4Y19B

Immune complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
192
structure length
184
Chain Sequence
SGDTRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGVGESFTVQRRVYPEVTVYPANLLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSLTSPLTVEWRAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title T cell receptor reversed polarity recognition of a self-antigen major histocompatibility complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
total genus 44
structure length 184
sequence length 192
ec nomenclature
pdb deposition date 2015-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y19B02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4y19B01
4G7YH 4ZXBA 1JGUL 4JQVC 2NTFA 3SCMA 1NUFA 5GISH 4R9HA 2XY1A 1J8HB 4ELMA 3IT8D 4X5LA 3BGMA 4DUWA 3B9KD 4YQXL 3D25A 4C55A 3X3FH 4PJCE 3QUZC 3KPMB 1YEEL 2A6DB 4FNLH 4RISL 4JRYE 3WHE0 1TCRA 5C1MB 3W39A 3KG5A 3QDAA 4R7NA 4U1GB 5L2KA 4MSWB 2P5ED 3MRGB 1NDGA 2ZUTA 1RFDH 2HVKB 1LE9B 5JPMB 2LQRA 1CL7H 4FFWD 4PRDB 3CU7A 2VUOA 1YECH 3KJ4B 4KK9C 4EN3C 3WDIA 3E2HC 4NN7C 2QADD 5DZNA 3U36B 4RDQF 1RU9H 5I8OL 3TZVC 3NCBB 2X89D 4UDTB 1CICC 2R1WB 2RIKA 3DVNB 4P2CG 3W9DA 3MV11 5CZXC 2E9IA 4Y2DC 2GSGB 4Y1AE 1WICA 1T20B 2COQA 2BHUA 4R2GB 4DN4L 5C0FA 3QZWG 4PJ5B 1WK0A 3Q6GL 4YR6B 3GRWH 1NCDL 3LB6D 4QHKJ 2FJGA 1EBAA 1N3NA 5GS2D 3T04D 3TP4A 1AC0A 2YR3A 3HE6D 1UCBH 1DBAL 1BZ7A 4FQ1L 4MQXD 1HYSD 4F15C 1NMBL 1UM4L 4R3SB 4G3YL 5HY9A 1Q9WB 3LKNB 3JV4A 5SWSE 4NNXA 1JZ4A 3B9VA 3CVHH 3TO2B 5FAAA 4U1NB 3EYQC 3AU1B 3NFSH 3FRUB 4LAQL 4GUPB 3FJTA 4J12A 5CWSB 5DJ6A 1WZ1L 3TT3L 3ZKND 5GSVB 4AYFA 1QR4A 4WTZG 1U92B 4YHKL 2DQHL 1XIWD 2UZXB 3BD3A 1PY4A 3GMLA 5FYJD 3UO1L 1H3WM 3AS1A 1JWUB 4EQ3A 2W91A 2BRQA 5CEXA 2WIIB 4PJAA 5CCKH 2GAZA 4PJIA 1IEBA 4AENB 4HSQA 4J4PC 1IQDA 1A6TB 3HRZB 2F54A 4JG1L 4U1IB 5ERWB 1AE6L 4XVJH 2A1WH 1FBIL 2NXYC 3NPSC 1BZ9A 2AVGA 5IVXB 3BQUA 4D2NA 1DLFL 3VH8G 3WIHA 7CGTA 1D5MB 5E8DH 3VGAC 3GZKA 1LO0L 2ATKB 2GW5A 5E95B 4IOIA 3PHQA 4OCSH 2X89A 3ARFC 5HHMD 2AJVL 4PB9H 1KPVB 1H5BB 2AGJL 4LU5L 4TQEL 5FGCE 2G60H 2VXUL 2X09A 1HK6A 3GSRA 4TVPH 4M9OA 3JWDH 3RL1B 4AT6B 4M8QA 4WDIB 3QFJA 4NHCH 4OCNC 1N6QH 3U9UA 3ET9F 5KZCB 1VEOA 2Q7NA 5JOFA 2A74B 4WFED 4KRPD 1LEKA 3W2DL 4G8GD 35C8L 1UACH 4LDOB 3BZEB 5JIPA 3ILQD 5C8JB 1NKOA 1I1FB 1YJDH 1Z9SA 4NCDA 6CGTA 5IQ7H 3VD9A 4FXKA 2V9QA 1F58H 5GRVK 2VQTA 4PRHE 1OGAA 2I27N 1UZ6E 2UYLB 2BVOA 2KL6A 1WBYB 1B0GB 1Z0NA 1VFMA 1WWBX 2BNRB 2VDNH 5MEND 2XYCA 4JZJB 1CZ8L 4U33A 4M6AA 2NY2D 3SOBL 1R5IA 1DLHA 1JRHL 1NDMB 2Y7QA 4PRIE 4S0TD 3WFDH 1BQSA 2A77L 5C0JA 1NCWH 1OAYH 3PHSA 2F58L 1ZWIA 1RPQA 3KPRD 1ZVSA 2RAMA 2IADA 4YDIL 4EEEA 4GT7A 4P2RA 5JZ7C 5E2JA 3QBTB 2GJJA 5FGRA 3RNQB 1CIUA 2YOCA 4PJEE 4BZ1H 1K2DB 3DX8B 2G5BA 4NKDA 5FYLL 1J0JA 1JN6A 5I75C 1YQVH 4U1KB 2EXWC 1NAMB 3BHBA 2O61B 5I8OH 1PX4A 2C3HA 1AQKH 4M7JL 4HUNB 5I17B 3BPCA 1OL0A 4H88H 2R4RL 5TPWH 3W5MA 4PJGB 5EIIA 3QO1B 5BV7B 2J5LC 5IM7B 4F37K 1SYVB 4QKXB 2I60H 5E4EB 3DLQR 4R90L 25C8H 3FQNB 1ZVSB 3BKML 3F7QA 2GJ6D 3EO1A 5CJQL 2V5YA 1K3ZA 3O3DB 5HHME 4EUPB 3OMZA 5T1DL 3ARRA 1TIUA 4UU9A 5KS9E 5EBMB 1ONQB 4XI5D 1UQSA 2P8LA 4OM1L 3V6BR 4MAYD 3CMOH 1MRDL 2VR4A 1VSCA 4R0LB 3UJJH 1T20A 3AS3A 3QXTA 3UP1A 1CDCA 1A7OL 1CGSH 2C3GA 1MOEA 4NN7B 5M94B 5FUOL 3GUTB 1BD2E 5SWZE 4IRSD 5GGSA 4JPVL 4JR9L 1MWAL 3SY0B 2D7OA 43CAB 1RZKL 2H41A 2BZDA 2CRIA 4S1DD 5EBWB 1NGZB 1Y18A 2CLRA 1DQJA 1I1AC 4Z7QE 2APTA 2PYFB 1KT2B 4OLVH 3VGDA 5JDJA 3KS0H 5BW7C 5HD8C 3DGCR 1PX3A 1VADB 4WU5B 3MRIA 4G42A 2QSQA 5DRXA 1MCJA 3MACH 2VXQL 5IHLB 4P3WA 4GKSB 5TGBB 1D5ZA 3PV7A 4Z0XA 4OZFB 3U7WL 1CDUA 2ZOKB 1N59B 1R3JB 5D8JH 3F7VB 4JO2L 1O5DT 1VFBB 3EIFA 1FPTL 3UDWC 1C8PA 4MLSA 2R2BB 2NY2B 2IG2H 3SEPA 5GIRB 4F7CB 1MREH 5MEQB 1T5XB 5DHVH 3LEYH 3EZJB 4XP1H 1PEZA 2X1WL 3NFPB 3DMMD 5ENWA 2SEBA 2OZ4L 3MRKB 4H26B 3ESUF 1S8DB 3RZWA 1H0DB 3TO4C 3QDMA 2FR4A 1LK3L 1FHGA 5ECJE 5EFIB 5DJ2A 1AXIB 3WEXB 2JCCB 5FF6A 1XGRB 3BRDA 4XMPL 4O2EA 1BIIB 1SYVA 5KZCD 4TTGA 5E2WL 2WBWB 1K4CA 2HWZL 4PRAA 2PTVA 2CK2A 5E03A 2DRUA 2YPVL 2G75B 1T1YB 2EC9U 5CFHA 1CICD 5BS0D 1P6AB 1WFTA 5CZXD 2X1PA 2DTMH 1GPOL 4NQCE 4OM1H 4HLZG 3HMWL 1MIMH 3V4UL 2JJWA 4G9DA 4U1MB 4Y5XA 4J6RH 3GGWB 4LLQA 3O41B 4LCCB 5T3ZD 2H8PA 3OAZK 1S3KH 3OF6D 2WQRA 1RMFH 3NABL 1P9MC 3D2UB 1NANI 4FZ8H 4NPYA 5DI8A 1FZJA 1MRDH 3T0ED 5F9WB 4KWUA 1I4FB 1KCKA 2BVUA 3BDYL 5LQBL 2J6EL 4XCFL 3L5WA 4Q7DA 4WI3A 3VRLE 5A2JH 3S36H 4YDVA 4NNYA 3BZFB 4XVUD 3FN9A 5BRZE 4I0PA 5B22A 3MV7D 3BKMH 1MAMH 3ESVF 3RU8H 5T33L 5ALCH 3J7HA 1NSNL 1KLUA 5FIEA 5C7XL 1XIWC 3RTQB 2X44D 2XWJB 4WY7L 5J1SC 1ZHKA 3AY4C 5K59F 4PJIE 1UWXK 4Z18A 5D7LE 4P5TC 4KTDL 3QDJB 3PJSB 4NQED 4D9QD 2Y36L 4KK5C 1EX0A 5FGSA 5DD5L 2K3TA 2R4SH 3TN0B 2R0KL 4MJIB 4WDIA 3TV3L 3V5KA 3ZE1F 1JV5B 4X0KB 3IAQA 5KOMC 4ZO9A 4YBQC 2X4UA 1NLDH 5AYQA 4KHTH 4M1GL 3L3JA 4MQTB 3LOWA 4X6CA 3O9WA 3SDXB 4YUEH 4XCNB 2GSIA 3RWEB 3MYZA 2E7LC 3NCJH 4NM4H 5DFWH 3RVWC 3PHOA 5C0CB 5HYJA 5FXCH 3G5VA 4XGZA 3VFVB 5E99L 4RZCA 1EEQA 4PLKC 1OT2A 4Q9RL 3LEVH 1M7IB 4HWNA 3NA9H 3MOAH 2OK0H 2A9MH 2UVFA 1YPZA 5I1JL 