1AUXA 3KAKA 2V5AA 4O7NA 3TINA 4O4HF 4NYEA 1OBGA 3VPCA 1B6RA 1UC8A 2R7MA 4YAKB 2XD4A 4O81A 3MWDA 2R7KA 4HQ6A 1KJJA 5C8YF 2R82A 3Q1KA 2IP4A 4XX0B 3KREA 2FP4B 3QFFA 4O7TA 1JLLB 3TIIA 1JDEA 2DLNA 4Y8VB 5LP6F 2P0AA 2V59A 2HGSA 2R84A 4O84A 3OUUA 4TV9F 4XYMB 4MV6A 2CQYA 3R5HA 5IYZF 1GSOA 1KJ9A 2YZGA 2GPSA 4O82A 3RV4A 4IWXA 5KX5F 3Q2OA 3TW6A 5JVDF 1JKJB 1DV1A 4FFMA 1DV2A 2FPIB 4HNVA 4IWYA 4O2AF 4O2BF 4I50F 3RFCA 3VMMA 2W6OA 2CZGA 3G8DA 4EGQA 2NU6B 2YS7A 2Z02A 4O4LF 2W70A 3ORQA 4FFOA 1VBHA 4EG0A 3U9SA 1E4EB 4MAMA 2J9GA 5J2TF 2YW2A 5HBRB 3RV3A 5LYJF 2VR1A 2OLSA 4RZQA 2R85A 1KJQA 2GPWA 3RUPA 5CB4F 4O4JF 5JQGF 4O4IF 3JZIA 1KBLA 4FFNA 2VQDA 1GLVA 3JRWA 2ZDGA 3N6RA 2GQSA 1KJIA 1JDBB 1SCUB 2R86A 4O7LA 5C1PA 4EGJA 5K2MA 2W6MA 4MV4A 3TQTA 3ETJA 1C3OA 3VOTA 3WNZA 3AW8A 3AX6A 4QSHA 5CA0F 2PBZA 5GONF 4I55F 3BG5A 1CQJB 2I87A 1A9XA 4YAJB 2YYAA 3JZFA 2V58A 4WBNF 4IIJF 2CNUA 4YB8B 4YBZB 3VA7A 4MA0A 5CA1F 3UFXB 2PN1A 3U54A 5FNVF 2QK4A 1UC9A 5LXTF 1CS0A 5CAEB 2C00A 1BXRA 1DIKA 1WR2A 4YJ2F 2NU8B 3ETHA 4FFPA 1C30A 1EHIA 4I4TF 4MV1A 3KALA 5D8DA 1I7NA 1A48A 4O86A 3V4ZA 4L1KA 2CNQA 4DIMA 5C1OA 1W96A 2YRWA 1Z2NX 4FU0A 4ZHQF 2YWVA 4O7SA 4FE2A 3NUAA 5LOVF 2VPQA 3G8CA 4XYLB 2YRXA 1GSHA 1EUCB 2DZDA 2W6NA 1KEEA 3HBLA 1KUTA 1KC7A 2DWCA 3GIDA 4O7RA 1OBDA 2I80A 4HNUA 1VBGA 2W6PA 3R23A 5BPFA 5EZYF 2FB9A 4O7WA 2HJWA 3HB9A 3SE7A 1ULZA 3R5FA 3E5NA 4HR7A 1I7LA 1PK8A 4XZ3B 2ZDHA 1EYZA 3MJFA 1M0TA 5JQWA 1AUVA 4O83A 5H80A 3MWEA 2NU9B 4ZOLF 3HO8A 2R7LA 4FFRA 2YZLA 4IZOA 2YZMA 1EZ1A 2GLTA 2YL2A 3JRXA 5HV6A 2Z04A 2I8CA 4C5BA 3KAJA 4FFLA 1GSAA 4MV8A 3K3PA 5LA6F 1GGOA 2GQRA 2X0SA 5J2UF 2DIKA 5DMXA 2NU7B 3R5XA 3R9RA 4O7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K5H A;  3LWB A;  3WO0 A;  4TUY F;  1B6S A;  3VPD A;  2ZDQ A;  4MV9 A;  2YS6 A;  4O7Z A;  2R6F A;  2QF7 A;  4ZI7 F;  3N8D A;  3V4S A;  4FGR A;  2FPP B;  1VKZ A;  5KKN B;  4HNT A;  2SCU B;  5I47 A;  1IOV A;  5BMV F;  1BNC A;  4MV3 A;  2R87 A;  4MA5 A;  3VPB A;  3DF7 A;  2W6Q A;  4C5C A;  4YJ3 F;  1CE8 A;  4O7V A;  2WYO A;  3GLK A;  4C5A A;  1M6V A;  3I12 A;  4M9U A;  1IOW A;  1Z2O X;  5JH7 F;  1E4E A;  1CQI B;  4WD3 A;  2PVP A;  4IHJ F;  1M0W A;  4E4T A;  1T36 A;  2XCL A;  2YZN A;  4ME6 A;  2NUA B;  3WO1 A;  3LP8 A;  1PX2 A;  4DLK A;  4ZQI A;  3TIG A;  4TV8 F;  5BPH A;  2R7N A;  3K5I A;  1W93 A;  1Z2P X;  4MV7 A;  1EUD B;  2W71 A;  2W6Z A;  3OUZ A;  1KJ8 A;  2FPG B;  3U55 A;  5JVL A;  3ORR A;  2CNV