4XZ3B

Ca. korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 (se-met derivative) in complex with coenzyme a and mg-amppcp, phosphohistidine segment pointing towards nucleotide binding site
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
228
structure length
228
Chain Sequence
SRDLLLKAKENGRKSLLEHEAKYFISSYGIPVTNIRLAKSEEEAVNFSREIGFPVVLKIVSPQVVHKSDVGGVKVNLRSEEEVRKAYREIIENVKRNVPNAEIEGILVQEFAPPGVELIIGLLRDPQFGPTVMFGLGGVFVELFRDVSFRVAPLSEQDAESMIKEVKAYKLLTGFRGMEPVDIEAIKDALIRAGRIGVENEEIAEMDLNPVIAYPKGIKVVDARIILR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Candidatus korarchaeum cryptofilum opf8
molecule tags Ligase
molecule keywords Acyl-CoA synthetase (NDP forming)
total genus 66
structure length 228
sequence length 228
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13549 ATP-grasp_5 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4xz3B01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4xz3B02
4MV9A 3KAKA 5DMXA 3NUAA 4QSHA 5CA0F 4XX0B 1UC8A 1M0WA 5JQGF 2ZDHA 4ZOLF 1KJQA 5EZYF 2WYOA 1KJIA 2YRWA 3OUUA 3JRXA 1BNCA 1BXRA 2XCLA 2W6ZA 3KAJA 5D8DA 2R85A 3TINA 4HNUA 1PX2A 4I50F 2V59A 2YZNA 1IOVA 4XZ3B 2I8CA 2DZDA 3OUZA 5LP6F 3QFFA 4MAMA 5CB4F 1KJJA 3WNZA 4YAJB 4O84A 4I4TF 2NU6B 3MWDA 3TQTA 2R7NA 5I47A 2R87A 4XYLB 4O2AF 3VPBA 2ZDGA 5HV6A 1Z2OX 2PBZA 3KREA 4MV4A 4FFMA 4MV1A 4O83A 1AUXA 2XD4A 3ORRA 1VKZA 2GPSA 3TW6A 2YZMA 2DIKA 3LWBA 3ORQA 1EUDB 2YZLA 5BPFA 3AW8A 5JVLA 2W6QA 1GGOA 2V58A 4O7SA 5J2UF 2X0SA 2NUAB 1Z2PX 4FFNA 4WD3A 1CS0A 1A9XA 4C5CA 2GQRA 2GPWA 2CNUA 3GIDA 4FE2A 3V4ZA 1GSAA 2R7LA 3U9SA 2YS7A 1JDBB 1EUCB 3MWEA 3K3PA 2VR1A 1DV1A 2YL2A 2R7MA 5C1OA 2R84A 3ETHA 3KALA 3HBLA 3SE7A 4YBZB 4IHJF 5J2TF 5GONF 2ZDQA 4FFOA 4L1KA 4MV3A 4O82A 3JZIA 5LXTF 1JLLB 3VPCA 2DLNA 2CZGA 2CQYA 2I80A 4O7RA 2W6NA 4IWYA 2R6FA 4EG0A 1OBGA 3I12A 2HJWA 2FPGB 2VPQA 2I87A 2OLSA 3HO8A 1UC9A 4O86A 3R5XA 4XYMB 2V5AA 1M6VA 5KKNB 2QF7A 1M0TA 5LOVF 5LA6F 3VOTA 3G8DA 1OBDA 4TV8F 3VPDA 3N8DA 2SCUB 4HNTA 3UFXB 5BMVF 3WO0A 3BG5A 3LP8A 5CAEB 1KJ8A 2W71A 4MV7A 4O7WA 3RFCA 1E4EB 1SCUB 2NU8B 3GLKA 4Y8VB 4WBNF 1IOWA 4RZQA 1GSHA 1KBLA 4ME6A 1GLVA 1CQIB 2NU7B 5KX5F 2YS6A 2Z04A 5H80A 3Q2OA 3VMMA 3RV3A 4O4IF 4IWXA 2YZGA 3MJFA 4DIMA 4ZQIA 2YRXA 1KEEA 3VA7A 1W93A 3Q1KA 4MA5A 4TUYF 3RV4A 4O7ZA 1EZ1A 1B6SA 4FFPA 1DIKA 4HNVA 2VQDA 2C00A 4C5AA 4HQ6A 4IIJF 3JZFA 4HR7A 1EHIA 3JRWA 4FGRA 4O7YA 4ZI7F 3WO1A 4YJ3F 4IZOA 3HB9A 4NYEA 2W6MA 4O4HF 4EGQA 1VBHA 5C1PA 3K5HA 1I7LA 2QK4A 4O7VA 2Z02A 3K5IA 5JQWA 4O2BF 5HBRB 5JH7F 3U54A 1DV2A 1ULZA 4M9UA 1I7NA 3E5NA 4O7NA 4YAKB 3G8CA 4FU0A 3V4SA 2FPIB 1GSOA 3ETJA 4YJ2F 5FNVF 3TIGA 2FPPB 2W70A 2R7KA 4O4LF 2YYAA 5IYZF 5CA1F 2PVPA 5K2MA 4MV8A 3R23A 5C8YF 1KUTA 1AUVA 1A48A 4TV9F 1C30A 1WR2A 1CE8A 2YW2A 1Z2NX 1EYZA 3U55A 4O4JF 2GQSA 4O7LA 2CNQA 2HGSA 2FB9A 2PN1A 1VBGA 4I55F 5LYJF 2R82A 4C5BA 2NU9B 1E4EA 4DLKA 4MV6A 2CNVA 3TIIA 2YWVA 2J9GA 1PK8A 1JDEA 4O7TA 1C3OA 3DF7A 4ZHQF 2IP4A 4MA0A 2R86A 1KC7A 3R5FA 1KJ9A 3R9RA 4YB8B 2W6PA 1T36A 5JVDF 3U9TA 2GLTA 3R5HA 3RUPA 1B6RA 4FFLA 2W6OA 2FP4B 1JKJB 3AX6A 3N6RA 2P0AA 2DWCA 1CQJB 4FFRA 4O81A 1W96A 4E4TA 4EGJA 5BPHA
chains in the Genus database with same CATH superfamily
5KFCA 4MV9A 3EPIA 2FLLA 4RCNA 1K1QA 2UVUA 3KAKA 2WTFA 5L1JA 4J9SA 5DMXA 2HIXA 3NUAA 4TM5A 3UYYA 5I5XA 2DAAA 1E4FT 3HKZA 5KFBA 4QSHA 3Q8RB 4ED7A 2BR0A 5CA0F 4XX0B 1CKMA 4ECRA 1HR0H 4WHXA 5DG7A 2B63G 1XNQH 1UC8A 2OWOA 1M0WA 4PWQA 1ZAUA 5JQGF 1S0OA 4LF5H 4LFBH 3N6XA 1RYRA 2ZDHA 2XCPA 3SNOA 2QYZA 4RB1A 4A3GG 4JI5H 4A3CG 4ZOLF 3H40A 3M4IA 1KJQA 2COIA 5EZYF 1TWCA 2WB1A 2Q2UA 3GTOA 2WYOA 1XMQH 1KJIA 3H4DA 4Q8EA 4YHHH 4JYAH 2YRWA 2A1HA 5C3EG 3OUUA 5KFTA 5KFNA 3JRXA 3TY9A 4LF7H 2YU9A 5IT9W 1BNCA 1BXRA 2JEFA 2XCLA 4UCUA 2W6ZA 1V4YA 3KAJA 4GKJH 3OHBA 3RB3A 2R8IA 3DTFA 5D8DA 2R85A 3TINA 4JI8H 1I6UA 4HNUA 4O3PA 1PX2A 4R7RA 4I50F 2V59A 