4XZUB

Crystal structure of the human factor viii c2 domain in complex with murine 3e6 inhibitory antibody
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
213
structure length
213
Chain Sequence
QIVLTQSPAIMSASPGEKVTMTCSASSTVSYMYWYQQKPGSSPRFLISDTSNLASGVPVRFSGSGSGTSYSLTISRIEAEDAATYYCQHWSSYPLTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHSTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords 3E6 antibody Fab heavy chain
publication title Structure of the Human Factor VIII C2 Domain in Complex with the 3E6 Inhibitory Antibody.
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 213
sequence length 213
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xzuB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xzuB01
4F3FB 1R3JB 3QUZC 3SCMD 3FQXA 2VWEE 3TNMA 4ZQKA 5HDBE 4O2CA 4N5EC 3W11C 4J1UA 4F15C 5F88A 1ETZB 3P0YL 5ISZB 5D72H 3OTTA 1FCGA 3HAEB 3I6LD 4U4BA 1NAKL 2X1XR 2VXVL 4L8DB 5C2BL 1FL3A 1TVBB 5K9KB 5IFHH 1KXQE 4Y88A 1AP2B 1FNHA 5ANMA 2A6KB 2VB5A 3JUYA 2DD8L 1Q0YH 3E1F1 1LHZA 2YPLB 3TYFA 5EFIB 4OCWH 2LQRA 4ZS7H 3BEVB 2C3WA 4ODWB 3BN9C 4EOWL 3L3JA 4OLVL 4ZSOA 3S88L 1WAAF 3VFVA 3U7AA 4NQCA 3AXLB 4WFEE 4G7VL 1I1AA 5DRZB 2HJFB 5C0CA 5GS1A 4LRNH 3WJJA 1OTUC 4RMTA 1JHTA 1TVHA 5FO8B 4GOSA 3UDWA 4HKXA 1R3LB 1HQRB 5CSZA 3LZFH 3MA9L 2I5YH 4S11A 4XP6L 4NDMB 2O93L 4PGDA 4YGAB 1FL6B 3DV4A 4QHKI 1OAQL 5HI5C 4RGMC 3S96B 5IB1A 2FATH 5HD8D 3C8KA 2Q87A 2O5YL 1AQKL 4GMTH 2NY0B 3RIAF 3SE4A 2FYYA 4CMMA 4B41A 3DUUB 4NGHH 4X4ME 1GIGH 1JHKL 1XGYH 1EIBA 2QHLA 3WS3A 4XPBH 5HGAA 4EI5D 5JIIA 4A6YA 2VE6A 5FYKE 4TULL 1W8NA 2VN7A 4D3CL 3IDYB 2JCCA 4E41A 3MCKB 3X14B 1WFTA 5DLMH 2QSQA 5IHUH 1K5NA 1TMCB 4KZEL 3NA4A 3IGAB 4NSKB 3QIBA 4LCIL 1XF2B 2F5AL 2JE8A 4TUOA 5ABDE 5IVXE 3BGFC 5ISZD 1A4KA 2NNAA 5DUBA 2ZCHL 2MKLC 4URTB 3VD7A 4OFIA 1WC7A 1N6QL 2A73A 1PJ9A 5D7LE 5T3XH 3ARSA 2UY7A 3LEYH 3VDAA 4TN9A 4YHKH 5ALBL 1LVEA 3GBNL 4CGTA 3PABA 1G0DA 3K8KA 3FB8B 4H0IA 1FFNA 1M7DB 3GI8H 3KYKH 2I27N 1X5KA 1FO0H 1IAKB 4ETQA 1QZ1A 3S97C 2ZUUA 5GGUA 4LLYA 3EFDL 4N0UA 5F6IC 3ARBD 4KTEH 5JMOC 1T20A 3EFFA 3P4MB 2IANA 2AJYL 2H1PH 4HMDA 5C0BA 2XRAH 2CLRA 1FFRA 3D48R 4ONFL 1CTOA 3X11A 3FO2B 3ME0A 4LCWE 2VNCA 3B43A 4G8EA 3L3IB 4QRUB 3MUGA 3B83A 4YBLC 5T5FH 1QP1A 1U2HA 2DLHA 5A16A 4QHNB 2P44B 4OD3H 1A4JA 4IRJC 5EOCH 3O6KL 1UM5H 4LKXA 4GW4A 5EOTB 2VDRL 1NJ9B 4FXLA 4Y8DC 3GKWL 2LTQB 1R24A 5E8EA 5D1ZC 2R2EA 1EVTC 4PLJD 3BQUA 2NY0D 1KEGL 5ETUA 4YHLL 4M43L 3TIDB 3OF6A 4Y2DB 1D5MA 3WLBA 3UCRA 3WO3B 4RWYH 2R1WA 4U1JB 4FABH 2R8SL 4KMTH 2D7TH 1CR9L 4L3ED 5H35A 3VCLA 2B1AH 5FGBC 1NDGA 4R26H 3HE7A 1H3UA 4XNMB 3VI4F 3MLWL 4MCYA 4NCC1 1C12B 3VFMA 1GVIA 2W38A 1U8OA 1ZHNB 4U7SA 3V4PH 3QWRA 5DTFB 1FG2B 2DL2A 2JJVA 4WI4A 5JZ7C 2O5XH 1FNGB 4P3DA 4A6YL 1N2RB 5AD0A 1P2CB 3VFPA 4I18C 1WVZA 4YC2B 4F7MA 1P4IL 4QOKB 1KJMB 4FZ8L 1IL1B 1MVFA 2DQEH 3GDBA 4LKCA 4Q9QL 1TIUA 3IFNH 2B4CC 5BMFH 2L7UA 4Q0XH 4YDJB 2Q3ZA 5FUZL 1ZWIB 2OR9H 1UXSA 4U1GB 1G84A 3LRGA 5KSVA 4NQEA 3L3KB 5F1KC 5CGMA 3QWOA 5IHZB 3IFPB 3SDYL 4HX1A 5GIRB 1TENA 5IMMB 4PJ7A 5D70L 5JQ6H 1MAMH 3KPRD 3ARFA 2QHRL 3TN0A 4GSDL 3KPOB 3ZHKA 2NYYC 2KQMA 3MSPA 4OGYL 1TNMA 1ERNA 4OZ4B 2AJXH 4I0PA 3BWUC 4G42B 5DHYA 3K8MA 5IBLD 5I15H 2C1OA 1MCEA 2G5BB 1BEYH 4ZFOA 4X6EB 1P9MA 4O00A 1QSZA 5C0DB 5LQBH 4W4OC 3FL7A 1CVSC 3CVHH 4FFWC 4M8VA 1WCQA 5E2WL 2H32B 1VFMA 2ZG3A 1NMCC 5J9PB 4NN5B 1F8TH 2K1MA 4H1LB 4KU1A 4JN1L 4Y2DD 1V3KA 2PTVA 3V6BR 4NRYA 3NIDE 2CDGA 2C1PA 4B50A 1CFVH 1OAXL 1P4BH 1S7VA 2VQ1A 2F19L 3BHBA 5CJXA 4Y5YA 1GPOL 3STZA 1RAMA 3WO4C 1I1YB 4FQHA 5C0NC 5DQJA 4N0YH 1U2CA 3E0GA 4P9ML 5DD5H 3V0AC 3H7LA 3DMMB 4TSAL 1JWSA 1MSPA 1WTGT 3HUJB 5F93C 5MENB 3H7BA 4OZHB 5DZOA 3W0WE 1JZ8A 4EDWL 1CICC 1U95A 2VKXA 2VSDA 1CT8B 2R2CA 1CE6A 1YEEL 4PBXA 4POZD 4D8PA 4QOKD 4IS6A 4XNYH 5T33L 3EYOA 1G9MC 5E8PB 2R56H 2L4OA 1RZJC 1KN4L 4ISVB 5C0IA 4D2NA 4NQXA 3OKOB 3C08L 4KQ4L 4XVTL 3RVUD 3FCTB 3I75B 3EBAA 1BF8A 2FJHA 4QTIH 3REVA 2BNRB 4JPVL 3LQZA 5I30L 2IADA 4HPOH 1SM3L 3HS0A 4YDIH 2XNAA 3VH8G 3SQOL 4HS6B 4C83B 2QQLH 3MGTA 3ZDZF 4ODVH 4EBQL 4DFHA 4MDIA 5E2VH 1FSKB 3KXFB 3QDJA 4JFDD 2NTFB 4Y5XC 1G7HB 3AY4C 5DDHA 1G1CA 4U1IA 3O9WB 1QQDA 1EEYA 4XP4H 1JWUB 3QDAA 1F4XL 1TCRA 5I1DB 4PRDA 1BWMA 5EN2B 1RIVH 2MCG1 1KNOA 5EPMA 3RTQA 2VIRB 5EO9B 3SGEI 3PXJA 3X3FH 4HK0B 2BSSA 3H9ZA 4N9GA 5FM8A 2A6IA 2BVYA 1BZ9A 1RZKH 1PFCA 3P4NA 4GW1B 4F7PA 4R4ND 2F53D 4KH2A 1LNUB 4WY7L 5L88L 1ITBB 2HLFD 1AKJB 2BFVL 4ZFOL 3QI9C 4DGVH 3TVMC 5KOMC 5IMLB 1XGTB 5I9QC 5DD3L 3UJJH 5JW3L 4M5ZH 2VUYA 4PBWD 1MH5A 1A9EA 4ZPVB 2HTLD 3IDNA 5I1KL 2WIIB 5MEND 4R4FL 4WTZG 2M2DA 1L9NA 1ZVYA 2VR5A 1NGQH 3GMNB 4UOW1 2X7LA 4RISL 5D71H 5F7KC 5C6WH 5SWSA 3K46A 5E6IB 2V5TA 4ZO7A 3MBEB 5E6ZA 5EWIL 3M1BA 1ZT7B 3TNNA 3PQYB 3OGCA 2FECI 4DVRH 4MB4A 5HHOE 4XT1C 1HSAB 4Z9KB 2P8MA 4DN3L 5CD5D 2ATPB 4XCYB 2BNRD 2R0WH 1U92B 2J88H 5E2UL 4DOHB 4OCYH 4TVPD 1ZHBB 5GGVL 1BECA 1RZFH 1T5WB 3KPMB 1WK0A 3QAZB 2VLMD 4Z77B 5DJ6A 1UXWB 2CGRL 1JF1B 1OAKL 1N5YH 3KXFD 2XI9A 3QNZB 3P73A 3GO1H 1TZGL 1B4JL 3OJVC 3CDFA 4KY1L 3WNNA 3MRPA 3ZO0A 4N68A 3O9WD 