4Y00A

Crystal structure of human tdp-43 rrm1 domain with d169g mutation in complex with an unmodified single-stranded dna
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
78
structure length
78
Chain Sequence
TSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIGGRWCDCKLPNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural analysis of disease-related TDP-43 D169G mutation: linking enhanced stability and caspase cleavage efficiency to protein accumulation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
molecule keywords TAR DNA-binding protein 43
total genus 15
structure length 78
sequence length 78
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4y00A00
2DNKA 3MD1A 2M8HA 3G8SA 3TYTA 1YIJS 2DNQA 2MZJA 5GADU 1K9MT 5IM0B 2CQPA 1OPIA 2DNMA 1N8RT 2AYBA 3SDEB 4F02A 3ULHA 2FC8A 5LJ5Y 2KFYA 4W90B 1YITS 5BJRA 1VQ4S 2DO4A 3THTA 2MKKA 3CXCR 5LJ3Y 1B7FA 3R27A 1ZZFA 2M0GB 2D3OR 1N88A 1VBXA 3VAKA 2DISA 2KHCA 1VQKS 5DETA 2CQ4A 2X1AA 1ZH5A 3MXHP 1WELA 1S79A 2ZJQQ 4FXWA 2LA6A 1YTYA 2DHAA 1JMTA 1U6FA 1DRZA 3CCMS 2CJKA 3NS6A 5DM7Q 2U2FA 3NNAA 1WEZA 4F26A 1H2TZ 2G4BA 4IOAQ 3HI9A 1M90T 1Q86T 1N54B 1VQ7S 2MY8A 3MDFA 3S8SA 2O3DA 2HGNA 5GMKa 3CPWR 1URNA 3H2UB 2HZCA 2KYXA 2MYFA 2AYMA 3SXLA 2AYGA 1YI2S 1YWXA 2F3JA 3PIOQ 1SJQA 2N7CA 2MQOA 4QPTA 4TU9A 2DGWA 2MB0B 1SJFA 2YWKA 1JJHA 1X4DA 2DB1A 3Q2TC 2DH9A 5EN1A 5LSLA 2XS2A 1X4FA 3CF5Q 2KU7A 3P3DA 2DK2A 3DLLQ 2KI2A 2PE8A 1X4EA 2RRBA 1N52B 2DIVA 2I38A 4TU8A 2YH1A 3G4SS 3H2VE 2DNNA 2J0QD 1PGZA 2JVRA 1X5SA 2CPYA 1ZZNA 3VAMA 3JB9k 2CPXA 2V94A 2Q79A 2MQNA 2VONA 2E5HA 2DGSA 4PRFA 4P6QA 2MPUA 3RW6A 3P5TL 1K73T 2QA4S 4RU2A 2VODA 2MXYA 2JX2A 4BS2A 2CPZA 1H2UX 2DHGA 2HGMA 4UQTA 4CQ1A 2M2BA 2EK6A 3CCUS 2L08A 3CCSS 2CQDA 1SJRA 3U1MA 2CPEA 2XSFA 3NNCA 1U1NA 2L41A 1X5OA 3THPA 2MZSA 4ED5A 4C4WA 4F25A 2MJUA 2KM8C 2M4MA 1VQ5S 4UY8T 4PKDB 1RKJA 1QVFR 1R8HA 2VOPA 3K0JA 4IOCQ 2OSQA 1UW4A 1G2EA 1WEYA 2D9PA 2G1DA 3P6YC 1NO8A 2YTCA 2RUGA 3P49B 3G96A 2E44A 1NU4A 1Q82T 2HGLA 2DITA 2A3JA 2RS8A 1FT8A 1K8AT 1VC5A 1P27B 2DIUA 3NNHA 3IRWP 1FJEB 1OO0B 3CC7S 2MQLA 2G0CA 1IQTA 5CA5A 4C7QA 2CPHA 5DDRC 4EGLA 2B0GA 2KXNB 1U1LA 2QEXS 4TU7A 3SMZA 3G9CA 2ZJPQ 1VC0A 2K3KA 3FEYB 1DHMA 5H1SV 1W2BR 1AUDA 2MZ1A 5CYJA 1DBDA 1HD1A 1FNXH 3MUMP 2DHXA 2DGQA 1QVGR 1D9AA 3CCES 1FJCA 2NZ4A 4CIOA 1L3KA 2QFJA 2KN4A 2MQPA 3BS9A 1WG4A 2FC9A 2MHNA 3EGZA 4Z2XA 1JJ2R 1WG1A 3MD3A 5HL7Q 1U1KA 1VQ6S 3N9UC 1VQPS 1FJ7A 1HD0A 2UP1A 1JJ4A 2ADCA 2MQQA 2MSTA 5JVGQ 1WI6A 3UD4P 3I55S 2KRRA 4YOEA 2DGTA 2CQ0A 1VQNS 2M52A 2KG1A 3UWTA 2DHSA 2CPFA 3ZZYA 4Y00A 2CQGA 4FXVA 1Q7YT 3HHNB 2CQ1A 3Q2SC 2J0SD 1UAWA 2CQ3A 5GAHU 3EX7B 3US5A 3J7ZT 3CULA 1Q81T 3CD6S 1O0PA 2CPDA 5ITHA 2CQBA 4YB1P 2LKZA 2XS7A 2E5GA 3DXBA 3R1HA 1A7GE 2MKCA 3BEGB 4J5OA 2X1GA 1UP1A 2DGXA 3B4MA 1UFWA 2J8AA 2MMYA 2RU3A 2RRAA 2DGVA 1WI8A 2CQCA 1BY9A 2LQ5A 2N3OA 4QQBA 1DZ5A 1YHQS 3G8TA 1D8ZA 3EGNA 2DNZA 1X4CA 3ZZZA 3CCLS 1KQSR 3LQVA 1WHYA 3VALA 2DNYA 2LEBA 3SDEA 4ZKAA 2OSRA 1M5VC 4CH0S 3BO2A 2F9DA 4W92B 2MKSA 1M1KT 2HYIB 2KG0A 1H2VZ 2MZRA 3MOJB 3BO3A 2XS5A 1H6KX 1YJ9S 1VBYA 1WF0A 2BZ2A 2CPIA 2CPJA 2DNOA 1VBZA 1U1QA 5GAEU 1U1RA 2OIHA 2AD9A 2JRSA 2XNQA 2ERRA 1WTBA 2RQCA 2MJNA 1KC8T 3VAHA 3CC4S 3BO4A 2U1AA 1F9FA 5D78A 2N3LA 1X0FA 2MKJA 3FEXB 3CCQS 2DO0A 2DNGA 2DNRA 3CTRA 4WCEQ 2K8GA 2OTJS 2JVOA 4OZ0A 1R8PA 2MGZA 1X4AA 2J76E 2KXFA 3IWNC 1P1TA 1WHXA 2RQ4A 1VQOS 2PEHA 2EVZA 1CVJA 1HA1A 2MY7A 1FXLA 2M9KA 5GVQA 1U2FA 4IO9Q 2RS2A 2DNHA 2KT5A 2D9OA 2RVJA 1U1PA 2VOOA 5IQQA 2N82B 1X4HA 3VAIA 2DGOA 3S01A 4IUFA 4WF9Q 1X4BA 3MUTP 2LECA 1U1OA 1WWHA 2JWNA 2XB2D 3R1LA 2RT3A 3NS5A 3VAJA 1WHVA 2YKAA 1NJIT 1U1MA 3S6EA 3MUVP 2X1BA 3G6ES 4LMZA 2M88A 3CC2S 1A9NB 4WIIA 5DDPC 3UE2A 1WHWA 2LEAA 3J7YU 1OWXA 4YUDA 2CQ2A 2HVZA 3S7RA 1S72S 1WF1A 2FHOB 4WFNQ 1SJ3P 2LCWA 1VC6A 3MURP 3RW7A 2KVIA 2MZTA 2DH8A 3D2WA 4ERDA 5JVHQ 1SXLA 2BOPA 2LXIA 2MZQA 4OZ1A 4A8XA 3I56S 3UCZP 2DNLA 2ADBA 1KOOA 2EK1A 4QU6A 2DNPA 3CCVS 3CUNA 1KD1T 4M5DB 3L3CA 4C0OC 3VAFA 1OIAA 5DM6Q 3CMES 2GO9A 4U67Q 2RNEA 3LPYA 5FJ4A 2LMIA 2F9JA 4WFBQ 2L9WA 3CMAS 3VAGA 2M70A 2ZJRQ 1VQMS 2MKIA 5GAGU 3PIPQ 2NLWA 2I2YA 2DGUA 1PO6A 4WFAQ 5IM0A 2M8DB 1WEXA 2MGZB 2CQIA 2MKHA 2KM8B 1M5OC 1VQ8S 4WKRA 2LYVA 1U6BA 1WG5A 3U1LA 2KXHA 2GHPA 2FPHX 2WBRA 4V19X 2DH7A 3UCUP 5HO4A 5IFMA 5LXYA 3TP2A 1YJWS 5DDOC 2KRBA 3CCRS 5D77A 1X5PA 2FY1A 3UCGA 4LIRA 2OJ3A 5LXRA 2E5JA 4TLQA 3B4DA 5CXTA 2SXLA 3MI7X 2M7SA 3TO8A 1RK8A 3G71S 4Y0FA 2LXUA 2CQHA 1M5KC 3CCJS 5MLCV 2YH0A 4QU7A 1FHTA 2LA4A 4PR6A 3VF0B 2X1FA 1HL6A 1YJNS 1WF2A 2AYEA 2E5IA 5DDQC 2OTLS 1QM9A 1X4GA 1FO1A 1SJ4P 3V4MA 3UD3P 1X5TA 2KH9A 3OW2R 5LSOA 2XNRA 2MSSA 4LJMA 2MQMA 4CH1A 3NMRA 1VQLS 1XN9A 1KOHA 1M5PC 1VQ9S
chains in the Genus database with same CATH superfamily