4MA8H 4U6XA 1CXLA 2E7BA 3LKOB 4WUKL 2XG4A 3BESR 4FQQA 4JRYB 5DUPL 4HC1A 2Y6SD 5ID0A 1MFAL 2JELH 4JQXC 1CFNA 5D1ZA 1T0MA 2NXZD 2Z31A 3DI2B 3E1F1 4JFOA 2R39A 4JFFA 4TVSa 4JN2A 2VL5A 2BK8A 3BFOA 1J8HE 3V2AR 3O11B 5I8EA 1BVLA 1KJMB 1HHKB 1F8TL 3HRPA 4LLQB 3UJIH 3F7RA 4I4WA 3V6ZA 4Z78A 1KF9B 1I8LA 3ILPA 5DRNA 5I1GH 4JDTH 3VWJA 1IAMA 4LFHG 2ERJB 3C08L 3IS0X 5F93C 1AY1H 1NBYB 4HEPG 4P46C 3TA3B 5BV7H 5FKPA 4HUVA 4LCUB 3O9WD 4MJID 4KAQH 1PEWA 4NQCD 3DXAB 2YSSA 5JW3L 3KPLB 4NIKB 5E8NB 1LEGB 1CE6B 4JEGB 4XTRD 3HFMH 3S3JA 1FYTD 2HG5A 4TPRL 1J86A 4P2RB 1CGYA 5IMMB 3SJVD 4DVBA 5DA4A 4N0CD 5DMIL 1QLFB 4HLZH 4Q2ZB 4X4XB 5T5FH 3GMMA 3K2UH 1HDMA 1MJ8L 3C6LA 3V6FB 1JGVH 4J3SA 2GCYA 3KR3L 4LFHD 4ZS6D 1CFTB 3BN9D 1YMHA 3RKDC 1KSRA 2P7TA 5HYIA 4JFEB 1F3JA 3Q0HA 3TT3H 2RBLA 3QO0B 2YPKB 1MF2H 1NUGA 5I9QC 3UTTE 3MR9A 3EFDH 4OKVA 1HSAB 1FN4A 1CGVA 5E8OA 3M8OH 3MCKB 1OVZA 1UEMA 2DQEL 3DYPA 4G7VL 4ZUWB 4JFDB 5JDSB 4AIOA 3RGVC 4EXPX 1OAQL 2J2ZA 3OPZL 3X11B 3B2VH 3PQYD 5KANI 3IDNB 1FV1A 4HD9A 3SGEI 3V5DB 2FB4L 1DSFL 1NAKH 5ITFB 2W0FB 4YZFF 3IDIB 5HGBB 3LB6C 3T0BA 4EN3A 1UB5A 2BVQB 4QTIL 3TWCL 1BZ9B 1YEKL 1MJJA 5EU4A 2IBZX 3CJJA 4XWOD 3V52H 5ERWA 2EIDA 3OJDB 3REVB 5ISZD 2B1HL 1HWGB 5GRJH 3B9DA 3UYPA 1GRWA 1E4JA 4P4KA 5DQJB 1A6WL 4XC3H 4BH8B 3VG9B 3EDKA 4MDJA 3QULB 1NJ9A 1HHHA 4APQC 1WUNT 4FNLL 5TFSH 1HQRB 1QFPA 1HSBA 2CRMA 4LCUA 3U4AA 2Z91B 4M7LL 3GMRB 1N6QL 2A9ML 2ZUVA 4L9LA 3PGCB 3MLYH 4L29A 2Z9TA 1CDBA 4X99A 4NZUH 3C5SB 2DDQL 2UVEA 2YRPA 3QQ9C 1OSPL 1OGTB 5AAWA 2Z8SA 1T2QL 4AEIL 1KN2L 1BD2A 1ZS8B 3ARBA 4X98A 5DDHA 3ZSTA 1X44A 2EDDA 1H8OA 3K3QA 4GRWF 3UTZA 4JLRA 1CK0L 1ITBB 1VGKB 2SEBB 1J0KA 3DXAE 3P9WB 4GMTL 3BXNA 3HE7A 4KH2A 4YHOH 4ORGA 3LD8C 2ICEB 4KKCD 1YUHB 1G0YR 4NNPH 4OUUA 4DAGH 2AXGB 2Z8WC 4D9RD 2P5WD 2BVTA 5DHVB 3ROOA 1JTPA 5EDXA 4XNZB 3TF7C 3I3EA 4KRPC 3ARDA 5TE4L 2ZSVB 1I3VA 3ILQC 5HJ3A 1PQZA 2AI0L 1BAFH 3EYOB 4MAYA 3O2DA 4MJ5A 5J56B 2Y5EA 3LKRA 3SCMD 4UTBL 3CVHB 3L3GB 4KGLA 3LSOB 5D7SH 1A6UH 2NR6C 5D9SB 4YK4B 1FFOA 3W39B 3JBG7 1X5HA 3P0VL 1NGXB 2NY7H 5EBLB 3GBMH 3SDAC 2XFXA 4FZ8L 1GIGH 2FX7H 3WFHA 3SO3B 3ARGC 1A9EB 3VWKD 4E41E 3BMVA 4L4VB 1U93B 5C0GB 4Y88A 4RWYL 1D5XA 2FJHB 2D31A 3ULUF 1SMAA 3BH8A 5HHOB 1KG0A 1ACYH 5JZ7D 1OSPH 1U8QB 2OI9C 3W9EB 1RJZB 1P53A 2BNQD 2WSKA 1CFTA 1B90A 1JK8B 4RFEA 4GG6E 1A0QH 1ETZB 3WJJA 4G8IA 4PRNA 5D1QB 3HMXA 4YDKL 5C2BL 2WW8A 3ME0A 1H8NA 4KROC 2GAZB 1P4IH 4PJIB 5HI4D 1J1PL 1KTKE 5L8JB 4CVWA 3VXRE 3PGDA 4JFQA 1JYNA 3DXAD 3IFLL 1SM3L 4PRBA 5IVZB 4OCRH 5CBAB 4UZGA 4JFYA 5F71A 3GI8L 1AR2A 2VLKE 2DL2A 5C0AD 3DIFA 3WD5H 1EUTA 1JP5A 4PJBA 1D9KC 2NCMA 4NOBA 1WWWX 2EEAA 2VMFA 2ZSWA 4PG9B 3MNWB 4OGYH 2NLJA 2FX7L 4WENB 4YR6A 4K3DH 4TRPH 1IEHA 4TULH 1MF2L 1EHNA 1FRGL 5E2VH 4AK1A 4WW2F 3QXVA 3RDTB 3QNXB 4LSPH 4ZFZB 5L2JB 5HY9B 2ARJA 5DR5L 1EFXD 1OB1B 1Q38A 2DI8A 1T0MB 1CBVL 1B4RA 4OFIA 3GB7B 4G6MH 5K9JL 3QUMA 3IFPB 4UNTA 4NQXA 4OZIF 1T5XA 3PDOB 3M8OL 3JWOL 3FB6A 2CIKA 5K9JH 1LNUB 1UM6L 2VRAA 3B3IB 3ZSSA 3DVNA 4JJ5B 1BFOB 1V3MA 3VXRB 1WBZB 1HXYA 5SWSB 2WBKA 4YO0A 1J9CT 1IGFH 3MNVA 3QIWD 1DN2A 5FYLE 4D9LH 1NAMH 2NY1C 4KXZI 2F8XC 3TPUB 2AJSH 1U8JB 4WNQA 3SDXA 1A02N 3G6DH 3HUJB 1G6VK 4IIQA 4OZHB 5L9DL 3PXHA 4N0YL 2FJHA 1OTSC 1GGUA 1DQDL 2YD7A 4N0UE 3T4AA 1LP9F 2O26U 1HHGB 1DQLL 1SM3H 2OQJB 3QNZB 5F3BB 2DTSA 3S97C 2FYYB 1A4JB 2IJ0C 4BQCA 3VRIB 1S7UA 5LGKA 2HLAA 1WZMA 2BSRB 1EXUA 1F13A 4PY7B 3RUGB 1DEDA 4ELME 3QCUH 2EDYA 4M7LH 4QXGH 2DYPA 1RJLA 5MENE 3VI3E 2ITDB 4NSKB 1E6OH 2BVEA 1MCOH 3VD4A 4I48B 3ARUA 3VCLB 4I0PB 3TZVD 3GJEA 4NNYB 4JCMA 4Z76B 4K71B 4ODTH 4X4ZA 2VSDA 4MA7L 4ONGH 2I9TA 3HAEB 4J3VA 1NCAH 1AD0A 1BQLH 2DMCA 4X4XA 3TFKC 5GSVA 1OLLA 4QF1B 3ES6A 2V2XA 3VXSA 4ELMF 1KTDA 5F88B 2YPLB 3TYGH 1D9KA 5JR1L 3UAJC 1YNKH 3SOBH 1W0VA 1INDH 3EUUA 3RRQA 4XH2B 1Q1JL 4HWEL 2Y25A 3QR2A 3MA9H 5T1MB 2QTEA 4DKFH 2B5IC 5KS9B 1QZ1A 4FS0A 5DJ8B 1FVEB 1HILB 2G5BB 1IQWH 4NKDB 1OP5H 3CFKB 4GLRH 1H3PH 2MKWA 5GGSY 5CSBA 1VKXB 2PO6D 3FB8A 2Y23A 1TVBB 3LKSB 1QO3B 2DYPD 3MCLH 5DVNA 2NX5D 3WIFB 4H88L 5E56A 3G9VA 3T65A 1QLRB 2W9LA 3DUSB 1NDMA 1XR8B 1IAOB 1UA6H 1B4JL 5I8CA 4XBPB 5E1AA 4XPBL 2D7TH 4XVTL 4ZUVA 4JM2C 3MYJB 3PWPA 1T22B 3O6ML 3VJ6A 1QACA 5IHUH 4HIHB 4BKLB 5T3XE 1XEDA 3BH8B 4M48H 3REVA 5DD6A 1HEZB 2IMMA 5DUML 2NZ9D 2YKLH 1AI1H 1BFSA 1BQHG 1FBIH 3RVWD 1U3ZA 3DYMA 4S1QL 4G7YL 3HAEH 4MA7H 2X4SA 5EUKA 4ZOAA 4C4KO 1FGVH 3DROB 1J1OH 1DCLA 3W0WD 1X5FA 3X3GH 1EGJL 3MXWL 2XPGA 4URTB 1R6VA 2VDNL 3VXQB 3RAJH 3KNBB 4HAGA 5MP6L 2ZCLL 3NABH 4K94L 5JIHA 2VLJD 1TETL 1XF3A 3BP6B 4Z8FL 1VERA 1CVSC 2DJUA 4GAFB 1MJ7L 1HHIB 3PWPE 2HT2D 5EU6D 1WQVT 4NYLB 3MOQA 5I30L 3UBXA 2YMXL 4FQ2H 3LN9A 3IAGC 1G9EA 3VFSA 5J13C 5D5MF 5BZWA 2GTWA 3LAFA 1I7TB 3HE7C 4UIKL 3GKWH 1FLTX 3VXME 3MBEA 5I76A 1KN4H 4Y4FB 4P48A 1AGDB 2CH8A 4RA3A 1I7UA 3IKCB 4ELKB 1O0VA 4CVZB 4BSWA 3UTTB 2VQ1B 4G43B 3PWPD 2C7UB 5KN5A 1BBJA 1DSFH 1NAKL 2FB4H 1ZEAH 3T65B 2ID5A 3RGVA 3SHSA 3LEVL 4ZAKC 4WEUD 5CZVH 2YS4A 3IRPX 1KEMH 4JHAL 3N06B 1H15A 2IEPA 4PGBB 3C5ZA 3EOYG 3ZTJH 4XPHH 5KSBE 5BVPL 3ZE2E 3SO3C 5IW6B 3I84A 