4XZUB

Crystal structure of the human factor viii c2 domain in complex with murine 3e6 inhibitory antibody
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
213
structure length
213
Chain Sequence
QIVLTQSPAIMSASPGEKVTMTCSASSTVSYMYWYQQKPGSSPRFLISDTSNLASGVPVRFSGSGSGTSYSLTISRIEAEDAATYYCQHWSSYPLTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHSTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3E6 antibody Fab heavy chain
publication title Structure of the Human Factor VIII C2 Domain in Complex with the 3E6 Inhibitory Antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 50
structure length 213
sequence length 213
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xzuB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xzuB01
1PDKA 3PV7A 2QQNH 3D2UA 1CF8L 4F33A 4GRLC 3TJEL 2P24B 5DJ2A 5FHAL 1RV6X 4MXQC 3O2WL 3BQUA 3N0PB 4PGBB 4Y5XC 2P8PB 3BEWB 3L5XH 3CJJA 5SWZB 1IQDB 1OLZA 4J3TA 4EOWH 4ZPVB 4WI2A 1F4YL 2J4WH 1FVCB 2IAMB 3N1QC 4H20H 3HZKB 4HC1A 1UKQA 2Y1VA 1E4XI 1AGBA 4LVNC 2ZOLA 5IFJA 12E8L 1D5ZA 3VD9A 2JELH 2X4SA 2IFGA 1H3TA 3HZYB 1BMGA 3OR6A 1T3FA 1DR9A 3T0VA 2VZSA 2XTJE 5FYKE 3O2DL 1SY6A 3QI9B 4O2EB 4Y5YB 5BJTA 4NGHL 3FT3A 5AG9A 4LAQL 1N5AA 5IB3B 2RCSL 3LS5L 3QG6A 2D2OA 1KIPA 3TBWB 2FBJL 3WBDA 5HVWA 3R1GH 1AQDB 1HDMA 4RDQF 3HE7C 3VFNA 2EO1A 1BFSA 5IF0B 4GRLD 3EDKA 3VFPB 2VERN 4MXQD 5K9JH 3G04A 4JRWA 3MLSH 4ODHH 2E8ZA 1S7QA 3OXSA 4R3SA 2V7HA 2FATH 1KJVB 5C6TL 4LARL 1YEJH 5F3BB 4P9HL 1Z5LA 4GXVH 4ELMB 3TGXA 5F93C 3RAJL 3G6AB 3BH8B 4LEOB 3KYOA 2EXYD 4YHKL 3V6OE 2EIZA 4PJDB 5AYUH 3BXNA 1BVKA 1UWEH 2X09A 1A47A 5E4IA 1P5VA 1SBBA 4HKZA 4UU9A 3U4EA 4KRNA 2MPAL 4IEFB 1UZ6F 1GPOH 4G8IB 4BZ1H 2QQLH 4QT5A 1VKXB 5E00A 4G8GE 3V8CA 3B6SA 3TJEH 4P46C 4AEEA 2ADFL 4Z7VB 3RWGB 4PRBA 2Y07L 5HVFB 5F70A 4LLWA 1INQB 3O0RL 3E6HA 4G9FD 1YPZB 3HE7D 1MVUA 2CGRH 1T21B 2P8MB 4OCNC 4ETYA 2PYEE 3GSXA 3IFNL 3B5HA 4NKMB 5EUOA 4KAQL 1JF6A 3FONA 1H9VA 2Y36H 3VXTB 4IJ3B 4ZXBA 2XKNA 1X7QB 1U8OB 1WVZA 1E27A 4LF3A 1H8SA 4IIQA 2BSRA 2A74B 4QKXB 5CLWA 1AR1D 4HFUL 1NC4D 3J7HA 3QDME 3MUY1 4PJBA 3TNNA 5ESVA 1G7LA 5C92A 3MUGB 3K80A 3ZDZE 1IC1A 3RL1A 1PY4A 2B8OT 3NA9H 2X9YA 3PV6A 5GGTL 4P23D 3MLTA 2XN9D 4U1HB 4ZUWB 4P46D 2I9LB 4NO2A 4B41A 1QEWA 3IDNB 4GKZA 2B1AH 1R5IB 5IB5A 3FO9B 2FO1A 3U6RA 3CFEB 4BYHA 3DIFA 4CDGC 4QRUB 5FOBB 3LV3B 3OJVC 4HWUA 5J1AB 3TIDB 4LK4A 4K55A 4JO3L 4APQA 4CBPA 2R29H 5D5MA 3CD4A 1K4DB 1WWBX 3IDIB 4L1HA 4U1SB 3QCTL 3I6KB 3P9MB 2AP2A 4Y1AA 5D2NB 4EQ2A 1YN7B 1ZA3B 4NN5B 2AJSH 3I02A 4MNGA 4PJGA 1I9IL 5F88A 4MVBD 3P11H 4JRYB 1AP2A 3MOBH 4MMXC 4MB3A 5EU6B 3UO1L 1JRHL 3MV7D 4NHCL 2LVEA 1A1OB 2F54E 4BK4A 1UWXK 1C7SA 4MJ4A 5F6IC 3LEYH 4TRPL 3VFWA 1RI8A 1QLFA 2G2RA 4KAQH 2FJGB 5DMJB 1M05B 3QEQE 5KSAB 4LLMB 3RWJB 1IGYA 1PZ5B 4ZOAA 2AJXL 2UUDH 5C70A 4OGAC 1BBJA 4XBPA 3RL2A 5HHOB 2Z93A 4OCRH 3MMEA 1D9KB 5IHBA 4JFFB 5FCSH 1JCKA 3JUYA 3FT4A 1LHZA 1JHLH 4HWEH 1QA9A 4YDJB 5FYJL 4MNQB 2OCFD 3TZVB 2A83A 2HRPL 4Z7UA 3SGEI 4GKSA 5HHMB 1NGWA 3ES6A 1HHHB 4RQQA 1LO0L 4X6EA 3LCYA 1YMMA 4XP4H 3BKYL 1T1ZB 4DJMA 3TA3B 1ES0A 1WFUA 3MPCA 1H5BA 1MCBA 3FRUA 2GFBA 1K5NB 1RJZA 1ZLVK 4S0SD 2GUOB 1ED3B 5HHNB 3D0LA 4OFIA 3QNXA 1Q94B 3W82A 4D9QD 2NY4C 4OZGB 5IMMB 1MHHA 1UENA 3T2QA 3MROB 2IMMA 5K59F 1RZJH 1HHIB 2DQTH 3FFCE 5F89A 3ISWA 1XGTB 2P24A 4RISH 1CFSB 1F4XH 4OGAD 5KOMC 4PGBA 1PG7W 4K3DL 4JLRB 3BEWA 5SWZA 1IQDA 4XNZB 4ZPVA 3CK0L 5DJZA 4Q2ZA 3HZKA 3F7VB 3EGSA 4ODVL 5B3JF 3ULVL 5DF0A 3H2WA 5EB9A 1U8PB 4ZUTB 5E5MB 2PTVA 4I9WD 4K94C 1AGFA 4JN2B 5DXWA 1A7OH 3C08H 5DUMH 4RIRB 2Q6WB 5E08H 1CI5A 2BY3A 4ODSL 4P4RB 4Y5YA 1OY3B 4FOMA 3V4PL 1LO4H 1QR4A 3O4LA 2W1NA 4KU1A 2AJXH 2W65B 5GIRB 2A9NH 1MCDA 3B5GA 1T20A 3C8KB 3QPXL 4XMPH 5CJQL 5T5NG 3VA2C 1AQDA 3VD4A 1DLFH 1JGLH 2VTFA 2QHRL 5EZOH 3RX7A 5IF0A 3R0MA 5JW4N 3VFPA 1UM5H 1ORQB 1KELH 1KJ2A 4M4PA 4NQSB 2AGJH 2AXJA 3SE3A 5F3BA 5KZCD 4FQJH 4Z7NF 2J8UB 3G6AA 4HFWB 3MRKA 1HWHB 3BP5B 3LMJH 1I75A 4OCYL 1TJIH 2LU3A 3KWWB 4GRMA 3S37L 5B39B 5ETUB 2FLRT 1T4KB 1RZ7L 4F9PA 2DQFB 4EQ3A 1VCAA 1X9QA 2VSCA 4ELKA 5B38B 1M1SA 1CXFA 4CU8A 1QACA 2RIKA 4AEHH 1CD9B 2DBJA 3G6DH 3H42H 2QKIB 3OPZH 1PAMA 3KGRA 3EYVB 3KPTA 4G8IA 5BW7C 1KIUA 5I8KL 3STLA 4HPOL 1ZHBB 1LNUB 4WU7B 4MDJA 3ULUL 1LE5A 1INQA 3VW3H 2R0ZL 5HHXH 1KULA 1Q8MA 5L2JB 4LHQB 2D7PA 3ZT6A 3CDFA 4UIMB 5F1OB 3V4VH 4CMHB 5BRZB 3GMOB 4XNYH 5GGSA 3MRMB 3QNYA 4O2CB 4N8VA 5ID1A 2OMBA 4RMWA 4NBZB 3ZL4H 3GSVA 4JVUA 2AEPH 1FVDA 4GBXC 1ROWA 3HPJA 3L1OH 2EEAA 5GGVH 1FJ1B 4TSAH 3FQRB 1X7QA 4K7PX 2EZ0C 1AKJD 3V4PH 5D6CA 4HH8A 2Z0BA 1BIIB 4EDWH 1I8KA 1OSPH 4TNWK 4JKLA 5J12B 5CJ5A 5SWQB 4YFLF 3MUGA 4OFPA 4NWUL 4LGPB 5IUSA 1BD2D 2D7TH 1LK3H 3V2AR 3FO0H 2QJDA 4IHOA 4G7YH 2YA1A 5BVPH 2V2TB 4U2YA 2BSSA 3DXAA 5I76A 2I9LA 3QB7C 1OAUL 3EJZC 3CPLA 3P73B 4XZUA 4JGUA 1PBYA 4HT1L 5HVHC 2DQGH 1TJHL 5TDNB 2NTSP 2DIAA 5CCKH 3IDNA 3QHTC 1DL7L 2EDBA 3HC0A 1R5IA 4N0UE 2IFFH 1RZ7H 5CD5C 2BOBB 4QRUA 5I1DA 4LEXH 3LV3A 1YQVL 3TIDA 5EOCH 5CZXC 4M7LL 1J0HA 5C9JA 1K4DA 3IDIA 3NFPA 5DJXB 3I6KA 4OKVB 2UZXB 4WTZG 3RA7L 4DKDC 1HXYA 3P9MA 5D2NA 4HPOH 