4Y19B

Immune complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
192
structure length
184
Chain Sequence
SGDTRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGVGESFTVQRRVYPEVTVYPANLLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSLTSPLTVEWRAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title T cell receptor reversed polarity recognition of a self-antigen major histocompatibility complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 44
structure length 184
sequence length 192
ec nomenclature
pdb deposition date 2015-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y19B02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4y19B01
2X1PA 1MRCL 3HC3H 1A5FL 4GLRI 3C5JA 4HUUA 2PXYB 2Y4SA 3EBAA 4HXAL 5KAQF 4XB8A 1QKZH 1I1YA 2YZ8A 3K8KA 2DQIL 4NM8L 4I4WA 4U3XA 4FQ2L 4WFHE 3GSQA 4E9LA 4G3YH 2YBRB 5FEBA 4TNVF 4APQA 4P57B 4MX7B 4NZRL 2X4SB 2A77H 3P2TA 3AU1B 1IMHC 5FK9B 1AQKH 1F58L 3HC0B 1IC5H 2H41A 1A6VL 1MF2L 3FT4B 3OB0H 4JKPH 3E6HA 3H42L 2ARWA 4OI9A 3WS6A 3MUGA 4OBSA 3I2CH 3U0WL 1INEH 3ORJA 2Q6WB 4HUXA 4IM8A 3TBVA 5E5UB 4HKJB 1F11A 5CSBA 3WXWH 3K46A 5DTFA 4N1EA 2ICES 5LCVL 1A4KA 3T04D 3C6LB 2AJVL 1I1CA 3L3HA 4U4BA 5I76A 1Z9MA 5HTSA 2QJDA 1DZBA 4S1SH 4PJ7F 3RUGA 1R6VA 1GGUA 2RFXB 4LSDA 2MOVA 1F90L 2BSTA 1N0XH 2GKIA 1BZQK 1HILB 4WJ5A 5JIIA 2HG5A 3V6OE 3MA9L 1MCOH 5DD5L 2P24B 1BJ1H 1CD1B 2IFGA 1FNEA 1T21B 2XICA 1QLRA 3LKSA 4JGUA 5J1AA 1NUDA 4JGJA 4L29B 3UO1L 5T1KB 1BOGA 3BUTA 3NCBB 4YHNB 2E27L 2JCCE 5KOMC 4Y5XB 4ZPTB 3NPSB 1ZHLB 3LRHA 5CIPH 4OCWH 3ARGA 5E03A 2FLRT 2VAAA 2W9DL 3HNSH 1TZHB 2R0LL 2FDBP 5KS9B 2V7NB 1DE4A 1E6JL 2DM2A 4ZO8A 2X4TB 9CGTA 4PJ5B 3NCJL 5FM8A 5KANI 3PGCA 5TPWL 1S7RA 2Q8BL 2EYTA 1U8NB 1BJMA 3EDEA 1U8HA 1S9YA 3PL6A 2RIKA 1GRWA 4RWYH 1XF4B 3ARGC 3CSGA 2NY3D 3BIBX 1TVDA 3PUCA 4PJDE 4GKOA 3VXRD 1KXQE 4MAYA 1RZJL 2WBJD 2DD8L 4JFDD 4EJ1C 3KLAB 3GJFH 2PETA 1OP5H 4GSDH 2GQHA 3STLA 1KGCD 4WEMB 1FNHA 4GRMA 4XVTL 2B7DT 1KT2B 4HX1A 2XWJA 3KPLB 3OAZK 1VFAA 1CD9B 1I7ZB 1TITA 2XV6B 2K1MA 2EYSA 2VISA 2FRGP 5EOTB 3M8OH 3TM6A 3HZKA 1LO5A 4QTHB 1T1YB 3NIDE 4J1UA 1FZOA 5F7HA 1TZGH 3PL6C 4J4PA 1QP1A 3HCVA 1QFWH 35C8L 4IHOB 3CZJA 2DYPB 5JW4R 4RMQA 4C56E 4PGEB 4MAYC 4NN6B 3PIQA 5JW5A 1ZA6A 5ITBH 4P23B 3UJTL 1NAMH 2DIBA 1LE5B 3LZFH 4Y16B 4M61A 4O2EB 4XPGL 2XY2A 1X4YA 3GDBA 3JUYA 4YHPB 3KPRD 4QXTB 2BP3A 3OKKB 4K7PL 4OBRA 4NJ9H 4BH8B 4L4VA 1U3ZA 4LLUB 2F54B 1AP2B 1YQVH 1U92A 2EDNA 1BBDH 4J4PC 1I4FB 2KL6A 5SWQB 3F6IA 4Y4HB 3L7FA 4PJHA 4KXZH 4P4KD 2W9EH 4E5XB 4RFNC 2AW2A 5E2TH 5IP4A 1T03H 4X5XA 3I6KA 1G0YR 1X5YA 5KSAA 1UKQA 4XNZC 1MAKA 2ATKA 4K9EH 4JO1H 2YD3A 4JHBA 2L7JA 3OSKA 3LRGA 3P40A 1J1OH 1B0GB 2J12B 1TQBB 3QUXD 4YXLL 5GHWL 4KC3B 3P0GB 4IOIA 5A2IH 4LLMA 2OLDA 1P6AB 1XH3A 3QIWB 3KR3L 2ADGB 4YHZH 4P99A 2BHZA 5FUOH 4QT5B 5ITFA 3X3FH 5D1ZB 5DFWH 5EZOH 1KEGH 5HHXH 3UDWA 