2CUIA 4LSUH 3P73A 3L7FB 4B7IA 2E5EA 1KOAA 2OL3A 4M3JA 3BPCB 4V1DE 4X4MA 3QXWA 1H3VA 3B9AA 1CXKA 4BJLA 2ED9A 1BBJB 1RZ7H 4RGNE 5SX4I 1UGNA 4DGIH 4S11A 2J1KA 4XB7A 4Z5RA 4MCYA 3FN0L 5C09D 3LKOA 1JNLL 4L4JA 5T1KD 2ENYA 4LARL 1S9YA 2Z4QB 1ZA6B 3RVTC 4ZPTA 1JMXA 3WN5A 4RZCB 2IGFL 4P2RD 4YHLH 4TPRH 5IUSA 2AERT 2IPUG 4L8DB 4DKEH 2L0DA 4JFPA 1UADC 1L7IL 4X7SH 5JW3H 4OZFH 5K9KA 4NQSA 1GC1C 3KPSD 1NDGB 3LH2L 4L8BA 5MEPA 1TVHB 4OGYL 4PJ5E 2VZ3A 3O45A 4L4TE 4OSUH 2WUBL 4QRPB 5DJ0A 4ZPVA 1A9EA 1RU9L 5C08B 4D0CA 1I1AD 1I7ZA 3QFDA 4PIRF 4D94A 3QIWB 5H8DA 1QA9B 3GM0A 4RQQA 1A6AA 3HCVB 3WHXA 1KELL 1RZKC 3EYQD 1FDLH 2BY1A 2VDLL 3C9NB 3SQOH 4KUCD 5AD0B 1IC7H 3P9MA 4WO4A 2X7LA 2YN5A 1H3TA 5TE7H 2Q7YB 3QEUA 2ARWA 4YX2H 3SDXE 5IEKB 4OGZA 3T2OA 5D96C 2E3VA 1Z6JT 1OTSD 4FXGB 3RA7H 3GM8A 5GISL 4YBHA 4JVUA 4ODHL 2CIIB 3VJ6B 5D7LB 4WIQA 5CHNB 3S3SA 3QQ9D 3BQUD 3INUL 1UENA 2W65A 5A2LH 4QCIA 2ADJB 1V7NL 3L9RB 3U9PH 1KJ3H 4FQJH 5CAYB 2N56A 4DZBA 4MD4A 4RX4D 3VFOA 5J3HC 3IDXH 1U8KB 5CIPB 1N0LA 3CSYA 4XH2A 5FFLA 1KB5L 1KIPA 4LRNH 3OR7A 5DJYB 4KI5F 5F3HB 4NWTL 4ZO7A 2X4OA 1QBMH 3RIFF 4AM0A 3OJVC 4G8GA 2AJVH 4JDZA 4OZGB 3TBTA 4Q9QH 2WLZA 4JFFB 4RFNB 2E9WA 4F7EB 4N90D 5E9DB 2BDNH 3N50A 4H0HB 3BDBA 4M7KL 4X6FB 3WJJC 3RVUD 3UYOD 5SX5H 1AGCA 3S5LG 3HG1E 3UAJD 3ZYJA 3K4AA 4LLYB 2IQ9H 1BIIA 5C0FB 1KTDB 4XCFH 2FHFA 4GRLB 2RGSA 1QEWB 5HDQH 2ITDA 1L7IH 4X7SL 5LCVL 2QADB 1VFBA 3BGAA 4M93C 2VR5A 4X9GA 1MY7A 2NY2C 1TPXC 3NIFE 1A7OH 1X4ZA 4L4VD 4FABH 3DV4A 3HC0A 5F6IC 3VFRA 2UY6A 1HXMB 2YWZA 1EH9A 1LO5A 4XX1G 4F2MA 2H6PB 5EO1B 2H1PH 5FV2A 2R9HC 2YK1H 4BA8A 4ZQKB 3PL6C 4OZIE 4ZDHA 1ZVHA 2EXWD 4M4PA 3KPNB 3OKKA 1QYGH 2GFBB 3UZEA 3MGTB 5E2WH 5GS1C 3C6LD 1AP2A 5GGSB 2DQHH 3MV8A 4HIJA 4Y8DC 1UVQA 1N6VA 5IB4A 1G9MC 3T4AB 4OKVB 1WZ1H 1Y6NR 2VR9A 1T3FB 1NUNB 3BO8A 5HYFA 1BX2B 1I3GH 4NKIH 4PJIF 4CU8A 4PJBF 4UNVA 4R0LA 2H6PA 5EO1A 4GAJH 4N5ED 4CU6A 1EPFA 1ZLWH 2ESVD 4N0YH 4HKBA 3C6LB 4RIRB 4HKJB 4WFEE 3WE6B 1X5JA 1WBZA 2IANB 5FHBH 2X6MA 4HBQA 1BFOA 3DV6A 4JO1H 1C7TA 1YUHA 3MRHB 2C3VB 1NAML 5C0BE 4YGVB 1UFUA 1S78D 4HC1H 2VISB 1CZ8H 4MCYB 2OSLA 1OSZA 1Q0YH 3P40A 4POUB 3G6JB 2ZCHH 3M1BA 3PWVB 2YBRA 4LKCA 3MFFB 3HE7D 5H94B 4F7EA 3K2UL 5D2LB 1BIHA 5ESAB 2FSEB 3RY6C 5IQ7L 4JY6A 3O3UN 5F96H 1IRAY 3V6ZB 4M6NL 4JR9H 2XV6B 1QTYT 3HFML 3HC3L 5FKAB 2DI9A 1GGCL 4DKEL 4TULL 4FQCL 2HA1A 3SDCA 3EJYC 2ZZUT 4LOUD 3BZ4A 2CK0H 2K9UA 2Y4SA 3QWOA 3NGBB 1HE7A 4PV8A 2NW3A 4AEFA 3O8XC 1RJZA 3RKPA 1FAIL 1I75A 4W4OC 1BX2A 1RJCA 3VH8A 1DDHB 3K74B 4OZ4A 2K7PA 2MPAL 1X5YA 3RNKA 3O6KL 1P7QA 1NBVH 5IR1B 2DN7A 1E27B 4WFGD 1ZGLA 2WBJB 4XRCB 4TNVF 1SBSH 2VLJB 4PJ8A 4YK4C 1T7XA 2EDXA 5TPWL 2V7NB 4XCNA 5E5RB 3DARA 3BP6A 3RVTD 1IM9D 1JPFB 3QG6B 4M3KB 5ESVA 2HH0H 5DVMA 2HJFB 4EI6A 3KPPB 3ZT7A 1LO4L 1DEEB 4FXKB 5CEYA 4HX1B 1G9NH 4ZUTB 2F5BL 1G7HA 3VFMA 1BD2D 1PQZB 2DQDL 3S35H 3NFNB 2QSCH 3T0VA 1TZIB 4YDLC 1KB5H 4NM4L 1AGBA 1AO7A 1JNNH 3GDBA 1N4XL 1T83A 15C8H 1KPVA 3WNNA 3QO0A 4M93B 1QPPA 2WIIA 2WMPA 3T0EC 2Q8AL 3GMOA 1A14L 4R97B 3OJMB 4KU1A 4DJMA 4RMSA 5FO7B 5IVXA 3U0WH 4JZOA 2C3XA 1NBZA 1JPTL 5D2NB 3FO1B 4E41A 3QRGL 4FN0A 4WO4D 3AREB 3MV8E 2AXFB 1ZTXL 3MO1A 1FZMB 1BVKB 2HVJA 5DJ6B 3F12A 4JDVB 5EH1A 4OZIB 4HIIB 1C08A 1U42A 5TFSL 1TETH 2AJYH 2OYPA 1BREA 3BXNB 3HE7B 3FOLA 4RFOH 2J4WL 4ETQA 3MLPA 1GOGA 3GMLB 2MWCA 1QRKA 2LVEA 3SE9H 1PZUB 2F53E 3RDTC 1RUAL 4KKNA 3SKMA 3MRBB 3MRDB 3VGHA 1YMMB 3SKOB 4PLOB 3QJHB 2HLFC 4UV4H 4MS8C 4UTAH 3QDMD 4P4KB 3BKYL 4HK3J 1ND0B 5D7JA 3F8UB 4WHYH 3OXRB 4M61A 4OLYH 2ITCB 2IMNA 4H1LG 1PAMA 1IGYA 4I1NB 5C0RH 3MX0A 3GHBL 5E5MB 3P2TA 1YMMD 2YUWA 3B9EA 1HCFX 2Z92A 2IFFH 3MZTA 1I7UB 2H26B 3BT2H 3HKFA 5LGJA 4DGVL 3UO1H 4UV7H 4B41A 1T2JA 3MRFB 1T3FA 4PJGF 4TVPE 1TQCB 3KLAB 3JTSB 1U95B 3X14B 1S7RA 2DKUA 3X11A 2AK4A 1GPOH 3SBWA 3WHXB 5B8CA 1CXEA 1T6VN 1KCRH 3NFNA 5FYKD 1SEBB 3MLVH 3QQ3A 5FHAH 4YBLC 1INQA 3MRIB 4HUUA 3OHXB 3LZFL 3OGOE 3QPQC 4HC1L 4DW2H 1QQDB 1NMBH 5DJXA 1TVHA 4QRRA 1JGVL 3WUWA 4H25B 4NO2B 3NZ8B 2W9DL 1F3JB 4OCWH 3VA6A 3O9WC 3TPUA 2AEQL 4DK6A 4GAJL 1EAPA 3CC5A 5CGYC 1A3RL 4AZ8A 1XCQB 3OL2A 1FN4B 1XT5A 5B4MD 1FIGL 3ULVH 4HIHA 2DMKA 1X4YA 4N0CC 5F7FA 4EBQH 4JFPB 3PDOA 5BV7L 1MHPL 1C5CL 1U8IA 3X13A 1JWUA 4Q9CA 3WUZA 3LRHA 4QY8B 4GLRI 4P9MH 1OARH 1NLBH 4KROD 4UAOB 4WWKD 2YUXA 5HI4C 4EDWH 4UILL 2CMRH 2DMBA 1CN4A 4KKLD 3H3PL 3VFNB 1YEJH 1K6QL 1HN1A 3SDXF 4I2XB 4LGSB 2K1MA 4NRZB 3UXFA 1WAAA 2RQ8A 4LGRB 1E4XI 4OZFG 4F80A 2DWDA 2A6JB 2R0WL 2PO6B 3PL6A 4NO3B 1HILA 3VFTA 2VZOA 3RVXC 2GITB 3IAPA 4OCXL 3DO7B 2X9XA 4HPYL 3PE9A 5DSCA 1EHLL 3EKCA 3P0VH 2P46B 3D0LB 1W0VB 3FOLB 4JPWH 2EIZA 1X9QA 5ANMB 5BS0A 4QHMA 5DK3A 4UMGA 1MIEH 4NQVA 4OQTH 5CJXA 1FH5H 1CLOH 1A7QL 1AQDB 1GSMA 4N8VB 3T4YB 5JMOC 5DMGD 2FBJL 5CMAB 3O81A 4U0RB 2DKMA 4KHTL 5JOPE 3S8WA 4M1DL 5EZLB 4XWOC 4IMKC 1G7PB 2ADGB 2QHRH 1G9NL 3EJZC 2MCG1 4HIXH 2ILLA 4G80A 1MVUB 3MREA 3LKPA 4HWBH 3GSQA 4GKNA 1MFAH 1ZT4A 4HJGA 3BJLA 1JV5A 4X0KA 3HI1A 1JFQH 4Z7VB 4EUPG 4OKDA 3OWEA 1AR1C 1ZANL 3DGGA 4P2QD 5C6PB 5I1JH 2XZCH 2BNUB 4F57L 3WS3A 1I7ZB 4QRUB 4NZJA 5SWZA 1G7HB 