4Y0GA

Beta2 carbohydrate binding module (cbm) of amp-activated protein kinase (ampk)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
82
structure length
82
Chain Sequence
QARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Determinants of oligosaccharide specificity of the carbohydrate-binding modules of AMP-activated protein kinase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein binding
molecule keywords 5'-AMP-activated protein kinase subunit beta-2
total genus 13
structure length 82
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y0gA00
1QKZL 4FTVD 4IM8A 4LDEB 4ONGL 1I9RL 3HG1E 1LNUB 1SEQH 3BHBB 2HT4C 3OGCB 3RGVD 3P9LA 3QUZD 5JQHC 5HYQB 1IVLA 2D9QB 1CR9L 4U1KA 3QNXA 3UX9B 2KH2B 2GCYB 1MFAL 1YEJH 1BQHA 5GRZA 4CMMA 1RVFH 1J0JA 1E4KA 3CFCH 3UTQB 2DF3A 2PYEE 2AJVL 3CVHH 4QHLB 1MRCH 1ZEAH 2X40A 4Y16A 5FM5O 1C7TA 4RGMC 5IB1A 3DUSA 5DUBA 1A6UH 1Y18A 1QHOA 4JM2C 3ULUH 2E7MA 1SY6A 1YUHB 3VU2A 2GTZA 4QRSB 1TXKA 1JZ6A 2EEBA 4DN3H 3U9UA 1DANU 1U3YA 1YQVL 3ULVD 1HINH 2I24N 4FQXC 5EO0B 1T1ZB 2ZSVB 3UAJC 1FVCA 2ERJC 2VTFA 1MI5E 1U2CA 2E8YA 1O7SA 2Z92A 2FX8L 5LG1A 1J1OL 2AJVH 3GJEA 2AVGA 1JZ2A 2HMID 3KPQB 3NFPB 5GSVA 5EH1A 5CJOL 1WITA 5D70H 2C3HA 4XMPH 4Q9CA 4LLDB 2VXUL 5T3ZD 4YDIL 4Y1AA 4W6YB 5C0BA 4OBRA 1IL1A 1ZHNA 3QDGD 5CEZL 2C5DC 3UXFA 1RMFL 5L2KB 3H3KA 3MV9A 3CSBA 1CD0A 4RFOL 5CJQL 1S9VA 4Z0BL 4LDLB 5GGUA 5IW6A 4UU9A 4MA3B 3L5XH 2Q6WB 2FX8H 1QRND 4JRXB 3PWPB 3ZE1E 1D5IL 1MPAL 1MH5B 3NACL 3IDYB 3S37H 1G6VK 3SKMB 4IJ3C 5DJXA 5CKAA 4DTGL 2NLJA 2ATPA 1UH2A 4LLMA 3LIZL 4YBLC 4OI8A 3K2UL 4D8PB 5L2KA 3CFCL 2R23B 2YUZA 3QI9C 3V52H 1LVEA 3MREB 3AAZA 4ZXBA 3HNTH 5JUEL 2CUMA 4S2SA 3LZFH 4DQOL 1G7HA 5IG7B 2O5XL 3RX7A 4R4BA 2D0GA 3QIUC 3S37L 1TQCB 2I5YL 4L9DA 4WVRA 4NKIH 4XVUD 3VGAC 3VDCA 1IGYB 4XI5D 1R5WB 3KYMA 1FIEA 3U7AA 4DGVL 5FO8A 4IHOA 3TZVA 1CG9B 3ARBB 1EHXA 5EO9B 4X6EB 3V0WL 5I1GL 3UTTA 1KIQB 4LNVA 1TMCB 15C8H 5BOZG 4D0DB 4IRSD 3OKKB 2R39A 2VIRA 5C0BB 2PTUA 4XMPL 4HXAH 3LRSB 4U6YA 3VFOB 4D0CA 1XR8A 3C5ZD 3Q3GA 5BVJB 2UWEF 1HH6B 5E94B 3CDYA 5D7LE 4P2OA 2C3WA 4OZ4B 3DX6B 2VLME 4PJXF 4NJAL 2OXGA 5TE7L 2A6IB 2X4OA 4PJFA 3H9SA 5IFAL 4ORGB 3V4UH 4JM2A 5EZOH 3TNMB 4Q9RL 3L5XL 3Q6FA 1OWRM 1BLNB 3SKNA 5C8JB 3O41B 2X05A 5F88B 4PUBH 4MJIA 1JPGB 5IHBA 1F11A 1A3LL 3O9WD 3BO8A 4CVXB 4BA8A 3CVHA 4WV1B 3OJDA 4PTUA 3GB7A 5EUOE 1TQCC 3U79A 3CMGA 4UQ2B 2ZJSL 3LSOB 3VXRE 1I8MA 1XIWB 5F8QC 1YJDC 4XNYH 1RFDL 1J0KA 3D69A 5KVDL 3TNNA 5F9DC 2EDLA 2KL6A 4KMTH 4S2SB 3V4UL 5D7LB 4Q9RH 4OFYD 4FZEL 2ZPKL 1WSST 4FQXB 5J6HA 5FHAH 2R0KL 2XWTA 1EHNA 3UTTB 3QUYA 2PO6B 4HXBH 2C1PA 4EXKA 1T4KA 1AR2A 1KJ2L 5D7IA 3IAGC 1YNKL 1RJLA 4OZHE 1XF4B 2B0SL 4LCIH 3QQ9D 2ESVB 1EGJL 1FIGH 3N9GL 1ED3B 2HH0L 1DTUA 1RK1A 1RIHL 3JSSA 2ZUVA 1UWXK 1HH9A 2EE9A 3QDME 1UC6A 3VFPA 3VXTB 5CD5C 4QYOB 3NCCB 3HA0A 1FLRL 2BNQA 5D1QA 1NJ9A 3D1MC 1R3LB 3AU1B 2YN3A 4R2GC 3RX8A 1ZS8A 2OCFD 5IB4B 3LS4L 1XAUA 1A1NB 3BYTA 4GRMA 1NUFA 5GS3A 3SKJL 3SCMB 2XY1A 4JN2A 1U2HA 4QRPA 3HZVA 4RAUB 1YMHB 2XY2A 3PHQB 2Q3AA 2FECL 2Z92B 5ITBL 3DRTA 1U8PA 2H8PB 3RVXC 1FRGH 2DKSA 1A6TB 3AS1A 1H15A 1IGIH 3MBED 4J8RA 4HT1L 3DXAA 3UJTH 1OGAB 2AJZA 3MRJA 1NSNL 3K3QA 1PKQA 2VR4A 2FH8A 1AC0A 3ARDD 2W92A 1KJ2B 5HVWA 1MFBL 2VUYA 2DBLL 2CMRL 5C0BD 4LVHB 5CZVL 1RJCA 5J13C 3V79C 4MD5B 3QDGA 2V5MA 1V5JA 4LVEA 3WNKA 5JW3H 3G6JA 4Y4KA 5IB5A 4OF6A 4YHNB 4UOJA 1RVFL 4QHNB 1SBSL 4OTXH 1F4AA 1UWGH 1C12B 8CGTA 3KPSD 3QIBD 2R56H 1IC5H 1BBJB 4JFZL 1A3RH 4OCNC 1SY6L 1SMAA 4XNZB 3ZHDA 3E2HB 1LE9A 1C08B 5KVFL 1H3WM 5C0RH 2MCPH 1FV1B 1AXTL 4OD3L 2WUBL 2BDNH 1BJ8A 3CDCA 3WIHA 1FP5A 2X09A 2I9TA 1PYWB 1AIFA 3BPNB 4WU7A 3MRGB 1Y6MR 1WZMA 2AV7B 1BHGA 4P48A 4YX2L 3QDAA 5K59F 1JGEB 5E1HB 1NL0L 1KLUB 4P3DA 4JFDB 1N8ZA 4NQDA 4NQEB 4PRHE 1FLRH 3T3ME 3HRPA 4UB0H 3L3KB 3PQYA 1UWGL 4N0UB 2AERT 5FYJL 1LP9E 4MDJA 4PJ8B 5TF0A 4LCYA 1LWRA 4FQXD 4XVTL 3LCYA 4NN5C 5C0FB 3L3GA 4LLQB 4LVHC 1KTDB 3BEWB 5SX4H 5SWZE 3BH8B 5DJ8A 3ARGD 5F93C 2AK4B 3TBVB 3BKYH 1JGDA 4JRWA 2FGWL 4Z76A 3VMNA 5SWZA 3WD5H 5B39B 5A2JH 3WJJC 4CVXA 1WF5A 2EE2A 3RWEB 1B4JH 1J86A 1Z9LA 1ZVSA 1ACYH 2X2YA 4YLQT 4C56A 1K5NB 5DHVH 4MX7A 5C08E 3ZKQD 1LDPH 2JJWA 3IFPB 3U30C 4RMQA 4KRPC 3HS0A 1CXEA 1WFOA 3H9ZA 1IC1A 1T03L 3TIDB 4KROC 2EDBA 1KN2L 2A6DA 3N1PC 4RMUA 2Z0BA 1EZVY 5IF0A 2X4QB 1G0YR 2F54E 1XF2B 4CMHB 4F7MA 1JGUL 1OLZA 1YEGH 3MLSH 3LZFL 3QWOB 3UTSA 4XXDA 3DI2B 4NN5B 4YQXH 4N1CA 3O6LL 4LSVH 5LXGH 4KQ4H 4AIZA 3T1FB 2EIBA 5F1IB 1LDPL 1OW0A 2K9UA 1EFXA 3DX7B 4C4KT 3HS0B 1UQSA 1GJIA 2CKNA 4FFWC 4QRRD 5C0FA 5DYOA 1HHJA 2NPLX 1ES0A 4Q6IC 1OP9A 3S5LG 1W8OA 3CFKB 5B22A 1DVFA 3VWKC 3C60A 3KR3L 4H88H 2GK2A 4JDVA 4MAYA 4RAUA 3ULVL 2QHRH 2QL1A 5F44A 5SV3A 32C2A 5DQJA 4I18C 1JUFA 1FL6B 3WL9B 1XIWA 2GTWB 4DAGL 3CU7A 3MLTB 4HGWB 5CINH 2NQCA 1ZHKA 3FOLB 1UM4L 1AKJB 3OJDB 1KOAA 1A9BB 4P3DB 1JIBA 3VD7A 1BIIB 5ESQA 2BNQB 1XGTA 1R3JA 4KZEH 4RFEA 1T5WA 2ARJB 4DUWA 3MRHB 5E6IC 4NRZB 1A22B 1JF5A 3ULVH 1KENL 1SVZA 1NGYA 4ZUVA 3UZVB 5JXAL 2PTVA 3Q2CA 3V8OA 3MRBA 3BMVA 5GZOC 3KPMB 1D5XA 4NPYB 5TE4L 3GI9H 