1YEJH 5DRWA 3ZE0F 1OCWL 4V1DE 3GBMH 4MJ6B 1JI1A 2VITB 1PKQB 4FZEL 4JREB 3R8BB 5KSAC 1V3KA 1HQRA 2BNUB 2ITCA 3L95B 2NY5C 1T20A 1HSAB 2HLAA 1VACB 5DXWA 3IGAB 3B3IA 5FKAB 3MGTA 4WFGE 2Y7QA 2FJFB 4XNQB 5JHDD 1OGAB 1YYLL 3F7YA 4Z7QE 4Q9RH 3IFOA 4ODTL 4OUUB 4QWWC 1C16B 3UDWC 1HOCB 3UC0L 3RWEA 3O6KL 1NC2B 1EO7A 5FYJL 3SOBL 5IOPA 2DLTA 1MJ8L 4D0DB 4WI7A 1PD6A 1N8ZA 3IDMB 4G8IB 4MQTB 3D3VA 1JHTA 2HAZA 3MRDB 4HCRL 1NCWL 4TVSa 4JDVA 43CAB 4BK5A 3FT2A 5EC2A 1NH6A 2GI7A 3OKLB 4U0RB 3MNWA 3NCYP 4F7PB 3OXSA 2V2TB 4I18C 5ANMB 3WMSA 2DWEA 4KKAC 1BOYA 3FQRB 3MLSH 2OK0L 3A6BH 1WTLA 2X10A 2DQDH 2JJWA 2Q20A 1DFBH 2J4WL 3ZE1F 3U9PL 1CT8B 2EDOA 1YNTB 3MGAA 4KK6C 2XTLA 3HLAA 4OM0L 1XGUA 4P59L 5MENE 2OTPA 3GMRA 4OQ1A 5B8CB 1H3UA 3R8QA 2YD5A 5GRVL 1SY6L 2PXYD 3ZDZF 3QR2A 3C09C 1HH6A 3QWOB 4PJXA 2XZAL 1FO0A 3QA3B 1Z5LA 4HKBA 3UBXA 4N1HB 3ZDYF 4HDIA 2WWMC 3L5XH 1RJYA 1FZMA 5C08B 5HHNB 2W91A 2NCMA 4PJDB 4MCYB 3GRWA 2FEEL 3F58H 3FO9A 1LE9A 5LQBL 4JHAH 4ODUB 1U0QA 4JHWL 2PCPB 2QHLA 5TDNB 5DJZA 2R15A 2RCSL 3ZKQD 1A3LL 1KPRB 3HRZA 1TQCB 1JZ8A 4FABH 2IPTL 1NBVL 1V7ML 2CRMA 4XX1E 4KQ4H 4H5SB 5E1HB 1G6RL 4UI2A 3QQ3A 5I75C 1BWMA 3KAAA 5HVGB 1WWAX 5EC1B 4CL7A 3SQOL 5BZDB 5CGYD 2WBWB 1F3DJ 4OGAD 5FYLE 4AM0A 3U0PA 3G5YA 1L6ZA 4M5YH 4KK8D 3TO4A 3WHE1 2YPLB 3MJ9L 5HHQA 4HUVA 4OZIE 4G9FE 4HIHB 4WUUA 1A1MA 3BQUB 4NO0A 5BS0A 2O26U 3B43A 2GT9A 5EOQH 4MS8D 5L0QC 2XWTB 4GUPB 4BZYA 1N6VA 2YXFA 3LOWA 4U6HB 5DJYA 4OCRL 3GSOA 4CUCA 3KPPA 3FB8A 2P5EB 1UACL 4N5EC 5T33H 1DQLL 4U1NB 5ACZA 3OZ9H 3P0VH 2ARJA 4Z78A 1YA5A 4NOBA 4AMKL 3TO4C 3EKCA 4ZUVB 4O02L 2VQUA 1JF1B 3CX5J 4QHKI 4OV6F 4JHZA 3OAUL 1Q0YL 1RZ7H 1NEZB 3WIFA 3FHQA 4U6YB 1A6AA 1TJGL 4N0FA 1E4WH 3P11H 4GG6A 4PJ5D 1A9BB 3KPQB 4WI8A 5I74B 3OGCA 1WEJH 2OJEA 1MH5A 2AI0H 1F6AA 5C0IA 4QNPF 1RY7B 5E8OB 1FAIL 2XI9A 5ENWB 4GT7A 4NRXB 2APXA 3SDDB 2JB6B 1M6OA 5IVXE 4XI5D 4QTIL 2R8SL 3WLBA 3WIHA 1C5DA 3W11D 1IGYB 3O6FA 3KPSE 4YIQB 1LD9B 4UT7H 1YECH 3S6CA 5I6XC 1NCTA 3DIFA 5EIQA 1VERA 2G9HA 4F57H 2ZKHH 4QHUA 3TH2T 5IHBA 4G6ML 3ARZA 3OTTA 1A6TB 1W2KT 2I07B 5C6TH 1UM4H 3GJEA 1BM3H 2APVA 4RIRB 5DZNA 1T1XA 4NOFA 2P8LA 3OMZA 1HCVA 2DYPD 2P8PB 2DDQH 1OAZH 3D9AH 4P23D 4HIIB 5SWZA 2WIMA 3BZ4B 1JRHH 5D93C 2HJLB 1QQDA 4Y16D 5DJAA 3JWDC 1NEUA 4KI5F 3VFVB 5T5FL 4DZ8A 4EBQL 4H88H 4G8GE 1FNFA 3VDBA 1UKSA 5KSBF 3QFJE 4YC2C 1NGWA 4BYHA 2D0HA 2VDNL 1ZHKB 3ZYJA 1EHLH 4R7NA 1J8HE 3GKZA 2GK0A 4YNYA 1NCBL 1OPGH 1W72B 2E8ZA 2DKUA 4I2XE 1C5CH 4UIKH 2XG4A 3JV6A 4K3DL 4PB9H 1T04A 1U93A 1OGTA 3MO1A 5EO9A 3QBTB 1D5BB 1JPTL 4Z7VF 1U8OB 1BZ7B 1XGYL 4BFIB 3O2DA 4OGXH 4ONFH 4CRPA 4DUWA 5HD8C 4HPYL 3QIWD 3MXVL 3F12A 3WDIA 2OTWB 2AKRA 5DUMH 1HXYA 5D1ZD 5DF0A 4FFWC 5C09E 1QACA 1RU9H 2IPKA 2J6EH 3VXSA 3V5HA 2GFBB 3V95A 1KPUB 3M07A 1ZHNB 1IM9A 1A6WL 1X4ZA 1ED3B 3KDMB 1V3MA 3P30H 3VD5A 3BWAB 3QCUL 1DQMH 5DHVA 5DRZA 3BSZH 3U4BL 3ES6B 1ORSB 