4Y0WA

Yeaz from pseudomonas aeruginosa
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
215
structure length
215
Chain Sequence
MSTLLALDTSTEACSVALLHEGRALSHYEVIPRLHAQRLLPMVRDLLDEAGVALSAVDAIAFGRGPGAFTGVRIAIGVVQGLAFALQRPVLAVSDLAILAQRAYREQGAERVAAAIDARMDEVYWGCYQLQQGEMRLAGSEAVLPPERVAVPWDAAAADWFGAGTGWGYVERMPQRPVALDASLLPHAEDLLSLAGFAWARGEGVEAEQALPVYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YeaZ
publication title Crystal structure of YeaZ from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao579
molecule tags Biosynthetic protein
total genus 62
structure length 215
sequence length 215
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2015-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00814 Peptidase_M22 Glycoprotease family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4y0wA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4y0wA02
3P4IA 2NRHA 5BPMA 1XUPO 1NMDA 1SZ2A 3B8AX 4MO5A 5FPDA 3SMSA 1T6CA 1BG3A 3GDQA 5AQXA 5AQZA 3UB5A 4CZFA 3D7EO 3QDKA 4AM7A 3MN6A 1HJOA 1BWFO 4HTLA 5AQIA 4QS7A 1NGJA 5AQYA 4BRGA 3VOVA 4LC9B 1GLEG 1X3NA 3A5LC 3VEZA 2D0OA 2P9PB 3ULEA 2WUSA 2FSKA 2D0PA 4CZMA 5EVZA 3FZMA 2QW9A 4L3QA 3WT0A 2QWMA 1X3MA 4WQ4C 3D2FA 1ATSA 5EX5A 3ZX0A 3M3ZA 3H46O 1SAZA 4JD2A 5AQPA 3S41A 4QS9A 2E2PA 4FWQA 5LJVA 4DB3A 4FPAA 3SMPA 1LCUA 5BRHA 2GEMA 4BGAA 3WQTA 2V51B 4H0TB 3U9DA 4CBWA 5AQWA 3G25A 4BRDA 3QFPA 3H1QA 2CGJA 4XEIA 1R59O 3A8YA 4BROA 1NGFA 2E1YA 3LDLA 5AFUH 2QWPA 1V4SA 2A3ZA 4BR4A 2ZGZA 1J6ZA 5AZIA 4RWTA 2P9LB 3MK6A 1Z05A 1GLDG 2DPNA 3ZETA 1DEJA 3VF4A 4FL9A 4EIAA 1MWKA 5FPMA 1RGIA 2GTDA 4BRIA 4CZEA 3VETA 2GELA 4JHDB 3DXKA 3R9PA 2EWSA 3FE1A 2Q1NA 3IDHA 3HZ6A 4IJNA 1S22A 1ESVA 3WQUA 3F9MA 3MN9A 3IFRA 3MN7A 4BRAA 1NGEA 5FPEA 4Y0WA 4DCHA 4O8KA 4YDUA 5AFUA 4EAHD 5F1XA 1NGAA 1NGCA 5E84A 2AP1A 1GLAG 4IZ9A 2P9SB 4WQ5A 2V52B 4H0VB 3WXLA 2V7YA 5AQGA 3BF3A 3H6EA 5JLHA 2YCHA 3CETA 1HKBA 3AAPA 1WUAA 5JLFA 1GLCG 4A2BA 4PKHA 1NWKA 2E20A 3CJ1A 3KZBA 3EO3A 3DXMB 1BU6O 4MLEA 4YDUC 4H0XB 3LM9A 5AQLA 3FFKB 4CBXA 1U2VA 4JHDA 3FLCO 1YAGA 4ISEA 4H0OA 3VERA 5KQDA 5CE3A 4WQ5C 3DWLA 4I6MA 4WYBA 3C7NA 4H0YB 4FWLA 3GOIA 2QM1A 5AQTA 1QHAA 1NM1A 1G99A 4BG8A 4B1YB 1E4GT 4FWNA 1EQYA 4A62A 4BRMA 1OKJA 2P9UB 4BRCA 5BN9A 3EKUA 2ZGYA 4DHYA 4BR9A 3QB0A 3BUZB 5BPLA 2P9SA 3UE5A 5BPNA 2A5XA 4FOEA 2PAVA 4O5FA 2ITMA 2KHOA 3TPQA 4IJAA 1GLJO 3EKSA 3WXJA 3U8XA 2P9IB 2BTFA 2E1ZA 3U4LA 5LY3A 2E2QA 1CZAN 3O6WA 4CZLA 1QZ6A 4CZJA 1YXQA 2A41A 5AQHA 3QFUA 3DXMA 4J8FA 1KAZA 1BA0A 4BGBA 4K42A 3H45C 1SQKA 3CJBA 3J8AA 4BRNA 2YJFA 4BC2A 1ZXOA 3GE1A 2P9KB 1TYQB 3VGKA 2Q36A 3DAWA 3L0QA 2FLOA 2QWQA 5BRFA 1P8ZA 2PBDA 2Q31A 5KPRA 4XH5A 1MDUB 4ISFA 3ID8A 2OANA 4FWKA 3UKUB 4IO8A 2P9UA 4FWSA 1NGBA 2I7PA 3KVGA 3O80A 4EHTA 5EY4A 4B9QA 2YJEA 5AQUA 2Q0RA 3UKRB 4JN4A 5AQJA 4BR5A 2F9WA 5AZJB 5AQRA 1RFQA 2P9IA 3BP8A 5EXWA 4PL8A 4FO0A 2YI1A 3ENHA 2D1KA 2VYPA 2I7NA 3O8MA 2IVPA 5ADXH 3QBXA 2CH5A 4KBOA 2ZWHA 3FZLA 3L6QA 5JICA 3QICA 4BG9A 2P9PA 4H0PA 3GL1A 1NGGA 3AARA 3CJAA 3EZWA 2P9KA 3A5OC 2HMPA 3I8BA 2A6AA 4B1XB 2QWRA 3MCPA 1HUXA 2VWBA 3U9ZA 3VF6A 2IVOA 3EL2A 4M7YA 3RSEB 4H5WA 3MMVA 4NB4A 3MDQA 3M6GA 4PL7A 3O4WA 5FPNA 3VEVA 3ZEUB 4EHUA 3UKUA 4JAXA 2IVNA 4A61A 1BOTO 1TUUA 3O5BA 2QWLA 2A40A 3W3DA 5ADXA 4IXCA 4BRHA 3CJ7A 3FR0A 3C0BA 3CIPA 3QMLA 3UKRA 4BRPA 1GLBG 4FWOA 4M63C 4BR7A 4BQZA 4RCHA 1QQNA 4M7XA 3A5NC 1V4TA 3CQYA 1NGHA 2P9LA 3AY9A 4CD3A 4FSVA 3WEEB 2E2NA 1K8KB 4AM6A 1NBWA 1Y64A 2Q0UA 2P9NB 3QBWA 1GLFO 2NZTA 3GG4A 4BRQA 3LDPA 3WUHA 2D4WA 3H3OB 4A2AA 4K43A 4B1ZA 3DJCA 5AQQA 3HSCA 2YHXA 3RSEA 3VEOA 4ISGA 3WXKA 1XQSC 4BRFA 2ASOA 3LL3A 2FF6A 3TU5A 3KHYA 4Z94A 4FWPA 1LOTB 4MLHA 2AA4A 3ZX2A 5KPZA 1BO5O 4HWIA 1TUYA 3R6MA 5BRDA 1WOQA 1NGIA 3VGMA 4BVPA 5E26A 3VENA 4K41A 1X9JA 3HBTA 2Q2RA 3IUCA 3CJCA 2FSJA 1KAXA 3BF1A 4QS8A 2W41A 1RDWX 4F9OA 2E88A 2QWNA 3WEEA 1K8KA 4CZGA 1E4FT 4PKGA 5BREA 1DKGD 2P9NA 3H1VX 4DQ8A 3FZFA 4NO7A 3R8EA 3AAQA 1MA9B 4C23A 2YHWA 1HPMA 4E1JA 2FSNA 4H03B 4CZKA 5AZIB 1H1VA 5AQSA 3ATUA 4BRKA 5TKYA 2H3GX 3EN9A 3VESA 3CHWA 3ZETB 1JCEA 4B1VA 5KPTA 2E2OA 4MO4A 2YHYA 1BDGA 2HF3A 2FF3B 2J4RA 5ELZA 3L4IA 3DXKB 2GWKA 2Q97A 5F2RA 3VPZA 4BC5A 1NGDA 5AQMA 2QWOA 3SJHA 1IJJA 1KXPA 1QQMA 3CERA 1ATRA 1IG8A 2ASPA 1HKCA 1BUPA 1QQOA 4H5TA 1Q18A 2GUPA 4BC3A 5AQNA 1QZ5A 1YUWA 2E8AA 5AQOA 3LM2A 3HM8A 4BRLA 4BR0A 3CJ9A 4B1WB 4XH1A 4CI6A 2VCPA 2ZF5O 3MN5A 4PKIA 1TYQA 1BA1A 2F9TA 4H5NA 4GNIA 3HI0A 3VEYA 1T6DA 2CGLA 4K25A 4BREA 1MWMA 2FXUA 4FPBA 5I9EB 3O1BA 2IIRA 1ZBSA 2CH6A 2V7ZA 3A5MC 4BC4A 5F0XA 4IWVA 1U2VB 5AR0A 3D2EB 3H3NO 4XH4A 4GY2B 3VGLA 4I6MB 3C7NB 1XC3A 1Z6RA 4CJ7A 4FWMA 3HTVA 4FOIA 5AZJA 3VEXA 2GWJA 3O1WA 2NLXA 2HOEA 1ATNA 4H5RA 5KQ8A 1S3XA 2ASMA 3SK3A 5B8HA 3W0LA 3ENOA 3JS6A 3CI5A 4EFHA 2BUPA 1KAYA 3WXIA 3I33A 1C0GA 3VF2A 3ZX3A 1ZC6A 1JCFA 5AQVA 1HX1A 2HF4A 1U6ZA 4BR2A 1DGKN 2CGKA 5AQFA 2W40A 3O08A 1JCGA 5EOYA 3VEWA 1D4XA 3FGUA 4BQLA 3ZEUA 1T44A 1YVNA 3OHRA 1C0FA 3ULEB 3ATVA 4H5VA 2A42A 5LJWA 5AQKA 3D2EA 3M1FA 3FZKA 4CBUA 3FZHA 3LDNA 4B1UB 1NLVA 3D2FB 5JMVA 4RTFD 2UYTA 4BVOA 4CD1A 3GBTA 3LDOA 1GLLO 5BN8A 4FWRA 2QXLA 4JD2B 4CZHA 1HKGA 4CZIA 3CQXA 1HLUA 3LDQA 3A0IX 3IMXA 3SLCA 3BEXA 4JNEA 3JXUA 4WQ4A 5BR9A
chains in the Genus database with same CATH superfamily
2RPIA 1SV5A 2E4LA 3NGIA 3E66A 4I7FA 3KLEA 4KHNA 5FRMA 4M3UA 3B8AX 3MWTA 4CZFA 3D7EO 3QDKA 4AM7A 4BE2A 2WFBA 4QS7A 4JI7K 5AQYA 1TAUA 1QSLA 3ZSWA 3THVA 2P1JA 2WUSA 1J9AA 5EVZA 3NMUA 3WT0A 2QWMA 1X3MA 4AHSA 2GBZA 2JWLA 3U3YA 4JRPA 1ATSA 4B8AB 3S41A 5HL7L 4ID5A 2E2PA 3S3MA 4IFVA 4V19S 3BGRA 4GVEA 4IFYA 4ELUA 2WC9A 1LCUA 2HBLA 4R79A 4BGAA 4H0TB 3U9DA 2FBYA 3MAQA 3H1QA 5T7BA 5JS1A 3CF5L 3V81A 4W5TA 1SKSA 1J6ZA 2QKKA 3AVMA 5AZIA 4OLAA 1EO1A 1D5AA 3R3LA 4J2BA 3VF4A 3DRSA 1RGIA 4E7LA 1KD1O 3VETA 4EP4A 3DXKA 3N4QA 4CVNE 1QQCA 3CYMA 3M8PA 2YNFA 3V1OA 3IFRA 3MXMA 4DUYK 3VQAA 4JKEA 1NGEA 4DCHA 3OA9A 4KRFA 1U47A 4CK3A 4FJIA 4EAHD 4OGCA 4Z4IA 2KFZA 3QEPA 4KHUA 4WCEL 4DTRA 1Q82O 4IZ9A 1KQSM 4DR6K 3KK7A 4LFBK 1KC8O 1ILYA 3BF3A 1T05A 4FW1A 3CETA 3AAPA 1IKWA 3CJ1A 1WB9A 1C0UA 4GV6A 2F8TA 1KVCA 4H0XB 4CJUA 4CBXA 1U2VA 4DR5K 1T3VA 5M1KA 4KH6A 1HJRA 4ISEA 1TKTA 2O8DA 1NKEA 3AVBA 2IDOA 4PY5A 3C7NA 1VSLA 1NMNA 1NM1A 1VSEA 4BDPA 2A1SA 1NK8A 1GOBA 1O1WA 1J54A 1VSJA 4CK1A 3NF7A 1ZBUA 2X6SA 1FXXA 3P1GA 1U45A 4X62K 1WBBA 3BUZB 3M5RA 5BPNA 4FOEA 4UQGA 3S3OA 2KHOA 1HNVA 3AO5A 2P9IB 1FKPA 4CECA 2E1ZA 3U4LA 2VWJA 1CZAN 2UUBK 1QZ6A 2OZSA 4A59A 3QIPA 2A41A 5AQHA 1RTIA 1WAFA 1VQNN 1N36K 4ILJA 3H45C 4FM2A 2YJFA 1KCFA 1C0TA 2P9KB 5CYQA 3L0QA 2QWQA 4E7KA 4FJJA 1S6PA 1BISA 5D3GA 2PBDA 2NRZA 3EYZA 4CJPA 4KHWA 3K0SA 1U04A 3UKUB 2IOCA 2XY5A 3L2RA 2XY7A 4EHTA 2F96A 1XNQK 1NOZA 1EETA 4CEOA 1O13A 2Q0RA 3ZSYA 3TTFA 4BR5A 1CXQA 1S9GA 3EE8A 3ISNC 5EXWA 2O4GA 4FO0A 4DKWA 4CIFA 4F4KA 3F5TA 2Y1JA 4F8RA 3VQDA 4BWMA 4CIEA 1EX4A 2O8CB 5JICA 1JXBA 2P9PA 4FJHA 1NGGA 3EZWA 3ZLJA 3ZT0A 2QWRA 4FJXA 3TAQA 3Q7CA 1IKVA 3VF6A 3VQQA 4AHVA 1HYVA 3NCIA 3M6GA 4IDHA 5E41A 4FLVA 5J2MA 1ZBLA 4JAXA 3HPHA 4A61A 2QXFA 3SV3A 1TUUA 3O5BA 5J2PA 3HXMA 4BRHA 1C0MA 3AVIA 3C0BA 4BRPA 5CY4A 1GLBG 4BE1A 3ZSQA 4FJMA 3SUNA 4BR7A 4E0DA 1QQNA 4M7XA 3A5NC 1NK9A 4JV5K 4HUEA 1UA0A 2P9LA 4CD3A 3DRRA 1IO2A 2IC3A 3E01A 3PO4A 1K8KB 1NG9A 5IT9O 3OYMA 2FBXA 1YHQN 1NU0A 1JLCA 3G0ZA 4CJ3A 4KTQA 1GLFO 3CCVN 1SKRA 2NZTA 3H08A 4RG8A 3LDPA 4N5SA 3H3OB 4DTOA 3U3GA 2A1RA 3DJCA 3OBWA 2YHXA 4JI8K 2GV9A 5I3UA 4A5AA 3RSEA 4LFAK 4ISGA 1L3SA 4BRFA 3ZT2A 2KZZA 5IWAK 5FROA 4CHNA 5J1EA 2UXCK 1EWRA 2O8FA 3TSPA 3OYEA 4JKGA 4DSKA 3KLHA 4K41A 4Y1DA 4H8KA 3OYGA 3HBTA 2Q2RA 2KTQA 2FSJA 4CK2A 4CF8A 4FLUA 3BF1A 4GW6A 3LWLA 4DTXA 2HHTA 4JYAK 5C2FA 1FK9A 1HR0K 4PKGA 3KD5E 1DKGD 4DQ8A 3CC4N 3R8EA 3G4SN 4Q0BA 1ZBFA 3SI6A 4YHHK 1MA9B 1HPMA 3TSQA 3AGRA 1VAZA 3KIOA 3TWHA 4BY9C 