3G5ZA 4HKXB 12E8H 1ZT4B 2ZJSH 3C9NB 1RJLB 4L9LB 4NO5B 4GMTL 5CMAA 4CUCA 4KHTH 2GY5A 3KHOA 1X5KA 4N0YH 1JI1A 4KDTC 4QOKD 5ICXB 4LGPB 2E9JA 3RUGB 1P69B 2VMFA 4U6VH 4P4RB 5D7SH 1A1OB 1LO4H 3UJJL 3L3IB 4XGZA 4S1DC 2VXSH 3PNWA 1DN0B 5IMMB 1OM3L 1CG9A 1CVRA 1KJVA 3ARBA 4D2NA 4K3EH 5DHVB 4G8GE 3WFDH 1RUKH 4ZTPL 1X7QA 1OGAA 1FNSH 1YEEL 1E6JH 3NIDF 3RWGB 4J3WA 1NBZA 2WBJC 4ZFOA 5LXGL 3SGDI 4I3RH 1KB9K 1MCBA 4OF0A 1UENA 3AXLB 5DJYB 4Q97A 2IBBA 2ATKA 2AEIT 1TNMA 4KI5C 2X4SA 5GZNC 5IV2B 4UV7L 4GAYA 3TO2B 1HIMH 3SDAD 3SDXF 5EUOA 3C6SA 2JB5H 1I7RB 4LQ1A 3KR3H 1ZS8B 4H88L 2AXHA 2QHRL 5DRWB 2Y7QA 2PXYA 4DGYL 5EZLB 3BIKB 1QOKA 3GKWH 1NEZB 1JWMA 4UT7H 1ZLUK 5IWLC 3DLQR 4YDVA 5DJ2B 5HPOA 5F1OB 3IU4H 5SX5K 4BK5A 4OGAC 4L1HA 3D9AH 4CMMB 5HI3C 4OZ4A 2OP4H 4ERSL 4ZD3L 5C09B 5E4IA 5GIRB 1VDGA 4JRXA 5D1ZD 1KULA 3DSNA 1HHKB 3UEZA 3ARGC 1HIML 2CDGA 2AJYL 4JHAL 3ZDYF 4N90D 5JDSB 1IQDB 1UH3A 4C58B 4QRTB 2X70B 2JE8A 4J3OC 4TUJA 2GAZB 1I1CA 1J11A 1BIIA 3CFJB 3MV7D 5DVOA 3HAEH 3UZQA 4H26A 4Z18A 1P84K 3NPZB 1R3KA 5GRJL 3VH8B 5TE4H 4P0DA 4JEGB 3HC0B 5BMFH 1MHHB 1BECA 1XGYL 4IMLB 1S7XA 1MFBH 3RKPA 3VFUB 1TJIH 1OB1B 3BP5B 4GKNA 1JN6B 5I2IB 4PLKD 3OJMB 3MCKA 2F54D 2VDKL 4X9GA 1FO0A 4D9LL 5ID0B 3MXVL 3HG1D 1BOGA 3RDTB 4TVPD 2IPUK 2YPLA 4LSQL 5GS0L 5HYIA 3OJ2C 5IBTL 3S7GA 3LSOA 4OQTA 1BD2A 4MQSB 2GAZA 4IOIB 2CLVA 4S11A 5DC4B 3ARDC 2BC4B 4DCQB 2BCKB 1M7DA 4MXQD 5JQ6L 1IGCL 2E7BA 2NW3A 4CU7A 3O45A 5E2JA 3PWVA 3TBWA 1QFWM 1HKLL 3VFNA 4M1DH 1KG0A 1JJUA 2AJ3A 2ZNWA 1MHEB 1UXSA 5CAYB 3B9VA 3HE6D 2DS4A 3VGFA 3HCVA 4ISVA 4JKWA 5BOPA 1N59B 3MOBL 3QUML 1K4CA 3HB3C 3MOQA 1NC4A 4HUMB 5IT2L 3RVVC 2CR6A 1G7MA 2QSCH 4PJHA 1G7LB 3W39A 1AGCA 4G6KL 4HIIA 4JFDE 4K7PX 1H5BA 5JQ6H 3BE1H 2DQHL 3CDFA 3MBEC 3HMXL 3RNQA 2QTEA 2P49B 3BZ4B 3T0ED 1SJVA 1T0PB 2R2EB 1RD6A 4O2FB 4QF1A 3MLWL 1QSVA 5IHLB 5I73B 1TNNA 2BY0A 2G9HB 1BEYH 3NZ8A 4WNQA 3PGDA 4ZG1A 1QR4A 4GQ9L 1AD0B 1X3DA 1L7IL 3IS0X 3DO7B 4LBEA 4WHTA 2VLRB 5A16B 1YN6A 5ESAB 1A7NH 5LWYH 1I8LC 5EU6B 1A2YA 2R0LH 2NXYB 5IM7A 4E0RB 5ACZB 3OR7B 1ORSA 2H26B 5ALBH 5MHSE 1HI6A 4HG4J 2NY1D 1SJHB 3V4VH 5HGDB 4PJ7E 3C2SA 1RZFH 1YQVH 3WSQL 5T1LB 4HULB 1S9WB 4BZ2L 4KWUA 2IQ9H 1WWBX 5HPMA 2XOTA 2J12B 4P2CG 4L9LA 1XGUB 1U3JA 2XKNB 4F9PC 1BVLA 3EKCA 1FG9C 4G9DA 4PR5B 5DR5H 4FQ2L 1T5XB 5IBUB 1FHGA 1I3VA 1SQ2N 1FNEB 3NGBC 2WUCL 1H8OA 1BF8A 4LQFL 3BHBA 3KHQA 4R90H 2HMIC 5CEZH 1HDMA 1X9QA 2IALA 1MFAH 5IR1A 2D03L 2YSSB 3GSNL 1U8IA 5ISZD 5ABDE 2XXMB 3ZMRA 2ZG2A 4PS4L 3QCUL 4K9EC 4QOKA 1HK6A 3AMLA 2VDRH 1ZT7A 5DVKA 4Y1AB 2B39A 3U48A 4LLDA 1HOCB 4MVBD 4W81A 4OKDA 4ZO9A 2VE6A 4AEEA 4LIQL 1BQHG 2RR3A 4NNYB 4HIEB 3BSZH 1W0YT 4GRLD 2H3NB 5C0AA 5IJKC 3OGOE 2H8PA 4ALAH 2ICCA 3RI5K 3IDYC 3FQXB 3DNKA 4HMCA 3QCUH 2Y07L 2GK0B 4K3DH 2QADD 3CK0L 4JFDD 5E08L 3VFTB 2HT2D 1J8HB 1AHWC 4RMRA 5DLML 3RTQD 2W65B 4ZNEE 3EJYC 4K8RL 3T4YA 1U42A 1OP3H 3WFHA 3KPQA 3LKPB 4Y19B 1IFHL 4GKZA 3AU1A 5KSAC 1YJDL 3PGFH 3H42L 2DB8A 1JGVL 5GGVY 2X4QA 4NKOA 3FT4B 1T66C 1KGCE 2P7TA 1AO7A 3OJVC 4R6UA 4QYOA 3IDXH 4U0RC 2I27N 4F7CA 4EI5D 3QPQC 1BAFL 4F8QA 2GJ6E 1E6OL 3V5KB 1TJHH 4S10A 4XI5C 3F7RA 4PJHF 4U6VL 1RSFA 5H94A 4I3SL 5DXWA 2BVOA 1LO4L 3UJJH 4PB9H 4EVNA 4KKCC 3K2MC 3JWOC 4LCWE 2VSDA 1A6WL 2I9LB 1HKFA 3OBAA 4AEHL 1FZMA 3EZ8A 2VQ1A 4FN0A 1QQDB 4KRPD 1KN4H 1E4XH 2WV3A 3IDXL 1OTUD 4G43A 2I26N 4NNXB 4X9BA 3KNBA 5F6HI 4KVNL 1T7WA 4O9HH 3U2SB 1KJ3H 5F89A 3MNVA 5KSAB 2DLGA 2GJZB 3P0VH 3MFFB 5GGSA 3C8DA 3S8WA 1RJYB 2DQUL 3IU4L 1D5XB 3GKZA 4OLVH 2GJJA 2P48B 2Z4QB 1J8KA 4IOFC 1D6EB 1EFQA 5F9JB 4DGIL 3PWPE 4KVCL 4LHQB 2QQKL 1X44A 3T8XB 4ALAL 2ICWJ 2NYYC 4EUPG 2O26U 1U3HA 4MNQB 4BQ8A 5L6YL 2FX9H 1YYLH 3SO3B 4XWOD 1FV1A 3MV7E 3QHFL 2VH5H 4Z7UA 1YNLH 2LU3A 3VXUE 2UWEB 3L9RB 1K3IA 2SEBB 3PGFL 4NHUB 4PGDA 1HQ4A 4P2OB 4JPIB 2ITCA 3VFWA 1CE6B 1MF2L 1XR8B 3Q3GB 4PJAF 3RWFB 4PJIF 5DD0H 4FZ8H 4D9QE 2PCPA 4NKMA 1HHIB 3EOBB 2UYLA 1DE4B 5EBLB 4LAQH 3JWNC 4GSDL 2PF6A 1P4LA 3FFCB 3VG0H 2R2HB 4MD5A 3L5WA 4LVNC 2UVFA 4G42B 1G1CA 4PJGB 2OR7A 3KJ4C 3EFFB 3L3HA 5EC2A 4JG0L 1FFRA 5J7CC 4QT5A 2MKLC 2MOVA 4PRPE 3CFEA 3KLAA 3MRPA 4PJ9C 4ZDHA 5JZ7C 3DVIA 2QJDA 5KTEH 5I1IL 4O2CB 3UTZA 3P11L 4JHWH 4KU1A 1CD9B 4DZ8A 1T21B 1WC7B 4F7EB 4NZTH 2CKBH 4LAQL 4N90E 2IAMB 4GSDH 4QOKB 3BWUC 1KIRA 1MJJB 3DVGA 5DJAA 4NT6A 3DI3B 1YNTB 2XZCH 3REVB 3B2UC 2D7NA 2ATPB 4ONHA 4UILL 3GSNA 1NANI 3VG9B 4OV6F 4ONFH 5DSCA 5D2NC 1HXMA 2VXVL 3D18B 2MWCA 3K46A 1GGBL 2NY5L 3RVUC 3A0OA 4MX7B 2BXZA 2SEBA 5DUMH 4Y2DB 3BMWA 3VFPB 3VXTA 3SDYL 1GGYA 4ORZC 1ZVSB 1YC7A 5JA9A 4N8PA 2BSRA 3LH2H 5DD6A 4K7PH 4FABL 3BVNA 3HR5B 2AI0H 5EZJA 4L3ED 5HGHB 3IFOB 4MS8D 5MEQB 1RK1B 2EC9T 3GSWA 3HI6H 5J6GA 2IMMA 1YNLL 2WBJB 2FNBA 1OY3B 4MJ4A 5B8CB 3V0VA 5GRYA 2XKNA 4A6YL 3O2WL 3CSYB 1DL7L 1ORQB 4IJ3B 4HWBL 5IOPA 1QR1A 2X1OA 1KPVB 4L4VE 2IBZY 3MC0A 4QTIL 2CGRH 1NBYA 2X4TA 3B5HA 4I1NB 1N3NA 3G6AA 1V7MH 4W6WB 5T1DH 4FFZL 3MRNA 4XPTL 3BN9C 1U8KA 2BVPB 5E9DE 1MPAH 4YEEA 4MLSA 2AXGA 1F42A 4QHUA 2VLJB 3P11H 2O61B 2ED8A 1INEH 4G6JH 4X98B 4U3CA 2X4UB 5F88A 3H2WA 1I1YB 2DQCH 2RAMA 2XZAH 3QIUB 3VDAA 