4Y0RA

Bovine beta-lactoglobulin complex with pramocaine crystallized from ammonium sulphate (blg-prm2)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
161
structure length
155
Chain Sequence
IVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDAENKVLVLDTDYKKYLLFCMENSQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactoglobulin
publication title beta-Lactoglobulin interactions with local anaesthetic drugs - Crystallographic and calorimetric studies.
pubmed doi rcsb
molecule tags Transport
total genus 37
structure length 155
sequence length 161
ec nomenclature
pdb deposition date 2015-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 4y0rA00
4ZHCA 3P6FA 1JJJA 1HMRA 1X8OA 3RSWA 1DFVA 2AMMX 4IB6A 3TGCA 1X8UA 2RD7C 1JYDA 1QABE 1YP6A 2OVDA 4YCEA 3I0AA 3PH6A 1GT1A 1BEBA 1FENA 1FTPA 1P6PA 3CBCA 1QQSA 2GTFX 3UEXA 2L68A 4OS3A 1KT7A 1XCAA 2OVAA 1BSYA 1LPJA 1BWYA 1IFCA 2R56A 4TQ2A 1YUPA 2LBVA 1HQPA 3JS1A 2HYSA 1GGLA 3C76X 3P6CA 4AYHA 5LJGA 3TGBA 3VG5A 1DF3A 3MVFA 2FS6A 4IMNA 5LJCA 2FTBA 2QO5A 3PP6A 3NP1A 1YWCA 4R0BA 1U0XA 5EDCA 4YDAA 3O19A 3CMPA 4ALOA 4IAXA 1FEMA 5BVSA 4ORRA 3DSZA 2AT6X 5F6ZA 3BY0A 3C77X 2G7BA 4TLJA 1MDCA 1ZNLA 4IB8A 1HN2A 3P6DA 4GETA 3WJGA 5H8TA 4YBPA 1N0SA 4BQUA 4MVLA 2W2BA 4NLIA 4TJZA 1LNMA 4XMEA 3KFIA 1SY3A 1MVGA 1DZJA 2AL0X 1BLRA 4IMOA 3STNA 3U0DA 4UU2A 1PEEA 4OS8A 1EPAA 2JU3A 3EBWA 5HZ5A 1QY1A 5AQ6A 1CBSA 2A2GA 4RUNA 4AW8A 5K06A 4WFVA 1SXYA 2ASNX 5D4AA 4XMCA 3HWEA 3D95A 1LIFA 1G7NA 1ZNHA 2WUTA 5LJKA 2F73A 2IFBA 3KFGA 2JN3A 3I17A 3VG6A 2ACPX 4YCHA 2W2AA 3TF6A 3KFFA 3KQ0A 2OZQA 4A8ZA 1IIUA 1D2UA 2LKKA 5LJDA 4TKBA 3P6HA 3BSZE 3HK1A 2XSTA 1T0VA 1KXOA 1BSOA 1A3YA 4ORXA 2GC9A 4K19A 4O9SA 2K23A 3B2LA 1IFBA 5EZ2A 3P6GA 5HA0A 1X71A 1G74A 3RZYA 2HNXA 2QOSC 4GRJA 3F9DA 4XMDA 5HZ9A 1OBPA 4GNYA 3L4RA 3BDRA 1LIDA 2JU8A 3NPOA 4ZH9A 4GKCA 2JOZA 4I3CA 3FENA 4NLJA 1IW2A 3K3LA 3PH5A 4HPBA 4LZVA 1GKAA 3IFBA 1UZ2X 3AKMA 1X8NA 4XMFA 1L6MA 3CQNA 4YMYA 1CBIA 1JJXA 1FELA 4ES7A 1YP7A 4XMGA 3AKNA 3B2KA 4Y0PA 1EUOA 2FR2A 3BU9A 1LICA 4EDEA 3FR2A 4ZH6A 5JR8A 1E00A 4YKMA 4OS0A 4WBKA 1YWBA 4QGVA 1FE3A 3CWKA 2POAA 5LJEA 1GXAA 3SAOA 1A57A 1FDQA 1S44A 3FLLA 1QG5A 4AZMA 1VYFA 4I9SA 5BVQA 3FA6A 4YKOA 3NX1A 2LBAA 1LFOA 4ODDA 3OJYC 5FFHA 1JZUA 1BRPA 1X8QA 1ADLA 3ELXA 4YGZA 1BRQA 2HZRA 3VG7A 3NQ3A 3BU1A 1VPRA 2AT5X 5F7GA 4NP1A 4A1HA 4ZJ0A 3PPTA 1GT3A 3FA9A 5LJHA 1ZNGA 2RCTA 3FW4A 1MX8A 2YG2A 4M7MA 1I05A 2X46A 3FEPA 1GX8A 4ZHDA 4Y0SA 1B4MA 1CBRA 5HTEA 4N7DA 4NNSA 1ZRYA 1SY0A 1SXXA 4IB7A 4RUUA 3WVMA 1UREA 3HWGA 1OBQA 4DQ3A 1BJ7A 1ICMA 5CE4A 5DPQA 3CR6A 1OEJA 1TW4A 2Q4NA 4QYNA 1JV4A 1E02A 5BVTA 3O2YA 2A3FX 1KZWA 4ZFXA 3HWDA 4QGWA 4QZTA 1EPBA 4EEJA 3S26A 3BS2A 1G85A 1KGLA 5C0NA 4YFQA 3UEWA 1TOWA 1BM5A 5H9KA 2ACOA 2K62A 2FLJA 1KT3A 2G78A 1HMSA 4WFUA 4ZCBA 1EXSA 4NYRA 3P6EA 4Y0QA 5IO6A 4AZOA 1VYGA 1NP1A 3VG4A 1O1UA 1TXLA 4ZHHA 1O1VA 3F8AA 2XKLA 5LKEA 2WEXA 4TKHA 2AT8X 2WQ9A 1CJ5A 1DZMA 2JU7A 2RQ0A 1QWDA 2CZTA 3FR5A 5HZ8A 1O8VA 5IO7A 4LZUA 3Q6LA 1GT4A 2L5PA 1RLBE 1MUPA 3EYCA 1BSQA 1BBPA 2R74A 1AELA 3BX8A 2HLVA 1A2DA 2X45A 5HCCC 1E5PA 1LKEA 3FELA 4I3DA 2RA6A 3B2IA 5B29A 2FRSA 5D45A 4ALBA 4TKJA 2NNDA 1I06A 2AKQA 2BLGA 1OBUA 1KT5A 3UEVA 3WBGA 1CRBA 3GAQA 5HCDC 1PM1X 4AZNA 1ZNDA 1KT6A 5EDBA 4IB9A 3D97A 1JBHA 3G7XA 4Y0RA 3IA8A 4NNTA 1ZNEA 2G79A 1KQXA 3WJCA 3B2JA 4ZR2A 1DZPA 1ACDA 4EXZA 3KZAA 1KOIA 3STMX 3VG3A 2RCQA 2KTDA 3WJBA 1AB0A 1GX9A 2NP1A 3ZUOA 3NADA 2N93A 2A2UA 4DQ4A 3BX7A 1LF7A 1MX7A 4YGGA 1SA8A 1IKJA 5EEDA 5B27A 1QFVA 1SY2A 3APVA 3BLGA 4A60A 2WEWA 1EALA 5L8NA 4BVMA 5HTDA 1ERXA 1I4UA 5HAEA 4N7CA 1T68X 3KFHA 5KICA 5HZQA 5H9NA 1OEEA 4MVIA 1NGLA 2WR6A 4YDBA 3CQRA 2FT9A 4KIIA 1AQBA 3TZSA 1DZKA 1EIOA 3FA7A 4D6AA 4LKTA 4EFGA 4GNWA 1EW3A 2O62A 1X89A 5F58A 1QY2A 2LB6A 1LIBA 1PMPA 3APXA 2EU7X 3U9PC 3EBKA 2FWVA 4QZUA 4M6SA 3O22A 3WJFA 4GH7A 4QYPA 1B0OA 2L67A 3QKGA 3FEKA 4YFRA 4YGHA 3FR4A 2MJIA 5F1EA 3ZQ3A 1B56A 4CK4A 3VG2A 4ZHGA 3FIQA 4ORUA 1EQDA 2OFMX 4ORSA 5HBSA 4YFPA 3UEUA 1DC9A 1OPBA 1E06A 4HPDA 2Q2PA 2CBRA 3T1DA 5EEEA 1JYJA 1CBQA 1KQWA 4YH0A 2HZQA 3MBTA 2KT4B 5HA1A 2WQAE 1H91A 3ELZA 3NQ9A 3EM0A 3JSQA 5DG4A 4IBAA 4UU3A 3FA8A 2A13A 1PBOA 1D3SA 2HMBA 1SXWA 1ZNKA 4A1YA 4QGXA 2Q2MA 1YIVA 2MM3A 1T8VA 1U17A 2FS7A 4AZQA 2WSJA 1QFTA 4MVKA 2AH7X 5D8JA 1GKAB 2LFOA 5H9LA 4XMHA 2MO5A 1GM6A 2E4JA 5KIDA 5LKFA 1OPAA 5L8IA 2AT0X 5D48A 3C78X 3NR3A 3FMZA 2QM9A 3HWFA 1LIEA 3FW5A 3NX2A 1EIIA 4NYQA 2OFRX 1TVQA 4OMWA 5L8OA 3WJEA 2A0AA 1XKIA 4LKPA 4TNNA 1YWAA 2QO6A 1OEKA 1KZXA 1KT4A 2R73A 1R0UA 1GT5A 1ICNA 2CBSA 5HZ6A 2WWPA 1RBPA 3DTQA 2FR3A 2Q39A 1AVGI 5LJBA 4I3BA 5D47A 3ZUIA 5H9AA 3APWA 5EPQA 1DV9A 1QY0A 1A18A 3APUA 4HPCA 5FENA 1S2PA 3PEDA 3STKA 1SY1A 2NNQA 3PECA 2AT3X 4ZGUA 1ALBA 3TGAA 2W2FA 5KHPA 4ORWA 1HBPA 4PSQA 4OMXA 2CM4A 4HFOA 4ZHFA 1TOUA 1G5WA 3WJDA 5FAZA 2P8GA 4ORYA 4D6BA 3WXQA 4YBUA 5IO5A 1HMTA 4HPAA 5F6BA 1YWDA 1S7DA 3BRNA 4QAEA 2PY1A 2ANSA 3CBSA 4ARHA 2OVEA 1B8EA 3D96A 2CZUA 3B2HA 1IKEA 4GE1A 1NP4A 5HCEC 4BOEA 1U18A 1Z24A 1SXUA 4AZRA 1HBQA 2GJ5A 2ALLX 4IAWA 1X8PA 2Q9SA 4I9RA 2NNEA 3U03A 1ERBA 1I04A 1ML7A 2QO4A 5HWZA 3EMMA 4AZPA 2CM9A 2DM5A 2L9CA
chains in the Genus database with same CATH superfamily