3UTTA 5GSVB 1YN7A 4P5TA 1RSFA 3IXTB 4A6YL 3ALXA 5C7XL 5L2KA 4Y4KA 3T09A 2FHBA 1RZKC 3P4OB 2UZIL 2B2XH 4MZ3A 4Y16A 1QFUL 3G6JA 2IH1B 4YIQA 3IVKA 1RUKL 4PRHE 1H3PH 2Z31B 1CLZH 4MJID 3EJZD 5IVXA 1DBMH 1JNHA 4U7MA 4LFHD 3MUHL 4PGZA 4OLZL 1TLKA 5I1GH 1MCKA 5J7CC 2IQAA 1P7HL 5CD5D 4U05A 5FYLE 3GMLB 4PV8B 3HUJB 4LVHB 4XNMB 4QLRA 1G1YA 4BQBA 5TQ0H 2EDJA 1WZKA 4MNQA 3UTSA 4JZNB 5DEGB 3ZDZF 2NX5D 2ZCHL 1P4BH 3QCVH 5EORL 3SDAB 4HQQL 1HHHA 4CKVX 4LRNL 4PYGA 1NJ9B 2HVJB 5D7JA 1A6ZB 2Y7QB 1MCPH 4ZFGL 5LGKA 4YO0B 2EDWA 1KCUL 2GUOA 1VESA 2C4XA 4JG0H 2I07A 1KLUB 4JO2L 4DGIH 3VXUB 2X4UB 5MEND 2FHFA 4OZGA 1U93A 1FV1B 1UVQB 1EHXA 3MROA 5F9OH 5IB4B 1Q9LB 2BNRE 3OB0K 3TWCH 1RMFL 3AC0A 1HHIA 1VFAA 1WBYA 2HT4C 3SDXF 1T22B 1XGTA 2IH3A 3CDCA 4I2XB 1LP9A 4U7SA 1IGFH 2CMRL 5F9WC 1CFSA 3TM6A 4JPWH 2X1WL 4WJ5B 3C60C 3U7AA 4M8QB 5M94B 3QIWB 3F7VA 4WO4C 4WW1B 5IWLA 1UM6H 5EUKA 3MNVA 4HBQA 1J8HE 4K7FB 3MRCB 1FVEA 1ZVSA 2LU4A 1Q0YH 4PJ5E 2IGFH 1CL7I 1U8PA 5E5MA 1GYAA 1OSZB 3GIVA 4JN2A 2WAHA 4U7KA 2W38A 4RIRA 4BSWB 1E4XH 1YYLH 4OLZH 3THML 5ID0A 1YN6A 4P4RA 4X9IA 1KV3A 1B3JA 2FR4B 5JZ7C 2W65A 4LQFL 4Z78A 5E8DH 3QEGH 3STZB 2R2HA 3C8KA 4Z8FL 3MRPA 4OQTH 5F1KC 1I3VA 1Y18B 5JDJA 4KDWA 5AZ2L 3REVA 4IOIB 3E2HB 5DD6A 5BVJB 1UZ8B 2GSGA 5C0AE 1A1MB 5C0GA 2YA2A 4F3FA 3RBGA 1WQVT 3SDDA 4B7LA 3I9GH 3KLSA 4NQSA 3VXRD 4RAUB 4TSCH 3O45A 1U8HA 5IKCB 4FZ8H 1IGMH 5HYJD 3QFJB 3FKUS 1V5JA 3QIUC 4I0PC 3BP5A 3MACL 3UDWC 3O6FC 3KWWA 4XP5H 2DQFA 3OMZA 3P9LB 5CJXC 1DUYA 2DI8A 3VGEA 3GMPB 5B38A 1IBGL 3JWDL 1W72B 1SYSB 3K46A 3RDTC 1MHEA 4JFDB 4OI9A 3OSKA 1UEMA 2ZOKB 1K9TA 4YBQC 1Z9MA 5DC4B 4YHYB 5JZ7D 2OJEB 2CMRH 3A6CL 1DQQB 3HFMH 4J3UA 1ZHBA 1NGXB 3MJ9A 4LLDB 5CMAB 1F3DH 5CIPB 4P3CH 1EHLH 5L9DH 4R2GB 5L2JA 4POZC 4PRPB 4A2LA 3GMOA 2PXYA 5HDBE 5D7LE 3EYSH 2J6EL 3MRMA 1FDLL 4YWGH 5D71H 4K3EL 3ZE1E 2JLLA 3ZZ1A 1JV5B 2EICA 2IQ9H 5C2BL 5D1XB 3QIUD 1FJ1A 3H0TB 3O6FD 3FQRA 2H6PB 1L7TL 4APQC 2XFXA 4MA8H 5C07E 1S5HB 5IFAH 1AC6A 1IC5L 3Q6GH 5E2VH 4QGYA 5JW3L 3O41B 1FFRA 5DJ6B 4EXKA 1A9EB 2PTTB 5SWQA 1MI5E 4X9FA 5HDQL 2PW2B 4GS7B 4BZ2H 4ZQKB 4CU7A 5AZ2H 2NZIA 4YBQD 5KG9B 3MC0A 1DSFL 1CIDA 5E24E 4BQ8A 1OB1B 3SO5A 4HHAB 3DBXB 2XNAA 4X4XB 1UACL 3CGTA 2FYYB 4RSVA 5TDNA 5GRYA 5I15H 5I1IH 5L0QB 1NDMB 5E9DE 3FB7A 1XF3B 1PW3A 1BVZA 4LVOC 1L9NA 4CW1B 3PWLB 1JFQL 3O3BB 3D39E 3MSPA 1MLBB 3ARBC 3KPSD 1Y0LA 2BOBA 5MHSE 1IT9L 3MV9E 2EKSB 2VDRH 4X6DB 4TVPH 1N4XL 1CQYA 4X80L 5DC9B 3QXAA 1D5BA 5EN2B 4HUNB 3IXAA 5J13C 1FE8L 1ZHNB 4OKVA 4APQD 3MLWL 4JPIB 1A7NH 1NGPH 2VDPL 4RMUA 5ADPH 5GSVA 3GSQB 2QQKL 1AD0B 2OTWB 1F45A 3OG4B 3P4OA 1PG7L 2D4FA 1E4KA 5FUCC 4J3OC 3TT1L 3UC0H 3H9HB 3L7EB 3ZT7A 2Z31A 4XPBL 1T89A 5TFSL 3TCLB 3T8XB 1DANT 4NKOB 3TV3H 4KHXL 3VXOB 5I1JH 1FDLH 3O81A 1J1PH 4X83A 3IJSB 3O2VH 5HPMB 5EIIB 4KMQA 2N7AA 1UG9A 3CX5K 5CLTA 3QCUH 3QQ4B 1DBBH 1WBZA 1ADQL 2MWCA 1MJ7H 2X1QA 2X1XR 1Z9OA 2AJYL 3GSNB 4ODTL 5DZNA 3RZCC 1JGVH 4XMKH 4AEFA 25C8H 3DVIA 3X3FL 3GMLA 5E94A 3DV6A 3T0EE 4ISVB 2ATKB 3V6ZB 1G1CA 4WV1C 4OKDA 1TVHB 4OD1L 5D7SH 5DEGA 4JFEB 3SDAA 4X8XA 1EO5A 3T77B 1MCJA 3B3IB 4A2MA 4GXUN 2HVJA 4KXZH 1A6ZA 4PJCA 4JFYA 3F7YA 5ICXA 1JRHI 1YEKH 4NQDB 4IRJB 4CVXB 2IBGA 1UQSB 4OLYL 3OF6D 1W72H 4OLVL 1KLUA 5IESL 2GY7B 2X4UA 1CQKA 2GCYA 4S2SB 1FV1A 3SE8L 3KYKL 2C4FT 1U36A 2NY0C 4KKCC 5IB4A 3VGDA 1Q9LA 1IKFH 5K93A 3BPCA 4X6CF 3RY6C 3W81A 2C26A 1T22A 5E56A 4Y4FA 5D96B 4P2RD 3C5ZB 1UWGL 4HF5L 3RZCD 4NO0B 1S9KC 5EO9B 1UADC 3FZUC 5CIPH 2ERJB 1QFWL 4LCYB 4AIZA 1RJYA 5DRXA 4FXGA 3AS3A 4WW1A 3K8MA 5HGGS 2NY3B 5ISZE 2OBGA 3QRGL 2NNAB 3ESUF 4LAJH 5DVKA 3QUML 1TPXB 4K7FA 3BDYH 3MRCA 1AR2A 1DN0B 1I3GL 4F15B 4LSTH 3REWB 4C4KT 1HXMB 2SEBA 2IBBA 5L6YL 2W0PA 4KMTL 1DUZB 2A38A 1Q0XL 3EFDL 3D69A 1ZT4B 5F7MC 5BV7B 3BEVA 2AV1B 4XRCB 2AV7A 1E0OB 2XPGB 3BP6B 1KIRB 1JPTH 2RHEA 3SPVB 2E9WA 1NAKH 1OQOA 4ODTH 4ZUVB 1T03L 1ERNA 4PP1C 3EKCA 5GJSL 3LEVL 1MFBL 3GNMH 3X3FH 5FF6A 1HZHL 2NY0D 5BZWA 1XEDA 1FORH 1CBVH 4EKXA 1NCWL 3LHPH 4NQCA 2X41A 3DX8B 1N6QH 4IOIA 4WGWB 1CGWA 1UZ8A 5HYEA 1A6WL 4NNPL 4JO4H 1JGUL 4NC2B 3FZUD 3D9AL 3U2SB 4G5ZL 1B90A 3PQYA 2DQUH 1I8LA 3JZ7A 2XI9A 5C0BD 4WFGD 2N1KA 3BISA 3OAUL 7CGTA 1FL6A 3SJVA 2L7JA 5FECA 4MQTB 4HWBL 5IJKC 4JHWH 1QLEL 3HAEA 1JE6A 3QHFH 4TQEL 5BS0B 4R8WL 3GMPA 3QXWA 2VLKE 3KYNA 5IROC 1SYSA 4YK4C 2NY1C 4RNRA 3WFCH 1IKNC 5CEZD 2ZOKA 2R0KL 4QTHB 3DGCR 3ZDXE 1TJGL 2C1PB 5DDHB 1VPOH 4MZ2A 1NLDL 4KZDL 3IJYB 5HGAA 2A1WL 1T5WA 1N7MH 3WIHL 1EVUA 1DQQA 3QZWA 3NCBB 2B0SL 2DLEA 1SJXA 5FCUL 2IPKA 1NGXA 4OV5A 4PD4J 1Q9KA 2FECL 4ZFOA 4ZAKC 2D7NA 5CIPA 3E3QE 2Y23A 5C3LD 3RWDB 3UAJC 2YEZB 5KJRH 3KPPA 3HLAB 2HKHL 5DD0L 3VFTA 3K3QA 1V7NL 1JK8B 4L4VD 2A6KA 4GUPA 1RVFL 1UA6H 4IRSB 3NN8A 1RUML 2ENYA 1JZ4A 3GUTB 5SX5K 4WU5B 1P9MC 3K8LA 3GSNH 4M9PA 1FNFA 4XCYB 4YHOH 1UXSB 5DVNA 1N6VA 2UYLA 4HUKB 3GSWB 4O4YH 5DJ6A 2NY1D 1LQSR 1I9JH 1EEYB 3ILQC 5T1KA 1DLHB 5JORB 2PW2A 3UYRL 2V5YA 1K4CB 2EIDA 2BNQD 5DGRA 2WANA 4DW2H 4DKEL 1MHPL 2RB8A 2ATPB 2FGWL 3P4MB 4PREA 4HHAA 3RWEA 2VXQH 1P2CB 3OAYK 3ZHDA 5A2JH 4WWID 1U6AH 2ZZUT 1H3GA 3PXJA 1NDMA 4ZAKD 5LBSL 1UJTA 2FH8A 