3K5OA 1VQON 5TKYA 3CHWA 4B1VA 5KPTA 4FW2A 5KTQA 4CGFA 5DK5A 1BDGA 4OVLA 1M90O 3G6EN 5ELZA 5FLXO 3ZT4A 1IH7A 4BWJA 5F2RA 2VQEK 5GAHP 3CERA 4KPYA 2QA4N 1IG8A 2ASPA 1QQOA 3TAMA 2O8BB 4WFNL 4BC3A 3OYLA 1ASVA 1VQ7N 4LSLA 2WONA 1WN7A 4B3OA 4BRLA 4FM1A 1QS4A 4CI6A 4XH1A 3THYA 2F7TA 3J80O 4J2EA 1EXQA 2F9TA 4H5NA 1VQ5N 4K0KK 3SBGA 5GINA 1NJIO 2IIRA 3SQ1A 2DY4A 1LW2A 2V7ZA 4BC4A 2BE2A 2RF2A 3P38A 5AR0A 3H3NO 4XH4A 1OVYA 3QO9A 1YTAA 2VWKA 2HOEA 2NRXA 1S3XA 3SQ2A 1C1CA 4CGGA 3K5LA 3O3HA 1S1XA 3NGYA 3LPUA 4DQRA 3OYKA 4EFHA 4B9NA 4NXMK 5KRSA 3NH1A 3MCAB 3UIQA 2JWKA 1K9MO 2PFUA 3I33A 4E89A 3ID6A 3SNNA 2NRTA 3ZSXA 1I3AA 3HPGA 1HX1A 3C6AA 2HBJA 2HBKA 1F21A 1HMVA 3DLGA 3SQ4A 1XMQK 2YKNA 3PIPL 1Z26A 3AVFA 3MXJA 3FGUA 1T44A 3OS1A 3B6OA 3ATVA 2A42A 1WAJA 4OPHA 5AQKA 3FZKA 3FZHA 3LDNA 4C1NI 3NF9A 4CEFA 3OYAA 4RTFD 1W7AA 4BVOA 3GBTA 3LDOA 1JXEA 4JKCA 1U4BA 4JD2B 3THWA 5KGXA 3CCJN 5EU7A 4W5NA 4KI6A 4CZHA 4CZIA 3QNOA 3CQXA 1HLUA 4FZXC 1NK5A 3IMXA 3SLCA 3HSTB 3BEXA 4WQ4A 1XI1A 2NRHA 3RR8A 3NAEA 1NJYA 1GOAA 3SMSA 4M41A 4W5QA 3UB5A 3MN6A 4C1NK 1BWFO 4HTLA 2RN2A 5JVGL 1JL1A 3HOTA 4BRGA 4E1MA 3VOVA 4A5BA 2QK9A 3ULEA 2FSKA 1J5EK 3J7YP 4CZMA 3QESA 3ZX0A 3M3ZA 1K8AO 1XNRK 4M42A 3CCQN 4DFMA 1SAZA 2VGNA 2YX6A 4QS9A 1X9SA 4IOXA 4LFCK 2OPRA 1YTUA 3CG7A 2HHXA 2KLAA 5C2DA 1XWLA 3SMPA 5BRHA 4IG3A 2GEMA 2YNGA 3WQTA 2V51B 4CBWA 4IO9L 4BRDA 5HRPA 3THXB 3O4QA 1WSGA 4ICLA 1WSIA 2AJQA 1RT2A 2E1YA 5AFUH 4NLCA 2IGIA 1V4SA 4CHYA 4DS4A 4BR4A 2ZGZA 4FZYA 2B6AA 4RWTA 1T8EA 1TV6A 1NKCA 1DEJA 4GMJB 4FL9A 2OTLN 4E7HA 4CZEA 2HVIA 4LD0A 1RBRA 2GELA 4DMNA 4JHDB 1QSSA 3R9PA 3I56N 1YT3A 1W97L 3F9MA 2UXDK 4AHCA 4BRAA 3DMJA 4ID1A 4Y0WA 4Z0UA 4GVMA 1ITGA 1NGCA 3VQ9A 2AP1A 1GLAG 4HHTA 4RW4A 2P9SB 1M1KO 4Z4HA 2V52B 2X74A 5HOOA 3AO1A 4AQYK 3QEWA 1WUAA 4PKHA 1SL0A 1NWKA 4JI6K 3TABA 4E7IA 1BU6O 4YDUC 3I55N 3TAPA 3KK3A 1WSFA 3FFKB 4DQQA 1HRHA 2G8WA 3FLCO 1BQMA 3S9HA 3CFOA 3VERA 4CESA 4WQ5C 3KK2A 4H0YB 3GOIA 2QM1A 5AQTA 1QHAA 2NRRA 3C95A 3AO3A 4DV7K 4DSFA 3CPWM 1EQYA 4A62A 4E7JA 4BRMA 4ZTJA 2P9UB 4LH5A 4CJFA 2KFNA 5BN9A 3EKUA 2IAJA 3HK2A 2ZGYA 4BR9A 4CEQA 4JKAA 4C8KA 3QB0A 3AA2A 3B6PA 4O5FA 2ITMA 1RDDA 3HVRA 1GLJO 4MDAA 3BDPA 3WXJA 1S9EA 4HUGA 2KQ2A 2ZD1A 3O6WA 4CZLA 4OLBA 4DTJA 3LALA 4MQ3A 4G1QA 4FLZA 3QFUA 3VN5A 4J8FA 4WFBL 3V9WA 3IG1A 1BA0A 4K42A 3MWPA 3CJBA 2F8SA 2IS3A 3J8AA 3F2KA 3HVTA 4H4OA 1TYQB 2VGMA 3L3UA 3VGKA 2Q36A 2FLOA 5CYMA 5BRFA 1GOCA 2HHSA 3C94A 3SPYA 1EWQA 3CPEA 3L8BA 3ID8A 2OANA 4FWKA 2Z1JA 2HHVA 4FWSA 4AHRA 3A2FA 4QOZB 5KGWA 1Y97A 3KLIA 1A5VA 1RT5A 3AO2A 4M3XA 1N32K 3HRGA 5AZJB 5AQRA 1RFQA 2P9IA 4JKHA 4QCLA 2YI1A 3HT3A 3HPOA 2D1KA 2VYPA 3O8MA 2IVPA 1SKWA 3SJJA 3OJUA 3NDKA 1KTQA 1BI4B 2DFFA 4CHOA 4HCCA 3FZLA 1NK0A 3QICA 4BG9A 2P9KA 2XY8A 3I8BA 2A6AA 3MCPA 1FJGK 4YOVA 2VWBA 2YKMA 1QVGM 4CW7B 4FJ5A 2IVOA 3PX6A 1XHZA 4NB4A 5LMNK 3MDQA 3VEVA 3ZEUB 4EHUA 1Q9YA 1VSHA 3UKUA 2IVNA 4B8CA 2LSNA 4DR2K 2A40A 4DFPA 5ADXA 4IXCA 3NF6A 3Q7BA 3CIPA 4B3RK 4LF9K 3SAFA 4IBNA 4BQZA 1Z25A 1NGHA 2B5JA 1D9DA 2O8EB 3O4NA 3AVGA 3WEEB 4PHTX 1NBWA 1RBVA 1RBSA 1E3MA 2O8CA 3QBWA 1HNIA 4A2AA 3TARA 1IKXA 4CGDA 3EE9A 4DU1A 5AQQA 3V1RA 3MX5A 1L3UA 4KHPK 3K58A 5CHIA 3MXIA 4ILGB 3TU5A 3KHYA 3SAGA 3P5JA 3ZX2A 5KPZA 1RBUA 1BO5O 1NGIA 4BVPA 4YOYA 3VQ6A 2X78A 3JYTA 3CJCA 1KAXA 2E88A 4CJRA 4FLXA 1K8KA 4CZGA 1E4FT 5BREA 3OYCA 4RW6A 3LANA 3ZCMA 3F73A 4E1JA 4O55A 1BCMA 4H03B 4N56A 4JI0K 4KTZA 2PYLA 3ZT3A 4CZKA 5AZIB 3IS9A 1TK5A 1K6YA 5AQSA 1VQLN 3ATUA 4DTMA 1RT1A 1HNXK 3EN9A 1S72N 2VG6A 3SPZA 4DU4A 5J2QA 4MO4A 3J7ZO 1UA1A 3RVCA 2YHYA 5JS2A 3L4IA 3DXKB 3ZT1A 4PQUA 3G10A 2Q97A 4IEIA 3L2VA 2NRWA 2VG7A 4YY3K 3ALYA 3DYAA 3OYDA 5AQMA 3SJHA 2PZSA 4KHQA 3L2UA 1WSJA 1HKCA 4H5TA 1Q18A 1CLQA 4K8XA 1YUWA 4CJLA 5AQOA 3RRGA 5M1OA 3OYFA 4FVMA 1VQ6N 4BR0A 3VQBA 1B9FA 2VCPA 1N8RO 4DF4A 3RMCA 4B9MA 1ZYQA 1MWMA 3AVAA 4FPBA 3L4QA 3OYIA 1ZBSA 3EZ5A 3SUPA 2HW3A 2Y1IA 5F0XA 2HNYA 1U2VB 3AO4A 4DS5A 4DFJA 5K14A 2DTUA 3C7NB 5GIPA 1Z6RA 2E5LK 3HTVA 3OBYA 3OY9A 3O1WA 4DSIA 3BY5A 2QI2A 1W9HA 4H5RA 1ATNA 5KQ8A 4JI3K 4FJKA 4KREA 2WBNA 2O8BA 4CCHA 3ENOA 3JS6A 3QINA 4L8RB 4N47A 4WFAL 2HNDA 1C0GA 4KO0A 3F9KA 4NYNA 4PUOA 4DU3A 1U6ZA 4NCBA 3LWMA 2CGKA 4E19A 3IKMA 3PSIA 2W40A 5AQFA 4DFKA 2DFEA 3J81O 1HNWK 4BQLA 3PIOL 4JLHA 1YVNA 3KWGA 1A5WA 3AGKA 1JLEA 5C42A 4LY7A 4Z4FA 1VSDA 1QTMA 1NLVA 3D2FB 3VQEA 2UYTA 2X6NA 4CD1A 2D0AA 3T1YK 4FWRA 4DWIA 3C6UA 4DV6K 5HRRA 1IBKK 3LDQA 4DF8A 4JKDA 1SUQA 2ITGA 1VHXA 3JXUA 5BR9A 4JI4K 3P4IA 4DQPA 4DTUA 4JI1K 1XUPO 1ASUA 1NMDA 1VQ4N 2ETJA 1VQ9N 1HJOA 4DG1A 1VQ8N 4B9TA 1A5XA 4KAZA 1S6QA 2BH1A 4LC9B 4JS4A 4ZTFA 2P9PB 3M8SA 3MEEA 2D0PA 3HJFA 3CCRN 1NJXA 1EKEA 1N6QA 5M1QA 2WOMA 1WSHA 4GKJK 4JD2A 5AQPA 3NH0A 4FJLA 4AHUA 3E9PA 4FWQA 2KW4A 5GIOA 3ULDA 4CERA 3VTHA 4FPAA 4DB3A 4C8OA 4CJVA 1J53A 3G25A 1WBDA 2G8KA 3CXCM 3CCSN 4BACA 2CGJA 4FJNA 4XEIA 3QIOA 4LF4K 1FW6A 1HYSA 1NGFA 3LDLA 2QWPA 4BDZA 2GX9A 2P9LB 1KVBA 1Z05A 2FC0A 3ZYYX 2DPNA 3ZETA 1DT9A 4EIAA 1MWKA 3ASMA 2GTDA 2YV0X 4LF6K 2QEXN 3ENBA 1RNHA 3VQPA 3FE1A 2F4VK 2NNWA 3IDHA 1YVUA 3HZ6A 1VK0A 1S22A 5JVHL 1X9WA 3PSFA 3WQUA 3MN9A 3MN7A 5FPEA 4H4MA 3QETA 1IBMK 1VRTA 3QLHA 5F1XA 3CC2N 2W6LA 1P90A 4HTUA 3O9UA 1NJWA 3R1XA 4K8ZA 4H0VB 4ELVA 2V7YA 5AQGA 3THXA 2FBTA 3TI0A 5JLHA 2YCHA 3DI6A 1GLCG 3N4PA 3V9UA 4CJEA 3EO3A 3I8DA 1VSKA 3DXMB 3JSMA 4AF1A 3FFIA 4MLEA 1JKHA 1YIJN 2YHBA 3KWIA 3C65A 3L2QA 4FJ8A 4B08A 4DTPA 1BQNA 4JHDA 1YAGA 3IAYA 5KQDA 1OH5A 5CE3A 4DR3K 4I6MA 4WYBA 4F2RA 1TL3A 3EEQA 1Q86O 4GKKK 1G99A 4BG8A 3VMFB 1B92A 4FWNA 4X65K 2HHHK 3DOKA 1IG9A 1U48A 1RT6A 1OKJA 2KKZA 4BRCA 1YJWN 3WNEA 3HOSA 2P9SA 2PAVA 3TPQA 4YOWA 4IJAA 3OJSA 3MECA 2UXBK 3U8XA 2E2QA 4IG0A 1KVAA 2OZMA 4CZJA 4OPJA 4CHZA 3KD1E 1JLAA 1KAZA 3LP1A 3ZSVA 4E1NA 1BHLA 1SQKA 3NF8A 1WNSA 4CJWA 1ZXOA 3THYB 3GE1A 4CEZA 4B9LA 2NUBA 3O9RA 1I94K 1P8ZA 4CHPA 2G8IA 3SYZA 4XH5A 4CIGA 3RR7A 3HM9A 4B9SA 4O4GA 3HL8A 4DUZK 2P9UA 4FLTA 3V1QA 1NGBA 4PWDA 1RT4A 3KVGA 3O80A 4ILHA 2YJEA 4Z4EA 3UKRB 4JN4A 4G9ZA 3WNGA 4DV0K 4C8MA 3LAKA 4CEBA 1DTQA 4CEEA 3BP8A 4F3OA 1NK6A 3ENHA 2I7NA 4N41A 2QKBA 2CH5A 2ZWHA 3WNHA 4H0PA 3GL1A 1QHTA 3CJAA 4KKOA 2HNZA 3A5OC 4B1XB 5GAGP 1ZBIA 1HUXA 3U9ZA 4M7YA 5M1FA 3MMVA 4AH9A 2QTDA 3NVKA 1SL2A 3PV8A 1TKXA 3K59A 3CFPA 1BOTO 4X66K 1HPZA 3AA3A 4JI2K 3W3DA 4DQSA 3CJ7A 3ZSZA 3FR0A 1L5UA 3PY8A 3C6HA 1RDUA 2OA8A 4M63C 1V4TA 3S3NA 3CQYA 4Y1CA 2GUIA 3TR8A 1R0AA 5HRSA 2E2NA 4AM6A 1Y64A 3OS2A 1BI4A 2Q0UA 2P9NB 4CF1A 3AA5X 4BRQA 3WUHA 2D4WA 4CJSA 3EY1A 3KLGA 3QNNA 4WE1A 1SS6A 3DLBA 3VA0A 4FLYA 3HSCA 2I5JA 4NCAA 2ATQA 5MLCQ 4O0IA 5HP1A 1C6VA 2P5OA 3VEOA 3WXKA 3RMAA 4DSLA 2ASOA 3PX4A 2FF6A 3SZ2A 4Z94A 4WF9L 3KKSA 1WSEA 4MLHA 3DLHA 3L3VA 1TUYA 3R6MA 5BRDA 1WOQA 1IBLK 3LP3A 5E26A 3VENA 4FJGA 1UWBA 3CM6A 3T3FA 3J7AP 5DMRA 4X64K 4QS8A 4B9VA 2W41A 4FK2A 2O8EA 3DRPA 1NOYA 2QWNA 3WEEA 1TK0A 1BIUA 2OTJN 3WXMB 3T1HK 3FZFA 4NO7A 1LWEA 4OX9K 3HO1A 3AVNA 2FSNA 4DR1K 1OVQA 4CFCA 2EX3A 4DSEA 1JLFA 1S1UA 1UAXA 4BRKA 2H3GX 3O3FA 3KK1A 2E2OA 1JJ2M 1RTJA 4E3SA 2FF3B 2J4RA 3CC7N 4OPAA 4JK7A 4CGHA 3TAFA 1EP4A 3VQ7A 3AA4A 2ZJQL 3HP9A 3I0RA 3VPZA 5LMUK 4FJ9A 4FLWA 2HB5A 4RW9A 3ZSRA 1KXPA 1QQMA 5AJ3K 1ATRA 4I9LA 2GUPA 2HMIA 1QZ5A 2DFHA 3CMEN 4J2AA 2E8AA 2NRVA 4F2SA 3LM2A 1T7PA 2XHBA 4NLBA 5CZ1A 4B1WB 4CJQA 3K2PA 1YI2N 4PKIA 1RDAA 3RTVA 1BIZA 2ZQBA 1T6DA 5DM7L 4BREA 4K25A 1RBTA 5HROA 4HVJA 1TKDA 3O1BA 2W42A 3QEIA 2BGGA 4AHTA 1KSPA 1YJNN 3D2EB 3E9OA 1NJZA 5GAEP 4NXNK 4CFBA 4YOXA 2FBVA 3O9QA 1XC3A 1S1TA 1VRUA 4QAGA 2GWJA 2NLXA 3SK3A 5KI6A 5B8HA 3W0LA 4AILC 2Z1GA 4EP5A 4DV3K 1KAYA 1KLNA 5H1SQ 3WXIA 5C25A 1WLJA 3VF2A 2D0CA 1JCFA 3KLFA 4JEPA 3K5NA 1Q9XA 1ZBHA 5HBMA 4DQIA 4UY8O 5EOYA 3VEWA 1HQUA 3KKRA 3LZIA 3AV9A 1XHXA 4RW8A 3OHRA 1C0FA 4H5VA 4JI5K 3KTQA 1KFSA 4CGJA 3DM2A 3CCMN 4KHSA 4DV1K 1GLLO 