3L7EA 3N85H 1MQKH 5DEZA 2FJGA 1QSVA 4X6CB 2ICES 3BRFA 4I4WA 5HPMB 5T5NF 4H5SB 2BCKA 1TJHL 3ULUL 4OBRA 1DL7L 1TTUA 3OKLB 3DURB 5F1IA 5ENWA 3KPNA 4X6DB 3THMH 1NCDL 3BJLA 4PYGA 4HXAH 3MODL 4P2OA 3V52L 4OD2B 5C0GB 5F3HB 5JDSB 4HBCH 4GKSB 2DICA 3EOAB 3D9AH 1T1XA 5HYQB 5JXEC 1KTLA 4OFYA 1AKJD 1QFHA 5JUEH 2Y23A 4ONOA 3O3AA 4U49A 3QEQA 4XPHH 5KS9F 1MJ7L 4GXUM 5GISL 1SEBA 4XCEA 2W60A 1BQUA 4M8QB 2Y36H 1E4KA 1YYLL 3OXRB 5SWZA 3FT3A 3UBXI 3EJZC 3HZKA 3IJYA 3ZDZE 3EYQC 1KJ3L 5DYOA 1QR1A 3DVGB 5IG7A 3CZFA 1Z0NA 4MA3A 3SGKA 5EUOA 2AV1B 4PJ9B 1I9IH 4U1NB 1ACYH 4WFFD 4K94L 4BQ6A 1PG7X 4Y16B 1U8IB 2IG2L 4KJPC 4HWNA 4NO5A 3QR2A 1ZT4A 3MBED 4J2XA 5E99H 1CGXA 4L1HA 3PQYD 3BYTA 3VGBA 1CLOL 1W0VB 1MVUA 5HHXL 3WEXB 3O3EA 2GSGB 5D7SL 1FFOB 1TJIH 1A0QL 3N1GC 4RDQF 2VAAA 1JK8A 1JGLL 2FH6A 4WTWA 1BVZA 1Z9LA 3PP4H 4M5YL 4DEPC 2GFBA 4GS7B 4R8WL 1IEBB 1S9XA 5FECA 3LS5H 1KCRH 5CEZH 4G9DA 1RZ7H 1FNFA 2EKJA 3IU4H 3KPLB 1MFCL 3FFCE 1X7QA 4PUBH 5ACMA 1IQDA 1I1FA 4EIZC 3RJQB 1A6VL 5ITBH 1U3ZA 4OLYH 1C5DA 3BPNC 3P4OA 3G6JB 5HPOA 5CILH 5JXAL 1L7TH 2NY5C 1BAFL 5CJOL 1ZHLA 3QQ4B 1NBYB 2W9EL 1UM4L 4HUVA 2OJZH 5DJZB 4LVHC 2XIDA 5D2NC 1P1ZA 5D1QB 5I6XC 5E9DE 3V7MA 4L4TE 1EH9A 4Z7VE 1RPQA 1LE9A 1HIMH 1NFDE 3BKCH 2FD6L 3KWWA 3AS3A 4RMSA 4S1QL 4CNIB 2HYMA 4FQQA 4TOYH 3NFSH 1KCSL 1A5FH 3PDOB 3WUWG 1TETH 3U0PA 1QFWI 4MA7L 5DMKB 2Q6WA 1L9MA 3WFHA 3NABH 2HFFA 4OCLC 4PRIB 8CGTA 1GOFA 4HZAA 2CO7B 4JR9L 3I6LE 3L5HA 3QIUC 4WIQA 4H26A 4FMKA 3MOAH 5DI8A 3VGEA 1VPOH 2XXCB 2UZXB 4KROB 2UUDK 1MFEH 2DQIH 4LDEB 2VDKL 3K2UH 4IRSC 4PJ9D 4J1UB 4PPTA 2XZAL 3C8DA 3Q5YA 5F88B 3VFOB 2A77L 4M48H 4IOIA 3EYSL 2IBZX 3H6JA 2WQ8A 5EO1B 1F4WL 4Q97A 4U33A 1G6RH 4M03A 4KKLD 4YZFF 4O02L 1DQLH 5F21B 4Z5RA 4QRPA 1A7OL 2BSTA 4IIQC 4Y4HC 4HGKC 1JHLL 3D1MC 1EUTA 4CADA 1MJ8L 2IGFH 2X89A 4P49A 4XHQA 4DQOH 5JHLL 5DSCB 1D6VL 4MHHI 1IT9H 3TYFB 2YD8A 3OQ3B 3O45A 2VDMH 5GJTH 3TBSA 2ESVA 3L3JB 3MLSL 3KDMA 1CGVA 3QQ3A 1I7TB 1KFAH 1T3FA 3D5OF 3VFVB 4NQCB 3RWGB 3JV6A 1VERA 1I1AB 2A1WL 5GGTA 1EBPA 3QHFH 4HFUH 5TE7L 5KVMC 4WCYL 3MLYL 5C0CB 1T03H 2DQDL 2CLZA 4LSSH 2V2XA 1TVHB 1EEQA 2GTWA 1VSCA 3C5ZC 4HKXB 3PWPA 4IRJA 5CSZB 4NBYB 3NGBB 3L5IA 2YD3A 3S37H 3SKUD 2NW2A 5HJ3B 4PGDB 3DV4B 3SDCA 2JF1A 3NPZB 4WUUA 4X83A 1RSFA 4MDJB 3JV0A 1CFQA 2EIZB 2V2WB 5D1ZA 4BZ1L 1KCVH 5IB1B 3C8KB 3CFBA 2GITA 3GSUA 1FVDA 1G9EA 4CMMB 4PRID 4DW2L 3CGTA 5ISZE 4XMPH 3ORJA 3ZYJA 3PG2A 2VXSH 3D69A 5E8DH 5HGAB 4QHLA 1IFHL 4A6YB 2VE6B 1DLHA 2APVA 4XZUB 3UJIL 1MWAH 1FH5H 4E41B 5FGBA 2VLKB 3AS2A 1CK0L 3BDYH 1I7UA 3LPWA 4KROD 1CQYA 4PRAA 1B6UA 2ID5A 3QIBB 5IB2B 1UADC 4TUOB 2DQUL 3VD9A 1A4KB 2NNAB 5DUBB 5TQ2H 2YHGA 2AEIT 2EYSA 3BPLC 3VXTB 5IBUG 5I0DA 1WC7B 2CH8A 4J6RH 2A73B 4R97C 2Q8BL 4R96A 2KQNA 1XCTA 4G6AD 4I18A 4RZCB 3WSQL 3FT2B 4LBEA 1VFOA 1CD9B 1VENA 3A6CL 3PABB 4FG6C 4WUKH 1X3DA 3OB0K 3VFSA 3KJ4C 1FL5A 3TP4A 1Y0LA 2KDGA 1QKZL 5B8CC 5J11B 4OQTH 2ARWA 4ETQB 4QYOA 3S5LA 5C0EA 5J56B 3DYOA 4LLYB 5GGUB 3OAUL 4TNWK 1Q0XL 2K7QA 3DI3B 5J12B 3BD4A 2GAZA 3EFFB 4YDKL 1INEL 3S3SA 4LQFL 3O11A 5C0BB 4Z95H 2QR0A 2CLRB 1YY8A 4HIHA 1U8JB 4NQCD 2IBZY 3ZHLA 4FQ2H 3X11B 1I1AD 3JWOC 3PE9A 4LVEA 4G8EB 3MUGB 3O3UN 4X0KA 2P4AB 1ZS8A 5A16B 4H25A 4LARH 1A4JB 1SEQH 3FAWA 4LKXB 2NY7L 4UU9A 1FLTX 4KJQD 4UQ3A 3BIBX 4OCXL 2VL4A 5D6CA 4W4OA 3TT3L 3SJVA 1AIFA 4JPWL 4L3EE 4PP2B 3H0TA 1R24B 5E8EB 4Y0GA 2GEEA 5GGTL 4UINL 3BQUB 1ZA3A 4ZFGH 2MQ0A 5ETUB 1QO3A 2GQHA 4JGMA 2GTZA 4X7EC 4UT9L 1D5MB 4P2QA 3VJ6A 3U30C 1AGBB 5F9WC 1ZTXL 3F6LA 2R1WB 3PXHA 1HHGB 4X4XB 4E41D 4KTDL 2G75A 4HQQH 5H35B 4U31A 3VCLB 5I2IA 2VLKD 4FFVC 1NDGB 3ZLQC 1DVFC 1RD6A 2LU7A 2AI0L 4MCYB 3QIBD 3VFMB 1WSST 4LSTL 4OM1H 1KENL 3F6IA 3WD5H 2OXHA 1ZGLP 3MRCA 1EEUA 4LVOC 4PY8I 4P3DB 4K3DL 4K3EL 5AD0B 4JQXA 3VFPB 5DJXB 5AUMA 2PR4H 4F7MB 4WW2A 1JTPA 3BIKA 3IAGC 1Q1JH 4LPUA 3KR3H 3ROLA 1FAKT 5HGHB 3KPRE 1CDCA 2E7MA 1XGPA 1FDLH 2AABL 2VQUA 3HUJF 5EIIA 2R2BB 5IEKA 4OZHF 1VADB 1XF5A 1UXSB 2FLRT 1CCZA 2ZSWA 4Z0XA 1QLRA 3CK0H 5KSVB 5C0BD 2DQCL 4NQEB 4N0CD 4I2XA 1ITCA 3O6FA 1DANU 3DYMA 3QNXB 4HX1B 5LXGL 3EJJX 4PJ7B 4M9PA 2B4CL 3TN0B 3K2MC 2DI8A 3CFDB 5EA0L 4G7YH 4Y5XA 1A7NL 3AY4A 1AQDB 3OKEB 4R90L 3LB6D 4KI5C 5JOFA 3U4BL 5MEOA 4I0PB 3S3JA 5DHYB 4EEEA 1N8ZA 1U42A 4O9HL 4P4KB 3VRIA 2VKWA 1CGYA 3WFDH 4BUGA 1H3XA 2ILLA 2AXGA 1Y6MR 4XC1L 2E6JA 3BQUD 4U6TA 4YHZH 1Y6KR 2FJFA 4LIQE 1XF1A 4M6MH 4NYLB 1JL8A 3OF6D 1N6VA 1IE5A 4NRYB 1LE5A 2BSRA 2CDGB 2C1PB 3W82A 4MJ5A 4Z76A 4DK6A 3QI9A 3LRSA 3TVMA 2OCFD 1YNLH 2F8OA 1RUAL 3DX7A 4G8GB 1S7VB 5DJDA 3D39A 4EXKA 1CFTA 4ZO6A 5TDPA 1LDPH 3BHBB 4Y5YB 3KHOA 4JPIA 3C87A 2DAVA 4YX2L 4QOKE 4FQHB 4HEME 4PJ8C 1A7BA 5DMJB 2AJUL 4CJ1A 1RY7B 5I1HH 5IP4A 1JWSB 3QA3A 3QWRD 5L9DH 3H7BB 3QRGH 1M1SA 3MRRA 4MWFA 1U8LA 1U95B 3HMXH 2D3VA 5GJSH 4JJ5A 5IESL 1CE6B 5GGSB 4D8PB 1RMFL 5DMYA 4IS6B 3EYOB 1HCFX 5EOQH 5C0IB 2X42A 3GHEL 1DEEA 3MJ7A 3X3GH 4OSUH 4C59B 3I3DA 5FM4A 3IS0X 4JFDE 1UACH 4FFYL 2FJHB 5DT1H 1I8MA 4NUJA 4NQED 3REVB 3RIFF 2HWZL 1PZ5A 3LQZB 2JJWA 3HS0B 3O2VL 2I07A 4HEPG 4M93B 4RAUB 1QSEA 1RZJL 3TN0D 3QB7C 3MGTB 4HBQA 2I60H 4MDIB 1YDPA 