2DNKA 2R42A 1NZ8A 5FDLA 2AJFE 3KLGA 3G8SA 1QTMA 1LW2A 4NYPA 2MZJA 2QA2A 5D0HA 1QAXA 5GADU 1HWUA 1FDDA 1RKIA 2R2UA 1RCXB 4LREA 1RTJA 3SV4A 2A6MA 1K1SA 1O8BA 2UUWA 3NGRA 4ZA1A 4LFAJ 4ALZA 2HFZA 5KG5A 3PW4A 1XMQJ 1PILA 3OUYA 1S0NA 4ZOSA 4H4KC 3VVUA 2R8GA 5B7WA 2E9RX 1C1BB 1VQ4S 3QBCA 1JNZB 5CCMA 4ECWA 3N79A 4O4RA 3THTA 4ZPCA 3W5ZA 5C25A 1N56A 3MM8A 3GIMA 3C8YA 4WXOA 5F0WA 1CJTA 1WSVA 2DRBA 5LJ3Y 1IBLJ 1U8WA 2OEMA 1LWFB 1B64A 1RWKB 1FK9A 3AJDA 2QO3A 3M2VA 4TN2A 2B51A 2FZKB 4KGXB 5ETMA 4CYUB 2VICA 4F4XA 1NXIA 3TARA 1T9TA 3RJMB 3D0IE 5I3QA 2NUHA 2PMHA 3MMCA 3TUJC 4H4OA 1F60B 4R0EA 1S12A 4MH8A 1WELA 2KYZA 5CQGA 3CJ2A 3ET6B 4FXWA 1CQNA 1LK7A 1ZM9A 2JL9A 2LA6A 4DL0C 3QT5A 4ZCLA 1CPZA 2HZAA 2J9EA 3MCNA 4ES3A 4OMFG 3EXYA 3ONQA 2HAFA 3ILLA 4C97A 3MR2A 3GIJA 4NXNJ 2U2FA 5EX0A 5D3GA 4M5GA 3J80Y 2Y3YA 1C0TA 2WVCA 3PEHA 2W9BB 3RB3A 3EGVA 1CJUB 2RAQA 4DI6A 3KHLA 4LR9A 4FS1A 1QTNB 3OQ2A 4RUCA 4AYBD 1RAHB 2E7VA 2VG6A 4ZJLA 2RUSA 5KFLA 3UN5A 3GILA 3CPWR 2ZDPA 2BEFA 3H2UB 2HHUA 1UVMA 1HNWF 1RADB 3PV8A 4RW4A 1Y5IB 3M32B 2E29A 2J9DA 4JYAJ 4DS4A 3OD2A 2VZ9A 4O3SA 2O1PA 4PQAA 2NSBA 3BQ0A 1Z1ZA 3D6MB 4ZLLA 2F3JA 4TVAB 3Q86A 1SJQA 4CM2A 3AQOA 4TYAA 1IKWB 3MPYA 1JJCB 2MQOA 2VDHA 4GVBB 1TKDA 3NAHA 1GNKA 1ZM2A 1UETA 2G13A 3MEEA 2PMZD 1X4DA 3L95X 3MGJA 3D6TB 5L9XA 2DH9A 3SEOA 5IZHA 5J1PA 5LMNJ 4DV5J 2GVDB 2C2DA 2UUCF 1X4FA 1HBNA 2XWYA 3CF5Q 2OAUA 2GHVC 3TZXA 2KU7A 4BBYA 1AFJA 3JTPA 3BBCA 2ZM6J 2VKRA 3DLLQ 4ZJOA 3OTEA 1RB0A 5FLXY 2I38A 4ZVOB 1TL3B 3H2VE 1WC1A 3GPAA 1OQ6A 1PGZA 2XC9A 2CPYA 1EQ0A 4YN3B 3UNGC 4QYRA 3VAMA 3JB9k 2JZ5A 4I67A 2FHJD 5ETNA 2K2PA 3NOCA 3HVRA 1S6QA 3AH6A 4KGKA 1FE0A 1U24A 2KJWA 3DRSA 1BWEA 3CDUA 5E7OB 2HRYA 2E5HA 3C6TB 2GMHA 2NXJA 2QLJB 5LMUF 3CJRA 1AB8A 2HQIA 2IM2A 3AD9C 1TKTA 3IFEA 2MPUA 3RW6A 3C14B 4J9VA 2QA4S 5KFMA 1UJ5A 3Q8SB 3RBDA 5C24B 4P52A 1B70B 1F5CA 3DOMB 4NCGB 2QLWA 1FJGJ 2GCFA 3IS9A 2YNFA 1T94A 2QLFB 1HQEB 3POTA 2N4CA 3DOLA 3M6WA 1AFIA 4DV4J 2AZ1A 3FFIB 5J2PA 1HIYA 5LT5A 4DQIA 3MEDA 2HW3A 3EMTA 1SJRA 3U1MA 3RYLA 3ETMA 3NNCA 2FYXA 1TKZA 1UEUA 3NCRA 5CYMA 1TKXA 4NLYA 4QZVB 2BBEA 5HK4A 1U1NA 1HNIB 4BWMA 1RTDB 3O6QA 1XNRJ 4ED5A 4K4VA 3CGIA 1QJHA 5T7LB 2KM8C 2IJRA 3HO1A 2I9SA 3GYGA 4UY8T 4C0HA 1YJTA 1XR6A 1HWLA 2UVVA 3FGVA 5KFPA 2NS1B 1R7IA 3M30A 4NI2B 4DWIA 2NZCA 1UW4A 5L46A 2V2QA 2G1DA 2YX1A 4EO6A 3PR5B 1NO8A 1PYTA 2YTCA 3EUNA 1T7PA 1R89A 1NHUA 2IVFB 3TAQA 1VFJA 5F8GA 1TK5A 2FB0A 3FMBA 1PKUA 3PTWA 5D0EA 3G96A 4EYIB 2P5VA 4IG3A 3UO0A 1UWAA 1VK8A 3FQKA 1NSKL 2DXEA 3PACA 2RH3A 4ID8A 3OL8A 4U6PA 1FRJA 2HGLA 2V0NA 2MLYA 1RP5A 3HFKA 3H8YA 1CJVA 4L3KA 3NGDA 1P27B 3QIDA 5I3UB 2QFIA 4RW6A 5HROA 2UUAJ 3NNHA 1FJEB 2HHSA 2OPRA 4JI1J 5CA5A 4C7QA 3SSRA 2CPHA 3GFXA 5KFWA 3FKBA 3KK3A 4P75A 1TELA 1XJWB 4H4MA 4EZ6A 4IQXA 2W25A 1JK9B 2G0IA 2JLGA 1WSRA 2BQRA 3BH6B 3BGUA 3OHBA 2UZAA 3G9CA 3KOAA 3F0NA 2A2CA 3BGRB 1W2BR 1DHMA 2UV8G 2DD8S 4EBDA 1RWWB 2GGPA 2W4DA 4TKTA 2AX0A 2XMJA 1AYEA 2GZOA 3TWZA 4B9UA 2P8IA 3MM8B 2DGQA 3HFZB 2Y1RI 2NZ4A 4CIOA 2W9CB 2RIJA 3ISZA 4I56A 2GMJA 3M8PA 4EU0A 2ZH2A 1EP4A 4N7TA 4NLGA 4JBCA 4NRTA 1XR7A 3VQTA 3OFEA 2LU2A 4C8NA 4B3MF 4C9DA 2POKA 1LEOA 4O44B 2BUNA 3M2UA 5HL7Q 1VQ6S 1VQPS 2F1FA 1JJ4A 3MCOA 3QPIA 3R6LB 1GMUA 2MQQA 2JEGA 2ZKUA 4HH0A 3MEEB 1S9EA 4FKXA 2YWWA 2APOA 5FDLB 1PC4A 3UD4P 5FLXU 3M6XA 3I55S 4DSKA 2GVDA 3BN7A 1V5IB 2DGTA 4OYBA 1M0SA 3ZNUA 5LMUJ 2NREA 3HHLB 1IBKJ 3QT8A 2DR6A 3QGIA 3R9LA 5L9NA 2IMWP 2A1BA 4XPEA 3QYYA 3UWTA 4IRCA 5GADI 4DL2A 4DR7F 2Z2MA 5E3RA 3VGTA 1R27B 2IC3A 4RBUA 1UMJA 2IA0A 4ES1A 3ZZYA 1CJTB 3W2VB 4WU2A 1RISA 2CQGA 3HHDA 3Q23A 1VR6A 1SB6A 4TLRA 4CP5A 5E3CA 1O5JA 3Q2SC 2GIRA 1LWEA 2V9KA 2AEJA 2VG5B 2F4FA 4FKYA 2JLEA 5C42B 5ITHA 3T5JA 3DRXA 4B9LA 4RPFA 1NK4A 1D9FA 8AT1B 2GA7A 4JI4F 1KQFB 2W2OP 2KZZA 1RYRA 2CAJA 1NPPA 3MAHA 1VIXA 4GO7X 5KT5A 1UVNA 1NKCA 1RBAA 2PA3A 3SCKE 2HVIA 3KK1A 1PC5A 1IBMJ 3C16A 1ULRA 3SQOP 1LNQA 3UR0A 3AT1B 2X1GA 4L3NA 4D3HA 4DQPA 3B4MA 2X3GA 4P2XA 1SC4B 1NDPA 2MMYA 3TAMA 2DGVA 3RRGA 1BY9A 3GB0A 1RHJB 4QQBA 2V8HA 1YHQS 3G8TA 1DZ5A 5CHCB 1IKYB 4DOZA 1TKZB 2R4FA 2E1RA 1X4CA 3M8YA 4DPTA 1Y0HA 2PT0A 3PDNA 2VPWB 1WHYA 4FDFA 3VALA 2W01A 1P8GA 1M5VC 1RAGB 2W4CA 4A8SA 4W92B 3OLAA 2FLNA 1O6XA 4OI0A 2AJQA 2EC2A 5C24A 4ED7A 3JSBA 1H6KX 5CD4A 1RWPB 1HQUA 1R0AB 3GFZA 4IG3B 1S5ZA 4LFCF 2EBGA 3DRRA 3L7OA 4ZVGA 3V4IA 2AD9A 1RT1B 2P9GA 4CO1A 4I6YA 3KMSA 2MKYA 2HLTA 1Q0NA 2EWHA 2RQCA 4LF7J 3CD5A 2OH2A 3PRVA 2OPRB 5E2QA 1FFWB 1F9EB 3CJQA 4NA3A 4PPZA 3Q8RB 1H3DA 2PMWA 3C6UA 1JNRB 2MKJA 3KK3B 4JI0F 5D4NA 2ZHBA 3HJFA 3B8HA 4XDDA 4FPIA 1ZS6A 4JI6J 3CTRA 2IBKA 2ZE2A 4CLKA 1HBOA 5GAEI 4WU3A 4ZHRA 3KLIA 4ELVA 3T19A 3CJ3A 3TJ8A 4WZMA 1F3FA 1HW8A 4O4GB 4KR0B 3IGNA 2VIHA 1C2PA 3D3BJ 1S0VA 1UKUA 4NCGA 3DLHA 3IS9B 2OPSA 3IWNC 4NLTA 2FHKA 2UXBF 1VQOS 3HKWA 2PEHA 3M1VA 4O0NA 1CVJA 1HA1A 2MY7A 3FCHA 4NMLA 2WONB 2DHHA 4CLWA 1XK8A 5J2MB 4ECZA 3PY8A 2VV5A 4JI3F 4H4KA 2DNHA 4FF4A 1AZSA 1YVFA 4UTGA 3NY0A 2GJIA 1TR0A 2XO6A 4ECTA 2ILYA 1X4HA 3LOUA 4ZJQA 2FLPA 3NLCA 2CJXB 3VAIA 2F8HA 2QA4G 3KJFB 3TUPA 2HVHA 3OJUA 3D67A 1TTHB 2YNIB 2V4JB 2EW9A 1W7WA 2FJAB 2HNDA 1U1OA 2JWNA 3FBCA 4DG1A 4DR1F 1U49A 2QSFA 3KYLA 3LP1A 1CEZA 3K89A 4PXEA 3I4PA 4A47A 2YKAA 3UDCA 3MR6A 3V6KA 4K0KF 4BHQA 3MCSA 1U1MA 3MUVP 5F9LA 1JXEA 1ZYQA 4U7UD 3TRGA 4YB7A 3FDSA 3EZ5A 5CAAA 1H74A 1ZM4A 3CDAA 4FN5A 4WIIA 1RLCL 2WW4A 2HFVA 2WOMA 4KFBA 3UE2A 1SUQA 3OTCA 4KH0B 3F73A 4PWDB 1FNOA 