3CEBA 2YZNA 1IOVA 4K6NA 3FMAA 4XZ3B 3CVZA 4RNNA 5IP9G 4DV2H 2I8CA 5KFHA 5BWTA 1I3QA 2DZDA 3T9DA 3PW5A 3OUZA 5LP6F 2R8HA 4EYHB 4RU9A 4DUZH 5JUMA 4F4ZA 3LULA 1KTAA 3GIPA 4DL7A 2B63A 3KYHC 3HT5A 3QFFA 5KFMA 4MAMA 2VUGA 5CB4F 5KFGA 4QWEA 3T5JA 1KJJA 4FM9A 1B33N 3WNZA 4JI4H 2KSWA 1JXLA 4DV5H 5L9XA 4YAJB 2PMZE 5KFOA 1K83A 2J6SA 2UUCH 4CMDA 3FKIA 4O84A 4CC6A 3N41B 5KG5A 4I4TF 4UCSA 5LMNH 3NBYB 3RR5A 3UZBA 4FS1A 4AQYH 3WWIA 5KFQA 2NU6B 3G6XA 1KT8A 2DPJA 3MWDA 3TQTA 5IP7G 1I2LA 2R7NA 5I47A 3RBEA 2JEJA 2R8JA 1DGSA 2HVRA 4Q4DA 4J9RA 2VOBA 3JSNA 4C2MA 4U7CA 2R87A 4XYLB 5LL6b 4ECQA 4O2AF 3T1YH 4LFCH 4TQSA 3VPBA 1JIHA 4JV1A 2C35B 5EWGA 2ZDGA 3GTMA 5HV6A 2CKZB 4JV2A 1Z2OX 2PBZA 2FMAA 4NZMA 4GLWA 4Q4CA 3KREA 2BQRA 1Y14B 4MV4A 4FFMA 4R8UA 4MV1A 3S24A 4DR4H 2JA7G 3PW2A 3GIJA 2HHFA 2ALZA 4DQNA 4PZ6A 4G3IA 4O83A 3NBZB 1IYDA 1AUXA 3Q8SB 2XD4A 3VNNA 3ORRA 1VKZA 2HHFB 1XMOH 4A93G 2GPSA 3TW6A 3KHRA 4F4YA 2YZMA 2DIKA 3LWBA 2Q2TA 4QWBA 5CE8A 3WWHA 2UXCH 3T1HH 3V6KA 1A0IA 3SI8A 4QW9A 2HVSA 3ORQA 3HOZG 4UCVA 1EUDB 2YZLA 5BPFA 4ED3A 4QWDA 2VQFH 3PO2G 1AN7A 3AW8A 5DLFA 5KFAA 4DL3A 3GTKA 1GO3E 5JVLA 4BY1G 3MWMA 3LQSA 5BWWA 4ED2A 2W6QA 2W8LA 2HG8A 3L4KA 2VUMG 3H3VH 1GGOA 2V58A 4M0JA 3K3VA 2W9CA 4DV6H 4O7SA 5DISC 4J9KA 5J2UF 4DR6H 4IRDA 2M05A 2X0SA 2NUAB 3IG0A 1Y1WA 4RB2C 5IYDG 1B04A 1Z2PX 1V51A 4FFNA 1N48A 1RJQA 4WD3A 2WAQA 1CS0A 2ASLA 2OH2A 4X66H 1E4GT 5DQIA 1A9XA 4GC6A 4BBSG 2W9BB 2FKLA 4C5CA 1I2KA 2GQRA 2ASDA 3HOWG 5DGBA 4RNOA 2GPWA 4JI2H 4ECSA 3I4NG 3GILA 3CQZA 5CR5A 2Y0SE 2CNUA 2NVXA 4YY3H 4DV3H 2W7OA 2ZGIA 3TQ1A 1TWFA 3NC0B 4DUYH 3GIDA 1CKOA 4FE2A 3V4ZA 1GSAA 2R7LA 3U9SA 4CHIA 4BWSC 2ASJA 2C2DA 2RDIA 4IAJA 2YS7A 1JDBB 1EUCB 5BYBA 5IWAH 4EFEA 2WB1E 2UXBH 4RAYA 3L2PA 3MWEA 3K3PA 5FPRA 3MR2A 2VR1A 1DV1A 1RYSA 3N40P 2PMZA 1S9FA 2YL2A 5KFKA 2R7MA 3HOYG 4A3KG 3OSPA 4GKKH 4K0KH 2HDKA 5C1OA 4JV0A 1TA8A 2WE6A 1R9TA 5BYAA 5KG7A 2R84A 3ETHA 5DG9A 5D1PA 4CKBA 3T9BA 2W9CB 3KALA 4ECXA 4EFBA 3HBLA 3SE7A 4YBZB 4IHJF 2DABA 3PR5B 4QIWA 4QW8A 5L1LA 5J2TF 4J9LA 5GONF 1EKFA 2ZDQA 3NGDA 5IYBG 4IR1A 2UU9H 4FFOA 5EWEA 3RAQA 4L1KA 2W57A 5KG6A 3MR5A 2V4QA 4MV3A 4O82A 1WCMA 1WSCA 3JZIA 5LXTF 4A2AA 4J0MA 4EYIB 5KFZA 1JLLB 3VPCA 2VA3A 1FJGH 2RGVA 3J7AK 3BQ0A 2DPIA 4LF9H 2DLNA 5EWFA 4DR7H 5L1IA 3PN1A 2CZGA 2CQYA 4BBRG 1SYXB 4DV7H 2I80A 2Y0SA 1ZQ7A 4UCRA 4O7RA 2W6NA 4CKEA 2ABJA 4IWYA 1RK5A 5KG3A 3T9FA 3QQMA 4EG0A 2FJZA 2R6FA 3GIKA 2C28A 2W9BA 4EBCA 1OBGA 3I12A 2HJWA 2FPGB 2VPQA 2JEGA 5DGHA 2I87A 2OLSA 4RUCA 4DL4A 4OX9H 5DQHA 1T3NA 1L2ZA 3HO8A 4TVIA 1UC9A 4O86A 3R5XA 4XYMB 3U0GA 3DAAA 2V5AA 3GIQA 1M6VA 3RF2A 5KKNB 5KFXA 3G6YA 2MCTA 5DG8A 2EIYA 1XK5A 1M0TA 2QF7A 5LOVF 5LA6F 3GIIA 2JA5G 3VOTA 1Y1VG 5BWVA 4QIWE 3BQ2A 4EBEA 2R8GA 2RF4A 3G8DA 1OBDA 1WCMG 5KFWA 2C2RA 4JV5H 2X5RA 3T99A 2EJ3A 4TV8F 2HVQA 3VPDA 3N8DA 4PBCA 3N42B 2SCUB 3CSWA 1CKNA 3QZ7A 4HNTA 2HGWA 3T5KA 4NZNA 3UFXB 5KFYA 2ODTX 5KT4A 2FLNA 2BQ3A 3GV7B 5BMVF 4A3MG 3WO0A 5C44G 4I7HA 3BG5A 3LP8A 3M9OB 4J9OA 5CAEB 2C2EA 4JI3H 4IRKA 2COGA 2JA7A 1TWGA 3EPGA 4A3JG 1KJ8A 2W71A 4RAZA 4U6PA 5K3WA 4PZ8A 1RJRA 2RDJA 3T5HA 5DLGA 3GTPA 1S0NA 4MV7A 1I94H 5KT6A 3MR3A 1S10A 3DTGA 1J5EH 3HOXG 4APMA 4A3IG 4O7WA 3RFCA 1ZHSA 1E4EB 1I1MA 3FKIG 1SCUB 1I1LA 5DAAA 3SGIA 3T9AA 1N56A 1S03G 3RTXA 1IBKH 3FDSA 2NU8B 3GLKA 4Y8VB 3H0GG 3PZPA 4O3NA 1Y1VA 3IN5A 5KFEA 3PW4A 2ATLA 4B3RH 4WBNF 1IOWA 4RZQA 1GSHA 1X9NA 2CW7A 1KBLA 5IYCG 3H4BA 3M9MB 4DR5H 4O3OA 4ME6A 3MFHA 1GLVA 4JI0H 4DL5A 1CQIB 4HN2A 4FBUA 2UVRA 3PW7A 2NU7B 2V4RA 5KX5F 2YS6A 5KFVA 4YR2A 4DR3H 2Z04A 3GDEA 5H80A 3LMLA 4A3LG 2FK3A 3Q2OA 5DQGA 1EKPA 1ZETA 3VMMA 3RV3A 4JXUA 4O4IF 4IWXA 2YZGA 3WWJA 2XIGA 2HHHH 5KFJA 4LMYA 3RB0A 3MJFA 1IYEA 1EKVA 4DIMA 4ZQIA 2YRXA 1KEEA 1K1SA 4AYBE 5C5JA 3VA7A 4DR1H 3Q8QB 1W93A 4EBDA 3Q1KA 2R92A 4MA5A 4UCTA 3KXYT 4DL2A 1GYFA 4TUYF 1XNRH 4MTDA 2Q7DA 5FJ8G 2XC9A 3RV4A 5FPOA 