4LSQL 3CXDH 3QDJB 5DDHB 1FFQA 1MFAL 3B9EA 1W0WB 4U1IB 5C6TL 4OF0A 5JA8B 3O6LL 1UWGL 1VESA 1LMKA 1XGUA 4P4KD 3EAKA 4PJXB 3U1SH 4PRDB 2F53E 4UV4L 5LGKA 1KNOB 5EPMB 3RTQB 4U1HA 5HHNB 5DZNA 2YPVH 4OV5A 1E4JA 5CS7A 5K9QG 1IGMH 3U7WH 4FQPA 4HIXL 1DQTA 3O3DA 4M1DH 1BZ9B 2NY1D 3P4NB 3PWVA 4MJ6A 2Q20A 3HUJE 3DIFA 1KULA 4XH2B 1OF2A 4X6CF 4F7PB 5MENE 3MMEA 4MSWA 2FO4A 1OP9A 2H8PB 2YBRA 4OZHE 3OJMB 1HH9A 2WUBL 4G8GD 4X7TA 5D1XD 3TT1H 5DJ8A 3V4VH 4YXLH 1I7RB 3EW3B 4JO4H 3O8XA 2XT1B 5F89B 2W9DH 2WZPD 1ZLVK 2UZIH 1MH5B 3ARDB 1G7LA 3IDNB 4GAGH 4UQ2A 1HYSD 1JTTA 1QLEL 4FP8H 3GJFH 4YHML 1A2YB 4KI1A 5SWSB 1NL0L 3MC0A 4ONGL 1P7HL 2BNRE 5DFVD 5ACZB 2ENSA 2ZPKL 4JHZA 4TVPE 1KACB 5TDNA 3M1BB 3CC5A 3TNNB 1MJUH 3OGCB 3MRIA 1A7PL 4MZ3A 1T4KA 2VLME 5HGBA 3P11L 1DE4A 4JANA 5I8CA 1YEIH 4M02A 1J86A 3KXFE 3K7UA 1A6UL 3VE0A 1G0YR 1JUFB 5MEPB 3C2SA 3ZKMC 4IOFD 4AEIH 1Z9OA 1EXUA 3K4DA 4ELMB 3VXQA 4MXQC 1IAOA 5DJ6B 4HLJA 4PG9A 3P73B 1RV6X 1FGVL 4EN3A 3MRPB 1JGEA 3L7EB 1YEDB 5D2NA 2UVFA 1YNKH 2BY0A 5J6HA 3C60B 3ILPA 2EXWD 3FQNA 5ADOL 4PV8A 1J8HD 5F1IB 5ENWB 3KPNB 5A1AA 3G6JF 4TNWF 2VDPL 1NLDL 4P2OB 1REIA 1IC7L 3QUMA 2X4NA 4JO1L 1XGRA 1T1XB 2HTKD 1JGDA 4NN7C 3DUHA 2DS4A 1KTLB 2JKXA 4PRBB 4HWZA 3O3AB 3QEQB 2BOBB 4JRYA 4WFFE 1OAUH 1RULL 2HKHL 3MLZL 1K9TA 4WEBH 1DBKL 4XCEB 3QIUA 3W9DB 3FO1A 3RY6A 1R6VA 4YWGL 3PHQA 3QDGA 4AT6A 5SWZB 1KG0A 3ARDD 3PQYE 3JWNC 3R1GL 3HZKB 3IJYB 1CDJA 4FQIL 1NCWL 2ADJB 1AD9B 1U36A 1T66D 5DYOB 1QR1B 4IRSA 2WANA 5IG7B 3CZFB 5EUOB 1DP0A 5DRXA 5SWSD 2CXGA 2BY2A 1DBML 1FV1B 1YECH 2OSLA 1VEOA 4DOHE 1UWEL 4NPYA 4LGSB 4P4RB 2YKLL 1MVUB 3EZJB 4U6YA 3O3EB 1RHHB 1G1YA 4IIQA 4Y4HA 3TLRA 3MLXH 2VAAB 1A3RH 1JK8B 2P8PA 3F5WB 3MJ9H 4U05A 3RU8H 2OYPA 2GFBB 1RU9H 3Q1SL 5CMAA 1IAMA 4F58H 4Y1AA 1S9XB 4PJCA 1B0RA 1JFQL 5FECB 5I1CH 1UB5A 3EHBC 4HLZG 1HK6A 1IGJA 1KBGL 1ZT1A 1S7SB 5IUSA 5HHQA 1IQDB 1I1FB 1I9JH 4M7JL 4M00A 4X6DE 1C5DB 2ITCA 5FYKH 1ZHLB 4EUPG 1OVZA 3JZ7A 4HUVB 3HC4L 4UT6H 4EKXA 4JM4L 4RMRA 3MRLA 1X5XA 3C60D 1IC1A 1P1ZB 3ULVD 1XCQA 5DEGA 3C5ZA 1NBVH 1KEMH 1LE9B 4Y7MA 4KRPC 2VH5H 3BP6A 3ZTNH 2UVEA 4FFZH 4P2OD 1NCTA 2Q3AA 2NY5L 4FQQB 2GCYA 3FKUS 3ALWA 3U0PB 3RPIA 3FB6A 3D3VD 1MCKA 3WFHB 4U3CA 3VD5A 4OFYD 2HFFB 2BRRH 2CK0L 4DGIH 1MHHA 3PIQA 4MVBD 3HG1A 4P5KA 1ED3A 4LSVL 4CVWA 4HG4J 3C8HA 4H26B 4QGYA 5TF0A 5GZNC 4DKEH 1GXEA 1A1OA 4L3AA 1J1XH 4FQ1H 5SWZD 2VXUL 4JY6A 5DI8B 1CDYA 3QUML 4KHTL 4LAQL 3HB3C 3VFRA 2X05A 3UX9B 1I9RH 1D6EA 2NXZC 2EEDA 4JY5H 3W5NA 2A9ML 5CUSL 2E7BA 4YO0A 3Q0HA 4QKXB 2P48B 1HOCA 4LVNC 4OTXL 3BUTA 4AJ0A 3U0TB 1H5BC 1A6WL 1C16A 4HKJA 2ICCA 2JCCF 3OB0H 3VXRB 2V9QA 3WIIH 4Z5RB 4QRPB 4XWGL 2GK0A 3G6JE 2BSTB 2ICWA 3PGDB 5TGBA 1VGKA 2ZCLH 1MFDL 4CADB 4UT7L 4MNQA 3RKDD 5B8CA 2R4SL 3QUYA 4LSDA 2WNGA 3OG4B 3WXVL 3S35H 2DBLH 3PP3K 4ZMAT 1YPZA 3QIWD 4JHAH 1N7ML 1BGXL 5IB5A 3WFBL 1UJ3C 4DZ8A 2DIBA 3CFIC 3O45B 1WV7T 1EO5A 3BN9D 4X7CC 3TBSB 1HSBB 3QQ3B 4ENEC 1T3FB 1UWXK 5EBMA 3ZKND 1FNSH 4HLZH 2AJSH 3MLVH 5FUOL 2E7LC 2EDKA 4YFLF 1O0VA 2AQ1A 4GRMA 1UQSA 4P2YA 4NHCH 4J12A 4JREC 4W6XB 2CLZB 2H26B 1AY1H 2V2XB 1U93A 2GTWB 4R2GD 4PRIE 3RVVD 4P2RB 5FA4A 3PWPB 1NGWA 1RZKC 7FABL 4EUPH 2ZSVA 2NW2B 2EDJA 4MZ2A 4NJ9H 3SDCB 1XF4A 5E2JA 2DTMH 3ZKSD 5IIEA 2OXGA 4ZTPH 3L1OL 1CFQB 5D1ZB 4R7DB 3ARYA 4WO4C 3CFBB 4XP1L 3GSUB 1FFPA 4GJTB 1FVDB 4J8RA 2HFEB 2K3TA 2W65A 2P1YA 4YK4C 5F7EH 1J18A 2EDOA 3D69B 4QHLB 3RHWK 1DLHB 1OARH 1BX2A 3ZL4H 1TPXC 1VEMA 1DVFA 2Y25A 1X5YA 3AMLA 3C09C 3STLA 1EHLH 4PRAB 4Y4KB 5HDOA 4U6HA 4AMKL 2EYSB 3SOBL 1A14L 4ZUTA 3ARGC 4R96B 4LPCA 2D4FA 1XCTB 2DLFH 4I18B 3VXRD 5DHVA 4LBEB 4MQXC 4YR6A 3C6LC 3O6KH 3VFSB 1FL5B 4TRPL 4NQCE 1Y0LB 2X89D 1XGQA 1T0MA 3KYMA 3QCVH 4QYOB 5C0EB 2VZVA 1U8HA 4OZFB 4ODSH 1JNJA 1AXTL 2FX9H 3GGWB 2GAZB 4JHBA 4LASL 2R23B 2HN7A 3Q3GB 1BD2A 1MEXH 3O11B 4EVNA 4B7IA 2QR0B 1INQA 1SBBA 1YY8B 4HIHB 2YXFA 1HINH 3AUVA 2ERJC 4JQIL 4S2SB 4BH7A 3W5MA 3O4LA 5CZXD 5JQHC 4UTAL 4NBXB 3SY0A 1FLRL 4PTUA 1A02N 4PRPA 4P2RD 4XAWL 1ZGLA 1DQJA 4OLZL 4PR5B 2J8HA 4UQ3B 2OLDA 3SDCD 3UAJD 4PJ7F 4E41E 3JWOL 2PXYC 5D1ZD 3H0TB 2VLKE 3I9GH 5EZIL 1C7SA 2CJUL 2VOTA 2EDFA 4W6YB 3WDHA 4GLRI 3UMTA 1ZA3B 1QFWH 5J13B 2GTZB 4P2QB 3VJ6B 1WT5C 3SGDH 2E5EA 2QSCL 4HAFA 1RUKL 3HA0A 2DDQL 1SMOA 2G75B 3CU7A 1CXEA 1L0XA 5DURD 5I2IB 4G5ZH 4YGVA 8FABA 2X4UA 1R5WA 1WJ3A 4GQ9L 4OCRH 4PJ8A 4Y4KD 2VDLH 3RBGA 4WNQA 5GS0H 3NIGE 2OL3H 1UGNA 4OB5H 2VZOA 5C9KA 1QHOA 2WV3A 3MRCB 1JGVH 3U48A 4F57H 4WI9A 2BC4A 2DIAA 5C0BE 4XHJC 3ZDXF 5AUMB 4L9LA 2AQ2A 4C55A 4WW2B 3MRJA 2ADFH 3BIKB 3K4ZA 3ROLB 2EO9A 3L6FB 3QP3A 5D7IA 3KGRA 1KPRA 1XGPB 4ZUUA 5I19L 1VDGA 1OPGL 1I8IA 5EIIB 5EZLA 5IEKB 1QSFB 1XF5B 5IMKA 1YEFH 2CIKA 3CFJA 3EIFA 1QLRB 3I2CH 4Z0XB 4NFDA 3FQRB 1CZ8L 2ZUTA 4BKLB 4YDLC 3CNKA 2E6PA 4PB0L 3VXPA 3O6FB 3QO1A 4L8SC 3DHJA 1TXKA 3X13A 3WKMH 4WWKC 2EC8A 2FGWL 2VLLB 4N8VG 3DXAA 2E6QA 5C3LD 3GSNH 4H20H 2VABA 4HJGA 3TBYA 3QZWB 4HS3A 1JPSL 1M05A 1N8ZB 5IVOA 5C0AD 5L6YL 4OBSA 3V7AE 3V9FA 3ULUF 3T2NH 4XCNA 3VXSA 5LBSL 3TYGH 5ID1A 3DSFH 4PFEA 3CUPB 2FJFB 3MRKA 1DDHA 3BGAA 1OM3H 3TO2A 5T1DH 3GSWB 4NNXA 4AM0B 