4KT5A 4ZHCA 3P6FA 1JJJA 4NV8A 1HMRA 1X8OA 3RSWA 5K68A 1SWSA 3SZHA 1DFVA 2AMMX 4IB6A 3TGCA 1X8UA 2RD7C 1JYDA 1QABE 1YP6A 2BSZA 2OVDA 4NV7A 4YCEA 3I0AA 3PH6A 4U3QA 1GT1A 1BEBA 1FENA 1FTPA 1P6PA 4GDZA 3CBCA 1QQSA 2OL7A 1VWEB 2GTFX 4Z2PA 3UEXA 2L68A 4OS3A 4U8UM 1KT7A 1XCAA 2OVAA 1BSYA 1LPJA 3Q34A 4BCSA 1BWYA 4O3YA 1IFCA 2R56A 1AVDA 1YUPA 4O3XB 2LBVA 3WOVA 1HQPA 4TQ2A 2X8TA 3JS1A 3ZW0A 5AJCA 2HYSA 1GGLA 3C76X 3P6CA 4AYHA 5LJGA 3VHIA 3VG5A 1RXKA 3TGBA 3MVFA 1DF3A 2FS6A 4IMNA 5LJCA 2FTBA 2QO5A 3PP6A 3NQKA 3P24A 3NP1A 3HOLA 1YWCA 1LDOA 1U0XA 3HTYA 4R0BA 5EDCA 4YDAA 3O19A 3RDSA 2ZAIA 2IZCB 3CMPA 4ALOA 2VFBA 2IZGB 4L1NA 1Y0GA 1SWLA 3LTWA 4IAXA 1I78A 1FEMA 5BVSA 2F09A 4ORRA 1SLFB 3DSZA 2AT6X 5F6ZA 2X56A 3BY0A 2G7BA 3C77X 1MDCA 1ZNLA 4IB8A 3MM0A 4O4OA 1HN2A 3P6DA 4GETA 3SLTA 3WJGA 5K67A 5H8TA 4YBPA 1N0SA 4BQUA 1VWNB 4MVLA 3RY1A 2W2BA 4NLIA 4BX5A 3UEUA 4TJZA 1N9MA 1LNMA 4GGZA 4XMEA 5AEOA 3KFIA 1SY3A 1MVGA 1DZJA 2M4LA 2AL0X 1LDQA 5B11O 3X00A 1BLRA 2X4MA 4IMOA 3STNA 2ZSCA 1SLDB 4UU2A 1PEEA 4Y5DA 3T2XA 1SWKA 2C1SA 3QQ2A 3U0DA 4OS8A 2VDFA 1SWEA 2Y32A 4BX6B 1EPAA 2JU3A 3EBWA 3RWXA 2GTLN 5HZ5A 1QY1A 1MEPA 5AQ6A 1CBSA 2IZHB 1SRGA 3WYQA 2A2GA 4RUNA 5B2AO 4AW8A 2RTDB 2RTCB 4NW4A 5K06A 4WFVA 4IABA 1SXYA 1WBIA 2ASNX 2RTRB 3SLJA 5D4AA 2KTSA 4XMCA 3HWEA 3D9WA 3D95A 1LIFA 1G7NA 1Y9LA 1ZNHA 1MOYA 2WUTA 5LJKA 2F73A 2BHVA 3MX7A 2IFBA 3KFGA 3T2WA 2JN3A 3I17A 2RTGB 4I60A 3VG6A 2ACPX 4YCHA 2W2AA 2AF5A 3TF6A 4MISA 4JGLA 3KFFA 4L3RA 3KQ0A 2OZQA 4O4UA 1IIUA 1D2UA 3UAQA 4MEEA 2LKKA 5CYBA 2MWHA 5LJDA 4TKBA 5IRWA 3P6HA 3BSZE 4DNEA 1PBYA 3HK1A 2XSTA 1N43A 1RXJA 1KXOA 1T0VA 3HPEA 1BSOA 1A3YA 3AUMO 4ML7B 4ORXA 5B5GA 4CV7A 1N4JA 1MK5A 1VWJB 1Y53X 2GC9A 2IZLB 2OL8O 4GU8A 4K19A 2K23A 4O9SA 3B2LA 1IFBA 4Z27A 5EZ2A 3P6GA 5HA0A 1X71A 1G74A 2DJFA 3RZYA 2HNXA 2OFAA 2QOSC 3D4RA 3F9DA 4GRJA 4XMDA 2DJGA 5HZ9A 1VWBB 1OBPA 4GNYA 3L4RA 3BDRA 1LIDA 2JU8A 3NPOA 4ON1A 4GKCA 4ZH9A 3ZW1A 2JOZA 4I3CA 3F6ZB 1SMPI 3FENA 4IRWA 4NLJA 1IW2A 5B10O 3K3LA 3PH5A 1IJ8A 4HWMA 2GH7A 4ID2A 1Y55X 4HPBA 2Z4HA 4LZVA 3SLOA 1GKAA 3IFBA 3CKFA 4BBOA 1UZ2X 3AKMA 1X8NA 4XMFA 2JMBA 4FBRA 1L6MA 2IZAA 3CQNA 5JD2A 4YMYA 1CBIA 1JJXA 1FELA 4ES7A 1YP7A 4XMGA 3AKNA 3B2KA 4Z6JA 4Y0PA 1EUOA 2IZEB 2FR2A 2RTOB 1LICA 3BU9A 3FR2A 4ZH6A 4EDEA 2OL6O 5JR8A 1E00A 4YKMA 2KD2A 4OS0A 3S5XA 4CDEA 4WBKA 3PQSA 4BJ8A 1YWBA 2I5VO 4QGVA 1FE3A 4GGTA 2X34A 3CWKA 2POAA 3MG5A 5AJBA 1SWAA 2OYBO 5LJEA 1GXAA 3SAOA 1A57A 1FDQA 2G5LA 1S44A 1SWGA 3FLLA 1PTSA 1QG5A 2GTLO 4AZMA 3S60A 1VYFA 3SZIA 1LUQA 3RE6A 4I9SA 5BVQA 1HY2A 1W6FA 4OEMA 4GK9A 2WPUA 3RDOA 3FA6A 4YKOA 1VWAB 3NX1A 2LBAA 1LFOA 4ODDA 3OJYC 2OY1O 5FFHA 1BRPA 1JZUA 1JJUA 1X8QA 3T6LA 4O3ZA 3RDXA 1ADLA 3ELXA 2A5CA 2UYWA 4JHQA 4YGZA 4B55A 2X32A 4CPEA 1BRQA 2HZRA 1VWHB 3VG7A 3NQ3A 1KFFA 4JO6A 3BU1A 4OKAA 1VPRA 2AT5X 5F7GA 4O49A 2RTIB 4NP1A 4BX7B 4AZQA 3PDFA 3KVNA 4A1HA 4ZJ0A 3PPTA 3OBLA 4MIRA 1JMXA 1SWJA 1GT3A 3FA9A 1SWDA 1SWBA 5LJHA 1ZNGA 2RCTA 2RTLA 1MX8A 2YG2A 3FW4A 1I05A 2X46A 4M7MA 5B5FA 1VWPB 2Y3EA 3FEPA 1GX8A 4ZHDA 4Y0SA 3VHMA 4CPHB 1B4MA 1CBRA 1HQQA 2RTKA 3VU1A 2LA7A 5HTEA 2JW1A 4N7DA 4NNSA 1NDJA 4O4SA 1UYOX 1ZRYA 2RTEB 1SY0A 1SXXA 4IB7A 4RUUA 1SWPA 3WVMA 5FQ7E 1UREA 1RSUB 3HWGA 1OBQA 4DQ3A 1BJ7A 1ICMA 5CE4A 5DPQA 3CR6A 4GUZA 5CHKA 1OEJA 1TW4A 2Q4NA 1VYOA 4QYNA 1JV4A 1E02A 5BVTA 5IXGA 3O2YA 2A3FX 1KZWA 3SZJA 4ZFXA 2Z4IA 1SRIA 3HWDA 4QGWA 3RBYA 4QZTA 1EPBA 1LELA 3S26A 4EEJA 3BS2A 4Z2VA 1G85A 1KGLA 4QRLA 2Y3FA 4YFQA 5C0NA 3UEWA 1TOWA 1BM5A 2OFBA 2ACOA 5H9KA 2K62A 3WZQA 2FLJA 1KT3A 2G78A 4FBVA 1HMSA 1NC9A 4WFUA 5FQ6E 1EXSA 1N7YA 4NYRA 4ZCBA 3P6EA 1AVEA 1KL3A 1SWOA 4Y0QA 1SWRA 5IO6A 4AZOA 4C5PA 4CDDA 1VYGA 1NP1A 3VG4A 5CSEA 1K3BA 5L3YA 1O1UA 1TXLA 4ZHHA 1O1VA 3F8AA 2MF6A 2XKLA 5LKEA 3WZPA 1VWLB 2WEXA 2AT8X 1N9YA 4TKHA 2WQ9A 4CSBA 2RTHB 1CJ5A 1DZMA 2JU7A 2RQ0A 1QWDA 2CZTA 3FR5A 3PK2A 1O8VA 4FQBB 5HZ8A 5IO7A 4LZUA 3Q6LA 1GT4A 2L5PA 2C1QA 1RLBE 1MUPA 3EYCA 3ZW2A 1BSQA 4CDCA 1GX3A 1BBPA 2R74A 4INNA 2RN4A 1AELA 2C4IA 2RTMA 3BX8A 3P02A 2BS5A 2HLVA 1A2DA 2X45A 2RTPB 5HCCC 1HXLA 1E5PA 1LKEA 2PI3O 3FELA 2RA6A 4I3DA 4YVBA 3B2IA 5IRUA 4DCBA 1SWTA 2FRSA 5D45A 4ALBA 4TKJA 5B29A 2NNDA 1I06A 2AKQA 2BLGA 3FYFA 1OBUA 4CPFA 1KT5A 3UEVA 3WBGA 1CRBA 3GAQA 2FHNX 5HCDC 4GJVA 2RTQB 1PM1X 4AZNA 3EW2A 1SWHA 1ZNDA 1KT6A 2RTJA 5EDBA 4IB9A 1SLGB 1KL5A 3D97A 1VWGB 3CKGA 4BX6A 1MM9A 1JBHA 3G7XA 4Y0RA 2OY7A 3IA8A 4NNTA 1ZNEA 2GTLM 3VGWA 4U8UN 2G79A 2RTFB 3RDQA 1KQXA 4KCAA 3B2JA 3WJCA 4ZR2A 1DZPA 1ACDA 2IZDB 4EXZA 3ZW0B 3ZI8A 3KZAA 1KOIA 3STMX 3HOEA 2OVSA 3VG3A 2RCQA 2KTDA 1SWNA 4U46A 1AB0A 3WJBA 1GX9A 2NP1A 1NBXA 2RTBB 2N93A 3NADA 3ZUOA 1JQPA 1UYNX 2UZ2A 4QQ1A 1VWKB 4U9CA 2A2UA 4DQ4A 2OF9A 2A5BA 4FBOA 3BX7A 1LF7A 1MX7A 4YGGA 2X8FA 1SA8A 1IKJA 4QNIA 5EEDA 5B27A 3AEHA 1QFVA 1SY2A 3APVA 3BLGA 4A60A 2WEWA 2I5ZO 1EALA 5L8NA 3VE1A 4BVMA 5HTDA 4BX5B 4A8ZA 2G8CO 1ERXA 1I4UA 5HAEA 4N7CA 3ZZVA 1T68X 3VE2A 4O4XA 2YMSA 3KFHA 1VWMB 3OD9A 4COTA 5KICA 5HZQA 3LHNA 5H9NA 2CAMA 1OEEA 4MVIA 5B3MO 2FKJA 1NGLA 2BT9A 3N91A 2WR6A 1SWFA 4YDBA 3CQRA 2FT9A 4KIIA 1AQBA 2FKGA 3TZSA 4Z28A 1DZKA 1EIOA 3FA7A 3WZNA 4LKTA 4D6AA 4EFGA 4GGRA 1EW3A 2O62A 1X89A 4GNWA 5F58A 2OY8A 1QY2A 2LB6A 1LIBA 1PMPA 4I6SA 3APXA 4LQZA 3EW1A 4KC7A 1SWCA 5BYPA 1RSTB 2EU7X 3U9PC 3EBKA 1EI5A 2FWVA 4GDAA 4GJSA 4QZUA 3VPJE 4GD9A 2RTAA 4M6SA 4GZVA 3O22A 3WJFA 4GH7A 1NQNA 4QYPA 1B0OA 2JGSA 3ZWEA 3FDCA 2L67A 3WZOA 3JQOA 4KH8A 3QKGA 3FEKA 4YFRA 4YGHA 3FR4A 2MJIA 5F1EA 3ZQ3A 1B56A 4CK4A 3VG2A 4ZGFA 4ZHGA 3FIQA 2OY5O 4ORUA 1EQDA 1STSB 2OFMX 3E3CA 1OSPO 4ORSA 4YFPA 5F2BA 1DC9A 1OPBA 1E06A 5HBSA 2IZFB 4HPDA 2FGSA 2Q2PA 2CBRA 4Y59A 4I95A 1JMZA 1I9HA 3T1DA 5EEEA 4O3WA 1JYJA 3FIDA 1CBQA 1KQWA 4U8UO 4YH0A 2HZQA 2X8SA 4FGIB 4EKVA 1W5RA 3MBTA 2KT4B 4MVEA 