4Y19B

Immune complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
192
structure length
184
Chain Sequence
SGDTRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGVGESFTVQRRVYPEVTVYPANLLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSLTSPLTVEWRAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title T cell receptor reversed polarity recognition of a self-antigen major histocompatibility complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
total genus 44
structure length 184
sequence length 192
ec nomenclature
pdb deposition date 2015-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y19B02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4y19B01
5EBWA 4WU7A 2H26B 4JY4B 4BZ2L 3UC0L 5SWSA 1S9YA 4OI9A 3JTSB 4DVBA 2FIKA 1YEEL 5FHAL 3TIEA 4KRNA 3O2VH 2VDNL 4NNXB 1BQHB 5EOCH 5K9QG 5HPOA 4NQDD 3O11A 5T3ZE 4U6XB 5E99H 5EU4B 1YMHB 3IT8D 4XPHL 3NH7H 2FL5B 4P3CL 1WFTA 4RA3A 2GCYB 3BIAX 1ZHKA 5D96B 2PCPA 2D03H 2ICWB 4QEGA 5IFJA 1I8LA 3KWWB 2AJXL 2VISB 4TSAH 3IVKB 4GAGL 2ZOKB 1CFVH 1IAII 3HLAB 4D0BA 4AH2A 3U48A 3VFSA 5AAWA 3VFPA 2IBZY 1X6LA 5J7CC 4M1DH 4GMSL 4IEFB 2C5DC 4LHQB 5LCVH 4B5EA 1WFOA 3DX6A 1MCPL 4P2CG 4OTXL 3FTGB 2FLRT 5SX4H 3EDJA 5CEYA 1YN6A 1CLOL 4RBPH 1TNNA 4GKZB 3X13A 1CBVH 4HKBB 1YEJL 1P7QA 2Y1VA 5F1IB 3TWCL 4N8PA 3QQ4A 3UC0H 4LLMB 3X14B 4R4NC 2GAZA 4DFHA 5I18L 4M48L 1XFPA 3SDAD 3TA3D 2VDNH 4FA8A 4CN6A 3ARGC 3PIQA 4NFBA 4HCRH 1KJ2L 3MRCB 4X5WB 4ZD3H 1EPFA 4N0YL 4UOW0 3HMWH 4RSVA 4J2XA 5F9WC 1IQWH 1HHJA 1N7MH 1TVBB 2OJZL 2YSSB 1J0KA 4I5BA 1RFDL 3RDTD 5IT2L 3BKJH 1L4IA 1A1OB 1DSFH 4A6YA 3STBA 4PJ5A 3BI9X 5IB3A 3LQAH 5T1LA 4P0DA 4F9LC 3W2DH 1KB5L 4PJFB 4FFZL 2WBJD 1QRNA 1AY1L 4JANA 1FN4B 5JNYB 3NACL 4KV5E 1CGVA 4U49A 5DJDA 4Z7UB 1J8HE 3SHSA 1J88A 3RX7A 5CZXD 2YBRB 5DDHA 5FDWA 1KPRA 3EFDL 4OQTL 1NCUA 1MSPA 3D39E 4Y1AB 5HHXH 4OZIF 1AO7D 2WINB 2VE6A 3V7AG 5E56A 3ULVH 3MRRA 4HKXB 1I7TB 3MLRL 4X6DB 1F4YL 4Y16C 5TDPA 4M7KL 4XCYB 1IC7H 3AUVA 2AGJH 3ARQA 2CGRH 4MDIA 1D6EA 1RUKL 3IJYA 4QRSB 5I17B 3WHXA 1I8LC 3GSNL 3DJ9A 4UT9L 4QHKJ 5D93C 5D7JD 5D1ZB 1XZ0A 3GSRA 1JYXA 4QNPE 4CVXA 1FE8H 2OQJB 3HR5A 2XA8L 1UADC 2Q20A 5I8EA 2E9BA 3G5VA 1NC4B 4PRAB 5DK2A 1WIUA 2Y5TB 4OJFH 1EMTL 3BDBA 4OAWA 4FG6C 1G7HA 1TJGL 1SVCP 2FDBP 5C07B 3TA3B 4KJQD 3NAAH 2GK0A 4LAQH 4FQ1L 1N4XL 3EFDH 2IBZX 4M1DL 3AXLA 4BH8A 4Y5VA 1JYVA 5IW1B 4JQXC 3RPIB 3PWNA 5GRXG 3DURB 4UNTA 4MJIE 4HFUL 1MHEA 1PQZB 4YC2B 5DHVH 4Z78A 1BP3B 2OL3H 2NZ9D 3RAJH 5IVXF 5E9DB 2EDYA 5D71L 3MUGB 5E8EB 3ARGB 3V5KA 5JOPD 3B8YA 5CJQH 1QFUL 3VFVA 1X5AA 3NCJH 3EO0B 3D85D 1PBYA 1OF2A 1RU9L 5SV4A 2D9CA 3L3IB 1DE4B 5BV7H 3KYMB 5JW4N 2CLVA 2WIIA 2PN5A 4C56E 2QKIA 2DBLL 5CCKH 4UNUA 5JORA 1B88A 1J1PH 3O2WL 4MGXA 2CR6A 5J0BA 3EOBB 4NZTH 5DVOA 3MRQB 2K7PA 2AXFA 1OM3H 2DJUA 4GKNB 3DTXA 3DXAB 3L7EB 3MCG1 1KB5H 1PEWA 3CDGA 2XKNA 5I30L 1OPGL 4JKMA 1E4KA 2X4PB 5JXAH 2EYSB 1NFIA 3MV9B 3EDEA 3WKNA 4Y16A 2R2HB 4OGYL 2AXGB 3FQWB 3O6LL 3C5SA 1S7XB 3GNMH 1NCNA 2M2DA 4LVHB 3WFZA 7CGTA 4LLQA 1QR1B 2BHYA 2GSGA 5ELIA 5DT1H 1U6AH 4ZD3L 2E7HA 5CJQL 3LPFA 4H1LH 4XCEA 4G3YL 5EO1A 3VXPB 2ID5A 4X6DF 1NBVH 1JF5A 1JHLH 3QCVH 3MNWB 2Z8WC 2PO6B 3QZWG 1YEFL 4NQEB 3P9LB 3WS3B 3ZO0A 2EKSA 4PB9L 2Z92B 2H8PA 2E9WA 4WCYL 2FBOJ 3QXWA 4MQ7B 1DQLH 3OKNA 1JK8B 2EXWD 2DI7A 1ZK9A 1A7OL 3X3FH 3WDJA 1OP5H 3T65B 2R4RL 3KPPB 3ZKSD 4O02L 1KACB 5D5MA 4L8BA 5HHOA 1H3UA 4BSVA 5FYKH 1F02I 3TA3C 3H9YA 1DQMH 4TSBH 4F9LA 3CZFB 1R5WA 4P59H 5KOVC 4OJFL 1UCBL 3E6FA 1MJ7L 2MOVA 3MRDA 1BPVA 4YHPB 2Q3ZA 1GXEA 4J8RB 3P4NA 3RDTC 3IJHB 4W4NA 1U95A 4X4YB 3WL9A 3NAAL 1LD9B 4L3ED 4FQ1H 4XNUH 4DN3L 3BJLA 1MFNA 5CP3H 3MLSH 3HHRB 3JTTA 5BRZB 3BSZH 1X5IA 2Y07L 3W39B 1A6TB 5FYJH 3EYFA 3JV6A 1X7QA 2AJYL 4F58H 4OZFA 3T04D 4HKZA 4WENB 3BO8A 2LU3A 5JXEA 1DEEA 3CAFA 1OLLA 3V7AE 1IEAA 4U1IB 4U6XA 5IGXL 1Q9KB 1A6VH 1MF2H 3BZDA 2BJML 3ARBD 1WCBA 4OCWL 1HXMA 4G6KH 4PV8A 4Q9BA 4QCIA 4WUUA 4AM0A 1DEDA 4ZG1A 5B38G 1N5YH 5TPWL 1U8KB 5E6IC 1JGUL 1WICA 3NCJL 2HAZA 4LGSB 4UI2A 2HTLD 1JRHL 5MHSD 1MCRA 1XGUB 5FYKL 3IGAA 4CAGA 2NR6C 3ES6B 2RHEA 2Q86A 1FV1B 3BPLB 5D6CA 5LWYH 3DUUB 4MJ4A 3ZKMD 3F12B 5KG9B 2BFVH 4PRHA 3FB7B 5DTFA 5T1MA 1XH3A 2V9TA 5E8DL 2LVCA 4LIQL 5J8OA 3AU1B 4JO3L 3LSOA 2Y23A 4YO0A 2AJ3A 5EORL 4JGMA 3HI6L 3PP3H 4TQEL 1A6WH 1LO4L 3NIDF 2OMNA 8CGTA 4CMHC 1ITCA 4MD5A 1BVKA 3CFKA 4EI5B 1V05A 4RX4A 3PIQB 3O45A 2AV1B 3LH2H 4IIQC 2BVOA 4XCNA 1ROWA 3W11D 3MGOA 1FDLH 3RIAK 1JZ8A 5CUSH 3IS1X 5HHVL 4ZXBD 4YHIA 2JIXA 2PYFB 5DRWA 4NCC1 5F88B 1RSFA 3KPMA 2H3NB 4P2OC 4KJQC 5CD5D 2VUOA 1YPZA 1FVEA 4Z0BL 3D9AH 4LLUA 1CXKA 5LWYL 1CXHA 3QUXB 3CXHK 4KI5F 4ZFGH 1AR1D 4FQPA 4JAMB 5CINL 3G04B 4Y1AE 3I6GA 5B21A 4YXKL 3VGBA 1BFTA 3D39B 4NRZB 5ESQB 5C0FB 3L3JB 4F9PA 1F11B 5DRNA 5FDYA 5IBTL 1R3LB 4TUKL 3RTQB 4PJGA 5GGSB 2OI9B 4MAYB 1NANI 4NN7B 4WHTB 5DJYB 3CX2A 5HJ3A 3GMMA 2BSTB 1G0YR 3VWJB 3ARDD 5IVZA 5JPMA 2DQIH 5JW4M 1MELA 4WCYH 1A6AB 1XIWB 1QOKA 4JFOA 3B9EA 1XF1A 3P4MA 3CXDL 5CP7B 2R69H 4E41D 3WLWC 3MRKA 4WJ5A 1DTUA 2DM4A 2W0FB 4LCWE 4P2OB 4GW1B 5TPWH 5DQ9B 3LKRA 4N0UB 4HPOH 1LO2H 