2MMXA 3PGFL 5TH2A 5D5MA 1T2QL 4RAUB 5TGBA 1MLBB 1EEZB 4GBXB 3U30C 4MNHA 3MRCB 2C3WA 4PUBH 1QSVA 5K33A 1OGAD 1EZVX 2XKNB 4L9LB 1DBMH 5F1SA 1T7ZA 1RJLA 1NC2D 1H8SA 3ZKXB 3QNXB 1YEGH 3SY0B 2CKBA 2AK4A 2J8UA 1K3ZA 2GEEA 1R0AL 1NMCB 5K93A 1BD2A 3BP6B 1CXLA 4HC1A 5JMRA 4NQDB 1TVHA 4M7JL 1IAII 1UQSA 1GSMA 1BEYH 3L1OH 4PV9A 1E4XI 4QRUA 2CMRL 3RZWA 1U58A 4OLVL 3AXLA 3G04B 3EYUL 1W0WB 3OBAA 3HNVH 5GS0D 2VLKB 3MRRB 3TYGL 2CJUH 3G08A 1NLDL 3O45B 5C0CE 2FSEB 4FQLL 4F58L 3ULVF 3H0TB 1NGZA 4JDZB 1MHCA 4KZEL 4N68A 5FOBB 3MC0A 1MCBA 2G5BB 4EN3A 3MV9B 4QRPA 3O41B 1QEWA 1Q0XL 5DD3H 1FZKB 3N85L 1T22A 3WD5L 3VG9C 2OTUA 4NHUA 1G7MB 1A7NL 4NPYB 1DQJB 3D2UA 4EI6B 5AG9A 3QNYA 1HI6A 2BDNL 1U8QA 2HJKA 3C5ZA 3QZWA 1HQ4A 1TJHH 1N3NA 2KPNA 2V7HB 2VMFA 1OF2B 3X12A 3ZKSD 3EGSB 1WAAE 4UDUB 3S37X 1ACYL 5H2BA 5C08D 5I2IA 2Z0BA 4U1JA 2AABL 1MCNA 3MLYL 4LLYA 4AQ1B 1N5YH 4EN3C 3MTRA 4WHCA 2I27N 5E94B 2VIRA 1OQXA 1KJ2A 4JPWH 1WWWX 2NY0B 4OD1H 4P3CL 3AS2A 4PLOB 2GJ6A 3ULUC 4K94L 1SEBA 4Z77A 1N5AB 2VLME 2W9LA 1XF1A 3CNKA 2CDFB 3CC5B 3SE8H 3BIKA 3QJHB 4YHLH 3WXVL 3C5ZC 3SE9H 4PJGF 4KDWA 4FXKA 1YMMD 3FB6A 2J88H 1LQSR 3EJZC 4BM7A 1KG0B 2CLRA 3NH7L 1X5KA 5JXED 5JW4N 2KBGA 3LKOB 2BVTA 1YPZB 4JEGB 3BEVA 5D72H 2YPLD 3QUML 4KWUA 5DSCB 3QDJE 4GW5B 4PGDB 2Z35A 1C5BL 3BQUD 5D7SH 5D7KD 2BVYA 4XWGL 5A3IC 1CDUA 1IAKA 1JTTA 4DVRH 5ELIA 4G8GB 4OCSH 2VDPH 1BVLA 5I1AB 4MJ5B 1AGFB 5F89B 1CZ8L 2CLZB 4R4FH 2ID5A 5AYUL 2P5ED 1MFCH 3CU1A 3QDMA 2HKHH 3HC3L 5IT2H 5C92A 4XBPB 2XQYG 3D1MC 2AXGA 1QKZL 1QFWM 2BOCB 3B8SA 4HWBH 4ZO7A 1CGSH 4LCWA 4LSTL 1XF5A 4JZNB 1H3GA 1JPGB 4HKZA 4G3YL 4HG4K 3CSYB 4PRHA 1JVKA 3QXTA 2A77L 3TZVA 1AQKL 4WUKL 2B0SH 1QSFA 1IC5L 4HH9B 4PB0H 2B4CC 3QCVH 4JKPL 5GRYA 2YWZA 1CFBA 3DUSB 3KG5A 3IETB 1MLCA 4LVOB 2H32A 3I2CL 3SDDD 1INEL 2X05A 4G6AC 4OF6A 1A6ZB 5EIIB 5MEOA 2XOTA 4HBQA 1RD6A 4KRPB 4BUHA 5HYJB 1S7VA 4D2NA 3MR9A 1XZ0B 3WXWL 4MVBC 5C09B 5I1CH 4YHIA 4DEPB 4I1NB 2OQJB 1Q9KB 2PF6A 5HYFA 3PHOB 4L3CA 3F8UB 4JJ5B 2X89A 3TZVC 4S1SL 5LJYH 3LS5H 3B2UD 1FLRH 1RZJC 1KNOB 2HLFC 1J12A 1MCDA 4ODXA 3B4NA 3MRNA 4ZNEA 4S2SB 5B3JF 1P4BH 1MCOL 2W0LA 3FO2A 4LLWA 1XF3B 2LAGB 3PQYB 1J0JA 3WNNA 1GGTA 2ZUWA 5FV1L 3O3EA 2OI9C 4YFEA 1Z9OA 4W81A 1F6FB 2LU7A 3OKYA 4AIZA 3HE6B 3TC9A 1QHPA 4OCWL 1HNGA 4ORGA 3CFDA 3PHQB 4X5LA 4PY7A 4OD3H 3HNSL 4HKXB 3HA0A 3EZJB 4HF5L 4HJGA 4ALAH 2RQ8A 5EU3B 1I8IB 2BK8A 4OZFB 5GS0H 4MSWB 2HT4C 3I6GB 2P46B 3GMMA 3RUGE 1C12B 1NFKA 3HPJB 3LB6C 3LIZH 5EIVA 4E42A 5BVJB 3VH8G 1YJDH 5FO8B 3VFRA 1WICA 5JO5B 5MEQA 1CXIA 4RWYL 2XQBH 5BV7C 4K7PX 2VR9A 4KJYA 3D18A 1V3JA 1AY1H 2EEAA 3IXTA 5CEXA 5IB1B 4GSDL 3HN3A 3VWJD 2FYYA 4E41A 3HB3C 3BGFC 1I7TB 1ZS8A 5GGQH 1NBYA 3LKNA 4J12A 3M8OL 4P9HH 1KLUA 4W6XB 3U1SH 1TZGL 4NWTH 4LRIA 4KAQH 1DUYB 1QFWL 4KJWC 5F3HA 1MHPH 1I1FB 4KPHH 1P2CB 1GGIH 3GI9H 3MRMB 4LPUA 1JK8B 5ITBL 3AB0B 1NAML 3ROOB 4GBXD 