4C8NA 4A57A 3K5MA 3BZCA 3OS0A 1LAVA 2R7YA 2RHKA 1SL1A 3KJVA 3TANA 1HKGA 3CFRA 3PUFA 1XC9A 2E6LA 3DLEA 4JRQA 4JNEA 4DTNA 5CR4A 4FZZA 5BPMA 1SZ2A 4MO5A 5FPDA 4FVUA 1RDCA 1T6CA 1BG3A 3GDQA 5AQXA 5AQZA 3SQ0A 3OYNA 1NK7A 4XIUA 1I39A 5AQIA 2Z1IA 5FRNA 1NGJA 5A2QO 4OO1J 1GLEG 1X3NA 4B3MK 1RT3A 3A5LC 4DSJA 3VEZA 2D0OA 4DLGA 4NYFA 1QE1A 2QW9A 3FZMA 4L3QA 5KRTA 5DM6L 4WQ4C 2W6KA 3G71N 3AVHA 3D2FA 5EX5A 5SZTA 3QERA 4RW7A 3H46O 3SAHA 1VSFA 4FJ7A 5LJVA 3TAGA 1HYZA 4YORA 4J2DA 5BR8K 5AQWA 1K73O 3QFPA 2G8FA 3QEVA 1W0HA 1TVRA 3CM5A 1R59O 3A8YA 4O44A 4BROA 2HVHA 3NH2A 2XRIA 2A3ZA 3OYBA 3PO5A 5M1PA 1N33K 1JLBA 3M8QA 3MK6A 4I2QA 4Z4CA 5C12A 3NFAA 1L3TA 1GLDG 4R5PA 1L3VA 1XMOK 4IOAL 1JLGA 1REVA 2WTUA 5FPMA 4CJ5A 2Z1HA 3AVKA 4BRIA 4CJTA 4YNQA 1W2BM 4CEAA 2PYJA 5FDLA 2O8DB 2EWSA 4BE0A 2Q1NA 1LV5A 4IJNA 1RT7A 2G8UA 1ESVA 4CFDA 1RDBA 4KH4A 3CCUN 4DV4K 4DTSA 4O8KA 3V9ZA 4CFAA 4YDUA 5I42A 5AFUA 2HHQA 3VQ4A 3ZSOA 1NGAA 1DTTA 5E84A 1CZBA 1MU2A 4FYDA 4WQ5A 3T19A 3WXLA 3OTOK 1JL2A 2D5RA 3K9JA 3H6EA 1HKBA 3JAMO 5C0YA 5JLFA 4CJ4A 3RWUA 5HLFA 4A2BA 1B9DA 2E20A 4JK9A 2XO7A 3KZBA 1TAQA 5HRNA 1VQPN 3T1AA 3LM9A 5AQLA 4DV2K 2G8HA 4MFBA 1DLOA 4H0OA 4BDYA 2Q3SA 3DWLA 4B3SK 4FWLA 4CE9A 1IKYA 4FK4A 4B1YB 1E4GT 4ELTA 3T69A 1OH7A 3NGZA 3DLKA 2HBMA 4F3TA 3C6TA 4DHYA 1VSIA 1Q81O 1D9FA 5BPLA 3UE5A 2A5XA 3V4IA 4JKBA 1LAWA 3SUOA 3O3GA 3EKSA 4LF5K 1RCHA 2BTFA 3CCLN 5LY3A 4PA1A 1KRPA 3MEDA 3T7ZA 1YXQA 3DXMA 3AVLA 3DOLA 4BGBA 4BRNA 4M3YA 4BC2A 4LH4A 1LWFA 3WNFA 1LWCA 3DAWA 4Q5VA 3SV4A 1D8YA 3CCEN 3L2WA 2Q31A 2ZE2A 5KPRA 3VQCA 1MDUB 4ISFA 4CF2A 4U7BA 3CD6N 5GADP 4M3RA 4M3TA 4IO8A 4KV8A 4HUFA 4CF0A 3TTCA 2I7PA 1KLMA 2E6MA 5EY4A 4KTWA 3TTDA 1X1PA 4B9QA 5C15A 1J5OA 4KB0A 5AQUA 1YF5L 3P31A 3LDSA 5AQJA 2F9WA 3E9LA 1Q7YO 4PL8A 3NHGA 2G8VA 3PX0A 1OH8A 5J2NA 3AVCA 3OVNA 1RTHA 4FCYA 4KHYA 3RMDA 5ADXH 3QBXA 4OKKA 4KBOA 1X9MA 3L6QA 2P5GA 3V9XA 1HNZK 3AARA 3NBPA 2HMPA 4O0JA 1NKBA 1TKZA 1BL3A 1HQEA 3EL2A 3RSEB 4H5WA 3VQ5A 4FM0A 3SBTA 1BCOA 3E1YA 4PL7A 3O4WA 5FPNA 3RMBA 4DR7K 4M45A 2HSTA 3RRHA 1NNEA 2O8FB 2QWLA 4KB1A 4JKGB 3UKRA 3QMLA 2HHWA 4FWOA 3V6DA 4RCHA 4CF9A 4OGEA 5SWMA 2ZM6K 2D0BA 3AY9A 1G15A 4FSVA 1VQMN 3O9TA 4FXDA 4KFBA 1TL1A 1UOCA 3GG4A 4LSNA 3VQ8A 4YOTA 1TK8A 4K43A 4B1ZA 3OYHA 2PY5A 4O8UA 3VTIA 3NE6A 4EZ6A 4IDKA 4EZ9A 4IFEA 3M8RA 3V9SA 1S5JA 2OCEA 2KZMA 4KI4A 1QVFM 3P83D 2UUAK 4W5OA 2ZJPL 4U67L 1XQSC 3LL3A 3K57A 2OPQA 4MDBA 4CHQA 2VQFK 3AVJA 4OJRA 4OPKA 2RKIA 4FWPA 4OKJA 3I0SA 1LOTB 4DLEA 2AA4A 3O9SA 4ZHRA 4HWIA 4W5RA 2BDPA 3VGMA 4B9UA 1X9JA 2XY6A 1NK4A 3IUCA 5C24A 3NVMA 3DLLL 4LF8K 1S1WA 1RDWX 4F9OA 2YHAA 3U6FA 4FK0A 2P9NA 3H1VX 1T03A 4CEDA 3AAQA 4C23A 2B4JA 2YHWA 1C1BA 4OKEA 1YJ9N 1IV0A 3OW2M 3HP6A 1H1VA 3D0PA 4JKFA 3PLAA 2ZJRL 3VESA 3ZETB 1JCEA 3LZJA 2OPSA 3HYFA 2EHGA 3CMAN 4GV3A 2HF3A 2RE2A 3SUQA 1ASWA 2GWKA 1RILA 4O5BA 2UUCK 4BC5A 3CQ8A 1NGDA 2JGUA 2QWOA 1IJJA 2OPPA 1BUPA 4CGIA 4GV9A 5AQNA 3LP2A 1BGXT 5C10A 2JLEA 3HM8A 1OH6A 4I9QA 3CJ9A 5CZ2A 1FKOA 1CZ9A 2ZF5O 3MN5A 5M1NA 4B3TK 4I2PA 1TYQA 1BA1A 4GNIA 2BANA 3HI0A 3IRXA 3VEYA 3VA3A 2CGLA 2FXUA 4TSXA 5I9EB 2CH6A 3MX2A 3LP0A 1QSYA 3A5MC 4IWVA 1YITN 4Z4GA 5TKWA 4GY2B 1KFDA 3VGLA 4YOUA 4I6MB 1LW0A 4CJ7A 1U49A 4FWMA 4KH5A 4FOIA 5AZJA 3VEXA 3MEGA 4M3WA 3THWB 4JK8A 2ASMA 3ITHA 1VQKN 1RTDA 3D45A 1CXUA 4NCGA 2YNIA 2O4IA 3CI5A 2BUPA 2P51A 1JLQA 4IEEA 3SCXA 3BZKA 3ZX3A 1ZC6A 2VG5A 5AQVA 3QEXA 4N76A 2HF4A 4BR2A 3P39A 3TAEA 4HCBA 2HHUA 1DGKN 3LAMA 2UU9K 4DV5K 1Q8IA 3O08A 1JCGA 3OYJA 4IKFA 1S1VA 1D4XA 1N34K 4IOCL 3ZEUA 4JS5A 3DLRA 3ULEB 2OYQA 5LJWA 4YFUA 3D2EA 3M1FA 1N5YA 1TGOA 4CBUA 4B1UB 5LL6Z 3LPTA 1C1AA 3D6RA 5JMVA 4M3ZA 4DR4K 5BN8A 1VSMA 2QXLA 4LF7K 3A0IX 3TSUA 4CJKA 4C8LA 3K9KA 2YNHA
chains in the Genus database with same CATH topology
3P4IA 5CR4A 2NRHA 3E66A 5BPMA 1XUPO 1NMDA 1SZ2A 3B8AX 4MO5A 5FPDA 1VQ4N 4FVUA 3SMSA 1T6CA 1BG3A 3MWTA 3GDQA 5AQXA 5AQZA 3UB5A 4CZFA 3D7EO 3QDKA 4AM7A 3MN6A 1HJOA 4C1NK 1BWFO 1VQ8N 2WFBA 4HTLA 4QS7A 5AQIA 5JVGL 1NGJA 3HOTA 5AQYA 4BRGA 4OO1J 3VOVA 2BH1A 1GLEG 1X3NA 4LC9B 3A5LC 4A5BA 3VEZA 2D0OA 2P9PB 3ULEA 2WUSA 2FSKA 2D0PA 4CZMA 5EVZA 3FZMA 2QW9A 4L3QA 5DM6L 3WT0A 2QWMA 1X3MA 3NMUA 4WQ4C 2JWLA 3G71N 3CCRN 3D2FA 1ATSA 5EX5A 3ZX0A 3M3ZA 5M1QA 3H46O 1K8AO 3CCQN 1SAZA 2VGNA 3SAHA 4JD2A 5AQPA 3S41A 2YX6A 4QS9A 5HL7L 4IOXA 2E2PA 3E9PA 4FWQA 4GVEA 5LJVA 5GIOA 2KLAA 5C2DA 3VTHA 2WC9A 4FPAA 4DB3A 3SMPA 1LCUA 2HBLA 4YORA 4R79A 5BRHA 2GEMA 4BGAA 3WQTA 2V51B 4H0TB 3U9DA 4CBWA 4IO9L 5AQWA 3G25A 4BRDA 1K73O 3QFPA 3CXCM 3CCSN 3H1QA 2CGJA 3CF5L 4XEIA 3A8YA 1R59O 4BROA 1NGFA 2E1YA 3LDLA 4NLCA 2QWPA 1V4SA 5AFUH 2A3ZA 4BR4A 2ZGZA 1J6ZA 2GX9A 5M1PA 5AZIA 4RWTA 1EO1A 2P9LB 3MK6A 1Z05A 5C12A 1GLDG 4IOAL 3R3LA 3ZYYX 2DPNA 3ZETA 1DEJA 1DT9A 3VF4A 4FL9A 4EIAA 2OTLN 1MWKA 5FPMA 1RGIA 2GTDA 1KD1O 4BRIA 4CZEA 3VETA 2QEXN 2GELA 3ENBA 4JHDB 1W2BM 3DXKA 3N4QA 3R9PA 2EWSA 3FE1A 3I56N 2NNWA 1W97L 2Q1NA 3IDHA 3HZ6A 4IJNA 1S22A 5JVHL 1ESVA 3WQUA 3F9MA 3MN9A 3IFRA 3MN7A 4BRAA 4KH4A 4JKEA 1NGEA 5FPEA 3CCUN 4Y0WA 3OA9A 4DCHA 4O8KA 4YDUA 5AFUA 4EAHD 5F1XA 1NGAA 1NGCA 3CC2N 5E84A 2AP1A 1P90A 4WCEL 1GLAG 3O9UA 1Q82O 4IZ9A 3R1XA 1KQSM 2P9SB 4WQ5A 1M1KO 2V52B 4H0VB 3KK7A 3WXLA 2V7YA 5AQGA 5HOOA 3K9JA 1KC8O 1ILYA 3BF3A 3H6EA 5JLHA 2YCHA 3CETA 1HKBA 3AAPA 5C0YA 1WUAA 5JLFA 1GLCG 4A2BA 3N4PA 4PKHA 1NWKA 2E20A 3CJ1A 4JK9A 4GV6A 3KZBA 3EO3A 3DXMB 1VQPN 4AF1A 1BU6O 4MLEA 4YDUC 3I55N 1YIJN 4H0XB 3LM9A 3KWIA 5AQLA 3C65A 3FFKB 4CBXA 1U2VA 1T3VA 5M1KA 4KH6A 4JHDA 3FLCO 1YAGA 4ISEA 4H0OA 3VERA 5KQDA 5CE3A 4WQ5C 3DWLA 4I6MA 4WYBA 3C7NA 4H0YB 4FWLA 3GOIA 2QM1A 5AQTA 1QHAA 1NM1A 2NRRA 1Q86O 1G99A 4BG8A 4B1YB 3VMFB 1E4GT 3CPWM 4FWNA 3T69A 1EQYA 4A62A 4BRMA 1OKJA 2KKZA 2P9UB 2HBMA 4BRCA 5BN9A 3EKUA 2ZGYA 4DHYA 4BR9A 1YJWN 3HOSA 4JKAA 3QB0A 1Q81O 3BUZB 5BPLA 2P9SA 3UE5A 3M5RA 5BPNA 2A5XA 4FOEA 2PAVA 4O5FA 2ITMA 4JKBA 2KHOA 3TPQA 4YOWA 4IJAA 1GLJO 4MDAA 3EKSA 3WXJA 3U8XA 2P9IB 2BTFA 3CCLN 2E1ZA 3U4LA 5LY3A 2E2QA 1CZAN 3O6WA 4CZLA 1QZ6A 4A59A 4CZJA 3T7ZA 1YXQA 2A41A 5AQHA 3QFUA 3DXMA 4J8FA 4WFBL 1VQNN 1KAZA 1BA0A 4ILJA 4BGBA 4K42A 3MWPA 3H45C 1SQKA 3CJBA 3J8AA 4BRNA 2YJFA 3F2KA 4BC2A 1ZXOA 3GE1A 2P9KB 1TYQB 2VGMA 3VGKA 2Q36A 3DAWA 3L0QA 2FLOA 2QWQA 3O9RA 5BRFA 3CCEN 1P8ZA 2PBDA 2Q31A 2NRZA 5KPRA 4XH5A 1MDUB 4ISFA 3CPEA 4U7BA 3CD6N 5GADP 3ID8A 2OANA 4FWKA 3UKUB 4IO8A 2P9UA 3TTCA 4FWSA 1NGBA 2I7PA 3KVGA 3O80A 3TTDA 5EY4A 4EHTA 4B9QA 4ILHA 2YJEA 5C15A 5AQUA 1YF5L 3P31A 1O13A 2Q0RA 3UKRB 4JN4A 4G9ZA 5AQJA 4BR5A 3TTFA 2F9WA 3HRGA 5AZJB 3E9LA 3EE8A 1Q7YO 5AQRA 1RFQA 2P9IA 3BP8A 5EXWA 4PL8A 4FO0A 4JKHA 2YI1A 4DKWA 3ENHA 2D1KA 2VYPA 2I7NA 3O8MA 2IVPA 3F5TA 5ADXH 3QBXA 2CH5A 4KBOA 2ZWHA 3FZLA 3L6QA 5JICA 3QICA 4BG9A 2P9PA 4H0PA 3GL1A 1NGGA 3AARA 3CJAA 3EZWA 2P9KA 3A5OC 2HMPA 3I8BA 2A6AA 4B1XB 2QWRA 5GAGP 3MCPA 4YOVA 1HUXA 2VWBA 3U9ZA 3Q7CA 3VF6A 1QVGM 2IVOA 3EL2A 4M7YA 3RSEB 4H5WA 5M1FA 3MMVA 4NB4A 2QTDA 3MDQA 3SBTA 3M6GA 3NVKA 3E1YA 4IDHA 4PL7A 3O4WA 5FPNA 3VEVA 3ZEUB 4EHUA 2HSTA 3UKUA 4JAXA 2IVNA 4A61A 1BOTO 1TUUA 3O5BA 2QWLA 2A40A 3W3DA 5ADXA 4IXCA 4BRHA 4JKGB 3CJ7A 3FR0A 3C0BA 3CIPA 3Q7BA 3QMLA 3UKRA 4BRPA 1GLBG 3C6HA 3SAFA 1RDUA 4FWOA 4M63C 4BR7A 4BQZA 4RCHA 1QQNA 4M7XA 3A5NC 1V4TA 3CQYA 1NGHA 2P9LA 3AY9A 4CD3A 4FSVA 3WEEB 2E2NA 1VQMN 1K8KB 4AM6A 1NBWA 1Y64A 3O9TA 4PHTX 1YHQN 2Q0UA 2P9NB 3QBWA 1GLFO 3CCVN 2NZTA 3GG4A 4BRQA 3LDPA 3WUHA 2D4WA 3H3OB 4YOTA 4K43A 4A2AA 4B1ZA 4O8UA 3VTIA 1SS6A 3EE9A 3DJCA 5AQQA 3MX5A 3HSCA 3OBWA 2YHXA 4A5AA 4IFEA 5MLCQ 3RSEA 1QVFM 3VEOA 4ISGA 3WXKA 2ZJPL 4U67L 5CHIA 1XQSC 4BRFA 2ASOA 4ILGB 3LL3A 4MDBA 2FF6A 3TU5A 3KHYA 3SAGA 4Z94A 4FWPA 4WF9L 1LOTB 4MLHA 2AA4A 3O9SA 3TSPA 3ZX2A 5KPZA 1BO5O 4HWIA 1TUYA 3R6MA 5BRDA 1WOQA 1NGIA 4JKGA 3VGMA 4BVPA 5E26A 3VENA 4YOYA 4K41A 1X9JA 3HBTA 2Q2RA 