5HA1A 1KL4A 3LV4A 2WQAE 1H91A 3ELZA 3NQ9A 3RY2A 3EM0A 3JSQA 5DG4A 3S5VA 3ZW1B 3EC5A 4IBAA 4UU3A 3FA8A 1SWUA 1K24A 2A13A 1PBOA 1D3SA 2HMBA 1SXWA 1SRJA 1ZNKA 4A1YA 4QGXA 2Q2MA 4TLJA 1YIVA 2MM3A 1T8VA 1U17A 1VWIB 2A8GA 2FS7A 2IZBA 2RTNB 1QFTA 2WSJA 3GE2A 4JNJA 2VFCA 4MVKA 2AH7X 1SRFA 5D8JA 1GKAB 2LFOA 4BX7A 5H9LA 1HXZA 2MO5A 4XMHA 1GM6A 2E4JA 2IZIA 5KIDA 1SWQA 2QMIA 1OPAA 5LKFA 5L8IA 2AT0X 5D48A 4OELA 1Y9TA 5IRAA 3C78X 1RXHA 1FJ1E 3NR3A 1LCVA 2QOMA 3FMZA 2QM9A 3HWFA 1LIEA 3FW5A 1VWCB 4CPHA 3NX2A 1EIIA 3OE3A 1VWOB 1TVQA 2OFRX 4NYQA 4OMWA 5L8OA 3WJEA 2A0AA 1XKIA 4LKPA 3T6FA 1VWDB 4TNNA 1YWAA 2QO6A 1SRHA 1OEKA 1KZXA 1KT4A 2R73A 3V8UA 1R0UA 1GT5A 2IZKA 1ICNA 3RE5A 2CBSA 3RKGA 5HZ6A 2WWPA 1STRB 1RBPA 3DTQA 2FR3A 2Q39A 1AVGI 5LJBA 3VHHA 2HKDA 4I3BA 5D47A 2AVIA 3ZUIA 5H9AA 4PJ2A 3APWA 3H3IA 5EPQA 2FHLA 4Z2OA 1DV9A 1QY0A 1A18A 3APUA 4HPCA 1NQMA 5FENA 1S2PA 3PEDA 3RDMA 3STKA 1SY1A 2NNQA 1VWQB 2AT3X 3PECA 4ZGUA 1ALBA 3TGAA 2W2FA 5KHPA 4ORWA 1HBPA 4BGFA 4PSQA 3RDUA 4OMXA 2CM4A 3NBXX 4HFOA 1TOUA 4CDFA 4ZHFA 1G5WA 1WUBA 3WJDA 4KC8A 2X55A 5FAZA 2P8GA 4ORYA 4D6BA 1LCZA 1SLEB 1VWFB 1RAVA 3WYPA 4YBUA 3WXQA 1Y52X 1HMTA 5IO5A 4HPAA 1VWRB 4CPIA 5F6BA 2MHDA 1YWDA 1S7DA 3BRNA 3SOTA 2QCBA 2F01A 2PY1A 2ANSA 3CBSA 4QAEA 4ARHA 2OVEA 1B8EA 3D96A 2CZUA 1STPA 1JIWI 1IKEA 2KW1A 1NP4A 3B2HA 4GE1A 5HCEC 4BOEA 4EQAC 1U18A 4WHIA 2BC3A 1Z24A 1SXUA 4AZRA 1HBQA 1W4TA 2GJ5A 1E2TA 2IZJA 2ALLX 4IAWA 3PQUA 1X8PA 2BS6A 2Q9SA 4I9RA 5FQ8E 2ZAGA 2NNEA 3U03A 1ERBA 1DF8A 1I04A 1ML7A 1SREA 2QO4A 5HWZA 1LCWA 3EMMA 2OF8A 4AZPA 2CM9A 2DM5A 2L9CA
chains in the Genus database with same CATH topology
4KT5A 4ZHCA 3P6FA 1JJJA 1HMRA 1X8OA 3RSWA 1DFVA 2AMMX 4IB6A 3TGCA 1X8UA 2RD7C 1JYDA 1QABE 1YP6A 2OVDA 4YCEA 3I0AA 3PH6A 4U3QA 1GT1A 1BEBA 1FENA 1FTPA 1P6PA 4GDZA 3CBCA 1QQSA 2GTFX 3UEXA 2L68A 4OS3A 4U8UM 1KT7A 1XCAA 2OVAA 1BSYA 1LPJA 1BWYA 4O3YA 1IFCA 2R56A 4O3XB 1YUPA 2LBVA 3WOVA 4TQ2A 1HQPA 2X8TA 3JS1A 3ZW0A 5AJCA 2HYSA 1GGLA 3C76X 3P6CA 4AYHA 5LJGA 3TGBA 3VG5A 1DF3A 3MVFA 2FS6A 4IMNA 5LJCA 2FTBA 2QO5A 3PP6A 3NQKA 3P24A 3NP1A 3HOLA 1YWCA 3HTYA 1U0XA 4R0BA 5EDCA 4YDAA 3O19A 2ZAIA 3CMPA 4ALOA 4L1NA 4IAXA 1FEMA 5BVSA 2F09A 4ORRA 3DSZA 2AT6X 5F6ZA 3BY0A 3C77X 2G7BA 4TLJA 1MDCA 1ZNLA 4IB8A 4O4OA 1HN2A 3P6DA 4GETA 3WJGA 5H8TA 4YBPA 1N0SA 4BQUA 4MVLA 2W2BA 4NLIA 4TJZA 1LNMA 4XMEA 5AEOA 3KFIA 1SY3A 1MVGA 1DZJA 2M4LA 2AL0X 1BLRA 4IMOA 3STNA 3U0DA 4UU2A 1PEEA 4OS8A 1EPAA 2JU3A 3EBWA 3RWXA 2GTLN 5HZ5A 1QY1A 5AQ6A 1CBSA 2A2GA 4RUNA 4AW8A 4NW4A 5K06A 4WFVA 4IABA 1SXYA 2ASNX 5D4AA 2KTSA 4XMCA 3HWEA 3D95A 1LIFA 1G7NA 1Y9LA 1ZNHA 2WUTA 5LJKA 2F73A 2BHVA 3MX7A 2IFBA 3KFGA 2JN3A 3I17A 3VG6A 2ACPX 4YCHA 2W2AA 3TF6A 4MISA 4JGLA 3KFFA 4L3RA 3KQ0A 2OZQA 4O4UA 1IIUA 1D2UA 3UAQA 4A8ZA 2LKKA 5CYBA 2MWHA 5LJDA 4TKBA 3P6HA 3BSZE 3HK1A 2XSTA 1T0VA 1KXOA 1BSOA 1A3YA 4ML7B 4ORXA 4CV7A 4GU8A 2GC9A 4K19A 4O9SA 2K23A 3B2LA 1IFBA 5EZ2A 3P6GA 5HA0A 1X71A 1G74A 3RZYA 2HNXA 2QOSC 3D4RA 3F9DA 4GRJA 4XMDA 5HZ9A 1OBPA 4GNYA 3L4RA 3BDRA 1LIDA 2JU8A 3NPOA 4ON1A 4GKCA 4ZH9A 3ZW1A 2JOZA 4I3CA 3F6ZB 1SMPI 3FENA 4NLJA 1IW2A 3K3LA 3PH5A 4HWMA 4ID2A 4HPBA 2Z4HA 4LZVA 1GKAA 3IFBA 1UZ2X 3AKMA 1X8NA 4XMFA 2JMBA 4FBRA 1L6MA 3CQNA 4YMYA 1CBIA 1JJXA 1FELA 4ES7A 1YP7A 4XMGA 3AKNA 3B2KA 4Y0PA 1EUOA 2FR2A 3BU9A 1LICA 4EDEA 3FR2A 4ZH6A 5JR8A 1E00A 4YKMA 2KD2A 4OS0A 3S5XA 4WBKA 3PQSA 1YWBA 4QGVA 1FE3A 5AJBA 3CWKA 2POAA 5LJEA 1GXAA 3SAOA 1A57A 1FDQA 1S44A 3FLLA 1QG5A 2GTLO 4AZMA 3S60A 1VYFA 4I9SA 5BVQA 4GK9A 3FA6A 4YKOA 3NX1A 2LBAA 1LFOA 4ODDA 3OJYC 5FFHA 1JZUA 1BRPA 1X8QA 4O3ZA 1ADLA 3ELXA 4YGZA 1BRQA 2HZRA 3VG7A 3NQ3A 3BU1A 1VPRA 2AT5X 5F7GA 4O49A 4NP1A 4A1HA 4ZJ0A 3PPTA 3OBLA 4MIRA 1GT3A 3FA9A 5LJHA 1ZNGA 2RCTA 3FW4A 1MX8A 2YG2A 4M7MA 1I05A 2X46A 3FEPA 1GX8A 4ZHDA 4Y0SA 1B4MA 1CBRA 3VU1A 2LA7A 5HTEA 2JW1A 4N7DA 4NNSA 4O4SA 1ZRYA 1SY0A 1SXXA 4IB7A 4RUUA 3WVMA 5FQ7E 1UREA 3HWGA 1OBQA 4DQ3A 1BJ7A 1ICMA 5CE4A 5DPQA 3CR6A 1OEJA 1TW4A 2Q4NA 4QYNA 1JV4A 1E02A 5BVTA 3O2YA 2A3FX 1KZWA 4ZFXA 2Z4IA 3HWDA 4QGWA 3RBYA 4QZTA 1EPBA 4EEJA 3S26A 3BS2A 1G85A 1KGLA 4QRLA 5C0NA 4YFQA 3UEWA 1TOWA 1BM5A 5H9KA 2ACOA 2K62A 2FLJA 1KT3A 2G78A 4FBVA 1HMSA 4WFUA 5FQ6E 1EXSA 4NYRA 4ZCBA 3P6EA 4Y0QA 5IO6A 4AZOA 1VYGA 1NP1A 3VG4A 1O1UA 1TXLA 4ZHHA 1O1VA 3F8AA 2XKLA 5LKEA 2WEXA 4TKHA 2AT8X 2WQ9A 4CSBA 1CJ5A 1DZMA 2JU7A 2RQ0A 1QWDA 2CZTA 3FR5A 5HZ8A 1O8VA 4FQBB 5IO7A 4LZUA 3Q6LA 1GT4A 2L5PA 1RLBE 1MUPA 3EYCA 3ZW2A 1BSQA 1BBPA 2R74A 4INNA 2RN4A 1AELA 3BX8A 3P02A 2BS5A 2HLVA 1A2DA 2X45A 5HCCC 1E5PA 1LKEA 3FELA 4I3DA 2RA6A 3B2IA 5B29A 2FRSA 5D45A 4ALBA 4TKJA 2NNDA 1I06A 2AKQA 2BLGA 3FYFA 1OBUA 1KT5A 3UEVA 3WBGA 1CRBA 3GAQA 5HCDC 1PM1X 4AZNA 1ZNDA 1KT6A 5EDBA 4IB9A 3D97A 1JBHA 3G7XA 4Y0RA 3IA8A 4NNTA 1ZNEA 2GTLM 4U8UN 2G79A 1KQXA 4KCAA 3B2JA 3WJCA 4ZR2A 1DZPA 1ACDA 4EXZA 3ZW0B 3ZI8A 3KZAA 1KOIA 3STMX 3HOEA 2OVSA 3VG3A 2RCQA 2KTDA 3WJBA 1AB0A 1GX9A 2NP1A 3ZUOA 3NADA 2N93A 4QQ1A 4U9CA 2A2UA 4DQ4A 4FBOA 3BX7A 1LF7A 1MX7A 4YGGA 2X8FA 1SA8A 1IKJA 4QNIA 5EEDA 5B27A 1QFVA 1SY2A 3APVA 3BLGA 4A60A 2WEWA 1EALA 5L8NA 3VE1A 4BVMA 5HTDA 1ERXA 1I4UA 5HAEA 4N7CA 3ZZVA 1T68X 3VE2A 4O4XA 2YMSA 3KFHA 3OD9A 4COTA 5KICA 5HZQA 3LHNA 5H9NA 1OEEA 4MVIA 1NGLA 2BT9A 3N91A 2WR6A 4YDBA 3CQRA 2FT9A 4KIIA 1AQBA 3TZSA 1DZKA 1EIOA 3FA7A 4D6AA 4LKTA 4EFGA 4GNWA 1EW3A 2O62A 1X89A 5F58A 1QY2A 2LB6A 1LIBA 1PMPA 4I6SA 3APXA 4LQZA 4KC7A 5BYPA 2EU7X 3U9PC 3EBKA 1EI5A 2FWVA 4QZUA 3VPJE 4M6SA 4GZVA 3O22A 3WJFA 4GH7A 