3NA9L 2MQ0A 4X8XA 4Y16D 4P59L 4Y4KB 3QWQB 3MRPB 5DJZA 1PG7H 3CSYB 2NLJA 3KPOB 5DQDL 2FWOA 5EUKB 5E2UL 1HE7A 4GXVL 4JFFE 5IBLC 4G8FB 3PL6D 4D0DA 1NDGA 2DDQH 4JPIA 3GI9L 4NKOB 5CIPA 2DOCA 5ESVA 5L2KE 4QGYA 1A6UL 4C58B 4R4FL 2FEEL 3BPCB 1A7QH 3WJJC 1H3GA 4POZD 4L4TE 4YNYB 3AGVA 3O41B 4JO2H 1JPTL 4YDJB 3UXFA 3SGKC 4WW2A 3TYFA 1GIGH 1IAKB 2VWEE 4NOBA 1QACA 5CILH 4LLVB 3DHMA 2IG2H 1ZHNA 3HAEA 3MLZL 2IPKA 1AGCB 3BN9D 1F6FB 3BUTA 3SCMA 2G2RA 3TJEH 5F1NA 4LVNC 5ACZA 4IHOA 5I75B 4Z76A 3KWWA 3ZE2E 3HAEG 4L8CB 2XWJB 3IVKA 1EHLL 2FL5A 3CVIH 2YD1A 4HXAH 2VLKA 4NN6B 5MP6H 2OX5A 1P84K 2JELL 2J5LB 3KPPA 1EXUA 5DQDH 2XYCA 4F8QA 1KXQE 3H9SB 3A6BL 4WTZG 3SDXB 4YFLI 3TVMB 5GS0L 5HHOE 4XWGH 3P9WB 2NW3A 3IJSA 4LEOA 3MXVH 3JVGA 1NDMB 4HDIB 4YEFA 3LKQA 2OP4H 3QDME 4TUOA 5E7FA 4I2XB 2HVKB 1TDQA 3WFCL 2VKXA 3IDNA 1A6WL 1LO4H 2Q76A 3IDJB 2AW2A 3QHTC 3SO3C 1T7VA 4NYLB 4LMQE 5FOBB 2UWEF 1DN0A 4M5ZH 5JHLH 1NSNH 2YEZB 2WBJA 3TNMB 2GSGB 1ZLVK 1BM3H 3O2DL 4PGEB 3AFLA 3GKZA 3VWJC 2A83A 2O93L 1AXSA 1NGYA 4Y2DA 4M43L 4QXUL 6FABH 4JN1H 4NQCB 4X98A 2P1YA 5DJCB 3NTCH 2CPCA 1EHLH 2DLGA 5L88L 4PGDA 1LK3L 1XR9A 2N1KA 2X42A 1J10A 3J8F7 2Y72A 3UZVB 1CD9B 1KIPB 1J11A 4G43A 1MI5A 4IBLT 1A22B 2IGFL 1T0MA 3QG7L 4NBZB 5TF0A 4FTVA 3GMPB 5JQ6L 1BIHA 3QFJE 1H3TA 3BKCH 1A7PH 2R2BA 1JNNL 3HB3D 3ZTNL 5L9DH 3GRWH 5DFWH 1NC2B 3VD5A 1BQLL 2P45B 2DQHL 1FFRA 3WJJA 4YFEA 2DWEB 1FN4A 3FN9A 4X7TB 3X12A 2HJFB 3QQ3A 2X44D 4OLVH 2GFBB 4JG0L 3VD7A 4J3WA 3GI9H 2VR5A 1SBSL 1KBGH 2VDKH 3NCYS 4YWGL 3GSXA 1IAOA 2YZ1A 1ZEAL 1HHJB 5DK3A 3VDAA 1M7DA 2VABA 3QDAA 2DLEA 4PR5A 3FRPA 4OLEA 1CWVA 5F7DB 3VJ6B 3BD5A 2P24A 3GDBA 1BLNA 2OR9L 5DC0A 4MNGB 2IH3A 5IW6B 2EE6A 2K9UA 2W9DL 4WO4B 1OQXA 5GSRA 3KPRB 5I1HL 4HX1A 3IFNL 4JM2B 5BXFB 4XBGB 3QRGL 4NM4L 1BOYA 4XMLL 3MV7E 4P23A 2YK1H 4XMPH 2YHGA 3VD9A 3E2HB 4OT1H 4Z7UA 4HKXA 3GJEA 5GHWH 4X80H 1QSEE 2A73B 3MA9L 4JLRA 4OCYL 2X89D 4U3XA 4DCQA 5DUMH 1BEYH 3RDTB 3PJSA 1XH3B 4WV1C 5C0BA 5C0ND 2ICES 1NGXB 2KL6A 5E4EB 5E2WL 3TT1H 1SJHB 2YC1B 4XCYA 5EOTA 1RZJH 2DLTA 2Z31A 2W91A 2V17L 4MXVF 3VDBA 3HRZB 3SGKA 3MRLB 1KELL 3BGMA 5B38A 1F8TL 4NC1C 1XCQB 4LKXA 2ED8A 1LNUA 4OUUA 1XAUA 4Z7VF 5JLZB 5F7HA 2D7TL 3QDGD 1QVOA 3CFCL 4R26H 4YDVB 5B39A 1ZGLM 3CUPA 2CDFA 5HHMD 1Q0XL 3CVIL 4P2YA 3GKWH 4HMDA 4YAQB 1KC5H 5MP6L 3GBNH 1VA9A 4ZNEE 2PXYD 4U05A 4JM2C 5T1DH 4U1LA 3GIZL 4GW1A 4JRYB 1W72A 4OKVA 3B2VL 1HEZA 3JWDH 1F90H 2XTJD 4JHZA 4CMMA 4DTGH 2HTLC 1NPUA 5GS1A 1D7FA 1UVQA 4RDQF 3PNWA 4FP8H 5GZOD 2CSPA 1BFSA 4PP1D 2GHWB 1KB9J 4LPYA 2PR4H 3RVTD 4L9LC 2BVEA 4HHAB 5H94A 1WISA 2AEIT 1BAFL 3P9LA 4GUPB 3MRNA 3DO7A 2BDNH 4LLVA 4M3JA 3ESVF 3VRLF 3HLAA 1I3GH 2GW5A 3DOSA 3V5HB 1T66D 3VH8A 3FAWA 4JDVB 5DFVD 4LCUA 1CD1B 1N64H 1A2YA 5F7FA 5I8CA 4RAUB 1MFEH 1IARB 5I1KL 3HNVL 2HKHL 3S37X 1A6PA 4Z7OF 3CVHB 3CDGB 4RIRB 4H26A 5IHUH 1D5IH 1OP9A 15C8L 4W6XB 5LXGH 4RGOL 1H15A 1MFCL 4FFYL 2X4NB 3BUYA 1AQKH 1I8KB 3RZWA 2AK1H 5DUML 4HGMA 1MCBA 3O11B 3SOBH 1CF8L 3OKKA 1I4FA 4O5LL 5D1XC 4EJ1C 2A6KA 1TZHB 1YN7A 2OTWB 1RD6A 2Y6SC 3C6LB 2IANA 4PGEA 3D3VD 4HULB 4EI5C 3SKOA 2EO9A 3MV7B 1I3GL 4HSQA 1Z6JT 1HXMB 3VGHA 1MLCA 3QO0A 4LCYB 5HY9B 5DJCA 2Y06L 4JJ5A 4AENA 3VW3L 4JG1H 5I16B 1X5FA 5I1HH 3QWRA 1SY6A 5EB9A 2XN9B 3HE7D 5FKAA 3CC5A 4NM4H 4XMLH 4XTRD 5I1KH 1Q0XH 1YY9C 2D7PA 2HT3D 3IRZA 4JY5H 4EI6A 3QIBA 3BKJL 1KIUA 2NY5C 5DRXB 5SWSE 3VFMA 1OCWL 5C07A 1QFWI 3HI5L 3HC0A 4AK1A 3UTPD 1S5IL 1JYNA 1NDMA 2ZZUT 3RWJB 4RRPA 4UT7H 2PO6C 3GHEH 5HDBF 1QPXA 2NY3B 1K3IA 5C9KA 1JPFB 1XF5B 4HWBH 1RZKC 2HT4D 5SWZE 4OZGF 1KYOK 3T1FB 5HHXL 1VEPA 5EOCJ 5C92A 3MJGX 1GJIA 3P4OB 4AL8H 1ZWIB 5I8EB 1BJ1H 1IEBA 2PW1B 3FB6B 4UIMA 3MYZA 3VW3H 3EYQC 1XIWC 1T5XB 2BSSA 4PJFA 3BH9A 3RWGA 2NMSA 5CAYB 1EFXD 2Z93A 3WEXB 1UC6A 1SEQL 4G6JL 1KT2B 4G80B 4KQ3H 4PJDA 3MO1B 5D96C 2VXQH 4G8GE 4WFFD 5L6YH 5DMIL 1AKJB 1R3HA 3VFUB 5GJSH 1RZ8A 3BRFA 3KR3L 4KVCL 2QBWA 5CBEA 2BNRB 5MHSE 5F7UA 5EBMA 4JFXB 1DFBL 3MLXL 4DKFH 1L9MA 4RRPG 3S5LG 4EQ2A 3QUMB 1L0XA 1MHCA 2R29L 1CGTA 4X8JA 2YUXA 2X4PA 3HRPA 5TE6H 3WIFB 1UM6L 3RTQA 4L5FH 2BMKB 3PJSB 3WXWH 1W0YT 4JM4L 1N4XH 5GGSA 5L7XL 4HPYH 3K8LA 3OAYK 5FA3A 3IF1A 4GRWE 3WLBB 3IAGC 4U31A 5HDQH 3KHQA 1GGTA 4P2QE 2Z31B 4M4RA 1MCOL 1KTLB 1YDPB 4WFHD 2VDQL 4NZRH 5DJYA 3BPOB 5T1KB 4F3FB 5JORB 1U8IA 3B2UD 3QYCA 4KGJA 5DJ2A 5TDNA 1OP5K 5K9KB 3EO0A 4JN2A 3W0WE 3B9KB 4ODWB 4UQ2A 3QJFB 4IMLB 1MCWM 1KCVH 4IRSC 3O4LB 1QFUH 3FO2B 1TJHH 4O4YL 4QRUB 3VFWA 3CFJB 4WEBH 2C4FU 3CIQA 4L8DA 3RPIA 1U8JB 4EXKA 4OFPA 1P4IH 3S6CA 5KS9F 3K2UH 2EYRB 3BEWB 4Z77A 3R1GH 4UBDC 4Z0XA 2W0LA 5A16A 4PYGA 5IHUL 4EUPG 4YHZL 5CJOH 4LLDB 4GJTB 4NWTL 3MV01 1BQHA 4NKDB 2LAAA 3IDGB 1NGZA 4JGUA 4X4YA 3C08H 2V2TA 3ZTJH 4O5LH 3HI5H 2VLRE 5FA4B 3SCMD 1RZIA 3CU7A 3N1GC 4DKEH 2BZDA 3MNWA 1QKZH 2XN9E 3MLVH 4O58H 2QADD 3WUWB 2X1PA 3TBVB 3RWDA 5HYEA 3Q6FB 5FB8B 1BGXL 5ANMB 4MLIA 5ICZB 4TRPH 1MH5A 3B9KC 5D1XD 1NCWL 4N0CC 5JPNA 1HQRB 1VFMA 2CRZA 2E8YA 3HFML 4CNIB 3VXMB 3MRIB 5IJKA 3EBAA 4D94A 4GRLB 5CJOL 3T0EC 1A7NH 1XF2A 2V2WA 4MAYC 3QIBC 4LPVA 1UB6A 5TDOA 4ZFOA 2ITCA 4PV9B 4I18C 