3IUCA 3NVMA 3CJCA 2FSJA 3DLLL 1KAXA 3BF1A 4QS8A 2W41A 1RDWX 4F9OA 2E88A 2QWNA 3WEEA 1K8KA 4CZGA 1E4FT 5C2FA 2OTJN 4PKGA 5BREA 1DKGD 3WXMB 2P9NA 3H1VX 4DQ8A 3FZFA 4NO7A 3R8EA 3G4SN 3CC4N 3AAQA 1MA9B 4C23A 2YHWA 1HPMA 4E1JA 2FSNA 4H03B 1YJ9N 3TSQA 3AGRA 1VAZA 4CZKA 3OW2M 5AZIB 4BY9C 1H1VA 5AQSA 4JKFA 3PLAA 2ZJRL 1VQLN 3ATUA 1VQON 4BRKA 5TKYA 2H3GX 3EN9A 3VESA 1S72N 3CHWA 3ZETB 1JCEA 4B1VA 5KPTA 2E2OA 1JJ2M 4MO4A 3J7ZO 3RVCA 3CMAN 2YHYA 1BDGA 4GV3A 2HF3A 3G6EN 1M90O 2FF3B 2J4RA 2RE2A 3CC7N 5ELZA 4OPAA 4JK7A 3L4IA 3DXKB 2GWKA 2Q97A 4IEIA 5F2RA 2ZJQL 2NRWA 3VPZA 4BC5A 1NGDA 5GAHP 5AQMA 2QWOA 3SJHA 1IJJA 1KXPA 1QQMA 3CERA 2QA4N 1ATRA 1IG8A 2ASPA 1HKCA 1BUPA 1QQOA 4H5TA 1Q18A 4WFNL 2GUPA 4BC3A 4GV9A 5AQNA 5C10A 1QZ5A 1YUWA 3CMEN 2E8AA 5AQOA 1VQ7N 2NRVA 3LM2A 5M1OA 3HM8A 1VQ6N 4NLBA 4BRLA 4BR0A 3CJ9A 4B1WB 4XH1A 4CI6A 2VCPA 2ZF5O 1N8RO 5M1NA 3MN5A 2F7TA 1YI2N 4PKIA 1TYQA 1BA1A 2F9TA 4H5NA 1VQ5N 4GNIA 3HI0A 3VEYA 1T6DA 5DM7L 2CGLA 4K25A 4BREA 1MWMA 2FXUA 3SBGA 4FPBA 5GINA 3L4QA 3O1BA 5I9EB 2IIRA 1ZBSA 1NJIO 2CH6A 3MX2A 2V7ZA 3A5MC 4BC4A 5F0XA 4IWVA 1YITN 3P38A 1U2VB 5AR0A 3D2EB 1YJNN 3E9OA 5GAEP 3H3NO 4XH4A 4GY2B 5TKWA 1OVYA 4YOXA 3VGLA 4YOUA 4I6MB 3O9QA 3C7NB 1XC3A 1Z6RA 4CJ7A 5GIPA 4FWMA 3HTVA 4KH5A 4FOIA 5AZJA 3OBYA 3VEXA 2GWJA 3O1WA 2QI2A 2NLXA 2HOEA 1ATNA 2NRXA 4H5RA 4JK8A 5KQ8A 1S3XA 2ASMA 1VQKN 2WBNA 3SK3A 5B8HA 3W0LA 3ENOA 3JS6A 3CI5A 4EFHA 2BUPA 1KAYA 3MCAB 5H1SQ 2JWKA 3WXIA 2PFUA 3I33A 4IEEA 4WFAL 1K9MO 3ID6A 1C0GA 2NRTA 3VF2A 3ZX3A 1ZC6A 1JCFA 5AQVA 1HX1A 3C6AA 2HBJA 1U6ZA 2HF4A 4BR2A 2HBKA 4JEPA 3P39A 1DGKN 2CGKA 3IKMA 5AQFA 2W40A 3O08A 1JCGA 4UY8O 5EOYA 3VEWA 3PIPL 1D4XA 3FGUA 4BQLA 3ZEUA 3PIOL 4IOCL 1T44A 1YVNA 3OHRA 1C0FA 3KWGA 1VQ9N 3ULEB 3AGKA 3ATVA 2A42A 4H5VA 4OPHA 5AQKA 3D2EA 3M1FA 3FZKA 5LJWA 4CBUA 3CCMN 3FZHA 3LDNA 4B1UB 4C1NI 1NLVA 3D2FB 3D6RA 4RTFD 5JMVA 2UYTA 4BVOA 4CD1A 3GBTA 3LDOA 1GLLO 4JKCA 4A57A 5BN8A 4FWRA 2QXLA 4JD2B 2RHKA 3CCJN 4CZHA 1HKGA 4CZIA 3CQXA 1HLUA 3LDQA 4JKDA 3A0IX 3TSUA 3IMXA 3SLCA 3BEXA 3K9KA 4JNEA 3JXUA 4WQ4A 5BR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P4I A;  2NRH A;  5BPM A;  1XUP O;  1NMD A;  1SZ2 A;  3B8A X;  4MO5 A;  5FPD A;  3SMS A;  1T6C A;  1BG3 A;  3GDQ A;  5AQX A;  5AQZ A;  3UB5 A;  4CZF A;  3D7E O;  3QDK A;  4AM7 A;  3MN6 A;  1HJO A;  1BWF O;  4HTL A;  5AQI A;  4QS7 A;  1NGJ A;  5AQY A;  4BRG A;  3VOV A;  4LC9 B;  1GLE G;  1X3N A;  3A5L C;  3VEZ A;  2D0O A;  2P9P B;  3ULE A;  2WUS A;  2FSK A;  2D0P A;  4CZM A;  5EVZ A;  3FZM A;  2QW9 A;  4L3Q A;  3WT0 A;  2QWM A;  1X3M A;  4WQ4 C;  3D2F A;  1ATS A;  5EX5 A;  3ZX0 A;  3M3Z A;  3H46 O;  1SAZ A;  4JD2 A;  5AQP A;  3S41 A;  4QS9 A;  2E2P A;  4FWQ A;  5LJV A;  4DB3 A;  4FPA A;  3SMP A;  1LCU A;  5BRH A;  2GEM A;  4BGA A;  3WQT A;  2V51 B;  4H0T B;  3U9D A;  4CBW A;  5AQW A;  3G25 A;  4BRD A;  3QFP A;  3H1Q A;  2CGJ A;  4XEI A;  1R59 O;  3A8Y A;  4BRO A;  1NGF A;  2E1Y A;  3LDL A;  5AFU H;  2QWP A;  1V4S A;  2A3Z A;  4BR4 A;  2ZGZ A;  1J6Z A;  5AZI A;  4RWT A;  2P9L B;  3MK6 A;  1Z05 A;  1GLD G;  2DPN A;  3ZET A;  1DEJ A;  3VF4 A;  4FL9 A;  4EIA A;  1MWK A;  5FPM A;  1RGI A;  2GTD A;  4BRI A;  4CZE A;  3VET A;  2GEL A;  4JHD B;  3DXK A;  3R9P A;  2EWS A;  3FE1 A;  2Q1N A;  3IDH A;  3HZ6 A;  4IJN A;  1S22 A;  1ESV A;  3WQU A;  3F9M A;  3MN9 A;  3IFR A;  3MN7 A;  4BRA A;  1NGE A;  5FPE A;  4Y0W A;  4DCH A;  4O8K A;  4YDU A;  5AFU A;  4EAH D;  5F1X A;  1NGA A;  1NGC A;  5E84 A;  2AP1 A;  1GLA G;  4IZ9 A;  2P9S B;  4WQ5 A;  2V52 B;  4H0V B;  3WXL A;  2V7Y A;  5AQG A;  3BF3 A;  3H6E A;  5JLH A;  2YCH A;  3CET A;  1HKB A;  3AAP A;  1WUA A;  5JLF A;  1GLC G;  4A2B A;  4PKH A;  1NWK A;  2E20 A;  3CJ1 A;  3KZB A;  3EO3 A;  3DXM B;  1BU6 O;  4MLE A;  4YDU C;  4H0X B;  3LM9 A;  5AQL A;  3FFK B;  4CBX A;  1U2V A;  4JHD A;  3FLC O;  1YAG A;  4ISE A;  4H0O A;  3VER A;  5KQD A;  5CE3 A;  4WQ5 C;  3DWL A;  4I6M A;  4WYB A;  3C7N A;  4H0Y B;  4FWL A;  3GOI A;  2QM1 A;  5AQT A;  1QHA A;  1NM1 A;  1G99 A;  4BG8 A;  4B1Y B;  1E4G T;  4FWN A;  1EQY A;  4A62 A;  4BRM A;  1OKJ A;  2P9U B;  4BRC A;  5BN9 A;  3EKU A;  2ZGY A;  4DHY A;  4BR9 A;  3QB0 A;  3BUZ B;  5BPL A;  2P9S A;  3UE5 A;  5BPN A;  2A5X A;  4FOE A;  2PAV A;  4O5F A;  2ITM A;  2KHO A;  3TPQ A;  4IJA A;  1GLJ O;  3EKS A;  3WXJ A;  3U8X A;  2P9I B;  2BTF A;  2E1Z A;  3U4L A;  5LY3 A;  2E2Q A;  1CZA N;  3O6W A;  4CZL A;  1QZ6 A;  4CZJ A;  1YXQ A;  2A41 A;  5AQH A;  3QFU A;  3DXM A;  4J8F A;  1KAZ A;  1BA0 A;  4BGB A;  4K42 A;  3H45 C;  1SQK A;  3CJB A;  3J8A A;  4BRN A;  2YJF A;  4BC2 A;  1ZXO A;  3GE1 A;  2P9K B;  1TYQ B;  3VGK A;  2Q36 A;  3DAW A;  3L0Q A;  2FLO A;  2QWQ A;  5BRF A;  1P8Z A;  2PBD A;  2Q31 A;  5KPR A;  4XH5 A;  1MDU B;  4ISF A;  3ID8 A;  2OAN A;  4FWK A;  3UKU B;  4IO8 A;  2P9U A;  4FWS A;  1NGB A;  2I7P A;  3KVG A;  3O80 A;  4EHT A;  5EY4 A;  4B9Q A;  2YJE A;  5AQU A;  2Q0R A;  3UKR B;  4JN4 A;  5AQJ A;  4BR5 A;  2F9W A;  5AZJ B;  5AQR A;  1RFQ A;  2P9I A;  3BP8 A;  5EXW A;  4PL8 A;  4FO0 A;  2YI1 A;  3ENH A;  2D1K A;  2VYP A;  2I7N A;  3O8M A;  2IVP A;  5ADX H;  3QBX A;  2CH5 A;  4KBO A;  2ZWH A;  3FZL A;  3L6Q A;  5JIC A;  3QIC A;  4BG9 A;  2P9P A;  4H0P A;  3GL1 A;  1NGG A;  3AAR A;  3CJA A;  3EZW A;  2P9K A;  3A5O C;  2HMP A;  3I8B A;  2A6A A;  4B1X B;  2QWR A;  3MCP A;  1HUX A;  2VWB A;  3U9Z A;  3VF6 A;  2IVO A;  3EL2 A;  4M7Y A;  3RSE B;  4H5W A;  3MMV A;  4NB4 A;  3MDQ A;  3M6G A;  4PL7 A;  3O4W A;  5FPN A;  3VEV A;  3ZEU B;  4EHU A;  3UKU A;  4JAX A;  2IVN A;  4A61 A;  1BOT O;  1TUU A;  3O5B A;  2QWL A;  2A40 A;  3W3D A;  5ADX A;  4IXC A;  4BRH A;  3CJ7 A;  3FR0 A;  3C0B A;  3CIP A;  3QML A;  3UKR A;  4BRP A;  1GLB G;  4FWO A;  4M63 C;  4BR7 A;  4BQZ A;  4RCH A;  1QQN A;  4M7X A;  3A5N C;  1V4T A;  3CQY A;  1NGH A;  2P9L A;  3AY9 A;  4CD3 A;  4FSV A;  3WEE B;  2E2N A;  1K8K B;  4AM6 A;  1NBW A;  1Y64 A;  2Q0U A;  2P9N B;  3QBW A;  1GLF O;  2NZT A;  3GG4 A;  4BRQ A;  3LDP A;  3WUH A;  2D4W A;  3H3O B;  4A2A A;  4K43 A;  4B1Z A;  3DJC A;  5AQQ A;  3HSC A;  2YHX A;  3RSE A;  3VEO A;  4ISG A;  3WXK A;  1XQS C;  4BRF A;  2ASO A;  3LL3 A;  2FF6 A;  3TU5 A;  3KHY A;  4Z94 A;  4FWP A;  1LOT B;  4MLH A;  2AA4 A;  3ZX2 A;  5KPZ A;  1BO5 O;  4HWI A;  1TUY A;  3R6M A;  5BRD A;  1WOQ A;  1NGI A;  3VGM A;  4BVP A;  5E26 A;  3VEN A;  4K41 A;  1X9J A;  3HBT A;  2Q2R A;  3IUC A;  3CJC A;  2FSJ A;  1KAX A;  3BF1 A;  4QS8 A;  2W41 A;  1RDW X;  4F9O A;  2E88 A;  2QWN A;  3WEE A;  1K8K A;  4CZG A;  1E4F T;  4PKG A;  5BRE A;  1DKG D;  2P9N A;  3H1V X;  4DQ8 A;  3FZF A;  4NO7 A;  3R8E A;  3AAQ A;  1MA9 B;  4C23 A;  2YHW A;  1HPM A;  4E1J A;  2FSN A;  4H03 B;  4CZK A;  5AZI B;  1H1V A;  5AQS A;  3ATU A;  4BRK A;  5TKY A;  2H3G X;  3EN9 A;  3VES A;  3CHW A;  3ZET B;  1JCE A;  4B1V A;  5KPT A;  2E2O A;  4MO4 A;  2YHY A;  1BDG A;  2HF3 A;  2FF3 B;  2J4R A;  5ELZ A;  3L4I A;  3DXK B;  2GWK A;  2Q97 A;  5F2R A;  3VPZ A;  4BC5 A;  1NGD A;  5AQM A;  2QWO A;  3SJH A;  1IJJ A;  1KXP A;  1QQM A;  3CER A;  1ATR A;  1IG8 A;  2ASP A;  1HKC A;  1BUP A;  1QQO A;  4H5T A;  1Q18 A;  2GUP A;  4BC3 A;  5AQN A;  1QZ5 A;  1YUW A;  2E8A A;  5AQO A;  3LM2 A;  3HM8 A;  4BRL A;  4BR0 A;  3CJ9 A;  4B1W B;  4XH1 A;  4CI6 A;  2VCP A;  2ZF5 O;  3MN5 A;  4PKI A;  1TYQ A;  1BA1 A;  2F9T A;  4H5N A;  4GNI A;  3HI0 A;  3VEY A;  1T6D A;  2CGL A;  4K25 A;  4BRE A;  1MWM A;  2FXU A;  4FPB A;  5I9E B;  3O1B A;  2IIR A;  1ZBS A;  2CH6 A;  2V7Z A;  3A5M C;  4BC4 A;  5F0X A;  4IWV A;  1U2V B;  5AR0 A;  3D2E B;  3H3N O;  4XH4 A;  4GY2 B;  3VGL A;  4I6M B;  3C7N B;  1XC3 A;  1Z6R A;  4CJ7 A;  4FWM A;  3HTV A;  4FOI A;  5AZJ A;  3VEX A;  2GWJ A;  3O1W A;  2NLX A;  2HOE A;  1ATN A;  4H5R A;  5KQ8 A;  1S3X A;  2ASM A;  3SK3 A;  5B8H A;  3W0L A;  3ENO A;  3JS6 A;  3CI5 A;  4EFH A;  2BUP A;  1KAY A;  3WXI A;  3I33 A;  1C0G A;  3VF2 A;  3ZX3 A;  1ZC6 A;  1JCF A;  5AQV A;  1HX1 A;  2HF4 A;  1U6Z A;  4BR2 A;  1DGK N;  2CGK A;  5AQF A;  2W40 A;  3O08 A;  1JCG A;  5EOY A;  3VEW A;  1D4X A;  3FGU A;  4BQL A;  3ZEU A;  1T44 A;  1YVN A;  3OHR A;  1C0F A;  3ULE B;  3ATV A;  4H5V A;  2A42 A;  5LJW A;  5AQK A;  3D2E A;  3M1F A;  3FZK A;  4CBU A;  3FZH A;  3LDN A;  4B1U B;  1NLV A;  3D2F B;  5JMV A;  4RTF D;  2UYT A;  4BVO A;  4CD1 A;  3GBT A;  3LDO A;  1GLL O;  5BN8 A;  4FWR A;  2QXL A;  4JD2 B;  4CZH A;  1HKG A;  4CZI A;  3CQX A;  1HLU A;  3LDQ A;  3A0I X;  3IMX A;  3SLC A;  3BEX A;  4JNE A;  3JXU A;  4WQ4 A;  5BR9 A; 