3LZFL 4U7KA 5IF0B 2VZ1A 1M1SA 4G6FB 2DTMH 4AH2B 1YN7B 4U1LA 1A21A 2BCKB 1BVKB 5D7IB 4K8RD 4FXLA 3N1PC 4C57C 1XR9B 4XXCA 4JO3H 3C6SB 1YQVL 1BBDL 3GSUA 4LRIC 5E08H 4L8CB 3OB0K 3UTZB 1N7MH 2VDRH 4NQDD 5F8RC 5LGKA 4YHYB 4PJFA 1OTTD 4UB0H 3BXNA 1BBJA 3QXUA 4JVPA 2H3NB 2W9EL 4JVWA 5E2TL 1NGXB 2EE9A 1N59A 4MCZA 2VLKD 1ZT4A 2Z8RA 1UCBH 1WBYB 4DCQB 4K9EL 4JO1L 1C7TA 1N6QH 1J1OL 1YEHH 4EI5A 1XCTA 2H45A 3CH1B 1DQQB 1MIEH 5DYOB 4XXCC 4XCCH 6FABH 1QRNB 1RI8A 3MV9D 5IB3B 5ILTH 3SDXF 4GRLA 1S7QA 2CRYA 5EA0H 4NO3B 4YHZL 5FUOL 3UTQB 3QQ4B 2EH8H 4L4TB 3X3FL 4YBLB 2CIKA 3REVA 2JB5H 5EZOL 1KEGL 5HHXL 1YEJL 4L4VE 3T8XB 4X7EC 3GBML 1NFDA 2XYCA 1EXUB 4JKLA 2NY2C 3HUJA 4W6YB 4NWUH 3GGWA 4PJHE 1VKXB 4WW1B 2NX5A 1OARH 5CP3H 3LN9A 4HS8L 1I8MB 2EIEA 2HJFB 4FQXD 4U1GC 4M6MH 5L2KA 3LPFA 1FH5H 2NY0D 5CUSH 1U95A 5B39G 1FFNA 4PJ9B 5DC0A 3RJDA 3ROLB 1MCLA 4OV5A 4XNUH 2CRIA 3G6AB 2QR0A 2DM7A 4MJ4A 2IAMA 5DMKA 1QSEA 2A6KA 4CDGC 2CRZA 1DVFC 3VRLF 1BFOA 2OBGA 2X4RA 1VADB 1VSCA 3GSQB 3F5WB 1OAQH 5CKGA 4APQB 1T7WA 4IRZH 3UTOA 2F53A 2FIKB 5H37G 4X6CF 5I1GL 4U6XB 3GMNA 3GJFK 1OP5K 4BSWB 5ETUA 1INQA 1CDBA 2BVPB 2E9BA 4FFZH 1D6VH 1HH9B 3MLSL 1FFOB 5AUMA 1F3RB 3A6BL 1SQ2N 2DQDL 2H6PB 1ZT7B 2IAMC 2XWBA 1DFBL 4WGVB 3AMKA 4ZTOH 2XN9A 3JWNC 4YXKH 3S7GA 4P3WA 1B90A 1E4KA 3V4UH 1W72H 1KCVH 4NDMB 4KJPD 4UTBL 4HLZG 4KKBC 3S34H 5E2WH 5I76B 3QHZH 5GGVH 5GGUA 5IHLB 3TGXA 5DD0H 1MHHB 3EOTH 2V5MA 3I6LE 5IMLA 4MJ2A 4WWID 4G8EB 3L5XL 2HRPL 4TUOA 2O5XH 3D3VE 5ICYA 3GIZL 1H3VA 4ZFZB 3MGOA 3EYFA 3L3DA 4I3RL 1AD0B 1E4KC 3F58L 5GS2H 2X70B 2BVUA 4JHAL 4Q9CA 4PJIB 3HE7B 1P7QB 1TVBB 4M43H 4KRPD 5HYJD 2J8OA 4XRCA 1DBJH 4NBXB 1WV7T 3TIDA 4KQ4L 4XPHH 3WIIL 4PJCB 4CN4A 1K4DA 1MFAH 1OTSD 4YQXL 3SDAA 5B21A 3L3JA 3VFOB 3CIQA 5F7NC 2OMBA 2YS4A 4MA1B 4M5YL 1H3PH 2EDWA 1T1WA 4ZQKB 1HYRC 3DHMA 4K8RH 4UUJA 3IDYB 3PQYD 2YXMA 5EOQL 3WFDH 1HINH 3LQZA 4LCCA 5C71A 3PP3K 2V5YA 2KKQA 5FUCC 2PW1A 3T77A 4MJIA 1KULA 3HE6D 3RKPA 4OZHA 3LSOA 5T33L 3SDAC 4UQ2A 5C0JB 3OZ9L 3T1WA 3P0VL 3C5SA 5E6IB 3TIEB 5D1QB 3FB7B 1OOAA 4MD0A 1G0DA 4JG1H 5I17B 3SGDH 1UEYA 5AD0A 5F6IC 1T80A 4KUZH 2ZUSA 2Z31B 3HZKB 1RZ7L 1HHKA 3EUUA 4FXGB 2B5IB 3QB7C 1E4WL 2R2CA 3P11L 4HSQA 3FAWA 2YHGA 1INDH 4W70A 1WEJL 2AI0L 5D2LA 1I85A 4J3OC 3S97C 5EFIA 3V5DA 1VESA 3SDCA 3NA9H 3HZVB 4TSBH 4KRLB 2BERA 5E9DA 3T4AA 4WUUE 1I75A 4F15B 5BS0E 5IB4A 3PV7A 2VN4A 3LQAH 2KQNA 1UZ6F 4OZGF 4PLKC 4QCIA 1GYAA 4UT7L 1YECL 4KMQA 5C7XH 1G7PB 3VD7A 4F57L 2ZKHL 2FEEI 4UAOC 2DWDA 2N4IA 1JWSB 3QAZB 4XWOC 1G7HB 1REIA 4Y19B 2CQVA 4OGYH 5FAAA 3L7FB 5C6TL 1I85C 1UM4L 4KJQD 4FHBD 5EUOF 2GSGA 4DZBB 4TVPE 3SDCC 2WZPD 5IFJB 3CFIC 1CE6B 5E0QA 3VFSA 3FQNB 4F7CB 2DDQL 3MRKA 3G9VA 3L5WB 3D9AL 1D5ZB 2OR9H 1JRHL 4GG6E 3ARQA 3BZDA 3FQWB 3RU8H 1RHFA 3CXHK 2ESVB 3G6JA 3RDTD 1LNUA 4H88L 1HDMA 3VXTB 4XVJH 1MRDL 3DHJA 4NO2A 4A6YA 5CD5C 1FP5A 1YY8B 2D31B 5CMAA 4IS6A 1EHLL 1SBSH 4AENB 3FQUA 4YJZL 5MEPB 5A16A 3TBTA 1CGWA 2QADC 3SJVB 3MV7A 3RNQA 2LVCA 2R1YA 5GZOC 2ZJSH 3GUTA 3U46B 1GAFH 3QP3A 1C5CL 2CDEB 5E95B 2X6MA 4PYHA 2XXCB 3BJLA 4PB9L 5BQ7A 3EYQC 5J4MA 1P5UA 3DX9A 4OKVA 5HGAB 3VFGH 1S7WA 4M6NH 3RTQB 3X11A 1QRND 2CUMA 4OGXL 4ONFL 4XCFH 5EZIH 4ZFOB 5SWZE 4BQBA 3D6GA 4M93C 3ZE2F 1H0DB 4X0KA 4PGBA 4GXUN 3O4OC 2YPKA 3Q6FA 3SCMA 1R3LA 4HG4J 5DUML 3G5XA 3LRSA 3DMMA 4L4TD 5J6HA 2Y25A 3RWHA 1S3KH 5E7FA 5IKCA 2GSIB 4CU6A 1FC1A 2J6EL 3P77A 3D0LA 4BFGA 2MCG1 4K7PY 2CUHA 2HFFA 3DX6B 2HVKB 3ESVF 3ZTJH 3L5HA 5C0EB 1ZK9A 3P30L 2FD6H 5JORA 4LGSB 4AY0A 1DQML 1X5FA 1MUJB 3BSZL 2FECI 1WC7B 4UINH 4PJAA 3MNWB 4BZ2H 1HYSD 1R5IA 3SCMC 1IEBB 1NGYB 3RA7H 4HS3A 5KW9L 5HGBA 4PUBL 3DMMC 4PJ9D 4WTZG 3OJDB 1M7DA 1DBML 5TE6H 1X9QA 1C7SA 2AJZB 1A2YB 4GRWB 4LU5H 1XGUB 4MWFA 5IVZB 3C8DA 5HPMA 1YEGL 1A1OB 4PY8J 4XAWH 2A2QT 4QRTA 2R1WA 3FRUA 5DRXA 3QUMA 4BSVA 5AAWA 2R0ZH 2YEZA 2IANB 3QUKA 3ARSA 4ZUSB 1FYHB 2W92A 5HDLA 1FO0B 4K94C 4CMMB 4UNUA 1J9CT 1JPSH 3QO1B 4R2GB 1BEYL 3L1OL 2AJXH 2JCCF 1I1AB 3GSNH 3HNVL 1ZLSH 3TO2A 5JPMB 2CJUL 2VJXA 2NPLX 4P3DB 3O0RH 1LE9B 3L3KA 4JFHE 4ZS6D 1ERNA 4NQVA 4OZFH 3IRPX 4MD5B 2AV7A 1FV1A 4KI5C 1ZV5A 2BNRE 3LKQB 3S5LG 3OJMB 4Z7OE 4EKXA 3TCLA 3U9UB 3HS0B 4OJFH 4WV1A 2ZG3A 1F4XH 3C9NA 3T1FA 8FABA 2YC1B 1R3HA 2HN7A 3B5GA 2WBKA 2AK4E 2J8UE 3U0TA 3OQ3B 3P73A 3TJHC 1HZHH 4PJDF 2PUQT 1BD2E 4POZC 5ADOL 2ZG2A 1A0QH 3S4SB 4FQQA 2VLLA 3MRIA 1X6NA 3W81A 1N5YL 4Q2ZB 3HE7D 1VGEH 1L0QA 1P7QD 2FZ3B 5EU6B 1OM3H 4EVNA 4JPWL 2X2YA 4DGVH 4OD1L 4WV1C 1PQZB 4ZODA 5DO2C 1PSKH 5ICZA 3LEVL 3SE8L 2GAZA 5D7LA 5KVEH 5K59E 3NIDF 4YHLL 4QY8A 3MRJB 3SE9L 4Z78B 4LLVB 2J88L 4WW2F 4QRPE 3O8XB 2IQAB 4I77H 4JRXB 1TNNA 3QULA 2RAMA 1U36A 1ZKAA 5E56A 1FE8H 3ULUE 2C4XA 5D72L 4Z8FH 4GKZB 4QGTA 5CEZD 5FO9B 5J13B 3OKDB 5KVFH 1XIWC 3FONB 1N2RB 3MJGX 3I02A 1O0VA 1FCCA 5F93C 5IMOB 4XP6H 4CW1A 2F9BT 1YQ2A 5HHMB 3HHRB 4DVRL 3IS1X 5MHSD 4OCSL 2HT2D 2VDPL 4UU9B 4IIQB 1J7VR 5CIPA 1IKFL 1F13A 1FG2A 2WIIB 1K8DA 1CFQA 4BZ1L 3WHXB 4FG6D 4NNXA 1CYGA 1MFCL 3AREA 3TBWB 2VXUH 1Z2KA 1XFPA 3O6FB 3QG6A 4KI1A 5E6ID 5IT2L 5D1QD 1ZHBB 1P4LB 2GJ6E 5IHZB 5KAQG 1F45A 2G9HB 5EBMB 3IKKA 3DX7A 1B6UA 4TSCL 1Y18B 4HWBL 4PPTA 2Z31D 1J5OH 3T0BA 5SX4I 3QWRD 4PY8I 1M4KA 1G7LB 3HZMA 1L6XA 2CUIA 4PJBA 4JLRA 1U3HB 2B0SL 2MHAA 4NCC1 4KU1A 3MMEB 4LNVA 4PB0L 3AREC 3GSWA 1PG7H 1D6EB 1HHHA 2J5LB 4RCAA 4R9HA 2OZ4H 3RVTC 2QQQA 3MV11 1MRFH 1LK2A 4ZUTB 4HZLA 1UXWA 2SEBB 5I1CL 4P5MB 4Z7NE 2W0FB 3PABB 4HGKC 1CG9A 5IJKA 1H3XA 5F88A 4Z7UA 2ZOKB 3QDME 4Y19D 1BX2B 1D9KB 2BNQB 2BY2A 3SN6N 3LS5L 2GTZA 5B39A 1FLRL 5BZWA 4R3SB 4BSJA 1B2WL 1NAMA 1S7UA 3ZO0A 4LCWE 3QDAA 1P4BL 2DTSA 3FFDB 4R4NC 4XTRD 1AHWA 2Q7NA 4PRHE 1QFUH 3O6LL 1CLYH 3MLXH 2I25N 2C4FT 1T66D 1FLTX 2UV3A 3MRFB 2KUTA 2XFXB 2ESVD 1QSFE 4K7FB 2C7UA 2H2PD 4J2XA 4LEOA 4PRPA 4XHQA 