5MP6L 3GIVB 3MLXL 3FO9B 4BSVB 1QBBA 2FYYA 5D2LE 3P4OA 3BKYL 3BZ4A 4QHNA 1BQLH 2P4AB 5HHVL 3GEWB 4DFHA 4F7CB 3LHPL 5D8JL 5IB5B 1V7ML 1VB9A 1LILA 3QHZL 5KN5A 1AGCB 4XPTH 1WLHA 2X1QA 4PP1D 1S8DA 1S7QA 4NKOB 4UDTA 4ZAKA 4F15B 4PJIA 5JPNB 1ZHLB 1TENA 3C6LB 3HMWH 4H0HB 2VXTL 2Y06L 4X6EA 1FNFA 2VAJA 5AUMB 4BFEA 5C0CA 3LRGA 2V9TA 1PKQB 5T1KB 5KW9H 2IADB 4HWNA 5HHMB 1RZKL 5F9OH 1VFAB 5HDLA 4F58L 1CU4L 4PJ9A 2W0KA 1NL0H 1I8IA 2YZ8A 3GMPA 4ETQB 4MA8H 4ZUSA 3FFCE 4F9PA 2JIXA 4RMTA 3HE7D 3RRQA 15C8L 3BZEA 2I25N 4WUUB 4YUEH 4WFFD 3IF1A 1EXUA 1IKNA 3CK0H 1EEYA 2FZ3A 2YA0A 3QR2A 4G80B 1CLOL 1NBVL 4PJCE 2A74B 2LTQC 4WV1C 4BJLA 1EBPA 2ZSWA 4Z7NE 3QWQB 2MHAA 3EGSA 5D2NB 4LEOB 4JFYA 3DETC 1G9MC 4Y2DC 3F62A 3LKOA 5DHYA 2FGWH 4KRPB 1IQDA 1T1WB 2EICA 2GSGA 3VXRA 1Y6KR 3NGBB 1I9IH 1JNHA 1EHLL 3GGWA 1G6RH 4H26B 3WHE1 1WBXA 5DD5L 5E0QA 1S3KH 4I18B 2NTSP 2BVEA 4MA3A 4JRYA 2ZSWB 3U83A 1WGOA 3WKMH 1QLEH 3MFGB 3BPCA 1NGQH 1EXUB 1NCAH 4K9EL 1OAUL 4M1CD 1VADA 3HRZA 4PRDB 3FZUD 1S7WB 3HB3D 2WZPD 1EUUA 3VGDA 5CEZE 4YFLI 2MPAH 4LOUD 5TGBA 2R0KH 2D7QA 1P4IH 2W0FA 5JXAH 1LE5A 4NKDB 2EDHA 5E7FA 4YQXL 4OM0L 1KJ2H 4YHIB 1JL8A 3PABB 5FKAA 5SWQA 2XTJC 4RWYH 5KSAD 3DROB 4ODTL 4NWTL 4Z8FH 5GS2H 4HJJL 3OR6B 3DGCR 5KN5B 3I50H 1DCLA 1MNUL 2Z91B 4XP4L 3K2UH 1F13A 2NY0B 4ZOCA 4X5LA 1X5FA 8FABB 2P8MB 1OAUH 1LEKB 4HUWA 1INQA 3FFDB 2MPAL 1BLNA 2V7HB 1FVCB 3O4OB 4P5KA 3SKNB 4DOHE 1NDMA 4XP5H 1YYLL 5KVMC 5JHLL 4XCFH 4L8CA 2A2QT 2WAHA 5I8OL 4I0PA 1WCBB 3VXNA 4FQHB 3DX6A 4QGTA 2OJZH 2Z8SA 3HN3A 4ZUVB 1MFCH 1FL3A 1HE7A 5FF6A 4LCUA 4R97B 3VXSB 1ND0B 4HDIA 4WI5A 5F71A 1X5IA 4LLVA 3U1SL 2OS7A 1YEHL 2R1WA 3UYRL 5T1MA 2YS4A 2GITA 5DK3A 4OLWH 4U6HA 1I3RB 3FRUB 1QO3A 4MA7L 3LN9A 3WDIA 4NGHH 5JHDA 2OMBA 1X5JA 1YY9D 2FSEB 1PEWA 5JLZB 5ECJE 4BQ9A 3CSYA 1T2QH 2GTWA 1P7KB 2NZ9C 3T2QA 4ZD3H 4JQXA 1HHHB 3N50A 4JHWL 4JO3L 3WXVL 1B3JA 3D39E 5ELIA 4KDTA 5KJRH 2F5AH 3KXFA 5L2JA 5FHBH 3QEHB 4O51B 2A77H 1DUZA 3U36A 3B8YA 1TZGH 4CJ0A 3BEVA 5D1QC 1T2XA 3BVNB 3HR5A 3HNVL 4PJ5B 1CDCA 1A1MB 3QAZB 1B2WH 3B2VL 3Q48A 1CYGA 5FECB 1F6AB 2YK1L 3CH1A 1IC5L 5DA0B 5TDNA 1WZLA 4MAUH 2NMSA 4UMGA 4JFOA 3REWA 5T5FL 4YR6B 1XF2A 5DD3L 4NDMA 2BY3A 3AFLA 3TT3L 3NFNB 4WFHD 4AZ8A 3TJHC 3RPIA 4XXDB 3NTCH 3MNWA 4UQ3B 3IAPA 5I0ZA 1MQKH 2P5ED 1EEZA 3RVUD 3C87A 4PJEA 1AQDB 5AWNL 1KLFA 2OJZL 1N5AB 1IM3B 4OFPA 5D1XA 5DZLA 4GXUN 4P5MA 5EO1A 3ZSSA 3DMMD 4Z7VA 1I1AC 5TFSH 5J1TC 1T0MB 3ULSA 3MCLL 5SX5H 3R06B 4M1DL 1MAKA 3A67H 3AREB 4UTBH 4W4NA 3VFSA 1S7TA 5TDPB 1KCVL 4D94A 4KJPD 1MCQA 4XVJH 5C08A 3BRFA 3TFKC 1K8DA 1J0YA 2DTML 3M17A 5GS1A 3GM0A 3W0WB 3TEUA 4G3YL 1UCBH 2D7OA 2Y36H 4OI9A 1A6VH 1HHIA 1KC5L 4ZXBD 3WHE0 3GJFB 5J1SC 2P8LB 3BN9D 3E6FA 3O4LD 3B2UD 2C3VA 2UWEE 3D0VB 4JQVA 4KJPC 3MLYH 3TT1L 5HYSG 4A6YA 3HC3L 1Z0MA 1J10A 4PP2B 4TRPH 5BXFB 1QZ1A 2DWDA 2XG5A 4HUXA 4XBPB 3HFML 4U1IA 5J11B 5FHBL 5I17A 1KCVH 4YDJA 5ETUB 1FGVH 4C4KO 4HK0B 5IBTH 4CADB 5LJYH 1S7RB 1WCQA 5CEYA 3TPUB 3TZVD 3RAJH 2WINA 3OF6A 4HHAA 2CSPA 3DOSA 3QA3A 3B9KC 5ICZA 4B7IA 1PW3A 2CDFA 5DK0A 5JZ7D 4U1KB 1F90L 2MJWA 2ZWLT 2VC2H 2EDYA 4WWKA 2Q76A 2VITB 3U4AA 3INUL 4HEPG 2XXCB 4QXGH 2OBGA 3EUUA 5T3XE 2BZDA 5SV4A 5HYJE 4M6OL 3D25A 3NCJL 1OAQH 1JYWA 4Z77A 4RAHA 4KY1L 3GSUB 4JM2D 4U3XA 3NH7L 5ICZB 1OW0C 3RWHA 1QFWL 3BW9A 3W9DB 3GSQA 5HJ3B 4WEBH 1YYMH 5EIIA 3AUVA 3L1OL 4J23A 5CEYB 4HIJA 4BKLB 3MRKA 3L7FA 1NMBH 2H45A 4RDQF 3PUCA 4U31A 4WFHE 1DUYB 2XTJE 5E6YA 1YPZB 2BDNL 4HKZB 4CW1B 1YQ2A 2F58H 3QDHA 4A6YB 3QIWB 3J8F7 4HJ0C 4I13B 4EBQH 1F4XL 1NAMH 1N5AA 4FG6D 4XPGL 4M1GH 4BQ6A 1A6VL 1ZOXA 1WWWX 3TC9A 4G5ZH 4PJ7F 3MRMA 2RCSH 4PD4J 3TZVC 1EERB 2VDOH 2YKLL 5MEOA 1I7ZA 3WUWB 3U6RB 4XNMB 3VFVA 3DRTB 1VGKB 1KPRB 4KROB 4OBSA 5DEZA 4WWKC 1MI5D 2I9LA 4R0LB 1CGTA 2ID5A 3QEUA 5M7QA 1RZJC 2HTLD 2IPTL 4WFGE 4NUJB 5T1KD 2F54B 3CZJA 3EJZC 1FGVL 5CKGA 2A6DB 5CZXD 2VDPL 4J3SA 4N0YL 2ZCKL 5MENA 3RWIB 1PX3A 1HHGA 3OXSB 2DQTH 5D72H 4HFUL 5D7SL 5HVHC 1FPTH 2YPLE 4UTAH 3FKUS 4W6XB 2CIKB 2VAAB 2V9QA 3ZZ1A 1ZGLA 3LEXB 4N0RA 2VLJD 3DV6B 1A4JB 4FFVC 4HKBB 3MV9D 4Y5YA 5F9JA 5L0QB 1M6OB 2FJFB 1FN4A 4JQVC 3QXTA 2VZOA 1DQDL 1QRNA 3KYKH 4YXKL 3H3PL 4ZUTB 1HSBB 4OFDA 4X99A 4OZHA 4Q9BA 1RIUL 3PWNA 3VFMA 5C9JB 1JMZA 4PJ5A 3ES6A 2V6HA 3ARGB 4HIEA 3O11B 43C9B 1I1AD 1JK8A 1V05A 2YD5A 1CDBA 1SHMA 3O9WA 4GFTB 4YGVA 5E6ZA 2COQA 3P73A 1KLGB 1XGPB 4ELMA 1LO3L 1AIFB 4NQTA 3ZT6A 4OFKA 3CXHJ 4FQQA 3MUJA 4K7PY 4EXPX 4P2QB 2BNQE 2FR4A 2JLLA 1AGDB 2GEEA 5CZXC 2VDOL 2E6QA 1D5ZA 3H7BA 3QDMA 1OQOA 1BVKA 1AP2B 5BW7A 3BUYB 1BWWA 1KBGL 3QQ9C 1G0XA 3E8UL 1A6PA 3LQAH 4OFYA 1U8NB 4U1LA 5IW1A 5D6CB 3BI9X 1AO7B 3CXHK 5HI5C 4RRPA 2HFFA 2AABL 4ETYA 4LPUA 2E9WA 3WLWD 5KVGL 1U8LA 4NQXB 4NOFA 5BVPL 1CFSA 3BQUC 1A7PL 1C5BH 4XCEB 3QJFB 4RGMB 4NUGH 5EBGA 1WAAE 2VLKA 1R5IB 3SY0A 2EDXA 1AQDA 5DD0L 3EOAA 3QFJB 4YNYB 2M8XA 2R4SL 4AJ0A 4JM2F 4BFBD 4JY4B 4FTVB 3O9WC 1NC4B 4R2GB 4GG8B 3QCTL 4KVNH 1U8HB 1M05B 5D1QD 3RGVB 2DWEA 1WTGT 4H0GA 1DQQB 4NM8H 4P46B 1F2XK 4PLJD 2AKRA 1CFNA 4ELKB 5B3JE 4JFXA 2ZOKB 3K8KA 4K3EL 2XQYG 2DMCA 3TYFA 4NOBA 1UM5L 1T3FA 