#chains in the Genus database with same CATH topology
 2RPI A;  1SV5 A;  2E4L A;  3NGI A;  3E66 A;  4I7F A;  3KLE A;  4KHN A;  5FRM A;  4M3U A;  3B8A X;  3MWT A;  4CZF A;  3D7E O;  3QDK A;  4AM7 A;  4BE2 A;  2WFB A;  4QS7 A;  4JI7 K;  5AQY A;  1TAU A;  1QSL A;  3ZSW A;  3THV A;  2P1J A;  2WUS A;  1J9A A;  5EVZ A;  3NMU A;  3WT0 A;  2QWM A;  1X3M A;  4AHS A;  2GBZ A;  2JWL A;  3U3Y A;  4JRP A;  1ATS A;  4B8A B;  3S41 A;  5HL7 L;  4ID5 A;  2E2P A;  3S3M A;  4IFV A;  4V19 S;  3BGR A;  4GVE A;  4IFY A;  4ELU A;  2WC9 A;  1LCU A;  2HBL A;  4R79 A;  4BGA A;  4H0T B;  3U9D A;  2FBY A;  3MAQ A;  3H1Q A;  5T7B A;  5JS1 A;  3CF5 L;  3V81 A;  4W5T A;  1SKS A;  1J6Z A;  2QKK A;  3AVM A;  5AZI A;  4OLA A;  1EO1 A;  1D5A A;  3R3L A;  4J2B A;  3VF4 A;  3DRS A;  1RGI A;  4E7L A;  1KD1 O;  3VET A;  4EP4 A;  3DXK A;  3N4Q A;  4CVN E;  1QQC A;  3CYM A;  3M8P A;  2YNF A;  3V1O A;  3IFR A;  3MXM A;  4DUY K;  3VQA A;  4JKE A;  1NGE A;  4DCH A;  3OA9 A;  4KRF A;  1U47 A;  4CK3 A;  4FJI A;  4EAH D;  4OGC A;  4Z4I A;  2KFZ A;  3QEP A;  4KHU A;  4WCE L;  4DTR A;  1Q82 O;  4IZ9 A;  1KQS M;  4DR6 K;  3KK7 A;  4LFB K;  1KC8 O;  1ILY A;  3BF3 A;  1T05 A;  4FW1 A;  3CET A;  3AAP A;  1IKW A;  3CJ1 A;  1WB9 A;  1C0U A;  4GV6 A;  2F8T A;  1KVC A;  4H0X B;  4CJU A;  4CBX A;  1U2V A;  4DR5 K;  1T3V A;  5M1K A;  4KH6 A;  1HJR A;  4ISE A;  1TKT A;  2O8D A;  1NKE A;  3AVB A;  2IDO A;  4PY5 A;  3C7N A;  1VSL A;  1NMN A;  1NM1 A;  1VSE A;  4BDP A;  2A1S A;  1NK8 A;  1GOB A;  1O1W A;  1J54 A;  1VSJ A;  4CK1 A;  3NF7 A;  1ZBU A;  2X6S A;  1FXX A;  3P1G A;  1U45 A;  4X62 K;  1WBB A;  3BUZ B;  3M5R A;  5BPN A;  4FOE A;  4UQG A;  3S3O A;  2KHO A;  1HNV A;  3AO5 A;  2P9I B;  1FKP A;  4CEC A;  2E1Z A;  3U4L A;  2VWJ A;  1CZA N;  2UUB K;  1QZ6 A;  2OZS A;  4A59 A;  3QIP A;  2A41 A;  5AQH A;  1RTI A;  1WAF A;  1VQN N;  1N36 K;  4ILJ A;  3H45 C;  4FM2 A;  2YJF A;  1KCF A;  1C0T A;  2P9K B;  5CYQ A;  3L0Q A;  2QWQ A;  4E7K A;  4FJJ A;  1S6P A;  1BIS A;  5D3G A;  2PBD A;  2NRZ A;  3EYZ A;  4CJP A;  4KHW A;  3K0S A;  1U04 A;  3UKU B;  2IOC A;  2XY5 A;  3L2R A;  2XY7 A;  4EHT A;  2F96 A;  1XNQ K;  1NOZ A;  1EET A;  4CEO A;  1O13 A;  2Q0R A;  3ZSY A;  3TTF A;  4BR5 A;  1CXQ A;  1S9G A;  3EE8 A;  3ISN C;  5EXW A;  2O4G A;  4FO0 A;  4DKW A;  4CIF A;  4F4K A;  3F5T A;  2Y1J A;  4F8R A;  3VQD A;  4BWM A;  4CIE A;  1EX4 A;  2O8C B;  5JIC A;  1JXB A;  2P9P A;  4FJH A;  1NGG A;  3EZW A;  3ZLJ A;  3ZT0 A;  2QWR A;  4FJX A;  3TAQ A;  3Q7C A;  1IKV A;  3VF6 A;  3VQQ A;  4AHV A;  1HYV A;  3NCI A;  3M6G A;  4IDH A;  5E41 A;  4FLV A;  5J2M A;  1ZBL A;  4JAX A;  3HPH A;  4A61 A;  2QXF A;  3SV3 A;  1TUU A;  3O5B A;  5J2P A;  3HXM A;  4BRH A;  1C0M A;  3AVI A;  3C0B A;  4BRP A;  5CY4 A;  1GLB G;  4BE1 A;  3ZSQ A;  4FJM A;  3SUN A;  4BR7 A;  4E0D A;  1QQN A;  4M7X A;  3A5N C;  1NK9 A;  4JV5 K;  4HUE A;  1UA0 A;  2P9L A;  4CD3 A;  3DRR A;  1IO2 A;  2IC3 A;  3E01 A;  3PO4 A;  1K8K B;  1NG9 A;  5IT9 O;  3OYM A;  2FBX A;  1YHQ N;  1NU0 A;  1JLC A;  3G0Z A;  4CJ3 A;  4KTQ A;  1GLF O;  3CCV N;  1SKR A;  2NZT A;  3H08 A;  4RG8 A;  3LDP A;  4N5S A;  3H3O B;  4DTO A;  3U3G A;  2A1R A;  3DJC A;  3OBW A;  2YHX A;  4JI8 K;  2GV9 A;  5I3U A;  4A5A A;  3RSE A;  4LFA K;  4ISG A;  1L3S A;  4BRF A;  3ZT2 A;  2KZZ A;  5IWA K;  5FRO A;  4CHN A;  5J1E A;  2UXC K;  1EWR A;  2O8F A;  3TSP A;  3OYE A;  4JKG A;  4DSK A;  3KLH A;  4K41 A;  4Y1D A;  4H8K A;  3OYG A;  3HBT A;  2Q2R A;  2KTQ A;  2FSJ A;  4CK2 A;  4CF8 A;  4FLU A;  3BF1 A;  4GW6 A;  3LWL A;  4DTX A;  2HHT A;  4JYA K;  5C2F A;  1FK9 A;  1HR0 K;  4PKG A;  3KD5 E;  1DKG D;  4DQ8 A;  3CC4 N;  3R8E A;  3G4S N;  4Q0B A;  1ZBF A;  3SI6 A;  4YHH K;  1MA9 B;  1HPM A;  3TSQ A;  3AGR A;  1VAZ A;  3KIO A;  3TWH A;  4BY9 C;  3K5O A;  1VQO N;  5TKY A;  3CHW A;  4B1V A;  5KPT A;  4FW2 A;  5KTQ A;  4CGF A;  5DK5 A;  1BDG A;  4OVL A;  1M90 O;  3G6E N;  5ELZ A;  5FLX O;  3ZT4 A;  1IH7 A;  4BWJ A;  5F2R A;  2VQE K;  5GAH P;  3CER A;  4KPY A;  2QA4 N;  1IG8 A;  2ASP A;  1QQO A;  3TAM A;  2O8B B;  4WFN L;  4BC3 A;  3OYL A;  1ASV A;  1VQ7 N;  4LSL A;  2WON A;  1WN7 A;  4B3O A;  4BRL A;  4FM1 A;  1QS4 A;  4CI6 A;  4XH1 A;  3THY A;  2F7T A;  3J80 O;  4J2E A;  1EXQ A;  2F9T A;  4H5N A;  1VQ5 N;  4K0K K;  3SBG A;  5GIN A;  1NJI O;  2IIR A;  3SQ1 A;  2DY4 A;  1LW2 A;  2V7Z A;  4BC4 A;  2BE2 A;  2RF2 A;  3P38 A;  5AR0 A;  3H3N O;  4XH4 A;  1OVY A;  3QO9 A;  1YTA A;  2VWK A;  2HOE A;  2NRX A;  1S3X A;  3SQ2 A;  1C1C A;  4CGG A;  3K5L A;  3O3H A;  1S1X A;  3NGY A;  3LPU A;  4DQR A;  3OYK A;  4EFH A;  4B9N A;  4NXM K;  5KRS A;  3NH1 A;  3MCA B;  3UIQ A;  2JWK A;  1K9M O;  2PFU A;  3I33 A;  4E89 A;  3ID6 A;  3SNN A;  2NRT A;  3ZSX A;  1I3A A;  3HPG A;  1HX1 A;  3C6A A;  2HBJ A;  2HBK A;  1F21 A;  1HMV A;  3DLG A;  3SQ4 A;  1XMQ K;  2YKN A;  3PIP L;  1Z26 A;  3AVF A;  3MXJ A;  3FGU A;  1T44 A;  3OS1 A;  3B6O A;  3ATV A;  2A42 A;  1WAJ A;  4OPH A;  5AQK A;  3FZK A;  3FZH A;  3LDN A;  4C1N I;  3NF9 A;  4CEF A;  3OYA A;  4RTF D;  1W7A A;  4BVO A;  3GBT A;  3LDO A;  1JXE A;  4JKC A;  1U4B A;  4JD2 B;  3THW A;  5KGX A;  3CCJ N;  5EU7 A;  4W5N A;  4KI6 A;  4CZH A;  4CZI A;  3QNO A;  3CQX A;  1HLU A;  4FZX C;  1NK5 A;  3IMX A;  3SLC A;  3HST B;  3BEX A;  4WQ4 A;  1XI1 A;  2NRH A;  3RR8 A;  3NAE A;  1NJY A;  1GOA A;  3SMS A;  4M41 A;  4W5Q A;  3UB5 A;  3MN6 A;  4C1N K;  1BWF O;  4HTL A;  2RN2 A;  5JVG L;  1JL1 A;  3HOT A;  4BRG A;  4E1M A;  3VOV A;  4A5B A;  2QK9 A;  3ULE A;  2FSK A;  1J5E K;  3J7Y P;  4CZM A;  3QES A;  3ZX0 A;  3M3Z A;  1K8A O;  1XNR K;  4M42 A;  3CCQ N;  4DFM A;  1SAZ A;  2VGN A;  2YX6 A;  4QS9 A;  1X9S A;  4IOX A;  4LFC K;  2OPR A;  1YTU A;  3CG7 A;  2HHX A;  2KLA A;  5C2D A;  1XWL A;  3SMP A;  5BRH A;  4IG3 A;  2GEM A;  2YNG A;  3WQT A;  2V51 B;  4CBW A;  4IO9 L;  4BRD A;  5HRP A;  3THX B;  3O4Q A;  1WSG A;  4ICL A;  1WSI A;  2AJQ A;  1RT2 A;  2E1Y A;  5AFU H;  4NLC A;  2IGI A;  1V4S A;  4CHY A;  4DS4 A;  4BR4 A;  2ZGZ A;  4FZY A;  2B6A A;  4RWT A;  1T8E A;  1TV6 A;  1NKC A;  1DEJ A;  4GMJ B;  4FL9 A;  2OTL N;  4E7H A;  4CZE A;  2HVI A;  4LD0 A;  1RBR A;  2GEL A;  4DMN A;  4JHD B;  1QSS A;  3R9P A;  3I56 N;  1YT3 A;  1W97 L;  3F9M A;  2UXD K;  4AHC A;  4BRA A;  3DMJ A;  4ID1 A;  4Y0W A;  4Z0U A;  4GVM A;  1ITG A;  1NGC A;  3VQ9 A;  2AP1 A;  1GLA G;  4HHT A;  4RW4 A;  2P9S B;  1M1K O;  4Z4H A;  2V52 B;  2X74 A;  5HOO A;  3AO1 A;  4AQY K;  3QEW A;  1WUA A;  4PKH A;  1SL0 A;  1NWK A;  4JI6 K;  3TAB A;  4E7I A;  1BU6 O;  4YDU C;  3I55 N;  3TAP A;  3KK3 A;  1WSF A;  3FFK B;  4DQQ A;  1HRH A;  2G8W A;  3FLC O;  1BQM A;  3S9H A;  3CFO A;  3VER A;  4CES A;  4WQ5 C;  3KK2 A;  4H0Y B;  3GOI A;  2QM1 A;  5AQT A;  1QHA A;  2NRR A;  3C95 A;  3AO3 A;  4DV7 K;  4DSF A;  3CPW M;  1EQY A;  4A62 A;  4E7J A;  4BRM A;  4ZTJ A;  2P9U B;  4LH5 A;  4CJF A;  2KFN A;  5BN9 A;  3EKU A;  2IAJ A;  3HK2 A;  