2VMFA 4OZIE 4QHMA 1P9MC 2J3SA 1NLDH 1M7XA 1UG9A 4H5SA 3VXRA 3B5HA 3WFHA 3BQUA 3JWNC 2HT2D 4S1RL 1IGMH 5FCUH 3WFEL 4OCMC 3LS4L 1LEIA 2BXYA 3QXDB 2OI9C 2N56A 2ZP0T 1EEUA 4PJ5B 5CGYC 3ETBF 4QHKI 1MNUL 1ZT7B 4RGND 1OAQL 2J4WL 1DN0B 1UQSB 2NY0C 5FHBL 4PP2A 1G7IB 3BSZL 3HE6D 2ZUXA 4ZAKA 4LCWB 1XEDA 4FTVD 4W68A 2C3VA 1QA9A 1TMCB 4J4PD 1UACL 1NC4D 3MJ8A 4HJ0C 5FGRA 5C0CB 3WO3B 4PP1C 1FP5A 4JDVA 3O6FC 4HDIA 2B1HH 3Q6GH 5IGXH 1P6FA 1L0QA 1G9MH 4HUKB 4WEMB 3SE4C 2AK4E 3CC5B 2G9HB 2YD3A 3D18A 3GZKA 3NPSB 3QA3B 4EZMA 4FZ8L 5IUSA 4KK8C 2JJTC 3PWLA 4OV6F 4EDXB 2CR3A 1QRKA 4JPVH 1AE6L 2QSCL 2W07A 5INDA 1GGUA 2HJLB 4JM2D 4R96A 4MZ2A 1NCAL 3TT3L 3V2AR 5L8KB 4AIZA 2VRAA 4X6DA 4C54A 1CXIA 3RVVC 4B50A 4PJ7B 1T83C 4O00A 5JW4R 2NY4B 3VXRE 4X6CF 5CBAA 2VDPH 3NZ8A 2NCMA 4NO0D 1N0XH 1X5HA 4MJ6A 3AS2A 4EUPB 3HI6H 3MREB 5KSAC 4FTVB 1PYWA 1FYTB 4P46A 2OQJA 1ZA3B 3MV7A 1YA5A 2CLRB 2CJUH 3I02B 5B3JF 2AABH 1TJHL 5EO0B 5CEXB 2X5PA 3OGCB 1FNLA 4WEBL 1C1EH 3QEHB 3RL1B 3BHBB 1P4IL 1NCCH 4PRHB 2I9LB 2P8MB 4MNQE 3C8HA 4NQXB 1IQWL 4GRLC 1EMTH 2Q8BH 3ROOA 4PRIA 4XNQB 2VZTA 3V5DA 5IT2H 2Y36H 2V9RA 4C56B 3BQUC 5K9JL 3SGJA 1OTTC 2A0LC 5F6IB 4X9BA 3PGDB 4J3UA 4TNWK 1JUFB 2F54B 3F7RA 1OF2B 3MUGA 3PWVB 4NPYA 3VXMD 3KG5A 4G8IA 2CLVB 4PJAA 1CDIA 4IOFD 4WI2A 5FYLH 5HGAB 4JKLA 4I48B 3MRMA 2Y7QA 5FUZH 2HWZL 1JPSL 4HIEA 3DPBA 4WO4A 5HJ3B 3EYQD 5DRWB 5JDJA 3VWJA 1X4YA 3SKMB 2CLZB 5KVDH 2NNAA 2R15A 4RWYL 1VKXB 1ZWIA 3CK0L 2AABL 2QLVB 2GSIA 5FFLA 4QXGH 1KJ3H 3VG9C 1OAZL 1R3IL 4H0GA 5DMGC 2ZCHH 3KJ6L 3BH9B 3ILQD 1GC1C 1LHZA 3QT2A 4L8CA 3AROA 2FZ3A 1CFNB 4JAMA 1W0WA 1U91B 2YPVL 5DHXB 4HV8B 2PYEA 3GJEB 2W92A 1S7XA 1IILE 3NPSC 2DQGH 3OSKA 1K4DB 5GGQL 4M62H 3G08B 1JZ7A 3HUJA 4BSWA 4C4KO 5IMLA 5GS1B 5EC2B 1IGFL 5JIHA 2WBKA 4PJ9A 1KFAH 5DO2C 5A16B 3W81A 4U6HB 3RJDA 1QR4A 4YDJA 2X4RA 1KB9K 5MEQB 4HBQA 2DQCL 3ARDA 4PD4K 1XCTB 2P5WB 3H3BC 2Y9RT 5FYLL 4XZUA 3BPCA 3SCMB 1K6QH 5HDOA 4JE4B 1IKNA 3W9DA 4X4MA 1QP1A 4PB0H 4JO1L 3IF1B 5FHBH 1S3KL 1U6AL 4JZNB 3NA4A 1U58A 5DEFA 1X5GA 5KW9H 3FOLA 5C09D 4AYFA 5MENE 1KJ3L 4HG4J 2FJHB 1R3IH 2H2SD 4KROB 4R90H 1RUML 4H1LA 2BRQA 1VFAB 1YY8B 2R4SH 2R2CA 1TQBC 1ZVSB 1SEBA 1CGYA 1IFHL 4LPWA 4RBPK 4UQ2B 3TVMA 1UKQA 1OTSC 3GUTB 4FRWA 3D5OF 4ZFZB 3PL6B 4GAJL 2R4RH 2KKQA 5BW7C 4LDEB 2EC9U 4LP5A 1E0OB 1WF5A 3BN9C 4WW1B 4ODTH 3KPQB 3H9HA 1TZIB 5J89A 5BQ7B 1SJVA 3RZCD 3KPSE 5GGTH 4J6RH 1FZOA 3MZTA 1L6ZA 2CRYA 2Y36L 1HH6A 3KLDA 2YS4A 1ZHNB 4CVWA 2X9WA 3CZJA 4L8SB 5EU7C 4HKZB 1TVBA 4JFFA 1T83A 2GJ6E 2PTVA 4PRID 3DBXA 5I1IH 1MHPL 5JO5A 2C4FT 3S97C 3MV9E 4RAUA 1GZQB 4P48A 4YHNA 1I1CA 1NFKA 2DLFH 4K7PL 4LCUB 4M6OL 1WEJL 1HHIA 3RTQD 2P5EA 1RZFH 1EZVX 4OF3A 3S37H 2IH3B 5IW6A 1EGJL 3BZ4A 3DGGB 2XZQH 1NBVL 1NJ9A 3IJSB 4FXGA 2R0KL 1EFXB 5GZOC 4JY6A 1R5VA 5JHDD 2Q8BL 5JHDB 2X4UA 3QISA 1F4WL 5D7LA 5EZJA 3T0XA 3TN0A 4NRYB 1FSKB 4ODXB 4JPKH 1E27A 1QHOA 3HC0B 4ZDHB 2ADJA 2P8PA 1CK0L 4YJZL 3UTSB 4LPXA 3O8XC 3RU8H 5EU6A 4PJFF 5CJ8A 4YFLF 1U93A 2LVEA 3TYGH 3WNKA 1YN7B 4JJ5B 4JZJA 3MBXH 2XN9D 1S78D 3RVXD 5BJTA 1A6ZB 4BZ2H 2VXVL 2V7HB 4P3DB 3QI9B 4EQ3A 3SDDB 2RR3A 3V6OA 1SJEA 4GT7A 4K9EC 2OXGA 1FYHB 4HIJB 1SBSH 2VDKL 1J5OH 1PLGH 4ZSOB 5AZ2H 5I16A 3G04A 1CTOA 2F53D 4JFQA 3D3VE 1F97A 1QSZA 3OAZK 4XP9L 1Q8MA 4HMEA 1CFSB 1WCQA 2AEPL 3RX5A 3TP4A 4MA7L 3ULUH 1W72H 2EDFA 3MCKA 3K1DA 1TENA 5C0FA 3ZL4L 4WUKL 2A73A 1ZKAA 3VFUA 2HRLA 4HXBH 2NXZB 4Z7VE 4G7YL 5E7BA 4RAVB 2HJLA 4BZYA 2R1XB 1MQ8A 2Q7YB 5HYJA 2R23B 1IEHA 2HFFA 1S7UB 4WW2C 4CADA 3LEVH 5L0QB 4XC3L 4HK0A 4ZTPH 1NBZB 4XP1H 5E2WH 1I9JH 3QWOA 4XGZA 2P5WD 5D7KE 4A6YL 5ECJE 4MNHB 3UTTD 4F2MB 5ITFA 5ALBL 1F00I 5GZND 5ISZB 4FG6D 3QJFA 2EDBA 3DROA 1ED3A 1T7ZA 2B5IB 4Q9RH 4XMKL 1D6VH 2OR7A 3UYOD 3ZHLA 3VFWB 5HVGB 3KNBA 3K74B 4KKNA 1HKLL 3P9MB 2EECA 3V6ZB 5IBUB 2ZSVA 1EZVY 5C0BD 3IDMA 3ZYJA 4D9LL 1K8DA 3K80A 3VXTA 3FO2A 4GO6B 4MXQD 2AXGA 1GGBH 3GMOA 4PUBL 4MA3A 4LLDA 1B2WL 3GBNL 3TYFB 1HEZB 1G0XA 2BNQB 4ZUVA 5IMMA 2AJXH 3C5ZC 4Z77B 4XCEB 1P1ZB 2VZSA 5B8CB 4GXVH 5EIIB 3QDJB 3PNWB 5LAXA 3Q5OA 2MKLC 1QLRA 2PO6A 4NQEA 2EDOA 3WS3A 1TPXC 3GMNB 4LBEA 3FB5A 1UA6L 4LLWA 1C16B 4GG8B 2XKSA 3V6OC 4CDHA 5AZEL 1EFQA 2ZPKL 1P2CA 5E6ID 1Q9WA 4LQFH 4NUJA 1UM4H 5I71C 1GCFA 1DP0A 1F2QA 5HVWA 4XVUD 5D2LA 4X83A 4YXHH 1IGCH 5CSGA 3R0NA 2Z8RA 2EC9T 3C9NA 1QSFA 2VXVH 4ONFL 2D9QB 2FIRT 3O3BA 1Q94A 5AUMB 4P4RA 4HIXL 3QEQA 3S37L 1VHPA 3AS3A 3MCLH 3VFOB 3NABH 3O0RH 2NY0D 1X5JA 4OI8A 5TQ2H 3KLHD 1EEZB 2GITA 3H9SA 1CDJA 4N0YH 3EYVB 3MV9D 3NCMA 3SDXA 3FRUB 3BX7C 5E6YA 3TFKD 2Q76B 1KJMB 1T5WB 4XPFL 4E0RB 1XF4B 1O5DT 4PRHD 2JELH 4UT6L 3UX9B 3G9AB 2B8OT 5F3HB 3L6FB 3LB6D 5C6TL 3DUSA 3OR7B 2P5WE 4G9DA 2AEQH 2DI8A 1I3VA 5IOPA 3BUYB 3CSGA 4LKCB 2X4OB 3KYAA 4GOSA 4C57C 5I1JL 1RUAH 4E41A 4U7SA 4X6EA 2PXYA 4FQHA 5TH2A 4OLYH 3GBMH 2CK2A 5ANMA 5BMFH 2KQMA 4CL7A 3HZYB 1RURL 2JIXD 1J0JA 3RWIA 5DEGA 3OZ9L 4ETQB 5HI4C 4ELKB 1C5DB 1XGQA 3QAZB 5DQJA 5A2IH 1PZ5B 4HUUB 1MI5E 4G8GB 4QHMB 2LU4A 4W4OA 1QBLL 4K3EH 4Q9RL 4X7TA 3X12B 3L3HA 2X7LB 3L9RA 2GFBA 3PXHA 4ERSH 4TNWF 3O2WH 3E8UL 5E08H 2EDDA 2P7TB 3EOTL 2BCKA 