4HH8A 1ZEAH 5DJ2B 5KOVC 5T33H 4P2QD 5FDYA 1EMTH 2D7PA 4OGXL 4S1SL 4K8RC 4MJ5B 4Z76B 4XB7A 1OP3H 4QHUA 3DX7B 1IBGL 1HXMA 5DJDB 3S4SA 4KK9C 1F45A 3TVMB 3D39B 3VD3A 1CFTB 5TDPB 3WL9A 3OB8A 4JPIB 5C0ND 1F11A 3FO9B 1CFSA 4ZNCD 2ZP0T 3RGVC 3QA3B 4LF3A 2VO5A 3U4AA 3MNVA 4JCLA 3MCG1 1RJYA 3MRRB 3V5KB 1EJOH 1MRDH 1DQDH 5FYJD 1EERB 1FO0A 3IXAA 1PY4A 4JJ5B 3BH9A 4JFEB 1FZKA 4NQEE 4G6JH 5D72L 1NCAH 4Z7WB 2HT2D 2IPKA 3LS4L 4P3CH 1OSZA 3RZCC 4PJ7E 4MNGB 1DEEB 3MJ7B 5CEXA 5BV7B 5IFHL 2BMKA 2A74A 1B90A 2MCPH 3LKQA 3OJ2C 1QSFD 5J6GA 1S5HA 1I8MB 4NUJB 4KXZH 3O6FD 5E5RB 1Q0YL 5KVGH 1PZ5B 2XFXA 1WICA 2Y72A 1ZSDA 1RK0B 4OCWL 1FZOA 2I07B 4JKLA 4F2MA 5L88H 4ZS7L 4KKAC 4XVJH 2BFVH 2GJ6A 4PJ5D 3DTXA 4HF5L 2W92A 1TVDA 3HR6A 2YZ8A 3U6RA 4CJ0A 5GS2H 4WI3A 4NM8H 4UIKH 4LNVA 4OLUH 4NP4H 1YN6A 2XZQH 4ZOBA 5F7WC 1MCIA 2CDFB 3FOMA 3KLHC 4LRNL 4X5LA 5CJ8A 5KAQG 4B7LA 1P6AB 4G8GE 4U1HB 3ZDXE 3LZFL 3NTCH 3PUCA 4QGTA 1I3VA 5EU5A 5CZKA 1ULVA 4GRLB 3QFDB 1QTYT 4FQJH 1FIEA 3O3DB 4UZGA 2VR4A 5E4IA 1YN7B 3DIFB 2FATL 1OF2B 5C9JA 4MSWB 2FO4B 5KVEH 2YBRB 4JB9H 4GMTL 4DKDC 1I3RA 5L8JB 3GRWA 4QF1A 4G3YH 3D39D 4NGHL 4HWEH 1GIGL 2CIIB 3O8XB 4O58H 3JV4A 4XPBL 3VFNA 3J8F7 1QHPA 5E2UH 2DLTA 5GSVA 4HK3N 5GGVH 1G7LB 1AO7A 1QOKA 4UQ2B 5DLML 5IHUL 4KRLB 3QFJA 1RUQH 4LOUC 1QFPA 2DWEA 3WJLC 4JFED 1FNAA 4HJJH 5SV4A 3DVNA 4WU7A 2YWYA 3QG7H 4U6VH 3PHOA 4MMXC 4RDQG 4K3JH 5T3XL 5TDNB 3CC5B 4N5UA 3G5ZA 3MRGA 1U8NA 4F7CB 4YHKL 3ARPA 3MRIB 1T4KB 1R0AH 1DL7H 5DK3A 5HGBB 4JANB 5I8CB 3QXVA 4G8FA 3HAEG 2EDXA 4DEPB 5EUOF 2HKFH 3UROR 2H2PD 5A40E 1KIQA 3GI8L 4Q2ZA 2FBJH 1ADQH 3KYKL 1FO0L 1YEHH 4UIMB 2NMSA 2R0ZH 4PJXE 1MJJA 2Q76B 4OZIA 5AZEH 4LSUL 4QXTA 1RFDH 1S7XA 1EXUB 3Q2CA 1DN2A 4KTEL 1ZLSH 3VXQB 3MNWA 1J8HE 1IAOB 2H1PL 3BPNB 4Q6YA 2XRAL 5IBTH 5GISH 4PG9B 1S9WA 1MNUL 4EN3B 3VXNA 4LVHB 2XY2A 2ENYA 3CVHA 5I6XB 5J6HB 3ILPB 2ZUXA 4YFLI 5T5FL 3LPGA 3FQNB 1R5IA 3QH3A 3PGCA 1UYWH 4OD3L 1Z9SA 5EOCL 1ZLUH 2DJ4A 2EE6A 3VGDA 4GRLD 1XAUA 2VQTA 3QUMB 2X4NB 2EIBA 1XGRB 4JHWH 3RA7H 4CU8A 3BZEA 4E0RA 1JGDB 5DHXB 4QRQA 1Z0MA 1DQQA 1IAIM 2C9AA 5SWSE 1EVUA 4FHBD 3O8XD 1PEZA 3B8YA 3FO1B 2GUOB 4RWYL 3K8LA 3QDGB 3EJZD 4KMTL 3PWLA 1KG0B 2D7TL 1E4WH 2B1AL 4P5TC 5F9JA 2B20A 4OIAA 4R26L 5LGJA 1JTOA 3HHRB 5JLZA 5DRXB 4PGZA 2W9EH 2BDNH 3GRWL 3V4PL 2OSLB 1AGCB 3BH8B 1DZBA 3IDJA 5E2TH 2JB6A 2O5XL 1S9VA 4G6FB 4ELME 1G7MA 4UAOB 5D96C 4U6YB 1BIHA 4R3SA 3LV3A 3WN5C 4M62H 4DZBB 2P8PB 1DLFH 1U9KA 3PP3H 1BM3H 1FZJA 5T1LB 4S1QH 4Y1AB 4PJCB 2DQEL 5KVDH 1UB5B 1UZ8A 3IFNL 1KCSH 35C8H 1UJ3A 3ULVE 4Q0XL 2OTUA 2XZZA 4CMHC 1ZT1B 4L9DA 3TM6A 5HHQB 4ZNEE 1UWXH 3HAEH 4RIRA 3DX8A 3D2UA 2J8OA 3CSYB 1ZXQA 3ISWA 5T3ZH 4EN3D 1NDMA 3VRLE 1BFOA 3SDDC 2E7LA 2F54A 5JQ6L 1MAML 1L0QA 2NY6B 3MRLB 3SKOA 3D3VE 1T21A 1XCQB 3NBNA 5DEGB 1CI5A 5K9OA 1FORH 3QPQC 5FUCC 3OL2A 2BSED 3BP6B 3BZDA 2A77H 3QISA 3EYSH 1BEYL 2GCYB 1LO5A 1XIWD 5SWZE 4JLRB 2YR3A 4WO4A 5LQBL 3CVHL 1RZIA 2FH8A 3DO3A 4HIEA 2HJLA 4JFOA 2HRPH 2DL9A 2VN4A 1F8TL 2YK1H 5IT2H 3HG1B 3MJGX 5F9DC 1ED3B 4JKMA 2B0SH 3GHBL 3QDGD 1A1OB 2Z8SA 1CFVL 1BZ7A 4YHNA 3G5XB 3L9RA 4KJYA 5DA0B 3VFRB 1P4BL 5JORA 4WJ5A 3TBVA 3MRBA 2O26U 2XKNA 3MUY1 1XR8A 2OK0L 1A6TB 4E5XA 3BPLB 4N0YL 3S7GA 3H9YA 5DD5L 4YO0B 2KZWA 5EU7C 1BWWA 3ARGA 1C16B 1O5DT 2ZCKH 4G6FD 5B38G 2DQDH 2Z0BA 5EC2B 2GK0B 1X5FA 3EDFA 3KJ4B 5TGBB 1VGKB 3TC9A 5IJKC 4MNQB 5B8CB 5T1LD 5DWUH 3QUYB 4Y1AD 2DI9A 2R56L 5GZOD 1YPZB 5IB5B 4I77H 3L3DB 2MTPA 3N1QC 4DZ8B 3KPSB 3H42H 4PRNA 4DFIA 1P5VA 1S7WA 5GRZA 3GSXA 5HI3C 5LAXA 4QTIL 3VH8A 1C1EH 3MO1A 5D5MA 1A8JH 4NQDA 2QQNH 5EBMB 1X5LA 1LILA 5KG9B 3KJ6H 4YDIL 2NY6D 1H3WM 3CSBA 3TBTA 2FGZA 1QEWB 1UQSB 2QQLL 4NJAH 4XPFH 2R2HA 5E2VL 5KSAC 4X80H 1U93B 1MCNA 1DQMH 3BDBA 3MRDB 1NGWB 1K2DA 1B6DA 2ZSVB 3BO8A 3EGSA 1SJHA 2A83A 4PBVC 4HIIB 3GBLA 4OLWH 1WBYA 3CFCH 4ZAKC 1XF4B 2PXYA 4DWHA 3QNYA 4KGLA 1RIVL 5FKAA 3VMOA 5I1AA 1P69B 1FFPB 3HFMH 3BRGC 3QJHA 3K80A 5F7UA 3VI3F 3X3FL 4J8RB 1H9VA 2DMKA 2W65B 1WT5A 3HG1D 5F9WB 2B5IC 3QCUH 1RZKL 4N1HB 1KOAA 1BX2B 1OLLA 1BJ8A 4RGNB 4PD4J 4WW1A 3DETC 4OUUB 4S1DD 2N7AA 3VXRE 4U1LA 3E3QC 3GSVB 4DGVL 3HI1B 4LLWA 3STLB 2CSPA 4PS4H 2XWTA 5BVPH 2VJXA 3ROOA 1MHPH 3L5WA 4NQVA 3UJJL 3NCJH 4PJAA 4U6HB 4WTZA 1M7IA 2MOVA 4M5ZL 4U6XA 4ZUTB 5HYIA 3STBA 2MWCA 5I1GH 3MLPA 1JYVA 2BVEA 3K1KC 1NGQL 1CDGA 1EFQA 1HXYA 5D71L 5DHVB 4L5FH 4FG6D 1Q94A 4YR6B 2OMBA 4LSPH 5K9JH 2PNDA 3QUYD 2APXA 3FHQA 1T0MB 4LCYA 5EH1A 4XWOD 3RVXD 4LHUD 4DVRL 3V6OC 5IFAH 3A6BH 1U8HB 3KPSD 4Z18A 3RWCA 1YUHB 1MCQA 2XTJB 4P2RE 1BD2B 3OKNB 3N1MC 4EVNB 4L8SA 1INQB 3EYFA 4ZOEA 2ZWLT 2R0WL 4WW2F 1T0PB 2J88L 4JPKH 4WWKA 4OCYL 2A6JB 2EDDA 4BH7B 5IVZA 1P84K 1RZFL 3O4LB 4I0CC 1D7FA 1CD0A 3VA6A 3SY0B 4PTUB 4Z78B 3OXSA 4XC3H 3UTTA 4P46D 4PRPB 1N5YL 3BEWA 3GO1L 4KK8C 1WBZA 3T8XA 2EE3A 3MTRA 1DQJB 3N85L 1MQKL 4ZOCA 2PUQT 2VZ1A 4WGVB 3BJ91 1JE6A 5EBWA 2JB5H 3X12A 3THML 1K4CA 3LCYA 4RGOH 4TSBH 4HXAL 3RL2B 1MUJA 4K7PH 4HBCL 3LH2H 5HYEA 4NQUA 3D9AL 4RGND 5HI4C 4I48B 1Q9KA 4TPRL 4WI7A 1U8PA 3CH8A 5JUEL 2C3VB 3H9HA 4XPHL 4YGVB 8FABB 1R5WB 4D9RD 4CVXA 3GUTA 4RAVA 5FXCH 1G6RA 