3O3DB 2ADIB 2EDTA 3PWLA 1ZOXA 4OCSL 4BQ6A 1MLBA 4W81A 1OAXL 3RPIA 4WNQA 1GC1C 1WGOA 2DM2A 2G5BA 3DPBA 3CCHB 4HIEB 7FABH 5FYKL 2Q86B 3U0WH 1J8KA 2NY6C 2PYEB 4LU5H 4Y8DC 1YEFL 3MRFB 4WI8A 4N0YL 1TJGH 1ZHNA 4MMZC 4JPIA 2R1YA 2AKRA 1VACA 4RRPA 3VDAA 1V8HA 2B0SH 5E1HB 1VADB 3BIBX 4L3EE 4NHUA 4JRXA 1EXUB 3QP3A 3ILQD 2ZJSH 4DVBB 5EC2A 4D3CL 2VR4A 1F90H 3S37X 2KUTA 1NC2B 3QULB 3HRPA 5L2KD 3L7EA 4S1SH 1I3RB 3IAPA 5EWIL 5DD0H 1U91A 2LU7A 4Y16D 1H3XA 5BV7H 5JO5A 5FK9B 3IJSA 4XPGL 5D6DC 4ETQB 2COQA 4P0DA 5EIIA 5HPMA 1PYWB 5J6GA 3ZE1F 3L7FB 3O9WB 3MRJA 5EU3B 4OZIE 2EDDA 4FQLH 4O02H 1QNZL 4X99B 1SMOA 5DUBA 2CKBH 3DLQR 3I2CL 5MI0B 1VDGA 1RULL 2EDNA 5E8EB 4EUPA 3ZKXB 4OCWL 4XCFL 3CFDB 1TZHA 1UC6A 2ATKA 3H8NA 2NY6D 1JNNH 3Q3GB 4JFEA 4L5FL 3S88H 3MLVL 1F11A 3T77A 1BX2A 1N2RA 3BKCH 3UTSD 5BZDB 3HI6L 3U0PA 3U9UB 4DEPB 4YPGB 4HUWA 3VXME 4CVXA 5C0JA 1A7PH 1SJVA 4NJ9L 5D7JD 3RGVC 3LRHA 3WJJC 1UQSA 4HUVA 1CFVL 3GMNA 3MLPA 2ZCLH 4S2SA 5F7DA 5I0DA 5LAXB 4X4MA 1SVZA 2F54B 4WUKL 3OKLB 1NMCC 1N64L 1EUUA 1U8IB 4QY8B 1EO8H 4YHZL 2VWEE 3UJIH 4X7TB 3MRGA 1IGTB 2JB6B 1LILA 3WJLA 1CGSL 2KZ1B 1CDBA 1IEAB 1X5LA 2IBZX 1FSKC 5FHBL 4OFYD 2AEWA 2ID5A 1HH9B 3I3DA 3ARGC 3CSYA 3VGFA 4XBGB 3F62A 2QSTA 1D5XA 1WZ1H 4UNVA 3QUZC 1FNEB 1Z3GH 1QR1A 1AQKH 4LGSB 5BXFB 3MRQB 5FA3B 3V7MA 1WC7A 2E27L 2X4OB 2ZSVB 4NRXB 1HXMA 2M8XA 4P2QB 1U8JA 3Q0HA 1I85A 5I73B 1KIQB 2GY5A 5GS3A 1UCTA 4P4KC 4NNYA 3U30C 1ZT4A 2BVEA 2GJ6E 1F58H 2NCMA 4Z77B 2P5ED 1QOKA 1G7PA 4JQIL 4D8PB 5SV3A 3RGVD 4WTZA 2XPGA 3BDBA 3BP6A 1K8DB 4ZUVA 4HIJA 5E6IC 3PHOB 2CKBA 3U0TB 3LN5B 2KZWA 5AZEL 1CVRA 1J05B 5E4EB 2EC9U 4DUWA 3DX8A 4ZTOH 5EZLA 5FUOL 3FB6A 5HJ3B 5IHUH 3PWVB 3FFCB 2NY2B 4L5FH 1D6VL 2DYPB 3OKOB 2JIXA 1BP3B 3UTQB 3U2SA 1KTKE 3L3GB 2Q76B 3SDDD 2V5TA 4XGZA 4OJFH 5CWSA 3P77B 5J4MA 2XA8H 3LSOB 3QG7L 2X1PA 4K71C 2J3SA 1U3HC 1X6NA 5ITBL 3CU7A 5BS0A 2YWYA 1OGAB 3NPZB 3VXQA 4OD3H 3NGBC 3HCVB 1LO2L 4L1DA 5ALBL 1S7WB 2ICWB 4WW2C 2HLAA 3WLBB 5LCVH 4WUKH 5EU4B 2AI0H 3X3GH 1SJEA 1OAKL 3ELAT 3IJYA 4FQIL 5C8JA 2GK0B 1MFCL 4HDIB 4YHZH 2E9IA 1R3LA 3TBYB 3W0WD 4E5XB 1P4IH 2VLJE 3CFCH 1FC2D 5E6ID 2J1KA 2QHLA 5DRWA 1G9NC 1HCVA 1MFEL 3MV7E 2DQDH 1IJ9A 5F7NC 2CDGB 2H2PD 1PFCA 5LVEA 4NSKB 5HGHB 2XZQH 5BO1L 4QRSB 4BFBD 1UGNA 4LP4A 2PXYD 3GUTA 1SHMA 3W9DB 3OV6A 1EJ6A 3DARA 3TVMB 4ODWB 4MHHI 2VUYA 4Z7OF 4CGTA 2VDKL 4BELD 3GBML 3U83A 2E7LA 4EI5B 1T1WB 4XCYA 1IGIL 4UOW1 3AB0C 3M07A 3GSWA 4D9LH 2XYCA 2HH0H 3DMMC 2B4CC 1O5DT 4UILL 5HYSA 1BWWA 4XPFL 2FD6H 3O6KL 1CXLA 1DLHA 5JORA 1XF5A 4R7DB 3PGDB 32C2A 4L8SC 2ATPA 4NC1E 5TF1H 2AJZB 3P4MA 5INDB 3NIDF 1KN4L 1P2CA 2E3VA 1D6VH 4MLIA 3MRDB 4WWKB 1MRCL 4ODBD 4HUXA 4D94A 4N90E 3O3DA 3C2SA 5JHDE 1IC7H 1EHNA 2HLFC 3GZKA 3RPKA 3CC5A 4F80A 5IVOA 2XXCB 3QEHB 3CCHA 3KPQB 3WFEH 3WEXB 5EG6C 4TTGA 1ITBB 5IBTH 4MDIA 4B50A 3DX7B 3FMGL 4POUB 2NXZB 1KTRL 3MRFA 4L4TE 4AJ0A 1T66C 3FTGA 3ZDXF 1MFCH 1QBAA 1YEIH 4WDIB 4DZ8B 4GG6E 1CFNB 2FX7H 3DMMD 4WI9A 1U8LA 1MFEH 1AIFA 1RUAH 1NC2A 1EV2E 4UQ2A 3KVQA 4UT7H 1HOCB 3FOLA 1N5YH 4X5XB 1NGYB 5DD3L 4FP8L 4XCEA 1EAPB 5C3TA 3WUWG 2O5YL 4ETQA 2J8HA 4R90L 3GK8H 3O9WA 2IG2L 2HLFD 5FM4A 5EU3A 1WWAX 3OJDA 3DX9B 2F53E 3KLAB 4ZFFB 5BMFL 2L4OA 1WCBB 1AHWA 4NWTH 4JY5H 5EBWA 4TPRL 3LN9A 4Y4FC 3EBAA 3CFDA 1G9MH 1WCQA 1P53A 2EE9A 3IFLL 2Z91B 3SKNB 1T0MB 4S1RH 3Q3GA 2KH2B 4UV4L 1T66D 5D7IE 3K8KA 2HFEB 3P0YL 3TF7C 1RK0B 5KVMC 5IM7B 1JZ6A 1CDJA 5DLML 1MRCH 4RMVA 2Q8BL 4YPGA 5FGRA 3EYOB 1KB9J 1A7QH 1R3IH 4LSVL 3OAZK 5KSUA 3UBXI 1A1NB 4ONFL 1U9KA 4HK0B 1T04A 1BBDL 1Y6MR 4FFZL 4PRHB 2VLRA 3DURB 3KPRB 2WBKA 3MRBB 3EDEA 5MEQB 5GRXG 2WBWB 3FN0H 4HS6A 4QY8A 3FMGH 2WP3O 1IGTA 1HQRA 2E9BA 1V7MH 4PGJA 3ZHLA 1F2QA 5E5RB 1IEAA 3BGAA 4Y4FD 4UAOB 2OQJA 3VDCA 43CAA 1PX4A 1DQTA 2IPTH 1G7QB 1A3LH 4BH8A 5L8JB 4XBGA 5FGCE 4NZJA 5TDPB 4XPTH 1FNEA 1RURL 1J0ZA 2VZVA 5BXFA 4KFZC 2X4OA 1RIVH 4NRXA 1C5DB 4P2QA 3B9KB 4TUKL 2BVPB 4FP8H 1EFXA 3NPSB 3IS1X 1NUGA 3H3BC 4GMTL 4D8PA 2O5YH 5KBNC 4Z95H 1ZE3C 3IGAB 1QFWM 1K8DA 3QIBC 5HPOA 5CGMA 2YPKB 2F8VA 4G80A 1BEYL 2GTZB 4OZIF 3INUL 4ORZC 3SY0B 1CGXA 4HGKC 3S3PA 4WI3A 1LK2A 3U0TA 3LN5A 3RWCB 3BAEL 5KSBB 1JZ2A 4TPRH 3WIIH 1PG7X 1J05A 4MJ6A 2FZ3B 3L95B 4FS0A 5HJ3A 2E7BA 1CDCA 3W2DL 4TTDD 1QFWI 1SEQL 2YBRA 4NQCD 3WSQL 3OKOA 5I30L 1IMHC 3GKWH 3UTQA 3T65B 5F3HB 3L3GA 4JREB 4EVNB 2WUBH 5GXBB 3T08A 4DGYH 5DLMH 3EOYG 4PP2A 3LSOA 1IQWL 4DN4H 1X4YA 3BGFC 3CFKB 4ONFH 4DWHA 1OGAA 4NOFA 1DBJH 4XWGL 3BGMA 3S8WA 3HS0A 5GGUB 5EU4A 3Q6FB 1MLCB 2FHCA 3TO2B 4H25B 4LSPH 2FEDD 3MRLB 3L5JA 5DQDH 1JUFB 1I1AA 3TBYA 2OZ4H 4P5MA 3S36H 1ZEAH 5ACZA 4M7KL 2NY5L 3ARDC 5FYLL 2P5WA 4CADB 3LKPB 4XP9H 2VZTA 4OM1L 3MXWL 3UZQA 3DSFL 5ICYA 4I18B 4MAUH 4PJ9B 1HI6A 1BOGB 5HHVL 5C0AB 4KGJA 1JNJA 1P7QA 2X42A 3LKSB 4GQ9L 5HGHA 2CD0A 5I1EL 4TSBL 4LCCA 4QRSA 5GPRA 2WBJA 4QRRD 4AM0B 3HNTL 3MJ8A 3N1PC 3W9DA 4S1QL 5TDOA 5F6HJ 1J12A 1SYVA 3PGCA 5IFHH 4NDMB 2VZUA 3S35L 1KB5B 4ALAL 3I6LD 3INUH 4KTDH 2DQJL 1CE1H 3BAEH 2LFGA 3BO8B 3V0AC 4R7DA 3CVIL 2R4RH 1W0WA 1ZANL 5LWYL 2GJJA 2AJZA 4F7CB 1NEZG 3K74B 5I71C 4PG9B 4LPWA 4FQHA 5JPNA 3MRDA 