4QYPA 1B0OA 3ZWEA 2L67A 3JQOA 4KH8A 3QKGA 3FEKA 4YFRA 4YGHA 3FR4A 2MJIA 5F1EA 3ZQ3A 1B56A 4CK4A 3VG2A 4ZGFA 4ZHGA 3FIQA 4ORUA 1EQDA 2OFMX 4ORSA 3E3CA 4YFPA 5HBSA 3UEUA 1DC9A 1OPBA 1E06A 4HPDA 2Q2PA 2CBRA 4I95A 3T1DA 5EEEA 4O3WA 1JYJA 1CBQA 1KQWA 4U8UO 4YH0A 2HZQA 2X8SA 4FGIB 3MBTA 2KT4B 4MVEA 5HA1A 3LV4A 2WQAE 1H91A 3ELZA 3NQ9A 3EM0A 3JSQA 5DG4A 3S5VA 3ZW1B 4IBAA 4UU3A 3FA8A 2A13A 1PBOA 1D3SA 2HMBA 1SXWA 1ZNKA 4A1YA 4QGXA 2Q2MA 1YIVA 2MM3A 1T8VA 1U17A 2FS7A 4AZQA 2WSJA 3GE2A 1QFTA 4MVKA 2AH7X 5D8JA 1GKAB 2LFOA 5H9LA 4XMHA 2MO5A 1GM6A 2E4JA 5KIDA 2QMIA 5LKFA 1OPAA 5L8IA 2AT0X 5D48A 1Y9TA 3C78X 3NR3A 3FMZA 2QM9A 3HWFA 1LIEA 3FW5A 3NX2A 1EIIA 3OE3A 2OFRX 1TVQA 4NYQA 4OMWA 5L8OA 3WJEA 2A0AA 1XKIA 4LKPA 4TNNA 1YWAA 2QO6A 1OEKA 1KZXA 1KT4A 2R73A 3V8UA 1R0UA 1GT5A 1ICNA 2CBSA 3RKGA 5HZ6A 2WWPA 1RBPA 3DTQA 2FR3A 2Q39A 1AVGI 5LJBA 4I3BA 5D47A 3ZUIA 5H9AA 4PJ2A 3APWA 3H3IA 5EPQA 1DV9A 1QY0A 1A18A 3APUA 4HPCA 5FENA 1S2PA 3PEDA 3STKA 1SY1A 2NNQA 3PECA 2AT3X 4ZGUA 1ALBA 3TGAA 2W2FA 5KHPA 4ORWA 1HBPA 4PSQA 4OMXA 2CM4A 3NBXX 4HFOA 1TOUA 4ZHFA 1G5WA 3WJDA 4KC8A 5FAZA 2P8GA 4ORYA 4D6BA 3WXQA 4YBUA 5IO5A 1HMTA 4HPAA 5F6BA 2MHDA 1YWDA 1S7DA 3BRNA 3SOTA 4QAEA 2PY1A 2ANSA 3CBSA 4ARHA 2OVEA 1B8EA 3D96A 2CZUA 1JIWI 2KW1A 1IKEA 1NP4A 3B2HA 4GE1A 5HCEC 4BOEA 4EQAC 1U18A 4WHIA 1Z24A 1SXUA 4AZRA 1HBQA 2GJ5A 2ALLX 4IAWA 3PQUA 1X8PA 2BS6A 2Q9SA 4I9RA 5FQ8E 2ZAGA 2NNEA 3U03A 1ERBA 1I04A 1ML7A 2QO4A 5HWZA 3EMMA 4AZPA 2CM9A 2DM5A 2L9CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZHC A;  3P6F A;  1JJJ A;  1HMR A;  1X8O A;  3RSW A;  1DFV A;  2AMM X;  4IB6 A;  3TGC A;  1X8U A;  2RD7 C;  1JYD A;  1QAB E;  1YP6 A;  2OVD A;  4YCE A;  3I0A A;  3PH6 A;  1GT1 A;  1BEB A;  1FEN A;  1FTP A;  1P6P A;  3CBC A;  1QQS A;  2GTF X;  3UEX A;  2L68 A;  4OS3 A;  1KT7 A;  1XCA A;  2OVA A;  1BSY A;  1LPJ A;  1BWY A;  1IFC A;  2R56 A;  4TQ2 A;  1YUP A;  2LBV A;  1HQP A;  3JS1 A;  2HYS A;  1GGL A;  3C76 X;  3P6C A;  4AYH A;  5LJG A;  3TGB A;  3VG5 A;  1DF3 A;  3MVF A;  2FS6 A;  4IMN A;  5LJC A;  2FTB A;  2QO5 A;  3PP6 A;  3NP1 A;  1YWC A;  4R0B A;  1U0X A;  5EDC A;  4YDA A;  3O19 A;  3CMP A;  4ALO A;  4IAX A;  1FEM A;  5BVS A;  4ORR A;  3DSZ A;  2AT6 X;  5F6Z A;  3BY0 A;  3C77 X;  2G7B A;  4TLJ A;  1MDC A;  1ZNL A;  4IB8 A;  1HN2 A;  3P6D A;  4GET A;  3WJG A;  5H8T A;  4YBP A;  1N0S A;  4BQU A;  4MVL A;  2W2B A;  4NLI A;  4TJZ A;  1LNM A;  4XME A;  3KFI A;  1SY3 A;  1MVG A;  1DZJ A;  2AL0 X;  1BLR A;  4IMO A;  3STN A;  3U0D A;  4UU2 A;  1PEE A;  4OS8 A;  1EPA A;  2JU3 A;  3EBW A;  5HZ5 A;  1QY1 A;  5AQ6 A;  1CBS A;  2A2G A;  4RUN A;  4AW8 A;  5K06 A;  4WFV A;  1SXY A;  2ASN X;  5D4A A;  4XMC A;  3HWE A;  3D95 A;  1LIF A;  1G7N A;  1ZNH A;  2WUT A;  5LJK A;  2F73 A;  2IFB A;  3KFG A;  2JN3 A;  3I17 A;  3VG6 A;  2ACP X;  4YCH A;  2W2A A;  3TF6 A;  3KFF A;  3KQ0 A;  2OZQ A;  4A8Z A;  1IIU A;  1D2U A;  2LKK A;  5LJD A;  4TKB A;  3P6H A;  3BSZ E;  3HK1 A;  2XST A;  1T0V A;  1KXO A;  1BSO A;  1A3Y A;  4ORX A;  2GC9 A;  4K19 A;  4O9S A;  2K23 A;  3B2L A;  1IFB A;  5EZ2 A;  3P6G A;  5HA0 A;  1X71 A;  1G74 A;  3RZY A;  2HNX A;  2QOS C;  4GRJ A;  3F9D A;  4XMD A;  5HZ9 A;  1OBP A;  4GNY A;  3L4R A;  3BDR A;  1LID A;  2JU8 A;  3NPO A;  4ZH9 A;  4GKC A;  2JOZ A;  4I3C A;  3FEN A;  4NLJ A;  1IW2 A;  3K3L A;  3PH5 A;  4HPB A;  4LZV A;  1GKA A;  3IFB A;  1UZ2 X;  3AKM A;  1X8N A;  4XMF A;  1L6M A;  3CQN A;  4YMY A;  1CBI A;  1JJX A;  1FEL A;  4ES7 A;  1YP7 A;  4XMG A;  3AKN A;  3B2K A;  4Y0P A;  1EUO A;  2FR2 A;  3BU9 A;  1LIC A;  4EDE A;  3FR2 A;  4ZH6 A;  5JR8 A;  1E00 A;  4YKM A;  4OS0 A;  4WBK A;  1YWB A;  4QGV A;  1FE3 A;  3CWK A;  2POA A;  5LJE A;  1GXA A;  3SAO A;  1A57 A;  1FDQ A;  1S44 A;  3FLL A;  1QG5 A;  4AZM A;  1VYF A;  4I9S A;  5BVQ A;  3FA6 A;  4YKO A;  3NX1 A;  2LBA A;  1LFO A;  4ODD A;  3OJY C;  5FFH A;  1JZU A;  1BRP A;  1X8Q A;  1ADL A;  3ELX A;  4YGZ A;  1BRQ A;  2HZR A;  3VG7 A;  3NQ3 A;  3BU1 A;  1VPR A;  2AT5 X;  5F7G A;  4NP1 A;  4A1H A;  4ZJ0 A;  3PPT A;  1GT3 A;  3FA9 A;  5LJH A;  1ZNG A;  2RCT A;  3FW4 A;  1MX8 A;  2YG2 A;  4M7M A;  1I05 A;  2X46 A;  3FEP A;  1GX8 A;  4ZHD A;  4Y0S A;  1B4M A;  1CBR A;  5HTE A;  4N7D A;  4NNS A;  1ZRY A;  1SY0 A;  1SXX A;  4IB7 A;  4RUU A;  3WVM A;  1URE A;  3HWG A;  1OBQ A;  4DQ3 A;  1BJ7 A;  1ICM A;  5CE4 A;  5DPQ A;  3CR6 A;  1OEJ A;  1TW4 A;  2Q4N A;  4QYN A;  1JV4 A;  1E02 A;  5BVT A;  3O2Y A;  2A3F X;  1KZW A;  4ZFX A;  3HWD A;  4QGW A;  4QZT A;  1EPB A;  4EEJ A;  3S26 A;  3BS2 A;  1G85 A;  1KGL A;  5C0N A;  4YFQ A;  3UEW A;  1TOW A;  1BM5 A;  5H9K A;  2ACO A;  2K62 A;  2FLJ A;  1KT3 A;  2G78 A;  1HMS A;  4WFU A;  4ZCB A;  1EXS A;  4NYR A;  3P6E A;  4Y0Q A;  5IO6 A;  4AZO A;  1VYG A;  1NP1 A;  3VG4 A;  1O1U A;  1TXL A;  4ZHH A;  1O1V A;  3F8A A;  2XKL A;  5LKE A;  2WEX A;  4TKH A;  2AT8 X;  2WQ9 A;  1CJ5 A;  1DZM A;  2JU7 A;  2RQ0 A;  1QWD A;  2CZT A;  3FR5 A;  5HZ8 A;  1O8V A;  5IO7 A;  4LZU A;  3Q6L A;  1GT4 A;  2L5P A;  1RLB E;  1MUP A;  3EYC A;  1BSQ A;  1BBP A;  2R74 A;  1AEL A;  3BX8 A;  2HLV A;  1A2D A;  2X45 A;  5HCC C;  1E5P A;  1LKE A;  3FEL A;  4I3D A;  2RA6 A;  3B2I A;  5B29 A;  2FRS A;  5D45 A;  4ALB A;  4TKJ A;  2NND A;  1I06 A;  2AKQ A;  2BLG A;  1OBU A;  1KT5 A;  3UEV A;  3WBG A;  1CRB A;  3GAQ A;  5HCD C;  1PM1 X;  4AZN A;  1ZND A;  1KT6 A;  5EDB A;  4IB9 A;  3D97 A;  1JBH A;  3G7X A;  4Y0R A;  3IA8 A;  4NNT A;  