3HSZA 4IQMA 1U25A 3AJ1A 1OWXA 2IDEA 2WAQD 2CQ2A 1SKSA 1YZ6A 4OIXA 4Y2CA 4RUHA 1OYDA 3L7UA 1XQIA 4K4SA 4NLOA 1HR0F 1ITPA 3WDOA 4WFNQ 3FBFA 3T9ZA 4DEZA 5C2GA 3MURP 3RW7A 3DU5A 4LUBA 2DR9A 2OD6A 3AQPA 3BN4A 4I4BA 1RTIB 3ZZTA 3E51A 3T3FA 5L38A 1ZETA 4CO3A 2ZH4A 2OLWA 3AODA 1NSPA 1RHKB 3LP2A 3Q8QB 1J5OB 4E0DA 4DPUA 2MZQA 1CQMA 1SPBP 1S4EA 1WKLA 2Q3PA 2YKPA 4OX7A 4P2MA 4OQJA 1HNWJ 4F4YA 1DQ8A 2FZGB 3SBMA 2E7XA 5HVHA 3V81B 2DNLA 4W4MA 1KOOA 5KFVA 2IDLA 4RUBA 4QU6A 3CUNA 3NXZA 1J27A 1E6YA 2HQFA 4UZCA 4CLLA 4G6VB 3VAFA 3N01A 4B17A 5BXIA 2QYCA 5DM6Q 1RWOB 2KZMA 3DLEA 3BQ2A 1MROB 4ZVUB 1FX4A 4DX6A 1R0AA 2JOQA 4FPRA 2F9JA 2PO4A 4WFBQ 3TAPA 2ZUAA 3VWSA 3ZO7A 4JI2J 3CMAS 4IDKA 1S9EB 4DFPA 4DDFA 1XNQJ 2FY8A 1HR0J 4EWTA 2ZVSA 1JLGB 1MU2B 1R43A 3R6GB 1NK0A 4KKOA 3PIPQ 3RB6A 3IM9A 1FRKA 1T0TV 5KFCA 5HBMB 1PO6A 4WFAQ 2Q43A 4MTPA 4X62J 5AXMA 3H90A 2AEFA 1S0MA 4C3KA 4G65A 1LWCB 1WEXA 2QA1A 2M8DB 5IXUA 3IBFB 2MKHA 3T1AA 2M5YA 4OYWA 2BX6A 4Q45A 1VQ8S 4WKRA 1S49A 3H2LA 3LUYA 4AFFA 1GEHA 2HEKA 3GV7B 1U6BA 1Y9OA 4MIAA 3W9HA 2YWHA 3J80U 3R7BB 4OJGA 3JTOA 1WD6A 4DFMA 1IVZA 2J7KA 1NDCA 2YKMB 2WBRA 3CO9A 2UVRA 1FDAA 1FWKA 4O3QA 4ZDNA 5LXYA 3NWGA 4M5IA 2H54B 3DLGA 1S6PB 3MM6A 4OJ1A 4NLDA 1GTHA 4YMEA 2V67A 2D3O1 4DR6F 2J0WA 1NPRA 1S0OA 4R5PA 1J5EJ 2D3ZA 3M05A 1V5VA 3CCRS 3KG0A 5D77A 4ECYA 2FY1A 5A8WA 3I9V9 3A12A 1CULB 1QY7A 4LBIA 3NGUA 5EHHA 4ITSA 2E5JA 4Y2AA 3EZOA 5KOWA 3GJRB 3CJ4A 3M8SA 3ETOA 4I6AA 1RT3A 5ETTA 4M5JA 1RK8A 1MN7A 3QLHB 4Y0FA 1AW0A 2HWIA 3K5LA 3EPIA 2FVPA 5AE1A 3FK4A 2MDAA 5KT7A 5KFGA 3RB4A 4NCBA 4PUOB 2QT7A 1WC0A 3VCDA 4DX8H 3KLEA 4I2QB 1UVJA 1HL6A 1YJNS 1WF2A 3I0SA 1HQ2A 4M1KA 2HFSA 1QM9A 2ZVIA 3BR8A 1X8DA 3TQEA 4XIUA 3ADAC 3HZEA 4Y6IA 2KH9A 3KTQA 4NLWA 2CNKB 3PJXA 4XPCA 4NZ0A 2XNRA 4Q0BA 3OSPA 1T03A 5KFNA 2VL1A 1PJ5A 4KE5A 3S1TA 5EWGA 2R7UA 1YBUA 1WC6A 1SBRA 2OELA 5F0UA 3EZUA 4F0MA 2LDIA 2FJBB 4KO0B 4K8RA 4DU8A 3Q22A 4DUZJ 1M5PC 4A8QA 4ETZA 2HWTA 3ENVA 4QPXA 2GQ2A 2GIFA 5CYQB 2NXUA 1B99A 3D6FB 2IPOB 3UFCX 4LFBJ 2PGCA 1VQSA 1VYAA 3UDEA 5IM0B 4ELUA 2AYBA 2KDOA 2OHDA 3CJTA 3MM7A 2QRRA 4M5MA 5BYRA 1I1GA 5LJ5Y 2CJ9A 2H3EB 3PKYA 3RRHA 3V6JA 4W90B 2BXJA 4RKUC 3BQ1A 1OMSA 2DO4A 3DI6A 5GMDA 4CH7A 1X7VA 4X4PA 6AT1B 1JB0C 4X4OA 5H9FK 3R27A 1N6QB 2M0GB 4KHMA 3N6MA 3LGNA 1U48A 2DISA 3SCIE 3OTOF 3CNQP 2C2RA 3O8WA 4LQ3A 3P49B 3T1YJ 1DTTA 2OPSB 4ZITA 3BKUA 2VQFJ 2FGCA 4B3SF 2X1AA 3RUBL 1N32J 1ZH5A 4O23A 4F3MA 3MXHP 3LANA 1S79A 2MQ8A 3K8WA 1I94F 5D8HB 2Q6BA 3V81A 1YTYA 2ZBIA 4O0IA 2DHAA 2XMMA 1U6FA 3CCMS 2VOPA 4NMXA 2C3MA 1HNVA 2RKIA 4ZCKA 4P74A 1WOOA 5IC6B 2HVEA 4IOAQ 4F26A 3B54A 2I8EA 2RHSB 3BZQA 3MM5A 4CNZA 1M90T 2G4BA 3B6BA 1Q86T 1N54B 3MDFA 3PYDA 1FRMA 1VK3A 3S8SA 2HGNA 3HDSA 4IDKB 5GMKa 1YLXA 3PYGA 1SQGA 2HZCA 3W1YC 4V19J 2ZC4A 4URSA 3O2IA 1FDNA 3F56A 2MYFA 3BGFA 1JXVA 4F2SA 3SXLA 2AYGA 3MOZA 1SV5B 1ZA1B 3TA1A 3DYAA 5A76A 2ROPA 5B08A 1SKUB 4DL5A 2W2QP 5FD1A 2H51B 2N7CA 3Q24A 3G2XA 3MMBB 3H5UA 1JLQB 2FHMA 3LPEA 2ZOMA 2DGWA 3NEKA 2XY5A 3M8QB 2MB0B 1LW0B 2YWKA 2C2OB 3NCQA 4RJVA 5AE3A 1REVB 2Q1LA 4NZ6A 5EN1A 2LEPA 3JAMY 2XZDB 3HP6A 1KQKA 2HBYB 1RQ0A 1FTRA 1HBMB 4ZPTR 3P3DA 2DK2A 5M2RA 2KI2A 5KG3A 4C8KA 1GQEA 1IBCB 2COLA 2LQJA 1X4EA 2NYHA 2PE8A 2V8DA 2Z30B 3GCXP 2DIVA 3I82A 2ZOFA 4LSZB 4EUVA 4K4UA 2YKNA 3BPDA 2B4UA 1F3VA 3UVJB 2PDAA 4KKOB 4NL5A 3TW0A 1X5SA 1RWXB 1TL7B 3DGPA 4QR2A 2B9YA 1CULA 5E3AA 1SH3A 4OI4A 1BUXA 2CPXA 2V63A 4DU7A 4QYZK 1CJKB 1JLEB 1NHKL 3J81Y 2FJDB 3IR7B 1VOMA 2W4PA 2Q79A 2MQNA 4KIAA 2HBRB 3H98A 3NS7B 4CI0B 2CYYA 3PHTA 1H72C 2C42A 4PXDA 3TZYA 1KQGB 4G3IA 4OHZA 1D09B 1GMWD 2QLXA 1CS4A 2BJ8A 4DHVA 2YKMA 3P5TL 4DPXA 1K73T 3HSJA 1JKHA 1IUJA 2BJ9A 2GVZB 4NLRA 4EYHB 2YKQA 1NZAA 1KLNA 4PUOA 1CLFA 2DY9A 1N33J 3W2WB 4ED4A 4UQTA 2QSWA 3HXMA 1WKKA 4PYDA 2VG7A 4AXJA 5E33A 2HQDA 1BD6A 1TQLA 2EK6A 1T9UA 2PSZA 3GZ7A 3OTBA 4LFBF 3C46A 2K3IA 4WWSA 3PX4A 1RHUB 1EETA 3KLFB 2CQDA 1TZ0A 5HJYA 2ALZA 1SC6A 3IAS9 4ZVPB 4R8UB 3K7RA 4LF6F 4Q0BB 3FQLA 2L41A 1LQ9A 1X5OA 1IWAA 4I2PB 2C2EA 4IR1A 2AWZA 2YQ3A 4KHRA 3HJVA 3I4HX 4NCAA 2MJUA 2DBBA 3B82A 1IM4A 3FCVA 4M8LA 3NGSA 2ROGA 4RW7B 1BQNB 2CJYB 4K2JA 4PKDB 2BYCA 1QSLA 4N56A 4JI5J 1RAEB 3K0JA 1GX5A 4M94A 2XEXA 3AA8A 4ZP9A 4DN9A 4JI3J 5F3TA 3PVXA 1NK6A 1FKOA 1RGVA 1YK9A 1FI4A 2XWXA 4FVCA 1OY9A 1B0PA 4G1QB 3ZC4A 3QWPA 3U27A 4DF4A 2QC3A 3A1YG 3D0GE 3DGVA 4NLSA 4PCQA 4RBVA 5DJBA 1HYSB 2RU9A 2HK2A 2HNZB 1HNZF 2RS8A 4DUYJ 1FT8A 4Y28C 4Q43A 1AA1B 2RSQA 2CNOB 3TOQA 1VC5A 4IG0A 2DIUA 4AUKA 5K8MA 2XYPB 4DR5J 1FXRA 1WDTA 1V3SA 3X1LB 2ZNYA 3MFHA 1P1LA 1NMEB 3TVZA 2XSJB 3OVSA 3P5BP 3E2EA 2DR8A 1FCAA 4G1PA 5KG4A 1SL0A 2QEXS 2YKOA 5DQIA 3SMZA 3C15A 2NPFA 4UOHA 4ZIVA 2DYAA 1PJ6A 4NA2A 5H1SV 1YBAA 1ZBTA 3M8ZA 1T3NA 1L3SA 4H4MB 1XERA 3RG6A 1OY6A 1VLYA 3LAMA 4OX9F 1WC4A 2VASA 1FNXH 3CEDA 1EIYB 3H5YA 2JEIA 2W2NP 1UFKA 1QVGR 1SVDA 2WZ1A 4J9SA 2UU9F 2HBQB 1HWJA 1PJ7A 1I6JA 2BABA 4OV6A 4OI1A 2ROEA 1MN9A 4BCAA 3ZZRA 5DG7A 4FP9A 5A8RB 2FC9A 4RW8A 5J2QB 4ZS6A 1JJ2R 3DOLB 3MD3A 1R0BG 5AE2A 1FVSA 1JIHA 3N9UC 4UUXA 3HT3A 4GC6A 1XIQA 2V6AA 2Y1JA 2W9CA 4AE5A 3D1OA 1Y5LB 1LW0A 