2PR4L 5TGBB 4IMKA 2WK2A 4NFCA 1IE5A 2CSPA 4D2NA 4Z76B 5JXAL 5M95B 1IQWH 4WFFD 3SGKC 4D9RD 4U6YA 2JK5B 4LHUD 1TZIB 5D7LB 5FEBA 3KPQA 1V05A 3WEXA 1KCSL 4JZJA 1EJOL 4V1DA 3PWPB 3WUZA 1F6LL 2VLMD 4O51B 3DX7A 4KTEH 3ALPA 1NUFA 3VGBA 3HTLX 1KT2A 1HHJB 1A8JH 4Q9BA 5C08A 1N0LA 4DZ8A 3VWKC 2OZ4A 3IDMA 5C07B 1CFNA 1T2QL 4WUUA 1ETZA 3CVHB 3DVFA 4XAWL 3EOAB 1MI5B 4XI5C 4E9LA 3QO0B 3LS4H 4GAYB 5ACMA 2AQ3A 4U1KA 2VH5H 4LLYB 4PJIB 5I16B 1E6OL 2M2DA 4YHNB 1NGYA 4M61B 3MLUH 4GQ9H 4P2OC 3HKFA 4TSBH 3G5VA 1PY9A 1MY5A 1QRND 4F7EA 4KJQC 2AK4D 3VXPB 4RGMB 1KB5L 3LKQB 3MNWA 3KXFB 2XWJB 4WHYG 1NLBH 1CXHA 2EE3A 5SWSD 3DX9A 4I13B 3KLAA 4ZFFA 5FM8A 1WCBA 1N0XL 4PRIA 1H0DA 1G7IB 5HYFA 3SKOA 4F57H 2Z35A 3HRZB 1T0MA 2ESVD 3BPNC 4R4BB 3V8OA 3NABH 4FTVD 3T4AB 3SBWC 4M6ML 3X11A 1GVIA 3EHBD 4K8RH 4L3AA 4NBXB 1MJ8L 5I1LB 4Q6IC 4XI5D 3BZ4B 1NAML 3QWQB 4JE4B 4XHQA 4HK0A 4JR9H 5JXAH 4NPYA 4N68A 2ZKHH 4B0MM 5I9QB 2AJVH 1KEML 4U1GB 4ZUUB 4O58L 1NFDB 4P2OD 1YEHL 2DWEB 5ESQA 5HI3C 1NCNA 1LEKA 4HIIB 3O8XB 3U4BH 4KC3B 2HRLA 4NNXB 4JVPA 4KJQD 5I8CB 4MX7B 2W0FB 3T4YB 4PY8J 1WAAA 3MLRL 2Y4SA 2CK0H 2Y25A 5KVEH 1DEEA 2H26B 5MP6H 2YPVH 2Y5TB 5SX4I 1CLYH 2Y9RT 5INCB 3IU3A 4X0KB 1G7QA 4GG6F 5TH2A 2WW8A 1SBSL 35C8H 4QYOA 3QA3B 4LCUA 4WI6A 2AQ1A 5T1DH 3HMXH 4KPHH 3VMNA 2IANA 1LO3H 5HD8C 4HKJB 5F7WC 1CDHA 5D93C 3OHXA 1VHPA 1UH3A 1KB9K 3CXDL 4XC1L 2N4IA 5CZVL 2W9DL 3PP4L 4DK6A 3N1MC 4L8BB 1KB5H 2E5EA 4JFZH 3DRQB 2CLVB 2P49B 2YPKA 2YD3A 4PJBE 4XP6H 1NCCL 2GTZA 5KSBA 4DCQA 1N0XH 5T1LD 1BZ7B 5HI3D 2X1OA 2ADJB 4YGAB 4L8CA 2FZ3A 2OTUB 4LSUH 1RZGB 1MFDL 2WSKA 3CZJA 4HULB 2B1HH 2DLFH 3K2MC 4QXGL 1OAQL 5F3HA 5E99H 2F5BH 2DB8A 4I3RL 5C0RL 3WUWB 2ENSA 4ERSH 4EVNA 4U31A 5IOPB 1CICA 4PJFB 5F7EH 4PJ8C 2JIXD 5H2BA 4RBPK 5C9KA 1RIUL 3AS2A 4LLUA 2XQYG 2BMKB 3X14A 3CFKA 1I1RA 4JHBA 1OF2B 4DOHE 5GRJH 2D9QB 5HD8D 4G6FD 3BT2L 4O58H 5D5ME 3PWNA 3V4UL 5GGUA 1YEHH 4PRAA 1MIML 5T3ZH 4PTTA 3Q6FA 1T2XA 4N9GA 2JF1A 4Y1AE 2FB4L 5GS0H 1JUFA 3VD5A 4NYLB 5CHNB 3MCKA 3H3PL 1BFOA 1FO0B 4OB5L 4CADA 3LKPA 5B21A 3CVHH 4EI6B 1AY1L 4PJGE 5IW6B 1DVFB 1D5IL 3PE9A 2MHAB 1KCVH 1FIGL 4M48L 4BUHA 1RJLB 2APFA 4MCZB 3TBVB 4Y5VA 5C0EB 5GRZA 1SBSH 2CDEA 4QOKD 1EPFA 3T2PA 5IG7A 3JWNC 4PJ9A 3MLXH 1QO3B 3LKSA 5I1AA 3S5LA 3HMXA 4AM0A 3LRSA 1JPFB 3U36B 4S0TD 4HS8H 4PJ8D 3BFOA 1ZWIB 3EJYC 4LHJB 4NDMA 1HHKA 4PLNC 1B4JH 3NH7L 3W5MA 4HKBA 1Y6KR 4HV8B 1R24B 4Q58C 2AEQL 3VXSD 3L3OB 2VLKB 1LEGA 1KXVC 1ZXQA 2HT3C 4XPHH 1IGCH 5E7FA 2BZDA 1BM3L 4Z7UE 2MJWA 2YHGA 4KJYB 1WZLA 2NTFB 3WN5B 4PY7A 4NM8H 1P7KB 1TCRB 3WFDL 3C5SB 4IM8A 4IDJL 1MFDH 1YMME 3OB8A 4JFXB 4PG9A 1KOAA 5EO1B 3R06B 1GJIA 4PJEB 4E41A 3EO1A 3SQOH 3LQMA 5C0RH 1OTUC 1F4AA 4LLVB 4LCIH 4Z76A 4P3WA 3D5OF 1HCFX 4UOW0 1PKQB 2K9UA 1R3JA 2JK5A 4MB5A 3QUXA 5CSGA 4OLUH 3PP3K 2OP4H 4P9HC 3SDYL 3V5KA 5LQBL 2F8XC 2XWBB 3PWPA 4NKIH 3V4UH 1AHWC 1OD7A 3EJYD 1KN2H 4URTB 1HHJA 4U49A 1U95B 1GOHA 5SWZE 1JWMA 1XCTB 2OL3A 4MAYB 3KYAA 3KHOA 3CVHA 2HT3D 3EOAA 4F58L 1ZLWH 4QHLB 1FIGH 2YUXA 4FNLL 4YBHA 3QO0A 5C71A 4MJ5B 5I66B 4HWNA 4PJIA 1Z2KA 5I16A 3UCRA 1JL8A 5AWNL 1HINH 2R4SL 5DMIL 1INEH 1C5CL 2DOCA 3GJEB 3ALWA 2IAMC 3PDGA 3QXTA 5CP7A 3G9AB 3P0VH 4J6RL 5KOVC 2VIRB 4OF3A 3VXPA 3O4LE 3PNWB 1OTUD 3LKQA 3QAZB 2XWJA 3VFGH 5TE4H 5AAWA 3W9EA 5IGXL 1IVLA 3NH7H 2H9GB 2DDQL 1ZLUH 4W4NA 4CVZB 3SKMA 1C1EH 2F74B 2VLLA 1GIGL 3M8OH 3QI9C 2AEQH 1G7IA 5I74C 3WKML 3KNBB 4R96B 3LQAL 1MWAB 3B9AA 4E0RB 4WFGE 3VFVA 3MRRB 4CNIB 1F00I 1GSMA 1I9EA 2H8PA 3WFDH 1QBMH 3QISA 3DX6A 4EN3A 5I1LA 1YEDB 4NN7B 3MA9L 1VGKB 1CD1B 5E2WL 4YDKH 1TQBB 1PEZA 4KHTH 4ZUUA 5GZND 4UOJA 1NFDA 1VFBB 2DWEA 3F5WB 4HIIA 3O8XA 4YDLB 5C0IA 2O5XL 2W0FA 3T4YA 5A40E 3UPRA 1BZQK 1F6AB 3IYLW 4DZBB 1FO0H 3A0OA 1KACB 1NEZB 2C5DC 2XRAL 4OZIB 2YSSB 3VCLB 1GGIH 4GRLB 3QI9D 5F71A 3JVGC 4QXUH 4X0KA 3VH8A 1T1YB 3OZ9L 4LSRH 4Y5XB 3X17A 4UT9H 5DK0B 2ZG2A 5D72H 4FNLH 2CPCA 1Q72L 4X4YB 1M7IA 3MGAA 4LQ1A 1QSEA 4QWWC 2R4SH 3U1SL 3MO1B 5C86A 4LVNB 4OCXL 1WIUA 4GRWF 5JQHC 3O3AB 1ZA6B 1EFXD 3CAFA 3VXMB 2CJUH 2X44D 1MCWW 1X5HA 4LFHG 5IGXH 2DDQH 5JW4M 3CFJB 1XF1A 3QBTB 5D1QB 4U1NA 2R0WL 1BZ7A 4BFEA 1PLGH 4RFEB 4DQOH 5I17B 2ADJA 4W4OA 1R3HB 5DSCB 2OTUA 3CMOL 3DGGB 1RZGA 3DXAE 4NQEA 4N5EC 4ZNCD 4G9FB 4G42B 4E42A 1ORSA 4ORGB 3U7WL 4K3JH 3HE7B 2IPUK 3V52L 4YUEH 3WUWA 4ODUA 3RVWC 1I8IA 4PJFA 1XF2B 1KPUA 4LCCC 1Z9LA 4PTUB 1TNNA 2BMKA 4IMLA 3H9SA 5HGBB 3CUPA 5E2WH 4QWWD 1OF2A 4JFOA 4N0CD 5HGDB 3IU4L 4EXPX 4I5BB 1LO5B 2V2XA 4HLJA 4DFIA 4CN1A 3OWEA 1XZ0A 1NC4B 3UBXA 1YC8A 1FFOB 5D2NE 1HYRC 4U0RB 3UTTE 3FQTA 5CHNA 1YNKH 4KY1L 5IHZA 1FO0A 2WNGA 5L2KE 4XP1L 4ZSOB 4EI6A 2VZ3A 3VMOA 4L3CB 1G7MB 4P23B 5MERB 5IW6A 3FRPG 2MHAA 2XN9B 5HYQB 4NBYB 3MRIB 2AABL 1C12B 4P46B 1M71B 2P5WD 1FL3A 2V2WA 1RJLA 3G6JE 3O6MH 4MCZA 5C0EA 1WSST 5EU6E 4BQ9A 3B9DA 4ZG1A 3BZFA 4XVJL 1JWUA 4OAWB 5IVXE 3EOBB 4N5ED 5C09D 3MNZB 2APBA 1QO3A 4Q9RL 3QWOB 2R0LL 4UQ3A 3GO1L 1W0YT 3MRNB 1JPFA 4AEIL 1M6OA 3DI2B 5JTWA 3MV8D 3TN0C 1P7QD 3NCJL 3RVWD 1U41A 5L8LB 3MOAL 1CFTB 1I7TB 2WBJD 4BH7B 2DLHA 4KUCD 5EPMB 5FYJD 4NFBA 3ULVC 1I9RH 5ERWA 4JFFE 4YHLH 3TIEA 