1ZNE A;  2G79 A;  1KQX A;  3WJC A;  3B2J A;  4ZR2 A;  1DZP A;  1ACD A;  4EXZ A;  3KZA A;  1KOI A;  3STM X;  3VG3 A;  2RCQ A;  2KTD A;  3WJB A;  1AB0 A;  1GX9 A;  2NP1 A;  3ZUO A;  3NAD A;  2N93 A;  2A2U A;  4DQ4 A;  3BX7 A;  1LF7 A;  1MX7 A;  4YGG A;  1SA8 A;  1IKJ A;  5EED A;  5B27 A;  1QFV A;  1SY2 A;  3APV A;  3BLG A;  4A60 A;  2WEW A;  1EAL A;  5L8N A;  4BVM A;  5HTD A;  1ERX A;  1I4U A;  5HAE A;  4N7C A;  1T68 X;  3KFH A;  5KIC A;  5HZQ A;  5H9N A;  1OEE A;  4MVI A;  1NGL A;  2WR6 A;  4YDB A;  3CQR A;  2FT9 A;  4KII A;  1AQB A;  3TZS A;  1DZK A;  1EIO A;  3FA7 A;  4D6A A;  4LKT A;  4EFG A;  4GNW A;  1EW3 A;  2O62 A;  1X89 A;  5F58 A;  1QY2 A;  2LB6 A;  1LIB A;  1PMP A;  3APX A;  2EU7 X;  3U9P C;  3EBK A;  2FWV A;  4QZU A;  4M6S A;  3O22 A;  3WJF A;  4GH7 A;  4QYP A;  1B0O A;  2L67 A;  3QKG A;  3FEK A;  4YFR A;  4YGH A;  3FR4 A;  2MJI A;  5F1E A;  3ZQ3 A;  1B56 A;  4CK4 A;  3VG2 A;  4ZHG A;  3FIQ A;  4ORU A;  1EQD A;  2OFM X;  4ORS A;  5HBS A;  4YFP A;  3UEU A;  1DC9 A;  1OPB A;  1E06 A;  4HPD A;  2Q2P A;  2CBR A;  3T1D A;  5EEE A;  1JYJ A;  1CBQ A;  1KQW A;  4YH0 A;  2HZQ A;  3MBT A;  2KT4 B;  5HA1 A;  2WQA E;  1H91 A;  3ELZ A;  3NQ9 A;  3EM0 A;  3JSQ A;  5DG4 A;  4IBA A;  4UU3 A;  3FA8 A;  2A13 A;  1PBO A;  1D3S A;  2HMB A;  1SXW A;  1ZNK A;  4A1Y A;  4QGX A;  2Q2M A;  1YIV A;  2MM3 A;  1T8V A;  1U17 A;  2FS7 A;  4AZQ A;  2WSJ A;  1QFT A;  4MVK A;  2AH7 X;  5D8J A;  1GKA B;  2LFO A;  5H9L A;  4XMH A;  2MO5 A;  1GM6 A;  2E4J A;  5KID A;  5LKF A;  1OPA A;  5L8I A;  2AT0 X;  5D48 A;  3C78 X;  3NR3 A;  3FMZ A;  2QM9 A;  3HWF A;  1LIE A;  3FW5 A;  3NX2 A;  1EII A;  4NYQ A;  2OFR X;  1TVQ A;  4OMW A;  5L8O A;  3WJE A;  2A0A A;  1XKI A;  4LKP A;  4TNN A;  1YWA A;  2QO6 A;  1OEK A;  1KZX A;  1KT4 A;  2R73 A;  1R0U A;  1GT5 A;  1ICN A;  2CBS A;  5HZ6 A;  2WWP A;  1RBP A;  3DTQ A;  2FR3 A;  2Q39 A;  1AVG I;  5LJB A;  4I3B A;  5D47 A;  3ZUI A;  5H9A A;  3APW A;  5EPQ A;  1DV9 A;  1QY0 A;  1A18 A;  3APU A;  4HPC A;  5FEN A;  1S2P A;  3PED A;  3STK A;  1SY1 A;  2NNQ A;  3PEC A;  2AT3 X;  4ZGU A;  1ALB A;  3TGA A;  2W2F A;  5KHP A;  4ORW A;  1HBP A;  4PSQ A;  4OMX A;  2CM4 A;  4HFO A;  4ZHF A;  1TOU A;  1G5W A;  3WJD A;  5FAZ A;  2P8G A;  4ORY A;  4D6B A;  3WXQ A;  4YBU A;  5IO5 A;  1HMT A;  4HPA A;  5F6B A;  1YWD A;  1S7D A;  3BRN A;  4QAE A;  2PY1 A;  2ANS A;  3CBS A;  4ARH A;  2OVE A;  1B8E A;  3D96 A;  2CZU A;  3B2H A;  1IKE A;  4GE1 A;  1NP4 A;  5HCE C;  4BOE A;  1U18 A;  1Z24 A;  1SXU A;  4AZR A;  1HBQ A;  2GJ5 A;  2ALL X;  4IAW A;  1X8P A;  2Q9S A;  4I9R A;  2NNE A;  3U03 A;  1ERB A;  1I04 A;  1ML7 A;  2QO4 A;  5HWZ A;  3EMM A;  4AZP A;  2CM9 A;  2DM5 A;  2L9C A; 
#chains in the Genus database with same CATH topology
 4KT5 A;  4ZHC A;  3P6F A;  1JJJ A;  4NV8 A;  1HMR A;  1X8O A;  3RSW A;  5K68 A;  1SWS A;  3SZH A;  1DFV A;  2AMM X;  4IB6 A;  3TGC A;  1X8U A;  2RD7 C;  1JYD A;  1QAB E;  1YP6 A;  2BSZ A;  2OVD A;  4NV7 A;  4YCE A;  3I0A A;  3PH6 A;  4U3Q A;  1GT1 A;  1BEB A;  1FEN A;  1FTP A;  1P6P A;  4GDZ A;  3CBC A;  1QQS A;  2OL7 A;  1VWE B;  2GTF X;  4Z2P A;  3UEX A;  2L68 A;  4OS3 A;  4U8U M;  1KT7 A;  1XCA A;  2OVA A;  1BSY A;  1LPJ A;  3Q34 A;  4BCS A;  1BWY A;  4O3Y A;  1IFC A;  2R56 A;  1AVD A;  1YUP A;  4O3X B;  2LBV A;  3WOV A;  1HQP A;  4TQ2 A;  2X8T A;  3JS1 A;  3ZW0 A;  5AJC A;  2HYS A;  1GGL A;  3C76 X;  3P6C A;  4AYH A;  5LJG A;  3VHI A;  3VG5 A;  1RXK A;  3TGB A;  3MVF A;  1DF3 A;  2FS6 A;  4IMN A;  5LJC A;  2FTB A;  2QO5 A;  3PP6 A;  3NQK A;  3P24 A;  3NP1 A;  3HOL A;  1YWC A;  1LDO A;  1U0X A;  3HTY A;  4R0B A;  5EDC A;  4YDA A;  3O19 A;  3RDS A;  2ZAI A;  2IZC B;  3CMP A;  4ALO A;  2VFB A;  2IZG B;  4L1N A;  1Y0G A;  1SWL A;  3LTW A;  4IAX A;  1I78 A;  1FEM A;  5BVS A;  2F09 A;  4ORR A;  1SLF B;  3DSZ A;  2AT6 X;  5F6Z A;  2X56 A;  3BY0 A;  2G7B A;  3C77 X;  1MDC A;  1ZNL A;  4IB8 A;  3MM0 A;  4O4O A;  1HN2 A;  3P6D A;  4GET A;  3SLT A;  3WJG A;  5K67 A;  5H8T A;  4YBP A;  1N0S A;  4BQU A;  1VWN B;  4MVL A;  3RY1 A;  2W2B A;  4NLI A;  4BX5 A;  3UEU A;  4TJZ A;  1N9M A;  1LNM A;  4GGZ A;  4XME A;  5AEO A;  3KFI A;  1SY3 A;  1MVG A;  1DZJ A;  2M4L A;  2AL0 X;  1LDQ A;  5B11 O;  3X00 A;  1BLR A;  2X4M A;  4IMO A;  3STN A;  2ZSC A;  1SLD B;  4UU2 A;  1PEE A;  4Y5D A;  3T2X A;  1SWK A;  2C1S A;  3QQ2 A;  3U0D A;  4OS8 A;  2VDF A;  1SWE A;  2Y32 A;  4BX6 B;  1EPA A;  2JU3 A;  3EBW A;  3RWX A;  2GTL N;  5HZ5 A;  1QY1 A;  1MEP A;  5AQ6 A;  1CBS A;  2IZH B;  1SRG A;  3WYQ A;  2A2G A;  4RUN A;  5B2A O;  4AW8 A;  2RTD B;  2RTC B;  4NW4 A;  5K06 A;  4WFV A;  4IAB A;  1SXY A;  1WBI A;  2ASN X;  2RTR B;  3SLJ A;  5D4A A;  2KTS A;  4XMC A;  3HWE A;  3D9W A;  3D95 A;  1LIF A;  1G7N A;  1Y9L A;  1ZNH A;  1MOY A;  2WUT A;  5LJK A;  2F73 A;  2BHV A;  3MX7 A;  2IFB A;  3KFG A;  3T2W A;  2JN3 A;  3I17 A;  2RTG B;  4I60 A;  3VG6 A;  2ACP X;  4YCH A;  2W2A A;  2AF5 A;  3TF6 A;  4MIS A;  4JGL A;  3KFF A;  4L3R A;  3KQ0 A;  2OZQ A;  4O4U A;  1IIU A;  1D2U A;  3UAQ A;  4MEE A;  2LKK A;  5CYB A;  2MWH A;  5LJD A;  4TKB A;  5IRW A;  3P6H A;  3BSZ E;  4DNE A;  1PBY A;  3HK1 A;  2XST A;  1N43 A;  1RXJ A;  1KXO A;  1T0V A;  3HPE A;  1BSO A;  1A3Y A;  3AUM O;  4ML7 B;  4ORX A;  5B5G A;  4CV7 A;  1N4J A;  1MK5 A;  1VWJ B;  1Y53 X;  2GC9 A;  2IZL B;  2OL8 O;  4GU8 A;  4K19 A;  2K23 A;  4O9S A;  3B2L A;  1IFB A;  4Z27 A;  5EZ2 A;  3P6G A;  5HA0 A;  