2NY2C 1TVHB 3NOIA 3NCCB 1GGBL 3RKDD 1NC2D 3G6DH 3DI3B 3SBWA 1IC4H 4LARH 2E27H 5HYQA 2IAMD 5D5MF 5DJ8B 2QQLL 3ARED 2IANB 1T2QH 1FO0L 1OPGH 4LHUB 2K7QA 1MJ8H 4ZNCD 1DUZB 1MLCB 3VFGL 3V4UH 3NCFB 3R8QA 2A6JB 4PP2B 4PS4L 4MSWB 3VWKD 1ZS8B 4P57B 4X7CC 5AZEH 1DUYB 2BC4B 4YHKH 1RK1B 4HWBL 4MNGA 2QQQA 4HUWA 3QDHA 3GSOB 1AKJA 2VLLB 2VLKE 2FO4A 3QO1B 4KJYB 2BVUA 4OV5A 5KVFL 4YE4L 1TQBB 3NIFF 1W0VB 3WN5C 4YDIH 3QNYA 1LE9A 3MV8B 3ZDXF 5KSUB 3I02A 5ESQA 4P5TD 1B2WH 4PG2A 2WNGA 4GRWF 3QIUD 5DMYA 3PHSA 4EDWH 2UUDH 5FYJU 4HUXB 2IF7A 5C7XH 2NY6B 3SY0B 5GS1C 4WWKD 3UEZA 4ALAH 3VGAC 3PP4L 4U1SA 2GJZA 1SJHA 2CK0L 4KJWC 1J8KA 4MB5A 4M1GH 1BEYL 2VDRL 2PXYC 3BT2H 1E4JA 4PJ7A 1YECL 2X1QA 3BKCL 1WV7T 4U1KA 2FJGA 5FM5M 1H3PL 4MDJB 4XP5L 5F71A 1MFBH 1U41A 1LP9A 4IDJH 5ADOL 5IB2A 1Q1JH 2BHUA 2JK5A 4M02A 4CVXB 1PYWB 2YA0A 4LIQE 2XWBB 1U8HB 4L9LB 5INCA 1QQDA 4FQ2H 1UWEL 3T4YA 3CH1B 1B3JA 3FT2A 3VU2A 1A3RL 2D7QA 1F6LL 3VGGA 1FNGB 4RGNB 1BHGA 5TDNB 3F7QA 1I1AD 3P0VH 3ECBA 4FMFA 1MFAH 3C2SA 1I3RB 1X5YA 1NQBA 3G6AA 2BJMH 4JFQB 5CD3B 3M1BB 2EDKA 1UH4A 5C0NC 3PGFH 1NCBL 4XVJH 4U1JA 4UT6H 4XNQA 2F54A 4NPYB 4R6UA 5I1GH 1J9CT 1JWSB 3O2DA 3RVXC 5IR1B 3VXMA 1M6OB 3LKPB 2BMKA 4CKVX 5DD6B 2AAVA 1EJOL 1RZ7L 5C0DB 3T0VA 1IL1B 5EWIL 2MFNA 4NKIH 5T1KD 3CDCA 2ERJB 4PLJD 5C09A 2P43B 1BJ1J 4NIKB 5IKCA 5KVMC 4LHJB 3MGTB 2VZOA 2CQVA 5EORH 1U58B 4O2CB 3TWCH 3W5MA 4MS8C 4NQDB 4U1HB 3WFDH 2WWMD 4ZS6C 2IH1A 3VFVB 5I2IA 4L4VD 3CVHA 2O5XH 2HKFH 3SE3C 1OWRM 5C0CE 5ICZA 4CNIA 3B83A 3HZKA 3M17A 1JNHA 4NO5B 1FDLL 4KDVA 5GGUA 5I1LB 1G6RL 3WDHA 2YOCA 3P77A 4JRWA 5D2LE 1N7ML 2OJZH 4AEEA 5CSZB 4EOWH 3LKQB 4H26B 3WUZA 4Z7WA 3EOBA 4J4PC 4TNVK 1MF2L 5E94B 3RWEB 4K23L 4XPHH 5EH1A 3AY4A 1JWUB 2X4RB 3H7LA 4OBSA 4AIXA 2ZNXA 3ARDB 1X5LA 2BY3A 4JZNA 4KK5D 4PRDB 3REWA 5DJ6B 1EERB 1MREH 4HJGB 3QHZH 4LCYA 3CFDB 1ETZA 3DV4B 1RJZB 3STZA 4PY7B 2FGWL 4ZOCA 2DQUH 4PG9A 1V3MA 3RUGA 2XZAH 1SY6L 3V4UL 1NLDL 4P5TA 4JHAH 4KRPB 5IBTH 4PS4H 1OW0A 2WMPA 5FKAB 1JF1A 1JPGB 1JK8A 3T4AB 3ZT6A 3ARBA 4XP5H 2L7UA 2M26A 3Q48A 1KIPA 4BM7A 2B1AL 1F4YH 4JO3H 2NZIA 4MWFA 1G7IA 4XPAH 2ZUYA 4U0RC 3DRQB 1WWWX 3UTZB 5H37H 5DZLA 5KAQG 4I9WD 3MOQA 3AM8C 3F5WB 3FQRA 4YDIL 3KPRE 5T3XL 5L8JB 2PTTB 1BAFH 3EO9H 1K5NA 1OGAB 3RWJA 2ITCB 2VDLL 2ITDB 4TUJB 1HHIB 4XXCA 1BJ8A 5IK3B 4YHYB 1YEGL 4KK6C 3MJ7A 1JV5A 2QR0A 2I9TB 1SYVA 2DIJA 3QEGL 2EE2A 1Z9LA 1DBKH 1D5BB 1PG7L 5JO5B 1EHXA 4LASL 1QO3A 2VE6B 3NZHH 1IGTB 1MFEL 1F6AB 1CICD 3D2UB 3SJVE 3C60A 1RZ7H 5DVNA 4UMGA 1BVLB 5ADOH 4JQIL 4BQCA 1JUFA 1MEXH 5SX5K 5EWIH 3GB7A 5BRZA 3UZEA 5KVEL 2MQCA 4NKMA 1D6EB 1A6TA 3MRFA 4JGJA 3TT3H 1JPTH 3L3OA 3QQNA 5IWLC 1MHHA 1AQKL 2KQNA 5J13B 2IALB 3QSKB 5DWUL 5GSRB 3OGCA 4BFEA 1A4JA 1QLEH 4P46B 1VFBA 3GMQA 3VXUE 1A1OA 4A6YB 3HZMA 4P23B 4FFWD 1E27B 3L3KA 3SDDA 4YDLC 3TC9A 4POZC 2EYTA 4KJWD 2BNUB 4JCLA 4U6TA 5E2VH 4PJXF 1RU9H 3MUZ1 1SEQH 3L3HB 1VPOH 2MCPH 5IQ7H 4B53A 1DQQB 4JFXA 3ALXA 4QWWC 4MVBC 3SGEI 4OZHF 3L5XL 3KR3H 3MRBB 1QTYT 4PJBA 2AS5M 3RNQB 2VN4A 3MRGA 3HE6A 5GGTA 4NKIL 5AWNL 25C8L 4XBEH 5KSBE 1H3WM 4BQ8A 1CQKA 3GFUA 1X4XA 3LCYA 5LKNA 3T09A 3UTTA 4HEPG 4LPTA 2Z8VC 5I30H 4QF1B 2DL2A 2VITA 4XRCB 5D7LE 5IM7A 4QOKD 4QRTA 4LF3B 4J12A 2BVPA 1NBZA 4MDJA 4HMCA 5GGVL 3CFJA 3OG4B 2DQUL 4UOJA 4UTAL 3VXSA 2UV3A 3GSRB 4OAWB 4ENED 2XZCL 5E70A 4GW4A 4JRYE 1EUTA 4Z0XB 2I9LA 2P8MA 3OKLA 4F7MA 4U1GC 1IGJA 5K59F 4UILH 3RVUC 1JN6B 2R9HC 2B20A 4XPTH 1T1XA 4EOWL 5DUBA 2DWDA 3MLZH 1W0VA 1NLBH 5D7IF 4ZFZA 1UKTA 1BQHG 4UUJB 4EN3B 4NZUH 4U1NB 1FFQA 7FABH 2UZIL 3HI1A 3GSWA 5EN2B 4WI9A 4L3EE 2H26A 2EDTA 4WW1A 1I7ZB 2IADA 4YHZH 1TZIA 3SKJH 2GK2A 1CLZL 1NCDL 4LCIL 1QLRB 3KPSA 5D4QA 4Z18A 1NFDF 5IV2B 2QTEA 4XVTH 1UWXK 1JRHI 3U46A 4G6AC 4Q6IB 3TO4C 2G60H 5M94B 3TBVA 3U30C 1EDQA 2DKMA 2HYMA 1N59B 5IVZB 4WGWB 3AREC 1MJJA 1K6QL 3SDDC 2XWBA 1MIEH 3ARBC 3FOLB 1YMMA 4ZFOL 5TE4H 1U91A 5L7XH 4NRXA 2AJYH 5BOZG 4Z95L 4PJHF 4KUCD 3MYJB 4U0QB 3OKDA 4FQCL 2BNQA 3GNML 4ZUVB 5DURB 4AJ0A 1G9NH 3G08A 1E4WH 2VDLH 3O6FA 1NCWH 4B41A 1KSRA 4ODSH 4PGCB 3IDMB 2NY2D 5BZDA 5FGBA 4YPGB 5HPMB 3FQTA 3LY6A 6FABL 1YN6B 3MOBL 1NMCB 2FX7H 1BBDH 2W1NA 4NO3B 1DL7H 4J8RA 3L6FA 5F7WC 3H42L 4I0PA 3G9VA 3MV8D 2JJTA 3ORJA 3THML 3ZDZE 2GI7A 5J6GA 3WV0A 2APXA 4LVEA 2I27N 2XTJB 1XF4A 2HLFD 3ET9F 1G7PA 4D9QD 2A6IA 2APFA 3ALPA 1QD0A 3U7YH 2NX5D 1JVKA 4ODTL 4PJCE 1JFQH 1G7LA 2LU7A 1BOGA 3DUSB 2PXYB 4FQHB 1YNTB 1GZQA 5GRWA 4LIQH 2X4SB 4FQQB 3QG6A 3VWKB 3I6LE 2FB4H 3QIUA 4X4XA 2HN7B 4KTYA 5HHMB 1BFOA 2CIIB 1J8HA 3TZVB 4EUPH 2V7HA 1MVUA 3WMSA 3P0YH 1MIMH 3QWRD 3V0AC 1TIUA 1U8KA 3JV0A 3PWPB 3OKMB 4EI6B 3FKUS 4LCCB 3T65A 4ELMA 1FIGL 4K94L 3LPGA 4JANB 4JFHD 3RGVC 1Q38A 2CRMA 1MRDL 3SN6N 1LO0L 3AMLA 1T6VN 1JZ2A 3H9HB 2NW3B 3VGEA 4Z8FH 4IM8A 2B1HL 4EN3C 1U8OB 3F12A 1AO7B 3CCHB 4PJAE 3IDNB 4CUCA 4IRZL 4E41E 5F1KC 1FG2B 1KLUA 2QSQA 4LLAA 4NO2A 2F5AH 5ACLA 2E6JA 2P42B 4NN5C 1IEAB 1QNZH 4JPVL 4U1IA 3MFFA 1FAKT 2XRAL 2YD7A 2WUCH 3DVIA 4JFPA 3LIZH 4M03A 5L2KD 1X7QB 4AM0B 2IQAB 5MEOB 4LSTL 2PW1A 1INEL 1RJLB 1FVCB 2FX8L 4RGMB 1QSEB 4JZJB 5AAMA 3E3QE 1CDHA 