2VB5A 3SKMA 4JQXC 4FNLL 4M7LH 4TQEH 4LGRB 4CDGC 5HVHB 3FQNA 3ET9F 5FOBA 3V6FA 2FX9L 1HN1A 3O3EB 1N2RB 1WBZA 5FM8A 2AXFA 4HMEA 5HI5D 3X3FL 2F8OA 2OR9H 4XRCA 4X5WB 2VZSA 3IS1X 2ESVE 4L4VD 5TQ0H 2OJEB 4NRXB 3DXAE 5B39G 1BOYA 1HSAB 3BD5A 2QQQA 3HHRB 3C5SA 3ETBF 1OT2A 5GSVB 3OXRA 1MEXL 3MQIA 4ERSH 3ABZA 5LAXB 1O5DT 4N9GB 1VFAA 3TN0D 1IZKA 3MYJA 3FAWA 3MODH 3MA9L 1U95B 5ILTH 1QVOB 1Z9MA 2PETA 3O3EA 3MO1B 2F5BL 1NGWB 2JJSC 3HC4H 4KK5D 5TDOB 3WE6B 3HI6L 4GG6B 3TLRA 3V6OC 1G9NC 3U0WL 3EFDH 4RISH 3ZHLA 1JTOA 2Z31B 4YAQB 5I8CA 4MXQC 1IGJB 5DHXB 1HZHH 1L9MA 3KAAA 3PDOB 5DMKA 1I8IB 2YUXA 4M7ZB 5EIVA 2CK0L 3X3GH 4LPCA 4LEXL 4LU5H 4LCWA 5T1KA 2FATL 2FHBA 4L3CA 5BZWB 5J9PB 1RV6X 1YMMA 2F5BH 4PS4H 1ADQA 2ENSA 4UBDC 3GNMH 2LAGB 1FYTA 1OAQL 3V8CA 1MRCL 3O4LE 2Y5TA 3I75A 1MFEH 3RZWA 4KY1H 2XNAB 1UXWA 2NY1B 3CC5B 3GJFK 3NIGF 4JDZA 4OLXL 3RIFK 1IMHC 5FA3A 1S9KC 4RFNC 4F7TA 1S7VA 1NCDH 4WTWA 2ED7A 5DRNA 5DFVD 1PG7W 5D2LB 1HINL 1J12A 1LEKA 5CLTA 1MCPL 1CGWA 1VADB 4OF8A 2F74B 3T0XA 1LQSR 1IEHA 4DFIA 2B20A 4I2XB 2CO6B 1RURH 1LD9B 3QXVA 4NKQB 4DEPB 5DJYA 2CDEA 5IT2H 1VERA 3LVEA 3FL7A 3BQUB 3QXUA 4C54A 4WW2A 4QY8B 1N2RA 1DDHA 1WBZB 3MRCA 3E6HA 4NKDA 1HYSC 1TJGL 4WO4B 4KK9C 3QDMB 4Z7UE 5CD5D 3W2DH 1OTSC 2ZUWA 2XV6B 1MCEA 3DIFA 4IDJH 4P49A 4CRPA 1I85A 2VWEE 3MRRB 1AI1H 2J6EA 4LSSH 3X12A 1XGPA 4ELMB 1BFSA 1MOEA 2X1XR 4WJ5B 3P4NA 2LV4A 2ZCLL 3FN0H 3C9NA 5CP7B 3MGTA 2AKRB 4TTDC 1CGXA 1INEL 3RL2A 2BXYA 4JO1H 3NOIA 3TP4A 1TZIB 1A6WH 3S35X 1O0VA 4WCYH 4U7SA 35C8L 3RZCC 2H9GB 4K71B 4JKMA 1RMFH 3OAYK 5D7JB 5ITFB 3MYZA 5JIKA 1A7RL 2KKQA 3ISWA 2YRLA 1IEAA 1EO8L 3G04B 4ZFFB 2OZ4A 2XN9E 4GW4B 1K8IB 5D7KD 3AVEA 4PJXE 4M9PA 1D5IH 3H3PH 5GZOD 4XCEA 1XF3A 4YXLL 3IVKA 1ZTXL 1NGXB 4IIQC 2Q3ZA 1NGZA 5MENE 4TNWF 3LN5B 1IAIM 3T65B 1I3GL 4XVUC 3S3JA 3ZDXF 1OGTA 1OCWL 3I6LD 3NN8A 1SM3L 4RA0C 5F1NA 3EOAB 1CLYL 2ESVD 3V0WH 1U8NA 3EJZD 4EI6A 5ISZE 1EO8H 5IIEA 4Z7QF 1G9ML 1CICC 4KHXH 4G8IA 3BPOB 3KYOB 2BMKA 1NBVH 3OB8A 4Z7UB 1NBQA 3C5ZC 2XN9B 3RL1A 4GO6B 3VFVB 4UDTB 4ZAKB 1KJMB 4DZBB 3SE4C 4NO3B 1T66D 4NJAH 4NO5A 1DQML 4QHLA 5HGBA 3NCFB 3QH3A 3N1QC 5SWZB 3RZCD 4OCMC 4LSSL 2H2PD 3IDNB 1CFBA 5IVXF 4TPRH 5LGHH 1I85C 2Z93A 5ANMA 4BFIA 2Y07H 4ZTOL 1KELL 4TNVK 1AGFB 4C83B 1XH3A 3GMOA 5FYLE 3DMMC 4KPHL 3L5JA 1F3JB 2V7NB 2HG5A 4WEUD 1U8OB 4G7VH 4ZFGL 4JGJA 4JFEA 3QIUD 3KVQA 1QBLH 3MV7B 5E03A 4RFEB 1DBKH 5FOJA 4G43B 2VKWA 4Y5YB 3B4NA 4YGVB 5DJZA 5BRZB 1D6VL 1CE1H 5B38A 3GSUA 5F7KC 1KGCD 4N0FB 3IDGB 4E5XB 2QR0B 3FO0H 4X7TA 1NCUA 4PJCB 4OM0H 4MSWA 2Q8AH 5SWSE 1A6ZB 4OUUA 3MV01 4HW6A 4H1LA 2YPKA 4NQUA 3SGJA 2K3TA 1I3GH 4OLEA 4Z7WA 4P59H 2FECI 4TVPL 2X9WA 1H0DA 3TO4C 4Z8FL 2W60A 1OP5H 3KS0J 4LLWB 1ZGLP 2X42A 5E99L 1F3DJ 3B9AA 5I1DA 3FQTB 3O6ML 4Y1AD 1MWAB 2YD8A 3LEVL 3OKOB 4MJ5A 5FGCE 4HIHB 3U46B 1GZQA 2M1KA 3KLDA 2K7PA 2RJMA 3D3VB 4H8WH 4YC2B 1FZOB 4KK6D 1D9KA 1I7UB 2G5BB 1ZXQA 1OGAD 2EKSB 3QXDA 3FQRA 2D7MA 2ICWA 2GK0A 3VFRB 2QKIA 3NFSH 1CFTB 1J0ZA 4YDLC 3U0TB 3CSPA 1NFIB 5H35A 3UROR 4P57B 3SE4A 1EHAA 3LS4H 4P4KB 3O3AB 4QRRE 5DDHB 1AD9A 2CIIA 2XT1B 5HYSB 1EAPB 4KJQD 4D9RE 4BH8A 5K9JL 4LCCA 4HS6B 4QRPB 1BFOB 5ILTL 3FT3B 3K8MA 4WW2F 4NGHL 4FXKA 4KPHH 4MXVE 1A1NA 1GOGA 3HI5L 4FHBD 3U7WH 5JW4N 1UM6H 4EOWH 3WFBH 5GRXG 4UUJA 5KSBA 2DM7A 2IF7A 2P5EE 1XF3B 4PLOB 5C6WH 4IRJB 2DQEL 3O8XB 5IJVB 4APQC 5BCAA 3P0GB 2X4PB 5J89A 3OB0H 1U8IB 5ITFA 1H15B 4UTBL 1A6TA 1QSEB 5HHOB 5CZVH 5DK2B 1X5YA 3HZVB 1RUPL 3VMPA 4GRWB 5KAQG 2ADIA 3RY5A 2B4CH 5HJ3A 1LHZA 3BJLA 1A14H 2C3XA 2BK8A 1JPTL 4NO0D 4JG0H 3GSVB 1V3JA 3O2VL 3QPXL 1OD9A 4MXWL 3QIBC 3U7WL 2J5LB 2J8UE 3K4ZA 5C0JA 3AM8A 1FO0H 3WFBL 5DT1H 1SY6H 4HZAA 4PG2A 1VEOA 5KVFH 2GJZA 3OTTA 4YJZL 3BD3A 5D5MF 4X9FA 5KW9L 3MACL 4NBXB 2FX7H 4Y4HD 1EMTL 4P2OD 3GSXA 4P5TB 2PTTA 3BKML 1CZ8L 5GS0C 3MJGX 5D5ME 1IC7L 5E6IB 3BP4A 4EI5A 5C71A 3H9SD 1A14L 1TPXB 5I1AB 1N4XH 1XF5B 4F2MA 1NFKA 2HLAA 1YN6B 5ESAA 5F3BB 1K8DB 2ZUQB 3ARPA 3IDIB 3LS5L 4GW1B 4X83A 2EXYD 4YDJB 3INUH 1GH7A 1IT9H 4MQXD 5FYKL 4YWGH 3VXSD 3MNVB 2EZ0C 4B50A 1MVUB 4QF1B 1U8JA 1MJ7H 1PSKH 4WW2C 1F6LL 4X6DF 1BP3B 4L9LC 5JW5A 1LK2A 4E0RA 4YZFE 2IC2A 1U41A 2W9DH 1PKQE 1KC5H 5EDXA 1QLRA 2NX5D 3JZ7A 2XKSA 4EOWL 3G08A 2CKBA 4CNIB 2BX5A 5IJKA 1NCCH 5LVEA 3EYUH 3DO7A 3WIFB 1FVDA 3SOBH 4GRLC 3HC3H 1E4WH 1ZA6A 1X6LA 4RQQB 3MX0A 3V0AC 1VFBB 1FGNL 2PYEB 1QSFD 2I60L 4G8EB 5F96H 1UCTA 4KKBD 4P4KC 4JLRB 3RBGA 1MAMH 1T03H 1LK3H 4U1SB 3O3DB 5A3IC 3QULB 3RZCA 3PXHA 4PJFB 4KTEL 2BOCA 5DMKB 1U3HD 5I19L 4MXWH 5F1KC 1JPSL 4GAGL 1UACL 1WFTA 4PGBA 2CD0A 3S5LB 1UVQB 2IWGA 1ACYL 5IIEB 1MVFA 4PJ8D 4Y1AE 3LQZB 5C7XH 1J0HA 4S1RL 1NFDA 4RWYL 2BNQD 4ODTH 2P42B 4WWID 1N0LA 2YHGA 1B0GB 1L0XA 4KTDL 2P43B 2F8XC 1W72A 2AK4E 3VFNB 3N1GC 1Q9KB 4JGUA 1S5IL 3HC0A 4IRJC 5BQ7B 1FBIL 3AMKA 1J1XL 3LPFA 2A9MH 1UKQA 3C8KB 1VGEH 3C5SB 5C0EA 4DCQA 4LHUG 5DRXB 5DTFA 4ZNEA 1WT5A 3WN5A 2X70A 5FV1L 1LP9B 4JM4L 4LKCB 3ILPB 3VXPB 3SHSA 1MCJA 4K3JL 4KZDH 2H32A 4EBQL 2V17L 3QZWG 2BNRA 3RJDA 3L3OA 4G6AC 5DJ6A 1ODAA 3NBNA 5FYLD 3BPLC 1AY1L 2ZOKA 4MZ3A 4MXVF 3TYFB 3KPNA 4HH9B 