1X71 A;  1G74 A;  2DJF A;  3RZY A;  2HNX A;  2OFA A;  2QOS C;  3D4R A;  3F9D A;  4GRJ A;  4XMD A;  2DJG A;  5HZ9 A;  1VWB B;  1OBP A;  4GNY A;  3L4R A;  3BDR A;  1LID A;  2JU8 A;  3NPO A;  4ON1 A;  4GKC A;  4ZH9 A;  3ZW1 A;  2JOZ A;  4I3C A;  3F6Z B;  1SMP I;  3FEN A;  4IRW A;  4NLJ A;  1IW2 A;  5B10 O;  3K3L A;  3PH5 A;  1IJ8 A;  4HWM A;  2GH7 A;  4ID2 A;  1Y55 X;  4HPB A;  2Z4H A;  4LZV A;  3SLO A;  1GKA A;  3IFB A;  3CKF A;  4BBO A;  1UZ2 X;  3AKM A;  1X8N A;  4XMF A;  2JMB A;  4FBR A;  1L6M A;  2IZA A;  3CQN A;  5JD2 A;  4YMY A;  1CBI A;  1JJX A;  1FEL A;  4ES7 A;  1YP7 A;  4XMG A;  3AKN A;  3B2K A;  4Z6J A;  4Y0P A;  1EUO A;  2IZE B;  2FR2 A;  2RTO B;  1LIC A;  3BU9 A;  3FR2 A;  4ZH6 A;  4EDE A;  2OL6 O;  5JR8 A;  1E00 A;  4YKM A;  2KD2 A;  4OS0 A;  3S5X A;  4CDE A;  4WBK A;  3PQS A;  4BJ8 A;  1YWB A;  2I5V O;  4QGV A;  1FE3 A;  4GGT A;  2X34 A;  3CWK A;  2POA A;  3MG5 A;  5AJB A;  1SWA A;  2OYB O;  5LJE A;  1GXA A;  3SAO A;  1A57 A;  1FDQ A;  2G5L A;  1S44 A;  1SWG A;  3FLL A;  1PTS A;  1QG5 A;  2GTL O;  4AZM A;  3S60 A;  1VYF A;  3SZI A;  1LUQ A;  3RE6 A;  4I9S A;  5BVQ A;  1HY2 A;  1W6F A;  4OEM A;  4GK9 A;  2WPU A;  3RDO A;  3FA6 A;  4YKO A;  1VWA B;  3NX1 A;  2LBA A;  1LFO A;  4ODD A;  3OJY C;  2OY1 O;  5FFH A;  1BRP A;  1JZU A;  1JJU A;  1X8Q A;  3T6L A;  4O3Z A;  3RDX A;  1ADL A;  3ELX A;  2A5C A;  2UYW A;  4JHQ A;  4YGZ A;  4B55 A;  2X32 A;  4CPE A;  1BRQ A;  2HZR A;  1VWH B;  3VG7 A;  3NQ3 A;  1KFF A;  4JO6 A;  3BU1 A;  4OKA A;  1VPR A;  2AT5 X;  5F7G A;  4O49 A;  2RTI B;  4NP1 A;  4BX7 B;  4AZQ A;  3PDF A;  3KVN A;  4A1H A;  4ZJ0 A;  3PPT A;  3OBL A;  4MIR A;  1JMX A;  1SWJ A;  1GT3 A;  3FA9 A;  1SWD A;  1SWB A;  5LJH A;  1ZNG A;  2RCT A;  2RTL A;  1MX8 A;  2YG2 A;  3FW4 A;  1I05 A;  2X46 A;  4M7M A;  5B5F A;  1VWP B;  2Y3E A;  3FEP A;  1GX8 A;  4ZHD A;  4Y0S A;  3VHM A;  4CPH B;  1B4M A;  1CBR A;  1HQQ A;  2RTK A;  3VU1 A;  2LA7 A;  5HTE A;  2JW1 A;  4N7D A;  4NNS A;  1NDJ A;  4O4S A;  1UYO X;  1ZRY A;  2RTE B;  1SY0 A;  1SXX A;  4IB7 A;  4RUU A;  1SWP A;  3WVM A;  5FQ7 E;  1URE A;  1RSU B;  3HWG A;  1OBQ A;  4DQ3 A;  1BJ7 A;  1ICM A;  5CE4 A;  5DPQ A;  3CR6 A;  4GUZ A;  5CHK A;  1OEJ A;  1TW4 A;  2Q4N A;  1VYO A;  4QYN A;  1JV4 A;  1E02 A;  5BVT A;  5IXG A;  3O2Y A;  2A3F X;  1KZW A;  3SZJ A;  4ZFX A;  2Z4I A;  1SRI A;  3HWD A;  4QGW A;  3RBY A;  4QZT A;  1EPB A;  1LEL A;  3S26 A;  4EEJ A;  3BS2 A;  4Z2V A;  1G85 A;  1KGL A;  4QRL A;  2Y3F A;  4YFQ A;  5C0N A;  3UEW A;  1TOW A;  1BM5 A;  2OFB A;  2ACO A;  5H9K A;  2K62 A;  3WZQ A;  2FLJ A;  1KT3 A;  2G78 A;  4FBV A;  1HMS A;  1NC9 A;  4WFU A;  5FQ6 E;  1EXS A;  1N7Y A;  4NYR A;  4ZCB A;  3P6E A;  1AVE A;  1KL3 A;  1SWO A;  4Y0Q A;  1SWR A;  5IO6 A;  4AZO A;  4C5P A;  4CDD A;  1VYG A;  1NP1 A;  3VG4 A;  5CSE A;  1K3B A;  5L3Y A;  1O1U A;  1TXL A;  4ZHH A;  1O1V A;  3F8A A;  2MF6 A;  2XKL A;  5LKE A;  3WZP A;  1VWL B;  2WEX A;  2AT8 X;  1N9Y A;  4TKH A;  2WQ9 A;  4CSB A;  2RTH B;  1CJ5 A;  1DZM A;  2JU7 A;  2RQ0 A;  1QWD A;  2CZT A;  3FR5 A;  3PK2 A;  1O8V A;  4FQB B;  5HZ8 A;  5IO7 A;  4LZU A;  3Q6L A;  1GT4 A;  2L5P A;  2C1Q A;  1RLB E;  1MUP A;  3EYC A;  3ZW2 A;  1BSQ A;  4CDC A;  1GX3 A;  1BBP A;  2R74 A;  4INN A;  2RN4 A;  1AEL A;  2C4I A;  2RTM A;  3BX8 A;  3P02 A;  2BS5 A;  2HLV A;  1A2D A;  2X45 A;  2RTP B;  5HCC C;  1HXL A;  1E5P A;  1LKE A;  2PI3 O;  3FEL A;  2RA6 A;  4I3D A;  4YVB A;  3B2I A;  5IRU A;  4DCB A;  1SWT A;  2FRS A;  5D45 A;  4ALB A;  4TKJ A;  5B29 A;  2NND A;  1I06 A;  2AKQ A;  2BLG A;  3FYF A;  1OBU A;  4CPF A;  1KT5 A;  3UEV A;  3WBG A;  1CRB A;  3GAQ A;  2FHN X;  5HCD C;  4GJV A;  2RTQ B;  1PM1 X;  4AZN A;  3EW2 A;  1SWH A;  1ZND A;  1KT6 A;  2RTJ A;  5EDB A;  4IB9 A;  1SLG B;  1KL5 A;  3D97 A;  1VWG B;  3CKG A;  4BX6 A;  1MM9 A;  1JBH A;  3G7X A;  4Y0R A;  2OY7 A;  3IA8 A;  4NNT A;  1ZNE A;  2GTL M;  3VGW A;  4U8U N;  2G79 A;  2RTF B;  3RDQ A;  1KQX A;  4KCA A;  3B2J A;  3WJC A;  4ZR2 A;  1DZP A;  1ACD A;  2IZD B;  4EXZ A;  3ZW0 B;  3ZI8 A;  3KZA A;  1KOI A;  3STM X;  3HOE A;  2OVS A;  3VG3 A;  2RCQ A;  2KTD A;  1SWN A;  4U46 A;  1AB0 A;  3WJB A;  1GX9 A;  2NP1 A;  1NBX A;  2RTB B;  2N93 A;  3NAD A;  3ZUO A;  1JQP A;  1UYN X;  2UZ2 A;  4QQ1 A;  1VWK B;  4U9C A;  2A2U A;  4DQ4 A;  2OF9 A;  2A5B A;  4FBO A;  3BX7 A;  1LF7 A;  1MX7 A;  4YGG A;  2X8F A;  1SA8 A;  1IKJ A;  4QNI A;  5EED A;  5B27 A;  3AEH A;  1QFV A;  1SY2 A;  3APV A;  3BLG A;  4A60 A;  2WEW A;  2I5Z O;  1EAL A;  5L8N A;  3VE1 A;  4BVM A;  5HTD A;  4BX5 B;  4A8Z A;  2G8C O;  1ERX A;  1I4U A;  5HAE A;  4N7C A;  3ZZV A;  1T68 X;  3VE2 A;  4O4X A;  2YMS A;  3KFH A;  1VWM B;  3OD9 A;  4COT A;  5KIC A;  5HZQ A;  3LHN A;  5H9N A;  2CAM A;  1OEE A;  4MVI A;  5B3M O;  2FKJ A;  1NGL A;  2BT9 A;  3N91 A;  2WR6 A;  1SWF A;  4YDB A;  3CQR A;  2FT9 A;  4KII A;  1AQB A;  2FKG A;  3TZS A;  4Z28 A;  1DZK A;  1EIO A;  3FA7 A;  3WZN A;  4LKT A;  4D6A A;  4EFG A;  4GGR A;  1EW3 A;  2O62 A;  1X89 A;  4GNW A;  5F58 A;  2OY8 A;  1QY2 A;  2LB6 A;  1LIB A;  1PMP A;  4I6S A;  3APX A;  4LQZ A;  3EW1 A;  4KC7 A;  1SWC A;  5BYP A;  1RST B;  2EU7 X;  3U9P C;  3EBK A;  1EI5 A;  2FWV A;  4GDA A;  4GJS A;  4QZU A;  3VPJ E;  4GD9 A;  2RTA A;  4M6S A;  4GZV A;  3O22 A;  3WJF A;  4GH7 A;  1NQN A;  4QYP A;  1B0O A;  2JGS A;  3ZWE A;  3FDC A;  2L67 A;  3WZO A;  3JQO A;  4KH8 A;  3QKG A;  3FEK A;  4YFR A;  4YGH A;  