3HC4H 3SE8L 2XZCH 1RZKH 5DA4A 43CAA 3L5HA 3T4AA 4WHYH 1MCWW 4N0CD 4WEUD 2V7NB 3PGCB 5E2TL 3WFBL 5C0CD 4YLQT 4NNYB 3F62A 3C5ZD 1HDMA 3HG1B 1MCKA 1XGPA 1RHFA 1S7QA 3DYMA 5IROC 4LCWD 5C2BL 3VG0H 3BIBX 3WNNA 1OOAA 5T3XE 1H8SA 4H0HB 3TN0B 4X5LA 2ZOLB 1MNUH 1G6RB 4QTIH 1IT9H 1FPTH 1JP5A 1NC2A 2F8OA 2BNUA 3DNKA 3MX0A 4JVUA 4TVPE 2IPUK 1NKRA 3QPQD 3MLUH 3BH8B 3GMPA 2ATKB 1Q72H 4P9HL 4HIEB 4DZBB 3LRSA 3I75A 1U9KA 1OT1A 1WZ1L 2BY2A 3G5XA 2AJZB 1NEZA 1ORQB 3T2OA 4G8IB 3VI4E 4QHNA 4MDIB 2SEBA 4R2GB 4RAVA 5HYIA 4TYUA 1NC4A 4P2QA 1KULA 1BVKB 3CFKB 3GSOA 3Q2CA 5CSBA 1AD9A 3U7AA 4MVBD 5SWSD 1FL5B 4Y8AA 1XGYL 2VABB 4U3HA 4CADB 5DYOB 4KDTC 4XCNB 5I1EL 1ZHLA 3SDCB 5E6IB 2BC4A 3QNYB 1YJDH 1YQVL 4GG6F 4YHMH 5TE4L 4JHWH 4LSSL 2FB4L 2Y5TA 3LMJH 5C0JA 5KSBB 1ZHBA 1MQKH 2Z4QA 4FQXA 1EBAA 1G9NL 3L3IA 3KHOA 1QSFB 1HI6A 1KXTB 4ZOBA 4TUKH 1DJSA 1I9JL 1OQOA 3TJEL 5H35B 1C5BH 2XXMB 2Y06H 5D7SL 4JLRB 3DVGB 1AGDA 2GITB 2BDNL 3DRTA 4Y4FA 2EYSA 5DEZA 4PJDE 3BP6B 5D8JH 4PJ9B 5C0BB 4WHTA 4Z8FL 4KQ4H 1YNKL 4DVBB 1OP3K 4GKNA 3CNKA 4U1JB 1NMAL 5DRNB 4X7FC 5HYJE 4XPBL 1AJ7H 3DX8A 3ARPA 5GS0H 5DVLA 3BZEB 4OCXL 3PV7A 5DD1L 2QADB 4NUJB 5EIIA 4CU6A 1KCSL 5IEKB 5ISZD 2C3XA 3TPKA 5HVFB 3UTTB 3GHEL 2GTWA 3HAEB 3KYMA 1ZXQA 5KSVA 3K1KC 3X11A 4D0BB 2HG5A 4PB0L 4NQTA 5DF0A 3IFOB 3FT3B 1ES0B 1FJ1B 1WLHA 3NVQA 5CKAA 4XNMA 3SE8H 4NFCA 3O2DH 1CT8A 5IHZB 1MJJB 3D39D 5DMKA 4KKAD 5DD6A 4BSJA 5T3ZH 2OJEB 2NXZD 1R5WB 4DK3A 1LO3L 1XGQB 5TQ0H 1N2RA 2J88H 5JTWA 2QHRL 1HH6B 3D0LB 2FWOB 2VUYA 3CXHJ 1LK3H 1OAXL 2E7MA 3GO1H 5D2NA 5JW5B 1S9YB 1NUGA 3FTGA 4LEOB 1JWUA 1OLZA 1C08A 3GI8L 2FLBT 4MJID 4N90E 4JPIB 4EIZC 3REWB 3RIAF 4YC2C 1AGCA 2CIKB 3OB0H 2VLJA 1CDYA 2A38A 3OR7A 3AS1A 4H0IA 5HI4D 1CYGA 4JDZB 4Z7UF 2XG4A 4CMHB 2BNRD 2LABA 4ZTOL 3HZKB 3S4SB 3HC4L 4HS6B 2IPTL 4E41B 1EO7A 2AEQL 1U92B 4HH9B 2W9EH 3QHFL 5F1NB 3N1QC 4I3SL 4R97B 2HH0L 5J9PB 3V4VL 4DN4H 1GRWA 1Y0LA 4JFEA 5J13C 3U0PA 1ZA6B 2EDEA 5EU3A 4EKXA 1Z9OA 1QEWA 4MXWL 4K7PH 1A3QA 1RAMA 4POUB 3O2VL 4MAYD 4M8QB 3V0WL 4QOKA 1BM3L 1OAXH 4YXLL 1KCVL 5DO2D 5FUCE 3JV6B 5EUOB 1LWRA 5T1MB 4UAOC 3Q5TA 2DD8L 4LSUL 3LZFH 1L6XA 1IGYB 1P4BL 5D2NE 1WWAX 4PRNB 2ORBH 1KENH 3HUJF 4OFYA 3NBNA 3INUL 1A9BB 3ARBB 5I1AA 1BVZA 2B0SH 4X5XA 3RBSA 3UO1L 4NN6C 4NO0A 4KDWA 3LN9A 1CR9L 3L95B 3RWFB 1LK2B 4MD0B 2D4FA 5AG8A 3QIWA 3EUUA 2NY3D 1KCSH 1GAFH 1OGAA 4R97C 2XACC 2YA2A 1P5VA 3ZKQD 1FL3B 4PR5B 1RIHH 1BIIB 2FNBA 4O58L 4XP6H 4M1CD 2DB8A 1BZ7A 2ESVB 4LLUB 1AGBA 1SHMA 1FGVH 3PWPA 3W5NA 3MPCA 1C5BL 4JB9L 5FM5O 5HDLA 4LOUC 12E8H 3C6LD 3OHXB 2R2BB 5E8NA 4HQQL 4FZEL 4NRZA 2VIRB 3C60D 5SWZA 1WTGT 2AEPH 3DETD 3PXJA 4M6OH 1N8ZB 1WEJH 5KANI 2VYRE 3ULVE 3VA2C 4LRNH 3MGOB 5C86A 3LEXA 3BRGC 1H3VA 1OTTD 2B0SL 2GTZB 3BMVA 3W2DL 8FABB 2GJZB 3B2UC 4JRXB 4KROD 3IDIB 2CUIA 1VFBB 3T3ME 2CUHA 1KTDB 2X70A 1KJ2B 3DV6B 1DUYA 1BD2E 5C09B 1T22A 4Q6IC 3TO4B 1D9KA 3JUZA 1VESA 2JCCF 4P5TC 1UZ8B 5E6ZA 1SQ2N 3ARXA 1OW0C 1N3NB 1CVRA 1XR8B 4MX7B 3JXAA 3O4LE 2X09A 2WIIB 1MFBL 3L3KB 5JQHC 3WIIH 3S3JA 1W2KT 5D7JC 2AI0H 5EZIH 1JWSA 3LEYL 3PDOB 3DURA 4Z7UE 2J88L 5DUBB 3AM8A 1IGIH 4PJGB 1NFDA 3M1BA 1G7QB 2AV7A 4KRMB 3R8BB 3GO1L 3HB3C 2C3WA 3PHQA 1I8MA 4Y5YC 5E9DA 5D7IB 1R3HB 5IVXE 3V5KB 3O4OC 3RVVD 1A0QL 3DX7A 2KZWA 5CJXA 4PUBH 5EBMB 1PX3A 4F57H 4LSUH 3FFDB 3GKWL 1I9EA 1TJGH 1IM9A 3ULVF 3W82A 1R3KA 4HS3A 5J1AB 1FL6A 2G2RB 1KUMA 1L7IL 1NCAH 1YMMD 3FT2B 1C5CL 3QDGA 2D7OA 5H8DA 1RJZA 3CPLA 3N85L 4N90D 5GRYA 1FNGA 5K9KA 4FFYH 4OBRA 4MJ5B 1AY1H 5DFTA 1YEHH 3KYKL 2ZPKH 3H8NA 2E6PA 3BD4A 3QH3A 3WKML 5EZOH 1RULH 4UV7L 2F54D 3F7PC 5TGBA 3H2WA 3OJ2C 2JCCE 4YK4C 5D5MB 1YNLL 4DEPC 4XP6L 1I1AB 4FXLA 3KYOB 4JRYD 1DQJA 1KLGB 3ULVL 2FYYA 2HKFL 5JMOC 3MLRH 3HAEH 4OCNC 4KK8D 3DHJA 4NKOA 4FNLL 5FEBA 3K46A 4XBPB 2XKUA 3MGAA 3UTPE 3CFDA 3WXVH 5J11B 2QHLA 3F65A 1RZGB 4X6DE 1FC1A 1IAKA 3U1SL 4OZHB 1T20B 3HE6C 1CR9H 3L3DA 4NM8H 5FM8A 2HVJB 2HVKA 4QTHB 4Q6IA 2VR9A 1HK6A 1T7XA 2OR8A 4WWKB 5BS0D 4U6VH 2NY6D 5BVJB 3HNVH 3A6CH 1QRNB 4UT7L 3H7BA 1MY7A 5IIEB 3BIKA 3MRJB 1M05B 3KPRD 1RULL 3QO0B 1ZVYA 1BQSA 2F8XC 1SY6H 4Y1AD 2XXCB 4ZQKB 3FO1B 1QSED 2JJWA 4JB9H 5IK3A 2AK1L 1NCTA 3DYOA 5EA0L 4P9ML 4PJCA 4PGZA 5KBNC 5CZVH 2XIDA 4NGHH 2G75A 4LU5H 4HQQH 2WBJB 1MRCH 4G8EB 3TCXA 4M9OA 4O2EB 1SMOA 2L7JA 3EHBC 5IB1B 5I6XC 4PRBA 32C2B 1YMME 4LRNL 4NQUA 3ZSSA 1YEEH 2CDGA 3KYNB 4WRLA 5FHAH 5EU5B 2D2OA 3NABL 3O0RL 3BO8B 3QBTB 5HYJD 1BX2B 1AXIB 4BQBA 5DRZB 4LSRH 2IAND 3K7UA 1IC4L 5J1TC 2VLJB 3QI9A 4P3CH 1JZ3A 4OCSH 3HNSL 4OZIA 4GKSA 5EBLB 5FUOL 3WNPA 5IVNA 3T1FA 4ZUUA 3O45B 5IG7A 2FSEB 4HIIB 1PG7W 5FUCC 2CIIA 1OB1A 3PWPD 1CU4L 3G6JF 1B4RA 5IVOA 4Q9QL 1EJ6A 1YPZB 4HAGA 5T5NG 3BRDA 2HP4A 1AIFB 3EYOA 4HJJL 1RV6X 3ILQC 1FORL 4OFIA 4F58L 4NQCD 4KPHH 5T5NF 4FXKB 1DBBL 2PW2A 5KVFH 1AR1C 3NIGE 5D9SB 3VG9B 3BJ91 1T4KA 4JFPB 5J1SC 3QUYA 4NQVB 4Z7VB 3LN4B 4PJXA 4X9GA 4YBLB 1ONQA 1CIUA 3QQ3B 4MXQC 4Y5YA 1IBGH 3GMMB 1T1YB 1OAZH 1UM5H 2D03L 2HFFB 4MLSA 3ULUC 3LV3B 5GGRB 1T80A 3GB7B 4H88L 4ZFFA 2YD6A 4XC1L 4OD2A 2ZJSH 3TJHD 1O7SA 2GTZA 1BQUA 2A0LD 3HNTH 4LVHC 3WXVL 4D2NA 5JHDE 