A;  3U9T A;  1AUX A;  3KAK A;  2V5A A;  4O7N A;  3TIN A;  4O4H F;  4NYE A;  1OBG A;  3VPC A;  1B6R A;  1UC8 A;  2R7M A;  4YAK B;  2XD4 A;  4O81 A;  3MWD A;  2R7K A;  4HQ6 A;  1KJJ A;  5C8Y F;  2R82 A;  3Q1K A;  2IP4 A;  4XX0 B;  3KRE A;  2FP4 B;  3QFF A;  4O7T A;  1JLL B;  3TII A;  1JDE A;  2DLN A;  4Y8V B;  5LP6 F;  2P0A A;  2V59 A;  2HGS A;  2R84 A;  4O84 A;  3OUU A;  4TV9 F;  4XYM B;  4MV6 A;  2CQY A;  3R5H A;  5IYZ F;  1GSO A;  1KJ9 A;  2YZG A;  2GPS A;  4O82 A;  3RV4 A;  4IWX A;  5KX5 F;  3Q2O A;  3TW6 A;  5JVD F;  1JKJ B;  1DV1 A;  4FFM A;  1DV2 A;  2FPI B;  4HNV A;  4IWY A;  4O2A F;  4O2B F;  4I50 F;  3RFC A;  3VMM A;  2W6O A;  2CZG A;  3G8D A;  4EGQ A;  2NU6 B;  2YS7 A;  2Z02 A;  4O4L F;  2W70 A;  3ORQ A;  4FFO A;  1VBH A;  4EG0 A;  3U9S A;  1E4E B;  4MAM A;  2J9G A;  5J2T F;  2YW2 A;  5HBR B;  3RV3 A;  5LYJ F;  2VR1 A;  2OLS A;  4RZQ A;  2R85 A;  1KJQ A;  2GPW A;  3RUP A;  5CB4 F;  4O4J F;  5JQG F;  4O4I F;  3JZI A;  1KBL A;  4FFN A;  2VQD A;  1GLV A;  3JRW A;  2ZDG A;  3N6R A;  2GQS A;  1KJI A;  1JDB B;  1SCU B;  2R86 A;  4O7L A;  5C1P A;  4EGJ A;  5K2M A;  2W6M A;  4MV4 A;  3TQT A;  3ETJ A;  1C3O A;  3VOT A;  3WNZ A;  3AW8 A;  3AX6 A;  4QSH A;  5CA0 F;  2PBZ A;  5GON F;  4I55 F;  3BG5 A;  1CQJ B;  2I87 A;  1A9X A;  4YAJ B;  2YYA A;  3JZF A;  2V58 A;  4WBN F;  4IIJ F;  2CNU A;  4YB8 B;  4YBZ B;  3VA7 A;  4MA0 A;  5CA1 F;  3UFX B;  2PN1 A;  3U54 A;  5FNV F;  2QK4 A;  1UC9 A;  5LXT F;  1CS0 A;  5CAE B;  2C00 A;  1BXR A;  1DIK A;  1WR2 A;  4YJ2 F;  2NU8 B;  3ETH A;  4FFP A;  1C30 A;  1EHI A;  4I4T F;  4MV1 A;  3KAL A;  5D8D A;  1I7N A;  1A48 A;  4O86 A;  3V4Z A;  4L1K A;  2CNQ A;  4DIM A;  5C1O A;  1W96 A;  2YRW A;  1Z2N X;  4FU0 A;  4ZHQ F;  2YWV A;  4O7S A;  4FE2 A;  3NUA A;  5LOV F;  2VPQ A;  3G8C A;  4XYL B;  2YRX A;  1GSH A;  1EUC B;  2DZD A;  2W6N A;  1KEE A;  3HBL A;  1KUT A;  1KC7 A;  2DWC A;  3GID A;  4O7R A;  1OBD A;  2I80 A;  4HNU A;  1VBG A;  2W6P A;  3R23 A;  5BPF A;  5EZY F;  2FB9 A;  4O7W A;  2HJW A;  3HB9 A;  3SE7 A;  1ULZ A;  3R5F A;  3E5N A;  4HR7 A;  1I7L A;  1PK8 A;  4XZ3 B;  2ZDH A;  1EYZ A;  3MJF A;  1M0T A;  5JQW A;  1AUV A;  4O83 A;  5H80 A;  3MWE A;  2NU9 B;  4ZOL F;  3HO8 A;  2R7L A;  4FFR A;  2YZL A;  4IZO A;  2YZM A;  1EZ1 A;  2GLT A;  2YL2 A;  3JRX A;  5HV6 A;  2Z04 A;  2I8C A;  4C5B A;  3KAJ A;  4FFL A;  1GSA A;  4MV8 A;  3K3P A;  5LA6 F;  1GGO A;  2GQR A;  2X0S A;  5J2U F;  2DIK A;  5DMX A;  2NU7 B;  3R5X A;  3R9R A;  4O7Y A; 