3RGVA 3LY6A 1OY3B 43CAA 1JV5A 4UTBL 1F2XK 1PBYA 1QNZH 1PDKA 5INCA 1GZPA 5D93B 3LPFA 4NKDA 1A7NH 2OJEB 2BC4B 1QBAA 1ACYL 3FT4A 2FX8H 4NHUB 4Q6IB 5DD0H 5BRZA 4L9LB 4D0DA 3MRJB 3HCVB 3RZCA 1ZE3C 3SBWC 2GSIA 4JAMB 1P6FA 1CDBA 5D7IB 1KPRB 5E99L 2D31B 4IJ3C 4YHIA 1FPTH 1I8IB 1MCBA 1TJIL 4Z7OF 2EDLA 3VI3E 3ARTA 5IMKB 3CH1A 2XTJD 3PP4L 3WE6A 1BD2D 2F74B 4ZPTA 5HDQH 1YMMA 3QO1B 3LS5L 3SE3C 1KCRL 5C0AE 5CEZL 4RFNB 4ZFFA 4UOW0 5C6PB 1RZ7L 3IU4L 2ADGA 2Z35A 4PUBL 1NBZA 1TZHA 3L7FA 3O4LD 3AGVA 1KJ2H 5DEFA 5EZOH 1T04A 5ITBL 3DXAB 4OLYL 5CILL 1G7QB 2VABB 4HJGB 4PRPD 4Z8FH 3TBYB 1L7TL 4N8CH 3TFKD 4HS3B 1M05B 5I1IH 2OJZL 4P2QE 3NIFF 1P7QA 4PGBA 3CSPA 4MX7A 2H2SC 3R8QA 5JIPA 5F96H 1BFTA 2IPTH 5FB8B 3VXSB 2X1QA 3MV8A 3A0OA 5ID1B 1HIML 1EO8H 3WUWA 5DJCA 3BKCL 1DDHB 3MRKB 4TVPH 3TO2B 3VXOB 4BSVA 1MWAA 4NNXB 3H3BC 4TOYL 5ITFA 3NFSL 2PF6A 3MLRL 4P9HC 5C0JA 5BS0A 1TETL 4V2CB 4OLXL 3TWCH 5KN5A 1ZK9A 4UMGA 4QHUB 3S4SB 3BKJL 1HXMB 5FYJE 2HVJA 4M6OH 3DUSA 3DOSA 1QLFA 4X9BA 4EZMA 5IFJA 2CDEA 3KLAA 4LLQA 1RJZB 2IMNA 3ZT7A 5I73C 1CFSB 4XP9H 3RVTC 1DJSA 3P9MA 4NKQB 3MOAL 4LF3B 1CTNA 3CMGA 1G9MH 5CLTA 1VPOL 3MNVB 2J6EH 2NY2C 4K8RL 1RJYB 3WJLA 1MFEL 1QSFE 2DQIL 3K2UL 5H2BB 5BVJA 3P77A 4AIZA 1MCSA 4C54A 1FO0B 4OQTA 1BF2A 1MFAH 3BH9B 5DVMA 1FZKB 3V0VA 3DO7A 4M48L 2VXQH 4ERSH 1SHMA 2IPKB 2R4RH 1OSZB 2P24A 1BFSA 1VACA 1LK2A 4OI8A 1G6RL 1DQLL 2BMKB 4PJ5E 1OB1A 3LKQB 1DBJL 2RIKA 3VG0H 3VXMA 5J6GB 2R9HD 1S5HB 4MCZA 5EUKB 5E8NA 2IGFL 4DQOL 1IT9L 2XFXB 2VERN 4HG4K 1FZOB 4F2MB 4MJ4A 3P9WB 2VDML 2NXYC 5GJTL 3DTXB 3DXAD 5J06A 3HNSH 2Y5TA 2MHAA 4EQ2A 2Y6SC 4KUZH 1KFAL 3ZE1F 3TO4C 1LEKA 1KYOK 2QLVB 2NY4C 4JZNB 1YN6B 3RKPA 3QHFL 4HFUL 3B5GA 3CAFA 4LPTA 1I3GH 2OX5A 3MOBL 1T03L 1F5WA 1HKFA 4LSSL 3D39E 2JK5A 5FEBA 3N06B 1D5BA 5EU5B 2ZG2A 5JHDB 4PRHA 4HIJB 3BP4A 1KCVL 4NN7B 4C58B 5C9JB 3GMMA 4Z7OE 5KZCB 3U0WH 3ZDYF 1I3RB 1OW0C 1WIPA 4QF1B 4ZS6C 9CGTA 1QBLH 2FLBT 3EJYC 4JFEE 4LP5A 4XMPL 4Z7WE 3UC0H 4AIXA 5ESVA 5T3XD 2VXSL 3QQNA 5E8DL 3IETB 2BVQA 5GSVB 2DOCA 1MWAL 1FH5L 4MNGE 4YH6A 2V6HA 4GAJH 4P5TA 1AO7B 4NKOA 3BDYL 4LEOA 3QFJB 4KZDL 4G80A 2DWEB 4U0RC 3OWEA 3VWKC 3EYVA 3B9DA 2VLJA 2R39A 2NR6C 3G5YA 5TQ2L 3AROA 3DVNB 2Y07H 3ARWA 4GO6B 3PHOB 2H6PA 3IRPX 1NGPH 3MRGB 3WNKA 2OI9B 5JW4R 1MCWW 3VG9B 3WN5A 4WUKL 3T77A 4OFVA 1Z9MA 1KIQB 4Q2ZB 4X9GA 5GGSY 3UBXB 3WFEL 3ZKMD 5HVFB 4OQTL 4JO1H 5IEHA 3UTQA 1MJJB 3T1FA 4OZIB 2R0LL 4QXTB 1NANI 1S7XB 2IBBA 3LN5A 5FO9A 1WITA 2ED8A 4Z95L 2EXYC 4OI7A 4DUVA 1S9WB 1LK3H 3VXNB 4OKDA 3SDDA 3CXHK 4FQ2L 3CVHB 5INDA 5TJWK 3CLFH 3UTSB 4PJCF 1WUNT 3HE6C 4U1SB 1NCWH 1R5IB 5IMOA 3PGCB 5DUPH 2APBA 4LARL 2IEPA 1SEQL 5KTEH 5JHDD 4IMKC 1YQ2A 3BOVA 5GRUH 3JTTA 4LSRH 5HVHC 2A2QT 1LEGA 3LKOA 4FQCH 5C08A 3SO3B 4ZUWB 3VU2A 3BZEB 4E0RB 5T1MB 4JEGB 3OBAA 5CWSA 4LU5H 1CWVA 1DQQB 4HZLA 5GS0C 4ZFGL 3FN0H 5ICZA 3CJJA 3T65A 1BQLH 1G9NH 1MF2H 3T0VA 4IHOA 3HI6H 1RURH 5CP3H 3HMXA 4MMZC 1KBGH 1OGTA 1WQVT 4NOBA 5F9JB 1VFBB 2YXMA 3UTPD 1E6OH 4X98A 5LGJB 3ZE1E 1SJEA 5JLZB 1NKRA 3IJHA 4F7TA 4OM1L 3HC4H 2J1KA 3WD5L 1F3DJ 1DANT 3FO0L 3VWJC 3IDJB 4AQ1B 1S9VB 3IJSA 2E9JA 4QHMA 1G7MB 5IOPA 3B5HA 2X9XA 2DBJA 2PR4L 1Q1JL 1FZJB 3HNVH 1P7KA 3DI2B 1DBAH 1UZ8B 2Z8RA 3EHBD 5JW4N 1AI1H 1FDLL 1UJ3B 3AREC 3LEVH 1MLBA 2OTUB 3EOYG 5TF1H 5F71A 3IT8D 4HS8H 4XBGA 4RIRB 3CK0L 3ILQC 3D2UB 1V7NH 4U1KA 5MI0C 1KUMA 2E27H 1NDMB 4NO3A 3B2UC 3ZKXB 3ES6B 3UTSD 2F54B 1ZANH 2V7NB 5DC4B 1YPZF 3UZEA 4JREB 5T1KA 4G7YL 5K9OB 5F70A 3IKCA 4WWID 1H15A 5CJ5A 1QRNA 2D7MA 3Q5TA 2A9MH 5CUSH 4ZAKA 3VGGA 2FDBP 1U8KB 1TJGH 3WFDL 4YBHA 3QDGE 1LO5B 4KJWD 4WO4B 3TIEA 1FNEA 4NC2B 1RZIB 1PX4A 4LDOB 1JWMA 1Z3GH 4PGEB 1NEUA 4JFOB 3OX8B 4M6ML 1FBIH 1J87A 5FYKU 3GJFA 3BX7C 5TPWH 3KPQA 1EGJH 3SGJC 3NFNA 1BZ7B 4YHNB 3L9RB 4KV5F 5C07B 5SWQA 1YNLL 3SE8H 5JORB 4C4KO 4WJ5B 1LDPL 3QPXH 2EEAA 3OZ9H 3WHXA 4WI5A 4CN4A 4JFFA 5DVKA 4E5XB 1U0QA 3V7AG 5CEYA 4Y1AE 3R8BB 4PJCE 1KLGA 2H41A 2AEWA 3D18A 5I1HL 4TQEH 4DKFH 3NH7H 2AQ3A 4GRWH 5L9DL 1AC6A 2Y06H 2VL5A 1HI6A 2Z91A 4YBQC 4QRRD 3QRGL 3V4UH 4H8WH 4WRLA 3FAXA 3HMXL 4FQXD 5GJSL 3FQUB 2WBJC 3ECBA 5FDWA 4AL8H 3B3IA 3T0XA 4BYHA 1JVKA 5CHNA 2NY3B 4KDWA 3HZMA 1CDIA 3V6OA 1HH6B 3X3GL 4M7LT 4OSUL 4XP1H 4PRNB 1F3RB 1S7WB 3GSXB 1UACL 2C26A 5KJRH 1DFBH 4XMLH 5DT1L 5SX4I 4ENED 1CLZH 2BVOA 2ERJB 2BXZA 3AU1B 5D5MB 3WLWC 1OGAB 4P5MB 4NQDB 3RRQA 4PGCA 2IC2A 3SPVA 5AYUL 1IZKA 3DJ9A 2OQJA 3EOBA 4QEGA 3TBTB 3TJHD 4PREA 2O61B 2I60L 4KAQH 2R2HB 3BW9A 4IRZH 3CXDL 3DX9A 4WV1C 1U41A 1K2DB 1HHIA 2EH8H 2GHWB 3HG1E 3GSOB 4F9PA 2A83B 4QRSA 4FXKB 2RBLA 1WBYB 5F7NC 3SOBH 3U1SL 3QUKA 2IH3B 3LHPH 2JJSA 2PXYB 3QNYB 4WO4D 5FKAB 5KANI 5I1AB 1NKOA 2YPVL 5ID0A 4XGZA 4KI5F 1IGML 3U7WL 1EFXA 4OT1H 4M1DL 5I76B 2AXHA 1HDMB 5CD3A 3VGAC 5C07D 4U1LB 3ZT6A 4LASH 3TT1L 5A43C 3V4VL 2XWTB 4S1RH 5MERA 3G6AA 4YXLL 3ROOB 4JO4L 2YUWA 2EYRA 5M7QA 1O7VA 3L5WB 4NQVB 2W9DL 1JI1A 3VFWA 1A6AB 4LDLB 3ALPA 1PQZA 2UZIL 5DK0B 3RL1A 5CFHA 5B39G 5JTWA 1YPZE 4U6XB 1GC1H 1WWAX 3REWB 4GAGL 3W2DL 3MJ9A 3KPSE 4L8CA 1HXYB 1PKQB 5DVLA 4L8BA 3SCMC 1U3JA 3SBWA 3V6FA 1WWBX 4MGXA 4DCQA 2NY3D 1HN1A 