3WYRA 1HWGB 1T2XA 4M7LL 1MWAH 5B38B 4NNYA 4Z5RB 3HPLB 2IFFH 1FRGH 4K8RL 1CU4H 4OUUB 4NZDA 2MNUA 3TVMD 1HNGA 2J8UE 2EICA 3H9SD 4PJIF 43CAB 3UJTH 3D6GA 4I77L 1KIQA 5L8LB 3VXSE 4GQ9H 3L7EA 2ICEB 5FYJE 3LS5L 5C0JB 4K3DH 4EUPA 2GJJA 5E8OA 1KCUL 3KPOA 1U3JA 4XBGA 5I9QC 3VCLA 4UINH 4WFGD 4J3VA 3VXTB 4UUJA 1LDPL 1M7IB 5H35A 4Y5XB 5DQ9A 1KCKA 5EU7E 5EO0A 3ROOB 1PGRB 2JB6A 3IXTB 2VLME 4X9IA 5F6HJ 5KSBA 1JL8A 3QFJD 1T1XB 1HOCB 5D72L 5HDQL 4TOYH 3LQAC 3VDCA 3UAJD 3OR6B 1I7UB 2OTUA 4XVJL 3BMWA 1MRCL 3SJVD 3BW9B 1RUMH 3QUMA 4I0CC 1JTOA 1Z5LB 5IM7B 4NM8L 3OKNB 3MUHL 4YGAB 4NZUL 1EJOH 4C59B 3BDXA 4O4YH 3IFLL 3ARZA 1URLA 8FABA 4GUPA 2R56H 4K7FA 2OK0H 4NJ9H 4L8BB 3A6CL 3C6LC 1T1WA 1KYOJ 4XX1G 1M1SA 3P77B 3VA6A 2F9BT 2LV4A 1VADB 1GC1L 3RP1A 5BZWA 4MJ5A 2C7UB 3BT2L 1Y6MR 2GEEA 1CT8B 3G6JB 3LS4H 4N1HB 1ACZA 5F9JB 4Z6AT 4Q9QH 3JWOC 5BRZE 3PQYD 2O5XL 4G8FA 2CMRL 1CXEA 4M7JH 4HFUH 2VNCA 4Y4KD 2DQIL 3OV6A 4JO4L 4XH2A 1VEMA 5IHZA 4WTWA 3BP6A 1RUKH 5E94A 3RWEA 5JOPE 1NFDB 4PIRF 1CICC 3BP4B 3PWJA 1DEEB 1WK0A 2RFXB 4G42B 4X0KA 5HGDA 4PGJA 2X4OA 4PJIA 2A83B 5FYKD 2A74B 1RZFL 3ZYZA 4PJIE 5D1ZC 4QGTA 2OS7A 4NQCA 2IJ0C 4WUKH 1HNFA 5BVPH 5A3ID 4XZUB 1MAKA 2F5BL 3T3PF 1KB5B 4KRLB 3EJZC 1BBJB 3VXNA 5CLWA 2XZAL 3CFEA 3VFNB 1RUPH 4D8PA 4AENB 4UTBL 4JREB 1Y0LB 1EEYB 4HUNB 5LGHH 3TFKC 2C9AA 3ARYA 3IDUA 4M00A 1BFVH 3MJ7B 2I9TA 4JQXA 1N0XL 2FBJL 3QCUL 4J7RA 5T3XD 1BWWA 4G6ML 1ZANL 4H1LB 1RMFH 2DYPD 1HHKB 1U3HA 4WI8A 4PBVC 5CILL 3QR2A 1ZLWK 1TJIL 2BCKB 2VKWA 4RAHA 1I7RA 2XI9A 5LGJB 2YWYA 4R8WL 3RZCC 5JW5A 5C3TA 4XT1C 2QR0B 1JV5B 2JKXA 1AI1H 1G7PB 5E2JA 3VMOA 1OAQH 4XCCL 2FHCA 5D72H 4HIHB 4H25A 1B9ZA 2ERJC 5AD0A 4CJ0A 3MJ6A 1QBML 1YEGH 1YZZA 3K4AA 2VXSH 4Q2ZB 4NBXB 4MD4A 3FMGL 3RBGA 1ZT7A 3SCMC 2OCFD 3EJJX 1WBZA 1J1OL 2GT9A 1DQLL 5HGHB 2YR3A 1JF6A 5J12B 1G9ML 5E8PB 4NQSB 3DYPA 2P48B 5DD5L 4I0KA 3UJTL 1YUHB 4JQIH 5C6PB 4XAKE 1LO2L 5C6WH 3ZL4H 3QUKB 5C0EB 3WIHA 2WUCL 3DBXB 2VLLA 2BOCB 4GFTB 1BFVL 3WFCH 4NOFA 4RMQA 3QB7C 5K59E 2FBJH 3HE7A 1U8MA 3MV8A 2HWZH 2P47B 3BEVA 2V7NA 1QEWB 3EOYG 1MJ7H 5IVXB 1DANU 3N9GH 4EDXA 3HMXA 1V7NH 1C8PA 2R8SL 3FQNB 1EO5A 3EYUL 1A6UH 1IM3B 2J8UA 3IKCB 4R4FH 1CGWA 2D7NA 4G5ZL 4XP1L 3VFTA 5HHQA 2ADGB 4ZS7H 4G8EA 1NGQL 5L88H 1IGYA 4WFHE 3RHWK 43C9A 2EEDA 1Y6KR 3T2NL 3O3DB 5D2NC 1Z2KA 5JW3H 4AQOA 5ID1A 5C08E 5FA3B 3EO9L 2YC1A 4LKXB 5A43C 5BJTB 3C09B 1LP9E 5CIPH 3NN8A 3QNXA 2X4QA 3WIFA 3BQUD 5I8KL 4G80A 2YD5A 1Z0NA 3L3GA 1T89A 3P0GB 4PJDB 2B2XL 4HGWA 2E7LC 5EOQH 3MRLA 4HXAL 4ODHH 3TO4A 3SGDI 5F7EL 4EXPX 1A5FL 1AD9B 2BNQE 2NZ9C 5GRJL 4L4VB 5J6HA 2VL5B 1FYTA 1XR8A 1ZGLP 4OQTA 4OB5L 1FZMB 2W60A 5B39B 1KT2A 4TULH 1RUPL 4HW6A 3ZE2F 5FYLE 1N6UA 4PJCF 2OP4L 4ONGL 4PJEF 2NY4C 5K9QI 3OHXA 2PF6A 4GW5A 4PJ7E 5SX4I 1EGJA 4XXDB 1KGCE 5BO1L 5IEHB 4ETYA 1P6AB 1NGQH 5JHLL 4TQEH 3VMPA 3B9VA 2DMBA 1A6VL 3OPZL 1J7VR 4Y19D 4R0LB 2J6EH 1JZ6A 5LBSL 5HXMA 4KRPC 3GJFA 3TBWB 2PO6D 4NQED 2BNRE 2ICWI 5IESL 3IDYB 5HYSB 4U1HA 2HG5B 5CJBA 3QDGB 3QFDB 4DKDC 2YRZA 3FZUD 3WHE1 3OKDB 5ITFB 4XNMB 3BEWA 1U8LB 4M62L 3LN5B 4TVPD 1RQ5A 1T3FB 2FJFB 5HHPA 3QH3B 1TLKA 3N1MC 5JOFB 4JRYA 5DD5H 4NRXB 2O26U 5I1DB 1YEIL 1HSAB 4G6MH 4MQXC 5CSZA 3S34L 3D0LA 1UYWH 4BK4A 1IZJA 3O6FB 1XGTA 4DW2H 4JKWA 4ZOEA 4NYLA 2IWGA 1NBYA 1QRNE 3DI2B 3IXTA 3VI3F 1HQRA 3U7WH 4PBWD 4F33A 1JI1A 4BYHA 1T04B 4HFWB 5EOCL 4Z7QE 1HZHL 3CFCH 1CS6A 4R26L 4RMSA 4L3CA 5F6IC 2Y07H 3I3BA 5KW9L 2A2QT 3FQWA 4UILL 1YY9D 4R0LC 1TZHA 1KC5L 1T21B 2VDOH 4BFIA 3KJ4C 3FONA 4TNVF 4OZHA 4WO4D 2IBBA 3FQUB 5SWSB 3BP5A 4HJ0D 3UMTA 3D9AL 5J06A 4YBQD 4G6KL 1N5YL 1JTPA 4QHLB 4DVRH 3QQ9D 3U0WH 4N9GB 4KU1A 4R2GD 1BFOB 2VDRH 1GL4B 1CE6A 4PJEA 5E08L 5E1AA 2HVJA 1A4KA 3EFFB 4PJEE 4K3HA 4HWUA 4YXKH 4HK3N 2DTSA 4OTXH 3DXAD 5JPNB 4X7SH 1JNJA 3S88H 4OCYH 1FO0H 4X6FA 3OKOB 1YEJH 4RMTA 4FQ2L 3T08A 4RA0C 5CHNB 4I3SH 1B90A 5CEYB 5D7JB 5E8DH 5DK0A 2QV2A 3V4VH 3QNZB 1O7VA 2FHBA 1IE5A 1NAMA 3QDGE 5FK9B 3ARSA 3DVNB 1NH6A 1FYTD 4S1QH 2HTKC 2VLJD 3C5ZB 4NRYA 3T2NH 1FBIH 5F9DC 4I3GA 3FRPG 5T33L 4NO0B 1GGYA 4OGXH 2IG2L 3FHQA 5F3HA 1KLFA 3CXDH 3OAUH 4JR9H 4H1LG 4MS8D 4X6EB 4OZFG 3OKEA 1G1YA 3ZE0F 1RPQA 1T66C 1H5BC 2DQDL 4L8SA 4X99A 5CUSL 4YFDB 3VRLE 4HIIA 5GQBA 1KENL 1KCRH 4PLKC 3QUYD 4FFZH 3NGBB 2C3VB 3VD3A 1QFWL 5TH2B 3MSPA 3SDXF 3SKNB 3CFEB 3U7YL 1ACYH 2FECL 3VH8G 3P30L 1JWMB 2M1KA 4ESKA 3ZKXB 4OUOA 3TLRA 4WTZA 2CKBH 3I6KB 4JQVC 3F8UB 2FECI 1KIRB 3TYGL 4O2EA 5BS0B 5D1QC 3BHBA 3QXTA 1UKSA 5JNYA 4O2FA 4F7TB 3BYYA 3NFSL 1S5HA 4QTIL 2OL3B 1MIML 1Z9SA 1D6VL 1UZ6F 2VIRA 4OGXL 5GRVK 5FDWB 4PJ5D 3DMMD 2EDLA 2IMMA 1FVDA 3PWVA 1ZA3A 4TTDD 4M43H 2O61B 1QVOB 3V4PH 4P3DA 4Z7WE 4D3CL 2QSTA 3B9AA 3ZHDA 3RA7L 3NTCL 1VERA 4I5BB 1FL5A 1T03L 1Q9LB 5BV7B 5DYOA 3SEPA 1BIIA 1KTDA 2VO5A 2P8LB 1B6DA 1I8IB 4NQXA 3OKLB 1FSKC 4X6BA 4FFWC 1VACA 3KS0H 3P30H 4RCAA 3V6FA 1IAMA 3MXVL 2DBJA 2DRUA 4Y4HA 5FO8A 2NNAB 4YHOL 2BSRB 4D9QE 1OGTB 2R1WB 2ZUVA 4FQIL 4KGLA 2OZ4L 1NSNL 4PJGF 3MLTA 4CN1A 4QWWD 5D1XB 4LRIA 3LKNB 3NFSH 2V2TB 4RFOL 3H6JA 3RVWD 1N6QH 1FNEB 1UXWB 1J12A 3GMOB 3WFDL 5KSUA 5GSVB 3WJLC 3MCLL 4L9DA 