3RVVD 1R24A 2GSIB 2YK1L 3FOMB 2Z8WC 1CDUA 1LDSA 3TESA 2AJUL 1MWAH 4MNQE 3UTSE 1QSFA 3PHQA 4PJ7F 5HHME 3WN5A 1FPTL 5GHWH 1D9KC 4NJAL 4UINL 1P7KA 1TCRA 2YPLA 2NLJB 3C5SA 1UKSA 5GGRB 5D1ZB 3ROOB 2BXYA 3NBNA 3FAWA 3B83A 3R06A 4X7CC 1ZV5A 2LE9A 4YH6A 3TZVC 3V52H 3QPQC 4U1JB 5C0NC 1J1OH 3NIFE 3MV7B 2DM7A 4AL8L 1OAYL 4ZOEA 4UI2A 4FQPA 1INDL 4OZGE 1BAFH 1KG0B 3OGOE 2MFNA 2CKNA 2R1WB 1TZGL 3AAZB 3QUMA 2XWBA 1FG2B 1NMAL 2V6HA 1S3KL 4JRYD 3TN0D 1LP9E 3IDXL 5CGTA 5TE7L 4BSVA 2QV2A 2VQ1A 5D5MF 5EA0H 5F8QC 5C6PB 4RGNE 1XCTA 3ULVD 1YY8B 3K4ZA 2G9HB 3TCXA 4MAYA 5J57B 1A0QL 4L9LA 1JMZA 4KKLD 4KQ4H 4ZFZB 2AS5M 1CN4A 4QHLA 2Z8RA 4DFHA 4PJGF 2R8SH 5I66A 2CIKB 2YS4A 4WUUD 1D9KD 1JZ7A 1D7FA 5FXCH 5DRNA 3MBEA 1HIMH 3V5DB 3ULUC 2DD8H 1F42A 1WTGT 4Y19A 5C0ND 3QPQD 2B7DT 1B0GA 4YDIL 2K7PA 2ZP0T 5JHDB 1TVBA 2YD8A 1X5KA 3L9RA 4JHAL 3MTRA 5F6IB 2H9GA 1WFTA 5JW4Q 3BHBB 4QNPF 1S9VA 2GTWA 4MWFB 4HWBA 5I1HH 3PGFL 5DI8A 2AJUH 3GIZL 1PX3A 1MWAA 2FIKB 3TO4B 4ZODA 3SOBH 3T0AA 3SE9L 4D0CB 4X8JB 2NYYC 4JDVA 4NJAH 3WS6A 3KR3L 4XCNA 1BFVL 1PSKH 3WIHA 2YD6A 3L3KA 4FZEL 3MJ6A 2DAVA 4H8WL 5ECJE 2VQTA 4AL8H 1OAYH 4ZO9A 5A1AA 3S35X 2DS4A 1A2YB 2DQEH 4IS6B 3QYCA 5GJTH 5D9SA 4LCWA 5IB1A 1I3UA 3O11B 4O00A 1A14L 2CIIA 3ULUD 5DD1L 4JM2F 2R2BB 3L3DB 5JUEL 5CJBA 4M7JH 5ITFB 2NXYD 5GZOC 5SX5H 4DZBA 3IFOB 2X4TB 1JHKH 4NO3A 1NEZA 4X6BB 1L0YA 3Q1SH 3D25B 1YNTB 3BIKB 2R1XA 3LKNA 1T1YA 5HTSA 5LG1A 4Y5XA 5BRZE 1YMHB 5LGHH 3S96B 5DK0A 4BJLA 4M3KB 3MLYL 4X4YA 2V5SA 2N56A 1S8DB 5SX4H 5D7IB 1AO7D 3GJFK 3BP7A 3MO1A 1YECL 2VDQL 3VRIA 5EBGA 2IAND 4QRPA 1AXTH 4CMHC 4WEUD 4QCIB 2WUCH 1Q1JH 2YKLL 3D48R 2F58L 5BOZG 3X13A 4LNRB 1IAOB 4UDUB 3BYYA 4Q97A 2VISB 4CAGA 4LKCA 4ZD3H 2G60H 1RHHB 2LQRA 3CFJA 3N06B 2X4PA 1HHGB 4OIAA 5I17A 1R3HA 2J8OA 5DSCA 3DGGA 8FABA 1NBQA 2C1OB 2BXZA 3MFFB 2VOTA 1ZTXH 4G42A 4LSSL 4KV5E 4JN1L 4HBCL 3HE7A 5FKAB 3VE0B 5GRWA 4M43L 3STBA 4XVSH 3MV11 3V0VA 4M6AA 4ELMF 5DMKB 4MYWB 2QSCH 1XF2A 1OP5K 1JYXA 3SCMC 3E6FB 3KYMB 4JY4B 4PTUA 4KVCH 4PJDF 1DQDH 4UTAL 1CICD 2Y06L 2VZ1A 5CAYB 1GAFL 1YQ2A 1C7TA 1A14H 1IGJA 1K6QL 4I5BA 3NAAH 4P49A 1AKJB 4G6JL 4YHPB 1NC4A 3VRJB 5JLZA 3LN4B 1SM3L 1RZ8A 3A67L 1BD2B 1TTUA 2WIIB 4Z7VF 1H3UA 3JV0A 4Q9QL 5HYQA 5E6YA 4P46A 1YPZF 3P4NA 4OAWA 3FQNA 1N8ZA 5IQ7L 5T3XL 4PYHA 1BGXL 4NQVA 1NEUA 3QWOA 1OM3H 4FQ1L 3UPCA 1LD9B 2Q1EA 4JDTH 1NANI 4HIXH 1CFTA 2YD5A 1KFAH 4BH7A 4C56D 3SCMD 4DGVL 1CDGA 1LEIA 5J11C 2F58H 1W2KT 2GSIA 4MNHB 1UCBL 1KUMA 2UY7A 5DHYB 4FA8A 3T0DA 1BWMA 3SQBA 5HYIA 1G84A 4I3GA 2IALB 1IM9A 4QXTB 2C3WA 3MCLL 3KJ6L 3UJTL 5EU5B 4M62L 3G5YB 4WFHE 2DICA 3C5JB 4M93C 3H7LA 5BQ7A 1WK0A 4U1JA 3G9VA 2CK2A 1S7TA 2DTML 3P9WB 4HMCA 4YBLB 3MZTA 5HVHB 5DUPL 3AROA 3VXUE 3ECBB 4E41D 4HMDA 3JTTA 1A6TB 5IK3B 3OL2A 1ND0B 4Y2DB 4UTAH 4U1MA 3N9GH 1IAKA 2R1WA 3MYJB 4TVPE 2PYFB 1U2CA 1W0VA 3F58H 1I7RB 5DC0A 3SGDI 1QSZA 1K6QH 1A21A 3O3EB 2H1PL 4OSUH 1BQLH 1HK6A 2W59A 1F8TL 3GHBL 1UB6A 5I18H 3BSZL 4LASH 4UB0L 1S5IL 1MCLA 2FWOB 3JWDC 4OGXL 3BPOC 3P0GB 4ZNEA 1QYGH 4FQXB 1OGTA 4Y89A 5DQJB 1XGQB 2NX5B 5CBAB 1UEYA 1IAMA 2CIKA 4EN3C 3SDXA 3H9ZA 5L88L 2CRMA 1ONQB 1S7XB 5IQ7H 4I8DA 1EX0A 3QIWC 1BGXH 4XTRC 5IVXF 4M1GH 1AGEB 5CINL 5FV1L 1CVSC 1T6VN 3D18B 5JR1H 5MENB 4NZUH 1CDYA 4K94H 2BC4A 2W9EL 5DWUL 4ZS6C 3RU8H 2NW3B 3HC3L 3IETA 3NZHH 3DTXB 1KTDA 3MREB 4QHKJ 4FG6C 4N8VG 2A77L 5DS8B 4UUJB 4ZTPL 5ACLA 3BVNB 5KVDH 4KK9C 3RRQA 2Q8AL 4P3DA 5DJ0B 4GXUM 4QF1A 3WHXA 1A6UL 5DJ2B 5H35A 3ME0A 5FUZL 1OPGL 2VABA 1CXEA 2NW2B 4YQXH 3PQYE 4PLKD 2XZCL 3QEQA 4DVRL 4DUXA 2OJZH 3QFJE 3BWAB 3SJVE 5B8CC 2KL6A 3GMRA 2YMXL 1JNLL 4EN3D 5F8RC 1AGBB 4U6XB 2ZOLB 5IFJB 1D5ZB 4IS6A 1DJSA 2X4SB 1RFDL 3OR6B 4JFDE 4KJPC 4XTRD 1SQ2N 1T3FB 3ET9F 4BKLB 4OZGF 5GRUH 3UTZA 4PRNB 2RBLA 3VA6A 2R2BA 3IF1A 4YX2L 1VEMA 2HP4A 4PS4H 2VXUL 1BVLB 3FT3B 1N5AB 4ZS6D 1LP9F 5C0DB 1KCRL 4XVTH 1CLOL 3QG6B 2VAJA 3AXLA 4FG6D 3D25A 2OR7A 5DVMA 3JTSB 4NKDB 1WIOA 2BVUA 3BIKA 4G6AC 4CVUA 4PRPE 4KK9D 1QBLH 1H3WM 3PL6C 4JVWA 5I1KH 5EFIA 3MUZ1 5L88H 1S8DA 3OXSB 3KPOB 4R3SB 5HYJB 4FQ2L 3MV01 2ZUUA 3WNKA 2VE6A 5CJOL 1XGPA 4R2GC 1Z5LB 5ILTL 3KYOB 4QCIA 4GQPH 2EIZB 3TH4T 5DJAB 3FB5A 4QTIH 1EBAA 1GZQB 3WO4C 1MCOL 1JF5A 2EXWC 4HWZA 3GRWL 2IC2A 2OX5A 3Q5TA 3TP4A 4HKZB 3U4EB 3QQ9C 4KJPD 5I6XB 1RHHA 5D1XC 4Z0BH 4YXHL 1B2WL 3ZE0E 2I5YH 4F8QA 2A77H 5EU7E 4I48B 1KJMA 4N0FA 2HKFH 3D3VA 2ITCA 4MD0B 2JCCB 4QT5B 5E00B 2Q8AH 2WINA 5KTEL 3MFFA 3B6SB 2OK0H 5TE6L 3C6LA 3HNVL 1UYWL 5FUZH 4PRBB 4WY7L 1KYOK 3OKNA 4XBEL 5FKAA 4HC1L 4LLWB 4GS7C 4NQED 1FYTD 3MBXL 5DMKA 2GK2A 4PBWD 2J8UF 1ZLSH 1MVUB 3PL6D 3E6FA 4JY4A 4WFEE 2PUQT 2YMXH 1NGQL 4CUCA 1CXKA 3FN9A 2ZCKL 5L0QC 1OARH 3ARRA 3QIUB 3TYFB 1QHPA 1KEGH 1KBGH 2H3NA 1SY6L 3CU1A 2RFXA 1MPAL 4R2GD 3ZTNH 3A6OA 4MA1C 1DQMH 3H9SD 3I75A 5EUOB 1AKJA 3MXVH 4AMKL 5IV2A 3ZDYE 3FONB 3S34L 3JWOL 5JOPE 4ZXBB 1RQ5A 2VXUH 3OKMA 2BSRB 2EXWD 1BD2A 1KF9B 1KTLB 4JRXE 5BW7A 3QQ9D 4PJBB 5ESVB 5GS2D 1G7LB 3MODH 2CUMA 3RL1B 4LPUA 3NFNA 4R4FL 3PV6B 4ACPA 5T5FL 1CXIA 3MLTB 1RZKH 3T3ME 4N0RA 1B0WA 4NO2B 4OIIL 1X44A 4GAJH 1LD9A 4F2MA 4GKZB 4LSQL 5JNYA 1YEGL 