5CD4H 4IRDA 1WI6A 4JI8F 1REVA 2AP6A 2KRRA 3DDIA 5H9FJ 3T41A 2I1RA 3DC2A 2CIMA 4ANCA 3W62A 2DKOB 3K8VA 1VQNS 2J8SA 4JI2F 2KG1A 2XTJP 4OLOA 4PG8A 2RE1A 5K8PA 3HHLD 3ENAA 1BGXT 4DUZF 4PQUA 2FJVA 2J9DE 3KUGA 3WZ0A 1YSJA 2DCUB 2BW7A 1BC6A 9ATCB 4ZIWA 4ZPAA 2AJ1A 2CPFA 3U02A 4Q5VA 1DURA 3JSMA 4Y00A 2ACYA 4OHWA 1TL7A 1RU2A 4Y2KA 3PJWA 1UAWA 3BSOA 1QLNA 4DSIA 4DZDA 1ZPVA 3AD8C 3BV8A 1U0HA 3EX7B 3OR2B 1HNXF 3J7ZT 1PAUB 2J5AA 3MECA 1FRLA 2IC3B 4X4RA 1Q81T 2V9WA 2FDNA 2LFVA 4LF1A 5HROB 4RU9A 5I3UA 3HKZD 1NH7A 4YS2A 5IS2A 2ZZNA 3O3LA 3RBXA 2BKOA 1FWLA 3DXBA 4X4SA 1NDLA 4QYZJ 3R1HA 3O1LA 1XR5A 1M1GA 3CVKA 2MKCA 1NSQA 1WTFA 5D0GA 3BEGB 4OI2A 3GR1A 4DQQA 1UP1A 3KNAA 2KT2A 4Q44A 1IKXB 1FNMA 4FNIA 1VBKA 1T9WA 2X7IA 2GX8A 2N3OA 4NE9C 4CDIA 3DGPB 2UU9J 2AV5A 3P8BB 3IN5A 1Q16B 2HFOA 4JV0A 5AJ3J 2N7YA 2PC6A 4M5NA 3KK1B 4DS5A 3SFGA 1VISA 1F9HA 1IJEB 3ZZZA 4AQYF 4CLUA 2UXDF 1OYEA 4GO5X 4UOFA 1YGYA 5ETLA 1S1UB 2PFDA 5F8LA 2F4VF 2FVCA 4QCLA 3K57A 4K0KJ 2CA9A 5CH7B 3SDEA 2HS4A 2LEBA 4CH0S 3OPKA 5CZVA 1EP4B 4Y65A 2HYIB 4QW8A 1Q95G 2C2MB 5DRKA 2BJ1A 3CJSA 5AT1B 5D3GB 1C0TB 2MZRA 3ZTRA 1CSJA 1UEVA 5KOXA 3PW0A 3W2WA 3OSNA 5CZXA 1L5UA 2L9NA 1WF0A 2IJNA 2JNJA 1OSDA 1R31A 2NUUG 4HDHA 3VV2B 4DX5A 2DR5A 2IA6A 2CPJA 3RR7A 3TZZA 4UOGA 3W64A 1FVQA 3GR0A 3W63A 1RE1B 3SV3A 1U1RA 2OIHA 1DQAA 3PRDA 2VC1A 3DN9A 3M32A 4FF1A 3N5BA 2B5JB 3R5BA 1WTBA 3LAKA 5I3PA 2MJNA 2IAJA 3KUHA 2VPZB 4X64J 1HQUB 3Q8PB 3VAHA 4B9NA 3M2RA 2E9ZA 1EZZB 3SSQA 1JLEA 4O3NA 1C1CB 1VRQC 2V5HG 5E3QA 4ED3A 2B7CB 2F5GA 2XZTB 3IBCB 2XSJA 4C8ZA 4DV7F 4LBHA 5EDWA 4BC9A 1T05A 1SI9A 4QIEA 1D9DA 1TVRB 3GQCA 1U4BA 1X9MA 1BE4A 2DNRA 3JXOA 1DTQA 4WCEQ 2AIRB 2BKPA 4DV3F 3FSXA 3E8OA 1XWLA 1EHWA 1LWEB 2G0JA 2JHEA 1JKHB 4C8LA 5J1NA 2MGZA 3PJ9A 3C19A 3PG9A 2KXFA 3DLJA 1Q8KA 2J6SA 1Q5VA 5EX3A 1N5YB 1N4LA 4OZ5A 5E41A 1Y5NB 5F3ZA 4O3OA 4TQRA 1RT4B 4JUZA 3R97A 1RU1A 1FXLA 3TR5A 1U2FA 2ATLA 1G3OA 2RS2A 4A8MP 1XMBA 2KT5A 2D9OA 2RVJA 1FKPB 1UZDA 3EM1A 3HULA 1GMWA 3DRSB 1PCAA 4QR0A 3M1VB 5AXKA 2VOOA 4WPAA 3MPUB 1EQMA 2WONA 2DGOA 3A8KA 3CIMA 5M2UA 2YNGA 2QMXA 4PXCA 3TUZC 4CT9A 5KFSA 1S10A 1ACMB 2MLZA 5KG2A 3T6BA 2BV3A 4WF9Q 1P9YA 3MUTP 2LECA 2XB2D 1XNQF 4WK3A 1TMMA 3OBIA 3N5FA 4A8KA 1GT8A 3VAJA 1TL5A 4G1QA 4HDGA 5LSRA 1N36F 1HQEA 1NJIT 4IH7A 2P6TA 3TJ9A 4USUA 4U7CA 3OJSA 2GO8A 3KLHA 1HYSA 2H5IB 2QL9B 2GJ2A 2R2TA 5EGYA 2XMAA 3BM7A 2M88A 3JSYA 4LMZA 3OXFA 4I64A 2Q6CA 5L1KA 2OPQB 3LO3A 1WHWA 4F4KA 5T7LA 3WBZA 3MM9B 3PO5A 2LEAA 3J7YU 3NGKA 4YUDA 1I94J 4N77A 1FEEA 2HBZB 4JI5F 2JC0A 4QW9A 3IGVA 2XLKA 3TVKA 5CCLA 1LXJA 4DL4A 4I7FB 2KHDA 3GLJA 1RBLA 2WOMB 1IQZA 4KFBB 3LA0A 2VPXB 1KONA 1RZMA 4LIWA 5IV3A 4CO5A 4JI0J 4J9MA 3Q0AA 3C6UB 2VPYB 2MZTA 5ETKA 1N34J 5KFZA 1KEKA 4X62F 1KTQA 3DMJA 5JVHQ 5HLFA 1HNZJ 4J9LA 1LW2B 2R7QA 3M8WA 4C98A 2BOPA 2LXIA 1RT2B 2EFOA 2QL7B 1IR0A 5HVFA 3I56S 4UUWA 4RZRA 3OFGA 1HMVB 1ZAWA 2EK1A 2L9DA 3DXSX 3SCJE 4DN0A 2DNPA 1NUEA 3CCVS 4JI1F 3H20A 2EFPA 2VFRA 1QUPA 4ER8A 4M5DB 1S1VB 3MMJA 4I6WA 3I96A 1OIAA 1Q78A 3QFWA 3PW5A 2OI2A 3OXLA 3FSYA 2GO9A 4YHHF 2JEFA 2DY1A 3CMES 4ID5A 5J2MA 5DGAA 4Y2IA 5FJ4A 2P2CB 5E5NA 1KN6A 3HD1A 1RDRA 1UJ4A 3TJAA 1AZSB 3FCWA 2K1RB 4C8YA 1VQMS 3DCAA 4NEZA 4Q7AA 2MKIA 2K7JA 2EC0A 1LFPA 1NKBA 2HHTA 4FF3A 2KFZA 3N4WA 5ETSA 2FZCB 1RBOB 3QRRA 4K4XA 2WSFC 2V4QA 2HRTA 4UQGA 3R3TA 3I31A 2AU0A 2G2YA 2I2YA 4YR2A 3NMAA 2DEJA 2HPUA 4ATNA 4AL5A 2V4JA 1L3UA 2XY6A 2XYHB 4IOBA 1RABB 3PRBA 2BE7D 5KFQA 1XMOF 2CQIA 2PD1A 2O01C 1M5OC 2PI5A 1VQYA 5C5JA 1RT7A 1UA0A 5DLGA 1RTHB 3BYRA 1HPZB 4ZMMA 5D4PA 2GW8A 3EDQB 3U1LA 3M2RB 3CCTA 4DMZA 5A8KA 2FPHX 2RQKA 3I87A 1XNRF 2QYGA 2IRYA 2B4OA 5F41A 1PAEX 3W8GA 4P71A 5IFMA 1KR4A 3TI0A 1BQXA 3BYPA 1JLCB 2XCPA 3JYTB 3JAMU 3LP0B 4EFAC 2AW0A 3DLKB 3GIRA 3WC2A 4MIBA 3ILOA 1YJWS 3PX6A 3IBWA 1D1UA 4C6AA 2ZH3A 3OL7A 3HHLA 3GCWP 2WHOA 3DDKA 2B9WA 1K47A 4PG5A 2LDYA 3DRPB 1S1TB 4PWWA 3UQSA 5KFDA 2IRUA 4W98A 3W7BA 4USJC 3LGHA 5HQ8A 2JSXA 3IRXA 3MMAA 1H7XA 2HAIA 4OHXA 1RT5B 1RTZA 2SXLA 3IC1A 1RTJB 2HWHA 3MI7X 5L8RC 5SUHA 3W2VA 2B4PA 2M7SA 4U8VA 2VF3A 4CO0A 1EB0A 3OUYB 2R8IA 1RTIA 2LXUA 4KJIA 4LF5J 2CQHA 4AL7A 1C1CA 2NCKL 1V3RA 1M5KC 5M2PA 5MLCV 3AA9A 1KHWA 3BF4A 1U7LA 3CD0A 2LA4A 1RCOB 1S1UA 1BXNA 3AY0A 3V2UC 3W5YA 2E5IA 1LWFA 2AHOB 2F63A 2OTLS 4MKVA 1HHTP 1X4GA 1Q1KA 4L73A 3ZXWA 4CYUA 4FBUA 4DX7A 1SJ4P 3V4MA 1TV6A 1E6YB 1Y4ZB 1X5TA 2OP5A 4KPCA 4NLPA 5BR8F 3UD3P 2VA3A 4DBQA 8ATCB 3OTOJ 3KLEB 4F0HA 1DFDA 1N5YA 2R7VA 3OV7A 2FVQA 2EFGA 2HG4A 3T5HA 2ZC3A 3QGPA 4CH1A 3NMRA 2XZWA 1LWXA 3GFYA 1VRUB 3KKFA 5KFKA 4ZP6A 4HT7A 4LRCA 3R7NB 3FVYA 5H9EK 2D69A 3ITHA 1XN9A 1KOHA 3NBPB 5CABA 4JI7J 2YPYA 4DL7A 4LSLA 3DOMA 4HTJA 5KFXA 3KG1A 3G6XA 2AEMA 1IWGA 2DNQA 2YNFB 2VKZG 3WHIA 2J6TA 1IN0A 1RJJA 2NXCA 2VG6B 3POTB 1SL2A 4F3OA 2GQQA 2C2ZB 1OPIA 1N8RT 4HTIA 2R8JA 5E0OA 2JC1A 4DL6A 2NR0A 2KFYA 1TVRA 3K5PA 4ECUA 2HZVA 2B6AB 2OFGX 4KPYA 1F0XA 1VLOA 4LF7F 4TY9A 2MKKA 3CXCR 1T3OA 3MEKA 1DARA 1PSDA 3EPGA 2CJAA 1DLOB 2EPIA 2WVDA 3HCXA 1ZZFA 5U47A 5K20B 3D0HE 2D3OR 1VBXA 2B8QA 1S6PA 3EWGA 3IWLA 1VQKS 5DETA 3QJLA 2B8PA 2FVSA 3GJQB 3QRQA 3DI6B 