2HT4C 5JIKA 4F7PA 1HOCA 3V6OE 2WP3T 3U46B 1B0GA 4HLZH 4J3OC 3DX8B 1OSZA 4D9RD 2EZ0D 4R0LA 1LMKA 2BP3A 1LP9B 5MEQA 4Z5RA 3BW9A 2ZUUA 1TCRA 1YEKH 5IF0B 4JN2B 1A9EB 1DBJL 2A9NL 1S7TB 4IMLA 1EA9C 5KSVB 3CLFH 5CWSB 2DKUA 3G5VB 5ERWA 4W6YB 2OMBA 3R0MA 2AXHA 4MXVE 2ICEA 4X7SL 5I76B 4G9FA 3QRGH 4L4VA 2VISA 1CLYH 2GY7B 1CL7L 2YK1L 4HCRA 1CFNA 4XMPL 4Y0GA 4NHUA 5GISH 1S9XB 2HTKD 3MRQA 3VCLB 4WI7A 4JFEE 4FQIH 4M6MH 3W9EB 3QEUB 3ZKXC 2FJHA 5FO9B 1PFCA 4OIIH 5DWUH 2EIBA 4NSKA 3SGEH 3CSYA 1ZVSA 4MNQD 1XGTB 4WW2F 1M6OA 3ISWA 3DVFA 3TT1L 3WBDA 2NR6D 2E7CA 4R3SB 1XF2B 3OF6A 3ULSA 5E2VL 4JRXD 3QUXD 4J3TA 1VGEH 1D9KD 1L9NA 3UP1A 3L3DB 2JJSC 2DMCA 4M93B 3LKPA 1JPST 5CJ5A 3WUWA 4DQOH 3I2CH 4OD3H 3VXRB 3W9DB 1YEDA 4QXUH 5J3HD 2GJ6A 1MPAH 5L0QC 3ALWA 2W38A 3FCTB 2D7TH 4X0KB 3VFRA 4URTB 3IB4A 1J8HB 1R3JB 1MH5B 5D8JL 3TF7C 1WBXB 1MCDA 1UH3A 1ZSDB 1FLRL 1ZVHA 25C8H 4XBEL 1FZJB 1WIOA 2E9IA 5EZLA 1VADA 2E27L 1JTTA 1DQTA 4OKDA 2EKSB 1T2QL 1OB1B 3RWIB 2IGFH 4IOSD 2P5EB 2YD2A 5FKPA 3BISA 2DJSA 1QA9B 3KYOA 3LPWA 4OIIL 2D3VA 1EO8H 3D25B 4PREA 3LHPL 3WE6B 4WHCA 1KV3A 1RIUH 3QQ9C 3MRDB 2DICA 2PETA 1I9IH 4R7DB 3C8DA 3DX6B 3ULUF 1W8NA 1UM6H 3WJLA 2VN7A 4JQVA 3ILPA 5JMRA 5EU5A 3E2HC 4V2CB 3UTSD 1KPRB 5D1QA 1P7QB 3I3EA 2YPLA 3QPXL 1MUJA 4R2GC 3N06B 2HMID 32C2A 3IS0X 3UCRA 2ILLA 1JBJA 4YHNB 3JWDC 5MERB 3ZKNC 1KNOA 2GCYA 3LZFL 4LHUG 4N8CH 1UXSA 3G5ZA 2ORBL 2I5YH 4MD0A 3MJ8B 3CMGA 2CDEA 3SKJL 1DVFB 3T0WA 3MLWL 3QJHA 5E00A 4KHXH 4PJEB 1JGLH 2AVGA 4I4WB 2PUQT 3R1GL 4PJCB 1FFPA 2LAGB 2HFTA 2W0PA 5AWNH 5C2UB 2EDXA 3EJYD 3I85A 4PRIB 2MKWA 4Y2DD 1OT2A 4E42B 1MI5D 35C8H 5IB1A 4OV5B 2UWEA 3LQZA 2J8UB 2PR4L 3IKCA 4NZJA 3RRQA 1IKFL 4S0SD 3I50L 2I60L 3I6KA 2B39A 1WIPA 2X40A 4ORGA 3BEVB 3QXVA 5DMGD 1T1YA 3TH4T 3EIFA 1GPOH 4MQSB 5AYUL 9CGTA 4DEPB 4FQJL 1NAMH 3IU3A 5EG6C 3OWEA 2AQ2A 1FCGA 4K8RD 3UROR 1AQDB 2A9ML 4P2QB 1S7WB 4HLZG 1YUHA 5HHOD 3VFTB 1OHQA 2JLLA 4CN4A 2FSEA 3V0WH 3H42H 5JZ7D 3ZT7A 2EIZA 2GT9B 2DQTL 3L5WB 1PVHA 4FZ8H 2H2PD 3VRJB 5IVXA 3F7VA 5FF6B 2JK5B 3HPLA 7FABL 3QUKA 5C0EA 4H88H 1JGLL 3BWAA 4TTGA 1P4BH 4KKLD 4H8WL 2BVOB 4LSQH 2GK0B 1U36A 3ARWA 1QSFE 2MPAH 1LQSR 4NC0B 2GSIB 3SE4A 4B7LA 1HHGA 4M6ML 4XGZB 2Q7NA 5DC4B 4I18B 1K4DA 1QFWM 35C8L 5A40E 1OCWH 3UJJH 2C7UA 5HYFA 5ADPL 4H20H 1J0YA 3OB8A 2RB8A 1IAIL 5HGGS 6CGTA 5CD3A 4NQVA 3HZMB 1YECH 5I66B 4I77H 4HV8A 5DD0L 4ZXBC 4S1RH 3O3UN 4LNRB 1CGXA 3L1OL 1IGIL 2V5TA 5KSBF 3SY0A 2FIKB 4R4BB 4EI5A 5IEKA 1WWBX 1XZ0B 2NW2B 4TOYL 3IKKA 1J0HA 3P0VL 3TNNB 4MNQA 4G9FD 3HRZA 4N68A 5HYSG 2XQBL 4N8CL 1HH9A 5ENWA 3D85B 5I0DA 1QFHA 3P4MB 1WZKA 2XRAH 4KTDL 5ICYB 4LSPL 4G6JH 4KQ3L 2BK8A 5K9JH 3FB8A 3VXOB 4AZ8A 2X1OA 4RNRB 3VXNB 1JN6A 2A6DA 3MNVB 5I76A 3U2SB 4BFGA 2WV3A 1MCQA 2Z91A 3EYVA 2DDQL 5KSAD 5IMKB 1UT9A 2AK4A 3HE7C 2EIDA 4RQQA 4H5SB 2VWEC 4U6HA 1DQJB 3P11L 4HS8L 3TIEB 1B6UA 4OF5A 1AFVL 5TE6L 4XPAL 4LLWB 1KTRL 1MRFH 1H8NA 4BQ9A 4I2XE 1I7ZA 1A3LL 3C2AH 1OARH 3BP7B 3EDFA 3BP4A 1R6VA 4RISH 4F7PB 2X05A 1ZT4B 4K7PY 4N1CA 1HIML 1RVFH 3W39A 1MCJA 2BY0A 5DJXA 3BIKB 3IAPA 1UFUA 3MRJA 4R9HA 4CDGC 2XQYG 1A6AA 1XIWA 4EIGB 4P9HH 5A2LH 4HZLA 5E99L 2BVYA 4LSVH 4PJHA 2DMKA 2CO7B 5DLMH 2XWTB 3DSFH 1KFAL 2HMIC 4E0RA 4QOKE 2VLKB 4POYA 2NY5L 2VC2H 2IQ9H 3ULVD 3TV3H 4G7VH 2X4UB 1JNLL 3QUXC 2Y6SD 2XWJA 4UV4H 1KG0B 4DWHA 5GGUB 4G9DB 5E95B 5IMOB 1JHKH 1KEMH 2I60H 4FXGB 4UTBH 3WNOA 4QNPF 5DFVC 5J3HC 4ZPVB 1MCCA 1HWHB 3TBSA 5AD0B 4PRBB 3ZZ1A 4Z7NF 1DANT 2A1WH 5L2KB 3CFBA 3NCBB 3X14A 3QCUH 1PY9A 2WWKO 1I8KA 5AYQA 4LQ1A 4WY7H 2R39A 1XT5A 4KHTH 1IFHH 2ARJA 3SPVA 3GEWB 5ETUA 3UTQB 1II4E 1AR2A 4NUGL 2Q8AL 3QFJB 3H3PH 3RVTC 4DUVA 1LVEA 4KQ4L 3D2UA 1LO5B 4U7MA 1TVDA 4YBQC 5DHYB 2OYPA 4OZFB 1YEDB 2JF1A 3F6IA 1OD9A 1S7VB 1YYML 4KAQL 1CE1L 4FQXD 4LSRL 3GMLB 4IRSB 2YMXH 2UVEA 4YH6A 1KF9B 3MRFB 3AREB 1MVUB 3G5YB 4PGBB 5JQ6H 3G6JE 4HUWB 5GS2H 1Q72L 1JNNH 3ZTNH 4G7VL 1J05B 4X98B 4KMQA 5LVEA 2BRRL 1HHKA 2HN7A 5L6YL 5DD3H 5DUPH 3P4NB 4ZSOA 1T4KB 1DBKL 1XGUA 4GLRI 3MNZB 3O6MH 4MHHG 4LASH 4QRQB 1SYVB 4IOIA 1KN4H 1DDHB 3F6LA 3GBLA 4MA8L 4XVUC 1SM3L 5CEZD 5ITBL 3MXWH 5I9QB 1XGYH 1BD2B 2ITDA 3DVNA 3OL2A 2R29H 4ZUTA 5FM4A 5I8OL 5EU6B 4QRRE 1IGTA 1KBGL 2OBGA 2FEDC 4JRXE 1R0AH 3W0WA 2LE9A 3GSUB 2ADGA 4QRPA 4N0UE 4JO1H 3CX5J 2I26N 2NY1B 3QDJE 2DWEA 1TFHA 2XOTA 4ZFFB 2D31A 4P9MH 4U1KB 4Z7NE 1WCBB 4QCIB 2R1XA 4LNVA 5B39G 1CE1H 5GZNC 3BE1H 4U33A 4NDMA 1OAUH 3REVB 2R0LH 3C5JA 2FZ3B 1UACH 3GMQB 3HR5B 2UY7A 4QRTB 4U2YA 2FJGB 3OX8B 1MWAL 5ILTL 4JKPH 5FYLD 4YX2H 3Q6GL 2Q87A 1CK0H 3QUXA 4X80L 2AJSL 3MMEA 1A14L 1CFSA 3KXFE 5E8OB 4KXZI 5F88A 5I8KH 3T0EA 3S4SG 3VXUB 2W60B 4ODHL 4OCSL 3QZWA 5DD1H 4X6BB 2FATL 4K3DL 2XFXA 4J1UB 3TV3L 5GRVL 3LSOB 2J7LA 4TSCH 1Z5LA 2YA1A 1X9QA 1G1CA 4RZCB 4OD1L 3O8XA 1MLBA 3C08L 3GM8A 5HYJB 1A3LH 5GSVA 1FNSH 3DMMC 4HBCL 1CICA 4YUEL 4ONGH 4XAKD 3U4AA 5C0AB 4LMQI 5TFSH 4GG8A 1RIVH 4A2LA 3T0EE 5FCSH 2OL3L 3BDYH 3KXFA 5AG9A 3QDJA 5F21B 4QRPE 3EZJB 2ZCLH 4UDUA 4N0FB 1Y18B 4QRRB 3C87A 3INUH 4QHNB 3THMH 4QLRA 3IFLH 5AUMA 4F3FA 2XZQL 3QFDA 1HYSC 3BGMB 5ALCL 1YYMH 5CEZE 5DZNA 3KPRA 