2ZGY A;  4BR9 A;  4CEQ A;  4JKA A;  4C8K A;  3QB0 A;  3AA2 A;  3B6P A;  4O5F A;  2ITM A;  1RDD A;  3HVR A;  1GLJ O;  4MDA A;  3BDP A;  3WXJ A;  1S9E A;  4HUG A;  2KQ2 A;  2ZD1 A;  3O6W A;  4CZL A;  4OLB A;  4DTJ A;  3LAL A;  4MQ3 A;  4G1Q A;  4FLZ A;  3QFU A;  3VN5 A;  4J8F A;  4WFB L;  3V9W A;  3IG1 A;  1BA0 A;  4K42 A;  3MWP A;  3CJB A;  2F8S A;  2IS3 A;  3J8A A;  3F2K A;  3HVT A;  4H4O A;  1TYQ B;  2VGM A;  3L3U A;  3VGK A;  2Q36 A;  2FLO A;  5CYM A;  5BRF A;  1GOC A;  2HHS A;  3C94 A;  3SPY A;  1EWQ A;  3CPE A;  3L8B A;  3ID8 A;  2OAN A;  4FWK A;  2Z1J A;  2HHV A;  4FWS A;  4AHR A;  3A2F A;  4QOZ B;  5KGW A;  1Y97 A;  3KLI A;  1A5V A;  1RT5 A;  3AO2 A;  4M3X A;  1N32 K;  3HRG A;  5AZJ B;  5AQR A;  1RFQ A;  2P9I A;  4JKH A;  4QCL A;  2YI1 A;  3HT3 A;  3HPO A;  2D1K A;  2VYP A;  3O8M A;  2IVP A;  1SKW A;  3SJJ A;  3OJU A;  3NDK A;  1KTQ A;  1BI4 B;  2DFF A;  4CHO A;  4HCC A;  3FZL A;  1NK0 A;  3QIC A;  4BG9 A;  2P9K A;  2XY8 A;  3I8B A;  2A6A A;  3MCP A;  1FJG K;  4YOV A;  2VWB A;  2YKM A;  1QVG M;  4CW7 B;  4FJ5 A;  2IVO A;  3PX6 A;  1XHZ A;  4NB4 A;  5LMN K;  3MDQ A;  3VEV A;  3ZEU B;  4EHU A;  1Q9Y A;  1VSH A;  3UKU A;  2IVN A;  4B8C A;  2LSN A;  4DR2 K;  2A40 A;  4DFP A;  5ADX A;  4IXC A;  3NF6 A;  3Q7B A;  3CIP A;  4B3R K;  4LF9 K;  3SAF A;  4IBN A;  4BQZ A;  1Z25 A;  1NGH A;  2B5J A;  1D9D A;  2O8E B;  3O4N A;  3AVG A;  3WEE B;  4PHT X;  1NBW A;  1RBV A;  1RBS A;  1E3M A;  2O8C A;  3QBW A;  1HNI A;  4A2A A;  3TAR A;  1IKX A;  4CGD A;  3EE9 A;  4DU1 A;  5AQQ A;  3V1R A;  3MX5 A;  1L3U A;  4KHP K;  3K58 A;  5CHI A;  3MXI A;  4ILG B;  3TU5 A;  3KHY A;  3SAG A;  3P5J A;  3ZX2 A;  5KPZ A;  1RBU A;  1BO5 O;  1NGI A;  4BVP A;  4YOY A;  3VQ6 A;  2X78 A;  3JYT A;  3CJC A;  1KAX A;  2E88 A;  4CJR A;  4FLX A;  1K8K A;  4CZG A;  1E4F T;  5BRE A;  3OYC A;  4RW6 A;  3LAN A;  3ZCM A;  3F73 A;  4E1J A;  4O55 A;  1BCM A;  4H03 B;  4N56 A;  4JI0 K;  4KTZ A;  2PYL A;  3ZT3 A;  4CZK A;  5AZI B;  3IS9 A;  1TK5 A;  1K6Y A;  5AQS A;  1VQL N;  3ATU A;  4DTM A;  1RT1 A;  1HNX K;  3EN9 A;  1S72 N;  2VG6 A;  3SPZ A;  4DU4 A;  5J2Q A;  4MO4 A;  3J7Z O;  1UA1 A;  3RVC A;  2YHY A;  5JS2 A;  3L4I A;  3DXK B;  3ZT1 A;  4PQU A;  3G10 A;  2Q97 A;  4IEI A;  3L2V A;  2NRW A;  2VG7 A;  4YY3 K;  3ALY A;  3DYA A;  3OYD A;  5AQM A;  3SJH A;  2PZS A;  4KHQ A;  3L2U A;  1WSJ A;  1HKC A;  4H5T A;  1Q18 A;  1CLQ A;  4K8X A;  1YUW A;  4CJL A;  5AQO A;  3RRG A;  5M1O A;  3OYF A;  4FVM A;  1VQ6 N;  4BR0 A;  3VQB A;  1B9F A;  2VCP A;  1N8R O;  4DF4 A;  3RMC A;  4B9M A;  1ZYQ A;  1MWM A;  3AVA A;  4FPB A;  3L4Q A;  3OYI A;  1ZBS A;  3EZ5 A;  3SUP A;  2HW3 A;  2Y1I A;  5F0X A;  2HNY A;  1U2V B;  3AO4 A;  4DS5 A;  4DFJ A;  5K14 A;  2DTU A;  3C7N B;  5GIP A;  1Z6R A;  2E5L K;  3HTV A;  3OBY A;  3OY9 A;  3O1W A;  4DSI A;  3BY5 A;  2QI2 A;  1W9H A;  4H5R A;  1ATN A;  5KQ8 A;  4JI3 K;  4FJK A;  4KRE A;  2WBN A;  2O8B A;  4CCH A;  3ENO A;  3JS6 A;  3QIN A;  4L8R B;  4N47 A;  4WFA L;  2HND A;  1C0G A;  4KO0 A;  3F9K A;  4NYN A;  4PUO A;  4DU3 A;  1U6Z A;  4NCB A;  3LWM A;  2CGK A;  4E19 A;  3IKM A;  3PSI A;  2W40 A;  5AQF A;  4DFK A;  2DFE A;  3J81 O;  1HNW K;  4BQL A;  3PIO L;  4JLH A;  1YVN A;  3KWG A;  1A5W A;  3AGK A;  1JLE A;  5C42 A;  4LY7 A;  4Z4F A;  1VSD A;  1QTM A;  1NLV A;  3D2F B;  3VQE A;  2UYT A;  2X6N A;  4CD1 A;  2D0A A;  3T1Y K;  4FWR A;  4DWI A;  3C6U A;  4DV6 K;  5HRR A;  1IBK K;  3LDQ A;  4DF8 A;  4JKD A;  1SUQ A;  2ITG A;  1VHX A;  3JXU A;  5BR9 A;  4JI4 K;  3P4I A;  4DQP A;  4DTU A;  4JI1 K;  1XUP O;  1ASU A;  1NMD A;  1VQ4 N;  2ETJ A;  1VQ9 N;  1HJO A;  4DG1 A;  1VQ8 N;  4B9T A;  1A5X A;  4KAZ A;  1S6Q A;  2BH1 A;  4LC9 B;  4JS4 A;  4ZTF A;  2P9P B;  3M8S A;  3MEE A;  2D0P A;  3HJF A;  3CCR N;  1NJX A;  1EKE A;  1N6Q A;  5M1Q A;  2WOM A;  1WSH A;  4GKJ K;  4JD2 A;  5AQP A;  3NH0 A;  4FJL A;  4AHU A;  3E9P A;  4FWQ A;  2KW4 A;  5GIO A;  3ULD A;  4CER A;  3VTH A;  4FPA A;  4DB3 A;  4C8O A;  4CJV A;  1J53 A;  3G25 A;  1WBD A;  2G8K A;  3CXC M;  3CCS N;  4BAC A;  2CGJ A;  4FJN A;  4XEI A;  3QIO A;  4LF4 K;  1FW6 A;  1HYS A;  1NGF A;  3LDL A;  2QWP A;  4BDZ A;  2GX9 A;  2P9L B;  1KVB A;  1Z05 A;  2FC0 A;  3ZYY X;  2DPN A;  3ZET A;  1DT9 A;  4EIA A;  1MWK A;  3ASM A;  2GTD A;  2YV0 X;  4LF6 K;  2QEX N;  3ENB A;  1RNH A;  3VQP A;  3FE1 A;  2F4V K;  2NNW A;  3IDH A;  1YVU A;  3HZ6 A;  1VK0 A;  1S22 A;  5JVH L;  1X9W A;  3PSF A;  3WQU A;  3MN9 A;  3MN7 A;  5FPE A;  4H4M A;  3QET A;  1IBM K;  1VRT A;  3QLH A;  5F1X A;  3CC2 N;  2W6L A;  1P90 A;  4HTU A;  3O9U A;  1NJW A;  3R1X A;  4K8Z A;  4H0V B;  4ELV A;  2V7Y A;  5AQG A;  3THX A;  2FBT A;  3TI0 A;  5JLH A;  2YCH A;  3DI6 A;  1GLC G;  3N4P A;  3V9U A;  4CJE A;  3EO3 A;  3I8D A;  1VSK A;  3DXM B;  3JSM A;  4AF1 A;  3FFI A;  4MLE A;  1JKH A;  1YIJ N;  2YHB A;  3KWI A;  3C65 A;  3L2Q A;  4FJ8 A;  4B08 A;  4DTP A;  1BQN A;  4JHD A;  1YAG A;  3IAY A;  5KQD A;  1OH5 A;  5CE3 A;  4DR3 K;  4I6M A;  4WYB A;  4F2R A;  1TL3 A;  3EEQ A;  1Q86 O;  4GKK K;  1G99 A;  4BG8 A;  3VMF B;  1B92 A;  4FWN A;  4X65 K;  2HHH K;  3DOK A;  1IG9 A;  1U48 A;  1RT6 A;  1OKJ A;  2KKZ A;  4BRC A;  1YJW N;  3WNE A;  3HOS A;  2P9S A;  2PAV A;  3TPQ A;  4YOW A;  4IJA A;  3OJS A;  3MEC A;  2UXB K;  3U8X A;  2E2Q A;  4IG0 A;  1KVA A;  2OZM A;  4CZJ A;  4OPJ A;  4CHZ A;  3KD1 E;  1JLA A;  1KAZ A;  3LP1 A;  3ZSV A;  4E1N A;  1BHL A;  1SQK A;  3NF8 A;  1WNS A;  4CJW A;  1ZXO A;  3THY B;  3GE1 A;  4CEZ A;  4B9L A;  2NUB A;  3O9R A;  1I94 K;  1P8Z A;  4CHP A;  2G8I A;  3SYZ A;  4XH5 A;  4CIG A;  3RR7 A;  3HM9 A;  4B9S A;  4O4G A;  3HL8 A;  4DUZ K;  2P9U A;  4FLT A;  3V1Q A;  1NGB A;  4PWD A;  1RT4 A;  3KVG A;  3O80 A;  4ILH A;  2YJE A;  4Z4E A;  3UKR B;  4JN4 A;  4G9Z A;  3WNG A;  4DV0 K;  4C8M A;  3LAK A;  4CEB A;  1DTQ A;  4CEE A;  3BP8 A;  4F3O A;  1NK6 A;  3ENH A;  2I7N A;  4N41 A;  2QKB A;  2CH5 A;  2ZWH A;  3WNH A;  4H0P A;  3GL1 A;  1QHT A;  3CJA A;  4KKO A;  2HNZ A;  3A5O C;  4B1X B;  5GAG P;  1ZBI A;  1HUX A;  3U9Z A;  4M7Y A;  5M1F A;  3MMV A;  4AH9 A;  2QTD A;  3NVK A;  1SL2 A;  3PV8 A;  1TKX A;  3K59 A;  3CFP A;  1BOT O;  4X66 K;  1HPZ A;  3AA3 A;  4JI2 K;  3W3D A;  4DQS A;  3CJ7 A;  3ZSZ A;  3FR0 A;  1L5U A;  3PY8 A;  3C6H A;  1RDU A;  2OA8 A;  4M63 C;  1V4T A;  3S3N A;  3CQY A;  4Y1C A;  2GUI A;  3TR8 A;  1R0A A;  5HRS A;  2E2N A;  4AM6 A;  1Y64 A;  3OS2 A;  1BI4 A;  2Q0U A;  2P9N B;  4CF1 A;  3AA5 X;  4BRQ A;  3WUH A;  2D4W A;  4CJS A;  3EY1 A;  3KLG A;  3QNN A;  4WE1 A;  1SS6 A;  3DLB A;  3VA0 A;  4FLY A;  3HSC A;  2I5J A;  4NCA A;  2ATQ A;  5MLC Q;  4O0I A;  5HP1 A;  1C6V A;  2P5O A;  3VEO A;  3WXK A;  3RMA A;  4DSL A;  2ASO A;  3PX4 A;  2FF6 A;  3SZ2 A;  4Z94 A;  4WF9 L;  3KKS A;  1WSE A;  4MLH A;  3DLH A;  3L3V A;  1TUY A;  3R6M A;  5BRD A;  1WOQ A;  1IBL K;  3LP3 A;  5E26 A;  3VEN A;  4FJG A;  1UWB A;  3CM6 A;  3T3F A;  3J7A P;  5DMR A;  4X64 K;  4QS8 A;  4B9V A;  2W41 A;  4FK2 A;  2O8E A;  3DRP A;  1NOY A;  2QWN A;  3WEE A;  1TK0 A;  1BIU A;  2OTJ N;  3WXM B;  3T1H K;  3FZF A;  4NO7 A;  1LWE A;  4OX9 K;  3HO1 A;  3AVN A;  2FSN A;  4DR1 K;  1OVQ A;  4CFC A;  2EX3 A;  4DSE A;  1JLF A;  1S1U A;  1UAX A;  4BRK A;  2H3G X;  3O3F A;  3KK1 A;  2E2O A;  1JJ2 M;  1RTJ A;  4E3S A;  2FF3 B;  2J4R A;  3CC7 N;  4OPA A;  4JK7 A;  4CGH A;  3TAF A;  1EP4 A;  3VQ7 A;  3AA4 A;  2ZJQ L;  3HP9 A;  3I0R A;  3VPZ A;  5LMU K;  4FJ9 A;  4FLW A;  2HB5 A;  4RW9 A;  3ZSR A;  1KXP A;  1QQM A;  5AJ3 K;  1ATR A;  4I9L A;  2GUP A;  2HMI A;  1QZ5 A;  2DFH A;  3CME N;  4J2A A;  2E8A A;  2NRV A;  4F2S A;  3LM2 A;  1T7P A;  2XHB A;  4NLB A;  5CZ1 A;  4B1W B;  4CJQ A;  3K2P A;  1YI2 N;  4PKI A;  1RDA A;  