3QJPA 1LV5A 1RAFB 1F5AA 2QX0A 3ISND 3LH2S 3UW1A 4HHJA 5HANA 4A4JA 3AB2B 1N0VC 2G9OA 2XGQA 2ZKTA 1JXLA 1FF2A 2UUTA 1SKWA 5J2NB 1KLMA 3HSGA 1DRZA 4HR2A 1IM6A 2FLOA 2O66A 3NS6A 3QATA 2W1BA 5DM7Q 1EARA 1TP7A 2BOAA 2CNNB 2HLUA 4QJVA 1WEZA 3OFFA 1H2TZ 4DR3J 4IFYB 4NRUA 3NNAA 3KLGB 3T5KA 1A0OB 3FNNA 2W7OA 4JI6F 1VQ7S 2MY8A 2YNGB 4OZNA 3SI8A 1HBOB 2O3DA 3KHGA 1URNA 2DCLA 2CFXA 5KT4A 3OR1B 2B7BB 4OJ3A 3H4BA 2PN6A 2IM3A 3DFEA 5L1IA 1U26A 3BR9A 2KYXA 2HKEA 4YP3A 4DV1J 2DTJA 1UPPA 4QWEA 3AOBA 3VAKA 3I0SB 4ZVSB 1R0CB 1SQEA 2KJVA 3D28A 3SQGB 5KFIA 4E2FB 1MWQA 4C2MA 2OUGA 2R9LA 2OKQA 1VDHA 3MAAA 4YHHJ 1J5EF 5DO2A 2Z8QA 4UY85 2G2ZA 3BGRA 3J7AN 4YQWA 1VS3A 2H4YB 3LGMA 2ZNZA 2EI5A 1SJFA 2OEKA 1T9XA 3Q2TC 1JJHA 2DB1A 1RT7B 3E3XA 1W2IA 1K0VA 4I0WA 2ASYA 1PIEA 1RTHA 4M63A 4ZN1A 5LSLA 2BVZA 1FTCA 3N28A 2PFFB 3CW2C 3HVTB 3QAUA 4K5RA 1A6LA 2ZEJA 3FFIA 3A3NB 5J2PB 2CZ9A 5THWA 4IO1A 3CDEA 1RLDA 2RRBA 5KT2A 1N52B 1TKXB 2YH1A 3NG8A 1UPMB 3E01A 4YDXA 1YRXA 4I7FA 4PXBA 2HNDB 5HAOA 3UR3C 5C2CA 3EYZA 4DG1B 2DNNA 2FIUA 2AGQA 2R7OA 3MAQA 3CDBA 3DHXA 2JVRA 2IRXA 4IFVB 1ZZNA 4C11B 1S1TA 3FSIA 2K06A 4KV8A 4MYUA 4FYDA 4ED8A 2A0FB 1U02A 4NOHA 1G4CA 4M95A 1VCTA 3RAMA 2DGSA 3UVJA 4BDPA 1WACA 4MIWA 4MK9A 1N6QA 2FQQB 4PRFA 3O5TB 5BYQA 5KFYA 3TX8A 1SC3B 1WNEA 6FD1A 4J9UE 4DV6F 3BREA 4LBPA 3TNVA 1UVLA 3H25A 4C48A 3CJKB 2VODA 4U9RA 1V3ZA 2JX2A 5DZ7A 4RW9B 4GC7A 5H9EJ 2CPZA 1H2UX 2HGMA 2F40A 3L9ZA 4CQ1A 4F7VA 4ZCMA 3HF5A 4B3MJ 2UXCJ 4N8OA 3PNIA 2M2BA 4F0KA 1RWVB 2H4WB 3P4UB 2HHVA 1FDBA 2CRLA 3CCUS 1HNVB 1RAOA 2XI2A 2K1RA 3L4BC 3CCSS 4DZ6A 3H42A 3R5AA 1BWVA 2GVZA 4K4TA 1FD8A 4DR4F 2ACMA 2VFSA 1X9WA 1GXTA 4XAKA 4Q8EA 2AT1B 1WC3A 4KGMA 3G6VA 4NA1A 1D0EA 1HHQA 2VG7B 4C4WA 3EVWA 3GG0A 4DSLA 4HACB 4F25A 3LWMA 1K0TA 2BM0A 3PCOB 3UD5A 4E98A 1VQ5S 3ITHB 1FK9B 3RBEA 4WTYA 1QVFR 1R8HA 1T9VA 2GGPB 3T6JA 2V50A 3DHWC 5ADZA 4EMDA 1QSSA 1S6QB 3W3SA 1HPZA 2QV6A 4AT1B 4I2PA 1MLAA 1FEHA 1WEYA 2D9PA 5HJXA 2VHGA 1CC7A 2WBMA 1SH2A 3MMBA 1W25A 3DNCA 3C2PA 2RUGA 1S48A 4RW7A 4DUTA 1NJWA 1BQNA 4ZCIA 5F8MA 1ZA2B 2GS8A 3G8QA 2CJQA 3LF0A 5KFTA 5LMNF 4ECQA 5K14B 4GRSA 1EJ7L 5KFAA 3NP5A 4A8OA 2DITA 4LRFA 3TA2A 5J1EA 2ZDOA 2P9EA 3GJTB 1Q7LB 5A0YB 2W9BA 4WK1A 4YY3J 4FXDA 3AXMA 1HBMA 2XLIA 3DLBA 4DCPB 4JI7F 2ZBQA 3IRWP 5DLFA 2GNKA 3PW2A 2FLLA 4OFZA 1WORA 3CC7S 4B9SA 3IA0A 5EWEA 4HH1A 2W7PA 3P45B 4F04B 5DDRC 4YEAA 1FWPA 2KXNB 3CJ8A 4MKYA 1RT5A 4X4QA 2LQ9A 2OD4A 1OJ4A 1R8BA 2BM1A 3FZBA 4GKKF 2GMLA 1GK8A 1U09A 4MK8A 3W8PA 3M9NB 5D4OA 5AXLA 2ZJPQ 4TY8B 1N5SA 4BLGA 2ZH1A 1VC0A 1UEKA 3FEYB 3MPVA 4LF8J 1PBUA 3CT9A 3CCZA 2MZ1A 1S99A 3AJ2A 1Q8BA 2ATCB 4M5LA 2RDJA 2C3OA 1DBDA 2B6AA 1HD1A 2F8EX 3RZAA 4LR8A 1TAQA 3BBBA 2AQ4A 5JXSA 1M1HA 1S6UA 2HHWA 1D9AA 4OHYA 2UUCJ 2VG5A 3CCES 4DJBA 4NXMF 3BH7B 3OR1A 3WC0A 1FJCA 1L3KA 2KN4A 2BRLA 1X9SA 1QAIA 3MPWA 4J91A 2UUBF 2RRNA 2WB4A 5B0DA 2V34A 1I51B 1AT1B 3CD7A 3FEZA 4H54A 4LRDA 4Z2XA 1SKRA 3H5SA 3EGZA 1J2VA 1FJGF 1WG1A 1U1KA 1VRUA 4UZBA 1HD0A 2UP1A 1RT6A 3ISNC 2HHHJ 2ADCA 4CM0A 4LSLB 1KLMB 2MSTA 3NWRA 5JVGQ 1Z4UA 2H5JB 3IR6B 4OZ2A 4DV0F 2A6OA 1T02A 3M9MB 2Y8WA 1VRTB 2Z2LA 2CQ0A 2AJ2A 2ZH8A 3C6TA 1ELOA 5DG8A 5GAHI 1B4SA 4I2QA 2DPIA 4IR9A 1NBEB 1W26A 3R5CA 2JFDA 2M52A 3MEGB 5K5MA 7FDRA 5I4MA 2A18A 4KHPJ 3KJQB 4CNYA 3TZWA 4CLSA 4CCHA 4DV2F 1NM2A 4USTA 4ZPVR 2D3UA 2O67A 3M6VA 4NXNF 4A8WA 1WC5A 1H0HB 4IKAA 5IOLA 3VVTA 3ENWA 3QIPB 4LSNA 4RR5A 4ES2A 1Q7YT 1JWWA 3HHNB 3QMQA 5KFJA 2CQ1A 4C11A 1WUUA 4DR7J 2CQ3A 2LXFA 3OVBA 2WRMA 1K44A 3AXKA 5GAHU 3IG1A 3CULA 3A3OB 2ZM6F 1QD1A 4DV4F 3ICLA 4JP8A 3JSMB 4M5HA 2LKZA 4WYWA 1NK8A 3ZTOA 2XS7A 4DV0J 2E5GA 2H48B 4XO0A 1HKAA 4ED1A 5E3PA 5J2NA 1JQGA 4J7CA 3OT9A 1R6VA 5DS7A 4ECSA 4ED0A 2ZD1B 5I42B 1Q79A 4QWBA 1RWMB 4ZLNA 1HI0P 2AX1A 2YQ0A 4ZPBA 4V1Ak 3M30B 4NI2A 4USKA 4FS2A 2DGXA 4DR6J 2GAGC 2E9TA 3QT6A 1SUQB 4NLXA 1N48A 2RRAA 2VC0A 3TX0A 1QAJA 2LQ5A 2RILA 5EUHA 2EKYA 3MHYA 4I68A 5ETRA 6FDRA 1NB7A 2DRAA 4B3OA 5IC4B 5KTQA 1IBMF 2DNZA 3CSKA 4HL9A 5IV4A 2EFNA 3IM8A 3D1HA 3PYFA 2EFVA 3GV8B 2QMUB 2OMOA 4FYWB 5K8OA 2RB7A 4X64F 2VQFF 4DR2J 3T1YF 1SL1A 1H98A 2HMIA 2PA8D 3MR5A 2EFQA 4PG4A 3T1HF 2DNYA 2F8MA 1Y7PA 3W61A 2OSRA 3C3LA 1HFEL 2F9DA 2W2PP 3PX0A 1M1KT 2KG0A 1B0VA 4EI2A 1M5HA 3H40A 1H2VZ 2VBWA 2E1AA 4GKKJ 4MT1A 5K9FA 4WKYA 3HVTA 2R8KA 3MOJB 2XS5A 4R25A 4R0JA 3PKMA 4G1IA 2UXBJ 4DR4J 1NJYA 2BZ2A 5IT4A 2F7VA 3M2VB 1MMLA 1JLAA 2DNOA 4P7VA 3OTDA 5FIIA 5MAOA 1YG0A 3UPFA 1U1QA 1VBZA 2V4RA 2ILZA 3PFOA 4RUAA 1R3NA 2JRSA 1TMJA 2DVIA 4ILMA 2XCAA 3C16B 2ERRA 1YBTA 2IY5B 4IRKA 3D3CJ 4IFVA 3CC4S 2RHQB 4WXWA 2U1AA 4URGA 2QTWA 2Z57B 4HACA 4WBFA 4EK2A 1RUSA 1PBAA 3JQMA 3P96A 4HVZA 4ICLA 4ZLJA 5D78A 4CTAB 4RNFA 5AJ3F 1X0FA 2E7WA 2IJFA 4C8MA 3G86A 3FEXB 3CCQS 3M8PB 1S1WA 4KAIA 3BDPA 1P9QC 3LP1B 4P7TA 4N76A 4ETXA 1LK5A 2CKWA 5HBMA 4ILLA 1IR1A 3KFWX 2OTJS 4CZCA 2JVOA 3OR2A 1HHSA 1R8PA 2HHPA 2RQMA 1X4AA 2J76E 3A8EA 4HEA9 4OZ0A 4ZVFA 1BHNA 1M5SA 4YFUA 1T05B 3M8RA 1KTVA 1RWUA 2BE2A 2VU5A 4MFBA 4K50A 1UCNA 3T5LA 2HIQA 1GXUA 2RDDA 2VUGA 5A0YA 3W60A 4ECVA 1JLBA 1TL1B 1AXQA 4X4UA 4USIA 5BR8J 2CWKA 3MPDA 5GVQA 5A2QU 