#chains in the Genus database with same CATH topology
 3K5H A;  5EWF A;  3LWB A;  3J7A K;  3N41 B;  5FD6 A;  2EJ3 A;  2ZJT A;  4ED6 A;  4IRK A;  4JI7 H;  1KTA A;  2JEJ A;  5KFH A;  3WO0 A;  3T5K A;  4TUY F;  4G3I A;  1B6S A;  5DGH A;  1FVI A;  2ZGI A;  2ZDQ A;  3RTX A;  3VPD A;  3HT5 A;  2YS6 A;  4MV9 A;  4O7Z A;  3TEK A;  2R6F A;  4RZR A;  4DL4 A;  2QF7 A;  2V9W A;  1ZAU A;  4DR4 H;  1TWG A;  2FLL A;  3NC0 B;  4NXM H;  1AN7 A;  5KFM A;  1BJT A;  3PO3 G;  4CKC A;  4ZI7 F;  5KT2 A;  4RNM A;  2UU9 H;  2IBK A;  2OH2 A;  3N8D A;  1ZET A;  3V4S A;  2UXC H;  3PO2 G;  4FGR A;  3GDE A;  1TWA A;  1TAE A;  4F4W A;  2RGR A;  4LF4 H;  3T54 A;  4WHX A;  4Q44 A;  2C22 A;  4A3G G;  4A3D G;  2F4V H;  3LQS A;  5DG8 A;  2RDJ A;  2FPP B;  1OWT A;  3KHR A;  5KFR A;  3BAB A;  4M7E A;  1RK6 A;  2JA7 G;  1MZB A;  2CW8 A;  3I4N G;  3V6K A;  1VKZ A;  4RUA A;  3TY9 A;  1T94 A;  1IBM H;  5CR5 A;  5L1L A;  5KKN B;  2AGP A;  3CEB A;  3EPG A;  4YQW A;  2R93 A;  4HNT A;  2UXD H;  2SCU B;  5KT6 A;  1WCM G;  5I47 A;  4A3J G;  5KFL A;  2UVR A;  4CMD A;  4J9L A;  1IOV A;  1XK5 A;  4YP3 A;  5BMV F;  1BNC A;  4TM5 A;  1RYS A;  1IBK H;  3BAA A;  4X65 H;  1V4Y A;  2W9B A;  3NBZ B;  2HIV A;  4O3N A;  4MV3 A;  2FLP A;  3W1B A;  4J9M A;  1IYD A;  4ECZ A;  3RB4 A;  1XNQ H;  2HDK A;  2R87 A;  4MA5 A;  3GIL A;  5T14 A;  3SI8 A;  3RAQ A;  3VPB A;  2X5R A;  3DF7 A;  4UCU A;  2W6Q A;  4C5C A;  2HGX A;  2WE6 A;  4ETS A;  4YJ3 F;  4BXX G;  1CE8 A;  4O7V A;  3GB8 B;  2WYO A;  4QIW E;  3BAC A;  2W7P A;  3GLK A;  4C5A A;  1M6V A;  1I1L A;  2HHH H;  4U6P A;  1I2K A;  1B33 N;  2FKL A;  3I12 A;  1HNX H;  3CVZ A;  3JZ6 A;  4X64 H;  4M9U A;  4EEQ A;  4RUC A;  1TWC A;  5KG1 A;  2R8I A;  2HVQ A;  4DV3 H;  3M9O B;  2HHF B;  4UCO A;  3PR5 B;  1IOW A;  1Z2O X;  5JH7 F;  1E4E A;  1CQI B;  4PZ6 A;  4RAY A;  2JA7 A;  4CHI A;  4QWC A;  1N33 H;  3KHH A;  2V4R A;  5I5Y A;  5CE8 A;  3EYY A;  4WD3 A;  2PVP A;  4IHJ F;  3BA8 A;  1WCM A;  5L1J A;  3OHA A;  4MTE A;  1M0W A;  1CKO A;  4O3S A;  1I1K A;  4A2A A;  2XCA A;  4DR6 H;  5A2Q W;  4ECT A;  4E4T A;  1I50 A;  1XNR H;  5BR8 H;  2R8K A;  5KT7 A;  3N42 B;  1X9N A;  4RB2 C;  3T5L A;  1T36 A;  3CQZ A;  3K3V A;  2XCL A;  3Q8P B;  2DPI A;  2YZN A;  4HN2 A;  4ME6 A;  3QZ7 A;  2NUA B;  3WO1 A;  5I5V A;  4BWS C;  4B3M H;  3V6J A;  3LP8 A;  1PX2 A;  4DLK A;  4CKB A;  1FKA H;  4ZQI