2R7ZA 1BGWA 2AQ4A 3BAAA 3KHLA 4O7ZA 5KFPA 3J81W 2E2IA 1EZ1A 1B6SA 3T9EA 2ZJTA 1FVIA 4FFPA 2J6TA 4X62H 5I5WA 1DIKA 4HNVA 2VQDA 4ECTA 2C00A 3UZOA 4HYKA 5FR9A 4A3FG 4LF8H 4GC7A 2XGPA 4GLXA 3GTQA 4C5AA 4HQ6A 2WDTA 4O3SA 2C22A 4IIJF 3GQCA 4ECYA 2IMWP 3C0FB 3JZFA 4HR7A 4IR9A 5C4XG 4NXMH 4RB0A 1EHIA 4CMFA 3T9CA 1T94A 4QJFA 4F50A 4A3BG 3JRWA 3TY5A 3I4MG 3GIMA 4FGRA 3KHGA 1HNWH 1S68A 3GTGA 4M7EA 1Y1WG 2JEIA 4O7YA 2IBKA 4ZI7F 2NVYA 3WO1A 4DR2H 4O3RA 4YJ3F 4UCOA 4IZOA 5KG0A 2FK1A 3HB9A 5DGAA 4DV4H 4NYEA 2W6MA 4O4HF 5E25A 4EGQA 4TQRA 1VBHA 2JA6G 3JSLA 1HNXH 4E6NA 2R92G 2E5LH 4X65H 5C1PA 5EDWA 3GV5B 4J9MA 4ED1A 4Q44A 3K5HA 4LF4H 3GTLA 2JA6A 5BWXA 1I7LA 4PZ7A 3QZ8A 2QK4A 3PVXA 4O7VA 4AYBA 5KT5A 2W7PA 4A2BA 3HOVG 3RIZA 2Z02A 3K5IA 5JQWA 1G2WA 4YP3A 1N33H 2FE3A 4DRFA 5FLXW 4O2BF 4YQWA 1TAEA 5T14A 1FKAH 5KS8A 5HBRB 3L4JA 5I60A 5JH7F 3U54A 2R8KA 4JI7H 1DV2A 4MTEA 3MFIA 4ECVA 4M9UA 1ULZA 5D1OB 5KT3A 4DAAA 1I7NA 5KFDA 3BACA 4O7NA 3E5NA 4YAKB 3G8CA 5EOYA 1N36H 2CFMA 3BA8A 5KG2A 1S97A 2UUAH 4FU0A 4A3EG 4B3MH 4Q8FA 2E2HA 3RB4A 3V4SA 2FPIB 3HXLA 5KFRA 5HNEA 5A2QW 4R8UB 1TWAA 4F4XA 4ETSA 4LFAH 2FK2A 2UVWA 4YR0A 4ECZA 2F4VH 3HKZE 2HGXA 3KTMA 5BWRA 4QWAA 2VA2A 4NXNH 2UUBH 1GSOA 3ETJA 3W1BA 2XGQA 5L1KA 3RAXA 4YJ2F 3TY8A 3BQ1A 1N34H 2UXDH 5FNVF 3TIGA 1MZBA 2FPPB 2W70A 2R7KA 3RGZA 2AGQA 5BWUA 4ECUA 5KFLA 1IBLH 2AGPA 4A3DG 3J80W 3JZ6A 4O4LF 2YYAA 4DL6A 5BR8H 5IYZF 4F4WA 4UUGA 2O03A 2W8KA 1WRVA 3T5LA 2EJ0A 4JUZA 1V9PA 1RJPA 2RGRA 5CA1F 4YR3A 3JAMW 2PVPA 4DV1H 3GJXB 1VS0A 4ECWA 3RB6A 1I50A 2JA8G 4CKCA 2BQUA 2UVVA 3OSNA 5FD5A 1HNZH 5K2MA 3Q8PB 3RGXA 2CW8A 2ZM6H 4ED6A 4RUAA 4BY7G 1M7JA 4MV8A 5FD6A 4PDBA 3R23A 5C8YF 4O3QA 3V6JA 3N43B 5LMUH 1KUTA 1S0MA 3H0GA 1AUVA 3EYYA 1SFOA 4RZRA 1A48A 5CM0A 5I5UA 3W1GA 3TEKA 4TV9F 1ZHQA 4Q43A 1C30A 2COJA 3UQ8A 5FLMG 1WR2A 4DV0H 5KT2A 2Y4RA 2JA5A 1O75A 5BPHA 1CE8A 2YW2A 4IRCA 4B3TH 1Z2NX 1EYZA 3U55A 4EEQA 5KFFA 5I5VA 4O4JF 3M9NB 2GQSA 4FBTA 4CC5A 4O7LA 4JI6H 2CNQA 4CE5A 3KHHA 2HGSA 4J9NA 2HIVA 2FB9A 3QWUA 2IA6A 1I1KA 2FLPA 2PN1A 3BABA 1VBGA 4I55F 5LYJF 2VPSA 5KG4A 1BJTA 3PR4A 1DAAA 2R82A 4QWCA 3RBDA 2R93A 4C5BA 2QB5A 2NU9B 3MR6A 1E4EA 3GB8B 1P8LA 4DLKA 1RK6A 4MV6A 2CNVA 3TIIA 3F8NA 5KG1A 5I5YA 4RB3C 4Q45A 2YWVA 2J9GA 2R93G 3RJ0A 3TW7A 2XCAA 1A0GA 2J6UA 1PK8A 5KFUA 4J9PA 1WH2A 4BXXG 3OHAA 3PO3G 1JDEA 3N44B 4LSXA 3V6HA 4B3SH 5KFSA 1IBMH 2YCHA 4O7TA 3G6VA 3H20A 2AU0A 1C3OA 2VQEH 3DF7A 5D1OA 3HOUG 1VAJA 3GV8B 3AYHB 3T7AA 5F9LA 1CKNB 1UNNC 4ZHQF 2IP4A 1A3GA 4MA0A 2R86A 2WAQE 4KHPH 5I5SA 4LH7A 1KC7A 3R5FA 5DGIA 4X64H 2AGOA 4LH6A 4EEYA 1KJ9A 1ET0A 4LSAA 4RNMA 3R9RA 4YB8B 4LF6H 2W6PA 4ED8A 2VUMA 1N32H 2EJ2A 1T36A 4FS2A 3GTJA 5JVDF 3PFFA 3T54A 4NZOA 3U9TA 2GLTA 4EQ5A 3R5HA 5I5TA 3RUPA 1B6RA 1OWTA 5KFIA 3BA9A 4FFLA 5KT7A 4NLGA 2W6OA 4ED0A 2FP4B 4J9QA 3PW0A 2R7ZG 1JKJB 3AX6A 3N6RA 2P0AA 4UFZA 3W5OA 4JI1H 3OTOH 2W9AA 3BJYA 5F9NA 2DWCA 1XDNA 1SEIA 4Q0YA 1JX4A 1CQJB 1TWHA 4FFRA 4O81A 2V9WA 1W96A 4E4TA 4EGJA 1P16A
chains in the Genus database with same CATH topology
4MV9A 3KAKA 5DMXA 3NUAA 4QSHA 5CA0F 4XX0B 1UC8A 1M0WA 5JQGF 2ZDHA 4ZOLF 1KJQA 5EZYF 2WYOA 1KJIA 2YRWA 3OUUA 3JRXA 1BNCA 1BXRA 2XCLA 2W6ZA 3KAJA 5D8DA 2R85A 3TINA 4HNUA 1PX2A 4I50F 2V59A 2YZNA 1IOVA 4XZ3B 2I8CA 2DZDA 3OUZA 5LP6F 3QFFA 4MAMA 5CB4F 1KJJA 3WNZA 4YAJB 4O84A 4I4TF 2NU6B 3MWDA 3TQTA 2R7NA 5I47A 2R87A 4XYLB 4O2AF 3VPBA 2ZDGA 5HV6A 1Z2OX 2PBZA 3KREA 4MV4A 4FFMA 4MV1A 4O83A 1AUXA 2XD4A 3ORRA 1VKZA 2GPSA 3TW6A 2YZMA 2DIKA 3LWBA 3ORQA 1EUDB 2YZLA 5BPFA 3AW8A 5JVLA 2W6QA 1GGOA 2V58A 4O7SA 5J2UF 2X0SA 2NUAB 1Z2PX 4FFNA 4WD3A 1CS0A 1A9XA 4C5CA 2GQRA 2GPWA 2CNUA 3GIDA 4FE2A 3V4ZA 1GSAA 2R7LA 3U9SA 2YS7A 1JDBB 1EUCB 3MWEA 3K3PA 2VR1A 1DV1A 2YL2A 2R7MA 5C1OA 2R84A 3ETHA 3KALA 3HBLA 3SE7A 4YBZB 4IHJF 5J2TF 5GONF 2ZDQA 4FFOA 4L1KA 4MV3A 4O82A 3JZIA 5LXTF 1JLLB 3VPCA 2DLNA 2CZGA 2CQYA 2I80A 