4JFOB 5I1JH 3QEQA 1KCLA 3BUYB 5EUKB 4IRJA 3WJLA 5FA3A 4NFBA 1EEQA 3F7VA 5C0DA 4R7DB 2C9AA 4TUJB 2Z4QA 4KV5E 3IJSA 2VLRA 4EDWH 2R0WH 3SJVD 4K3GA 4ALAL 2J1KA 4KMLB 5ALCH 1AHWC 1U8KB 3GMQA 3HR5B 1J1XH 3ARFB 3MCG1 3NAAL 2N7BA 4WDIB 4X99B 4MNGB 1NCCH 5AAMA 2VABB 3LIZL 2BMKA 1WUNT 1YJDL 4XPAH 4IRJC 4Z95H 1M7XA 3WJLC 4NBYB 2XQBL 3KYOB 3RTQD 2BNRB 5C0AB 4PJ8C 3S35H 2PW2A 1FC2D 5GJTH 3U4EB 4X4YB 3DVFA 3Q2CA 5INCB 4EOWH 4K9EC 1CXFA 4U1IA 5GGQL 1BF8A 4X8JA 3SKJH 4P9HL 2D0FA 3MREA 2H26A 4H1LG 1OP9A 3U1SL 4AYFA 5DRNA 4GMSH 4NWTL 2XKSA 3IAQA 4KAQL 5CILH 4Q0XH 5E8EB 1MHPL 4QRUB 4KPHL 4XP9H 4Y7MA 3GI9L 1IGIH 4HGMA 4M1GH 3R06A 2A74A 1IGTA 2Q1EA 2VZUA 4N9GA 2ADJB 1PEWA 3V8OA 5FYKD 2DTML 4MA3B 4DUXA 4U2ZA 4N1CA 1LO0H 3U7YH 2FO4A 4MGXA 1EO5A 5BJTA 1BQUA 5FF6A 1QLEL 4JO3L 2H8PA 5IW6B 1NL0H 5E08L 3UJIH 4JZOA 4OZIF 2IAND 3D2UB 4NKQB 2UWEA 4YO0A 1JZ3A 4E41E 1DLHA 1N7ML 2VDRL 3BN3B 2XZQH 1TLKA 2E6JA 3ME0A 1I9EA 4UB0L 4TNWF 2Z92B 3QEUA 1I1AD 2ICCA 2NQCA 2A9ML 1IM3B 1FZJA 2X44D 3RY5A 1CFTA 1DBAH 1UCBL 1YEDB 1U41A 1N6QL 1YEHL 1NUGA 1F8TH 1MIEL 1QRKA 4XXDA 4XCCL 1VFBB 1O7VA 5EG6C 2IEPA 4PD4J 3VFNA 2D7TH 1T5WA 5EA0L 1T0NB 1BVZA 2ZUVA 4N90D 1CLOH 5HHOB 3LHPH 4UOW0 3F7RA 4N9OB 3VG0H 3VMNA 2A6DB 4FQCH 2EH8L 1FNGA 2E5EA 1KCKA 2JB5L 3VXRA 1MHEB 1WZMA 5JW4M 2WBJA 4JFDA 1CD0A 1DJSA 1JYNA 2Q76A 5IQ9B 1MFNA 2FEDC 1T7VA 1WFNA 5DJXB 4WI5A 4XP5H 5IVXF 5DJ8B 1S5HB 4NWUL 1X7QB 4ZO9A 4D3CH 4OZ4A 4PJFE 4U3HA 1OARL 5L8KB 4M6ML 5A1AA 4OCMC 5EU6D 1OAYH 4NQUA 4KHTH 1K4CA 4I9WD 5CUSL 2X4PB 3RL2B 2FCBA 4X4XB 2V5SA 2IADB 2K3TA 1NGPH 2NY3C 3DXAD 5E00A 4XNUL 1UJ3C 2WBJC 1B3JA 1QFWI 3A6CH 1KYOK 1WIPA 3G5VB 4R97C 1MJJA 1IAOB 3O8XD 4XBGB 4QF1B 4MMZC 4JRXD 3P4NB 1AO7B 3KPRA 2CDGA 4PRBB 1OAQL 1QFPA 1I8KA 3DX8A 1YNLH 4CVXB 4Z5RA 4IRZL 1J05A 1NFDE 4NSKB 3M1BA 3QRGH 3N1QC 5ESAA 4RMRA 5HHMD 1AJ7H 3HUJE 2PTUA 5IEHB 2QEJA 3F7QA 3PJSA 1D6VL 1MLCB 2H32B 3UZEA 2E9WA 2NX5E 4ZTOL 4YXKL 4P4KA 3TBSA 1KLGB 3CDFA 5DMGC 2FHBA 4HD9A 5IR1B 1W72L 5L2KE 1KCVL 4HIJA 1U3JA 1NLBH 3VXPA 4RA3A 1RIUH 1QFOA 5GGSY 1U91B 1CDYA 3S34L 5E2WL 1OLLA 3QUXA 2EE3A 1CE1H 3NFSL 2AAVA 3QHZL 1NEZG 4V2CB 4ODBD 5GGVL 5LKNA 3QNZA 4EQ3A 3OR7B 1QSEE 2F5BL 5DD0L 4WEBH 2JJSA 4PRNB 1FDLH 3EOTL 1T3FB 5DMJB 3T2NH 1U3HD 4AIXA 3DV6B 5J12C 4HLJA 1AGEA 1XR8B 4P4KC 4X6DA 3HI1B 2OSLB 4X7TB 1U8MA 3E2HB 2F53E 3O2WH 1GVIA 2ZCLH 1AIFB 1LP9A 4M43L 3QUXC 1DN2A 2VDQL 4OFVA 1C08A 5C0RH 1DBJL 1WISA 2GITB 4LHUB 2YKLH 4XPHL 4I0PB 2JJSC 3EYSH 5EZJB 3U6RA 5C0ND 2UVFA 1D9KD 2JLLA 2BNQD 5JHDA 5CBAA 1HHGB 4DN4H 3PWJA 4WTZA 2GJZB 4D8PB 3BZFA 3IDJA 3DBXB 3FCTA 1ODAA 1H3PL 2ICWB 5FYKH 3U4AA 1OT1A 5IESH 1DN0B 4CN6A 4LGRB 1HXMB 3RPIB 2JJTA 5IMMB 3VFUB 2O61A 2FJGA 3WNPA 2HFEA 4NZJA 1KV3A 1TZIA 5ALBH 3CCHA 3WFDL 1HINL 2R2BA 1FIEA 5CJOH 4Q6IA 3SGJA 3KHOA 2IF7A 3E8UH 3EDKA 3TH4T 3ZDXE 1FO0H 1XF2B 4LKXB 4PRIB 2FR4A 4QHMA 2HTLD 4HV8A 