4JFFD 3VCLA 3GMMB 3AB0C 4HJGA 2Y1VA 5DURD 1M05A 3H9SB 5HGAA 5C0AD 2F53B 3MV8A 3RVTC 4AL8H 5LCVL 1BJ1J 1DQQA 1N7ML 3G6DH 3DRQA 5I9QC 4WUUA 4JO4H 1YMME 4HGKC 4UOW0 3PGDB 5IEKA 1FL5B 5E94A 1N6QH 4Z0XB 1S9WA 1ADQH 1U9KA 1S3KL 1XGQA 2EXWD 4NN7C 3VGAB 3QDJD 1INDL 5AD0A 3BPOC 5A2LH 3U0PB 2LFGA 2VABA 3STLB 3WKML 3MRFA 3S34H 3CXDL 2IANE 2B4CC 2R69L 1I1FB 4MQ7B 4M7KH 4K23H 3RWGA 3SDAB 1VGEL 3QG6B 4N8CL 4D3CH 3T04D 2VLLA 1I9JL 4U1LB 4N9OB 3NA9L 3R0NA 4Q9QL 3CNKA 1LNUA 1KUMA 1PEZA 4LRNL 5FO7B 4YHPB 2CQVA 3WN5C 5J9PA 4JDTH 3RVWC 1JBJA 2BNRB 3MOAH 4L4TA 3MCLH 4GXUM 3SGDH 3DJ9A 3THML 3W0WE 3QRGH 3GHEH 1KLGA 1QSED 3LKQA 5HHOD 5I75B 4TSAH 3S9DB 3PF2A 3FONB 4NCC2 4H1LG 1IM9D 2X1PA 1IAIL 2BVQA 3SO5A 5EN2B 4PRPA 1D5MA 4XBGB 5JIPA 1REIA 4OZHB 3IJSB 5F7HA 2R1YA 5FGSA 1C8PA 1FE8H 1S9VB 4BZ1L 4JRXE 3MLYL 3TT1H 1S9YA 3X11A 4EUPA 1T5WB 5C0GB 2GUOB 2AJUH 5GSRB 3K7UA 1EFXB 3DX7A 4M43L 1RZ7L 4WI8A 5EU4A 1KB5L 2AV1A 2A9NL 2VZTA 2AJYH 4JHAH 4WI6A 2BSTA 3D85B 4Z7UF 2IJ0C 4D0BA 3SDAC 1S8DB 4UIMB 2Z8WC 4OZFH 4QRRA 3M8OH 4XP1L 4HV8A 4L3EA 3GSOA 2JIXB 2OR8A 3C60D 3AS0A 3CDGA 3TWCH 1BD2E 2HA1A 1CTOA 3P4OB 4R96A 5CUSL 3HMXA 1BIHA 2WWMD 1DLFL 3U4BH 4X80H 2G75A 1K4DB 1YNTA 3S88L 5F1IA 3VFRA 1NAKL 2P44B 2YXMA 1CICD 2X4RA 3T77B 1U8HA 1JZ7A 4N8CH 4U1SA 5K9KA 1OP3K 2IAMA 5BS0B 3VD4A 4M3JA 1T6VN 3EOTL 4OGYL 2Z35A 4U1MA 1BM3L 3UTZB 4DZ8B 3NAAH 4JDTL 4LF3A 4DKEL 5JW5B 2OI9B 2WLZA 5I18L 4MAUL 4K8RC 1J18A 4URTB 1SJXA 3I02A 2E8ZA 7CGTA 5FYKH 4MS8C 3IGAA 3PNWB 4KUCD 2CRYA 3O8XC 5E24E 1QFHA 2NY7L 4KMLB 2DL2A 5CP3H 4TSAL 5F97E 1BZ7A 3EHBD 3MLRL 1KIUA 3DURB 4K8RD 3RU8H 2NX5E 5EC1A 1RHHB 5LGJA 4FG6C 4N0UA 3GK8H 3BGFB 4BYHA 2FJHB 5FKPB 3CZFB 3P4MA 5TPWH 1G9NL 4IRSB 4L3EE 1MUJB 3IDJB 2AJUL 4W70A 3WFZA 4X4ZA 4OKVB 5EZJB 3TVMC 3QUZA 1WK0A 2I9TB 4PG9B 3DX9A 1H3TA 3DX8A 4NRZA 4MCZB 3S3PA 5ICXA 2BNRD 4J3TA 2J6EH 1GGCH 5C07A 4YDLB 2ICWI 4XZUB 1HXYB 5KSBE 3EDKA 3N1FC 3STZA 3CLFL 2NY3C 3BWAB 3FCTA 1MCSA 4Z95H 3X3GL 1MWAL 4U1JB 1T22A 3N06B 4LEXH 2V2TB 4YO0B 2UZXB 3CPLB 4JZOB 1DQJB 1NLBL 5DJ0A 1G6RB 5DO2D 4X99B 3ZDZE 5I1LB 3KPLA 2RGSA 3LMJL 4MCZA 4GW5B 3EO1A 1IAKA 2ADJA 1KSRA 2JJUA 1L6XA 3T2OA 3L7EB 2N1KA 5D9SB 3O11A 3B9KD 1TVBA 3GSNB 5JR1L 2V5YA 1OT1A 3FTGA 3MR9B 4K7FA 3SJVE 3B5GA 3IJHB 5I1EH 2DLFH 3PWNB 3VFMB 1LO5B 5BV7L 4HPYL 4HWEL 2YBRA 1E27B 4HC1H 1Z9OA 3QWOA 2VC2L 3VI4E 4ONGH 1NCDL 4GLRI 4JN2B 1JUFB 3UTTD 3VD9A 4X6CA 1AGBA 3O3BA 4GRLB 2DM3A 2DIAA 3EOBA 4PV9A 3T08A 4OD2A 2P5WB 4OCLC 1NUGA 4WFGD 1CS6A 3DUUB 1UZ6F 1KCSL 3CVHL 3FQWA 5F3HB 1GPOL 5A43C 4XCCH 5F7MC 5DVNA 4HK3N 1WZ1L 1JRHL 1GOHA 4BUGA 4U1GB 4XNUL 2XWJA 1A6UL 5ID1B 4UAOC 4U1HA 3BZFB 4GW5A 3UTSB 5H35B 4XNXL 3TBSA 3E8UH 5GJTH 3EYVA 1KEGH 2IQAB 4X6DA 5IEHB 4NCDA 1PJ9A 4K94C 1XT5A 2OTPA 2PYEA 3MRLB 3KPRA 4XAWH 3OKMB 3MLPA 4N5ED 5E8EB 1I7TA 1FFPA 5JMOC 2JB6B 1FSKC 5EG6C 4J6RL 1TZIA 3F7VA 2XTJD 1OTUC 1K6QL 5I1DB 1MQ8A 5E5UB 2DKMA 2F8VA 1OARL 4M6AA 2HTKD 1NAML 5GSRA 3O2DA 2A6JB 4H25B 1CD1B 5TH2A 4NBZB 2R9HC 5CP3A 5E2VL 3RNKA 2EIEA 2CUHA 1MCKA 4MDJB 1LEGA 4Z7WB 1EK3A 4ZUUA 4YHKL 2PNDA 1ZLWH 3OSKA 2R4SH 1PFCA 4EIGB 3E6HB 4JANB 5D1XD 1XZ0B 2HP4A 3DMMA 4N1EA 4Y5XA 4GXVL 4KTYA 3MXWL 3NCYP 2ZPKH 2YBRB 4AMKH 1OLLA 1KCKA 1AFVH 5IWLA 1BZ7B 3OKNA 5B3JF 1G7JA 4KH2A 3TJHD 4F9LA 4QTHA 3MBXL 4E41B 3HZYA 3QRFM 2NW2B 3C5ZA 4Q9QH 3RTQC 1UM5H 3ZTJG 4LRNH 2VISA 5MEPB 4DVRH 4EEEA 1QBLL 3WKNA 3IAQA 5H2BA 3CLEH 3F12A 4XC1L 5TE6H 3QEQD 4HUNB 1FL3B 3P9WB 5KVEH 2H2SD 1UXWB 4HX1B 1SMOA 2Z93B 1GPOH 2BOBA 3QQNA 4FQHA 4QGYA 1CICA 3QSKB 4L8BA 5BXFA 4Z7NF 4OB5H 1MCRA 4D9RD 1CFQB 1VSCA 4FQPA 5TQ0L 1EDQA 1KIPB 2XQBL 3IETA 3H3BC 1V7NH 3FFDA 4JQIL 1JYNA 4NKIL 1FDLH 4R2GD 2DQJH 1KCUL 3VXUA 3ZL4L 5LBSL 2OTUB 5TQ2L 4F3FA 1Q0XH 1JMXA 3STBA 2V9RA 2QQLH 5F9WC 3SKJH 1FH5L 4AH2A 3OX8B 3FO2B 1KB5H 3QIBB 6FABH 2EIDA 4PJAE 2DJUA 2C3VB 3D0VA 2DIBA 4AENB 3TJEH 4U6XB 1YEDB 3TPKA 3GFUA 5JW4Q 5BO1H 2XA8L 2PW2B 3VWKB 4U1GC 5DEGB 3TM6A 1R24B 5JORB 2Q20A 2YD1A 3EYOB 4HUKB 1E27A 5KTEL 2H3NA 4UOW1 5C0AB 3B9EA 4NC1E 4PRDA 5JPMB 3KYMB 2IFGA 5FO8B 3MXWH 1FH5H 4MNHA 4DWHA 3L3DA 4QHKJ 1MFDH 3EW3B 2W9LA 3SE8L 3SGKC 4J2XA 2H2SC 4OZIE 4GRMB 3HUJF 1KPUB 1R3HA 2DM2A 2GJ6D 4Y4FB 3REWB 5GGTA 4I18A 2KPNA 1OAZH 3WIHL 1WZKA 5BJTB 4I3GA 2DQIH 1NCNA 2EE6A 1E28B 2LAAA 1GRWA 3O45B 1CLZL 2OYPA 5CEXA 1CDGA 1UZ8A 1UT9A 5TE6L 3DIFB 4NQDD 4X7FC 4RNRB 3B3IB 5C07B 1I4FA 1KTLB 1PBYA 4K2UH 3ZKMC 5AYQA 5T3ZE 2AJXH 5ESVB 1QD0A 3MRCB 1DDHB 4HXBL 3GMQB 2J8UB 2APVA 3HE7B 4KJWC 1F5WA 1OAZL 3WIHH 4APQB 3CFDB 5HXMA 4MNHB 3GK8L 4M93B 4HKJA 4Q6IA 3HZKA 2BSTB 1Q72H 5CHNA 5GS0D 4V1DD 4GUPB 3MMEA 3UPCA 4WHYH 2G9HA 5C2BL 3QQ4B 4MB5A 5SWZD 3RZCB 3N9GH 3VDBA 2GUOA 3V5DB 2EYSB 2NY6B 4Q2ZB 3ZKSD 3G5VA 5A2KH 4UT9L 2D3VA 3MLVH 3VGHA 3CFIC 4O00A 3MJ8A 4JFQB 2MSPA 2XA8H 3QEQB 3CMOH 3KPSA 1U8LB 3CFBB 1IKFL 4XTRD 5JOEA 1QFPA 3LS5H 3WEXA 5CBAA 5JNYB 3PHSA 4JFEE 1MLCB 4LLAA 2RBLA 1DEDA 5D71L 1B0WA 1MEXH 5EU7E 4OJFL 3TIEB 5DRWA 5DMIH 1MI5B 3JV5A 5IK3A 1NLBH 4BSVA 4OGXL 3GUTA 4QRSA 4FFWD 1A7RH 3LMJH 2O61A 4XNZC 3T4AA 5FO7A 1YN7A 1Q9LA 1FRGL 2X4UA 