3VFMB 1J8HA 4GS7B 3BDXA 4IRSA 5DK0B 3RX5A 4LVHB 2N1KA 3UBXG 3AMLA 1WGOA 2ZUQB 4Q58C 3LKRB 2EDRA 3RTQD 5DC4B 4TUJA 1G0DA 4FQHA 3EYOA 4MAYB 4MJ5B 1F90L 1AD9B 1T1XB 3LQZA 1N5YH 4O02H 3I6GA 1VB9A 4G9FE 4L4TA 2YUZA 1E4WL 1F02I 1PBYA 3C8DA 4ZOBA 5JPNB 3HRZA 4U1IA 5E0QA 2VXUH 2Z4QA 1FSKB 1AIFB 2VXSH 3A6CH 3EOTH 3VG0H 1GH7A 2VH5L 4ZFFA 5KSAB 2YPVH 2J8UA 1G7QA 5D1XA 3EYFA 3IF1A 1G7LA 4XP6L 1HKFA 2HFEA 3RVUC 3LCYA 1WC7A 2XOTA 4YGAB 3C8KA 3VRJA 3CCHB 3CLEL 3P73B 1LK3H 3D39D 5GGUB 1EEYA 5ANMA 5BS0B 1U3HA 3MLXH 3ZE1E 4JM2F 3ECBB 3OR7B 3D1MC 4I77H 2CDEB 4IM8A 4PYGA 3LKQA 3ZHDA 4ZXBD 3T0XA 1PLGL 1Q9KB 3JV4B 2YZ8A 1OP3H 3EO9L 3CZFA 3ARBC 1E6JH 3ARGD 1PG7H 1RIVL 5IJVA 1H3UA 3T0WA 2DJSA 3CSGA 3O6MH 4N68A 3IDGB 3BYYA 3G04A 2VXQH 3KS0J 3HMWH 1J0IA 1V7ML 5HXMA 5HGGS 1ADQA 1QP1A 4KJPD 4P2QE 4HIIA 3B5HA 4KGJA 3DX7B 5DWUL 5EFIA 2A73B 1KUMA 4I3GA 1CGTA 2DYPB 4JRXE 5E8EB 2IANA 4QXUL 3TBVA 2AJ3A 1CFVH 5EZOH 4XMLL 3C6LC 5C9JB 1TJIH 1I8IA 2IBZY 3V7MA 3FT2A 1FVDB 3MXWH 4F7CA 3C2AH 4PJXB 4KV5F 1KGCE 3QFJD 1S9VB 2XKUA 4G9FD 4X9HA 3ZKXB 1KG0B 3MUHL 5D7LD 3LD8B 4LPYA 3D3VD 5HGAB 2HJKB 4KVCH 4LHQB 5F89A 3PWUA 2EDHA 2YK1L 3BE1H 1S9KC 1EXUB 3AUVA 3FOMB 4LLAA 4PV9B 4XP5L 3PJSA 4OCYH 4K8RL 1HINH 3QIUB 2FIKA 3MRPB 3VG9C 2B0SL 1NCDH 2FEDC 3O4LD 5F7UA 5MEPB 3WJLA 4UIKH 3W0WB 1OWRM 4YBLB 3VXTA 1Y18B 3MGOB 2DQTL 3P9LA 1FLRL 1P5VA 3VWJC 2AQ1A 3MRNA 4WFHD 1G7PA 1RZFL 3MUGB 1K8DA 1UH3A 1UXSA 4EVNA 4PJFE 6FABH 2HH0L 2XQBL 3TESA 3X14A 4LKXA 1NLBL 4EDWL 4X7DC 1FIEA 1MFDL 4JN1H 4KUZL 5E6IC 1KB9J 1DDHA 3ABZA 3E8UH 5ISZE 5FYLH 5HHQB 2YC1A 2JKXA 3GIVA 5IFJA 3MFGB 4KPHH 4MVBD 3V95A 1QUNA 4ZAKD 1KCLA 2H26A 1FSKC 5HGHA 3KLHD 1W72A 3QDJD 5CGYD 3FO0H 1AKJB 3HZYA 3O2DH 4I9WE 3HI5H 1QSZA 4LLWB 3IVKA 2AJZA 2AEPL 3X3FL 5K59E 3OKOB 2PCPB 4G6AC 3H9HB 4LCCC 3JV5A 3TVMC 3MODH 1MAKA 4G8GB 5GS1B 4PREA 2L7UA 4MA1B 2VDRL 5IEHB 3S5LA 2NY7L 5KVFH 2FCBA 1A6VH 3ES6B 2E7LA 5JLZA 4FG6C 3S37H 1WISA 4QEGA 5C0BA 5FUCC 1LP9B 3MRRA 5I8KH 5J6HA 4LIQL 4UTBH 2IH3B 3KR3H 1IM9B 4LLWA 4LSQH 2AJUL 1DUYA 2A0LC 1MSPA 1A3LL 4D3CH 5TQ2H 4YHMH 4FP8L 2XKNB 4HIXL 4WI7A 2AXFA 1TFHA 3FHAA 3CX5K 5DR5H 3MBXH 3QUYA 1NBZB 2VJXA 4ACPA 3R1GL 1CS6A 5J89A 4ENED 4LVEA 1Q9LB 4GAGH 4EI5C 4OFYA 5EOCH 3B83A 2BX5A 4HZLB 1MFBL 5DYOA 5IEKA 1AD9A 1T1XA 2H9GB 4ZSOA 1NGXA 4L8CB 4OSUL 2WV3A 4YIQA 4Y4HD 4RFNC 3MXVL 3E3QC 1W0WA 1DUZA 1UWXH 1DZBA 4HJJL 2B7DT 3TLRA 4LVNB 3KPSB 3W0WA 5JXAH 3FAXA 1JGEB 3C87A 3D3VE 1UJ3B 1XMWA 5C0GA 3QXUA 4JCLA 4WI5A 4WU7B 1RURH 5I1IL 3HB3D 4KFZC 2AJYL 2OTWB 2DF3A 1U6AL 1J0YA 1D5MA 4KDTC 4U1LA 1P2CB 4RAUA 3ZZ1A 3P30L 1FFNB 3MMEA 1S5IH 4HS8L 2PO6C 5AWNL 1UYWL 5DURD 5GGTA 5D5MA 5IFAH 2M26A 4P2OD 4PUBH 2GI7A 5E6IA 3BWUC 4U7MA 4G80B 2FL5A 2R23B 3MOAL 2OK0L 1I8IB 3K4DA 1ES0A 5CSGA 3G6AA 4PGJA 1UKTA 4BSVB 4GO6B 4I0PC 4WVRA 3G6JE 4ZPTB 5L2JA 1XGPA 1A6TA 4EBQL 3BKJH 1C5BH 1DQDH 2Z35A 2FD6H 4PGDA 4JQIL 3U6RB 5BVJB 2XWBA 3H9SB 2BOBA 3BIBX 3NCYP 5CKGA 1NEZB 5C2UB 4LLMA 5FK9B 1RK0B 5D6CB 4XPBH 3SPVB 1UH2A 2RFXB 4PJ9C 2AEQH 3DTXB 4DN4H 5JIIA 3AAZA 4ODSH 4P5TB 4KKAC 3L6FB 5DJAB 2V7HB 2ZUQC 1BZ7B 3I3BA 4Y4KC 1N3NB 3WL9A 2MSPA 1OGTA 2EDBA 1RV6X 1LGVA 3MQIA 5D1QD 2CDGB 2Q6WA 1E28B 1N8ZA 5AG8A 3GNMH 5GGRA 2VDLH 1XGPB 3MLRL 1FG9C 1FGNH 1CFSB 3CAFA 4LSDA 1EAJA 1MHHB 1ETZA 4LCIL 3LEXB 4ZAKB 4ODVL 4RIRA 3QULA 2F53A 4ZOEA 5HHOD 1A4KA 1S9XA 5HGHB 1YNKL 3ULUH 1CLOL 5BRZD 4MNQB 2YPLD 1EFXA 3FONA 3D0VA 3S98A 1QLEL 2X1OA 4MD5A 3SGEH 4I18C 4X5WB 2V6HA 4XNUH 4HH9A 3ULUL 5CGMA 1ZHBA 1CT8B 4Y1AD 3AS2A 5EN2B 3RWFA 3A6OA 4I5BA 4KJPC 3MRNB 3P0YH 2OQJA 2AI0H 4UNUA 2Q7YA 1QFWI 5EO9A 4R90H 3V5DA 3V6OC 5I71C 1AGEA 5DURB 2YD1A 1XH3A 5IF0B 2VLJA 2VO5A 3T8XA 4WWKA 1NPUA 4I3SL 3WV0A 1ZGLB 2X4RA 3O3BB 1T1WB 5IT2H 4WTXA 4D0CB 1XF5A 1HXMA 4PPTA 1T21A 2VLLB 1L6XA 3MLRH 1Q94A 4PJEF 1UEYA 2C5DC 4DVBB 4CADA 3I02A 1NUDA 5TH2B 1OLZA 2DQJH 4LCYA 5E2TH 1SVZA 3HI6H 3GSOB 2ZJSL 3FKUS 3IGAB 3HUJF 1JUFB 2Q8BH 1ONQA 3ZT6A 1R5VB 3LRSB 2P42B 2WP3O 4H8WH 2XXMB 3Q48A 1I4FA 1D5BB 1LP9A 3MRRB 4K23H 4XAKE 5GS0D 4JHBA 2EKSB 4MWFA 4QHKI 1IL1B 1S7QA 2WAHA 1QFWH 5CJBA 2VZVA 2ATPB 1BAFL 1B9ZA 1T5WB 2ORBL 4OGXH 1KB9K 5I8EB 1YEIH 3TBYA 1CU4H 3FQXA 5TDOA 1CBVH 2VXSL 4LASH 4ZTPH 5IESL 1CR9H 3V4VL 4MD4B 5HHPB 1JN6B 2R4SL 4ETYA 5C0EB 1TJGH 4OD3H 3WFBL 1KIQA 3FQWB 1E4WH 2VISA 3BOVA 2E7MA 1XGRA 4C56A 3EO9H 1I1AB 5LKNA 3CVIH 4MWFB 5IFJB 5I1LA 2CIIA 3MLSH 1IT9L 2F74A 1YEDB 1AR1D 5B38G 4HS6A 3EJJX 4XPFL 4CNIA 5HDQL 2BVQA 3WNKA 4K2UL 1DN0B 4WW2A 5I1IH 5I1CH 3L9RA 5KW9L 3PWJA 2J8UB 3TNMB 4FABL 5IV2A 4S1RL 3T2NL 5MEQA 1LD9B 1PY9A 3ULVC 3MZGB 4P4RB 2XN9D 1MI5A 1S7SA 4ZO6A 3SE8H 1HQ4A 2KDGA 4UOJA 1M7XA 4KAQL 4BZ2L 5B3JE 5IB3B 1QFUH 4R7NB 5C2BH 3IDMB 3HE6B 4KMLB 3ARGB 4FQPA 1N59A 3P4NA 1NCBL 3MLTB 2X70B 3T1FB 2FIKB 3MRPA 3J8F7 5HVHB 4NCC1 2EDNA 4IS6A 1A2YA 3DGGB 2E9BA 4IOFD 1NGQH 7FABH 5F1SA 4CVXA 1RHFA 3PQYB 4PG2C 1TDQA 4QGTA 5ACMA 4LASL 1G6RB 1RUMH 1RVFL 2J8UE 4WCYH 3EFFB 2AV1A 1AGFB 2W59A 4CAGA 1UWEL 4H20H 2ORBH 4AJ0A 1MCPH 2Q76B 5JTWA 1QG3A 4RWHA 2X4PB 2EYTB 3ZE0E 5JW4Q 2ED7A 3DV4B 5IG7A 3BPNB 3GRWL 4PGCA 