A;  3TIG A;  4UFZ A;  3MFH A;  5KFO A;  4TV8 F;  5KFC A;  4ED0 A;  4LF8 H;  5BWR A;  5KFX A;  5BPH A;  2R7N A;  1M7J A;  5IP7 G;  4F4Z A;  3K5I A;  3JAM W;  5DG9 A;  1W93 A;  1Z2P X;  2W7O A;  3RBE A;  2FK2 A;  2Q7D A;  4MV7 A;  5E25 A;  5CM0 A;  3PFF A;  3H0G G;  3OTO H;  1EUD B;  2OWO A;  4O3O A;  2W71 A;  1I2L A;  2WDT A;  1WSC A;  2AU0 A;  1N32 H;  2W6Z A;  5FPR A;  1I3Q A;  3OUZ A;  2ODT X;  4AYB A;  2DAA A;  5I5T A;  5KFB A;  3U0G A;  2R7Z A;  1CKM A;  5IP9 G;  3GJX B;  3WWI A;  2KSW A;  1KJ8 A;  2FPG B;  5FLM G;  3U55 A;  4EEY A;  4A3F G;  1HNW H;  5JVL A;  3PW0 A;  1N36 H;  3ORR A;  4PWQ A;  3GQC A;  4ECY A;  2W57 A;  4JI6 H;  2W9C A;  3T1Y H;  4A93 G;  2CNV A;  4RB1 A;  4O3R A;  3U9T A;  2UUC H;  5KFZ A;  4EYH B;  4F50 A;  1AUX A;  5DG7 A;  4B3R H;  3KAK A;  5BWT A;  2V5A A;  4O7N A;  3TIN A;  2W8K A;  1SFO A;  5D1O A;  5KG4 A;  2CFM A;  1N34 H;  4O4H F;  3HOY G;  4NYE A;  3LUL A;  1V51 A;  2XCP A;  3BQ1 A;  3PW4 A;  1OBG A;  4DRF A;  5KFT A;  1HNZ H;  1VAJ A;  3JSN A;  3VPC A;  4RNO A;  3BQ0 A;  5D1O B;  1B6R A;  4OX9 H;  2VA2 A;  3N43 B;  3TY8 A;  3L4J A;  3NBY B;  3TY5 A;  1K1S A;  4E6N A;  3RBD A;  3SNO A;  3Q8Q B;  5FLX W;  3H0G A;  4JI8 H;  4J9S A;  1SEI A;  1TWF A;  3GII A;  1UC8 A;  2R7M A;  2BR0 A;  4YAK B;  2BQU A;  3QWU A;  5LMU H;  3T5J A;  1XMQ H;  3T9C A;  3RB0 A;  1WH2 A;  1IYE A;  2XD4 A;  4O81 A;  3Q8S B;  2RDI A;  3MWD A;  5HNE A;  4YR0 A;  3PW7 A;  2ASL A;  3J80 W;  4IR9 A;  3GTO A;  2R7K A;  5K3W A;  4HQ6 A;  4J0M A;  2R8J A;  4QW9 A;  1KJJ A;  5C8Y F;  3R9R A;  2R82 A;  3Q1K A;  4LFA H;  2IP4 A;  2FMA A;  4XX0 B;  5DAA A;  3KRE A;  5C4X G;  4FBU A;  4Q4D A;  5L1K A;  1Y14 B;  2CKZ B;  3RB3 A;  2FP4 B;  3M4I A;  4O3P A;  3GIP A;  3QFF A;  3GV5 B;  4O7T A;  4UCR A;  1GO3 E;  2Y0S A;  3H4B A;  1JLL B;  3W5O A;  3TII A;  1JDE A;  2DLN A;  2C2R A;  4Y8V B;  2QB5 A;  2FE3 A;  5LP6 F;  2P0A A;  2V59 A;  2HGS A;  5DLF A;  1ZHS A;  4IR1 A;  1K1Q A;  2Q2T A;  2R84 A;  4O84 A;  1JX4 A;  2XGP A;  3OUU A;  2UVV A;  3HKZ A;  4FBT A;  3GTL A;  4TV9 F;  4XYM B;  2ZM6 H;  4MV6 A;  2CQY A;  2W9B B;  3R5H A;  4DV7 H;  2UUA H;  5L9X A;  5IYZ F;  1GSO A;  1KJ9 A;  3BA9 A;  3OHB A;  4ECU A;  4A3B G;  2YZG A;  2W9A A;  2GPS A;  4O82 A;  2E2I A;  3RV4 A;  4IWX A;  4A3K G;  5KX5 F;  3Q2O A;  3TW6 A;  2C2D A;  2PMZ A;  5JVD F;  1JKJ B;  3N44 B;  1DV1 A;  5BYB A;  4FFM A;  4UUG A;  4RU9 A;  4U7C A;  2ATL