3RTV A;  1BIZ A;  2ZQB A;  1T6D A;  5DM7 L;  4BRE A;  4K25 A;  1RBT A;  5HRO A;  4HVJ A;  1TKD A;  3O1B A;  2W42 A;  3QEI A;  2BGG A;  4AHT A;  1KSP A;  1YJN N;  3D2E B;  3E9O A;  1NJZ A;  5GAE P;  4NXN K;  4CFB A;  4YOX A;  2FBV A;  3O9Q A;  1XC3 A;  1S1T A;  1VRU A;  4QAG A;  2GWJ A;  2NLX A;  3SK3 A;  5KI6 A;  5B8H A;  3W0L A;  4AIL C;  2Z1G A;  4EP5 A;  4DV3 K;  1KAY A;  1KLN A;  5H1S Q;  3WXI A;  5C25 A;  1WLJ A;  3VF2 A;  2D0C A;  1JCF A;  3KLF A;  4JEP A;  3K5N A;  1Q9X A;  1ZBH A;  5HBM A;  4DQI A;  4UY8 O;  5EOY A;  3VEW A;  1HQU A;  3KKR A;  3LZI A;  3AV9 A;  1XHX A;  4RW8 A;  3OHR A;  1C0F A;  4H5V A;  4JI5 K;  3KTQ A;  1KFS A;  4CGJ A;  3DM2 A;  3CCM N;  4KHS A;  4DV1 K;  1GLL O;  4C8N A;  4A57 A;  3K5M A;  3BZC A;  3OS0 A;  1LAV A;  2R7Y A;  2RHK A;  1SL1 A;  3KJV A;  3TAN A;  1HKG A;  3CFR A;  3PUF A;  1XC9 A;  2E6L A;  3DLE A;  4JRQ A;  4JNE A;  4DTN A;  5CR4 A;  4FZZ A;  5BPM A;  1SZ2 A;  4MO5 A;  5FPD A;  4FVU A;  1RDC A;  1T6C A;  1BG3 A;  3GDQ A;  5AQX A;  5AQZ A;  3SQ0 A;  3OYN A;  1NK7 A;  4XIU A;  1I39 A;  5AQI A;  2Z1I A;  5FRN A;  1NGJ A;  5A2Q O;  4OO1 J;  1GLE G;  1X3N A;  4B3M K;  1RT3 A;  3A5L C;  4DSJ A;  3VEZ A;  2D0O A;  4DLG A;  4NYF A;  1QE1 A;  2QW9 A;  3FZM A;  4L3Q A;  5KRT A;  5DM6 L;  4WQ4 C;  2W6K A;  3G71 N;  3AVH A;  3D2F A;  5EX5 A;  5SZT A;  3QER A;  4RW7 A;  3H46 O;  3SAH A;  1VSF A;  4FJ7 A;  5LJV A;  3TAG A;  1HYZ A;  4YOR A;  4J2D A;  5BR8 K;  5AQW A;  1K73 O;  3QFP A;  2G8F A;  3QEV A;  1W0H A;  1TVR A;  3CM5 A;  1R59 O;  3A8Y A;  4O44 A;  4BRO A;  2HVH A;  3NH2 A;  2XRI A;  2A3Z A;  3OYB A;  3PO5 A;  5M1P A;  1N33 K;  1JLB A;  3M8Q A;  3MK6 A;  4I2Q A;  4Z4C A;  5C12 A;  3NFA A;  1L3T A;  1GLD G;  4R5P A;  1L3V A;  1XMO K;  4IOA L;  1JLG A;  1REV A;  2WTU A;  5FPM A;  4CJ5 A;  2Z1H A;  3AVK A;  4BRI A;  4CJT A;  4YNQ A;  1W2B M;  4CEA A;  2PYJ A;  5FDL A;  2O8D B;  2EWS A;  4BE0 A;  2Q1N A;  1LV5 A;  4IJN A;  1RT7 A;  2G8U A;  1ESV A;  4CFD A;  1RDB A;  4KH4 A;  3CCU N;  4DV4 K;  4DTS A;  4O8K A;  3V9Z A;  4CFA A;  4YDU A;  5I42 A;  5AFU A;  2HHQ A;  3VQ4 A;  3ZSO A;  1NGA A;  1DTT A;  5E84 A;  1CZB A;  1MU2 A;  4FYD A;  4WQ5 A;  3T19 A;  3WXL A;  3OTO K;  1JL2 A;  2D5R A;  3K9J A;  3H6E A;  1HKB A;  3JAM O;  5C0Y A;  5JLF A;  4CJ4 A;  3RWU A;  5HLF A;  4A2B A;  1B9D A;  2E20 A;  4JK9 A;  2XO7 A;  3KZB A;  1TAQ A;  5HRN A;  1VQP N;  3T1A A;  3LM9 A;  5AQL A;  4DV2 K;  2G8H A;  4MFB A;  1DLO A;  4H0O A;  4BDY A;  2Q3S A;  3DWL A;  4B3S K;  4FWL A;  4CE9 A;  1IKY A;  4FK4 A;  4B1Y B;  1E4G T;  4ELT A;  3T69 A;  1OH7 A;  3NGZ A;  3DLK A;  2HBM A;  4F3T A;  3C6T A;  4DHY A;  1VSI A;  1Q81 O;  1D9F A;  5BPL A;  3UE5 A;  2A5X A;  3V4I A;  4JKB A;  1LAW A;  3SUO A;  3O3G A;  3EKS A;  4LF5 K;  1RCH A;  2BTF A;  3CCL N;  5LY3 A;  4PA1 A;  1KRP A;  3MED A;  3T7Z A;  1YXQ A;  3DXM A;  3AVL A;  3DOL A;  4BGB A;  4BRN A;  4M3Y A;  4BC2 A;  4LH4 A;  1LWF A;  3WNF A;  1LWC A;  3DAW A;  4Q5V A;  3SV4 A;  1D8Y A;  3CCE N;  3L2W A;  2Q31 A;  2ZE2 A;  5KPR A;  3VQC A;  1MDU B;  4ISF A;  4CF2 A;  4U7B A;  3CD6 N;  5GAD P;  4M3R A;  4M3T A;  4IO8 A;  4KV8 A;  4HUF A;  4CF0 A;  3TTC A;  2I7P A;  1KLM A;  2E6M A;  5EY4 A;  4KTW A;  3TTD A;  1X1P A;  4B9Q A;  5C15 A;  1J5O A;  4KB0 A;  5AQU A;  1YF5 L;  3P31 A;  3LDS A;  5AQJ A;  2F9W A;  3E9L A;  1Q7Y O;  4PL8 A;  3NHG A;  2G8V A;  3PX0 A;  1OH8 A;  5J2N A;  3AVC A;  3OVN A;  1RTH A;  4FCY A;  4KHY A;  3RMD A;  5ADX H;  3QBX A;  4OKK A;  4KBO A;  1X9M A;  3L6Q A;  2P5G A;  3V9X A;  1HNZ K;  3AAR A;  3NBP A;  2HMP A;  4O0J A;  1NKB A;  1TKZ A;  1BL3 A;  1HQE A;  3EL2 A;  3RSE B;  4H5W A;  3VQ5 A;  4FM0 A;  3SBT A;  1BCO A;  3E1Y A;  4PL7 A;  3O4W A;  5FPN A;  3RMB A;  4DR7 K;  4M45 A;  2HST A;  3RRH A;  1NNE A;  2O8F B;  2QWL A;  4KB1 A;  4JKG B;  3UKR A;  3QML A;  2HHW A;  4FWO A;  3V6D A;  4RCH A;  4CF9 A;  4OGE A;  5SWM A;  2ZM6 K;  2D0B A;  3AY9 A;  1G15 A;  4FSV A;  1VQM N;  3O9T A;  4FXD A;  4KFB A;  1TL1 A;  1UOC A;  3GG4 A;  4LSN A;  3VQ8 A;  4YOT A;  1TK8 A;  4K43 A;  4B1Z A;  3OYH A;  2PY5 A;  4O8U A;  3VTI A;  3NE6 A;  4EZ6 A;  4IDK A;  4EZ9 A;  4IFE A;  3M8R A;  3V9S A;  1S5J A;  2OCE A;  2KZM A;  4KI4 A;  1QVF M;  3P83 D;  2UUA K;  4W5O A;  2ZJP L;  4U67 L;  1XQS C;  3LL3 A;  3K57 A;  2OPQ A;  4MDB A;  4CHQ A;  2VQF K;  3AVJ A;  4OJR A;  4OPK A;  2RKI A;  4FWP A;  4OKJ A;  3I0S A;  1LOT B;  4DLE A;  2AA4 A;  3O9S A;  4ZHR A;  4HWI A;  4W5R A;  2BDP A;  3VGM A;  4B9U A;  1X9J A;  2XY6 A;  1NK4 A;  3IUC A;  5C24 A;  3NVM A;  3DLL L;  4LF8 K;  1S1W A;  1RDW X;  4F9O A;  2YHA A;  3U6F A;  4FK0 A;  2P9N A;  3H1V X;  1T03 A;  4CED A;  3AAQ A;  4C23 A;  2B4J A;  2YHW A;  1C1B A;  4OKE A;  1YJ9 N;  1IV0 A;  3OW2 M;  3HP6 A;  1H1V A;  3D0P A;  4JKF A;  3PLA A;  2ZJR L;  3VES A;  3ZET B;  1JCE A;  3LZJ A;  2OPS A;  3HYF A;  2EHG A;  3CMA N;  4GV3 A;  2HF3 A;  2RE2 A;  3SUQ A;  1ASW A;  2GWK A;  1RIL A;  4O5B A;  2UUC K;  4BC5 A;  3CQ8 A;  1NGD A;  2JGU A;  2QWO A;  1IJJ A;  2OPP A;  1BUP A;  4CGI A;  4GV9 A;  5AQN A;  3LP2 A;  1BGX T;  5C10 A;  2JLE A;  3HM8 A;  1OH6 A;  4I9Q A;  3CJ9 A;  5CZ2 A;  1FKO A;  1CZ9 A;  2ZF5 O;  3MN5 A;  5M1N A;  4B3T K;  4I2P A;  1TYQ A;  1BA1 A;  4GNI A;  2BAN A;  3HI0 A;  3IRX A;  3VEY A;  3VA3 A;  2CGL A;  2FXU A;  4TSX A;  5I9E B;  2CH6 A;  3MX2 A;  3LP0 A;  1QSY A;  3A5M C;  4IWV A;  1YIT N;  4Z4G A;  5TKW A;  4GY2 B;  1KFD A;  3VGL A;  4YOU A;  4I6M B;  1LW0 A;  4CJ7 A;  1U49 A;  4FWM A;  4KH5 A;  4FOI A;  5AZJ A;  3VEX A;  3MEG A;  4M3W A;  3THW B;  4JK8 A;  2ASM A;  3ITH A;  1VQK N;  1RTD A;  3D45 A;  1CXU A;  4NCG A;  2YNI A;  2O4I A;  3CI5 A;  2BUP A;  2P51 A;  1JLQ A;  4IEE A;  3SCX A;  3BZK A;  3ZX3 A;  1ZC6 A;  2VG5 A;  5AQV A;  3QEX A;  4N76 A;  2HF4 A;  4BR2 A;  3P39 A;  3TAE A;  4HCB A;  2HHU A;  1DGK N;  3LAM A;  2UU9 K;  4DV5 K;  1Q8I A;  3O08 A;  1JCG A;  3OYJ A;  4IKF A;  1S1V A;  1D4X A;  1N34 K;  4IOC L;  3ZEU A;  4JS5 A;  3DLR A;  3ULE B;  2OYQ A;  5LJW A;  4YFU A;  3D2E A;  3M1F A;  1N5Y A;  1TGO A;  4CBU A;  4B1U B;  5LL6 Z;  3LPT A;  1C1A A;  3D6R A;  5JMV A;  4M3Z A;  4DR4 K;  5BN8 A;  1VSM A;  2QXL A;  4LF7 K;  3A0I X;  3TSU A;  4CJK A;  4C8L A;  3K9K A;  2YNH A; 
#chains in the Genus database with same CATH homology
 3P4I A;  5CR4 A;  2NRH A;  3E66 A;  5BPM A;  1XUP O;  1NMD A;  1SZ2 A;  3B8A X;  4MO5 A;  5FPD A;  1VQ4 N;  4FVU A;  3SMS A;  1T6C A;  1BG3 A;  3MWT A;  3GDQ A;  5AQX A;  5AQZ A;  3UB5 A;  4CZF A;  3D7E O;  3QDK A;  4AM7 A;  3MN6 A;  1HJO A;  4C1N K;  1BWF O;  1VQ8 N;  2WFB A;  4HTL A;  4QS7 A;  5AQI A;  5JVG L;  1NGJ A;  3HOT A;  5AQY A;  4BRG A;  4OO1 J;  3VOV A;  2BH1 A;  1GLE G;  1X3N A;  4LC9 B;  3A5L C;  4A5B A;  3VEZ A;  2D0O A;  2P9P B;  3ULE A;  2WUS A;  2FSK A;  2D0P A;  4CZM A;  5EVZ A;  3FZM A;  2QW9 A;  4L3Q A;  5DM6 L;  3WT0 A;  2QWM A;  1X3M A;  3NMU A;  4WQ4 C;  2JWL A;  3G71 N;  3CCR N;  3D2F A;  1ATS A;  5EX5 A;  3ZX0 A;  3M3Z A;  5M1Q A;  3H46 O;  1K8A O;  3CCQ N;  1SAZ A;  2VGN A;  3SAH A;  4JD2 A;  5AQP A;  3S41 A;  2YX6 A;  4QS9 A;  5HL7 L;  4IOX A;  2E2P A;  3E9P A;  4FWQ A;  4GVE A;  5LJV A;  5GIO A;  2KLA A;  5C2D A;  3VTH A;  2WC9 A;  4FPA A;  4DB3 A;  3SMP A;  1LCU A;  2HBL A;  4YOR A;  4R79 A;  5BRH A;  2GEM A;  4BGA A;  3WQT A;  2V51 B;  4H0T B;  3U9D A;  4CBW A;  4IO9 L;  5AQW A;  3G25 A;  4BRD A;  1K73 O;  3QFP A;  3CXC M;  3CCS N;  3H1Q A;  2CGJ A;  3CF5 L;  4XEI A;  3A8Y A;  1R59 O;  4BRO A;  1NGF A;  2E1Y A;  3LDL A;  4NLC A;  2QWP A;  1V4S A;  5AFU H;  2A3Z A;  4BR4 A;  2ZGZ A;  1J6Z A;  2GX9 A;  5M1P A;  5AZI A;  4RWT A;  1EO1 A;  2P9L B;  3MK6 A;  1Z05 A;  5C12 A;  1GLD G;  4IOA L;  3R3L