4JG1L 5T5NG 1ZS8B 1YDPA 3DROB 3VGEA 1AR1D 4KUZL 1Z6JT 5FUCE 5TF1H 2JJTC 3ARFD 1YY9D 1H8NA 1G84A 1S9WB 1G9NL 3O3UN 2PXYA 3MLZH 1INDL 3S5LA 1GGCH 3SGJC 3WEXB 4LKCA 5IVNA 4JCLA 3L5IA 5C3LD 2YBRA 4TRPH 4NYLB 5IB2B 3MCKB 4P57A 2OL3B 4MX7A 4TSBL 2BHYA 2X4SA 3P3YA 1UWXH 3AU1A 5C0AD 1NMAH 5FK9A 2ILLA 1QLFB 5CEYB 3HC0A 3WKMH 5TDPB 2GIYA 2PO6B 3MRGB 4RMSA 3O3BB 2VDKH 5C7XL 1ORQB 4ZFFB 4MJIE 5CJQH 4DVBB 4E0RB 3ZYIA 4WVRA 1WAAF 1JYXA 5CP7B 2PXYC 4Y1AD 1SVCP 2AXHA 5JPNB 4NP4H 3VGBA 4HKJA 4OGYL 4LASH 3VXUB 2OR7A 5DZOA 4ZXBB 4PBVC 4ZPVB 5K9KB 5C0BB 2APTA 1YUHB 2OR9L 2RFXA 4RDQF 3QDGB 3RU8L 1HILA 4EI5B 1XCTB 4PR5B 5D2LE 3BH9B 3VI4E 3DVNB 3O9WC 4TVPH 3BEWB 5LGJB 4OFYD 4XVJL 5DK2B 2P24A 4GRLB 3UMTA 1CD1A 5E9DE 1T21A 4IJ3B 4L29A 3C6LC 3JBG7 1SBSL 4YHNA 2YUWA 3HZYB 3L7EA 4YHOH 4OKDA 5HHPA 1AGDB 4Y5XA 1KCUL 4ZPTA 1G0XA 7CGTA 1NFDB 5IHUL 1ZHLA 3BFOA 2E7MA 1IEAB 3V9FA 15C8H 2ZJSL 1GAFL 5CGYC 5GQBA 1TZHA 1PY4A 4OGAC 2J2ZA 2V7NA 2VZVA 1ZMYA 3JSSA 5FA4B 3B9AA 4ONGH 2AEWA 1R24B 3WIHH 4LVEA 3VXOB 1D5MB 3JWDH 5GXBB 3MXWH 4X7SH 2X4TA 3VFGL 3LDBB 2I9TB 2VO5A 4M6NL 4MS8C 4MQ7B 4XCFL 1ONQB 5EZIL 4PJ5A 1U8NA 4KQ3L 3G6JE 5HHOD 4Y5XC 3NPSC 1XF4A 5KSVB 1S3KL 4Z7WB 2DLHA 3SEPA 3VXNB 3KLAA 3WO3B 1T2JA 1KT2A 2DBLL 3G9AB 3TLRA 3KPLA 2FD6L 4WFEE 1GJIA 3BZEB 1JNHA 1I7ZA 3MV7E 5DDHB 3KWWB 4M4PA 5EOTA 3R0MA 4UINL 3B6SB 3FN3A 1T1YA 4QTHA 4BZ2L 2D03H 3G5ZB 5INDB 5JOPD 3RA7L 3BD3A 3DJ9A 3LN5B 2XWBB 2DYPA 4IHOA 1IGFH 5TE6L 3CVHB 5GGTA 4LU5L 4PGEA 4DOHE 4XCNB 4XI5C 3FKUS 4P23A 5IWLC 3EOBB 5DQJB 2WLZA 4XAWL 1LE5A 1EGJA 3OGOE 4Y16A 3W11C 2R9HD 3W2DH 3BH8A 3H9HB 4H8WH 4O2EA 4Z9KB 1AO7D 1JRHI 4QXTA 3VI3E 3OKKA 1TJIH 2YOCA 4M7LL 4BH8A 4LLUA 1AP2A 1JPSL 3O2DH 1IFHH 2MQCA 4L8BB 2EDQA 3GKWH 3RWIB 2AJXL 4TUOB 4BKLB 3ARPA 1I4FA 2VE6B 4KTDH 3EYOB 4ONHB 3WFHB 3TVMC 4M02A 3GSNL 1RJZB 4YBHA 1ZLSL 1JGDB 4XNMB 4NN6C 3O0RL 4RGMB 1NJ9B 4P23C 5IVOA 4E5XA 4Y16C 4PJAE 1Q9LB 4HWBA 1XGTB 2IALB 4J3UA 1B0RB 3REWB 1B0GA 4OJFL 5D6CB 1F4XL 3RUGF 3OR6B 2IMMA 4J6RH 1WCQA 1DANU 3L3JB 1S78D 3QIWA 4Y4HC 4UT9H 2ADGA 4GW1A 4YPJA 4QT5A 5LXGH 1HZHL 5EOCH 5D1ZA 2N56A 4M48H 5D2NB 2VN7A 3MOAL 3DGCR 4MJ6A 2VITA 1PKQA 1RZGB 2CKBH 2FIRT 1A7OH 3MNZB 1VGEL 1EH9A 2EDTA 4LCCB 3K8MA 1OM3L 4JGMA 2FBJH 4H1LA 2BNUA 1TQBC 4DGVL 3L95A 4P46B 1CLCA 1PSKL 3MRHA 3OAZH 4MJIB 1HSAA 4HC1H 5KVEL 1VACA 1KN2H 1RZFL 3IGAA 1U8LB 4LHUD 1I7UB 3S37H 3V4PH 4I0PD 1U8JB 3QIWC 5FKAA 2Z8VC 3C5SB 2FJFA 3B9EA 4XNQA 1OGAA 4I77L 5D1ZC 1JGLH 1KENH 1C16A 4Y4KB 1D5IH 1HK6A 1HOCA 1NC2A 1FE8L 4Z8FL 4D0DA 1KPVB 4JREC 1IVLA 5KVFL 3FQXB 4KRMB 4QRRB 4HT1H 4M7LT 4XP6L 4YK4B 1NDMB 4Y4FB 3TFKD 2IQ9H 5GSRB 4G8IA 3IDMA 1JPST 3IRZA 4PREB 1TTGA 3V5DB 4PIRF 3MRDA 4P9MH 2BOBB 2UZXB 3ULUH 1BQSA 43CAA 5F1NB 3OX8B 3OKLA 3T2PA 1A7PH 4OCLC 2VXUL 1B4RA 4F7PA 2VSCA 2YA0A 2Y6SD 4PRID 4QCIB 2V2TA 1Q9OB 5ANMA 4ELMB 3FQRA 5D7LE 4LVNB 3L3GB 