A;  4UCT A;  3MFI A;  3HOW G;  4X66 H;  2XC9 A;  2VQE H;  3PW5 A;  1DV2 A;  2FPI B;  4EQ5 A;  4HNV A;  4QWA A;  3H3V H;  4IWY A;  4O2A F;  4O2B F;  4I50 F;  4GLX A;  5KFQ A;  3RFC A;  3F8N A;  3VMM A;  2W6O A;  4RB0 A;  4A2B A;  2CZG A;  3G8D A;  5I60 A;  4EGQ A;  4AYB E;  3IG0 A;  3RGZ A;  5EDW A;  5DLG A;  2NU6 B;  5DGI A;  3W1G A;  4DV1 H;  5F9N A;  4GC6 A;  2YS7 A;  2Z02 A;  2WTF A;  3HOZ G;  4O4L F;  2M05 A;  2W70 A;  3ORQ A;  4FFO A;  1VBH A;  4EG0 A;  2VUM G;  2NVY A;  3U9S A;  4LF9 H;  1E4E B;  3GTG A;  5DQI A;  2R7Z G;  1B04 A;  4Q8E A;  5KFG A;  4A3C G;  4MAM A;  2J9G A;  3QQM A;  4CC6 A;  4DV4 H;  4DV6 H;  4ECS A;  3IN5 A;  5J2T F;  4QWE A;  2YW2 A;  5HBR B;  1N48 A;  3RV3 A;  5IWA H;  5LYJ F;  2VR1 A;  3RF2 A;  4EBC A;  4A3E G;  1RJQ A;  2OLS A;  5KFK A;  4RZQ A;  5C44 G;  5KFA A;  3L4K A;  2R85 A;  1KJQ A;  3T9F A;  3G6X A;  2IMW P;  4O3Q A;  4R8U A;  5KFS A;  2WAQ A;  4JUZ A;  4ECX A;  4YY3 H;  4YHH H;  4Q8F A;  2GPW A;  3DTG A;  2JA5 G;  3RUP A;  4LFC H;  5CB4 F;  4LFB H;  3T9B A;  4O4J F;  3WWJ A;  4ED1 A;  1JIH A;  2YU9 A;  5JQG F;  1O75 A;  5KG5 A;  5KFE A;  4PZ8 A;  3MR5 A;  4O4I F;  3EPI A;  3OSP A;  3HXL A;  3JZI A;  1A0I A;  4DL5 A;  5JUM A;  4ED8 A;  1KBL A;  4LH7 A;  4FFN A;  2VQD A;  2O03 A;  5DQH A;  1GLV A;  2HVS A;  2YCH A;  3N40 P;  4UCV A;  4DV5 H;  3RGX A;  3RB6 A;  3JRW A;  3UZB A;  3Q8R B;  3MR6 A;  2BQR A;  3N6R A;  4JYA H;  2GQS A;  3KYH C;  4CKE A;  3LML A;  4CMF A;  2MCT A;  4DV2 H;  1EKV A;  3T99 A;  2XGQ A;  1T3N A;  2DPJ A;  2VUM A;  1KJI A;  4JV1 A;  3QZ8 A;  2VUG A;  2COJ A;  5KFF A;  5KG3 A;  5IYB G;  4RB3 C;  1JDB B;  1SCU B;  2Y4R A;  2R86 A;  4O7L A;  3H40 A;  4J9N A;  1N56 A;  2R8G A;  5C1P A;  3GIJ A;  4EGJ A;  4NLG A;  5KG2 A;  5K2M A;  1ZQ7 A;  2W6M A;  4MV4 A;  5F9L A;  3TQT A;  3TW7 A;  2JEF A;  3MWM A;  3ETJ A;  3RAX A;  4QJF A;  1J5E H;  1C3O A;  3VOT A;  3WNZ A;  3AW8 A;  1S9F A;  4DAA A;  3AX6 A;  4QSH A;  5CA0 F;  2W9C B;  2Y0S E;  2PBZ A;  5GON F;  4IAJ A;  4I55 F;  4JV5 H;  3BG5 A;  4EBE A;  2JA5 A;  3VNN A;  1G2W A;  2WB1 A;  2W8L A;  5L1I A;  3TQ1 A;  3DAA A;  4LF5 H;  1CQJ B;  2I87 A;  5DIS C;  4YAJ B;  2YYA A;  1A9X A;  3JZF A;  1EKP A;  2J6U A;  3BJY A;  1P16 A;  2V58 A;  4BBR G;  3RIZ A;  5BWW A;  1ET0 A;  4WBN F;  4IIJ F;  2CNU A;  3HKZ E;  1I1M A;  4YB8 B;  5I5S A;  5KFW A;  3I4M G;  4YBZ B;  4AQY H;  3T9A A;  3VA7 A;  2FK1 A;  4MA0 A;  5CA1 