2E9JA 3U6RB 1WICA 1JI1A 3B2UC 2YR3A 1OWRM 3OAZH 4JPKL 4GBXA 5FB8B 4TULL 2X89A 1OHQA 3GRWH 4ONGL 1NBYA 3LKRA 2E6PA 2XV6B 4M6OH 4APQB 2QQNL 4JFEE 3U46A 1MEXL 4PG2C 1HSBA 1ZGLM 3KPNA 3U7YH 1JBJA 4Y1AB 3B2VH 5TE6H 4EOWL 3WDHA 2J4WL 4WY7H 4H20L 2ZG3A 4WGVB 2YPLD 4MJIA 3I02B 4MNGB 5KSVA 3MBEC 1DQLH 4OUUB 5JPMB 1MCQA 5K9QI 2JELL 3B9EA 5F21B 4X4ME 3S4SA 1S7UA 3ARXA 2R69H 4PGDA 3TPKA 1SY6H 4IRJC 4LKXA 1I7RA 1JGDA 3TNMA 3VFWB 4GO6B 2G2RB 4AMKH 1IGYB 1JPGA 2IPUG 2AQ2A 3B2UD 1BBJB 3RL2B 5JHLH 1H8NA 2FWOA 4PY8I 1D6EB 3R1GL 5JA9A 5J13B 4B7IA 5DQJA 2NX5A 3FT4B 3TBSA 1DDHB 3C5ZC 4X6CA 5K9JL 1MF2H 2A83B 2YOCA 3MLSL 4ODHL 2VXTH 4Z7UB 2FATL 1S7XA 3ES6B 3VFOB 1YEJL 4RQQB 1FAKT 4GXVL 1ZT1B 4X6EB 1YMMB 1CTNA 4D0BA 3MBED 5AYUL 5MENA 4ZUSA 1UWEL 2FO4A 2AK1H 2GFBB 2XQBL 1RJZB 3BH9B 4OFDA 4Y19D 4JFHE 3D0LB 5EC1A 1YJDL 3PIQA 1MHHB 2FIRT 4UUJA 3C6SA 2R15A 4P2RB 3HC4H 2MQ0A 4BZ1L 5J1SC 2QQLL 3HUJF 5F89B 5DJ0A 2HWZH 5SV4A 2EEBA 1MEXH 5F1IB 5GGQH 2K1MA 2NW2A 1NCBL 3OKKB 4WV1B 1J1XH 5DJZB 3WDJA 3BWAA 3GMMA 4Q2ZB 4ZO8A 1A6VH 3C5ZD 4R4ND 2CGRL 5C1MB 3EGSB 5BS0E 4U6XA 1F3JA 3EDDA 4JG1H 1VA9A 2WIMA 5TPWH 3AS0A 4BKLA 1AGFB 1WV7T 4PRNA 2Y36L 1E6JH 4LCWD 1BVLA 2UUDK 3O4LB 2NY0B 4NQXA 1EUTA 5C0DA 2IEPA 4GLRI 1CTOA 1T20B 3QDJA 2XTJC 1G6RA 3JTSA 4NKDA 2EIBA 3MZGB 3NA9L 3UTPD 2I24N 5FAAA 1I7ZB 3C60A 3VXRA 4J7RA 1CZ8H 3RWIA 3V79C 4JY6A 1A6AA 3KPOA 5C0BB 1KJ2B 5HYJA 4HK3N 4WO4A 1XH3A 4MSWB 2G5RA 4Y88A 2X9XA 1WIPA 1EVTC 3RP1A 2B1AL 5IW1B 5AUMA 2J88H 3CIQA 2PW1B 3MRKB 5A2FA 5CD3B 1FZJB 2HJLA 5DJAA 5DQ9B 5FO8A 2V7NA 4GRMB 1GZQA 2OSLA 2XQBH 4QRPD 4ELKB 4IRSC 1J8HA 1YJDH 1Y6NR 4XAKE 1K3ZA 2R29L 4I48A 2YRLA 3V6OC 5JIPA 4M6NH 2FDBP 4H26A 1FLRH 4MD0A 2JCCA 4YE4H 3L3JA 3STLB 2LAGB 2YRZA 4TUJB 1J87A 3MLZH 1Z0MA 2I60H 1OCWL 4MDJB 2HN7A 1M7DA 4FQCH 5IQ9A 1LE5B 1NCBH 2AJSL 2XTJD 4X4ZA 5FYKD 2APXA 1JIBA 4XT1C 2GHWB 4FHBD 3P11L 4L4VB 4KGLA 3MOBL 5DZOA 3LKOB 3DV4B 5GGSB 2ZWLT 3QNYB 3V0WH 3QIUA 5FYJU 4I0PA 4N8VB 3TYFA 5ID1B 3UDWA 3O6FA 3GSVB 3LEYL 1W8NA 3LY6A 4R97B 5CJXA 5I19H 1JZ3A 1FVDB 3HPJB 1MIEL 1OP3H 1IAIH 3BZDA 2NY1B 3RDTA 4YXLH 4OCRL 3NTCH 5E8NA 5D6CB 1BQSA 5DJ8A 1HSAA 1KTLA 4PB0L 3BKJH 2BNQB 1I8KB 1H3VA 5IIEA 1WTLA 1JHLL 1XIWC 4HWEL 2R2EA 3EDJA 5GISH 4JQVC 1YEEH 2W92A 3CDGB 4IHOB 4TOYH 1MUJA 1UXWA 3S98A 1FZKB 4ZAKB 2BSSB 3DXAB 5I76B 3DYOA 3CPLB 4XZUB 4XP4L 1EBPA 3KPSA 4J4PC 1A64A 4M02A 2VC2H 3ZHKA 1OVZA 3DUSA 3UTOA 3HC0B 1U8MB 4G8GD 3AU1A 2FJFA 4QHMB 3ARTA 3T0BA 2APVA 2DIJA 1FGNH 3QNZB 5FB8A 5I1DB 2EC9T 3CZFB 4HLZG 3T3PE 2WV3A 1NAMA 3ZYIA 1RZJL 2DQTL 2WZPD 5C9JB 1MCNA 1EAJA 1QKZH 4RISL 5F1NA 5C2UB 3ZE0F 3HG1A 3NFPB 3L3HA 1F4XL 4WCYH 1HXYB 3KPLB 1IM9D 4P9ML 3UTTB 3VMPA 1XF4B 4P5TB 1GGCH 2KQNA 2PYED 1OCWH 5L2KB 1MAMH 4Y4KB 4W6WB 1XIWD 1VERA 1U58A 1XR8A 1FNSH 1M4KA 4OUUA 5JPMA 4Y16B 3G6JB 4YIQB 3IVKB 1R3KA 5IMLB 2VLRE 4M3JA 5IVXB 3QDMD 1JNHB 4DEPC 1A7OL 3C08L 5DUML 5E08L 4XNQA 3ARBA 4J4PD 3CDYA 4X6DF 5T5NF 2MMXA 4HGWB 1MIEH 1LO4L 4JPVH 2IQAB 5J0BA 3HAEG 3ZDYF 3WFHB 4XXDA 2A9NL 4OV6F 1U8QB 1FGVL 2NY6B 4XMPL 1D6EA 5DTFA 4PB0H 5I1CH 1DLFL 1JGLL 2WLZA 2W0LA 1DDHA 3KDMB 1AJ7H 5EZOL 5E1AB 2X7LB 4HXAL 1UM5L 3UTSB 1KJ2H 1KELL 3UJJH 3OXRA 1CG9A 1H8OA 3FO1B 3QZWG 4P2QE 4UBDC 1BLNB 3T2NH 1LE9A 3VFOA 1ZHKA 2AGJL 1C5BH 2QLVB 3EOTH 4FQJL 1ZT1A 1MH5A 1K3IA 5HY9A 5D7JB 3T3MF 3QH3A 5IEKA 3OF6A 4WEBH 1CLCA 4HCRH 4GFTB 3LMJL 5EIVA 1TJIL 3PG2A 1KPRA 4S10A 3N85H 2RGSA 3BH9A 5CEZH 3BZEB 4PBXA 3IDYB 2I07B 4KH2A 4RBPH 4AEHL 3NIGE 4P59H 3G6DL 4BFIA 3H42L 3OPZL 3IDGB 1U93B 5T1MB 4P2RA 3RZCA 2ICEB 4KQ3H 1VFAB 1WBYB 1ZMYA 2IH3B 1LP9B 5F1IA 1G6VK 4EEEA 3VWJA 3VW3L 4RGNB 3OKKA 4P9MH 4WV1A 5K33A 3E1F1 5HHXL 4HX1A 3RVTC 4AZ8A 3LOWA 4L9DA 2KPNA 3QEQD 2NY2C 3RFZC 5EUKB 3MNVB 3V4VL 3RWHB 2DF3A 4XNYL 3V9FA 5KS9B 1OGAE 5D2LA 4CMMB 4UBDD 1FVEB 1ZVSB 2FLBT 4OLXH 2QQQA 1SMAA 3ZL4L 2VL5A 3GIVB 5CEXA 2AEPL 3TT3H 1HN1A 1ITCA 3L1OL 5GGVL 4AIXA 3ETBF 4JB9L 4TSAL 4C83A 5ID0B 1YN6B 4JEGB 4JFPA 2IF7A 4LHUG 1FL5B 1NGZB 4CRPA 1CD0A 3I3BA 1A7BA 3F7PC 2EYRA 4EDWL 4Z78B 3VI4E 5FOJA 1OSPL 3QXVA 5CBEA 3RY6A 1NMCB 4GMSH 2NY4D 2R2HB 1FGVH 2X9WA 3WD5H 3MRPB 3C6LC 1N59B 1NFIB 1LK3L 2D7TL 3LPGA 3REVB 1RIHH 5JOEA 3FO0L 2CO7B 1C8PA 1NDGA 4G7YL 5BVPL 5DD6B 1I7ZA 2GSGB 4HXAH 1FSKB 3KS0J 5C0GB 4F3FB 5C0BA 2DQGL 4NCC1 4PJXB 3SDDB 4MSWA 4RRPG 4DUVA 4F9LC 5CCKL 3O45B 4AH2B 1U8HB 4ZYKB 3JSSA 4PV9A 3RVTD 5IW1A 3PWUA 2BSTA 2IFFL 2PW1A 3RNQA 2X4RA 2NY2D 1FZJA 3OG6B 4HCRA 5DQ9A 5CD3A 1QRKA 2EH8H 4H1LG 1DUYB 4LEXL 3U30B 5ISZA 4FXLA 3ZLQC 4H5SA 5EOCL 4JKMA 1MHEB 3TVMC 4U1IB 3W0WB 4YR6B 4EI5C 5E6IB 1YYMH 1P4LB 4Z0XA 1IZJA 3D3VD 4M1DH 1KXTB 4TUJA 3IFPA 3O3UN 4EUPG 3BN3B 4LLQA 4DKFH 1Z6JT 3C6LD 2DKSA 3C09B 2B2XL 2DQIH 4L4VA 2UWEB 2YA0A 3BE1H 1H3PL 1CLZL 3LKOA 2PXYB 2A6IA 4WWKC 3DV4A 1DBML 4O9HH 5DHXB 2JTDA 3A6BH 4V1DE 3K81A 2JJUA 2XZAH 1AGDA 5IJKA 1GC1H 5I1GL 4OLEA 1J5OL 4JB9H 5C08E 2C3GA 5IROA 3UPAA 1GOFA 2XFXB 5FKPA 1IKNA 4WW2B 1KC5H 2YC1A 2GJZA 2BNQA 1MFAL 1P69B 5IBLC 2NXZC 2W91A 5TQ0L 2B5IC 4U6HA 3CDGA 3R8QA 5ADOH 1P4BL 3QCVL 2XACC 1FZKA 4ZAKA 4CN6A 3QDAA 2XNAB 3CX2A 3L5WA 1IFHL 