3JWOH 4GBXA 1MJUL 4JZOA 3MRMA 2N4IA 5EZIH 4GUPA 1YEIL 5E00A 1BMGA 3K3QA 4JVWA 3LN4B 4YDLB 4L8SB 3EYFB 5DXWA 1OHQA 1OGAD 4ALAL 4NQDD 5GPRA 2QSCH 5IVXA 4AEIL 3KPTA 1T0NA 1RUKH 5IVZB 4KV5E 5I75B 2DDQH 5D7IF 3QEGH 4K71C 3GFUA 3MQIA 2X9YA 2EKSA 1KSRA 4P23C 2XWBA 3UTTB 1KELH 3FQTA 3DGGB 3T8XB 3KYOB 4HUNB 2A6DA 1AXSA 5C8JA 5IVNA 2RB8A 1YNKL 4YHPA 4NZUH 3LD8C 4OJFH 5EBLA 4Z7UA 2PXYD 4RGNE 1WBXA 4G6MH 4ZFZB 4H88L 5EBWB 3X12B 1K4CB 4D9RE 3U9UB 3LMJH 3E6HA 1OOAA 4KK5D 5GXBB 5C09B 4HH9B 5EBGA 5E5MB 4OD1H 4LCWA 4AYFA 2VLRD 1X44A 5K59E 1Q9KB 3DRTA 2E8ZA 1U8PB 5HY9A 1WFUA 4POYA 3HZVA 3H9HB 5HD8C 5J1AB 4WEBL 4CVXB 1HHKA 1CIUA 3GUTB 4K2UH 4OF8A 4V1DB 4RAVB 5IM7A 1G6RB 4JZJC 3RGVB 4HFWA 1JV5B 2FWOB 4XB8A 1IVLA 4XVUC 1PYWA 5INCB 1GZPB 3TESA 3ZMRA 3LVEA 1CL7H 5CIPH 4XNQA 4NKDB 1E4XH 3SKMB 2XTJE 1QPXA 1BD2E 5CEZD 3FT4B 3G08A 3GKZA 4D0DB 1JPSH 3KYNB 3Q6FB 1YECL 3RZCB 5C0FB 2GSIB 3C9NA 2YRPA 1LEIB 4LLDB 2V7HB 3O4LE 4YHIB 3SEPA 3SDAA 4PJGB 1W72A 5JR1H 3SKNA 5KS9B 3D6GA 3MLXL 1A3RL 4GAYB 4C56A 4PRPE 3CH1B 1SYSA 2B2XH 3MJ9L 2MQ3A 1OAZH 2Z31C 3WE6B 1RU9L 2WINA 4F58L 2HT4D 5L8LB 1FN4A 1YMMB 1UCTA 5I1CL 2EDEA 4ZFFB 5F7FA 1J0ZA 1J0KA 1N0LA 2Z35B 3L7FB 25C8H 3NCFB 4EUPA 2YEZA 1I9JL 4HWUA 1T04B 4GW5A 3M8OH 4GG8A 3UTTD 3TO4A 1ND0A 4RBPK 5FYKL 3ARBC 3I6GA 1MCPL 3GI9H 1GGBH 5BW7C 3PL6B 1UT9A 2W9LA 1S7TA 4UT6L 5TQ0L 1P7QB 4BQBA 1HQ4A 1Q9OA 4PIRF 1JPFA 4OAWA 4O4YL 1NBVL 1KEML 4HC1H 1YEGL 2APFA 4O5LH 1YJDH 3WUWB 2VH5L 3O2WH 5HXMA 3ZTNL 1MWAB 4FFZL 2LU4A 5C09D 4O2EA 3LS4H 4WU5A 4MXVF 3ZSSA 5KN5B 1ORQB 1OW0A 5E1HB 1C5CH 1I8KB 3DROA 5F72S 2BRRL 2HVJB 4DGIL 3DUSB 3NMEA 5J3HC 4HHAB 3MRFA 5IFJB 2CDEB 3KLAB 1IGTA 4YXHH 1A7QH 4LLQB 3IDMA 4V1DD 1F90H 1G7JA 3RGVD 4DKEL 3P9MB 3PJSB 5D7IE 5KW9H 3HKFA 1J1XL 4FQ1L 5CZVH 3ET9F 4APQA 4P9HL 3RJDA 1WWWX 1I9RL 3CX5K 1XF3A 3VWKA 2YPKA 1E6JH 1XR9A 4JDTH 3P77B 5BVJB 4AIZB 1WZLA 4HF5H 4JY5L 2GYSA 3O4OB 3DO7B 3RZCD 1XH3A 4MAYA 4LMQE 2P24B 1VACB 1AC0A 1LK2B 4R0LC 3SQBA 3WIIL 3DXAE 1OB1B 2CRMA 3P2TA 5DC9B 5I66A 3VXMB 4N1EA 2AJVH 2ZCLL 1T7XA 4MQSB 5E8NB 5HTSA 2OBGA 3OKKA 4YPGA 1CGWA 4B5EA 3S35L 2DBLL 4JHAL 4Y5VB 4P3WA 3QCTH 2Q8AH 4J3WA 1B2WH 1LD9B 3W0WA 2ICEA 3K74B 1W72L 3TGXA 4OIBA 1FNSL 3I02A 3PL6D 4OZGA 1I85C 2AJSL 1P7QD 3MLVL 3RNKB 4JG0H 3CPLB 4AENA 4OZIF 4BUHA 4PJBA 4NHCL 4LFHD 5HHMB 1AY1L 3W9EA 2JK5B 4YHOL 4WTXA 1D5BB 2Z4QA 4IMKA 2LVEA 5T3XE 3UXFA 1YMHA 4NJ9L 2DTML 4ZTPL 4G9FB 1U58A 1UM6H 3BKMH 5CBAB 1OAYH 1CBVH 2OL3A 5GGRA 3S36X 2OS7A 4HKZA 5ESVB 3ULVH 5F7EL 5ESQA 2W0LA 3MRQA 1OARL 1NSNH 1RZ8A 2BVQB 2YPLD 4LSUH 4Y2DC 3IF1B 3PWJB 3ZL4L 4NRXA 4P5TB 4NKOB 4LEOB 1Q38A 4N9OB 3IDUA 4G80B 3M17B 1EHLL 4NFCA 2A0LC 1MNUH 4NO0A 4OFPA 5BZDA 5JO5A 2ZG1A 3VWJA 2DM2A 1JN6A 1NCCL 2CKBB 2H6PB 5D96B 2DLFL 2PW2A 3WN5B 3RWJA 3VXMD 2R1XA 3E6FA 4O51A 3T77B 4NKIH 5FM5M 3T4AB 4PY8J 1PG7W 5IEHB 3QCVL 3GSNA 4POZC 4CMHB 3T1FB 4OF3A 4ODSL 4ORZC 3BFOA 2PN5A 4PD4K 2FX9L 5FO9B 1UH3A 3UYPA 3L95A 4M4RA 1WTLA 4JDZB 1MEXL 1V3LA 1NEZG 4M4PA 5JHDE 1HINL 3RVUC 2PO6B 1A64A 4U1GC 1RZGB 3SDDB 1J05A 2AJ3B 5BZWB 4DUWA 3ZYIA 1NC4A 4KMQA 1KB5H 4I3SH 3QUXB 5HHMD 3GEWB 5IMOB 1WAAE 5F9AC 5IV2A 5HHOA 3U2SB 1ONQA 4Y19A 3GRWH 3JTTB 2ITDA 1KN2L 5FCSH 2F8XC 4IM8A 4KKNA 1LEGB 3LKOB 5C08B 5HYSB 3MGAA 2XTLA 5D7JB 4G9FD 1SYVA 1CXIA 3I9GL 4DTGL 3UTPE 2DWDA 4QTHA 5CWSB 5F7HA 4HZLB 1DSFH 5DMGD 5H94A 1QFWL 5ICZB 3T65B 3U83A 2VISA 1LO4L 3VFGH 3SGJA 1KIRA 4NN5C 2NPLX 2BNQA 3D25A 2YD4A 1KC5H 1OGTB 1T7VA 4G5ZL 1F97A 1MCRA 4X98B 4R4NC 2DRUA 2ZUQC 3TEUA 2LAAA 1SJEB 3GNMH 4OCRL 2HLFC 2VDLL 5IF0A 1D5ZA 3P30L 4F37K 5GS0L 4G43A 3IJHB 4F7TB 2OL3L 1VKXA 2R0KH 4OB5L 2HG5A 1XFPA 2D7OA 4OZIE 2DM3A 2RAMA 1KCUH 1JGVL 3IJSB 1BP3B 5FYLH 4F57L 2J4WH 3Q48A 2HTLC 5DD1H 4UV7H 2WBJA 1SJXA 5IB3B 3VMPA 2ADFL 1TFHA 2W59A 3BUYA 1P7KB 3UTSE 4BK4A 3RPKA 3V2AR 5DJAA 3OKDA 3OAYH 5I1JH 1F4HA 1MLBB 1KT2B 2GW5A 4HUWA 4XPTH 1BOYA 4XBGB 3C5SA 1YEFL 3G6DH 1KTDA 3I2CL 1U91A 4U1KB 3UTOA 4N8VA 2PO6D 4MNHA 4NO3B 4CVZA 1K3ZA 5CD5C 3GHBH 5CJQH 3WKML 4OZFG 1DEDA 5CP7B 3RWIA 3QUXD 2D9QB 3GSNL 4H20L 5TDOB 5F3BB 3IKCB 1OWRM 5E6YA 3MUHL 4WV1A 2OK0H 3LDBC 1QRNB 3G04A 5KVFH 3LSOB 1UZ6F 1J11A 1FSKC 1MI5A 5D5MF 1E28A 1S8DA 3JWDH 3T2NL 5C08D 4LNRA 1MPAL 3O9WC 4LMQI 1FIGH 4HD9A 1W2KT 1FNEB 5D7JD 3TIEB 3TYGL 3DSFL 1EHAA 4HJ0D 3RY5A 1QYGH 1FAIH 3FFCA 3IRZA 1JWMB 1BREA 2E9BA 5FGRA 1OM3L 5T1DL 2B5IB 1ZEAL 1CFBA 1ZHKA 4GQPH 1EMTL 4FXGB 3D0LA 1HHJA 4EXPX 5L2KA 3GJFB 4JQVA 2AV7A 3KPQB 4QRRE 2Y5EA 5CGYC 1MCOH 5A3IC 4HULB 4L4TA 6FABH 4Q7DA 3HMWH 3WHXB 4Z7VA 1WEJH 2VZUA 1NFDA 3RDTB 5CEYB 4ZXBC 3D18B 4RFOH 1FQ9C 1CLCA 5EO0A 4J4PD 1HI6B 2Z91B 1ZV5A 3IU3A 3MUZ1 3PGFH 1EJOL 2XA3A 1MRDL 3VI4E 1DQDL 1ADQA 1DBBH 4OUOA 3SCMA 1URLA 4G6JL 1NCAL 2X70A 4YAQB 1G7IA 3ECBB 5FDWB 1N5AA 3B3IB 4GKZB 4KMLB 5GRWA 4PJAF 1T2JA 4P3CL 5CHNB 3HZMB 5BO1H 1A1NA 4QXUH 3MBEC 4RMWA 2MCPL 1HILB 3T04D 3TZVA 1R5VB 4YHYC 1OTTD 3WNOA 4MB3A 2BVOB 3RFZC 5KVGL 4FS0A 4PGCB 5ADPH 3SPVB 2WSKA 2OQJB 5E7BA 1T89C 5I74B 4XVJL 4P23A 4PREB 4QXGH 2BERA 3DX9B 1J12A 4JFXA 1QRND 4RRPG 4NM8L 4UIKL 4QRSB 1M7XA 3O41A 4OLUL 4NP4L 