F;  3UFX B;  4APM A;  4R7R A;  1DGS A;  4DUZ H;  2JEI A;  2PN1 A;  3U54 A;  5FNV F;  1S0M A;  5BWU A;  4RAZ A;  1XDN A;  4B3T H;  2QK4 A;  2PMZ E;  1UC9 A;  5LXT F;  4ED3 A;  1CS0 A;  5CAE B;  5KFI A;  1R9T A;  2C00 A;  4LH6 A;  2JA6 A;  2VA3 A;  3HOV G;  2ASD A;  3KXY T;  4JI4 H;  5C3E G;  3MR2 A;  1E4F T;  4JV2 A;  2B63 G;  4PDB A;  4X62 H;  4F4Y A;  4ECQ A;  2AQ4 A;  4NZN A;  2AGO A;  1BXR A;  1DIK A;  3H4D A;  1S03 G;  1WR2 A;  4YJ2 F;  1RJR A;  2C28 A;  1EKF A;  4JXU A;  2NU8 B;  1TA8 A;  4YR2 A;  3ETH A;  4FFP A;  1C30 A;  1I6U A;  5LL6 b;  3KHG A;  1JXL A;  1EHI A;  1BGW A;  1KT8 A;  4K6N A;  4QWD A;  4I4T F;  4J9R A;  1IBL H;  1I94 H;  4MV1 A;  4RCN A;  4JI2 H;  3KAL A;  5D8D A;  4LSX A;  4TVI A;  5I5X A;  1I7N A;  3GTK A;  3L2P A;  1A48 A;  2AGQ A;  3T1H H;  4O86 A;  4QWB A;  2Q2U A;  2WAQ E;  3V4Z A;  1L2Z A;  1K83 A;  4L1K A;  2CNQ A;  2VQF H;  2HIX A;  5DGA A;  4LMY A;  4DIM A;  4DL7 A;  1GYF A;  5C1O A;  3RR5 A;  1W96 A;  3CSW A;  5KS8 A;  5DGB A;  2COI A;  2YRW A;  3RJ0 A;  4J9K A;  1Z2N X;  4FU0 A;  4ZHQ F;  2E5L H;  4NXN H;  2YWV A;  1RJP A;  4LSA A;  4O7S A;  5C5J A;  4DQN A;  2B63 A;  2FLN A;  5KG7 A;  5EWG A;  2COG A;  2JA8 G;  2DAB A;  4FE2 A;  1FJG H;  3FKI G;  4K0K H;  4KHP H;  3BQ2 A;  2EJ2 A;  2XIG A;  2V4Q A;  4ED2 A;  4FS2 A;  3M9N B;  3GV7 B;  2IA6 A;  4DR3 H;  3GTM A;  5BWX A;  3NUA A;  4JV0 A;  1Y1W G;  2FK3 A;  5LOV F;  2VPQ A;  4CC5 A;  2CW7 A;  4Q0Y A;  3S24 A;  1HR0 H;  1A0G A;  3G8C A;  4MTD A;  4EYI B;  4XYL B;  2HVR A;  2J6S A;  3GTP A;  4ECW A;  2YRX A;  1GSH A;  4UCS A;  2QYZ A;  4ECV A;  2J6T A;  2A1H A;  1P8L A;  1EUC B;  2HHF A;  2DZD A;  2W6N A;  3T7A A;  1KEE A;  1DAA A;  2HG8 A;  3HBL A;  4Q4C A;  3DTF A;  4BY1 G;  1KUT A;  1KC7 A;  2DWC A;  5IYC G;  3GID A;  3GTQ A;  4BBS G;  3KTM A;  2R92 G;  5FJ8 G;  2WB1 E;  3NGD A;  3GIQ A;  4O7R A;  4NZO A;  1OBD A;  5KFP A;  2I80 A;  4HNU A;  2RF4 A;  1VBG A;  2W6P A;  5KFY A;  5KT3 A;  3J81 W;  3SGI A;  4DL6 A;  4IRD A;  3R23 A;  5BPF A;  1RYR A;  3C0F B;  4TQS A;  3HOX G;  5EZY F;  4A3M G;  2FB9 A;  4EBD A;  2NVX A;  4O7W A;  4R8U B;  1VS0 A;  2HJW A;  1S97 A;  1WRV A;  3HB9 A;  4BY7 G;  3H20 A;  1Y1V G;  1S68 A;  5D1P A;  1RK5 A;  3FKI A;  3T9D A;  3GIM A;  2ASJ A;  2JEG A;  4M0J A;  5FR9 A;  5KFN A;  4HYK A;  4JI1 H;  2HGW A;  3SE7 A;  1ULZ A;  3PVX A;  1S0O A;  4Q45 A;  3R5F A;  3E5N A;  2VPS A;  3AYH B;  4GKJ H;  3PW2 