4O7RA 2W6NA 4IWYA 2R6FA 4EG0A 1OBGA 3I12A 2HJWA 2FPGB 2VPQA 2I87A 2OLSA 3HO8A 1UC9A 4O86A 3R5XA 4XYMB 2V5AA 1M6VA 5KKNB 2QF7A 1M0TA 5LOVF 5LA6F 3VOTA 3G8DA 1OBDA 4TV8F 3VPDA 3N8DA 2SCUB 4HNTA 3UFXB 5BMVF 3WO0A 3BG5A 3LP8A 5CAEB 1KJ8A 2W71A 4MV7A 4O7WA 3RFCA 1E4EB 1SCUB 2NU8B 3GLKA 4Y8VB 4WBNF 1IOWA 4RZQA 1GSHA 1KBLA 4ME6A 1GLVA 1CQIB 2NU7B 5KX5F 2YS6A 2Z04A 5H80A 3Q2OA 3VMMA 3RV3A 4O4IF 4IWXA 2YZGA 3MJFA 4DIMA 4ZQIA 2YRXA 1KEEA 3VA7A 1W93A 3Q1KA 4MA5A 4TUYF 3RV4A 4O7ZA 1EZ1A 1B6SA 4FFPA 1DIKA 4HNVA 2VQDA 2C00A 4C5AA 4HQ6A 4IIJF 3JZFA 4HR7A 1EHIA 3JRWA 4FGRA 4O7YA 4ZI7F 3WO1A 4YJ3F 4IZOA 3HB9A 4NYEA 2W6MA 4O4HF 4EGQA 1VBHA 5C1PA 3K5HA 1I7LA 2QK4A 4O7VA 2Z02A 3K5IA 5JQWA 4O2BF 5HBRB 5JH7F 3U54A 1DV2A 1ULZA 4M9UA 1I7NA 3E5NA 4O7NA 4YAKB 3G8CA 4FU0A 3V4SA 2FPIB 1GSOA 3ETJA 4YJ2F 5FNVF 3TIGA 2FPPB 2W70A 2R7KA 4O4LF 2YYAA 5IYZF 5CA1F 2PVPA 5K2MA 4MV8A 3R23A 5C8YF 1KUTA 1AUVA 1A48A 4TV9F 1C30A 1WR2A 1CE8A 2YW2A 1Z2NX 1EYZA 3U55A 4O4JF 2GQSA 4O7LA 2CNQA 2HGSA 2FB9A 2PN1A 1VBGA 4I55F 5LYJF 2R82A 4C5BA 2NU9B 1E4EA 4DLKA 4MV6A 2CNVA 3TIIA 2YWVA 2J9GA 1PK8A 1JDEA 4O7TA 1C3OA 3DF7A 4ZHQF 2IP4A 4MA0A 2R86A 1KC7A 3R5FA 1KJ9A 3R9RA 4YB8B 2W6PA 1T36A 5JVDF 3U9TA 2GLTA 3R5HA 3RUPA 1B6RA 4FFLA 2W6OA 2FP4B 1JKJB 3AX6A 3N6RA 2P0AA 2DWCA 1CQJB 4FFRA 4O81A 1W96A 4E4TA 4EGJA 5BPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MV9 A;  3KAK A;  5DMX A;  3NUA A;  4QSH A;  5CA0 F;  4XX0 B;  1UC8 A;  1M0W A;  5JQG F;  2ZDH A;  4ZOL F;  1KJQ A;  5EZY F;  2WYO A;  1KJI A;  2YRW A;  3OUU A;  3JRX A;  1BNC A;  1BXR A;  2XCL A;  2W6Z A;  3KAJ A;  5D8D A;  2R85 A;  3TIN A;  4HNU A;  1PX2 A;  4I50 F;  2V59 A;  2YZN A;  1IOV A;  4XZ3 B;  2I8C A;  2DZD A;  3OUZ A;  5LP6 F;  3QFF A;  4MAM A;  5CB4 F;  1KJJ A;  3WNZ A;  4YAJ B;  4O84 A;  4I4T F;  2NU6 B;  3MWD A;  3TQT A;  2R7N A;  5I47 A;  2R87 A;  4XYL B;  4O2A F;  3VPB A;  2ZDG A;  5HV6 A;  1Z2O X;  2PBZ A;  3KRE A;  4MV4 A;  4FFM A;  4MV1 A;  4O83 A;  1AUX A;  2XD4 A;  3ORR A;  1VKZ A;  2GPS A;  3TW6 A;  2YZM A;  2DIK A;  3LWB A;  3ORQ A;  1EUD B;  2YZL A;  5BPF A;  3AW8 A;  5JVL A;  2W6Q A;  1GGO A;  2V58 A;  4O7S A;  5J2U F;  2X0S A;  2NUA B;  1Z2P X;  4FFN A;  4WD3 A;  1CS0 A;  1A9X A;  4C5C A;  2GQR A;  2GPW A;  2CNU A;  3GID A;  4FE2 A;  3V4Z A;  1GSA A;  2R7L A;  3U9S A;  2YS7 A;  1JDB B;  1EUC B;  3MWE A;  3K3P A;  2VR1 A;  1DV1 A;  2YL2 A;  2R7M A;  5C1O A;  2R84 A;  3ETH A;  3KAL A;  3HBL A;  3SE7 A;  4YBZ B;  4IHJ F;  5J2T F;  5GON F;  2ZDQ A;  4FFO A;  4L1K A;  4MV3 A;  4O82 A;  3JZI A;  5LXT F;  1JLL B;  3VPC A;  2DLN A;  2CZG A;  2CQY A;  2I80 A;  4O7R A;  2W6N A;  4IWY A;  2R6F A;  4EG0 A;  1OBG A;  3I12 A;  2HJW A;  2FPG B;  2VPQ A;  2I87 A;  2OLS A;  3HO8 A;  1UC9 A;  4O86 A;  3R5X A;  4XYM B;  2V5A A;  1M6V A;  5KKN B;  2QF7 A;  1M0T A;  5LOV F;  5LA6 F;  3VOT A;  3G8D A;  1OBD A;  4TV8 F;  3VPD A;  3N8D A;  2SCU B;  4HNT A;  3UFX B;  5BMV F;  3WO0 A;  3BG5 A;  3LP8 A;  5CAE B;  1KJ8 A;  2W71 A;  4MV7 A;  4O7W A;  3RFC A;  1E4E B;  1SCU B;  2NU8 B;  3GLK A;  4Y8V B;  4WBN F;  1IOW A;  4RZQ A;  1GSH A;  1KBL A;  4ME6 A;  1GLV A;  1CQI B;  2NU7 B;  5KX5 F;  2YS6 A;  2Z04 A;  5H80 A;  3Q2O A;  3VMM A;  3RV3 A;  4O4I F;  4IWX A;  2YZG A;  3MJF A;  4DIM A;  4ZQI A;  2YRX A;  1KEE A;  3VA7 A;  1W93 A;  3Q1K A;  4MA5 A;  4TUY F;  3RV4 A;  4O7Z A;  1EZ1 A;  1B6S A;  4FFP A;  1DIK A;  4HNV A;  2VQD A;  2C00 A;  4C5A A;  4HQ6 A;  4IIJ F;  3JZF A;  4HR7 A;  1EHI A;  3JRW A;  4FGR A;  4O7Y A;  4ZI7 F;  3WO1 A;  4YJ3 F;  4IZO A;  3HB9 A;  4NYE A;  2W6M A;  4O4H F;  4EGQ A;  1VBH A;  5C1P A;  3K5H A;  1I7L A;  2QK4 A;  4O7V A;  2Z02 A;  3K5I A;  5JQW A;  4O2B F;  5HBR B;  5JH7 F;  3U54 A;  1DV2 A;  1ULZ A;  4M9U A;  1I7N A;  3E5N A;  4O7N A;  4YAK B;  3G8C A;  4FU0 A;  3V4S A;  2FPI B;  1GSO A;  3ETJ A;  