1MCPL 4IDLA 5A43C 3FB7B 3HI5H 3OJ2C 1U8MA 3CX5J 4PB9H 4QHMA 2VR5A 4JG0L 1Y0LB 4G8FB 3FJTA 4DGIL 4OGZA 3QNZA 4I3SL 4PRIE 1BREA 1P9MA 3CZFA 3ULSA 5F9OL 3CFIC 2VSDA 3TWCL 1KGCE 4NUGL 4YFDB 1BF2A 4GBXD 3RIAF 1AH1A 2X89D 3QXAB 1D5BB 1IGFL 4P5KA 3IXAB 3NCYS 1T5XA 3DMMB 4KUZH 3MJ9L 3OR7B 5GQBA 4JGMA 4JPWL 2EZ0D 3KPLA 4LOUC 3KLHC 1CT8B 1TTGA 4KRPC 2Y72A 1XF4A 5I2IA 15C8H 2I9TA 3MYZA 3BOVA 5IBLD 1IC4H 1UM6L 4XNUH 1MJJB 3AY4C 4R7NA 5BCAA 1Q0YL 5IMLA 2IGFL 3LZFH 3KPRE 4HEME 4XNXH 1P1ZB 4LMQE 1E4XL 1YYLL 1H15B 1WAAE 2DKMA 4HGWA 1WBZB 4DTGH 1J5OH 1F3RB 1NFKA 3UZEA 3WFHA 2DMBA 2QSQA 5E8DL 2FX8L 1U8QA 3QEGL 4C58B 4F37F 1E4WH 1GHFH 4OQTL 3NA4A 3H7BB 4LLAA 5E94B 3DV6B 1MFAH 4LSDA 2VKWA 5CZXD 2VXSH 4MA3B 2P42B 3KDMA 4KKAC 4HUUA 2OR9H 2MOVA 5E1AA 2X7LA 5FM5O 2EYSA 3FQWA 4LOUD 3FO1A 3KLHD 1BLNA 3LEXA 3I9GL 4UAOC 1O0VA 4KRPD 2NY5C 4TSCL 2PCPA 1MRDH 5A2LH 4FZ8L 1IGML 4PJCB 1IFHH 4JFYB 3F7YB 5ICXB 4OZHB 2GKIA 4XP5L 4WHTA 3MOQA 4AYFA 3EO9H 3BZEA 3B9KC 5D6DA 3AVEA 5KSBE 4N1HB 3NPSC 4I3SH 2GCYB 3IDGA 2P8LA 5T1MA 1FAIH 2AW2A 2ICEA 3BPCB 4NUGH 1WITA 3T3PF 4CDHA 3SGJC 1X5FA 3HFML 4Y4FB 4OFYA 1FZMB 3MJ9H 5DYOB 2PNDA 2JJTC 3PHSA 3QHZL 3BPLB 3GI8H 4FABH 5HYSG 4AIZB 2ARJQ 3EAKA 4P3CL 1RJYB 1EHLL 5L9DL 1S7SB 2CXGA 4FXGB 5DRXB 3D1MC 4UV7H 5JDSA 4KKAD 5E2TH 3RWHA 1W8OA 3QUKA 3EYSL 5KS9A 4CMMA 3NCMA 2MQ3A 2EH7H 4YWGL 3V6FB 2OM5A 5D71L 2P5EA 2BRRL 5FYLD 2SEBB 4JREC 3TLRA 3W39A 4M5YH 1QVOB 3RGVA 1MQ8A 1J0IA 2QADC 2IQ9L 3FFDA 3WJJA 3D69B 2PTUA 3KG5A 3P30L 3BEVB 3GJFB 1ZGLA 2AV7B 4MA8L 4WI5A 1FL5A 1NGZA 4DAGH 5F7UA 2D31A 5IFAL 1JWSB 3EUUA 3TYGH 3Q6GL 3B9KD 5E2VL 1IILE 3GFUA 2K3TA 4YEFA 2FX8H 3GI9H 3SHSA 4G6MH 5LKNA 5KVFH 1P5UA 5FF6B 5BZWB 5CILL 5FO7A 1N59A 1NFIA 4N8PA 4BZ2L 4NQCB 1QQDB 2F19L 3RHWF 2FEEL 2HT4D 3QDJD 1K2DA 3D85D 5I8OH 4PRDA 3ARGA 4PJXA 3C60D 5I1IL 5I15L 1LVEA 4M4RA 4FFYH 4AH2A 1HKFA 4ZYKA 3PQYB 2BNRD 3QUZA 4ODXB 5CUSH 4I77H 2BP3A 4WO4D 4R0LC 1FL6B 2M26A 3SO3C 3SJVB 5FECB 4MXVE 3JV6A 3IB4A 1QFPA 3HAEB 4P4KA 1J0YA 1DQJA 5T33H 6FABH 1T80A 2VDRL 3KYNB 1L4IA 4TVPL 4KK8C 4RNRB 3C8DA 3F8UB 4U1IA 3G5XB 2QADD 3NIGF 1FNHA 3W0WA 4YR6A 2B4CH 1J8HD 5E6IA 2EIEA 3I6GA 1A7NL 5HGAB 1NGPL 1T5WB 1JPSH 1P4LA 5ADPL 2I26N 3QZWB 4PJ5D 4OV5B 5ABDE 2IPKB 1Q9KB 4JQXC 2QR0A 4ZFOB 3QHZH 2P48B 3IDUA 5DHVA 3UC0L 4ZDHB 1J18A 2UWEA 3KPPB 4QRRB 2VB5A 3SKJL 2DWDA 3TV3L 3VFTB 43C9A 5I1JL 3SE4C 2AJ3A 2A6KB 4GUPB 1J1PL 3QFDB 1A02N 3PWPE 2BRRH 3O2VL 3F6LA 4RGOH 3NN8B 1U3HA 4HIHA 3BGFB 3QCUL 1DBBL 4KI5E 2DM3A 5T3ZE 1MJ7L 4I0PD 5GSRA 4KI1A 5C0AD 3P30H 1JGVL 4XMKL 1PQZA 25C8L 2ICCA 5JXEC 1WZMA 4WW2A 2KDGA 2UYLB 4UDTB 2Y6SC 1BHGA 1VB9A 3QUYC 1NSNH 3RDTD 1JF1B 3VI4F 2WWMC 5T1KB 5CILH 4O5LH 1MCIA 5D7SL 4PJIE 3ARFA 4UTBH 2F19H 2P44B 3RTQC 5AG8A 5ALCH 4PREB 3ORJA 3RWEB 1JTOA 4HK3J 5DD5H 4BM7A 3LH2H 2ZUWA 4MCYB 1YEKL 3KXFE 3FCTA 2D03L 1G7JB 4POZD 1LGVA 3EFFA 4LHUB 1HKLH 1W72L 2W60B 4G8FA 3D0VA 3RPIB 4WNQB 1TETH 1I7UA 2G5BB 1OTSC 1YNLH 1IKFL 4RGMC 5IMOA 5JW4R 4Q7DA 4LP5A 4QHKI 4H88H 3DMMA 3OR7A 1G7HB 4LGRB 3V5HA 2R1YB 1S7VB 2AKRB 5D7LD 2Z4QA 4BUGA 5JXED 1CT8A 1QLRB 1VACB 3RY4A 3WFZA 3FO2B 3HG1D 2Y6SD 3PXHA 1FN4A 3QUYD 4NHUB 1S9YA 4JRXB 4L8SA 2WWMD 3VG0L 5EC2B 3EYUH 2R23A 1MJJA 3BDYL 3BRFA 3CH1B 3ZSTA 2CDFA 4H1LB 5C07D 3RTQD 4LSTL 1DE4A 5JMOC 2DTSA 1NFDE 4HLZH 3SKJH 1XMWA 3WCYA 1U91B 2AK4B 5DJYA 3MR9B 1EEQA 4XC3H 1MI5D 1GZPA 1P1ZA 2RR3A 5JO5B 2GAZA 5HXMA 3GJFH 4KROC 4OF6A 5SWSB 1H15A 1CS6A 5J6GB 4FQQB 3MRJB 1RPQA 1JPTL 4U1GC 3ARBD 1NAKL 3UX9B 5DUBB 3OKEA 4Y4HC 4EUPB 3GNML 1UZ6E 1FORL 1NBVH 2ESVB 3H7BA 5E9DD 1CBVL 1TZHB 3LHPL 2R56L 3AUVA 4HPYH 5KAQF 4FTVB 4GW5A 4MA3A 4NO5A 1N6QL 3VWJC 1BQHG 3D39D 4UIKL 1QSEE 4JO4L 4XMLH 4S11A 4MXWH 2BRQA 5MHSD 1F11B 1BX2B 3MV9D 1N2RB 4JANA 4AK1A 2DJUA 4K7PL 3E8UH 3LPWA 2DQUL 4L4TA 3T0EC 1G0DA 3U0PB 5J1TC 4OZHA 5EZJB 1U92A 2IWGA 4J2XA 4HUWB 3HAEH 4JHWL 3SGEH 3EW3B 3QHFL 5C0JB 2D03H 4HUVB 4RMRA 2G75B 5JQ6H 4P2OB 1UFUA 1UKTA 3GMNB 4YFEA 1O7VA 3MJGX 1L0XA 3WFCL 2NY7L 5F7DB 3OX8A 4KROD 2WWKO 1VPOL 1L7IL 4XPAH 1HILA 4I0CC 1N7ML 5DK3A 3MGOB 3DO7A 1VSCA 3MRGB 1FZMA 4KRMB 5H94A 5DYOA 4Y4HD 5ANMB 1ZT7B 3BPNB 4PJFE 4U6VH 1S7SA 1NCAH 5I75B 1MCEA 2F53A 5EOQH 1ZS8B 3CSYB 3VWJD 5KJRL 3VG0H 4G8EA 1D5XB 1R0AH 4HAGA 1QR1B 1XGYH 1YUHB 4Q6IB 3V6FA 1WC7B 1UA6L 3KPMA 2BNUB 1U8JB 1JYWA 2CLRB 5F9JB 1QVOA 3T0ED 5DT1L 5D7KE 2AXFA 3K2UH 4G7VL 4NNYB 3GSNL 1G7PB 3QQ3B 4LPYA 3GJFA 1GGBL 4JJHA 4YHOL 4OFKA 1JWSA 5T1LB 1WAAF 4AIOA 4O4YL 2FBOJ 4HIJB 1C08B 2A73A 2CKBB 1I9JL 1MREH 5ESAA 4KKCD 2R56H 3I50L 1LDPH 4DW2L 1QQDA 5EZLB 3FB6B 4OM0H 5FYKU 4GSDL 3JBG7 3C2AH 4UIKH 2VXQL 3QJFA 1MAKA 3I85A 1FFPA 1U6AL 4XWOC 3VGAC 2JIXB 5CS7A 5KAQG 2XZZA 3O6LH 3VXNA 4ODXA 4K7PH 1BJ8A 3BP4B 4XGZB 3S7GA 5C0CA 5CWSB 4Q0XH 2V9RA 3BJLA 4XH2A 3MJ7B 2VDNH 5D93B 4Z7WB 5E8PB 4HUMB 7FABL 4HEPG 3VXQB 2NY7H 3WXWH 1QSFE 3G5XA 5FO9A 5KSBF 3U0WL 3BDXA 2HLAB 3BUYB 4LU5L 3QIBA 5ISZD 2VZOA 1II4E 1SJEB 1PJ9A 4G3YH 1L7IH 3UP1A 2UV3A 5C8JB 2HJKA 1R3LB 4X5LA 2ICES 1T0PB 5CFHA 1WLHA 4PP1D 2KQMA 1U0QA 4PJEE 5DRWB 2ZJSL 2XXMB 1WWCA 3MGTB 1F90L 3BWUC 5IVZB 1AC0A 