2XZQL 4OZFH 3DMMD 5DRNA 3QUKB 4LPWA 4I1NB 4ZUSA 3C6SA 5C07E 4R9HA 2W91A 4YIQA 4XNZC 3FOLA 3QZWG 3NTCL 5ID0B 4XGZB 4NCC2 3O2DH 3ZT5A 3O3BA 4LLUA 5GRVL 4FQJL 1O7SA 3T0EB 1UH2A 15C8H 2OTPA 1IAIH 5CD3B 2XPGA 5KVEL 5L0QB 4JB9L 1OTSC 2VYRE 2UZYB 3WXWH 4G3YL 4ODXA 4HWEL 3G6AB 4HDIA 2DQGH 4O58L 2E8YA 4JZJA 4LK4A 3VFWB 3RDTD 1RUPH 4G8IB 4XXDA 4K3GA 1PQZB 3MPCA 3TCLA 4GFTB 4L8CB 1RUQL 1JZ4A 1R3JA 1J1OH 5B3JF 4L8BB 1CXFA 4HJJL 1UZ6E 5D5ME 4WHCA 4F9LC 3F62A 1OGAE 4NQDE 3QG7L 4PJ9C 4U6VL 3V6FB 1ETZA 1CD1A 4DCQB 3HAEA 4IJ3B 4K3JL 1IQWH 4GBXB 4JZOB 3LKPA 1RHFA 3MRMB 2HA1A 1X5AA 1R0AL 3BSZH 2UV3A 4L8DA 4GUPB 3MX0A 5E00B 2Z31A 2HKFL 4KKLC 5K9KA 1ZVSB 1MFBH 2ZOLA 4PJHA 1AH1A 3DV6A 2FBJL 1IMHC 1ADQL 1KB9J 1YEHL 2R0ZL 5HVGB 5B4MD 5BJTA 5AZEL 1T0NB 5FYJH 3T0BA 1RFDL 1ZLSL 4RBPH 4TPRH 2EKSB 4PJGF 3HC0B 2XWBB 4CVUA 5IBTL 3ARBA 1U8QB 4KK8D 5BW7A 4PB9H 4XVSH 3FTGB 3JTSB 4JM2A 5KANG 1AXSB 5C8JB 1NC2A 4UTBH 2UY6A 4Z6AT 2Y7QA 5EBLB 4BZ2H 4Z7UB 1HYRC 3QUZA 2VLRE 3GIZH 1CXLA 1II4E 5ICXA 1WBXB 4HWBH 5E70A 2HJFA 1U3HB 1G9NC 1UYWL 3F7VB 3V5HA 3LQAH 5FO8A 3GJFK 5E6ID 4WDIA 3A6OA 5DMIH 4KK6D 3T0ED 2PTTB 5LWYL 3MJ8A 4HUUA 4JHWL 3RA7L 1PX3A 3BE1H 3MLTB 3QXUA 3DRTB 4P59H 1WF5A 1PKQE 4LHJB 2GK2A 3EOTH 1UEMA 3HZVB 5CEZE 2EE2A 1T2QH 2QSVA 4X9HA 1HHKB 4NCDA 5I73B 4I3RL 2QKIA 3H3PL 3KLDA 1E4WL 4XPAH 1PYWB 1N64H 4L3EA 4XNQB 3X14A 1H0DA 1OT1A 5I8EA 3V6ZB 1HEZA 5JW4Q 4M1CC 3G08B 4TTDD 2BDNL 3RAJH 3IGAA 4NSKA 2JJTC 1XF2A 3QQ9C 4IDJH 4R0LA 1A3LH 3C9NB 4FQLH 5E2TL 2Q7YA 3FB7A 4GBXD 1KJVA 3SDAB 3CMOH 4XCCH 5FK9A 3CLEH 4WENB 4JO2H 3UTTE 4M62L 3BD3A 4C56B 1SYSB 1DLFL 2OR7A 5LCVH 3BMWA 1BM3L 2WINB 4ESKA 1FN4B 3BDXA 5KVDL 3MLRH 35C8L 1JF5A 2J5LC 4OLXH 1M7DA 1S9YB 2YD2A 5HYJB 5AAMA 4EUPB 2YEZB 1AGEB 2H9GA 3ABZA 3OR7A 2HLAB 3BKJH 4QWWC 4GW5B 5DD6B 5K93A 3TO4B 5F1SA 3RWHA 4GKNA 2VZ3A 3P4MA 5T3ZL 5C09E 1LO0H 2NY4B 3QJFA 1JYXA 1S7TB 1FCCA 2P7TA 1HQ4B 1Q9OB 3UPRA 3IVKA 1JPFB 4OAWB 3KPRA 1CU4H 3FQXB 2YD6A 4K8RH 3TNMB 3WCYA 4ZQKB 1FORL 1U3HD 4MLSA 4X5WA 4O2CB 5B3JE 1UA6H 2DLEA 3V5DA 1X5JA 2OM5A 4Y16D 4QHNA 4V1DE 1TQCB 4FRWA 3UDWC 5KBNC 1H3GA 3BKYH 1B4RA 1JNNH 4O2EB 4WU5B 3NGBC 1MRCH 1YY9C 1BVKA 1FL3B 1HZHH 4KJQC 1OQOA 1TQBC 1VGEH 1DBJH 3DROB 4OGAD 2HRPL 4K23H 5ANMB 2YK1L 3MRFB 5IT2L 3SN6N 3WUZA 2B0SL 3IDMB 4ZO9A 2C3GA 4JFQA 3TIDA 1G7JB 3PV7A 4Y2DA 4H8WC 2V9RA 4APQB 3DSNA 4PJGE 4X7DC 3WBDA 5KS9E 2QADB 4KKCD 3VWKB 5BCAA 2YPKB 1V5JA 4ZSOB 1WFOA 4IDLA 5B38A 1XH3B 1C12A 4LGPB 4MAYB 5D1QD 4PJDA 5GS1B 2ZCKL 3MOBH 1EDQA 3LKSA 4OKVA 1AR2A 1J9CT 1JHTB 1FG2A 5DTFA 3SDAD 1TNNA 1YNTA 4C56D 2IJ0C 4KTYA 5DWUL 5TH2A 3OKKB 4YPGB 2MJWA 1JZ5A 3EO0A 4NC0B 4OF6A 4QOKA 5ACLA 2Y1VA 4I77L 5C0RH 4V2BA 4OM0H 5HYJD 3H42L 5A2KH 5I8KH 3IB4A 1C8PA 5I18H 5J11C 4YDJA 5JIHA 2FYYB 2R15A 1MRFL 1Y6NR 1C1EL 1NUNB 4XXCC 5J12C 3CSGA 2QQNL 3WS3B 2NY4D 3I02B 1L0YA 4OZGB 3KJ6L 4N0CC 2JCCB 4AENB 4PJBB 4XPFL 4NJAL 5IMMA 4RX4A 3AB0B 1K5NB 3JV5A 4KZDH 4NC1E 4X80L 5GRXG 3W9EB 3MV9A 1DQML 1BBDH 3HPLA 1UG9A 3KPOA 4DN4H 5HVHB 4JFDA 4OLWL 3LB6C 1JRHH 3CFCL 2YPLE 2QL1A 2F58H 1U58B 1F58H 3HFML 3O6MH 4J3XA 2R69H 3R06A 4ZS6D 2OL3B 5GGRB 3EJYD 2DQTH 5HVWA 3IKKA 1V05A 5C92A 1JP5A 4UILH 1YZZA 4L29A 3FRUA 3QCUL 1FFNB 1GC1C 5ESQB 3WFEH 3MRQB 4H0HB 1RZ8B 3U4EA 4A2MA 2R0LH 3SDXA 4N0UB 4APQD 5E7FA 5B21A 1T20B 2F53A 2IANB 4PS4L 2QADD 3VXME 5BVPL 1BIIA 3VWKD 5GRJL 3TH2T 1MHPL 2BX5A 3CDGA 4NO0B 3NCJL 1M6OA 1MCCA 3MV11 4MAYD 5C0CD 5I1GL 1C5BH 4Q9BA 1OT2A 1UKQA 3BIAX 3HN3A 4L5FL 3RWJB 4AEHH 2R1XB 1A47A 3E6FB 4AY0A 2WW8A 4LSPL 5K9JL 4GW4B 3U7YH 3SHSA 1KJ2A 3AMKA 4M7LH 3GSNB 4YZFE 3DPBA 5IFAL 2YN5A 3A6BL 5E8PA 2R2EB 5HHME 1YYML 3WFCH 3R4DA 3NPSB 4MQ7A 2DQJH 2EXYD 3OKOA 4PGJA 3B5TA 3IDGA 5D8JH 4UI2A 3WLBB 4LHUG 4JPKL 4QCIA 4W68A 3B9KC 4G9FE 2X44D 2ZUVA 3H3KA 3RWFA 2DMCA 4XC3L 3HE7B 4HS6A 4C83A 2IF7A 1HWHB 3GMOA 4J7RA 1MCHA 1U8OB 1S3KH 1ONQB 4Y19B 2FX7H 2ITDB 3EO9H 4Y4FC 4PJEA 3NZ8A 3FO0H 3O9WA 3CCHA 1CN4A 1JWUA 1SYVB 1CICA 4P4KC 5I1DA 5A2IH 3WMSA 4OFKA 1RVFH 2JB5L 4QTHB 1P9MC 4RGOL 5J1SC 4TSBL 4JO3H 4YLQT 2V5SA 1Q9WA 3F58H 3IAPA 2MQCA 1PLGH 4NKMA 4K7PL 2J6EA 4LKCB 1GGIH 3LH2L 1KIRB 3A67H 4JGJA 3T2OA 1R3IH 2BNQB 3D25B 3DLQR 5BXFA 5K33A 4HGWA 4GW1A 2NY1C 2XZCH 4NZRH 3AFLA 2ZUSA 5MP6H 2IAND 2NX5A 3H8NA 4YFDB 1AKJA 3UYOD 3W81A 3QWOB 2NTSP 1D5ZB 5IF0B 4ZXBA 4NO0D 3ZE0F 4G43B 5D1XC 1VKXB 4DJMA 2XV6B 2XQYG 5CJXC 4OF5A 4J3UA 1QNZL 1FVEA 3ARFB 1UB6A 4CDHA 2J8UA 4PLKC 1BOGA 4M9OA 2OR8A 4D9QD 3S8WA 3OAZH 4AK1A 2FX8L 3V0WH 5DD0L 5AWNH 2WBJB 1A7RH 3QDMA 1EEZA 1FGNL 1HYSC 3BUYB 5SX5H 1FJ1A 2C1OB 2XG4A 1H8SA 2ZNWA 3ZZ1A 3BXNA 4ZFOB 5EZJA 1YEJH 3OKDB 4JE4B 5DFVC 3MBEA 3F8UB 1FPTL 4L4VA 4HUWB 4NFBA 4LHQB 4LCCC 1ZT7A 3PQYA 4Q9RH 3DYPA 3C5SB 4JN2A 1KTDB 3DVFA 3ARRA 4YUEH 5HDQL 1IM9A 2YOCA 4BA8A 4N8VB 1DUYA 3B2UD 1BVLA 4R4BA 4MNHB 4UB0H 5E5UB 5DQDH 1T89A 5C08E 4PV9A 1C7TA 1YJDC 1KJ2L 4AG4H 5EU6A 5EZOL 1ZHBA 4IOFC 3Q6GH 2VQ1B 2X1OA 3HE7D 3STZB 4Z8FL 4WV1B 1JPTH 4N8CL 4XBPA 2IQ9H 5DQJB 3G04B 5I1IL 1JF1A 2FO1A 4K7FA 4Y19D 5HDBF 1MI5B 3QNZA 4QNPF 1S8DB 1DN0A 5F96L 4ODTH 2IPTL 3I3BA 4ZODA 3NZHH 5H37G 