4IO9Q 5HSPA 2WVFA 4QIFA 1IBKF 3CB4A 3DLGB 5SZTA 3MCMA 2IM1A 4KQZA 5L1JA 3SIPB 1U1PA 3DRRB 3GP9A 4OYAA 1FD2A 4LF8F 2Y8YA 1IBLF 1WJ9A 3MF5A 4CLZA 2I0XA 3NRBA 3R2CJ 3TEGA 3W5XA 1KFDA 3WIVA 4IYQA 1FE4A 3GMGA 4OI3A 2CJBA 1RT6B 1U2CA 1N5TA 2CUYA 2NXEA 2XM3A 4DV6J 4IUFA 4EZ9A 4LF6J 4GKJF 2HQGA 3QT7A 4M5KA 4ZP8A 4LFAF 4WE1A 4WFZA 4DV3J 2R7SA 3A3PB 1YZ7A 1U0SA 1WWHA 5HN0A 1FESA 4MYTA 3KHHA 2BANA 3NL0A 1C4CA 2X51A 4CWBA 1RI7A 3NS5A 3PZPA 2LU1A 3J7YI 3MWBA 4J9KA 1WHVA 2E66A 4NXMJ 2Z58B 3SFUA 4PABA 5K14A 1HLWA 1RAIB 2C22A 4URQU 2KTQA 3W9JA 2ZH7A 3G6ES 2KFNA 8RUCA 4K4YA 3CC2S 3SZ2A 1B7YB 2FTRA 2FJXA 1MROA 5ETPA 1UWBA 2RD5C 2XMKA 3I5AA 2D74B 4L76A 1OS5A 4U96A 5D15A 1UFLA 1KWMA 5HP1B 5DZ6A 2KO1A 2BE9B 1OSCA 3BGLA 4Z37A 2HVZA 3S7RA 4YB6A 4OYMA 4JV1A 1S72S 3QO9A 3VGUA 2CXEA 1HARA 2FHOB 1PYOB 1H73A 1G7CB 4ZVHA 4U8YA 4QWCA 1SJ3P 3GG1A 4I69A 2R7XA 4OV1A 3UN3A 2YNHB 3KJVA 1LWCA 2LCWA 4UW2A 1VC6A 1S76D 2VFVA 3MR3A 4NASA 1VMBA 1Z2LA 4KO0A 2YNIA 1RAJA 3UN2A 1NH8A 5KFBA 3PW7A 4NPOA 4AXIA 5CYQA 3OVAA 3J81j 2ZH5A 3MR7A 4OZ1A 4L75A 4PG7A 3DOKA 3FBEA 1RSCA 2Y0BB 3ZFVA 1XMQF 1Q4RA 1X0PA 5JJBA 1HBUA 3B78A 2BJ3A 2QIFA 3ELHA 4MKBA 2ADBA 4DSJA 3QSIA 1MWZA 3CMQA 4JYAF 1S9GA 2J7UA 2MHEA 3L3CA 4Q8FA 4C0OC 1YRUA 2N4DA 4IH6A 5B0EA 4ELTA 4U67Q 1RT4A 2QG9B 2RNEA 3GYNA 3LPYA 3GIIA 1F6TA 1CC8A 4B9TA 4F8RA 3PM9A 2L48A 3A13A 4K7QA 1T9YA 2GC8A 2L9WA 2O5DA 5HATA 1HMVA 4PWDA 1GXLA 1MNEA 2HHQA 5JUMA 2ZJRQ 2VFUA 4M5DA 4YR3A 3K5NA 1NKEA 3RR8A 2RMLA 1Z2ZA 2GHWA 5GAGU 3QZ8A 3R2DJ 4F4AA 2E1MC 4TQSA 4FBTA 1XEZA 1E6VB 2BDPA 3TUIC 1FFGB 2ZE2B 4ZHRB 3BGOP 2AKWB 4USWA 1U2RA 1N34F 1Y3KA 5F8JA 2IFXA 1VJQA 3GSIA 5A6PA 5HMZA 2W7AA 2KM8B 1RXOB 1UA1A 2ASLA 1F1BB 1YDLA 1GMVA 1MWYA 3NGTA 3QIPA 2LYVA 4FYXB 4HT5A 4LSNB 3TA0A 3L7PA 1EKRA 1WG5A 1KNZA 2KXHA 1XTZA 2FUG9 5F8IA 3L09A 4LF5F 2Y0SD 4OHVA 3TQ1A 2W8KA 4ICLB 3ZTPA 5HO4A 2G1HA 1T03B 3TP2A 1KFSA 5B09A 2DXFA 4OX6A 5K8NA 2BJ7A 2NQPA 2XI3A 1S7HA 3W66A 4LVOP 2ZBRA 4RNNA 3FBBA 1SH0A 4H4OB 2KRBA 5A8KB 4A8FA 3DLEB 4QWAA 1X5PA 3K17A 3TEHB 4AQYJ 2QL5B 3UCGA 5C7PA 1GX6A 3F44A 1VI7A 3BKTA 1NLKL 4LIRA 5T41A 1UVIA 2CG8A 4OYZA 4OL8A 2HURA 5IT0A 4TLQA 4WJBA 2QN6B 2XY7A 4NWBA 4RBTA 1Y11A 4O44A 1XC9A 1KRPA 2HRUA 1R6YA 3N0VA 4J9NA 4DR5F 4KC5A 2GV1A 1ROFA 2LVWA 1EAYC 3JTNA 2C1EB 3DRPA 3TO8A 3RGIA 3G71S 4NYZA 3R5DA 3KLVA 4X2BA 3O44A 1MG7A 4F50A 2ASJA 1RHRB 1NRKA 3D6HB 5G0RB 2R3VA 2YH0A 2X3DA 4CTAA 2ZBCA 3HT0A 4Z7YA 3CCJS 1FHTA 2HMIB 3D5MA 3VF0B 2XO7A 1S1WB 3HPOA 4LF4J 4KGVB 2X1FA 1S1XA 5KFOA 3EDRB 5DDQC 2UV8A 1HW9A 4ILRA 4LR7A 2JLFA 4B3RF 4QBUA 1FRHA 1FO1A 1IKWA 4P10A 2ZH9A 4EBCA 2D41A 3OW2R 3GWCA 2XLJA 1S1VA 3BJYA 3HVAA 5LSOA 1YJVA 4DV1F 3KWMA 2IVYA 4MK7A 4OLPA 5KFRA 2MSSA 3HFVA 2YVSA 4LJMA 3IAM9 4MFBB 3ZTSA 2DJWA 2YXLA 1TL1A 1JLAB 3V5RA 3ZZPA 2YY3A 1IJFB 3I5BA 3EGWB 1VQLS 2WCXA 3FC9A 3I6PA 1S59A 4U95A 1EX8A 4ED2A 2OGUA 2W8LA 2HS0A 1QUVA 4DXLA 1VQ9S 4USHA 3MD1A 2M8HA 3NKYA 3TANA 1TL3A 3TYTA 1YIJS 2EBEA 3LP2B 1J5OA 2UUBJ 1K9MT 4USMA 3BSAA 1L3TA 2CQPA 2DNMA 1XBWA 4F02A 3SDEB 3BSCA 3KLFA 3ULHA 2FC8A 3QLHA 4DLGA 2XBPA 1YITS 5BJRA 2CADA 4D3GA 2AMCB 1CG2A 2C2NA 3VZHA 5KFEA 3FZ2A 3ILIA 3MMCB 3BKFA 4DCOB 2Y1IA 2BR0A 3HSDA 4ZLPA 2ZITA 3I5CA 2GAHC 4KH1B 3EXCX 4P2SA 4K4ZA 1B7FA 3M7VA 1PYSB 9RUBA 1N88A 4HLBA 5F9NA 5ETVA 4DQSA 2BA9A 3M8QA 5KT3A 3DM2B 2KHCA 3DLKA 1YX2A 2BE2B 4Y34A 7FD1A 5D0RA 1UTAA 3VGVA 2CQ4A 5BYSA 2HFNA 1T8EA 1GH8A 3HVWA 1ZTWA 3HHKA 1CJUA 2ZJQQ 4PAAA 2EG2A 2VB6A 3D54A 1LFWA 1TUWA 2WB1D 1IKVB 2BACA 2B43A 2BKNA 1JMTA 2QMWA 3CCWA 3GYXB 4U7UK 4FZVA 4F67A 2CJKA 3ZZOA 4HKQA 3GTYX 2UUAF 1V9OA 2HNZA 2V2ZA 4K59A 4OYOA 5GMEA 3KXDA 2A10A 3HI9A 3U7JA 4ZVRB 2XQCA 2IHR1 3QO9B 4MAKA 1NPKA 2CDQA 4OYIA 1HI8A 3VTIA 2VJUA 1RACB 4YR0A 3FMWA 1P6TA 2KKHA 4JI4J 4CLFA 5KT6A 1RT1A 2KL8A 2AYMA 3MM6B 4OZLA 4QIGA 1YI2S 1OPZA 4B9MA 1RA6A 1YWXA 2V2KA 4OZ3A 4P72A 1VHIA 1CS4B 3C15B 4R5PB 3PIOQ 2RDIA 3DOKB 4FYVB 1NSAA 2GIQA 3Q89A 5KAKA 3WQPA 3GE9A 4QPTA 4TU9A 2RF2A 4C3MA 1TAUA 3SYZA 4I1TA 1WDDA 2G2OA 2C3UA 3KMQA 1C0UA 1Q53A 2XS2A 2I6WA 3KLIB 2V8GA 3KHRA 4KHPF 1CJVB 4JV5F 3JQKA 4RNMA 4LT6A 4RW6B 4WP3A 4O4GA 4C8OA 2FD2A 3GU0A 3EICA 4GVLA 4TU8A 2RKIB 3G4SS 3VHQA 5DG9A 3D9BA 2IYIA 3Q8UA 2J0QD 4RL1A 2MTLA 5L1LA 1RYSA 3D4JA 3FUYA 1QDUB 1S7IA 1TKTB 3D7SB 3QQCD 4XDCA 2DPJA 4J37A 3G82B 3OL6A 1N36J 4B3SJ 2V8PA 4RWWA 2V94A 1APSA 2VBXA 2VONA 3KNGA 2E1PA 3RU0A 5LM7E 4N47A 2W9AA 1DLOA 1SV5A 4WYLA 5F8HA 3R5GA 1TK8A 2BJDA 4P6QA 4PPDA 4X66J 1N33F 3KG4A 2W24A 3RAQA 2NYIA 5LOQA 2XMUA 4DR2F 1TFYA 4RU2A 1LKZA 1WOPA 4HHUA 4BWJA 1C4AA 1RAAB 2MXYA 1S4FA 4BS2A 1NNDA 2DHGA 1SC1B 1K1QA 4IG0B 1XMOJ 1HNIA 1RTDA 1IXKA 3QJJA 5AXNA 1U45A 1G1XA 3PO4A 3DKDA 3M2UB 1TUGB 2AGPA 2R7WA 2L08A 4XTTA 1ZTTA 1TK0A 1HNXJ 2E5LF 3MM7B 2HK3A 3CJKA 3MECB 3PFEA 2CPEA 2XSFA 4IFYA 1HI1A 1SQFA 1X31C 2KVQE 3ZTQA 5HMXA 1FERA 1E6VA 4AD6A 5HMYA 3THPA 2MZSA 2XYGB 2GQCA 2NSCA 3I9ZA 1KVKA 2M4MA 3R5JB 1RA7A 5A2QY 4ZN3A 1RKJA 4B3TJ 1CJKA 2B4VA 1HWIA 3H7HB 3KJNB 4IOCQ 2OSQA 5G0RA 1H38A 2FJWA 3A4TA 1G2EA 1Y3JA 2Z0GA 3MAAB 4X65F 4B3RJ 1S1XB 4K2XA 1YJUA 4F4ZA 2E44A 2B3TB 1G6BA 1NU4A 