3OKEA 4HH9B 3ARWA 5T1LD 5CJOH 1JZ7A 1T22A 2E6PA 2UWEF 4C56B 1MLCA 5JR1H 5FDWB 3MRQA 3K4ZA 4GW5B 1WBXA 1QD0A 4JN1L 4KUZH 2VABA 3V0VB 1IM3A 4GH7B 2DQEH 1G6RH 3CFJA 4HIEA 5TDOB 3QDJE 3GSNA 3ZDYF 3EFDL 4BH7B 3CX5J 5C6TL 5I71B 3QUKB 3FQWA 3I50L 3MA7B 3O4OC 4DTGH 4APQA 3SQOL 5DO2C 5I66A 4KTEH 2H2SD 4OBRA 4X5XB 4EQ2A 3CUPA 4Q6IA 5DJ2B 3BPLB 4GMTH 3RL2A 2HLFD 4NN5B 5I1DA 2IAMC 5EZJB 5GGTL 3F6LA 4WTWA 4JFOB 2DL9A 5C7XH 4YQXH 5F6HJ 3MFFA 2X4TA 3UJTL 3KYAA 3RWIB 4NO3A 1KLGB 1WBXB 4QCIB 3ZKNC 2C4XA 2DIBA 5GSRA 5DHXB 5DLMH 1Q1JH 2BOBB 3D3VA 4PGBA 4PGDB 3VDAA 5JORB 3BKCH 5A3IC 4PJDA 5C0CD 2BOCA 3CLFH 4Y4KD 5KSBB 2LU7A 1E4KA 1ZLSL 1R0AH 5IOPA 4Y16A 5IBUG 1F42A 3TJHD 2X4RB 3GMOB 3SKNA 1B4JH 3RWCB 3SDDB 2NXYD 3EOBA 4WI4A 1KGCD 1GOFA 3QFJE 3BO8B 1IJ9A 4UQ3A 1G6RA 4PR5A 1BOYA 4N1HB 9CGTA 1Q94B 3LIZL 4P2QA 3QA3B 4U1LB 1OAKL 2PKDA 2OJEB 4K07A 4U0QB 1IGIL 2J7LA 3GSXB 1NEUA 3DPBA 1XH3B 2NW2A 2XTJD 3OGCB 43C9A 2CUHA 4LRIA 3IDMA 1EVUA 4HJGB 3ZMRA 4KVNH 3BGFB 3HUJA 2YPKA 2GJ6B 1GGTA 3PABA 3QDGD 1DBML 4IIQB 5K9KB 2QKIA 3MYJA 4MX7A 3SN6N 1M71B 4WFHE 1WCBA 1A1OA 3SY0A 4D0BB 4GBXC 2V9TA 4R0LC 1XF4A 5GZOC 4YDIH 1ZEAL 4ZAKA 5ABDE 1P7QB 1JZ3A 4XNZC 5E5MA 3WHE1 1XGYL 3G6JF 4C54A 3IFLH 1JRHH 3H8NA 3NAAL 1EFXB 3FONB 4KKLC 5AYUL 1FNSH 3TCLB 5IM7A 1EGJA 2MNUA 1V8HA 3QEQA 4W6YB 2FX9H 5E4EC 2YD5A 4KJWD 1I1YB 2DJ4A 2FZ3B 3IXTB 5IFAL 1NFDF 3MRJB 3SJVE 4MDIB 4Z9KB 5E8PB 4EUPA 1RK1B 2A0LD 1BHGA 4WV1B 4GUPA 4NO5A 3N1MC 5IBLD 1IC7L 3F7YB 1U6AH 1N6UA 3OKLA 3NBNA 1A1MA 2ZUWA 5MENB 1D6EB 1OHQA 1ED3B 1CLYL 1P69B 3MROB 3F12B 3QPXH 4JDVA 4PJGA 1F45A 2OL3L 2ZSWB 3O11A 3D9AL 2PN5A 3QCTL 2KZ1B 3V7AE 2Q3ZA 3TH3T 4OLYL 1S8DA 4OF6A 5I15H 1NAMA 3BHBB 1GYAA 1JPSH 3SE4A 2OTUA 2FJGB 1AI1L 4CJ0A 1KXTB 4BSWB 3WSQH 1CLZL 3SJVA 4N0UB 4YXHL 5CHNA 2LTQB 4PP1C 1AIFA 1NMAL 1U2HA 5F7NC 4HGMA 4XVSL 2YD6A 3WNOA 4FP8H 5INDA 3HAEA 3S35X 4N8VG 5IHBA 3MV9E 1PKQA 3SDYL 3SDAB 5J1TC 3BUYA 5CP7A 1XGUA 4IRZL 1DQMH 3WIIH 4Y0GA 4O2CB 2BNRA 1WSST 3QIUD 4HS3A 3GSRB 4BFBD 2VITB 4HJ0D 4HWBL 1ZA3B 4R2GD 1I9RH 1W0WB 1A14H 3QRGH 1UVQB 1FO0L 1X3DA 4LVOB 3RDTD 1D5IL 3FQUB 5F7HA 3U0WL 3NFSL 3DRQA 3I75A 3MGAA 1OP9A 2BNUA 1A6ZA 2MTPA 4R96A 1DBKH 5IBTH 4MNGE 3I85A 4JE4B 4WHDA 1SJEA 3O4OB 4ELMB 4C58B 3RTQA 3BVNB 2W38A 4K7FB 2CK0L 4HH8A 1KLUB 1KN2H 4PRPE 3QI9C 1LEIB 3TC9A 2WWKO 3Q5OA 4JO2H 4N0FB 5JHLH 4YFLI 2P7TB 3VXUA 1A64A 5D1XD 5I8CB 1LO4H 1XAUA 5C0IB 5LGHL 3ROOB 5C07A 4LF3B 2GK0B 4PJ7A 1Z3GL 3HZKA 4KY1L 5F72S 4UOW1 3P30H 1KXQE 4DZ8B 2XA8L 5JQ6H 1J05B 3GJFK 5BW7A 1RZFH 3TO4D 4HF5L 4O9HH 4DUVA 5IK3B 1YPZF 3TPKA 5I30H 3QCUL 3UTSE 2HJLA 3KHOA 3HPLA 5FYJU 4FMKA 2NXZB 3BW9B 3DUUB 2P4AB 1CLZH 5K9OA 2AGJH 3F58H 1ZK9A 4HWZB 4ZXBC 2XZZA 5JOEA 2HTKD 3H3BC 1P1ZB 3ZTJG 1IKNC 3FO9B 1S3KL 1ZLSH 1LO0H 3TYFA 3C5ZB 1P7QD 1T4KB 3IU4L 5CJOL 5J9PB 2VXVH 4XNQB 3R1GH 1ZWIB 2GK0A 4E41B 3PGFL 3O6FD 4JY4A 3OX8B 4JZOB 1KEGL 1OTUC 4QY8A 3ARQA 5F9JB 2W92A 4RFEB 3C5JA 1U41A 4Y5YA 1GXEA 4JZJA 4J3UA 4JFHE 3L95B 5D2LF 3IXAA 4QOKD 3I6KB 1LE9A 1A3QA 3HG1A 2NY0B 2CO7B 3ROLB 1T03H 5D7IA 5D1QA 1OD7A 1X5IA 2R0KH 5IIEA 2IFFL 2Y36H 4QHNA 3BZEA 5ITBL 2UV3A 3DURA 1M05B 1MJ8H 1JYVA 1M71A 4KV5E 4WY7H 2WNGA 3QUZB 2H1PL 3IDJB 3K0WA 4GG6B 3TWCH 1QRNE 2E6QA 2HJKA 3P77B 3NIFF 1H3PL 3OF6A 4KK5D 4DCQB 5BOPA 4UTAL 3CVHA 5J1AA 4AMKL 3RVXD 2XPGB 3T2NH 4S1RH 3MA9L 4L8CA 2A6DA 2FEDD 5I73C 3FO0L 4IS6B 4C83B 5GGVY 2GFBA 5C9JA 4XPGL 1E27A 4FZEH 4BFGA 5IIEB 5J11C 1IT9H 4M1CC 5J6GA 1GHFH 4UOW0 1OAQH 3T3ME 3MR9B 5FOBA 5F44A 2AXHA 3F62A 1S7TB 4HT1H 1CDGA 1XZ0B 4ALAH 1BEYL 1Z3GH 3QH3A 2QQKL 3SDDC 3QUMB 4Y19B 4LLYA 3A6CL 4JKPH 1QBLH 3FTGB 3LEXA 3N0PB 5GS0L 4Y4FC 1CG9A 4HCRL 3PIQB 1EHAA 5J6HB 1BLNB 3HR5A 4JY5H 1TPXB 3GI9H 5DUPH 4IDJL 1MJ7H 1VEPA 3D2UA 4S2SB 2D0FA 4XHJD 1C12A 4N0UA 4YAQB 4G6AD 4BFIB 5F9AC 4PJFF 2NY3B 4JJHA 5KVEL 3TO2A 5FECB 4K3JL 5INCB 3L7EB 3B2UD 3VU2A 4MB4A 4HBCL 2I25N 5T1MA 2AK4E 4LCWE 3SDCC 4KVCL 3NMEA 2AV7B 3FQXB 4JKMA 1KJVB 2IQ9L 2BRRL 4K3GA 1G7QB 3BZDA 5D1XB 4X9IA 4LRIC 2EIEA 2V2WB 4DFIA 2VYRE 5DJZB 4QYOB 1CTOA 4JFDD 3VXSB 4JHWL 4XWGL 1S7WA 5FF6B 1I8LC 3B8SA 5DJDA 5JIKA 3C08H 1MFBH 3HR5B 5I1KL 2DQGL 5F97E 2Z31B 3VDBA 2DLGA 3W11D 3ZKMC 4V2BA 2IQAA 4Z7UF 5ID0B 3K8KA 3WFZA 3IF1B 5LWYH 4PJ8C 4U49A 4MQ7A 1PZ5A 4ZTPL 2R0ZH 2DWEB 2FWOB 3BGFC 5GRXG 2XN9E 4CADB 4P0DA 1CE1H 1FAIH 4FTVE 1SY6A 1YEIL 1JJUA 3VFSB 4BYHA 4P2OB 1IQWL 2XA3A 1LK2A 3BVNA 4K7FA 4QTHA 1NCWL 1HOCB 2ADFL 3SE3C 5BZDA 4FFWC 3MGTA 4NZUL 1IGJA 2BSTA 2P5WB 5HDBE 8FABB 5D71H 2GJ6A 4F58H 1XF3B 5C0AE 1S5HB 3SCMB 4OLZL 4EDXB 1WFUA 4D8PA 5EU3A 2PF6A 5ESVB 2C4FT 3UJJL 1ORQB 3OR6A 2PXYC 1IKNA 1H8SA 5F96L 1U8JA 2A6IA 4OAWB 2JJTA 4OGAC 2HYMA 3T0AA 3O0RH 4XBEH 4Y2OA 1F4HA 3QDGE 1KYOK 4LCWB 3AREC 4M02A 2AK4B 4OCRL 5INDB 5IR1A 1RHHB 4X8XA 3TBVB 4LLVA 1KC5H 4R4FH 1A7PL 5ANME 2B1HH 3JWDL 3HE6C 4XXDA 2BOCB 3FFCB 3BEWB 3I9GH 1HQ4B 3HNVL 1S7XB 1OTTD 3KPOA 3D0VB 1N5AB 1XFPA 4QTIH 4NFBA 2QR0B 5CEXB 1NCBH 3HAEG 3FQRB 3KYKH 3FQTA 5KG9B 2E7CA 4K71C 5L8LB 4GAYA 5D1ZC 5ALCL 4LEOB 4MAUH 2BMKA 3DVIA 4JY4B 1QSFD 1T1ZA 2PW1B 3KYMA 1EJ6A 4A2MA 5HYQA 