2WBWB 4QHMB 5ALCL 1UADC 4Y19E 4ZO6A 5DJ6B 4F33B 3U0WH 3UJTL 1NDMB 4PPTA 3CFBA 4FQQB 2ORBH 4P4KD 5HDBE 1INQB 1ZVYA 3RA7L 3NACH 4M03A 2H32B 2BVPA 1E4WL 2Y06H 1JWSB 4FXGB 4GS7C 2BY2A 3BXNA 4J1UB 5IFJA 1UB5A 5J12B 5F7UA 4I77L 1JPFB 1T1YA 3PG2A 4IMLA 3C5ZB 3WFCH 4D0DA 4DTGH 2EZ0D 2XWBB 5FM5M 3ARGA 4PJ8C 1RZIA 1Q0YL 5IVZB 2BHUA 1CD8A 4Q0XL 1RU9L 2VLMD 4LL9A 3OWEA 2E9BA 4ZSOB 1IT9L 3HR6A 3GSVA 4ODWA 2B2XH 1F4YH 1KB5B 1UM4H 5EZIH 4WU5A 2NY3D 2D4FA 5C09A 4PLJC 4MD4B 4ZFZA 1JF1B 1J5OL 2IBZX 4X7CC 3CFDA 2NTFB 3MRIA 2YOCA 4NWUL 2VXQL 3VWJB 4BFGA 4Z0BH 3P9MA 2AXFB 3W9EA 2BOCB 2D31A 5D93B 2HRLA 2KQMA 2WP3O 4X6FB 4LEOA 5T3ZL 2XTJB 4PRIA 1OF2A 1RU9H 4RGOL 1UYWL 4JLRA 1OAYH 2HVJA 3GO1L 3U4EA 4NN6C 4Y5VA 2GSGB 2J88H 4GS7B 4XAKE 1OAXH 4U6XA 1CFNB 3MLTA 4HGWA 4MJ6A 4RWHA 4YHZH 2ZNXA 3WO4C 4JRYE 4F7EA 2IGFL 1MAML 3BX7C 4LSRL 3DHJA 2HN7B 4I9WE 1ZT1A 5C07E 4WTZG 4PJ7A 1Q94B 1T1ZA 2ZSVA 4Z7VF 3WS6A 2YC1B 3LQAC 1TLKA 5ENWA 3F65A 3F58L 2BFVH 3CUPA 1ONQB 3SE3C 2FWOB 3K0WA 4PJGA 5C7XL 1SYVA 3A6BL 4DOHB 1Q8MA 1BQUA 2JCCB 1F3RB 5ISZB 1UB6B 4HG4K 5FYKE 4TUOB 3C08H 2RIKA 5FV2A 3WFCL 4BZYA 2OQJA 3N1MC 4NZJA 1G9EA 4BH8B 4AEIH 2E7HA 3E0GA 3PWLA 3F7YB 1MWAA 4F3FB 2O5YL 5TJWK 4JVPA 1FNGA 3FO2A 4KMQA 4LLYA 3EZJB 4RGND 3U0TA 3FMGH 3GMRA 2RHEA 1JNNL 3K80A 5KSUA 4OB5L 1BVKB 1DR9A 2EDKA 2VLJA 5LQBH 1M7IB 2P5EB 1A1OA 5I8OH 1CXHA 3ORJA 4L3CB 3TF7C 3IDMB 3FOMA 5DUBB 2BSED 5IKCB 1GGUA 3VRIB 4MHHI 2V17H 3GIVA 5HHNB 3T8XA 4WI9A 5EUKA 1MLCA 3DMMB 5I16B 1CIDA 1T6WA 1EGJH 1VCAA 2IAMC 1OPGH 1FAIH 4CGTA 1G9MH 5HYQA 1J0IA 2Z31A 4PJ5D 4TTDD 4XP5L 4YAQA 4JFEB 5I8CB 32C2B 3TJEL 5IESL 3IT8D 5IMLA 4KJYA 2CPCA 5TH2B 4QWWD 1ES0B 1MY5A 3IRPX 2OTWB 4JY5H 4RX4A 1RIVL 4M8VA 3ZDYE 2C7UB 2B1HH 1N6VA 3QEQE 3VA2C 5JO5B 1U0QA 4JZJA 1KPVA 3TV3L 4V1DA 4JPVL 2QR0A 4XNYL 2L0DA 2PKDA 1BD2D 4I5BB 4KUZH 3O2DH 2FBJH 1PZ5B 4OLUL 2AEQL 4AT6B 3HI1A 4MB3A 4APQA 5BV7B 3VRIA 2CIKA 3QWRA 3F58H 2B4CL 3CCHB 3KXFE 3H8NA 4RZCB 1CGUA 2C3GA 2LTQB 3K81A 1FVEB 3P77B 4HGMA 4KV5E 4O5LL 3SDXE 4X4XB 3LB6D 5SWSB 1CF8L 3C09B 4OCYL 3NZHL 5C0ND 5D6DA 1RZ7H 4WI2A 3BGMA 4JGMA 5F7WC 1FYTE 1CK0H 4Y4KC 1AJ7L 2HYMA 4L8SA 3QO0A 4KUZL 1G0DA 3JV0A 4OCRL 3B8SA 2ICES 4QCIB 3QUMH 4K2UL 4JFFB 1U8MB 5EU7C 4UT6H 3EO0B 4KK6C 3I6GA 4BSWB 4OQTH 5IROC 4OTXL 3O4LB 1NGXA 2YD3A 4OM1L 5EA0L 4TTGA 4OSUL 5FA4B 4AG4L 1FFPB 2EH8H 2MQ3A 1NCBH 1X6NA 5HD8D 3DYMA 5J11C 1MJUL 1TVBB 1YEKH 1X5HA 4O5LH 1KTDA 3BEWA 3DXAB 4IRZH 2YD7A 3THMH 3U6RA 1N5YH 1ULVA 1K85A 2KDGA 4YWGL 3MROA 4TVPE 4NFBA 3DHMA 1NAMB 2C4FU 3MRKB 2IH3A 1R24A 5GRUH 5INDA 1QG3A 1UKSA 4UUJB 4UIMA 4XPBH 3FO1B 5ITBH 2F15A 4PJGF 3HI1B 3UC0L 2R2BB 1PZUB 4DKAA 4MYWB 3IKCA 1D5BB 2BNRE 4MLIA 1BFOA 1RIVH 2B1AL 2R0LL 1HXYA 1ZGLM 1SYSA 5EPMA 3SOBL 2EH8L 4X6FA 2LVCA 1G7PB 1GZPA 3V7MA 4NM4L 2NX5B 5FUCE 4Q74A 4QXUL 3HE6A 4FQ1L 3QYCA 3KLSA 1A5FL 1G6RA 3TCLB 4TSBL 3PV6A 5GPRA 1F58H 1NC2D 3B5TA 1SBSH 2ZUQC 1H3PH 1KNOA 3PE9A 4ENEC 2PW1B 1KLUA 3JBG7 4LK4A 4HBCL 3LV3B 5F9WB 5KG9B 4HK0A 4CADA 5FF6B 3QJHB 4X80L 1A64A 1DN2A 3KGRA 4TUOA 4HQQL 4KK5C 5IVNA 4TULL 1PQZA 2BJML 3MPCA 3IDMA 2WUBH 4S1QH 3S37X 4B0MM 2FJGB 3EYSL 5CJXA 2W0PA 1LO2H 4U1IB 1LO0H 3TGXA 4MNGA 3TH3T 2XZZA 4TSBH 2FO4B 1GGTA 2BMKB 2FEEL 5HGDA 2FHFA 1KYOK 1OTTD 1SEBB 4OZGF 1FNLA 1QRKA 2A9ML 2APBA 5IM7B 1GL4B 2X4PA 3HE6B 4NFCA 2J4WL 4NP4H 2Y5TB 2Q1EA 2X7LB 4NRYA 1R5VA 2C9AA 3ULUC 2J8HA 3QDGB 4XCNA 1WT5C 5MERB 1CBVL 1MIMH 4OV5B 1Y6NR 3CZFA 3P4MB 1A02N 5GRUL 3IGAB 5CGYD 2WK2A 2X9XA 5DRNB 1F4XH 2AXJA 3V4PL 3WMSA 5LGJB 3VE0A 4NWUH 5A3ID 1F45A 3W39B 5FAAA 4G6KH 3GMNA 1B6DA 5L88H 2A6JA 5EBMB 1EEUA 3BE1L 3Q5YA 5I8KH 5C3TA 2OXHA 3GI8H 5J0BA 4MQXC 2IBGA 3VXQB 2MTPA 1R0AL 5CD3A 2VQTA 1OAXL 3FQUA 2B8OT 3L3JB 5D7IE 3QXDB 3ROLA 4OZFA 2GI7A 3NFNA 1MCOH 3KYNA 1Q9OA 1BAFH 4WDIB 5HHPA 2VDPH 1F6AA 1CXIA 3FRPG 4L8SB 1MSPA 3I2CH 2V5RA 3X12B 1A7NL 5LWYL 2DI9A 3NIDE 3FFCD 1HEZB 2ARJQ 1JFQL 1UGNA 1W72B 5E6ID 5K59E 1KEGL 3HTLX 4GRLA 1W72L 1WWAX 1P7QD 4LKCA 4XB7A 3UJIL 1SJEA 1FGNH 3ZHKA 2IQ9L 1P7KA 3MRIB 4GMTH 4HV8B 4UQ2A 5F7DA 4EUPB 1QPPA 2B7DT 3AGVA 4WGVB 4WFEE 1A6AB 5KSBF 4U2YA 3QWRD 2P24B 1F2QA 4AY0A 4JZJB 1Q9OB 4WW1B 4Q58C 4JFXB 1EO7A 1PKOA 4ZPVA 5I9QB 1TTGA 4OF3A 3CH8A 1MRFH 1AO7D 2XZQL 5DZNA 3DO3A 4PY8I 3KPOA 4JO2H 3GSNH 1CDYA 1CWVA 4KJYB 3VRJA 4KZEL 5JPNA 4GXVH 4Y5YC 4DK6A 1D5MB 4XBGA 3NABH 4XP9H 4YXKH 1JRHH 1JTTA 3QUMB 2V2WA 2DYPA 1OPGL 3S35H 2JB5L 3VXNB 1SJHA 1F11B 1UJ3A 1BVLB 1RJZB 5HHXL 4YE4L 4KRLB 4LIQH 2BNUA 4XXCC 5D1ZC 5ETUA 2ADGA 1OVZA 3HE6C 4P99A 4XHQA 3WV0A 5AG8A 3VD5A 4QOKE 3PDOA 1J8HD 1I3UA 3QIWD 1QLFB 4KKAD 5HVFB 4G6FB 4JHBA 4N68A 3QFDA 1OARH 2UZYB 5HDOA 1TITA 1W0VB 3QI9D 5KVGH 3RHWK 1BZ9A 3S4SA 3L95B 5F8RC 3AXLA 2IMNA 4MQ7A 5ESVA 4R4BB 4O2EB 4Y2DD 1IQWL 5DLMH 4KAQL 3CSGA 2FO4A 5GS2D 5HTSA 3PWLB 1SEBA 2GTZB 3DPBA 1E6JL 3H7BB 1FDLL 3MRFB 4RMVA 4JFQA 4LLMB 2LU4A 2D7PA 1J05A 4F7TB 7FABL 4Z6AT 2HFFB 4GW4A 1CK0L 3DV4B 3OV6A 2EYRB 4UNVA 5I1AA 2NNAB 4CAGA 3IFLL 1U6AH 1ZHBB 1QSEE 5HHOE 1IBGL 5JXEC 3RFZC 4LPVA 5HYFA 4ZS6D 5CGTA 5BS0A 3PV6B 4L8SC 3HZYB 4OGYH 1CXFA 3ESVF 