4ZDHA 4QHNB 3BESR 4H1LH 3LQAC 3SEPA 1PKQE 4S1SL 5IMKA 4QRRA 3RBSA 2D4DA 3T1WA 1J7VR 3RJDA 2HAZA 4XWOD 4PJ8B 3QFDA 4NRYB 5BV7L 3E3QC 1IM3A 2EDFA 4HZLA 2HJFB 4K23L 5DT1H 4W68A 4G7VH 1AE6H 3WFBH 1Q9OB 4FQLL 4O02L 2CKBL 3N1FC 4R26H 3VXSB 1GGBH 3AMLA 3HE6C 4EUPH 4UDTA 3RIAK 4MA7H 5HYSB 1JF1A 1JNNL 5J89A 5DFVC 1XF5B 4QHUA 3ARDA 3I50H 32C2B 3S88L 3NFSL 4TNWF 4GSDH 3BKCL 2VLKD 4JO1H 4Y19E 3N1GC 4MCYA 1CGYA 4HUXB 1B0RA 3UAJD 1I8MA 1F4HA 1A7PL 1G7JA 4NN6B 4LHUA 2W60A 3CC5B 1T83C 3CLFH 1HH6B 2VXVL 2ZCLL 4MXVF 5FDYA 4NC0B 2HT2C 4ONHA 1NCDH 5HSFA 1T6WA 2ILLA 1B6UA 3TH2T 4MDIB 1EO8L 2QTEA 4MD5B 3UJIL 4F37K 4AG4H 1G7HA 5F96L 3FTGB 1S7VA 3HE6D 5L7XH 1QLRA 3QDGA 3QEUA 3FO2A 3QWRD 1ACYH 4RFNB 1EMTH 4YXKH 1FRGL 3FQXA 1U8LB 5EBMA 1AIFB 2R39A 5DFVD 1WZ1L 1ZHLA 4WTXA 1Z3GL 1AQKL 2YUZA 3CH1A 4UQ2B 5J9PB 4H1LA 4YNYA 4LCWE 4PJAB 3FOLB 1QRNA 4XCCH 3TEUA 2D0GA 1JVKA 4Q9CA 2AK4A 3MR9A 3HZMB 4XCEB 3IRPX 1K8IA 5HDBF 4G9DB 4NZTH 1F58L 1XCQA 5SWSA 3SGKA 1IZKA 2PETA 3BW9A 4K23H 4FQQA 1CCZA 1TQBC 1AI1H 4JKPL 4KI5F 3OJDB 9CGTA 5FA4B 2W9LA 2J5LB 1AHWB 2HT2D 3CSGA 5FGBC 1FZOA 5EBWB 4KZEH 2ESVA 2DI9A 4YDLC 2ARJA 4U3CA 1FBIH 4FTVA 4ZTOL 2WP3T 5IHUL 3VWKA 3RVXC 4RFOH 3PABB 3NFSH 3R8BB 2ZNXA 4PJIF 4N8CH 1EGJH 1ULVA 5HI5C 4EBQH 4UT6H 4QRPE 1S7RA 4OJFL 5EZJA 2XA8L 5D70H 2OYPA 5A3IC 5KSUB 5E95B 1RU9L 3TFKC 2EXYC 2G75A 4P2OA 1T04B 4OD3L 4HJJH 2VXVH 2VLRB 3B8YA 3S5LG 4L3ED 1BZ9B 5LCVL 2AI0L 1JPST 4JM4H 4H0GA 3X3GL 2D3VA 4HS6B 3K1DA 1G0XA 2D7MA 4G9FE 3MGOA 1P4IL 3CFCL 1HQRB 5F96H 5I74B 5D1QC 1DZBA 3ZKNC 5ANMA 1EO7A 1ZT7A 3RHWK 2DQDL 2OQJB 43CAB 5KVGH 1ZS8A 2VDMH 3BKMH 1FRGH 4BH8B 3SBWA 1IEBA 1IL1B 2VWEC 3RVXD 3ZTJG 1YUHA 1RUPH 4Q6IA 4GH7B 4CVWA 2XZQL 4M7ZC 5JOFA 2BNUA 5HI5D 2CLRA 5F9JA 1OQXA 2YUWA 1EFXB 1NFDF 4NP4H 1XGUA 4FXKA 4OIBA 5J8OA 1OAZH 3QQ3A 3LDBC 1NBZB 5GGRY 2EE2A 3VGHA 5A3ID 5AD0A 3TFKD 1CL7H 5T1LA 4ZSOE 4JKPH 4D9LL 2HH0L 1C08A 2QSVA 4G80B 2XN9E 2DLIA 3QRFM 1LK2B 2FD6L 1AR1C 1CE6B 1CGUA 3P4LA 2D7OA 5E5UB 4MJ6B 4U0RC 3ROLA 2EDYA 4I4WB 3VXMD 5J6HA 4J1UB 3C9NB 3FL7A 4UNTA 1CWVA 5TF1L 2HFTA 2YBRB 4P23C 5D1QD 1CF8H 5DMGC 2AXGA 3OKDB 3ZKND 5FHAH 2OXHA 1EGJA 3O2WH 5F7FA 2NZ9C 3BP4A 1IC7L 2EE6A 3ARGD 2JJWA 4PP2B 2V17L 1F4YH 3MJ7A 3QUZD 1XT5A 4RZCA 1EZVY 1XR9A 1RU9H 4Z7WA 5E8PA 4JZOA 5IEHA 3WFEL 5DJCA 1X5JA 5IBTL 3BGMB 12E8H 4P4KD 2A6JB 2LTQB 3BUYA 3WNPA 3HS0B 2EDQA 1BQHB 4ZO7A 3WHE1 2HTKC 1I1AB 1YEIL 4P5MB 3O2DH 2EC8A 5ACZB 2FX7L 3MQIA 1FFNA 2P5WB 3ARFC 4NGHH 5A16A 4LAQH 2BVYA 2BX5A 2DL9A 2FEEI 3DRTB 3G08A 2RCSH 4QOKA 3LS5H 4FMKA 3MGTA 1RUAL 5C09B 2DIBA 2GJ6D 5IVZA 5ICYB 1Q9WB 4TN9A 4MHHG 3RX5A 4QHNA 4UT7L 4PJFF 3MCG1 2FBJH 4PJ7A 5D1ZC 1N5YL 1HI6B 5KN5A 1DTUA 4MVBC 3MV8B 3OBAA 1P7QB 5DMGD 4PJ8A 4JAMA 2E6JA 4NRYA 4LCCB 2WBJB 3EDFA 3MJ8B 3U9PL 2NZ9D 1A4KB 2HJFA 5TDOB 3GK8L 5C6TH 1VFUA 4LARH 3IKCB 4PGCA 4H8WC 2MCG1 1SYVB 3PGCB 1SJHA 4P9HH 1Q9OA 4RDQG 4LIQE 3RAJH 1U3HD 3VXSA 4BQCA 3IJHB 4YHKH 1BOYA 4NWTL 4ZNEE 2ORBL 4JY5L 1B4RA 4LBEB 1FNGA 1G9ML 1I1FA 1A5FL 1X3DA 1TNMA 4AQ1B 3WS3A 3B5TA 1T0NB 4S1RL 3SDXE 2MPAH 1W0WB 5MEPA 1R5VA 2HTKD 4O2FB 3LD8C 3ARFD 4M1CC 4FQHB 5JPNB 5M7QA 2ADFH 3VH8G 1A7QL 1R3IL 3PDOA 4D9QE 2Y07H 3O0RH 2V17H 4NC1C 5D1ZD 1HH6A 1BFTA 2VLJD 4U6YB 3TN0B 5I0ZA 4N9OB 1ZSDB 3K4AA 4PFEA 2YXMA 1A4JB 4JZJB 4V1DB 3FN0L 2PF6A 2X10A 4MD5A 2EYTA 1KT2B 1DFBL 3IFNH 1V7ML 5C08B 2V9TA 4RX4D 1S9WA 3ZYJA 5K9OB 3IDMB 3AREA 1I4FA 3O2DA 2IPTL 4MB4A 1UJ3C 4WUUB 1A3LL 1ETZB 4LPCA 1GXEA 2MSPA 4HFUH 3GKZA 3TO4C 4PJEF 4I9WE 4XPTL 5J9PA 4KXZI 4HD9A 4U1KB 4BSJA 1RIVL 1D5MA 4PJAA 3SDCC 1WEJL 3R0NA 3ZT5A 4JHZA 2PO6A 4OTXL 5GGTH 4M1CD 3HZMA 4LPXA 4KDVA 1OW0C 4G9DA 4U4BA 3G5VB 3U9PH 4F7EB 3BRGC 4Z95L 2ADGB 3DROA 3C8HA 3MNWB 4PJHB 2FX9L 4OCLC 5FA4A 4M00A 1MHCA 2P4AB 2ORBH 3WIIL 3BYTA 3RQ3A 4PRIB 1H0DB 3ABZA 2IADA 4N90D 1A5FH 1YDPA 4JM2A 3SKOB 1J88A 2Z35B 5JHDD 3UBXG 4JO3H 2C9AA 3PABA 2XIDA 3QO1B 4XXCA 3GKWL 3X11B 3QCTH 4OZFB 1QG3A 2P8PA 2WUBL 4DGYL 5DJDB 3TO4D 4M8VA 4DN4L 1FVCA 4L4TD 5GS1C 2IAMA 1RD6A 1UH2A 3AGVA 4NPYB 3SDCD 1I9IH 1DBJL 3KJ4B 2NXYB 4JFQB 3BI9X 1BZ9A 3D3VE 5ESQB 3UO1H 1JRHH 3HZYA 1LEKB 1J9CT 4NHCH 4LSPL 5DQDL 2OZ4L 3QI9A 4O2EA 3S36L 1ZEAL 1DFBH 4TRPH 3PF2A 3DECA 5IB3A 1DEEB 2BHYA 4XP9L 2PKDA 4EJ1C 3GM0A 3IU3B 1BJ1J 3EYQC 5TH2B 3TBWA 2Z92B 4MAUL 4QYOB 1AO7B 1IL1A 4LCUB 2UVEA 1PGRB 4OLWL 2F53D 3T04D 3B4NA 2IANB 2ARWA 1WEJH 5FYJH 2HRPH 4KK5C 4OTXH 5GGTA 1X6LA 1KJVA 1TITA 3OHXB 1LO0H 2ZUQB 5IFHL 4ELMA 1NBZA 3BKYH 3BH8A 3L5HA 4LEOA 1PZUB 2K7QA 1BD2E 1JMXA 2BY0A 4PJDA 2FX9H 5T3XD 4YZFE 4KTDL 1CE1L 2DQCL 4DCQB 3L6FB 1CE6A 4U6TA 2R4RL 4QRQB 4L8CB 4I4WA 1GGYA 4J1UA 3C9NA 4CL7A 2LVCA 1RAMA 4PBVC 3JVGA 1VKXA 4KDTC 3OKDA 2VNCA 5E8OB 3UMTA 2KBGA 4Z7VA 3RWGA 4K3DH 3EYQD 1CICB 3AM8C 5H2BB 4KRLB 3CK0H 1YPZA 4LLUB 3F65A 4A6YB 3X14B 4NUJB 5C0CD 1T21A 5EOTB 4ODVH 4KK5D 2P8MA 4HGMA 3I3EA 2UZYB 3WIFB 3ULVH 2A6JA 3PWNB 3GSRB 5DURD 4KTEL 4PRAB 4PTTB 1BQHA 4N9GB 1UWXH 4NKMA 4ESKA 2AAVA 4LRIC 1MELA 4YHML 3VXTA 4BA8A 3QIBD 2WM0A 3MCKB 4ODSH 1BFOB 1U8OA 4MJIE 3QR2A 3DRTA 2A74A 4HXBL 5C09A 2VDOL 1Q9WA 3LS4L 3QPXH 4P2YA 4Y5VB