1CZ8H 5BV7L 1TCRB 3NGBC 1IQDA 4P23C 3TH3T 4DTGL 2ZSVB 2DWDB 5F9JA 3SDCA 1HI6B 3PHOB 4Z7QF 4NQDA 4Y16B 3UBXG 3MACH 3ZSTA 3GSWB 1EXUB 5IMMB 5MENB 1DQDL 3DRTB 1M71A 2DQEH 1CFTB 1CD8A 1S9XA 3RU8L 5F97E 2BY1A 3RDTA 4KKBD 1OM3L 1UXWA 4L1DA 4IRJD 3P0YL 2W9EL 3QHFH 5LAXB 3ULUD 5JOEA 3QNZA 1ODAA 5IQ9B 3C8KA 4HWNA 4JO4H 4J3XA 2J8HA 4DZ8A 1KCUH 1SYSA 4I0PB 4ZO7A 5FCUL 3WFEH 5CIPB 4EEEA 3VD4A 4KY1L 12E8L 1ORSB 4HHAA 5H94B 5HHNB 3L5IA 5MEPA 3PABB 3V52H 2F58H 5KS9E 4X6CB 1NUNB 1JNHB 4NO5A 2WW8A 3TNNA 5I15L 1G6VK 2YMXL 2DN7A 3BZEA 5C8JB 4UIKH 1DN2A 4ZPTB 4PY7A 3E6FB 3FO0L 4JM2F 2RAMA 4FFVD 4X6FB 2F5BH 3VMNA 3WS6A 5KSAB 2N7BA 4LSDA 4BSVB 1FQ9C 3JV4A 3SDAC 1W72L 2IANE 5DK0B 2ZNWA 4PTUB 4UZGA 3UO1H 1KPVA 4WI6A 4F9PC 1UA6H 2Z91B 4LLYA 2VLJE 4N1EA 4APQC 2ZG3A 3OKOA 3WUWG 4Z7WB 3QUML 3RY6A 5F96H 1JFQL 5BZDB 4PJHE 3U9UA 1ETZB 4P99A 4PRPE 5GGVY 4WV1B 4KUZL 3RI5F 4I8DA 3CCHA 1KN2H 1I4FB 4AEHL 1QBAA 2Z8SA 2VSDA 4WUUB 2OL3A 1MFDL 4X9HA 1OWWA 2F58L 3TEUA 3QI9D 2LFGA 5E24E 5GS0C 4XPGH 2BOCA 5KJRH 1TQCB 5ETUB 5EBGA 4BELD 4IIQA 1FVCA 1P7HL 3AAZA 5D6CB 4MMXC 1YC7A 2FD6H 1OGAD 1TNMA 1X3DA 4HS6A 3OGOE 3P73B 5SWQA 5MI0C 3MV7D 1G9MC 1IVLA 3U9PH 4FXKA 1CL7I 2WZPD 1F4XL 2DM2A 4NHCL 4KXZH 3IFPB 4I2XA 1KG0A 4Z9KB 4LAJH 1TVHA 4OD1H 2RCSL 3E6HB 1YC8A 2WQRA 4YHML 2WLZA 1A1NB 5KAQF 3UBXA 4KRPD 2B4CC 3SO5A 2R8SH 5D1XA 5FYJD 4PJBB 4WU5A 2EDHA 2JB5H 2ATKA 3UJIL 3TZVC 2OZ4A 2YZ8A 3QULB 4MJ2A 3I75B 3WIIL 3EW3B 4DGYL 4KI5D 5F9OL 1LK2A 1F4AA 2FEEI 5BRZD 1U8HA 4L9LA 3IDXH 5B8CC 5KZCB 2NTFB 1KJVB 1AQDA 2VZ1A 3VRJA 2CKBB 3BAEL 3V0VA 1RFDH 5HI3D 3V52L 4U3CA 1PG7X 4KC3B 4YZFE 1U3HD 5DS8A 5EULV 5TQ2L 2ZCHL 3KJ6H 3MC0A 3J7HA 3G5YA 1OGTA 3RA7H 2DLIA 3G6DL 1LE9B 1L0YA 1FG9C 3QUZD 2HA1A 3TM6A 4APQA 5FYKE 3MRBA 3QIBB 5DRXA 1NGWB 3IU3B 3FJTA 3RVWC 5C6TH 5GS2D 1HQ4B 5JUEL 2WIMA 3LD8B 4UB0L 2F19L 4QO1A 5JR1H 3LOWA 1DVFD 4U6YA 4OF0A 5LCVL 2EIZB 5CS7A 4GXUN 2NTSP 3EDDA 1MCPH 2YPKB 1MCOH 4KY1H 4NGHL 1S7WA 2BOBB 3DXAE 5JLZA 1N8ZA 2AJVL 2IPUG 3NCEB 1N6QL 1EH9A 1R5IA 2VDMH 3DGCR 3FB6A 4RDQG 4NJAH 2VZ3A 3BXNB 4IJ3B 2X9XA 5I74B 2Z4QB 4NCC2 3MGTA 5ICYA 1HXYA 2X41A 5T5FH 3WN5B 4GW4B 3HPJB 1A9EA 3ME0A 1AGEB 4OZ4B 3GJFH 1WT5C 3BESR 3B5TA 1HN1A 5I1DA 4LOUD 3CH8A 4DCQB 3TN0C 3OXRA 5EC1B 4ZUWA 3VGAB 2IPTH 4XPBH 1UVQB 3VXUA 2Q1EA 3D25A 1WBYA 1OAKH 3T77B 5ANME 4U6VL 2PYED 3ARFD 5GGTL 1HHHB 5C0GB 4HXBL 1CL7H 1AD0A 1F4XH 1FNAA 4NHCH 5GISL 3ZT5A 3EDKA 3RY6C 2OM5A 1ZGLA 1CFQB 2ADFH 1OSZB 4NFDA 3EAKA 4KPHL 4YNYA 5FECA 3JUYA 2RQ8A 1BGXH 5D1QB 3DO7B 1N59A 3ZDYE 3BWUC 3Q1SH 4MAUH 1V3JA 2GTWB 2WBJC 2Z92A 2VDML 5EUOE 3UJIH 2W65A 5EA0H 2YKLH 3NMEA 3CUPB 3VGFA 5HVHB 3EFFA 3O3AB 2FR4A 2N4IA 1UM5L 4M7KH 3QIUB 1LEGB 4JFHE 4HAFA 4IHOB 3U2SA 4P5TB 2I25N 1IM9B 5I74C 1TTFA 3VFRB 4AEIH 3D69A 1X5KA 3FT4A 3OPZH 3OMZA 1BOGB 3VXOA 3FFCB 2J6EL 1QLFB 4PREB 4BQ6A 1EGJH 1ES0A 1HKLH 2IFFL 3MYJA 5JA9A 4NWUH 4GAYA 4P2RD 1GYAA 2EYRA 5TF1H 5E4IA 2V9QA 5IMKA 2XWTA 5IFAH 1LDSA 1I7RB 2UZYB 3VXQA 5IJVA 5LGJA 1T7YA 5LQBL 4D9RE 3UTSE 2E8ZA 4R4ND 4YR6A 4XNZB 1UB6B 3O6KL 3MODH 4YGVB 4AG4L 3S88L 5C0AD 1JHTB 4PV9A 3WIHL 1F4HA 2DAVA 1AXSB 2EXWC 3RWHA 3MRIA 2NXYC 3EYFB 2JB5L 3LHPH 4BKLB 3DECA 3RUGE 1X6NA 1WZLA 2H1PL 1TTUA 1F3JA 4MA1B 3MFFB 5CFHA 4OZGA 2AGJL 3TZVA 4DN4L 1FBIL 4C55A 1NGYB 1A9BA 4XBPA 4HK3J 3T3MF 3BD3A 1MHHB 1RJCA 2A6KB 3OKMA 4WWKA 4YXHL 1KNOB 4JDZA 3BAEH 4AEIL 2A77L 4PRPB 3RL2A 3SE3A 3T2QA 1ADQA 5CEZH 1MCLA 1D3CA 3BPNC 2EDQA 2QSVA 4KKBC 4QRPD 3T8XA 3PL6C 4ZPTA 4G8GD 2V2XA 1GGIH 1S9VA 3MA7B 3LKOB 4RX4D 4KJPD 1AE6H 2QSCH 2X4TB 4J4PA 5F7LB 1NJ9B 3JV4B 5CCKL 3PWUA 4JFYA 4XWOC 4LAQL 4KHXL 4I18A 1MCIA 3W0WD 3MR9A 3PWLB 1A7PL 4V1DD 3WD5L 3MRGB 5EZJB 1WITA 2VAAA 3D18B 4K7PX 1OAKL 1UGNA 5IB2B 4QT5A 4K3JL 3X13B 2H32H 1F13A 3ZE1F 1RUAL 4Y88A 3JWOH 5D71H 1LEIB 3LAFA 1JMXA 3HE6B 3CH1A 1VCAA 3GSXB 2Z31C 4L4VE 4OZIB 1A8JH 5D6DC 1RJLA 4ZTPL 4AY0A 4JG0H 2EH7H 4DZBA 3U6RB 1U8NB 3RUGF 4MAUL 3TN0D 1S7QB 5DRZA 3OZ9H 1LEKB 2YKLL 4G3YH 3VJ6A 2ZKHH 4LF3A 3IETA 2NPLX 1QPPA 3LRGA 4GRMB 4KVNL 5C0AE 1T03H 2DTMH 3B9KA 4FQXB 4Y4HB 2OR9H 1WT5A 1CFVL 4YBHA 3MNZA 3TBYB 4YK4B 5ID0B 4JFFD 4P5MA 1A7OH 3UTTE 4IOIB 3W0WB 4U1NA 2H6PA 3KPLB 4H8WH 3DIFB 1B0RA 4PJGE 2OK0L 1TTGA 3OBAA 4NC2B 2WP3O 3QUYB 2QJDA 3GRWA 4Y8DC 5JXAL 2R1YB 4PJBE 4MAYA 1V3KA 3MA9H 1Q0YH 1I8MB 2VLRD 2MWCA 1EK3A 5IKCB 1CBVL 5BMFL 3ZDXE 5DZOA 1LNUB 3FOMA 5IV2A 1QLEL 1ORQA 1AGDB 1RURH 1D5MB 1T1ZB 3A0OA 4OM0H 3W11C 3N50A 2IH1B 4HCRL 3D1MC 4P46C 5DVMA 1QRND 3RWGB 3ARFA 3T0AA 4K9EL 3H0TA 4OF7A 5DR5H 1U8LA 2V17H 2XA3A 1S7TA 3WHE0 5KANG 4BH7B 1KELH 4KVNH 3MJ9L 1ZT1B 4PJ7F 4W4OC 3JV5A 3X3FL 1HSAA 1H0DA 3U1SH 5F8RC 4O02H 1A7RH 1ND0A 3EZ8A 4ZMAT 2ZCKL 2ZUWA 5FGCE 3A67L 4X6CE 4M4PA 3ZYOA 4UNVA 3OJVC 3WNLA 4HKJA 2XFXB 4J1UA 4WI3A 3QEGH 4NO3A 5F3BA 4F57L 1QUNA 3TBTA 4X7DC 3HUJB 4KI5C 1M71B 3RFZC 3NIGF 1OVZA 4GXUM 3KS0J 3O8XB 4P2RB 4OZGE 5FA4A 1F90L 3RI5K 2WAHA 1FNFA 4KMLB 3Q0HA 4NKQB 4NQCE 4UAOB 1FAIL 4OIAA 3MQIA 2CO6B 4GAFB 1S3KH 1P69B 3SDYL 5D6DA 4PRHE 4D0CA 4RMWA 4IDJL 1EVTC 3IFOA 4ZO9A 1AFVH 2NY1C 1J0IA 5MEPB 4CU8A 2OZ4H 2PKDA