3FR4 A;  2MJI A;  5F1E A;  3ZQ3 A;  1B56 A;  4CK4 A;  3VG2 A;  4ZGF A;  4ZHG A;  3FIQ A;  2OY5 O;  4ORU A;  1EQD A;  1STS B;  2OFM X;  3E3C A;  1OSP O;  4ORS A;  4YFP A;  5F2B A;  1DC9 A;  1OPB A;  1E06 A;  5HBS A;  2IZF B;  4HPD A;  2FGS A;  2Q2P A;  2CBR A;  4Y59 A;  4I95 A;  1JMZ A;  1I9H A;  3T1D A;  5EEE A;  4O3W A;  1JYJ A;  3FID A;  1CBQ A;  1KQW A;  4U8U O;  4YH0 A;  2HZQ A;  2X8S A;  4FGI B;  4EKV A;  1W5R A;  3MBT A;  2KT4 B;  4MVE A;  5HA1 A;  1KL4 A;  3LV4 A;  2WQA E;  1H91 A;  3ELZ A;  3NQ9 A;  3RY2 A;  3EM0 A;  3JSQ A;  5DG4 A;  3S5V A;  3ZW1 B;  3EC5 A;  4IBA A;  4UU3 A;  3FA8 A;  1SWU A;  1K24 A;  2A13 A;  1PBO A;  1D3S A;  2HMB A;  1SXW A;  1SRJ A;  1ZNK A;  4A1Y A;  4QGX A;  2Q2M A;  4TLJ A;  1YIV A;  2MM3 A;  1T8V A;  1U17 A;  1VWI B;  2A8G A;  2FS7 A;  2IZB A;  2RTN B;  1QFT A;  2WSJ A;  3GE2 A;  4JNJ A;  2VFC A;  4MVK A;  2AH7 X;  1SRF A;  5D8J A;  1GKA B;  2LFO A;  4BX7 A;  5H9L A;  1HXZ A;  2MO5 A;  4XMH A;  1GM6 A;  2E4J A;  2IZI A;  5KID A;  1SWQ A;  2QMI A;  1OPA A;  5LKF A;  5L8I A;  2AT0 X;  5D48 A;  4OEL A;  1Y9T A;  5IRA A;  3C78 X;  1RXH A;  1FJ1 E;  3NR3 A;  1LCV A;  2QOM A;  3FMZ A;  2QM9 A;  3HWF A;  1LIE A;  3FW5 A;  1VWC B;  4CPH A;  3NX2 A;  1EII A;  3OE3 A;  1VWO B;  1TVQ A;  2OFR X;  4NYQ A;  4OMW A;  5L8O A;  3WJE A;  2A0A A;  1XKI A;  4LKP A;  3T6F A;  1VWD B;  4TNN A;  1YWA A;  2QO6 A;  1SRH A;  1OEK A;  1KZX A;  1KT4 A;  2R73 A;  3V8U A;  1R0U A;  1GT5 A;  2IZK A;  1ICN A;  3RE5 A;  2CBS A;  3RKG A;  5HZ6 A;  2WWP A;  1STR B;  1RBP A;  3DTQ A;  2FR3 A;  2Q39 A;  1AVG I;  5LJB A;  3VHH A;  2HKD A;  4I3B A;  5D47 A;  2AVI A;  3ZUI A;  5H9A A;  4PJ2 A;  3APW A;  3H3I A;  5EPQ A;  2FHL A;  4Z2O A;  1DV9 A;  1QY0 A;  1A18 A;  3APU A;  4HPC A;  1NQM A;  5FEN A;  1S2P A;  3PED A;  3RDM A;  3STK A;  1SY1 A;  2NNQ A;  1VWQ B;  2AT3 X;  3PEC A;  4ZGU A;  1ALB A;  3TGA A;  2W2F A;  5KHP A;  4ORW A;  1HBP A;  4BGF A;  4PSQ A;  3RDU A;  4OMX A;  2CM4 A;  3NBX X;  4HFO A;  1TOU A;  4CDF A;  4ZHF A;  1G5W A;  1WUB A;  3WJD A;  4KC8 A;  2X55 A;  5FAZ A;  2P8G A;  4ORY A;  4D6B A;  1LCZ A;  1SLE B;  1VWF B;  1RAV A;  3WYP A;  4YBU A;  3WXQ A;  1Y52 X;  1HMT A;  5IO5 A;  4HPA A;  1VWR B;  4CPI A;  5F6B A;  2MHD A;  1YWD A;  1S7D A;  3BRN A;  3SOT A;  2QCB A;  2F01 A;  2PY1 A;  2ANS A;  3CBS A;  4QAE A;  4ARH A;  2OVE A;  1B8E A;  3D96 A;  2CZU A;  1STP A;  1JIW I;  1IKE A;  2KW1 A;  1NP4 A;  3B2H A;  4GE1 A;  5HCE C;  4BOE A;  4EQA C;  1U18 A;  4WHI A;  2BC3 A;  1Z24 A;  1SXU A;  4AZR A;  1HBQ A;  1W4T A;  2GJ5 A;  1E2T A;  2IZJ A;  2ALL X;  4IAW A;  3PQU A;  1X8P A;  2BS6 A;  2Q9S A;  4I9R A;  5FQ8 E;  2ZAG A;  2NNE A;  3U03 A;  1ERB A;  1DF8 A;  1I04 A;  1ML7 A;  1SRE A;  2QO4 A;  5HWZ A;  1LCW A;  3EMM A;  2OF8 A;  4AZP A;  2CM9 A;  2DM5 A;  2L9C A; 
#chains in the Genus database with same CATH homology
 4KT5 A;  4ZHC A;  3P6F A;  1JJJ A;  1HMR A;  1X8O A;  3RSW A;  1DFV A;  2AMM X;  4IB6 A;  3TGC A;  1X8U A;  2RD7 C;  1JYD A;  1QAB E;  1YP6 A;  2OVD A;  4YCE A;  3I0A A;  3PH6 A;  4U3Q A;  1GT1 A;  1BEB A;  1FEN A;  1FTP A;  1P6P A;  4GDZ A;  3CBC A;  1QQS A;  2GTF X;  3UEX A;  2L68 A;  4OS3 A;  4U8U M;  1KT7 A;  1XCA A;  2OVA A;  1BSY A;  1LPJ A;  1BWY A;  4O3Y A;  1IFC A;  2R56 A;  4O3X B;  1YUP A;  2LBV A;  3WOV A;  4TQ2 A;  1HQP A;  2X8T A;  3JS1 A;  3ZW0 A;  5AJC A;  2HYS A;  1GGL A;  3C76 X;  3P6C A;  4AYH A;  5LJG A;  3TGB A;  3VG5 A;  1DF3 A;  3MVF A;  2FS6 A;  4IMN A;  5LJC A;  2FTB A;  2QO5 A;  3PP6 A;  3NQK A;  3P24 A;  3NP1 A;  3HOL A;  1YWC A;  3HTY A;  1U0X A;  4R0B A;  5EDC A;  4YDA A;  3O19 A;  2ZAI A;  3CMP A;  4ALO A;  4L1N A;  4IAX A;  1FEM A;  5BVS A;  2F09 A;  4ORR A;  3DSZ A;  2AT6 X;  5F6Z A;  3BY0 A;  3C77 X;  2G7B A;  4TLJ A;  1MDC A;  1ZNL A;  4IB8 A;  4O4O A;  1HN2 A;  3P6D A;  4GET A;  3WJG A;  5H8T A;  4YBP A;  1N0S A;  4BQU A;  4MVL A;  2W2B A;  4NLI A;  4TJZ A;  1LNM A;  4XME A;  5AEO A;  3KFI A;  1SY3 A;  1MVG A;  1DZJ A;  2M4L A;  2AL0 X;  1BLR A;  4IMO A;  3STN A;  3U0D A;  4UU2 A;  1PEE A;  4OS8 A;  1EPA A;  2JU3 A;  3EBW A;  3RWX A;  2GTL N;  5HZ5 A;  1QY1 A;  5AQ6 A;  1CBS A;  2A2G A;  4RUN A;  4AW8 A;  4NW4 A;  5K06 A;  4WFV A;  4IAB A;  1SXY A;  2ASN X;  5D4A A;  2KTS A;  4XMC A;  3HWE A;  3D95 A;  1LIF A;  1G7N A;  1Y9L A;  1ZNH A;  2WUT A;  5LJK A;  2F73 A;  2BHV A;  3MX7 A;  2IFB A;  3KFG A;  2JN3 A;  3I17 A;  3VG6 A;  2ACP X;  4YCH A;  2W2A A;  3TF6 A;  4MIS A;  4JGL A;  3KFF A;  4L3R A;  3KQ0 A;  2OZQ A;  4O4U A;  1IIU A;  1D2U A;  3UAQ A;  4A8Z A;  2LKK A;  5CYB A;  2MWH A;  5LJD A;  4TKB A;  3P6H A;  3BSZ E;  3HK1 A;  2XST A;  1T0V A;  1KXO A;  1BSO A;  1A3Y A;  4ML7 B;  4ORX A;  4CV7 A;  4GU8 A;  2GC9 A;  4K19 A;  4O9S A;  2K23 A;  3B2L A;  1IFB A;  5EZ2 A;  3P6G A;  5HA0 A;  1X71 A;  1G74 A;  3RZY A;  2HNX A;  2QOS C;  3D4R A;  3F9D A;  4GRJ A;  4XMD A;  5HZ9 A;  1OBP A;  4GNY A;  3L4R A;  3BDR A;  1LID A;  2JU8 A;  3NPO A;  4ON1 A;  4GKC A;  4ZH9 A;  3ZW1 A;  2JOZ A;  4I3C A;  3F6Z B;  1SMP I;  3FEN A;  4NLJ A;  1IW2 A;  3K3L A;  3PH5 A;  4HWM A;  4ID2 A;  4HPB A;  2Z4H A;  4LZV A;  1GKA A;  3IFB A;  1UZ2 X;  3AKM A;  1X8N A;  4XMF A;  2JMB A;  4FBR A;  1L6M A;  3CQN A;  4YMY A;  1CBI A;  1JJX A;  1FEL A;  4ES7 A;  1YP7 A;  4XMG A;  3AKN A;  3B2K A;  4Y0P A;  1EUO A;  2FR2 A;  3BU9 A;  1LIC A;  4EDE A;  3FR2 A;  4ZH6 A;  5JR8 A;  1E00 A;  4YKM A;  2KD2 