4YJ2 F;  5FNV F;  3TIG A;  2FPP B;  2W70 A;  2R7K A;  4O4L F;  2YYA A;  5IYZ F;  5CA1 F;  2PVP A;  5K2M A;  4MV8 A;  3R23 A;  5C8Y F;  1KUT A;  1AUV A;  1A48 A;  4TV9 F;  1C30 A;  1WR2 A;  1CE8 A;  2YW2 A;  1Z2N X;  1EYZ A;  3U55 A;  4O4J F;  2GQS A;  4O7L A;  2CNQ A;  2HGS A;  2FB9 A;  2PN1 A;  1VBG A;  4I55 F;  5LYJ F;  2R82 A;  4C5B A;  2NU9 B;  1E4E A;  4DLK A;  4MV6 A;  2CNV A;  3TII A;  2YWV A;  2J9G A;  1PK8 A;  1JDE A;  4O7T A;  1C3O A;  3DF7 A;  4ZHQ F;  2IP4 A;  4MA0 A;  2R86 A;  1KC7 A;  3R5F A;  1KJ9 A;  3R9R A;  4YB8 B;  2W6P A;  1T36 A;  5JVD F;  3U9T A;  2GLT A;  3R5H A;  3RUP A;  1B6R A;  4FFL A;  2W6O A;  2FP4 B;  1JKJ B;  3AX6 A;  3N6R A;  2P0A A;  2DWC A;  1CQJ B;  4FFR A;  4O81 A;  1W96 A;  4E4T A;  4EGJ A;  5BPH A; 
#chains in the Genus database with same CATH topology
 5KFC A;  4MV9 A;  3EPI A;  2FLL A;  4RCN A;  1K1Q A;  2UVU A;  3KAK A;  2WTF A;  5L1J A;  4J9S A;  5DMX A;  2HIX A;  3NUA A;  4TM5 A;  3UYY A;  5I5X A;  2DAA A;  1E4F T;  3HKZ A;  5KFB A;  4QSH A;  3Q8R B;  4ED7 A;  2BR0 A;  5CA0 F;  4XX0 B;  1CKM A;  4ECR A;  1HR0 H;  4WHX A;  5DG7 A;  2B63 G;  1XNQ H;  1UC8 A;  2OWO A;  1M0W A;  4PWQ A;  1ZAU A;  5JQG F;  1S0O A;  4LF5 H;  4LFB H;  3N6X A;  1RYR A;  2ZDH A;  2XCP A;  3SNO A;  2QYZ A;  4RB1 A;  4A3G G;  4JI5 H;  4A3C G;  4ZOL F;  3H40 A;  3M4I A;  1KJQ A;  2COI A;  5EZY F;  1TWC A;  2WB1 A;  2Q2U A;  3GTO A;  2WYO A;  1XMQ H;  1KJI A;  3H4D A;  4Q8E A;  4YHH H;  4JYA H;  2YRW A;  2A1H A;  5C3E G;  3OUU A;  5KFT A;  5KFN A;  3JRX A;  3TY9 A;  4LF7 H;  2YU9 A;  5IT9 W;  1BNC A;  1BXR A;  2JEF A;  2XCL A;  4UCU A;  2W6Z A;  1V4Y A;  3KAJ A;  4GKJ H;  3OHB A;  3RB3 A;  2R8I A;  3DTF A;  5D8D A;  2R85 A;  3TIN A;  4JI8 H;  1I6U A;  4HNU A;  4O3P A;  1PX2 A;  4R7R A;  4I50 F;  2V59 A;  3CEB A;  2YZN A;  1IOV A;  4K6N A;  3FMA A;  4XZ3 B;  3CVZ A;  4RNN A;  5IP9 G;  4DV2 H;  2I8C A;  5KFH A;  5BWT A;  1I3Q A;  2DZD A;  3T9D A;  3PW5 A;  3OUZ A;  5LP6 F;  2R8H A;  4EYH B;  4RU9 A;  4DUZ H;  5JUM A;  4F4Z A;  3LUL A;  1KTA A;  3GIP A;  4DL7 A;  2B63 A;  3KYH C;  3HT5 A;  3QFF A;  5KFM A;  4MAM A;  2VUG A;  5CB4 F;  5KFG A;  4QWE A;  3T5J A;  1KJJ A;  4FM9 A;  1B33 N;  3WNZ A;  4JI4 H;  2KSW A;  1JXL A;  4DV5 H;  5L9X A;  4YAJ B;  2PMZ E;  5KFO A;  1K83 A;  2J6S A;  2UUC H;  4CMD A;  3FKI A;  4O84 A;  4CC6 A;  3N41 B;  5KG5 A;  4I4T F;  4UCS A;  5LMN H;  3NBY B;  3RR5 A;  3UZB A;  4FS1 A;  4AQY H;  3WWI A;  5KFQ A;  2NU6 B;  3G6X A;  1KT8 A;  2DPJ A;  3MWD A;  3TQT A;  5IP7 G;  1I2L A;  2R7N A;  5I47 A;  3RBE A;  2JEJ A;  2R8J A;  1DGS A;  2HVR A;  4Q4D A;  4J9R A;  2VOB A;  3JSN A;  4C2M A;  4U7C A;  2R87 A;  4XYL B;  5LL6 b;  4ECQ A;  4O2A F;  3T1Y H;  4LFC H;  4TQS A;  3VPB A;  1JIH A;  4JV1 A;  2C35 B;  5EWG A;  2ZDG A;  3GTM A;  5HV6 A;  2CKZ B;  4JV2 A;  1Z2O X;  2PBZ A;  2FMA A;  4NZM A;  4GLW A;  4Q4C A;  3KRE A;  2BQR A;  1Y14 B;  4MV4 A;  4FFM A;  4R8U A;  4MV1 A;  3S24 A;  4DR4 H;  2JA7 G;  3PW2 A;  3GIJ A;  2HHF A;  2ALZ A;  4DQN A;  4PZ6 A;  4G3I A;  4O83 A;  3NBZ B;  1IYD A;  1AUX A;  3Q8S B;  2XD4 A;  3VNN A;  3ORR A;  1VKZ A;  2HHF B;  1XMO H;  4A93 G;  2GPS A;  3TW6 A;  3KHR A;  4F4Y A;  2YZM A;  2DIK A;  3LWB A;  2Q2T A;  4QWB A;  5CE8 A;  3WWH A;  2UXC H;  3T1H H;  3V6K A;  1A0I A;  3SI8 A;  4QW9 A;  2HVS A;  3ORQ A;  3HOZ G;  4UCV A;  1EUD B;  2YZL A;  5BPF A;  4ED3 A;  4QWD A;  2VQF H;  3PO2 G;  1AN7 A;  3AW8 A;  5DLF A;  5KFA A;  4DL3 A;  3GTK A;  1GO3 E;  5JVL A;  4BY1 G;  3MWM A;  3LQS A;  5BWW A;  4ED2 A;  2W6Q A;  2W8L A;  2HG8 A;  3L4K A;  2VUM G;  3H3V H;  1GGO A;  2V58 A;  4M0J A;  3K3V A;  2W9C A;  4DV6 H;  4O7S A;  5DIS C;  4J9K A;  5J2U F;  4DR6 H;  4IRD A;  2M05 A;  2X0S A;  2NUA B;  3IG0 A;  1Y1W A;  4RB2 C;  5IYD G;  1B04 A;  1Z2P X;  1V51 A;  4FFN A;  1N48 A;  1RJQ A;  4WD3 A;  2WAQ A;  1CS0 A;  2ASL A;  2OH2 A;  4X66 H;  1E4G T;  5DQI A;  1A9X A;  4GC6 A;  4BBS G;  2W9B B;  2FKL A;  4C5C A;  1I2K A;  2GQR A;  2ASD A;  3HOW G;  5DGB A;  4RNO A;  2GPW A;  4JI2 H;  4ECS A;  3I4N G;  3GIL A;  3CQZ A;  5CR5 A;  2Y0S E;  2CNU A;  2NVX A;  4YY3 H;  4DV3 H;  2W7O A;  2ZGI A;  3TQ1 A;  1TWF A;  3NC0 B;  4DUY H;  3GID A;  1CKO A;  4FE2 A;  3V4Z A;  1GSA A;  2R7L A;  3U9S A;  4CHI A;  4BWS C;  2ASJ A;  2C2D A;  2RDI A;  4IAJ A;  2YS7 A;  1JDB B;  1EUC B;  5BYB A;  5IWA H;  4EFE A;  2WB1 E;  2UXB H;  4RAY A;  3L2P A;  3MWE A;  3K3P A;  5FPR A;  3MR2 A;  2VR1 A;  1DV1 A;  1RYS A;  3N40 P;  2PMZ A;  1S9F A;  2YL2 A;  5KFK A;  2R7M A;  3HOY G;  4A3K G;  3OSP A;  4GKK H;  4K0K H;  2HDK A;  5C1O A;  4JV0 A;  1TA8 A;  2WE6 A;  1R9T A;  5BYA A;  5KG7 A;  2R84 A;  3ETH A;  5DG9 A;  5D1P A;  4CKB A;  3T9B A;  2W9C B;  3KAL A;  4ECX A;  4EFB A;  3HBL A;  3SE7 A;  4YBZ B;  4IHJ F;  2DAB A;  3PR5 B;  4QIW A;  4QW8 A;  5L1L A;  5J2T F;  4J9L A;  5GON F;  1EKF A;  2ZDQ A;  3NGD A;  5IYB G;  4IR1 A;  2UU9 H;  4FFO A;  5EWE A;  3RAQ A;  4L1K A;  2W57 A;  5KG6 A;  3MR5 A;  2V4Q A;  4MV3 A;  4O82 A;  1WCM A;  1WSC A;  3JZI A;  5LXT F;  4A2A A;  4J0M A;  4EYI B;  5KFZ A;  1JLL B;  3VPC A;  2VA3 A;  1FJG H;  2RGV A;  3J7A K;  3BQ0 A;  2DPI A;  4LF9 H;  2DLN A;  5EWF A;  4DR7 H;  5L1I A;  3PN1 A;  2CZG A;  2CQY A;  4BBR G;  1SYX B;  4DV7 H;  2I80 A;  2Y0S A;  1ZQ7 A;  4UCR A;  4O7R A;  2W6N A;  4CKE A;  2ABJ A;  4IWY A;  1RK5 A;  5KG3 A;  3T9F A;  3QQM A;  4EG0 A;  2FJZ A;  2R6F A;  3GIK A;  2C28 A;  2W9B A;  4EBC A;  1OBG A;  3I12 A;  2HJW A;  2FPG B;  2VPQ A;  2JEG A;  5DGH A;  2I87 A;  2OLS A;  4RUC A;  4DL4 A;  4OX9 H;  5DQH A;  1T3N A;  1L2Z A;  3HO8 A;  4TVI A;  1UC9 A;  4O86 A;  3R5X A;  4XYM B;  3U0G A;  3DAA A;  2V5A A;  3GIQ A;  1M6V A;  3RF2 A;  5KKN B;  5KFX A;  3G6Y A;  2MCT A;  5DG8 A;  2EIY A;  1XK5 A;  1M0T A;  2QF7 A;  5LOV F;  5LA6 F;  3GII A;  2JA5 G;  3VOT A;  1Y1V G;  5BWV A;  4QIW E;  3BQ2 A;  4EBE A;  2R8G A;  2RF4 A;  3G8D A;  1OBD A;  1WCM G;  5KFW A;  2C2R A;  4JV5 H;  2X5R A;  3T99 A;  2EJ3 A;  4TV8 F;  2HVQ A;  3VPD A;  3N8D A;  4PBC A;  3N42 B;  2SCU B;  3CSW A;  1CKN A;  3QZ7 A;  4HNT A;  2HGW A;  3T5K A;  4NZN A;  3UFX B;  5KFY A;  2ODT X;  5KT4 A;  2FLN A;  2BQ3 A;  3GV7 B;  5BMV F;  4A3M G;  3WO0 A;  5C44 G;  4I7H A;  3BG5 A;  3LP8 A;  3M9O B;  4J9O A;  5CAE B;  2C2E A;  4JI3 H;  4IRK A;  2COG A;  2JA7 A;  1TWG A;  3EPG A;  4A3J G;  1KJ8 A;  2W71 A;  4RAZ A;  4U6P A;  5K3W A;  4PZ8 A;  1RJR A;  2RDJ A;  3T5H A;  5DLG A;  3GTP A;  1S0N A;  4MV7 A;  1I94 H;  5KT6 A;  3MR3 A;  1S10 A;  3DTG A;  1J5E H;  3HOX G;  4APM A;  4A3I G;  4O7W A;  3RFC A;  1ZHS A;  1E4E B;  1I1M A;  3FKI G;  1SCU B;  1I1L A;  5DAA A;  3SGI A;  3T9A A;  1N56 A;  1S03 G;  3RTX A;  1IBK H;  3FDS A;  2NU8 B;  3GLK A;  4Y8V B;  3H0G G;  3PZP A;  4O3N A;  1Y1V A;  3IN5 A;  5KFE A;  3PW4 A;  2ATL A;  4B3R H;  4WBN F;  1IOW A;  4RZQ A;  1GSH A;  1X9N A;  2CW7 A;  1KBL A;  5IYC G;  3H4B A;  3M9M B;  4DR5 H;  4O3O A;  4ME6 A;  3MFH A;  1GLV A;  4JI0 H;  4DL5 A;  1CQI B;  4HN2 A;  4FBU A;  2UVR A;  3PW7 A;  2NU7 B;  2V4R A;  5KX5 F;  2YS6 A;  5KFV A;  4YR2 A;  4DR3 H;  2Z04 A;  3GDE A;  5H80 A;  3LML A;  4A3L G;  2FK3 A;  3Q2O A;  5DQG A;  1EKP A;  1ZET A;  3VMM A;  3RV3 A;  4JXU A;  4O4I F;  4IWX A;  2YZG A;  3WWJ A;  2XIG A;  2HHH H;  5KFJ A;  4LMY A;  3RB0 A;  3MJF A;  1IYE A;  1EKV A;  4DIM A;  4ZQI A;  2YRX A;  1KEE A;  1K1S A;  4AYB E;  5C5J A;  3VA7 A;  4DR1 H;  3Q8Q B;  1W93 A;  4EBD A;  3Q1K A;  2R92 A;  4MA5 A;  4UCT A;  3KXY T;  4DL2 A;  1GYF A;  4TUY F;  1XNR H;  4MTD A;  2Q7D A;  5FJ8 G;  2XC9 A;  3RV4 A;  5FPO A;  2R7Z A;  1BGW A;  2AQ4 A;  3BAA A;  3KHL A;  4O7Z A;  5KFP A;  3J81 W;  2E2I A;  1EZ1 A;  1B6S A;  