3IS1X 4KMTL 1OGAE 2CSPA 2G9HA 1YYMH 5FM4A 1U8HA 4OD1L 4XCEB 4ISVA 4KRMB 5JW5A 3FO2B 3DXAA 4M1GH 1B0RB 2JK5A 4TUKL 3ULSB 5DJAA 1Q0XH 3LN5A 4XP9H 4LLDB 1IKFL 2B4CL 3MRCA 3QIBD 4ZFFB 1LO3L 3RZCC 1MLCB 4NQTA 2YC1B 2GTWB 1EEUA 1XR9B 4GKZA 2FR4B 3MJ6A 4WUUD 5EU6B 2IC2A 2LAGB 5B8CC 1MRCL 3BT2L 4XMPH 1OCWL 3OB8A 5MERB 1NC2B 2NYYC 4WHYG 5FDWA 5DWUH 1GZQA 3MLXL 1XCTA 4F7TB 4TQEH 2N7BA 5DRZA 5B39G 2DAVA 3S4SB 2HT4D 5DEGA 3FT4A 2Q87A 5DS8A 3G9AB 2V17H 3UBXB 1P2CA 1WJ3A 4JQVA 3SCMC 1YY9C 2BY2A 4WEBL 5GZOD 5C0CA 1XGTB 1NMAH 3QDJA 1KB5B 1VADA 2MQ0A 1MCDA 5LCVH 4S0SD 3WUWB 3ULVE 4QHUA 1OP5K 5KTEH 2R1YA 2X4UB 3ALWA 4FFYH 3EBAA 3BD4A 4JREB 4H0IA 4XXCC 1XCTB 2JELL 4JFEA 2P5WA 2R0LH 5D70H 3EDJA 3X17A 4QHNB 1U95A 3UTSB 2PYEE 5FYKU 2UUDK 3OSKA 4HXAL 1L6ZA 1JHLL 3X3GL 1FIGH 2CLZA 2EDEA 4YHPB 1A6VL 2C4FU 1RURL 2XWTB 4P4RA 2JCCE 5MP6H 5FA3B 5CBEA 2V2WA 2DBLH 3BYTA 1EJOH 1FNEA 4K7PL 3O6LH 2F53B 4X6CE 3EW3B 1JPGB 4HJJH 4HCRA 1CCZA 1FPTH 2QQNH 3EYSL 4PJCA 4G8EB 1SJXA 5HDOA 3NAAH 4LNVA 1UWGH 2GY7B 3RL2B 1HH9B 4F3FB 4WUUE 3G5XA 2NQCA 2FJFB 3D39E 1UA6L 1T4KA 5GGRY 5EO0A 4HMCA 5L2KE 3VXPA 5AUMA 3VI4E 3C5SA 2R0ZL 5D2NE 4IMLA 4ONGL 3F7YA 5GS2H 1FDLL 4TSCL 2FSEA 4OLUH 5LG1A 2ZPKH 4ESKA 1LO2L 1Z9LA 2BCKB 3T1WA 5IB5B 2OXHA 1FH5L 4JKLA 5ICXA 2FDBP 3W0WE 4CVUA 4FQQB 4LQFL 2HMIC 1DFBL 3AXLB 2BNQE 1S7QB 3B43A 1CFQA 1VEMA 3MLZH 4S2SA 4XCCH 5I18L 4H1LH 1LVEA 2X9WA 4PJ7B 1YQVL 4XAWH 1MJJB 5EU4B 1F00I 4HWEH 5TDPA 2NX5B 4YDJB 1MRFL 4I0PD 3TZVB 4LPTA 3CDCA 3U7YH 4Y19A 4ZS7H 1NC2D 4KUCF 2IALA 1JUFA 2Q76A 2VWEC 3LN4B 1J8HD 4LCYB 3O3EA 4RGOL 2I5YL 3CU1A 2CDFB 4J2XA 3MV7B 5DF0A 5GRUH 2NY1D 1BP3B 1OQXA 3W11C 3ZKMD 1YEJL 4BQ9A 3A67H 1KULA 2F15A 4JVPA 5D1XC 2LFGA 3QUML 2BJMH 1T2XA 4ZUWA 1I85A 3QP3A 1BVZA 4MB5A 5HHMB 3HN3A 1MHPH 1R3KB 4ZUTA 1U0QA 4P2QB 3M07A 4Q6IC 1HEZA 3CK0L 3TEUA 4G6FD 4TN9A 4HWBA 4K9EC 1H5BA 4NC2B 2CIKB 1G1YA 2FWOA 4WV1C 3RUGF 3P0GB 3LS4H 4TVPL 4Y5YB 1R24A 2GK2A 3R06B 3MNVB 3T77B 3JVGC 4I0KA 4Y16B 5EB9A 3P4LA 1HXYB 4MXWH 5MEOB 1MNUH 5L7XH 5EA0L 3PG2A 4LNRA 4HG4J 4MZ3A 4AMKH 1MVFA 2AXGA 1TNNA 4G6FB 5LBSH 1HIMH 4XT1C 4LGPB 5DEFB 2AK1L 2KH2B 4GW4B 4H1LB 1I1RA 3ARED 1AHWA 3U79A 1YA5A 2OJZH 5EBMA 3B2VL 3CLEH 2GJZA 3T2PA 1AGCB 2EDOA 1KEML 3O6FC 1J1XL 2P1YA 3EO0A 3U7WH 1IVLA 3C60A 4L9DA 5E5UB 2E8YA 3DO7A 1G7IA 5DO2D 1IMHC 2H2SC 5C0BB 3OAYH 2VKWA 4YUEL 4YC2C 1OCWH 2BNRE 3VD3A 5A1AA 3ILPB 2XT1B 5DRNB 1YECL 3FCTA 5JO5A 4M5ZL 2APFA 1A0QL 1YEFL 3QG7L 4ONOA 4YGVA 4XVUC 1QYGL 4MA1C 1R3HB 2G60L 1B6DA 4MDIA 5F8RC 3CFJB 4HKZA 2R29H 4HQQL 2H2PC 1G7LB 2I5YH 2QADC 4GSDH 5IP4A 4NHUB 4LLMB 3PWNA 4A6YL 3QH3B 2PETA 1E6JL 1MAML 1QNZH 3E6FB 2KZWA 4NN6B 3KPOB 1LEIA 4FQ1H 5HDBF 1CGUA 1N7MH 5I1HL 3BEWA 5DK2A 4KK6D 2D7TL 4N9GB 3L3KB 5ALBL 3F7VA 4JFZH 4BZ2H 1ZXQA 1A21A 5D7KE 3T77A 1MJUL 1T04B 3O3BA 3L3DA 3SE9L 5IVXE 2KBGA 2RB8A 3IDYB 3P11L 3VXOA 4PD4K 5FO8A 5HHNA 2UUDH 1OQOA 1I7RB 4JDTL 3EFFA 3RWJB 1ORQA 3OR6B 1A7RL 3JWOC 5DRWA 2ZP0T 2OI9B 5HHOA 5KAQG 4K2UH 5DFTA 5JHDA 3ARPA 4PP2B 5HI3D 4F7PB 1TJGL 4JFFD 3FL7A 1ACZA 3QWRA 4ZQKA 1F5WA 1Z0MA 3QQ3B 2F54E 4WFFE 1EK3A 1AKJD 2OBGA 3FOMA 4PV9A 5D7IE 2X70A 1Q9LA 1NFKA 2HT4C 4KDTA 3KXFE 3MJ7B 5E8OB 4NBYB 3O45B 2B0SH 2W0LA 3L3KA 1UWGL 4PJDF 1MFEH 1ZA3A 3NH7L 4BZ1L 5J57B 1UCBL 3HG1B 1G6RL 4MA8L 5IESH 4XBEL 1TQBB 1KJ3L 4L5FH 4DEPC 1CU4L 1NFDA 1FVDA 5E08L 3BZFA 2F58H 5F9JA 2ZSVA 1GC1L 3RPKA 2DDQH 1YDPA 3GMMB 3LVEA 1J0ZA 2BCKA 2V9RA 2Y9RT 1CFSA 3CIQA 4MXVF 3ULUC 3GHEH 4Y19D 3ZHLA 5SWQA 3ARFD 5JLZB 3T0EB 1GOHA 1OAZL 1UACL 1KV3A 3HHRB 4JREC 1JNNL 5ICXB 3WL9B 4UT9L 4XTRC 4MQSB 3G5XB 4UT7H 3L3IA 1G9MH 1IM9A 4X7TB 2X4TB 4XPTL 5IT2L 5KS9A 5DXWA 2FRGP 5E9DA 3CFDA 2NY4B 4I3SH 2LAAA 3OKOA 4FQIL 4NC0B 1TTUA 3ZYIA 4MD0B 2MPAH 2G75A 4DN3L 4DAGL 1XGQB 3WJLC 4G6JH 2AKRB 1K2DA 1FNLA 1BZQK 5FA3A 1ITCA 4D0DB 1RQ5A 3MUJA 2IAND 3GIVB 4PLJD 1KACB 3FZUC 1MWAH 3GKZA 1NCUA 3VFOB 2VZUA 1KLFA 2ZOLB 1EV2E 4PP1D 5HHXL 2X42A 4OFYD 3QZWB 3HZYB 1ES0B 3ARZA 3FQTB 1A1OB 5FYKL 1IZJA 4YHLL 3QXDB 4Z95L 5AZEL 1BGXL 1U8QA 1BF2A 3G6DL 5L9DH 2PXYD 3KYNA 1H3XA 3D5OF 2XTLA 3MLUH 3WN5C 3QIUC 2VIRA 2NY5C 3KJ4C 4KQ3L 4GKSA 5B39A 2W9EH 3T8XB 2YHGA 4K9EH 3JV0A 3DX9A 3U0TA 1FFOB 2XZAH 1IKFH 2B4CH 1YNTA 1OARL 5CEZD 1XF2B 4QLRA 3UZVB 1S5HA 2L7JA 2I07A 4GRWH 5GS3A 4AEHH 3HC4H 2JJTC 1RZGA 5DMKA 1RUKL 4NUGH 2CKBA 1FGNL 1TXKA 3EOBB 4QRUA 1RZIA 4LPVA 4I5BB 1MCHA 4NDMB 5HHVL 4K94C 5EOQL 2E27H 2ZCHL 5TE6H 1BFVL 4OV6F 3VXSD 3QUYB 4ODHH 2DLFL 3MNZB 1FZOA 1YJDC 2HT3D 4JQIH 3I6KA 3E6HB 4PJAB 4ORGB 2B20A 2X10A 3OQ3B 4PGZA 5F7KC 3IJHB 5F7EL 2OJZL 2AJ3B 3TJHC 4YPGB 3C09C 2O5ZH 5F1NB 5TDNA 2VDKL 2XZQL 4R26L 5CMAA 3UEZA 1WTLA 2ZG3A 4DGYL 1AXSA 1HI6B 4HDIB 5SWZD 3L5JA 4C59B 3BPOC 3KPTA 1N8ZB 2C1OB 2NMSA 3HA0A 1WWAX 3CGTA 1WVZA 4TNWF 3K1KC 3BAEL 3FT3B 4OF7A 1JNHA 2ZNWA 5IW1B 4XZUB 5EIIB 4AQOA 1TTGA 3VRJB 3GMRA 2VZSA 5AZEH 5JOPD 4M6MH 3VGAB 4HUVB 1HQRA 3QHFL 5T5FL 5T3ZL 5FYKH 1J1OL 4BM7A 4GW5A 4OZGF 2VXTH 4WJ5A 2BP3A 2VSCA 1L0XA 1W2KT 3HLAA 1GCFA 2XKSA 1BVKA 2HVJB 5D7LA 2Z35B 4JHZA 4U4BA 2BC4A 3CCHA 4PJEA 1P9MA 2ZCKL 5I1GL 5L88H 2ADIA 