A;  3ZYY X;  2DPN A;  3ZET A;  1DEJ A;  1DT9 A;  3VF4 A;  4FL9 A;  4EIA A;  2OTL N;  1MWK A;  5FPM A;  1RGI A;  2GTD A;  1KD1 O;  4BRI A;  4CZE A;  3VET A;  2QEX N;  2GEL A;  3ENB A;  4JHD B;  1W2B M;  3DXK A;  3N4Q A;  3R9P A;  2EWS A;  3FE1 A;  3I56 N;  2NNW A;  1W97 L;  2Q1N A;  3IDH A;  3HZ6 A;  4IJN A;  1S22 A;  5JVH L;  1ESV A;  3WQU A;  3F9M A;  3MN9 A;  3IFR A;  3MN7 A;  4BRA A;  4KH4 A;  4JKE A;  1NGE A;  5FPE A;  3CCU N;  4Y0W A;  3OA9 A;  4DCH A;  4O8K A;  4YDU A;  5AFU A;  4EAH D;  5F1X A;  1NGA A;  1NGC A;  3CC2 N;  5E84 A;  2AP1 A;  1P90 A;  4WCE L;  1GLA G;  3O9U A;  1Q82 O;  4IZ9 A;  3R1X A;  1KQS M;  2P9S B;  4WQ5 A;  1M1K O;  2V52 B;  4H0V B;  3KK7 A;  3WXL A;  2V7Y A;  5AQG A;  5HOO A;  3K9J A;  1KC8 O;  1ILY A;  3BF3 A;  3H6E A;  5JLH A;  2YCH A;  3CET A;  1HKB A;  3AAP A;  5C0Y A;  1WUA A;  5JLF A;  1GLC G;  4A2B A;  3N4P A;  4PKH A;  1NWK A;  2E20 A;  3CJ1 A;  4JK9 A;  4GV6 A;  3KZB A;  3EO3 A;  3DXM B;  1VQP N;  4AF1 A;  1BU6 O;  4MLE A;  4YDU C;  3I55 N;  1YIJ N;  4H0X B;  3LM9 A;  3KWI A;  5AQL A;  3C65 A;  3FFK B;  4CBX A;  1U2V A;  1T3V A;  5M1K A;  4KH6 A;  4JHD A;  3FLC O;  1YAG A;  4ISE A;  4H0O A;  3VER A;  5KQD A;  5CE3 A;  4WQ5 C;  3DWL A;  4I6M A;  4WYB A;  3C7N A;  4H0Y B;  4FWL A;  3GOI A;  2QM1 A;  5AQT A;  1QHA A;  1NM1 A;  2NRR A;  1Q86 O;  1G99 A;  4BG8 A;  4B1Y B;  3VMF B;  1E4G T;  3CPW M;  4FWN A;  3T69 A;  1EQY A;  4A62 A;  4BRM A;  1OKJ A;  2KKZ A;  2P9U B;  2HBM A;  4BRC A;  5BN9 A;  3EKU A;  2ZGY A;  4DHY A;  4BR9 A;  1YJW N;  3HOS A;  4JKA A;  3QB0 A;  1Q81 O;  3BUZ B;  5BPL A;  2P9S A;  3UE5 A;  3M5R A;  5BPN A;  2A5X A;  4FOE A;  2PAV A;  4O5F A;  2ITM A;  4JKB A;  2KHO A;  3TPQ A;  4YOW A;  4IJA A;  1GLJ O;  4MDA A;  3EKS A;  3WXJ A;  3U8X A;  2P9I B;  2BTF A;  3CCL N;  2E1Z A;  3U4L A;  5LY3 A;  2E2Q A;  1CZA N;  3O6W A;  4CZL A;  1QZ6 A;  4A59 A;  4CZJ A;  3T7Z A;  1YXQ A;  2A41 A;  5AQH A;  3QFU A;  3DXM A;  4J8F A;  4WFB L;  1VQN N;  1KAZ A;  1BA0 A;  4ILJ A;  4BGB A;  4K42 A;  3MWP A;  3H45 C;  1SQK A;  3CJB A;  3J8A A;  4BRN A;  2YJF A;  3F2K A;  4BC2 A;  1ZXO A;  3GE1 A;  2P9K B;  1TYQ B;  2VGM A;  3VGK A;  2Q36 A;  3DAW A;  3L0Q A;  2FLO A;  2QWQ A;  3O9R A;  5BRF A;  3CCE N;  1P8Z A;  2PBD A;  2Q31 A;  2NRZ A;  5KPR A;  4XH5 A;  1MDU B;  4ISF A;  3CPE A;  4U7B A;  3CD6 N;  5GAD P;  3ID8 A;  2OAN A;  4FWK A;  3UKU B;  4IO8 A;  2P9U A;  3TTC A;  4FWS A;  1NGB A;  2I7P A;  3KVG A;  3O80 A;  3TTD A;  5EY4 A;  4EHT A;  4B9Q A;  4ILH A;  2YJE A;  5C15 A;  5AQU A;  1YF5 L;  3P31 A;  1O13 A;  2Q0R A;  3UKR B;  4JN4 A;  4G9Z A;  5AQJ A;  4BR5 A;  3TTF A;  2F9W A;  3HRG A;  5AZJ B;  3E9L A;  3EE8 A;  1Q7Y O;  5AQR A;  1RFQ A;  2P9I A;  3BP8 A;  5EXW A;  4PL8 A;  4FO0 A;  4JKH A;  2YI1 A;  4DKW A;  3ENH A;  2D1K A;  2VYP A;  2I7N A;  3O8M A;  2IVP A;  3F5T A;  5ADX H;  3QBX A;  2CH5 A;  4KBO A;  2ZWH A;  3FZL A;  3L6Q A;  5JIC A;  3QIC A;  4BG9 A;  2P9P A;  4H0P A;  3GL1 A;  1NGG A;  3AAR A;  3CJA A;  3EZW A;  2P9K A;  3A5O C;  2HMP A;  3I8B A;  2A6A A;  4B1X B;  2QWR A;  5GAG P;  3MCP A;  4YOV A;  1HUX A;  2VWB A;  3U9Z A;  3Q7C A;  3VF6 A;  1QVG M;  2IVO A;  3EL2 A;  4M7Y A;  3RSE B;  4H5W A;  5M1F A;  3MMV A;  4NB4 A;  2QTD A;  3MDQ A;  3SBT A;  3M6G A;  3NVK A;  3E1Y A;  4IDH A;  4PL7 A;  3O4W A;  5FPN A;  3VEV A;  3ZEU B;  4EHU A;  2HST A;  3UKU A;  4JAX A;  2IVN A;  4A61 A;  1BOT O;  1TUU A;  3O5B A;  2QWL A;  2A40 A;  3W3D A;  5ADX A;  4IXC A;  4BRH A;  4JKG B;  3CJ7 A;  3FR0 A;  3C0B A;  3CIP A;  3Q7B A;  3QML A;  3UKR A;  4BRP A;  1GLB G;  3C6H A;  3SAF A;  1RDU A;  4FWO A;  4M63 C;  4BR7 A;  4BQZ A;  4RCH A;  1QQN A;  4M7X A;  3A5N C;  1V4T A;  3CQY A;  1NGH A;  2P9L A;  3AY9 A;  4CD3 A;  4FSV A;  3WEE B;  2E2N A;  1VQM N;  1K8K B;  4AM6 A;  1NBW A;  1Y64 A;  3O9T A;  4PHT X;  1YHQ N;  2Q0U A;  2P9N B;  3QBW A;  1GLF O;  3CCV N;  2NZT A;  3GG4 A;  4BRQ A;  3LDP A;  3WUH A;  2D4W A;  3H3O B;  4YOT A;  4K43 A;  4A2A A;  4B1Z A;  4O8U A;  3VTI A;  1SS6 A;  3EE9 A;  3DJC A;  5AQQ A;  3MX5 A;  3HSC A;  3OBW A;  2YHX A;  4A5A A;  4IFE A;  5MLC Q;  3RSE A;  1QVF M;  3VEO A;  4ISG A;  3WXK A;  2ZJP L;  4U67 L;  5CHI A;  1XQS C;  4BRF A;  2ASO A;  4ILG B;  3LL3 A;  4MDB A;  2FF6 A;  3TU5 A;  3KHY A;  3SAG A;  4Z94 A;  4FWP A;  4WF9 L;  1LOT B;  4MLH A;  2AA4 A;  3O9S A;  3TSP A;  3ZX2 A;  5KPZ A;  1BO5 O;  4HWI A;  1TUY A;  3R6M A;  5BRD A;  1WOQ A;  1NGI A;  4JKG A;  3VGM A;  4BVP A;  5E26 A;  3VEN A;  4YOY A;  4K41 A;  1X9J A;  3HBT A;  2Q2R A;  3IUC A;  3NVM A;  3CJC A;  2FSJ A;  3DLL L;  1KAX A;  3BF1 A;  4QS8 A;  2W41 A;  1RDW X;  4F9O A;  2E88 A;  2QWN A;  3WEE A;  1K8K A;  4CZG A;  1E4F T;  5C2F A;  2OTJ N;  4PKG A;  5BRE A;  1DKG D;  3WXM B;  2P9N A;  3H1V X;  4DQ8 A;  3FZF A;  4NO7 A;  3R8E A;  3G4S N;  3CC4 N;  3AAQ A;  1MA9 B;  4C23 A;  2YHW A;  1HPM A;  4E1J A;  2FSN A;  4H03 B;  1YJ9 N;  3TSQ A;  3AGR A;  1VAZ A;  4CZK A;  3OW2 M;  5AZI B;  4BY9 C;  1H1V A;  5AQS A;  4JKF A;  3PLA A;  2ZJR L;  1VQL N;  3ATU A;  1VQO N;  4BRK A;  5TKY A;  2H3G X;  3EN9 A;  3VES A;  1S72 N;  3CHW A;  3ZET B;  1JCE A;  4B1V A;  5KPT A;  2E2O A;  1JJ2 M;  4MO4 A;  3J7Z O;  3RVC A;  3CMA N;  2YHY A;  1BDG A;  4GV3 A;  2HF3 A;  3G6E N;  1M90 O;  2FF3 B;  2J4R A;  2RE2 A;  3CC7 N;  5ELZ A;  4OPA A;  4JK7 A;  3L4I A;  3DXK B;  2GWK A;  2Q97 A;  4IEI A;  5F2R A;  2ZJQ L;  2NRW A;  3VPZ A;  4BC5 A;  1NGD A;  5GAH P;  5AQM A;  2QWO A;  3SJH A;  1IJJ A;  1KXP A;  1QQM A;  3CER A;  2QA4 N;  1ATR A;  1IG8 A;  2ASP A;  1HKC A;  1BUP A;  1QQO A;  4H5T A;  1Q18 A;  4WFN L;  2GUP A;  4BC3 A;  4GV9 A;  5AQN A;  5C10 A;  1QZ5 A;  1YUW A;  3CME N;  2E8A A;  5AQO A;  1VQ7 N;  2NRV A;  3LM2 A;  5M1O A;  3HM8 A;  1VQ6 N;  4NLB A;  4BRL A;  4BR0 A;  3CJ9 A;  4B1W B;  4XH1 A;  4CI6 A;  2VCP A;  2ZF5 O;  1N8R O;  5M1N A;  3MN5 A;  2F7T A;  1YI2 N;  4PKI A;  1TYQ A;  1BA1 A;  2F9T A;  4H5N A;  1VQ5 N;  4GNI A;  3HI0 A;  3VEY A;  1T6D A;  5DM7 L;  2CGL A;  4K25 A;  4BRE A;  1MWM A;  2FXU A;  3SBG A;  4FPB A;  5GIN A;  3L4Q A;  3O1B A;  5I9E B;  2IIR A;  1ZBS A;  1NJI O;  2CH6 A;  3MX2 A;  2V7Z A;  3A5M C;  4BC4 A;  5F0X A;  4IWV A;  1YIT N;  3P38 A;  1U2V B;  5AR0 A;  3D2E B;  1YJN N;  3E9O A;  5GAE P;  3H3N O;  4XH4 A;  4GY2 B;  5TKW A;  1OVY A;  4YOX A;  3VGL A;  4YOU A;  4I6M B;  3O9Q A;  3C7N B;  1XC3 A;  1Z6R A;  4CJ7 A;  5GIP A;  4FWM A;  3HTV A;  4KH5 A;  4FOI A;  5AZJ A;  3OBY A;  3VEX A;  2GWJ A;  3O1W A;  2QI2 A;  2NLX A;  2HOE A;  1ATN A;  2NRX A;  4H5R A;  4JK8 A;  5KQ8 A;  1S3X A;  2ASM A;  1VQK N;  2WBN A;  3SK3 A;  5B8H A;  3W0L A;  3ENO A;  3JS6 A;  3CI5 A;  4EFH A;  2BUP A;  1KAY A;  3MCA B;  5H1S Q;  2JWK A;  3WXI A;  2PFU A;  3I33 A;  4IEE A;  4WFA L;  1K9M O;  3ID6 A;  1C0G A;  2NRT A;  3VF2 A;  3ZX3 A;  1ZC6 A;  1JCF A;  5AQV A;  1HX1 A;  3C6A A;  2HBJ A;  1U6Z A;  2HF4 A;  4BR2 A;  2HBK A;  4JEP A;  3P39 A;  1DGK N;  2CGK A;  3IKM A;  5AQF A;  2W40 A;  3O08 A;  1JCG A;  4UY8 O;  5EOY A;  3VEW A;  3PIP L;  1D4X A;  3FGU A;  4BQL A;  3ZEU A;  3PIO L;  4IOC L;  1T44 A;  1YVN A;  3OHR A;  1C0F A;  3KWG A;  1VQ9 N;  3ULE B;  3AGK A;  3ATV A;  2A42 A;  4H5V A;  4OPH A;  5AQK A;  3D2E A;  3M1F A;  3FZK A;  5LJW A;  4CBU A;  3CCM N;  3FZH A;  3LDN A;  4B1U B;  4C1N I;  1NLV A;  3D2F B;  3D6R A;  4RTF D;  5JMV A;  2UYT A;  4BVO A;  4CD1 A;  3GBT A;  3LDO A;  1GLL O;  4JKC A;  4A57 A;  5BN8 A;  4FWR A;  2QXL A;  4JD2 B;  2RHK A;  3CCJ N;  4CZH A;  1HKG A;  4CZI A;  3CQX A;  1HLU A;  3LDQ A;  4JKD A;  3A0I X;  3TSU A;  3IMX A;  3SLC A;  3BEX A;  3K9K A;  4JNE A;  3JXU A;  4WQ4 A;  5BR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...