3T9E A;  2ZJT A;  1FVI A;  4FFP A;  2J6T A;  4X62 H;  5I5W A;  1DIK A;  4HNV A;  2VQD A;  4ECT A;  2C00 A;  3UZO A;  4HYK A;  5FR9 A;  4A3F G;  4LF8 H;  4GC7 A;  2XGP A;  4GLX A;  3GTQ A;  4C5A A;  4HQ6 A;  2WDT A;  4O3S A;  2C22 A;  4IIJ F;  3GQC A;  4ECY A;  2IMW P;  3C0F B;  3JZF A;  4HR7 A;  4IR9 A;  5C4X G;  4NXM H;  4RB0 A;  1EHI A;  4CMF A;  3T9C A;  1T94 A;  4QJF A;  4F50 A;  4A3B G;  3JRW A;  3TY5 A;  3I4M G;  3GIM A;  4FGR A;  3KHG A;  1HNW H;  1S68 A;  3GTG A;  4M7E A;  1Y1W G;  2JEI A;  4O7Y A;  2IBK A;  4ZI7 F;  2NVY A;  3WO1 A;  4DR2 H;  4O3R A;  4YJ3 F;  4UCO A;  4IZO A;  5KG0 A;  2FK1 A;  3HB9 A;  5DGA A;  4DV4 H;  4NYE A;  2W6M A;  4O4H F;  5E25 A;  4EGQ A;  4TQR A;  1VBH A;  2JA6 G;  3JSL A;  1HNX H;  4E6N A;  2R92 G;  2E5L H;  4X65 H;  5C1P A;  5EDW A;  3GV5 B;  4J9M A;  4ED1 A;  4Q44 A;  3K5H A;  4LF4 H;  3GTL A;  2JA6 A;  5BWX A;  1I7L A;  4PZ7 A;  3QZ8 A;  2QK4 A;  3PVX A;  4O7V A;  4AYB A;  5KT5 A;  2W7P A;  4A2B A;  3HOV G;  3RIZ A;  2Z02 A;  3K5I A;  5JQW A;  1G2W A;  4YP3 A;  1N33 H;  2FE3 A;  4DRF A;  5FLX W;  4O2B F;  4YQW A;  1TAE A;  5T14 A;  1FKA H;  5KS8 A;  5HBR B;  3L4J A;  5I60 A;  5JH7 F;  3U54 A;  2R8K A;  4JI7 H;  1DV2 A;  4MTE A;  3MFI A;  4ECV A;  4M9U A;  1ULZ A;  5D1O B;  5KT3 A;  4DAA A;  1I7N A;  5KFD A;  3BAC A;  4O7N A;  3E5N A;  4YAK B;  3G8C A;  5EOY A;  1N36 H;  2CFM A;  3BA8 A;  5KG2 A;  1S97 A;  2UUA H;  4FU0 A;  4A3E G;  4B3M H;  4Q8F A;  2E2H A;  3RB4 A;  3V4S A;  2FPI B;  3HXL A;  5KFR A;  5HNE A;  5A2Q W;  4R8U B;  1TWA A;  4F4X A;  4ETS A;  4LFA H;  2FK2 A;  2UVW A;  4YR0 A;  4ECZ A;  2F4V H;  3HKZ E;  2HGX A;  3KTM A;  5BWR A;  4QWA A;  2VA2 A;  4NXN H;  2UUB H;  1GSO A;  3ETJ A;  3W1B A;  2XGQ A;  5L1K A;  3RAX A;  4YJ2 F;  3TY8 A;  3BQ1 A;  1N34 H;  2UXD H;  5FNV F;  3TIG A;  1MZB A;  2FPP B;  2W70 A;  2R7K A;  3RGZ A;  2AGQ A;  5BWU A;  4ECU A;  5KFL A;  1IBL H;  2AGP A;  4A3D G;  3J80 W;  3JZ6 A;  4O4L F;  2YYA A;  4DL6 A;  5BR8 H;  5IYZ F;  4F4W A;  4UUG A;  2O03 A;  2W8K A;  1WRV A;  3T5L A;  2EJ0 A;  4JUZ A;  1V9P A;  1RJP A;  2RGR A;  5CA1 F;  4YR3 A;  3JAM W;  2PVP A;  4DV1 H;  3GJX B;  1VS0 A;  4ECW A;  3RB6 A;  1I50 A;  2JA8 G;  4CKC A;  2BQU A;  2UVV A;  3OSN A;  5FD5 A;  1HNZ H;  5K2M A;  3Q8P B;  3RGX A;  2CW8 A;  2ZM6 H;  4ED6 A;  4RUA A;  4BY7 G;  1M7J A;  4MV8 A;  5FD6 A;  4PDB A;  3R23 A;  5C8Y F;  4O3Q A;  3V6J A;  3N43 B;  5LMU H;  1KUT A;  1S0M A;  3H0G A;  1AUV A;  3EYY A;  1SFO A;  4RZR A;  1A48 A;  5CM0 A;  5I5U A;  3W1G A;  3TEK A;  4TV9 F;  1ZHQ A;  4Q43 A;  1C30 A;  2COJ A;  3UQ8 A;  5FLM G;  1WR2 A;  4DV0 H;  5KT2 A;  2Y4R A;  2JA5 A;  1O75 A;  5BPH A;  1CE8 A;  2YW2 A;  4IRC A;  4B3T H;  1Z2N X;  1EYZ A;  3U55 A;  4EEQ A;  5KFF A;  5I5V A;  4O4J F;  3M9N B;  2GQS A;  4FBT A;  4CC5 A;  4O7L A;  4JI6 H;  2CNQ A;  4CE5 A;  3KHH A;  2HGS A;  4J9N A;  2HIV A;  2FB9 A;  3QWU A;  2IA6 A;  1I1K A;  2FLP A;  2PN1 A;  3BAB A;  1VBG A;  4I55 F;  5LYJ F;  2VPS A;  5KG4 A;  1BJT A;  3PR4 A;  1DAA A;  2R82 A;  4QWC A;  3RBD A;  2R93 A;  4C5B A;  2QB5 A;  2NU9 B;  3MR6 A;  1E4E A;  3GB8 B;  1P8L A;  4DLK A;  1RK6 A;  4MV6 A;  2CNV A;  3TII A;  3F8N A;  5KG1 A;  5I5Y A;  4RB3 C;  4Q45 A;  2YWV A;  2J9G A;  2R93 G;  3RJ0 A;  3TW7 A;  2XCA A;  1A0G A;  2J6U A;  1PK8 A;  5KFU A;  4J9P A;  1WH2 A;  4BXX G;  3OHA A;  3PO3 G;  1JDE A;  3N44 B;  4LSX A;  3V6H A;  4B3S H;  5KFS A;  1IBM H;  2YCH A;  4O7T A;  3G6V A;  3H20 A;  2AU0 A;  1C3O A;  2VQE H;  3DF7 A;  5D1O A;  3HOU G;  1VAJ A;  3GV8 B;  3AYH B;  3T7A A;  5F9L A;  1CKN B;  1UNN C;  4ZHQ F;  2IP4 A;  1A3G A;  4MA0 A;  2R86 A;  2WAQ E;  4KHP H;  5I5S A;  4LH7 A;  1KC7 A;  3R5F A;  5DGI A;  4X64 H;  2AGO A;  4LH6 A;  4EEY A;  1KJ9 A;  1ET0 A;  4LSA A;  4RNM A;  3R9R A;  4YB8 B;  4LF6 H;  2W6P A;  4ED8 A;  2VUM A;  1N32 H;  2EJ2 A;  1T36 A;  4FS2 A;  3GTJ A;  5JVD F;  3PFF A;  3T54 A;  4NZO A;  3U9T A;  2GLT A;  4EQ5 A;  3R5H A;  5I5T A;  3RUP A;  1B6R A;  1OWT A;  5KFI A;  3BA9 A;  4FFL A;  5KT7 A;  4NLG A;  2W6O A;  4ED0 A;  2FP4 B;  4J9Q A;  3PW0 A;  2R7Z G;  1JKJ B;  3AX6 A;  3N6R A;  2P0A A;  4UFZ A;  3W5O A;  4JI1 H;  3OTO H;  2W9A A;  3BJY A;  5F9N A;  2DWC A;  1XDN A;  1SEI A;  4Q0Y A;  1JX4 A;  1CQJ B;  1TWH A;  4FFR A;  4O81 A;  2V9W A;  1W96 A;  4E4T A;  4EGJ A;  1P16 A; 