A;  1Y1W A;  2R8H A;  4HR7 A;  1I7L A;  3GIK A;  1PK8 A;  5KFD A;  4XZ3 B;  2ZDH A;  1EYZ A;  3MJF A;  1M0T A;  3FDS A;  4ED7 A;  3PR4 A;  5JQW A;  4Q43 A;  3G6V A;  1AUV A;  4DR5 H;  4O83 A;  4GLW A;  4J9P A;  1A3G A;  1SYX B;  4PBC A;  2E2H A;  5FD5 A;  4JI3 H;  4DUY H;  5H80 A;  3G6Y A;  5EOY A;  3HOU G;  2JA6 G;  2C2E A;  3MWE A;  3T9E A;  2NU9 B;  4QIW A;  4ZOL F;  2FJZ A;  4J9O A;  3T5H A;  2R92 A;  3HO8 A;  4LF6 H;  2VOB A;  4NZM A;  1TWH A;  5LMN H;  4A3I G;  4JI0 H;  2R7L A;  5DQG A;  1CKN A;  3OSN A;  4ECR A;  5KG6 A;  4FFR A;  2YZL A;  4FM9 A;  4IZO A;  5IYD G;  4DR1 H;  4J9Q A;  5IT9 W;  3UQ8 A;  2YZM A;  1EZ1 A;  4PZ7 A;  3MR3 A;  2GLT A;  2BQ3 A;  2RGV A;  2YL2 A;  4YR3 A;  1UNN C;  5KFU A;  1CKN B;  4DL3 A;  4B3S H;  4JI5 H;  4LF7 H;  1S10 A;  3JRX A;  4DL2 A;  3PZP A;  5HV6 A;  1Y1V A;  5KT5 A;  3WWH A;  2UVW A;  3JSL A;  5KG0 A;  1E4G T;  4CE5 A;  2Z04 A;  2I8C A;  1S0N A;  4EFE A;  4GKK H;  4DR2 H;  4FS1 A;  5FPO A;  4QW8 A;  4FFL A;  3KAJ A;  4C5B A;  5I5U A;  3GTJ A;  5I5W A;  1GSA A;  2EJ0 A;  5BYA A;  4RNN A;  4MV8 A;  1XMO H;  4I7H A;  5EWE A;  1ZHQ A;  3GV8 B;  4IRC A;  4GC7 A;  2UUB H;  4C2M A;  4F4X A;  3K3P A;  5LA6 F;  4TQR A;  2UXB H;  3M9M B;  1GGO A;  2GQR A;  2X0S A;  5BWV A;  3KHL A;  5KT4 A;  5KFV A;  2EIY A;  4EFB A;  4DV0 H;  2UVU A;  5J2U F;  3UZO A;  3FMA A;  2ALZ A;  2ABJ A;  2DIK A;  4DR7 H;  1V9P A;  5DMX A;  2NU7 B;  2C35 B;  3N6X A;  4A3L G;  3UYY A;  2R93 G;  3PN1 A;  3V6H A;  5KFJ A;  3R5X A;  2ZDG A;  4O7Y A; 
#chains in the Genus database with same CATH homology
 3K5H A;  3LWB A;  3WO0 A;  4TUY F;  1B6S A;  3VPD A;  2ZDQ A;  4MV9 A;  2YS6 A;  4O7Z A;  2R6F A;  2QF7 A;  4ZI7 F;  3N8D A;  3V4S A;  4FGR A;  2FPP B;  1VKZ A;  5KKN B;  4HNT A;  2SCU B;  5I47 A;  1IOV A;  5BMV F;  1BNC A;  4MV3 A;  2R87 A;  4MA5 A;  3VPB A;  3DF7 A;  2W6Q A;  4C5C A;  4YJ3 F;  1CE8 A;  4O7V A;  2WYO A;  3GLK A;  4C5A A;  1M6V A;  3I12 A;  4M9U A;  1IOW A;  1Z2O X;  5JH7 F;  1E4E A;  1CQI B;  4WD3 A;  2PVP A;  4IHJ F;  1M0W A;  4E4T A;  1T36 A;  2XCL A;  2YZN A;  4ME6 A;  2NUA B;  3WO1 A;  3LP8 A;  1PX2 A;  4DLK A;  4ZQI A;  3TIG A;  4TV8 F;  5BPH A;  2R7N A;  3K5I A;  1W93 A;  1Z2P X;  4MV7 A;  1EUD B;  2W71 A;  2W6Z A;  3OUZ A;  1KJ8 A;  2FPG B;  3U55 A;  5JVL A;  3ORR A;  2CNV A;  3U9T A;  1AUX A;  3KAK A;  2V5A A;  4O7N A;  3TIN A;  4O4H F;  4NYE A;  1OBG A;  3VPC A;  1B6R A;  1UC8 