1IJ9A 3CFEA 5HPMA 1EO8L 4H5SA 3AS0A 2EXWC 2DKUA 4TVPL 3UPCA 4NM4L 4X6DA 5DJ0A 1ZHKB 3D0LB 1HHJB 4HW6A 2L7JA 5L2KB 4X4ZA 3TWCL 4HT1H 4NQXB 2BNQD 5F3HA 3VW3H 4YXKH 3VGAB 1KCLA 3N50A 1NUGA 3FFDA 4M6OL 2EEBA 4Z0BH 5HYQA 4L4TB 2UYLA 4Z7VB 3NA9H 5F7LB 5DS8A 4XP9L 2IADB 4Z7QF 3E2HB 1MELA 1WGOA 2XNAB 5AYUH 2ADIA 5EO0B 1G9ML 3ARFD 2YZ1A 3EDJA 2J6EL 3OXRA 3IU3B 4M7ZB 3E8UH 3ARDC 2AK4A 4M6NH 1T7ZA 3SCMB 2YA0A 4F9LA 4I0PD 1Z2KA 5FHBH 1G7IB 2HMID 4ODBD 4PJ9A 4U1NA 1QQDB 2VXQL 1EEYB 4UNUA 3HZYA 4ERSL 2R4RL 1U8IA 5E4EB 1TCRB 1A1NB 2LFGA 3TBWA 3MGOA 3BN3B 3VG0L 5GS2D 3TZVB 2DJUA 4YDVA 3WEXA 2GSGA 5D2LA 2DQHH 2BSSB 1FFOA 1QRNE 2AW2A 4N9GB 2A6IB 1K6QH 4ODUA 4PP1D 1IEBA 5FCUH 5CJBA 5JXEA 3NVQA 1U8MA 1IEAA 3PWUA 3LKNA 4P23B 1FNLA 3HNSL 4KUZL 1OP3K 1QG3A 1T7WA 4U2ZA 4JFXB 43C9A 1OSPH 2A38A 3O41B 1MI5D 3LD8B 3QQ4A 3KYAA 5DRNB 1LO3H 1NBYA 1I3GL 5E0QA 5IVXF 1A9EB 4ZUSB 1WIOA 1MAKA 3W2DH 2W0KA 2QJDA 4AEFA 3C60C 3FOLB 2X7LB 3ULVC 5CP3A 1A6ZA 2FEDD 1B0WA 1D9KC 5L2KD 5H37H 4CNIA 2XPGB 4R7NA 3LN9A 4Z7UF 3U0WL 1ORSA 4JVPA 4X7SH 3S98A 2P8MB 3IDXH 3RZWA 4ODXB 1QBLL 3UC0L 4HDIB 4PRIA 3ETBF 4JZJB 4ALAH 4MVBC 3ULUD 3V6OE 4GAJL 3TCLB 1HE7A 1P4LA 4FA8A 3QDJD 1OCWH 2ORBH 6CGTA 2JJTA 2BJMH 3SGKC 4QNPE 2Y07L 2FJGB 1CD1B 4LAJH 1PG7H 3VFOA 2FB4H 1EHXA 4I4WB 2HJKA 1NGPL 1K8DA 2BCKB 3LKPB 4X6FA 5DO2D 1T22A 5EO1A 3RTQD 4G6KH 4H88H 3RGHA 2DIJA 5LG1A 4JVUA 2Z31B 3TZVD 1CF8H 3MUJA 1S78D 2ZOLB 4PJHB 3DV6B 4ACPA 3DECA 3B8SA 2ARJA 4X4YA 4X9IA 5BJTB 5GRVK 1IARB 3RKDC 5DSCA 4M6AA 3QIWC 4KKBD 1N3NA 4P23D 1MAJA 3ARBB 1SEBB 1LK3L 2W60B 3PHSA 5CSBA 1F3DH 2W07A 2E9WA 3T0EE 3CLFL 4JM2B 1I7TA 4Z7QE 1NC2B 3FT3B 2Y7QB 3RWGA 3QUZB 3ZKNC 4W4NA 5ICXB 1UENA 3PWNA 2V5RA 4MA3B 4F15B 5DUPL 5HBBA 3QYCA 3V5HB 4JY4A 5KTEL 1EGJA 4CU7A 4NO5B 4R2GC 4LSRL 4WDIB 5GRUL 4FMFA 4X8XA 3RVVC 4M3JA 1ZT4B 2X1PA 5FOJA 3MJ8B 4FQCL 4HUUB 1RIUH 5HJ3A 4KRMB 2IBGA 1HNFA 4MDJA 4LU5L 2EIZA 2V2WA 1NMBH 1QPPA 3FN0L 2L0DA 1BQLL 2X5PA 4NNYA 1G9NL 1MF2L 2D0FA 3HI6L 1KV3A 4G9DB 1RURL 4HUXA 4D0CA 2GKIA 3JBG7 2QKIB 1MHCA 4X6CE 5IGXH 4U7MA 1X7QB 4XVUD 3CU1A 3TV3H 4XZUA 1OLZA 3IS1X 3GMQA 1E6OL 4L3EB 1H0DB 3P4OB 2VLKA 2FIRT 2CPCA 5I8EB 1HEZB 3T3PF 1MCPH 4XX1E 5IB2A 5TQ0H 3IDIA 4R0LB 2X4PA 1AR1D 2Q7YB 3VXTA 3FB7B 1KJVB 1BQHG 4O4YH 5T3ZD 1EZVX 1YEGH 5FK9B 5CGTA 2Z31D 3HLAA 3B2VH 2DM7A 3S37X 5JPNA 4RZCA 3FT2A 3KWWB 1CLYH 3HNVL 2FEEL 1DBAL 3SGEH 1GHFH 4RGMB 4JRXA 1AI1L 1ZLUK 3LEVL 4JCMA 3FZUD 4Z7UE 1EPFA 5TF1L 2Q6WB 1WZ1H 4NZTH 2H9GB 3NIDF 3S34H 4HS8L 5M94B 3RVWC 3OR7B 3MBXH 1V7NL 3QEQD 1A22B 4XXCA 2E27L 3UBXG 2BHUA 4GKNB 3RWHB 3JWDC 3TCXA 3QJFB 2CUIA 3QG6A 4JM2D 1NC2D 1U8JA 2P7TB 3GMLA 3UPRB 3IVKB 1ZANL 1GAFH 5JIKA 4P9HH 3QUZD 3KPRB 2C5DC 3FMGH 4N5ED 4X5WB 3W11D 2XA8H 2G5RA 5CZXC 3OG6B 3BGFB 3V5DB 3WIHH 3WS6C 4IOIB 1TJGL 4OZGF 3UJTH 4QY8A 1BVKB 1SY6H 32C2A 3PDDA 4GXVH 4PJBF 3SDCC 3Q5OA 3UAJC 1Z3GL 4PP2A 2ZNXA 5J3HD 1FBIL 4QLRA 4JFPA 3JUZA 4JFQB 5TPWL 1EGJL 1N6UA 1MQ8A 1GL4B 3CDYA 1AGBA 5F6IB 3SE8L 1HHGA 4X4XA 2VDQH 3QPXL 2ESVB 3OZ9L 3CFKA 4C56E 3KDMB 4OIIH 4NQSA 1W72H 3JV6B 4LEXH 5B38B 3NN8A 4TQEL 4DKFL 3NH7L 1J88A 2KKQA 4Y4KC 1MLCA 1Z5LA 2Y06L 2VDOH 4PJDB 1OTUD 4YBLB 5AZ2H 5HYJE 3V4UL 4H8WL 2EZ0C 3ZKQD 3LKSB 4OKVB 3I50H 1GZQA 1H8NA 1YNTB 4YHOH 4IRJB 4QXWA 4XNUH 4AL8L 5ERWA 5GSRA 3BP7A 5TH2B 5DJXA 5HI5D 5EB9A 3EO0B 4WUUB 4RSVA 4CRPA 5HGHA 1R3HA 1XEDA 2WM0A 3U9PH 2GITB 1FC1A 3UYRH 2ZKHH 1BFVH 5KJRL 1DFBL 2R2BA 4XMLL 5I1EH 1VADA 2AK1L 1CLZL 4GXUN 3MYJA 2BY3A 3NCMA 5DC0A 2MSPA 5IQ7H 3B9KA 4OV6F 4WEUD 3B6SA 5D9SA 3QNXA 1JPGA 5JW5A 1DTUA 1EZVY 1I7UB 2BHYA 4KAQL 5I8OH 2NZ9C 1BBJA 4IRZL 3MV9B 5ANME 3HPLB 5DFTA 3T3PE 3CFDA 4DUXA 2EH8L 3OKEA 1AQDA 4I8DA 4DAGH 4JFDB 5EU4A 3GK8H 4Y4FA 1FYHB 4O2FA 4P99A 3PNWA 3LHPL 3KPPA 1A9BA 4WI2A 1NCCH 4P4KA 2VXTL 4TSCH 4QRPD 4MHHG 3R06B 4WVRA 4GKOA 4ZSOE 5F9OH 5DGRA 4L29B 3FRUB 4OT1L 3UP1A 3KS0J 4NYLA 5DR5H 5J13C 5CIPA 5C0CE 3S5LB 3U4EB 3BZ4A 3HRZA 3SDXB 4HGMA 3N9GH 4ZTOH 5K9QI 4XMKH 2F53B 2ZUQB 5KSBA 4S1RL 5B39A 1BIIB 2ESVD 2A0LD 4G8GA 1IGCL 5D1XA 3CDGB 3ARZA 2JELL 4RWHA 1DCLA 2HH0H 2V2TA 1M6OB 3VFUA 5IWLC 2EIDA 1GC1L 1YQVH 5CKAA 4U1MA 4X0KB 2PETA 1ZS8B 4H25B 3PWPD 4IRJD 4WEMB 4UU9B 2LE9A 5HSFA 1KN2H 1KJ2B 4JQXC 1BJ1J 4OZGE 3EKCA 2MPAH 5GGSA 5D6CB 4WUUD 1F00I 4ONHA 2JCCE 4WW2C 1AIFB 3SJVB 4LCCA 4PJBE 3PV6A 2HT2C 4DTGH 4MQ7B 1NMCB 2E7CA 3IDGB 1QO3B 3U82B 4K9EH 5JOPD 1NAMH 5FHAH 1LO4H 2B1HH 2LVCA 4QCIB 4HC1A 1T1ZA 3QEGL 3O6FC 3TJEH 4WFGD 2RFXA 2FHFA 3UPAA 1JIBA 3LQAC 4RX4D 3RWFB 1LO2L 2XN9A 3WO4B 1MY7A 4RAUA 1KELL 5MEQA 3MV9D 3LDBB 5L8KB 4JKPH 3GMOB 3P30H 2WWMC 2P8LA 5DRWA 1W0WA 4NZUL 4PJEB 3NZ8B 4OJFL 5LGHH 4NNPH 1F3JA 3CCHB 5JZ7D 4BFBD 4N0UE 4G6ML 1F42A 4PJXA 1CICB 4CKVX 2IANE 5ALCH 1S9KC 1IC5H 3OSKA 3BESR 4XI5C 3LMJL 1J8HA 1Q9WB 5HHNA 3DHMA 4NKMB 2W0PA 1J5OH 3NCYS 2O5ZH 3RWEA 1KB9K 5BXFB 4OD1L 3EO1A 2K9UA 4HGWB 4XH2A 3SE9H 4D9QE 2ZSWB 2H8PA 2NX5B 2A9NH 2DJSA 2NLJA 4XNXH 4RMVA 4I2XB 5GS3A 4K2UL 4ODHL 4ZXBB 2I9LA 3QULA 1I7RA 1SJVA 1PD6A 5F89A 2CRZA 1RUMH 1FVEB 1UB6B 3BP5A 2NYYD 3MCLH 3ARDA 4EI6A 2J8UB 1BOGB 1CL7L 4Y5XB 1E4XL 2G2RA