1RZJL 3D2UB 3HNSH 4XH2A 5C0NC 2NX5A 1M71B 5DUML 2WANA 4OF5A 4AYFA 5FYLH 2JJTA 5GGRY 3EBAA 3SJVA 4U0RB 1AQKH 1H8NA 2ADGB 5J1AB 2EE3A 4OCWL 1VACB 4K23L 4YDKH 1YEDA 2FCBA 1A9BA 2XQYK 5CSBA 5I8EB 3IF1B 5DQDL 3FB8A 5DRXA 5DTFB 3VRJB 1UJTA 2B0SH 3ZL4H 5DQJB 1CLZH 2YWZA 1LP9A 2OTUA 4NJ9L 4PRNA 5H37G 5EU4B 3BQUA 5GGQL 3VXUB 1AXSA 1QRNB 2A83B 5LAXA 5DEGA 1FN4B 3WYRA 2NCMA 2VDKH 1J05B 2NYYD 2ZUUA 2C26A 1D9KD 3NVQA 3IXAA 4NQCE 2R8SH 4KXZH 4KAQH 5E9DD 3DV6A 4Y4HC 2W0LA 1T2JA 1KPRA 2RFXA 1IJ9A 4QRQA 3FT2A 4XP6H 3O4OC 4WDIA 5HHPB 1Q9KA 4FXGA 3UBXI 3QO0B 1TPXC 1NC2B 1UB5B 4JCMA 4QCIA 1AD9B 3SKOA 4FZ8L 5MI0B 4XPHL 2YRZA 2Q7NA 4WHDA 2UZIH 3BGMB 4G6ML 2CK0H 4M5YH 3D39A 3DECA 2N7BA 4K3GA 3SQBA 4JPIA 4XNQB 1ZWIB 3RUGF 2ZUYA 4EN3B 3SE8H 3X13A 4GAYB 3TO2A 1JHTB 3GMNB 1YUHA 2E6JA 5EORL 3O6KL 1DQLH 4LASL 4MSWB 3RI5F 1FVEA 3W82A 1A4KA 4RFOH 5CJQH 1JWMB 2FDBP 5EZLA 1ZV5A 4YXHL 1NSNH 3RWEA 1NFDE 2AEPH 3SDAA 4PRHD 1LO5A 1U8KB 3EDDA 3QO1A 4PJ9D 1UJ3B 3ROLB 2QADB 5EUOB 1X7QB 2AK4A 5FYJD 1VFUA 3G5YB 4FQLH 5E6IA 2DQFA 1KXQE 3VXQA 3TH2T 1BEYL 1N3NB 2NR6D 5K9OA 3M1BB 3N0PB 3S36H 3V95A 3WS6C 2G60L 4PRAA 3MJ8B 1IC4H 3NIFF 1LEIA 2QQNL 3F8UB 5C6TH 5JOPD 4IMKC 3RVXD 4XCCL 2JCCE 5K9QI 1QSFA 3HZMA 4Y5XB 3GSQB 1JWUB 3MMEB 3WUZA 2FEDD 3BDXA 3HZKB 3DVNB 3DRQB 5I16A 3MV7A 5F7DB 1CGSH 4MVBC 1F02I 4OIBA 1MCPH 1T7VA 2NY7H 4ODUB 2WMPA 3KPNB 1SJEB 4M48H 3P0YL 3ZKXC 4LFHG 4P23A 1LE9B 4R9HA 3X13B 5ADPL 2XFXA 3RVWD 1DVFC 4POYA 5IMKB 1RUML 4ZS7L 5FFLA 2ZCLH 3N85H 4MNGB 1AGDA 3D0LB 1OAKL 4ONHB 1UWXH 4DJMA 3R1GL 1C12A 4P2YA 4P2RB 4M02A 3W0WA 3K1KC 3F7YA 3QISA 1Q9WB 3OAUH 4HD9A 5FYJU 3SGEH 3JVGA 4IDJL 3CFKA 3G6JB 2MFNA 4JVWA 5DURB 3REVA 3OKLB 1FZKA 1FAKT 3JTTA 4L4TD 4LASH 1S7TB 1RPQA 1CDJA 4ZPTB 3T4YB 4K55A 2B5IB 1R6VA 2JIXD 3FTGB 3MR9A 5HDBF 5ERWB 3OB0K 3EYFA 5B8CC 1QACA 4ODHL 2OM5A 3R4DA 3PJSB 2H6PB 4ZSOE 1ETZB 5E1AA 3ARRA 5J3HD 4IRSC 5IBLC 3P3YA 3MROB 4M9OA 4G6JL 1D9KB 1I7UA 4X4MA 2DQCL 1XCQA 2EH7H 4R7NA 3PWJA 2H41A 3LRHA 1IEBB 1NLDH 3SGJC 2V5TA 3D0LA 4JO2L 3KLHC 5DVLA 1F4HA 1ITBB 3SDCA 3IDUA 4K7FB 4JREC 5D8JH 5C6TL 4LCCB 3O3BB 4MA1B 2ZCHL 5IBUG 2DMBA 5L2KE 3FT3A 1R5VB 3U7YL 5E08H 4FFYL 4YXLH 4IOFD 1ZTXH 1IGFH 3S98A 3ULUE 3BH9A 2B2XL 2W1NA 2DI8A 1P6FA 4HLJA 3TIDA 1UA6H 5I71B 3T3PF 4DN3L 4OZIB 1UJ3C 4AT6A 4F57L 1XCTA 1CFTA 3QG7H 1WBYB 5EZOL 5CBEB 3P0YH 3QDJA 4WGWB 3TBVA 2YD4A 2H2PC 2VZ1A 4RZCA 2AXGB 3U1SH 3PIQB 4K71C 1RUMH 4ZS7H 2UV3A 3QFJE 5IROA 4M7JL 2HG5B 2W07A 1VPOL 1KF9B 4DQOH 3TBTA 1OHQA 1FYTD 43C9A 3V6ZA 3PL6D 5F89B 2O5ZL 5DJ8B 4XZUA 4CMHC 4Y8DC 5ANMB 4BFIB 1S7VB 2IGFH 4LSRH 4OKVA 3VW3L 3MFFA 1X5ZA 2VR5A 1FCGA 3CX2A 4NIKB 3T0DA 2IANA 1S78C 4LHUA 4M7LT 4O4YL 2A77L 2YWYA 2ERJB 4ZTOH 4OZGB 1VFOA 2FEEI 4HFWA 4R8WL 5I1CH 1N0XH 5F7FA 4PD4K 3MTRA 5IESH 4L5FL 3JV6A 1F3JA 3T0EB 2VDQH 1EA9C 5I71C 3FAXA 1AKJD 2UVEA 3TVMA 1GYAA 3I02B 4LCIL 2WBJD 2GITB 4NQED 4AEIL 3K1DA 4P2QE 1Z0NA 4MQTB 2P5EA 3V52L 2OQJB 4NN6B 1C5DA 4HH8A 4BK4A 4EN3A 1QRNE 1CD1A 5IFAH 2RFXB 4R4ND 2P7TB 5GRVL 1PDKA 4FQIH 3D39B 1CT8B 2R4RH 1RZ8A 3U7YH 5JW3L 2W65A 2WIIA 3WFDL 3LN5A 4ISVB 5JHDD 1H3XA 1IEBA 3OKKA 5C07D 3O6FC 1XCTB 2P1YA 4NDMB 4R4NC 1CL7I 2AJ3B 3MUGA 4OCYH 4YK4B 5ID1A 4NFDA 4QRUA 1DLHA 3QQ4A 5FECA 5KVEL 2JK5A 3H9YA 3HG1B 5I76B 1MCWM 4LIQE 3O6FA 2ZOLB 4EDXA 4MCYA 1EUTA 2ZKHH 3GBNH 4HJGB 2NY5C 3MO1A 3WJLC 5CP7A 1GOFA 1LE5B 4JQIH 1P4BH 4Z78B 3RWCB 2EDEA 1JZ8A 5CJBA 3W5NA 3W9EB 3VJ6A 1S9YB 3X11B 2OI9C 4P57A 2GT9A 3RGVC 4FP8L 4RFNB 3EYQC 5GRVK 1PZ5A 3ULSB 2WWKO 5J12C 1R3IH 5DJXB 2P8PB 1M71A 3WFEH 4GAJH 4YPJA 4LARH 3QUXA 5IUSA 3OAYH 3P30H 4XPBL 5A40E 3JUZA 1P9MC 1K8IA 1DQLL 2ESVA 1VEPA 2ZKHL 5ALCH 1ZHBA 4G9FA 5JTWA 1LP9F 3EHBC 2DRUA 2AEPL 3C8KA 4RCAA 4WU5B 3ARXA 5I8EA 3LN4A 3SDYH 2HJLB 4YH6A 4PR5A 4WENB 2GT9B 4PBWD 4P2OC 1R3IL 3WLBB 1RJYA 4M6OH 3RWCA 5IB2B 5KS9A 2VQUA 3AREC 5HPMB 2OK0H 3S36L 3OR7A 2Y7QB 3QZWA 2BVYA 5EU3B 3SN6N 2DWDB 1CFSB 4GT7A 2OLDA 2APFA 2Q7YB 5FDYA 4PJIB 2DQIL 3GJEB 2YK1H 1FO0L 2D2OA 1YEKL 4WTZA 3O2WH 3MLSL 5FKPA 5FCUH 1NQBA 1X5GA 2HTLC 4TULH 2F74A 4ACPA 4NZRL 3VWKD 1HHHA 1I1FA 3W5MA 4LNRA 3FO9A 3C60C 4YIQB 5IB2A 5KS9B 2A6IA 2X4OB 3OF6D 1IKNC 4MGXA 1LD9A 2P5WD 1RJZA 2QSCL 3P40A 5A1AA 4C83A 1CFQA 5IEKB 4E42B 5AWNH 1ZWIA 1SYVB 1UYWH 1FC1A 1S7SA 4TNVF 4LLVB 4WWKD 4NP4L 5D70L 4HF5H 4BELD 5HGBB 1AR1D 4F37F 2EEDA 5IW1B 4UNTA 3ULVF 4LCCC 5GHWH 4I0CC 4S1SL 1EIBA 1MCLA 4GRWF 1L7TL 2NW2A 5KAQF 3FT2B 4QNPF 3ZDXE 2HN7A 4U2ZA 1BGXH 1KG0B 3QEQA 4QHMA 4KK8C 5HHVH 4YK4C 3ZO0A 1DFBL 4P9HL 2CLVB 1JGUH 5JIIA 1I1AB 4OIIL 4UTAL 2QV2A 4X7DC 1GGIH 2BFVL 1J87A 4J12A 1XZ0A 5T1LD 2APWA 3PWVB 5DO2C 5B8CA 2BJMH 1FO0B 5ID0A 5IG7A 3GBLA 5EO9A 5IFHH 1X5LA 3UDWA 4J4PA 2V2WB 1KB9J 4JFHD 5HGHA 12E8L 4Z7OF 5E8DL 2Q7YA 4ZFZB 5F6IB 4FQJL 4ZQKB 4JG1L 2VLRD 4HLZG 3GHBL 1BOGB 3RDTA 4D0BB 1H9VA 5AEAA 5EU6D 1KB5A 5EWIL 5E2WL 1NGWA 4P9HH 3O3DA 4OZHF 1GXEA 1JNNH 4Y19D 3LKRA 1MHHA 5B38G 2O5XH 1JE6A 4ZYKA 3FQUB 3KYNB 2R1XA 4OD3H 1DJSA 5J6GB 2EYTB 4X6DB 5IEHA 4GG6E 3LKSB 4ODXA 1H3VA 1Z9SA 2R1YB 5CHNB 5IVZA 3OKMA 4LVOB 3ARTA 1HSAA 3BZFA 3B9KA 2VRAA 