A;  2R7M A;  4YAK B;  2XD4 A;  4O81 A;  3MWD A;  2R7K A;  4HQ6 A;  1KJJ A;  5C8Y F;  2R82 A;  3Q1K A;  2IP4 A;  4XX0 B;  3KRE A;  2FP4 B;  3QFF A;  4O7T A;  1JLL B;  3TII A;  1JDE A;  2DLN A;  4Y8V B;  5LP6 F;  2P0A A;  2V59 A;  2HGS A;  2R84 A;  4O84 A;  3OUU A;  4TV9 F;  4XYM B;  4MV6 A;  2CQY A;  3R5H A;  5IYZ F;  1GSO A;  1KJ9 A;  2YZG A;  2GPS A;  4O82 A;  3RV4 A;  4IWX A;  5KX5 F;  3Q2O A;  3TW6 A;  5JVD F;  1JKJ B;  1DV1 A;  4FFM A;  1DV2 A;  2FPI B;  4HNV A;  4IWY A;  4O2A F;  4O2B F;  4I50 F;  3RFC A;  3VMM A;  2W6O A;  2CZG A;  3G8D A;  4EGQ A;  2NU6 B;  2YS7 A;  2Z02 A;  4O4L F;  2W70 A;  3ORQ A;  4FFO A;  1VBH A;  4EG0 A;  3U9S A;  1E4E B;  4MAM A;  2J9G A;  5J2T F;  2YW2 A;  5HBR B;  3RV3 A;  5LYJ F;  2VR1 A;  2OLS A;  4RZQ A;  2R85 A;  1KJQ A;  2GPW A;  3RUP A;  5CB4 F;  4O4J F;  5JQG F;  4O4I F;  3JZI A;  1KBL A;  4FFN A;  2VQD A;  1GLV A;  3JRW A;  2ZDG A;  3N6R A;  2GQS A;  1KJI A;  1JDB B;  1SCU B;  2R86 A;  4O7L A;  5C1P A;  4EGJ A;  5K2M A;  2W6M A;  4MV4 A;  3TQT A;  3ETJ A;  1C3O A;  3VOT A;  3WNZ A;  3AW8 A;  3AX6 A;  4QSH A;  5CA0 F;  2PBZ A;  5GON F;  4I55 F;  3BG5 A;  1CQJ B;  2I87 A;  1A9X A;  4YAJ B;  2YYA A;  3JZF A;  2V58 A;  4WBN F;  4IIJ F;  2CNU A;  4YB8 B;  4YBZ B;  3VA7 A;  4MA0 A;  5CA1 F;  3UFX B;  2PN1 A;  3U54 A;  5FNV F;  2QK4 A;  1UC9 A;  5LXT F;  1CS0 A;  5CAE B;  2C00 A;  1BXR A;  1DIK A;  1WR2 A;  4YJ2 F;  2NU8 B;  3ETH A;  4FFP A;  1C30 A;  1EHI A;  4I4T F;  4MV1 A;  3KAL A;  5D8D A;  1I7N A;  1A48 A;  4O86 A;  3V4Z A;  4L1K A;  2CNQ A;  4DIM A;  5C1O A;  1W96 A;  2YRW A;  1Z2N X;  4FU0 A;  4ZHQ F;  2YWV A;  4O7S A;  4FE2 A;  3NUA A;  5LOV F;  2VPQ A;  3G8C A;  4XYL B;  2YRX A;  1GSH A;  1EUC B;  2DZD A;  2W6N A;  1KEE A;  3HBL A;  1KUT A;  1KC7 A;  2DWC A;  3GID A;  4O7R A;  1OBD A;  2I80 A;  4HNU A;  1VBG A;  2W6P A;  3R23 A;  5BPF A;  5EZY F;  2FB9 A;  4O7W A;  2HJW A;  3HB9 A;  3SE7 A;  1ULZ A;  3R5F A;  3E5N A;  4HR7 A;  1I7L A;  1PK8 A;  4XZ3 B;  2ZDH A;  1EYZ A;  3MJF A;  1M0T A;  5JQW A;  1AUV A;  4O83 A;  5H80 A;  3MWE A;  2NU9 B;  4ZOL F;  3HO8 A;  2R7L A;  4FFR A;  2YZL A;  4IZO A;  2YZM A;  1EZ1 A;  2GLT A;  2YL2 A;  3JRX A;  5HV6 A;  2Z04 A;  2I8C A;  4C5B A;  3KAJ A;  4FFL A;  1GSA A;  4MV8 A;  3K3P A;  5LA6 F;  1GGO A;  2GQR A;  2X0S A;  5J2U F;  2DIK A;  5DMX A;  2NU7 B;  3R5X A;  3R9R A;  4O7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...