#chains in the Genus database with same CATH homology
 4MV9 A;  3KAK A;  5DMX A;  3NUA A;  4QSH A;  5CA0 F;  4XX0 B;  1UC8 A;  1M0W A;  5JQG F;  2ZDH A;  4ZOL F;  1KJQ A;  5EZY F;  2WYO A;  1KJI A;  2YRW A;  3OUU A;  3JRX A;  1BNC A;  1BXR A;  2XCL A;  2W6Z A;  3KAJ A;  5D8D A;  2R85 A;  3TIN A;  4HNU A;  1PX2 A;  4I50 F;  2V59 A;  2YZN A;  1IOV A;  4XZ3 B;  2I8C A;  2DZD A;  3OUZ A;  5LP6 F;  3QFF A;  4MAM A;  5CB4 F;  1KJJ A;  3WNZ A;  4YAJ B;  4O84 A;  4I4T F;  2NU6 B;  3MWD A;  3TQT A;  2R7N A;  5I47 A;  2R87 A;  4XYL B;  4O2A F;  3VPB A;  2ZDG A;  5HV6 A;  1Z2O X;  2PBZ A;  3KRE A;  4MV4 A;  4FFM A;  4MV1 A;  4O83 A;  1AUX A;  2XD4 A;  3ORR A;  1VKZ A;  2GPS A;  3TW6 A;  2YZM A;  2DIK A;  3LWB A;  3ORQ A;  1EUD B;  2YZL A;  5BPF A;  3AW8 A;  5JVL A;  2W6Q A;  1GGO A;  2V58 A;  4O7S A;  5J2U F;  2X0S A;  2NUA B;  1Z2P X;  4FFN A;  4WD3 A;  1CS0 A;  1A9X A;  4C5C A;  2GQR A;  2GPW A;  2CNU A;  3GID A;  4FE2 A;  3V4Z A;  1GSA A;  2R7L A;  3U9S A;  2YS7 A;  1JDB B;  1EUC B;  3MWE A;  3K3P A;  2VR1 A;  1DV1 A;  2YL2 A;  2R7M A;  5C1O A;  2R84 A;  3ETH A;  3KAL A;  3HBL A;  3SE7 A;  4YBZ B;  4IHJ F;  5J2T F;  5GON F;  2ZDQ A;  4FFO A;  4L1K A;  4MV3 A;  4O82 A;  3JZI A;  5LXT F;  1JLL B;  3VPC A;  2DLN A;  2CZG A;  2CQY A;  2I80 A;  4O7R A;  2W6N A;  4IWY A;  2R6F A;  4EG0 A;  1OBG A;  3I12 A;  2HJW A;  2FPG B;  2VPQ A;  2I87 A;  2OLS A;  3HO8 A;  1UC9 A;  4O86 A;  3R5X A;  4XYM B;  2V5A A;  1M6V A;  5KKN B;  2QF7 A;  1M0T A;  5LOV F;  5LA6 F;  3VOT A;  3G8D A;  1OBD A;  4TV8 F;  3VPD A;  3N8D A;  2SCU B;  4HNT A;  3UFX B;  5BMV F;  3WO0 A;  3BG5 A;  3LP8 A;  5CAE B;  1KJ8 A;  2W71 A;  4MV7 A;  4O7W A;  3RFC A;  1E4E B;  1SCU B;  2NU8 B;  3GLK A;  4Y8V B;  4WBN F;  1IOW A;  4RZQ A;  1GSH A;  1KBL A;  4ME6 A;  1GLV A;  1CQI B;  2NU7 B;  5KX5 F;  2YS6 A;  2Z04 A;  5H80 A;  3Q2O A;  3VMM A;  3RV3 A;  4O4I F;  4IWX A;  2YZG A;  3MJF A;  4DIM A;  4ZQI A;  2YRX A;  1KEE A;  3VA7 A;  1W93 A;  3Q1K A;  4MA5 A;  4TUY F;  3RV4 A;  4O7Z A;  1EZ1 A;  1B6S A;  4FFP A;  1DIK A;  4HNV A;  2VQD A;  2C00 A;  4C5A A;  4HQ6 A;  4IIJ F;  3JZF A;  4HR7 A;  1EHI A;  3JRW A;  4FGR A;  4O7Y A;  4ZI7 F;  3WO1 A;  4YJ3 F;  4IZO A;  3HB9 A;  4NYE A;  2W6M A;  4O4H F;  4EGQ A;  1VBH A;  5C1P A;  3K5H A;  1I7L A;  2QK4 A;  4O7V A;  2Z02 A;  3K5I A;  5JQW A;  4O2B F;  5HBR B;  5JH7 F;  3U54 A;  1DV2 A;  1ULZ A;  4M9U A;  1I7N A;  3E5N A;  4O7N A;  4YAK B;  3G8C A;  4FU0 A;  3V4S A;  2FPI B;  1GSO A;  3ETJ A;  4YJ2 F;  5FNV F;  3TIG A;  2FPP B;  2W70 A;  2R7K A;  4O4L F;  2YYA A;  5IYZ F;  5CA1 F;  2PVP A;  5K2M A;  4MV8 A;  3R23 A;  5C8Y F;  1KUT A;  1AUV A;  1A48 A;  4TV9 F;  1C30 A;  1WR2 A;  1CE8 A;  2YW2 A;  1Z2N X;  1EYZ A;  3U55 A;  4O4J F;  2GQS A;  4O7L A;  2CNQ A;  2HGS A;  2FB9 A;  2PN1 A;  1VBG A;  4I55 F;  5LYJ F;  2R82 A;  4C5B A;  2NU9 B;  1E4E A;  4DLK A;  4MV6 A;  2CNV A;  3TII A;  2YWV A;  2J9G A;  1PK8 A;  1JDE A;  4O7T A;  1C3O A;  3DF7 A;  4ZHQ F;  2IP4 A;  4MA0 A;  2R86 A;  1KC7 A;  3R5F A;  1KJ9 A;  3R9R A;  4YB8 B;  2W6P A;  1T36 A;  5JVD F;  3U9T A;  2GLT A;  3R5H A;  3RUP A;  1B6R A;  4FFL A;  2W6O A;  2FP4 B;  1JKJ B;  3AX6 A;  3N6R A;  2P0A A;  2DWC A;  1CQJ B;  4FFR A;  4O81 A;  1W96 A;  4E4T A;  4EGJ A;  5BPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...