A;  4OS0 A;  3S5X A;  4WBK A;  3PQS A;  1YWB A;  4QGV A;  1FE3 A;  5AJB A;  3CWK A;  2POA A;  5LJE A;  1GXA A;  3SAO A;  1A57 A;  1FDQ A;  1S44 A;  3FLL A;  1QG5 A;  2GTL O;  4AZM A;  3S60 A;  1VYF A;  4I9S A;  5BVQ A;  4GK9 A;  3FA6 A;  4YKO A;  3NX1 A;  2LBA A;  1LFO A;  4ODD A;  3OJY C;  5FFH A;  1JZU A;  1BRP A;  1X8Q A;  4O3Z A;  1ADL A;  3ELX A;  4YGZ A;  1BRQ A;  2HZR A;  3VG7 A;  3NQ3 A;  3BU1 A;  1VPR A;  2AT5 X;  5F7G A;  4O49 A;  4NP1 A;  4A1H A;  4ZJ0 A;  3PPT A;  3OBL A;  4MIR A;  1GT3 A;  3FA9 A;  5LJH A;  1ZNG A;  2RCT A;  3FW4 A;  1MX8 A;  2YG2 A;  4M7M A;  1I05 A;  2X46 A;  3FEP A;  1GX8 A;  4ZHD A;  4Y0S A;  1B4M A;  1CBR A;  3VU1 A;  2LA7 A;  5HTE A;  2JW1 A;  4N7D A;  4NNS A;  4O4S A;  1ZRY A;  1SY0 A;  1SXX A;  4IB7 A;  4RUU A;  3WVM A;  5FQ7 E;  1URE A;  3HWG A;  1OBQ A;  4DQ3 A;  1BJ7 A;  1ICM A;  5CE4 A;  5DPQ A;  3CR6 A;  1OEJ A;  1TW4 A;  2Q4N A;  4QYN A;  1JV4 A;  1E02 A;  5BVT A;  3O2Y A;  2A3F X;  1KZW A;  4ZFX A;  2Z4I A;  3HWD A;  4QGW A;  3RBY A;  4QZT A;  1EPB A;  4EEJ A;  3S26 A;  3BS2 A;  1G85 A;  1KGL A;  4QRL A;  5C0N A;  4YFQ A;  3UEW A;  1TOW A;  1BM5 A;  5H9K A;  2ACO A;  2K62 A;  2FLJ A;  1KT3 A;  2G78 A;  4FBV A;  1HMS A;  4WFU A;  5FQ6 E;  1EXS A;  4NYR A;  4ZCB A;  3P6E A;  4Y0Q A;  5IO6 A;  4AZO A;  1VYG A;  1NP1 A;  3VG4 A;  1O1U A;  1TXL A;  4ZHH A;  1O1V A;  3F8A A;  2XKL A;  5LKE A;  2WEX A;  4TKH A;  2AT8 X;  2WQ9 A;  4CSB A;  1CJ5 A;  1DZM A;  2JU7 A;  2RQ0 A;  1QWD A;  2CZT A;  3FR5 A;  5HZ8 A;  1O8V A;  4FQB B;  5IO7 A;  4LZU A;  3Q6L A;  1GT4 A;  2L5P A;  1RLB E;  1MUP A;  3EYC A;  3ZW2 A;  1BSQ A;  1BBP A;  2R74 A;  4INN A;  2RN4 A;  1AEL A;  3BX8 A;  3P02 A;  2BS5 A;  2HLV A;  1A2D A;  2X45 A;  5HCC C;  1E5P A;  1LKE A;  3FEL A;  4I3D A;  2RA6 A;  3B2I A;  5B29 A;  2FRS A;  5D45 A;  4ALB A;  4TKJ A;  2NND A;  1I06 A;  2AKQ A;  2BLG A;  3FYF A;  1OBU A;  1KT5 A;  3UEV A;  3WBG A;  1CRB A;  3GAQ A;  5HCD C;  1PM1 X;  4AZN A;  1ZND A;  1KT6 A;  5EDB A;  4IB9 A;  3D97 A;  1JBH A;  3G7X A;  4Y0R A;  3IA8 A;  4NNT A;  1ZNE A;  2GTL M;  4U8U N;  2G79 A;  1KQX A;  4KCA A;  3B2J A;  3WJC A;  4ZR2 A;  1DZP A;  1ACD A;  4EXZ A;  3ZW0 B;  3ZI8 A;  3KZA A;  1KOI A;  3STM X;  3HOE A;  2OVS A;  3VG3 A;  2RCQ A;  2KTD A;  3WJB A;  1AB0 A;  1GX9 A;  2NP1 A;  3ZUO A;  3NAD A;  2N93 A;  4QQ1 A;  4U9C A;  2A2U A;  4DQ4 A;  4FBO A;  3BX7 A;  1LF7 A;  1MX7 A;  4YGG A;  2X8F A;  1SA8 A;  1IKJ A;  4QNI A;  5EED A;  5B27 A;  1QFV A;  1SY2 A;  3APV A;  3BLG A;  4A60 A;  2WEW A;  1EAL A;  5L8N A;  3VE1 A;  4BVM A;  5HTD A;  1ERX A;  1I4U A;  5HAE A;  4N7C A;  3ZZV A;  1T68 X;  3VE2 A;  4O4X A;  2YMS A;  3KFH A;  3OD9 A;  4COT A;  5KIC A;  5HZQ A;  3LHN A;  5H9N A;  1OEE A;  4MVI A;  1NGL A;  2BT9 A;  3N91 A;  2WR6 A;  4YDB A;  3CQR A;  2FT9 A;  4KII A;  1AQB A;  3TZS A;  1DZK A;  1EIO A;  3FA7 A;  4D6A A;  4LKT A;  4EFG A;  4GNW A;  1EW3 A;  2O62 A;  1X89 A;  5F58 A;  1QY2 A;  2LB6 A;  1LIB A;  1PMP A;  4I6S A;  3APX A;  4LQZ A;  4KC7 A;  5BYP A;  2EU7 X;  3U9P C;  3EBK A;  1EI5 A;  2FWV A;  4QZU A;  3VPJ E;  4M6S A;  4GZV A;  3O22 A;  3WJF A;  4GH7 A;  4QYP A;  1B0O A;  3ZWE A;  2L67 A;  3JQO A;  4KH8 A;  3QKG A;  3FEK A;  4YFR A;  4YGH A;  3FR4 A;  2MJI A;  5F1E A;  3ZQ3 A;  1B56 A;  4CK4 A;  3VG2 A;  4ZGF A;  4ZHG A;  3FIQ A;  4ORU A;  1EQD A;  2OFM X;  4ORS A;  3E3C A;  4YFP A;  5HBS A;  3UEU A;  1DC9 A;  1OPB A;  1E06 A;  4HPD A;  2Q2P A;  2CBR A;  4I95 A;  3T1D A;  5EEE A;  4O3W A;  1JYJ A;  1CBQ A;  1KQW A;  4U8U O;  4YH0 A;  2HZQ A;  2X8S A;  4FGI B;  3MBT A;  2KT4 B;  4MVE A;  5HA1 A;  3LV4 A;  2WQA E;  1H91 A;  3ELZ A;  3NQ9 A;  3EM0 A;  3JSQ A;  5DG4 A;  3S5V A;  3ZW1 B;  4IBA A;  4UU3 A;  3FA8 A;  2A13 A;  1PBO A;  1D3S A;  2HMB A;  1SXW A;  1ZNK A;  4A1Y A;  4QGX A;  2Q2M A;  1YIV A;  2MM3 A;  1T8V A;  1U17 A;  2FS7 A;  4AZQ A;  2WSJ A;  3GE2 A;  1QFT A;  4MVK A;  2AH7 X;  5D8J A;  1GKA B;  2LFO A;  5H9L A;  4XMH A;  2MO5 A;  1GM6 A;  2E4J A;  5KID A;  2QMI A;  5LKF A;  1OPA A;  5L8I A;  2AT0 X;  5D48 A;  1Y9T A;  3C78 X;  3NR3 A;  3FMZ A;  2QM9 A;  3HWF A;  1LIE A;  3FW5 A;  3NX2 A;  1EII A;  3OE3 A;  2OFR X;  1TVQ A;  4NYQ A;  4OMW A;  5L8O A;  3WJE A;  2A0A A;  1XKI A;  4LKP A;  4TNN A;  1YWA A;  2QO6 A;  1OEK A;  1KZX A;  1KT4 A;  2R73 A;  3V8U A;  1R0U A;  1GT5 A;  1ICN A;  2CBS A;  3RKG A;  5HZ6 A;  2WWP A;  1RBP A;  3DTQ A;  2FR3 A;  2Q39 A;  1AVG I;  5LJB A;  4I3B A;  5D47 A;  3ZUI A;  5H9A A;  4PJ2 A;  3APW A;  3H3I A;  5EPQ A;  1DV9 A;  1QY0 A;  1A18 A;  3APU A;  4HPC A;  5FEN A;  1S2P A;  3PED A;  3STK A;  1SY1 A;  2NNQ A;  3PEC A;  2AT3 X;  4ZGU A;  1ALB A;  3TGA A;  2W2F A;  5KHP A;  4ORW A;  1HBP A;  4PSQ A;  4OMX A;  2CM4 A;  3NBX X;  4HFO A;  1TOU A;  4ZHF A;  1G5W A;  3WJD A;  4KC8 A;  5FAZ A;  2P8G A;  4ORY A;  4D6B A;  3WXQ A;  4YBU A;  5IO5 A;  1HMT A;  4HPA A;  5F6B A;  2MHD A;  1YWD A;  1S7D A;  3BRN A;  3SOT A;  4QAE A;  2PY1 A;  2ANS A;  3CBS A;  4ARH A;  2OVE A;  1B8E A;  3D96 A;  2CZU A;  1JIW I;  2KW1 A;  1IKE A;  1NP4 A;  3B2H A;  4GE1 A;  5HCE C;  4BOE A;  4EQA C;  1U18 A;  4WHI A;  1Z24 A;  1SXU A;  4AZR A;  1HBQ A;  2GJ5 A;  2ALL X;  4IAW A;  3PQU A;  1X8P A;  2BS6 A;  2Q9S A;  4I9R A;  5FQ8 E;  2ZAG A;  2NNE A;  3U03 A;  1ERB A;  1I04 A;  1ML7 A;  2QO4 A;  5HWZ A;  3EMM A;  4AZP A;  2CM9 A;  2DM5 A;  2L9C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...