3MRKA 4HIEB 1YDPB 1BQUA 3QDGA 4OIIL 3FTGA 3DMMC 3BH9A 4LL9A 4S1SL 1QVOB 2HFTA 4MJ6B 4QWWC 3R06A 2WINA 1K6QH 3IKCA 2ESVB 4KTEL 3N9GH 4NQCA 1NGYA 1F6LL 1S7XA 2JJSC 2HVKA 5I1EL 1S7VB 4NM8H 4PRPD 2PW2A 4PGCB 3IYLW 2EE2A 5EG6C 1TNMA 3GSNH 1U8OA 1I8KB 2Q3AA 3CXDH 1VPOL 2BXZA 2P8PB 2X4SB 4YXLL 4G42B 4N1EA 4YWGL 5TQ2L 1BJ1J 3O2VH 5DUBA 3PWUB 1TZGH 4DCQA 1K8IB 4WWID 4ODUA 5CZVL 3QEHB 4WW1B 4K8RC 5EBGA 3T08A 1WV7T 1U91A 1KIRA 2AXJA 1MCLA 1X5GA 1V3KA 4YFEA 3OBAA 4XBPA 3DETD 3ZDXE 4UQ2B 1K4DB 3MLTA 1S7RB 4HS6B 4CNIB 5LAXB 3H9ZA 1F4YL 5TDPB 1H9VA 4HZAA 3RPIB 1IC4H 1KTRL 1CLYH 1S7SB 1QBLL 4ODTL 5GRZA 5IGXH 3F6IA 3EOAB 3DUSA 4DEPB 3HMXL 2CKNA 1UYWH 2VL4A 4YX2L 1JGDA 5I1DB 1DVFC 5IQ9A 3QHZL 4QXWA 2CKBH 1I1AA 3G08B 2X4OB 5AYUH 4N5UA 4HHAB 3BDYH 5LQBH 1DR9A 4YBQD 6FABL 2W0KA 3R8QA 4G9DB 4U1MA 2EEDA 4JY6B 1XGQA 3QQ4A 4RISH 4PREB 4U1GC 4NQEB 5EORL 1ZKAA 1KNOB 4PJBB 4JN2B 2AV7A 5ADOL 1G7IB 4NFDA 3CPLB 4LSSH 1IGTB 2V5SA 4WW2C 1HHHB 3UTTD 3NCFB 4NZTH 5L0QB 5ETUB 1FAKT 4OF0A 1TJHL 4MA3A 5DFVD 5IB2B 5C0NC 1S9WB 1L7TL 2C9AA 3MJ9L 5GJSL 1UKQA 3RUGE 1N5AA 4GAGL 5EZIL 1QRND 2C3VA 4XP5H 3HZKB 4NSKA 4NQUA 4OIBA 4CU7A 4NGHH 2GYSA 2WP3T 3PP4H 4ZUUA 3ELAT 3WLWD 4M5ZH 5JNYA 3MV01 1M7DA 1UM6H 2I9LA 1K4DA 1FNHA 4YHKH 1N64H 4NDMA 1WCBB 1A4JA 3RY6A 4L3EA 3L1OL 4PG2A 5D7KD 1AGFA 3MRMA 1WBYA 2NY6D 2C3WA 2C1PA 1QPXA 3QG7H 2EDQA 4PD4J 4RGMC 3UYRH 2OZ4H 4AIZB 1MY5A 2IBBA 4QXTA 3ARFA 5CLWA 1LEKB 1W0YT 3GSWA 4XC1L 3VE0A 4PJ7E 1PLGH 1ZLVK 3ORJA 4QNPF 4UBDC 3CDYA 4Z7VA 1IBGL 1XIWB 2CUMA 2VZ1A 4HXBH 4JANA 1HHGA 1HSAA 1AH1A 2QJDA 3TFKD 1MVUA 3QXDA 5EIQA 4HXBL 1INQB 4HUUB 5EORH 4YHYB 4XPAH 3OKMB 5HGDA 3DMMB 1PKQB 4KDVA 1FC2D 3GO1L 4Q9QL 4UINL 2OMNA 5I1AA 1F11A 3CFCH 1IEBB 5EC1B 2JB6B 3I50H 1J10A 4JG0L 4KJYA 4QHLB 3UZQA 3ULVL 1MCFA 3CK0H 4LPWA 3L1OH 4Z7UB 3B9KA 4YPJA 3KYKL 3HC4L 3C60C 4H0GA 4KK9D 4EN3D 1RIHH 2R15A 4X6FA 4YHNB 1YEGH 4JLRB 4EJ1C 2EDLA 4NGHL 2AEIT 2RFXA 5CWSA 3WIHL 2W9DH 3FB5A 1OAYL 4OM0L 4D0DA 4PRHA 4WRLA 1RK0A 4PFEA 5DMJB 5FV1L 4R8WL 4FTVA 5IROC 2YRLA 2ZKHH 3BPOB 2R69L 4XAWL 3L3OB 2GKIA 3RA7L 4OF8A 1JRHI 2V7HA 1Q9OB 4LF3A 1A9BA 1MEXH 3RY4A 3LV3B 3Q5TA 5BRZA 4ZS7L 2WK2A 3MBED 1EDQA 4LEOA 2OR9L 3G6AB 3UDWA 5HHOE 5D6CA 3WXVL 2FHBA 1J05A 1C08B 1N64L 4OLEA 4L4VE 3VD7A 2GSGA 5F70A 1IGCH 2EDWA 1CXIA 4R4BA 1ADQH 2NYYD 2WZPD 4M1DH 1T66D 5IG7B 2F19H 2GT9A 4LLVB 3BP7A 3G5YB 3RWHA 4L4TB 1CD9B 4LU5H 2Y5TA 4QGYA 3MCLL 4NQDD 3VXUB 1RSFA 1ZOXA 4AT6A 4NFCA 2QHRL 1NSNH 1UJ3A 2EZ0C 1KT2A 1CK0H 2CPCA 2YEZB 1NGZA 4P3DB 4WNQB 3ETBF 3QCTH 4QWWD 3EAKA 1BFTA 2OJEA 1MFCL 5CEZE 5HYJD 3FFCE 4N90E 5LXGL 1TTFA 3SDAA 3SO5A 2D7QA 2O93L 2MCPH 2YN3A 3QDME 3K8MA 3KPNA 1UM5L 4J1UA 4ZUSB 4Z7OF 2I24N 4I9WD 2FGWH 4Y8AA 3S88L 1PJ9A 4QRRD 1EA9C 2P24A 2V7NA 1NGYB 3H3PH 1JHTA 3RWCA 1LO5B 4PY8I 2YD2A 3KLDA 4WI9A 5KOVC 4UILH 1CD1A 1X5LA 1OAXH 4YFDB 4DFHA 4Z7NF 2P5WE 3NH7H 3ZHKA 1F4AA 2E8ZA 2VZTA 3EGSA 1MREL 3WO4C 1FFRA 3SGJC 3V8OA 4G3YH 3EYVA 5IMOA 2GUOA 3LQAL 1A22B 4O02L 5C70A 5C86A 3QO1A 4UIMA 4FZEL 2Q1EA 2ICWI 5E8NA 5EOCL 4NNXB 3VXUD 1BEYH 1RK1A 3SKOA 3LV3A 4R3SA 3ZYZA 5F7LB 3CFBA 3VFTB 4LKCB 3IVKB 3DSFL 4MAYC 2PTTA 1OT1A 2DLFH 2B1AH 3DX8A 5DC0A 1MWAB 3NA4A 3OKLB 3V4PL 2FNBA 2XWBB 2V2XB 5EOQH 4E42A 3GK8L 5GS1A 3CSYB 5DD0L 3GSVA 1I3UA 2HP4A 4H26A 3FN0H 4PRNB 1NJ9B 1RAMA 1EO8H 3S37L 1RZ7L 1ZHLA 4Z7WF 4ELKA 4JFED 1RD6A 3LQMA 4TUOB 1C7SA 1I9JH 1UZ8A 4I48A 1VFOA 5FYJL 2OMBA 2VLMD 1OP3K 3CMOL 3JWNC 2X4NB 4JANB 4PJHF 2VKXA 1KTLA 1F4WL 4QRPD 5C08D 3RJQB 4HKBB 1YN6A 4PRIA 4RMRA 1FNAA 3DMMA 2PYEA 2JJUA 4BK5A 2FYYA 5DRXB 1JYXA 1OM3H 3ZDXF 4PGEB 1J7VR 2XN9B 3TN0D 3O3AB 4NWUH 1A8JH 2XG5A 4XCYB 5T3ZH 1BMGA 2FATH 3LDBB 4G9FA 5IMKA 1DL7H 3VXQA 1L7TH 4RQQB 5JXED 4LLUA 3BAEH 3QFDB 4ODVH 1AQKL 3AFLA 3BGMB 4M7JH 1FYTE 4Z7WB 1A5FH 1HIML 2AEWA 4OZGE 4IMKA 3MCKA 4PJ5D 1U8MB 4QRQA 3KJ6L 5CJQH 3C8HA 2X4NA 5SWSD 2DQTH 4P2OA 1V05A 2APBA 4S1DC 5EWIL 4ZD3L 1KJ2H 5L7XL 1L0QA 4GKNB 1T7YA 1CD0A 4U6YB 4YDKH 1S9WA 3QAZB 4DQOH 1WWCA 4ZD3H 2XQYG 4Z8FH 2MJWA 4OBSA 4OCYL 4X8JA 3U46B 4DKFL 4YHIA 3TNNA 1A7NL 2IH3A 3NA9L 3F65A 2FGWL 1JF1A 2ARJB 4M6OH 3KAAA 4G6KH 5A2FA 4DOHE 3HTLX 3ARBB 4X98B 2M8XA 5J9PA 1BFVH 5JA8B 1KPUA 3QXAA 3KPSE 4M9PA 4PJAF 3V5HA 5IEHA 3BIKB 4YE4H 1JHKL 2FLBT 4NOFA 4U1NA 2PNDA 2EH8H 1SVCP 1M4KA 3NCJL 2YA2A 2O5XH 4M48L 3SGDH 3IFOB 1WEJL 3TA3C 2A77H 1J18A 2F5AH 2UWEB 1OW0A 4LCWD 5I74B 1KPRA 1NLDL 4PTUA 2FZ3A 1NBYA 3IXTA 4P59H 3L7FA 2WBJC 2PR4H 4JO4H 4LPCA 2OX5A 3ARDD 4P9HC 4KQ4L 4UIMB 5D7SL 1CYGA 4YAQA 1YPZE 1EEYB 2IPKB 2MMXA 2VDPH 4YHPA 2F8OA 5C0CE 1OPGH 3FO1A 4OCSL 4WI8A 2GIYA 1AD0B 3GMPA 4XCCL 5F1NA 5TDNB 1WT5A 5HGDB 1LP9E 2W65B 3X13B 3GSOA 3VFUA 3HNSL 5D93C 4LSQL 2P47B 2J6EH 1DQTA 3MBEB 3GK8H 3SKJL 3K8LA 1I8MA 4MSWA 5I8KL 4U6VH 1RJLB 4XXDB 1MCNA 2VN7A 4NC1C 4OIAA 4U7SA 4BELD 5DGRA 5B3JF 1T21B 3PF2A 4L4VA 1JWMA 2QHLA 3VGGA 4GXVL 4K7PY 3C5ZD 4M7ZB 2VDRH 2OM5A 2F8VA 3VWKB 4F33B 3QNZA 1JZ6A 2O5XL 1AFVH 4QRPA 4OD3L 4RA0C 5DJ0B 5C08A 3WFBH 3RWEA 1VFAB 4L5FL 4WHTB 5CEYB 4NKOB 1QQDA 5KAQF 4NQSB 2B4CC 3V5KB 5JW4M 1FL3A 4F9PC 3SDDA 1PG7W 