4DCJB 2ASDA 2D7SA 5D6GA 1ICEB 2RJZA 4RNOA 2A3JA 1Q82T 3RRKA 3MM5B 5HQMA 5C42A 1OQ3A 4DR3F 1K8AT 4CLTA 3MZIA 3EVOA 5A6WA 1EKSA 1OO0B 3ENQA 2MQLA 2AGOA 2G0CA 3DM2A 4LQ9A 4ZVQB 3W65A 4ZK7M 1TFWA 1IQTA 1F2GA 2HQCA 5J1EB 3JS9A 5G4DA 4EGLA 2B0GA 1U1LA 1L3VA 1MW7A 2FJEB 2Z4PA 5IT9Y 4HI2A 2HHHF 4TU7A 2OO4A 3AD7C 3C66A 3DYAB 1TUVA 1IKVA 3SCLE 2R2SA 4OX9J 1JLFA 3NCPA 2OFHX 4PQUB 4RX6A 4KV8B 1UZHA 2ZUGA 2K3KA 4Q2MA 4FF2A 1AUDA 3QRPA 2A2DA 3F41A 2GJFA 5CYJA 4KY3A 1RHQB 2L3MA 2UXDJ 3MUMP 3ZNJ1 4DF8A 2DHXA 2WK4A 4ANEA 2MLXA 2IMOA 3SSSA 4EO8A 3J7A1 1Q8LA 1N32F 2OPPA 2QLBB 1U0HB 1B0TA 2XHWA 2QFJA 1TU0B 3AB4B 4HI1A 1FX2A 4LRBA 4KRWA 2MQPA 3CJ0A 2VDIA 3BS9A 3H0PA 1WG4A 3GONA 4DL3A 4RLEA 2MHNA 5KG1A 2M3DA 3CWJA 3IRXB 2FHJA 1NJXA 2XG8A 1KS2A 2CZVC 1FJ7A 1FXDA 1VHFA 5DQHA 2B56A 1I5OB 2OMLA 2RF2B 2XMWA 3IMQJ 2JJ4D 2V8VA 4A8YA 1RHMB 1JX4A 2J7WA 5B0GA 3QAEA 4KYZA 4NLVA 3V4IB 4F2RA 3U1NA 4YOEA 3WX4A 4X65J 3G6YA 1NAQA 4WZQA 3FRYA 2B9XA 2VH7A 2J6UA 4C3LA 4UF4A 3NOGA 4WIQA 1B3TA 1ZPWX 2E1CA 4MJKA 4PZVA 1VIOA 2DHSA 2PI4A 1VJWA 4B3OB 4J9RA 3CIZA 2CNLB 4LVNP 4FXVA 3KDOA 3M6UA 3IO1A 2J0SD 1UVKA 1SCJB 3D68A 4X4TA 1F2HA 3US5A 4UT4A 1DJ0A 2Y1LB 4QIVA 3FJ2A 3NBPA 3CD6S 4NEYA 1O0PA 2YWGA 4FYYB 2CPDA 4YB1P 2CQBA 4JV5J 2IYGA 4DV7J 1KKHA 2HFUA 1S9FA 5A8RA 4LF9J 1O51A 4PEOA 4HHHA 3TAMB 4E8UA 3GV5B 5GAGI 2XMTA 3QFHA 3EVMA 4N8NA 1NK7A 4TXSA 1A7GE 1IKYA 2DXDA 2ZHAA 4J90A 2B5JA 2WVBA 4AL6A 4PWUA 4J5OA 4ECRA 2D1CA 2YPZA 1UFWA 2V2VA 4O3PA 2OPQA 2J8AA 1R8CA 2RU3A 4TY8A 3PXGa 1WI8A 1FFSB 2CQCA 3AAWB 1QAYA 1D8ZA 3EGNA 1KVIA 3DRYA 3CJ5A 2F65A 5IQ6A 1NK5A 1S6OA 1UJ6A 2V69A 2KB2A 3BDEA 4F4WA 1NJZA 1DTQB 3CCLS 1S77D 1H7WA 2MEWA 1KQSR 2HNYA 1QE1A 3LQVA 1S97A 2ZFHA 4WP8A 2V68A 4JOUA 5KFHA 4NZ7A 4CO4A 4F36A 4Y3CA 4ZKAA 4EBEA 1KDNA 2BJEA 2ZHOA 3BO2A 3BSNA 2MKSA 3OXGA 2JEJA 1S57A 1U6ZA 2BRKA 3OL9A 3BPSP 1C0UB 1X60A 2Z2YB 5CXTA 1ZOTA 2I5JB 3EJMA 2C28A 1NK9A 5DGBA 1Q5YA 3G87A 7AT1B 3BO3A 2KT3A 1YJ9S 4CLPA 2XULA 3UI3A 4DSEA 1VBYA 4UOCA 1YKWA 1BLUA 5KG0A 3PR4A 2E5LJ 4P2FA 1DQ9A 5T14A 5EWFA 4LF4F 1TL4A 3KK2A 1U8SA 2CPIA 4OYPA 4DPOA 4IH5A 4K4WA 2WSEC 1FKPA 4B9VA 4B08A 4QOTA 5GAEU 1SJ1A 1YRTA 2IM0A 2WSCC 4BC7A 3RTVA 2EKNA 1YQHA 4ZVEA 1ZAVA 2XNQA 3ZZ0A 2BQUA 5DQGA 2Y9HA 1KC8T 3SQGA 4J9PA 1T95A 3BO4A 4ED6A 3H4DA 1IKXA 3R8YA 3GFHA 3AOAA 3G82A 1F9FA 3CDWA 2VJVA 5D4LA 2N3LA 2Z56B 4DV5F 4DFKA 2XMVA 2DO0A 1PG5B 2DNGA 1BMQB 1AROP 3HZGA 3QNWB 1C1BA 4X4VA 3D1QA 4RW8B 2FGOA 3HD2A 4TYBA 3K5MA 5J2QA 3A8IA 4GKJJ 2HHXA 3KLHB 1F5BA 4Q2LA 4FNHA 2K8GA 3FRZA 4GMKA 4MKAA 4Z7CA 3IG1B 2LQ8A 4MMOA 3T9NA 2VQEF 2YX7A 4L74A 2CG4A 3H59A 1BQMB 1V6HA 1HWKA 2NPIA 3KUEA 4NLUA 5HVGA 4ZP7A 1QSYA 2IIHA 4QR1A 4TNOA 2H9ZA 1P1TA 5KG6A 1WHXA 4DPYA 2RQ4A 1KP6A 2VA2A 2EVZA 3I0RA 4ZVTB 1SIWB 5B0CA 3GSDA 3MM9A 4LRAA 1YJRA 3P6YC 3LWLA 4OYXA 1NEEA 2J0XA 2M9KA 2ZD1A 4CRJA 3MFIA 5I42A 1MSWD 2AF6A 2XHCA 5IWAJ 3M9OB 4WFXA 2CDRB 5ETOA 4XK8C 2LLZA 4HYKA 2PEBA 4X84A 3ZZUA 1N5VA 4DPWA 5HQLA 2F4VJ 1KHVA 5IQQA 3M4XA 2N82B 1JLBB 4DFJA 4N5SA 1U47A 1KSPA 1RWNB 3S01A 3V6DB 2BW2A 2B9EA 1REGX 4X66F 3DMJB 1YJ7A 2PIIA 1WOSA 1X4BA 3CE8A 2YKNB 4B02A 2P6SA 2VFTA 3Q8YA 2ZZTA 1RT2A 3MMAB 4RW9A 3R1LA 1FA0A 2RT3A 3BBFA 2UXCF 5KFUA 1FKAF 2EG1A 3QZ7A 3S6EA 3HLUA 3OHAA 2R8HA 2OPPB 2X1BA 2R7TA 1UW9A 1MMNA 2JH3A 3HHLC 2WVEA 3I32A 2CZ4A 3QGGA 5HMWA 1A9NB 2J9CA 3LTOA 1KVJA 3ET6A 4ID5B 4KBIA 1DAXA 5B0AA 3QSYB 5DDPC 4KTQA 4LFCJ 5IWAF 2AZ3A 2ABYA 2VD3A 3LALA 1LOUA 4Y2MA 2R7RA 3QWUA 5IT9U 3K59A 4J9OA 3V6HA 2DRDA 4WFYA 2AJ4A 2NXNA 1ZM3A 3HMJG 3RB0A 4B3TF 1T11A 2ZWOA 1WF1A 3RAXA 2YWFA 5C25B 2ZWPA 1IR2A 2WTFA 4CT8A 1JLFB 3UDVA 2HIYA 2ZH6A 2QJ3A 3JQJA 3HHEA 3J81U 2UVUA 2DEIA 1RT3B 4JV2A 1EETB 3T1HJ 2KVIA 4R8UA 1D8YA 2DH8A 3K58A 3HK2A 3J7Z5 3D2WA 4ERDA 4C0BA 1SXLA 2AJ0A 4LF2A 4S0MA 1Y00A 3IWXA 2BMBA 4ECXA 5KG7A 4NYOA 4A8XA 5B0FA 2P9CA 1URRA 2YNHA 3R7SB 3KJVB 4GVBA 2XGPA 3UCZP 2LQBA 4JI8J 4YB5A 2DT9A 4QWDA 4NLQA 1NDKA 3LP0A 3C14A 1KD1T 3Q83A 2IVMA 4O3RA 3MTKA 2OEJA 1JLGA 1MU2A 4P9SA 4DV2J 1FKOB 4OJHA 4QU7A 3K2YA 4P73A 3HM9A 2H65B 1N5QA 2IAJB 2LMIA 4DR1J 4L72B 1HBUB 2UVWA 1SIZA 4L6V3 3EE3A 3VAGA 2ZZMA 1MMDA 2M70A 1CBKA 2I5JA 4RW4B 2HQ3A 3GIKA 3Q8VA 2EEYA 3VGSA 3AFGA 2VBZA 2YX4A 3X3UA 4OI6A 4A48A 4ANDA 4YDDB 2GFFA 2NLWA 3PYEA 4DQRA 4PYAA 1NCLA 2DGUA 3PEJA 3MTJA 3VQSA 4WE1B 5IM0A 1NHVA 2JFKA 3AHPA 3UDLA 4CO2A 2MGZB 2BANB 5HLFB 1LXNA 2BQ3A 3H5XA 4KSEB 4JB8B 4X4NA 1Y10A 4ZPWR 2HS3A 1HBNB 1D3WA 2GHPA 2HNYB 3PHEA 4USVA 3IR5B 1TV6B 3N6NA 2DH7A 5ETQA 5A8WB 2JDJA 3OLBA 4V19X 2C2KB 5B0BA 3UCUP 1GTEA 3OFHA 1DTTB 2CVEA 4K5SA 1UWBB 2VBYA 5DDOC 1VRTA 1VGYA 2DR7A 3D66A 4OZJA 1GAOA 4PG6A 4KGZB 4KB7A 4DUYF 2CVIA 4RO0A 1KBRA 4EEYA 5HP1A 2QE5A 5HI7A 3MEGA 4KT0C 2HVDA 3MEDB 3WX8A 2OJ3A 2ZOGA 2LP4A 3JSRA 3NAIA 1BQMA 1I3OB 5CYMB 3KK2B 1Q8IA 3ILJA 5LXRA 5JMNA 4LF9F 1DY3A 3B4DA 2QZ8A 2Z2ZA 3KDNA 2C3PA 2K7KA 4RWXA 1FRXA 3UNYA 3AOCA 3VZIA 4QIWD 3W9IA 4F3QA 4DSFA 2W2MP 4YY3F 2H1YA 5F8NA 4ENOA 3E01B 2ZBPA 3DDNA 3QGHA 4WP9A 1AUSL 1ZAXA 2IBOA 1QE1B 4PR6A 4A46A 1GFWB 2FVRA 4OX8A 2VQEJ 4ZPDA 2AYEA 2ALYB 3IXQA 3N6LA 3V6DA 1WKJA 3BB5A 3GJSB 1FRIA 1NB2A 2EXUA 1UL3A 2H5EA 2YWEA 3HX9A 5RUBA 3DU6A 3IP0A 4FVMA 1S9GB 1JLQA 2C3YA 3VR1A 5KFFA 2R2RA 3A8JA 4NX9A 3THVA 1JLCA 4CLYA 4WTOB 3JYTA 1OY8A 2Q66A 2MQMA 2WW8A 3CO0P 3TVYA 2YQ1A 4DLEA 3K5OA 3WIUA 3I0RB 2CWXA 2QGFB 4N41A 5LL6d 1N0UA 2YBVA 4J9QA 5L39A 4RNHA 2HSEB 3LW5C 1R8AA 3RBZA