2PXYC 3HUJA 3QG7L 4KDWA 1FNEA 5CFHA 3TBSB 2P45B 1MNUH 2NNAA 4X5WA 2VDNH 1DQTA 5EUOF 3BDYH 5E2WH 1KV3A 3FQNB 1R0AH 1DSFH 4KKCD 2A6KA 5KSVB 4UU9B 1MVUA 4JM4H 5DZOA 1T20A 4I0PB 5E5RB 4JPVH 4HMDA 4KI5F 3QUKB 5CEZD 4HS3A 5D5MB 2AABH 4EI5C 5L8JB 1RUQH 3MV8E 3LAFA 1OWWA 1KPUA 4KI5E 4Y4FA 4PREA 2PCPB 1A7PH 4NKMB 4TNWK 4XPGH 4F7PB 3OAZH 4MCYB 3DV4A 1A7QH 4GKSB 2YKLH 1GCFA 43CAB 3EJYD 4HBQA 3MNZB 1XF1A 3LD8C 4PGCB 1W72H 1NBZB 2J88L 2XACC 4DVBA 5E8OA 1I8KA 2VABB 3SBWA 2HJFA 5FDWA 3L7FB 3NZHH 2IADA 1H3GA 1QTYT 1AE6H 2V2TA 4XP4H 3PIQA 4I3SH 5C0CD 2Y4SA 4M6NL 3WXVH 2L4OA 1QA9A 3GIZH 4MWFA 1FPTL 3BP4B 1MELA 1CICB 4L8BB 4DGYH 1YEGL 3DYPA 4JPKL 2YPKB 1QSZA 1G7JB 2HFTA 4O58L 2VO5A 3HNVH 3BRGC 4OI7A 4OM1H 4X4YB 4L29B 1OGAE 2B5IC 4LKXA 2BNUB 2QSTA 2PR4H 5DSCB 2P5WE 4M7KL 4LLYB 3RIAF 5ESQB 1RAMA 2PN5A 3JTSB 4M6NH 4XWGL 1DBJH 2BCKA 3BDYL 1W0WA 1OM3H 4YHOL 2BOBB 4HS6A 1IAIH 4Y4KB 3PWUA 1MQKL 3GBNL 5SX4I 3UTTE 5EC1B 1RZJH 3VXRD 4HLZH 3RPKA 4OLVL 3A6CL 4W68A 5AZ2L 2VLKD 3O3AA 3M1BA 4P2QD 2DQHH 5EOCL 3MNZA 1U93A 1RQ5A 4OAWB 5HDQL 4WW1A 3ES6B 5I1KH 2YUVA 4P5MB 3ZTJH 1KJ2A 4TN9A 4OCWH 4QXUH 3KPRB 4H25A 1XMWA 3QEUB 1J88A 1UWEL 3RIFF 2BP3A 4XMLL 5CSGA 1F58L 2DLHA 4IBLT 1L7IH 4RBPH 2DTMH 4MNGE 4LVOC 3MCG1 1UCBL 5KSBB 4J4PC 1MF2H 2JELH 5TDPA 4MDIB 3FN9A 4JY5L 2GYSA 4DN4H 1HKLH 4N0UE 3SDDC 3UYPA 4HQQH 1AE6L 2BSRB 4ZXBC 1K4DA 1F6FB 1X4YA 3UMTA 3GSOB 1NAMA 4GMSH 4MJIE 1WAAF 3EDJA 4XHJD 5EIIB 1OTTC 3VGBA 5GGSY 4U3HA 1JCKA 4X98A 4DKEH 4I3RL 5GRJH 4I4WB 4C56B 3I6GB 4DN4L 3MJ9H 3I3DA 1RZ8B 3OHXA 2UZIL 4G6MH 2VL4A 1WICA 3ZKMD 5C0CE 3ARSA 4XMKH 5JLZA 2JF1A 2R15A 2HT3D 3QEGL 3E1F1 3BH8A 3GJFH 5T1MB 3FB8B 3ILQD 4LSQH 3EOTH 5GS0H 2HKFL 3ZE1F 1II4E 2H1PL 1U93B 4MMXC 4G42A 1GGBH 4HDIB 3ECBB 5J56B 5KS9E 3GI8L 1MJUH 1P4LB 1XGUA 4PJFE 3BSZL 2ED9A 3UCRA 2YN5A 4BKLA 2Y6SC 4TRPL 4NPYA 5GHWL 5E7BA 1KNOB 2XRAL 1YPZF 5DFTA 5FIEA 1XGRA 3JVGC 1YMMD 3ALWA 3RAJL 3MOBH 4YHPA 4K3HA 3ZE0F 1ZEAL 4QY8A 1BFTA 1YEFH 3WD5L 1PGRB 4M1GL 4A6YH 2FJGA 1FNGB 4JZJC 1JFQH 4XHJC 2FLBT 4JZNB 3CPLA 1TZHA 3HMXH 4U1JA 5KANI 5DRZB 3D3VE 4G8GB 4QXGL 1HQRB 4IRSA 3R8QA 3PQYE 4FS0A 3ZYZA 5J3HC 1WCBA 3UJIH 1WBYA 3O6KH 1L0QA 3VWJC 3K74B 2NY1C 1QA9B 2XRAH 4MWFB 3FB6A 3WL9A 5DMYA 2N4IA 3EFDL 3HE7C 4RISL 4LSPH 1QSEA 5HHOA 4JHZA 5C09D 4GKSA 4ZFFA 3MSPA 2C4FT 1T21A 1U91A 4HPYH 2YR3A 2Q8BL 2JJVA 3MUHL 3L95A 1MHCB 4PGCA 1MCDA 1MWAH 4PRPD 5T33L 1NKOA 1OCWH 3FJTA 1CR9H 1T0NB 2UUDK 3ULUD 2W38A 5DWUH 3VD3A 4RX4D 4ELME 4MJID 2XZQH 3QFJD 4R0LC 5DFVC 1AGEA 4R3SB 1FZMB 3M17B 5FUOL 2OL3B 2VL5B 1ZGLB 2VAAA 5EO1B 5CWSA 4X6CB 3QQ3A 1ZLWK 4P2RA 3QUKA 4P4KA 3Q6GL 2E7CA 2RCSL 5J1AA 1N26A 1Z6JT 4QHKI 1IFHH 1P7QB 1EEZB 4Y5VC 4P2RE 5AYUH 1TVHB 2HVJB 4OFVA 5C08D 2DJSA 2QHLA 1UZ8B 5EU5B 3ALXA 2XICA 1CGSL 5BV7C 2EH7L 3KJ4B 1CU4H 5D1XB 1DZBA 3LDBB 3O4LA 2AV1B 1YC8A 1E6OH 5F7LB 2EKSA 1A7OL 2EYRA 3BAEL 5D7IB 5C0AE 3CCHA 4MD4A 4OUOA 3OXRB 3L3DB 3VG9C 5JUEH 1WZ1H 4PB0L 3G5XB 4E41D 2VXUH 4R7DB 3LKRB 3WDHA 4ZQKA 2C1PB 4PG2C 1QSFB 4H8WC 4ZYKB 1OF2B 4XVSH 1JHKH 2CJUL 4CW1A 4OUUB 3BZDA 3AY4C 1CXKA 1E4XL 1PY4A 2VZUA 4YHKH 1A47A 3P9MB 5A2FA 5DD1L 1NDGB 4J6RH 4HIJB 2XWTB 4FMKA 1AO7E 1AI1L 3D69B 4PGEB 4P46C 4QRRB 3O6FB 3FZUC 3BAEH 1U58A 3MZGB 2J8UF 4PIRF 4N0FA 3NCBB 4HUUB 2XI9A 4KGLA 2Q8BH 5I0DA 4JO1L 5GXBB 1M7XA 4IS6A 4HWBA 5BRZA 4MB4A 4WCYL 3BIKA 3CU1A 4ZOBA 5ICYA 2V7NA 1NGQL 5CJXC 4QRPD 4DVRL 5DMGC 1A4KB 4YBHA 5JXEA 3F7QA 1ZA6B 1ZLVH 5FK9A 1JV5A 1I3RA 3FRUA 5DD1H 4NZTL 2DYPB 1B9ZA 4N5EC 3WEXB 1S7QB 5D93C 1WFNA 3V5KA 3STLA 5GGRA 4BM7A 1NMAL 2R1WB 3SY0B 5DS8A 3RWJB 1FFOB 4P3CL 1NC2A 5C3LD 3BIBX 2AJSL 3VE0B 5CLWA 3BT2L 1RULH 4HWZB 3OZ9L 2VISB 5MEPA 3QIUA 4APQD 3TO4A 3D9AL 4Y4KD 4NJ9H 3TBWB 2NZIA 2YRPA 4U6YB 5MERA 5KOVC 1KN4L 4YIQA 2VZVA 2DLTA 2JJSA 4HS8L 4NC2B 1MI5A 3GMRB 4NNPH 4OZGA 1B6UA 2HLAB 3HAEA 1MJ8H 3TIEA 2VLLB 5BVPH 5F3BA 2GIYA 3JUYA 5F1NB 4QKXB 2EDFA 2E7LC 4YHLH 5MHSD 4YE4H 5MEND 4Z7WF 4HUUA 4RMWA 3P0VL 3V6FB 1NGYB 4WI4A 2BERA 3VW3H 3OR6A 1LMKA 1DN0A 5IMMA 1HEZA 4WUUE 2R2EA 4V2BA 5DC0A 1QVOA 3IVKB 3SQOH 4W4OA 3V9FA 4NRXA 2VJXA 4ODSH 3LV3A 5C0IB 4NM8L 1A3LH 2D31B 4HIIB 3QDJB 4GMSL 5L9DH 2VDQL 4F15C 2VSCA 4OZFB 3O2VH 2VH5L 2E5EA 3UTSE 5KS9F 2CLRB 1A9EA 3BPCB 4DUXA 1K4CB 2A0LD 3MRLA 4AEHH 4ODXB 1E28A 1BREA 1CVSC 5DK2A 2IQAA 1FFQA 4JY6B 2EXYC 2DTSA 3P2TA 1ED3A 4MJ6B 1J8HE 2OJEA 3BPLB 5BQ7A 4N1HB 1SVCP 5FCSH 5EBMA 4X9IA 4K7PL 4FABH 3O8XA 5JORA 4JB9H 1WWCA 1ZKAA 7FABH 4U49A 2QEJA 4HKBA 5FB8B 3KPRD 5JPMA 1DBAH 1WBXB 3WIIL 5C0CB 1AR1C 1ZHNB 4P23C 5E00B 1T4KB 3LHPH 1B2WL 2E6PA 3B2VH 2NTFA 2EDNA 3QHZH 5IMOB 4K94L 1HI6B 1AGBB 3SDDA 3JWDC 3KXFB 4CVUA 1K2DA 5T5FH 3VXPA 1U91B 3KYAA 4PV8A 3HAEB 1AQKL 1EEYB 2FYYB 1CE6A 3U9UB 4HS8H 5I15H 1MJ7L 5I76A 1CCZA 3MLWH 2UWEA 4JY4A 4OCXH 3IETB 1P9MA 3TO4B 2YA2A 5IQ7H 4PJ9B 4U6HB 4DUVA 3FQRB 4NO0A 5EB9A 3RWDA 3QPQD 1CI5A 4ZUSB 3T2PA 1GZQB 5FUZH 3ARED 1A3RL 3GZKA 1EFXD 3I84A 1FJ1A 3FB6B 1ND0A 4PJEF 5FCUL 1ZMYA 5KG9A 2BVUA 4M61A 3VGGA 5HI4D 3V6BR 4A2MA 2I60H 3ESUF 3WFEL 4XBEH 1GIGL 2YUWA 5CZKA 4ZUWB 3S96B 5HGGS 1IRAY 1FCCA