5ISZA 1IFHH 4N8PA 1E4XH 2X5PA 2NXZC 3JWDC 4TNVK 4ZPVB 5SWSA 2LVCA 4CW1B 3HPJB 2F74B 1ZHBB 1FNSL 4MNGB 5I19L 4W68A 2ED8A 2H32B 3MRFA 5E99H 3L5IA 1SYSA 5T3XL 1GC1H 2NY5L 1LD9A 4U3CA 1KCVL 2FECI 1U8PB 2ADGA 4X7FC 2VLKB 5IV2B 1ZV5A 4QNPE 1QVOA 4MJ6A 4P46D 4LMQE 4HFWB 1F3DJ 4AQ1B 1MHHA 5A16A 1O7VA 15C8L 3CD4A 1BM3H 1KPRB 3OTTA 4HMDA 5ALBH 4PLKD 3TA3A 2PYED 4LAJH 4JO1L 2DQIL 1M6OB 5I66B 5KVDH 1FNGA 4MXWL 4I8DA 2APVA 3S35L 3DO3A 3B5TA 4U05A 3OPZH 5CUSL 4GQPH 4GRMB 3B9KC 2WWMC 4HPOH 1K5NA 4D3CL 3PV6A 2FBJH 4ZS6C 1A1NB 3DRTB 2ADJA 4WFGE 1RZKH 3RX8A 5F7DB 2VLKA 4Y5VC 2W0PA 3FZUD 5ACZA 3FT3A 4UAOC 5DQJA 5F9OL 2EE9A 1AGDA 2LTQC 3EYVB 3S36L 5HYQB 1YPZB 4IJ3B 5CSZB 2XNAB 3LHPL 3MJ8A 3Q1SH 3IU4H 1JF1B 5GGQL 5C07B 4CBPA 5LAXA 5EZIH 2APWA 5GRYA 2EH7H 4YPGA 1CD1B 1TCMA 3EHBD 1MI5D 2R0WH 1ZSDB 3REWA 3WD5L 3P9LB 5FGBA 2O5YH 2VXVL 3PNWB 4JAMA 1PG7L 1RIVH 1RZJC 3I2CL 2HN7B 5T1KA 3C9NA 3MV9B 2P43B 1ZMYA 3TBWB 1RUQL 3O3AA 4PY7A 3NACL 4MQXC 1MNUL 3TN0A 1PYWB 2DICA 3RX7A 5BZDB 3DUHA 3PUCA 1EUUA 3DNKA 3QWRD 1CLCA 3OKKB 1F97A 4PBVC 3RKDD 3P4NB 4U2YA 4NO2A 4ZTOL 2RHEA 4NZRL 4ZXBB 2PW2B 5GRWA 2R56H 3LPFA 4WO4C 1V7MH 4NZRH 3CMGA 5GGTH 5HHNB 2GJ6E 4CMMA 4MQ7B 2ATKA 3VG0L 5EUKB 4BQ8A 1V7NH 3RGVD 4U31A 4ERSH 2GT9B 1A47A 2XRAH 3BKJL 3INUH 3R0NA 4OZ4B 1KC5L 4R4FL 3A67L 3ROLA 2FHCA 2V5MA 4PJDB 5DJDB 2AS5M 2ICEA 2ZG2A 1GIGL 1UZ8B 2NNAA 1MPAL 2F5AL 4A6YB 5I6XC 2HG5B 4Q74A 2PTUA 3SJVB 5T3ZE 4BQBA 4MS8D 4I18A 3AB0B 3MLVL 5FHAL 2QV2A 3RWIA 3BSZH 4JO3H 3KDMB 1YY8A 3A0OA 3QHTC 1CDYA 4NQEA 3LHPH 1TVBA 3PL6B 2PO6A 2VLRD 1ED3A 1FO0H 1U8HB 1RZJH 3FB8B 4JB9L 4MGXA 5JW4N 3F5WA 2X1XR 3HS0B 3RZCA 3RIFK 3W2DH 1ZANH 3H42H 3H9SA 1QHPA 4GJTB 2B8OT 4L9LB 3WEXA 2CGRH 4OT1L 4BH7A 4CGTA 5IQ9B 5K33A 3DBXA 4FFZL 1CE1L 3D85D 3BD5A 2DIJA 5D1ZB 4TYUA 1TLKA 2VABB 4KZDL 4S10A 5IK3A 4Q0XL 4Z76A 1AHWB 3RNQA 1JHTB 1DBBL 4F7MB 3H3KA 3E3QE 1HH6A 1NGQL 4UDUA 7FABL 2EZ0D 4U1HB 4O4YH 5E24E 4PRID 4JKWA 5BXFA 2UYLA 3UTQB 5FGBC 3BQUC 5CIPH 3KXFA 2QQNL 4NT6B 1D5ZB 1MEXL 1WIPA 3ULUD 1CGXA 3S34H 4ZFOL 3P4OB 4LEXH 4PRDA 4TTDD 2FL5B 3QFJB 1UJ3C 2QKIB 1Z5LA 4U2ZA 2OP4L 2R4RH 1QFHA 5HPMA 4M7KH 4KKCC 2BHZA 3JSSA 1QNZL 4XPFH 3GIZL 1VFAA 2DQFA 1Y0LA 3IDJA 3ZE2F 1U8NA 3RWGB 5KSVB 4GMSL 5GXBB 2JF1A 3FFCD 3PHQB 5GRJL 2JJVA 1JI1A 1BF8A 4K8RD 5DHYA 3N1PC 1T0NB 5BVPH 1A7QH 1HNFA 4ZDHB 3EDFA 4L8BB 4JJ5A 4WHCA 2O5ZL 4MD5B 3H42L 3HG1D 4FHBD 3TJEH 1Z5LB 4GW1A 2NR6D 4PJ8B 2XACC 4ZSOB 4H8WC 3UTSD 3VXOB 1NC2A 3FT2B 4XNYH 1WLHA 3L3DB 4KVNL 3CH1A 4IHOB 2Z8VC 1GGBL 3ARYA 1RZ8B 2W60A 2YD3A 1D9KD 4Z7NE 5C0DB 1QLFA 1RIUL 2E6JA 4Q2ZA 2BC4B 1B2WH 4AG4L 1GGBH 1LNUA 4RAVB 4HGWA 5IHZA 5CD3A 3DVGB 3S5LB 1E6OL 3O41A 4OCWL 5F7DA 1SHMA 1YNLH 3C6SA 1LEGA 1TZHA 4P5MB 4NJ9H 3S96A 3SDCB 1Q9WA 4P5TA 3DBXB 1NBVL 1UKSA 1YC8A 3SKMB 8CGTA 3RDTA 4C56E 1R3HA 1Q9KA 1QFWM 4JFHD 1DQLH 2CDEA 4KDWA 3BIKA 4X99B 3VXPB 4POYA 1IL1A 3L5XL 5HYSG 5ESAA 3MO1B 1DLFH 3W9DB 4OLWH 3V0WH 1H0DA 2BVYA 4N1CA 5A16B 3QIWC 4U3XA 5MEOA 1R5IB 4JPWL 4LEXL 1JTTA 4LQ1A 3UTTA 3GJFB 3OAUH 1C1EH 1TENA 2NNAB 4QT5B 4CRPA 2Q20A 5DJCA 4MJIE 2P24B 1MHCB 4HLJA 1I9IH 5A43C 5DLML 1U3YA 2ZUXA 3RPIA 4UDTA 4M6OL 3IJSB 4AY0A 3TM6A 4L8SA 2D03H 5GJTH 5JXEC 1R3KA 1CICA 3ZTNL 1IE5A 5C6TH 1OAUL 1JK8A 3PHOB 5I73B 2EIBA 4ZFOB 4Y4KB 1IAIL 4FFVC 2DM4A 4Z7UE 1NMCB 3MRGA 1CTNA 1HWHB 5DTFA 5DJXB 2KUTA 1FV1B 3OZ9L 3LPGA 3BP4B 4PJXA 1Y6KR 2ZG1A 5D7IF 1REIA 4P4KD 3WS3B 1J11A 3VE0B 1T7VA 3DURB 1TVDA 3QEQD 2OZ4A 1M7DB 4YDJA 4ORZC 5A2KH 1CT8A 1LK2B 3F7PC 1MUJA 1DP0A 5E00B 3VH8B 5DGQA 5KJRL 3QSKB 5EOTB 3GMQB 3O8XD 1T83C 3FB6B 4NQCB 3I6LE 4FQXA 2JTDA 5IB2A 1A4KB 2D4FA 4TOYL 3C5JB 1DBJL 5IFHL 2CR6A 5DQ9A 2XZAL 4KK8D 3HC0B 4HK3N 4HWUA 5H37G 4PTTB 1A9BB 4X80H 3QI9B 3UC0L 3ARDC 4RFOL 5I1LB 1KBGH 3QUYC 2FECL 2H3NA 1BQLL 1ND0A 3HLAB 3FRUA 5D7JB 2DQDH 2QBWA 4KHXL 1IGMH 2P49B 1WFNA 3CFKA 5D5ME 4CN6A 2HFGL 1CL7I 1A1NA 1PSKL 4D9RE 4U6TA 5I17A 4Z95H 4F9LA 1JGUH 3DIFB 1JI2A 4K94H 2HFEB 1X4XA 3HPLB 4OLZH 4PJ7F 1GHFL 3KHQA 1NL0H 2OTPA 5C0AA 5CCKL 2OSLB 4QHLA 4W4OA 4O2EB 1OOAA 3QUKA 4I2XA 2Y07L 2JB6A 4AL8H 3KYMB 3QI9A 1AXSB 4ONHA 3JVGA 5BMFL 5JXAL 4YXHH 4GAYB 3EOAA 3TBSB 3D18B 3N85H 4JG1H 1T89A 3IGAA 4GSDL 4PYHA 4U6YA 1NGPL 3PWLA 4X6EA 4OD2B 5E6IB 4XC1H 5EOTA 5HTSA 2NPLX 3VA2C 4EZMA 2L4OA 2EE3A 5AZ2L 3N1QC 4UT9H 3X12B 4HKXB 4BQ6A 1QFWL 5JUEL 1ROWA 2EXYC 1UJTA 4OI7A 5JOFB 5E7FA 4WEMB 1U8NB 3RWGA 4BZYA 4F7PA 5DS8B 1CGSL 5F89B 2D7NA 4L1DA 5T1KB 5AD0A 5EO9B 3L3GA 3LKPB 5ESQA 43C9B 4HBCH 4Z0BL 4TSBL 1INDL 4Y4KA 3S9DB 2ESVA 1SEBA 1E4KC 4IOIB 2IWGA 4TTDC 2YRZA 5JHDE 2R69H 4Z7OE 3TYGL 2HRPL 4HAFA 1PGRB 5C0ND 1ORSA 4OZHF 1MH5A 5DD5H 1S7VA 3HC3H 4RRPG 1NCAL 2YPLE 3CH8A 5EU7C 1KCUL 3WDHA 1JHKH 3N1FC 1GZQB 1QSFA 1KIUA 4IJ3C 1UQSB 2P8LB 3IFPA 3O2DL 2D3VA 1X6LA 5IJKC 1G7MB 3NVQA 3DI3B 5I19H 4LSVL 4CN4A 1MAJA 4HW6A 3OB0K 1OD9A 5JORA 4ZTOH 1I9IL 3IU3B 1MJUH 2X4QB 1U9KA 1W72L 2VUYA 3AVEA 3LY6A 3MA7A 1C1EL 3O6KH 3MNWA 1R3IL 2XTJE 3ZKXC 3I2CH 1WZLA 3EO0B 4Y5XC 3B5GA 3V0VA 4BUGA 1IC4L 2MHAB 3G6JA 2NY0D 5T1LA 3EYFB 3H0TB 1FNEB 1J0HA 4ENEC 5JMRA 1FG2B 2AJXH 2R29L