chains in the Genus database with same CATH topology
2DNKA 3KLGA 1QTMA 5FDLA 2AJFE 3G8SA 1LW2A 4NYPA 2MZJA 2QA2A 1QAXA 5GADU 1HWUA 1FDDA 1RKIA 2R2UA 1RTJA 3SV4A 1K1SA 1O8BA 2UUWA 3PW4A 4ZA1A 4ALZA 4EZ6A 2HFZA 5KG5A 1S0NA 1PILA 3OUYA 4ZOSA 4H4KC 2E9RX 2R8GA 5B7WA 1C1BB 1VQ4S 1JNZB 5CCMA 4ECWA 3N79A 4O4RA 3THTA 4ZPCA 5C25A 1N56A 3MM8A 3GIMA 3C8YA 4WXOA 5F0WA 2DRBA 5LJ3Y 1LWFB 1B64A 3M2VA 1FK9A 4TN2A 2QO3A 3VAKA 4F4XA 2B51A 3TARA 3D0IE 5I3QA 2NUHA 2PMHA 3MMCA 3TUJC 4H4OA 1F60B 4R0EA 4MH8A 1WELA 2KYZA 5CQGA 3CJ2A 4FXWA 4DL0C 1CQNA 1LK7A 1ZM9A 2JL9A 2LA6A 2HHQA 1CPZA 4ZCLA 2J9EA 4ES3A 3MR2A 4OMFG 3EXYA 3ONQA 3GIJA 4C97A 2U2FA 5EX0A 5D3GA 3J80Y 1C0TA 2W9BB 3PEHA 3RB3A 3KHLA 4FS1A 3OQ2A 4RUCA 4AYBD 2VG6A 5KFLA 3CPWR 3GILA 2ZDPA 3H2UB 2HHUA 1UVMA 1HNWF 3PV8A 4RW4A 1Y5IB 3M32B 2E29A 2J9DA 4DS4A 4O3SA 2VZ9A 2O1PA 4PQAA 2NSBA 3BQ0A 1Z1ZA 2F3JA 1SJQA 3AQOA 4TYAA 1IKWB 3MPYA 2MQOA 1TKDA 3NAHA 1GNKA 1ZM2A 1UETA 2G13A 3MEEA 2PMZD 1X4DA 3L95X 3MGJA 5L9XA 3SEOA 2DH9A 3T6BA 5IZHA 5J1PA 2C2DA 2UUCF 1X4FA 1HBNA 2XWYA 3CF5Q 2OAUA 2GHVC 2KU7A 4BBYA 1AFJA 3JTPA 2VKRA 3DLLQ 3OTEA 5FLXY 2I38A 1TL3B 3H2VE 1OQ6A 1PGZA 2XC9A 2CPYA 3UNGC 4QYRA 3VAMA 3JB9k 2JZ5A 4I67A 2FHJD 2K2PA 3HVRA 1S6QA 3AH6A 4KGKA 1FE0A 1U24A 2KJWA 3DRSA 1BWEA 3CDUA 5E7OB 2HRYA 2E5HA 3C6TB 2GMHA 5LMUF 2HQIA 2IM2A 1TKTA 3IFEA 2MPUA 3RW6A 2QA4S 5KFMA 1UJ5A 3Q8SB 3RBDA 5C24B 1F5CA 4NCGB 2QLWA 2GCFA 3IS9A 2YNFA 1T94A 1HQEB 3POTA 2N4CA 3DOLA 3M6WA 1AFIA 3FFIB 5J2PA 4DQIA 5LT5A 2HW3A 3MEDA 1SJRA 3U1MA 3RYLA 3NNCA 1TKZA 1UEUA 3NCRA 5CYMA 1TKXA 4NLYA 4QZVB 2BBEA 1U1NA 2DRAA 1HNIB 4BWMA 1RTDB 3O6QA 4K4VA 4ED5A 3CGIA 1QJHA 5T7LB 2KM8C 3HO1A 2I9SA 4UY8T 4C0HA 1YJTA 1XR6A 1HWLA 2UVVA 3FGVA 5KFPA 2NS1B 1R7IA 3M30A 4DWIA 1UW4A 2YX1A 2G1DA 4EO6A 3PR5B 1NO8A 2YTCA 3EUNA 3P6YC 1R89A 1NHUA 2IVFB 3TAQA 1VFJA 5F8GA 1TK5A 2FB0A 3FMBA 4EYIB 1R0AA 3G96A 1TK0A 2P5VA 4IG3A 1VK8A 3FQKA 3PACA 2RH3A 4ID8A 3OL8A 4U6PA 1FRJA 2HGLA 2V0NA 1RP5A 3HFKA 3H8YA 3NGDA 1P27B 3QIDA 5I3UB 5HROA 4RW6A 3NNHA 1FJEB 2HHSA 2OPRA 5CA5A 4C7QA 3SSRA 2CPHA 3GFXA 5KFWA 3KK3A 4H4MA 4IQXA 2W25A 1JK9B 2JLGA 2BQRA 3KOAA 3BGUA 3OHBA 2UZAA 3G9CA 2A2CA 3BGRB 1W2BR 1DHMA 2UV8G 2DD8S 4EBDA 2GGPA 2W4DA 4TKTA 2AX0A 2XMJA 4B9UA 3MM8B 2DGQA 2Y1RI 2NZ4A 4CIOA 2W9CB 2RIJA 3ISZA 4I56A 2GMJA 3M8PA 4EU0A 2ZH2A 1EP4A 4NLGA 4JBCA 4NRTA 1XR7A 3VQTA 3OFEA 2LU2A 4C8NA 4B3MF 4C9DA 2POKA 4O44B 2BUNA 3M2UA 5HL7Q 1VQ6S 1VQPS 2F1FA 1JJ4A 3QPIA 2JEGA 2MQQA 2ZKUA 4HH0A 3MEEB 1S9EA 2APOA 5FDLB 1PC4A 3UD4P 3I55S 3M6XA 4DSKA 3BN7A 2DGTA 1M0SA 2NREA 3HHLB 3QGIA 5L9NA 2IMWP 2A1BA 4XPEA 3QYYA 3UWTA 5GADI 4DL2A 4DR7F 2Z2MA 5E3RA 1R27B 2IC3A 4RBUA 1UMJA 2IA0A 4ES1A 3ZZYA 3W2VB 4WU2A 1RISA 2CQGA 3HHDA 3Q23A 1SB6A 4TLRA 5E3CA 1O5JA 3Q2SC 2GIRA 1LWEA 2V9KA 2VG5B 2JLEA 5C42B 5ITHA 3T5JA 3DRXA 4B9LA 1NK4A 1D9FA 2GA7A 4JI4F 1KQFB 2KZZA 1RYRA 3MAHA 1VIXA 4GO7X 5KT5A 1UVNA 1NKCA 2PA3A 3SCKE 2HVIA 3KK1A 1PC5A 1ULRA 3UR0A 4DQPA 2X1GA 4L3NA 4D3HA 3B4MA 2X3GA 2MMYA 3TAMA 2DGVA 3RRGA 1BY9A 3GB0A 4QQBA 1DZ5A 2V8HA 1YHQS 3G8TA 5CHCB 1IKYB 4DOZA 1TKZB 2R4FA 2E1RA 1X4CA 1Y0HA 2PT0A 3PDNA 2VPWB 1WHYA 3VALA 1P8GA 1M5VC 2W4CA 4A8SA 4W92B 3OLAA 2FLNA 4OI0A 2AJQA 5C24A 4ED7A 3JSBA 1H6KX 1R0AB 1HQUA 3GFZA 4IG3B 4LFCF 2EBGA 3DRRA 3L7OA 4ZVGA 3V4IA 2AD9A 1RT1B 2P9GA 4CO1A 4I6YA 3KMSA 2HLTA 2EWHA 2RQCA 3CD5A 2OH2A 2OPRB 5E2QA 4NA3A 4PPZA 3Q8RB 1H3DA 3C6UA 1JNRB 2MKJA 3KK3B 4JI0F 5D4NA 2ZHBA 3HJFA 3B8HA 4XDDA 3CTRA 2IBKA 2ZE2A 5GAEI 1HBOA 4ZHRA 4WU3A 4ELVA 3KLIA 3T19A 3CJ3A 4WZMA 1HW8A 4O4GB 4KR0B 3IGNA 1C2PA 1S0VA 1UKUA 4NCGA 3DLHA 3IS9B 2OPSA 3IWNC 4NLTA 2FHKA 2UXBF 1VQOS 3HKWA 2PEHA 3M1VA 1CVJA 1HA1A 2MY7A 3FCHA 4NMLA 2WONB 5J2MB 1XK8A 4ECZA 3PY8A 2VV5A 4JI3F 4H4KA 2DNHA 4FF4A 1YVFA 2GJIA 1TR0A 4ECTA 2ILYA 1X4HA 3LOUA 2FLPA 3NLCA 3VAIA 2F8HA 2QA4G 2HVHA 3OJUA 2YNIB 2V4JB 2EW9A 2FJAB 2HNDA 1U1OA 2JWNA 4DG1A 4DR1F 1U49A 2QSFA 3KYLA 3LP1A 1CEZA 4PXEA 3MR6A 3I4PA 4A47A 2YKAA 3UDCA 3V6KA 4BHQA 3MCSA 1U1MA 3MUVP 5F9LA 1JXEA 1ZYQA 3TRGA 4YB7A 3FDSA 3EZ5A 1ZM4A 3CDAA 4FN5A 4WIIA 2WOMA 4KFBA 3UE2A 1SUQA 3OTCA 3F73A 4PWDB 1FNOA 4IQMA 1U25A 3AJ1A 1OWXA 1SKSA 2WAQD 2CQ2A 4RUHA 4OIXA 4Y2CA 4K4SA 4NLOA 1HR0F 3WDOA 4WFNQ 3T9ZA 4DEZA 3MURP 3RW7A 3DU5A 4LUBA 2DR9A 3BN4A 2OD6A 3AQPA 4I4BA 1RTIB 3ZZTA 3E51A 3T3FA 5L38A 1ZETA 4CO3A 2ZH4A 2OLWA 3LP2A 3Q8QB 1J5OB 4E0DA 2MZQA 1CQMA 2Q3PA 2YKPA 4OX7A 4OQJA 4F4YA 1DQ8A 3V81B 2E7XA 2DNLA 1KOOA 5KFVA 4QU6A 3CUNA 1E6YA 4G6VB 3VAFA 3N01A 4B17A 5DM6Q 2QYCA 2KZMA 3DLEA 3BQ2A 1MROB 1NK8A 2JOQA 4FPRA 2F9JA 2PO4A 4WFBQ 3TAPA 3VWSA 3CMAS 4IDKA 1S9EB 4DFPA 4DDFA 4EWTA 2ZVSA 1JLGB 1MU2B 1R43A 1NK0A 4KKOA 3PIPQ 3RB6A 1FRKA 5KFCA 5HBMB 1PO6A 4WFAQ 2Q43A 4MTPA 5AXMA 1S0MA 4C3KA 1LWCB 1WEXA 2QA1A 2M8DB 5IXUA 3T1AA 2MKHA 4Q45A 2M5YA 1VQ8S 4IRCA