3SKMB 1QG3A 4DJMA 5C6PB 1CT8A 4X80H 1YNTA 1OP3H 1J5OL 5FOJA 5B8CA 4PGCB 3E1F1 1IC1A 4R4BA 1KJ2H 5F6HJ 1MWAB 3N50A 3QWOA 1XT5A 2X4NB 3CFCH 5H35B 3QA3A 4U0RC 5T3XE 1PG7L 2EXWD 5E8PB 5GS0C 4KTYA 4AT6B 2OZ4L 4ZUWB 4JFFB 4EQ2A 1MRFL 2PO6D 5DT1H 5C08A 5HHNA 1J0YA 3MLTB 4MCYA 5B8CC 3GHBH 4ODUA 3RVXD 4S1DC 4V2BA 3BPCB 2PCPA 3QPQD 5TDNA 4XPBH 4YZFF 4PJHF 3GMOB 4Q6YA 2M8XA 3VXUD 1XEDA 4X6FB 1KPRA 5JQ6H 4ZXBD 3IFPB 5C0BD 1OAUL 3LPWA 4H5SA 2B4CH 3QO0B 5EC1A 1YZZA 4H0IA 4JQXA 4ERSH 4ZFGH 1QFUL 5BZDA 3MLXL 2R4SL 3QDGD 1KYOJ 4PJBE 5JXEA 3DSNA 4P9HC 2YPLA 3MA7B 4RRPA 4MQSB 2QBWA 4GXUM 3DYMA 4MXVE 4WWKB 2HKFH 4O9HH 3SE3A 3BP4B 4BA8A 3BQUA 4NUJB 1ZGLP 1UB5B 3EO9H 4GUPA 1TQCC 4U6HA 3IT8D 3RWHB 2XA8H 2UY7A 4FQPA 4EDWL 2R0WL 2D7QA 5GGRY 2P5EA 5ALCL 1MCJA 1J1XL 4JQXC 2H32H 4Z7UE 4U1NA 1NCCL 4J8RB 3FTGB 4AZ8A 5JXEC 2Q8AH 4YPGB 4ZUVA 2NY1B 1JF1A 1MPAL 1CGVA 2DI7A 4XPAL 3SE3C 4Z95L 2GCYB 1NEZA 5BVPL 1AH1A 3BQUC 5FGBA 4AEFA 1TPXB 1II4E 1A7QH 4U6YA 1A9EB 1TNMA 1KIUA 3KPQA 1WWBX 3S35L 4XNZB 1TCMA 5GJTL 3NMEA 3S96B 3I50L 4PRPE 5E8OA 1F4YH 3QEQE 4EOWL 5ENWA 3PWUA 4NRXA 3SDDA 3CZFB 5DGRA 4LIQE 2JB6A 5DRXB 1OAXH 3SKJL 4WCYH 3DUUB 5TFSH 3QUKB 4KFZC 1IGYA 2DM4A 4YIQA 1LD9A 2YD9A 3HI5H 3RJQB 2CKNA 4I0KA 4GMSL 2VLRE 3W9DB 5FGBC 1VGKB 5CILL 1BPVA 5EO1B 4PGJA 3FHAA 4XP9L 1CTNA 3IYLW 1IGIL 4M1GL 5I74C 1A6TA 5BV7H 2I07A 1F02I 4G7VH 4RIRA 5F6HI 2W60B 1JWMB 2P8PA 4CADB 1X5LA 5LAXB 4XAKD 1LO0L 3U7YL 2FJHB 4HIIA 1D3CA 2HJLA 4PJXF 3VH8B 3BIAX 1RURH 3VFVA 1NL0L 3UJIL 1JCKA 1GOFA 3MLWH 5E70A 2JJVA 5EORH 1JBJA 2XZQL 3P9MB 1P7KB 2VRAA 4CU7A 3B2UC 1RJCA 1ZHKA 5FM4A 3KXFB 4DTGH 1DBAL 5DVNA 2VLLB 4RQQB 1W72A 5I1KL 4QHNB 5HY9B 1F8TL 2BRQA 4LL9A 1H5BB 4N0RA 5I1DB 4WNQB 2Y5TB 3PV6B 2D7TL 4YDIH 4YDKH 1D5BA 1CLOL 1U8OA 3LHPL 3VG0L 3P4OB 1BZ7A 1VDGA 2VZTA 4FQCL 4BFIA 4BJLA 4FQ1H 1R3IH 4X6BA 2CD0A 4MXWH 2OTWA 3C09B 2I26N 3VWJA 3W9EB 2UWEE 4XP5L 1NUNB 1IARB 1AD9B 1T89C 7FABH 3WSQH 3T0XA 3L6FB 4D3CL 1SBBA 3MNVB 4CW1B 3UPRB 2GFBA 1KPUA 5F1OB 4ZNCD 1MAJA 2XZCH 4BQ8A 1OAYL 1J0HA 1ED3A 3KDMA 2AERT 1GOHA 4KHTL 3ZHLA 3T09A 5I15H 4P46D 3BWAA 1NGPL 1K8IB 3ES6A 4TTDD 1ORSA 4GQPH 1XGPB 4X9IA 1F5WA 4RAUA 3A6CL 4UOW1 1MLBA 1EEZA 4GBXA 3MRCA 3KJ4B 1NGQH 1LEIB 4RMVA 2XKNA 4L9LA 2WQRA 4Y4KD 3QEGH 1AGBB 2H1PH 3QIUB 1MQKL 2EXYD 2LABA 4GG6F 3QNXA 3SY0A 3V4VH 1YNLL 3BD5A 3VXRE 3HZMB 1CGXA 4QRRD 4JFDE 3QRGL 4Y4FD 3VGHA 2X4QB 3V6BR 5T1MA 1KGCE 1AJ7L 3BP6A 4G8FB 4NQDA 3KYKH 1S9KC 3AUVA 5C86A 4K55A 4GBXC 4XBEH 4OF3A 3UTPD 1R3KB 5KN5A 3G04A 4YGVB 1LK2B 4L9LC 1W0WA 3ZKNC 2VLKA 3MRRA 3BI9X 3QQ9D 2PTTA 1RIUL 3O45A 3ZKMD 3ZKXC 4K8RC 1RK0B 2FSEA 5I0DA 2PTVA 2R23B 4KH2A 3H0TA 2I9LB 4JDZA 4CVZB 5FOBA 2ZUQB 2G5BA 4ZD3H 3MV9A 1NMCC 1EAPB 4OIAA 3O41A 4BQ6A 4L3EB 4WEBL 1FDLL 4ACPA 2YD7A 1FZKA 2WP3O 1KB5B 1ZANH 3ZHDA 3T2NL 2VDOH 2LTQB 3KPRE 5DJDB 1G7MA 2NW3B 1OTTC 4NPYA 1DQJA 2P5WB 4EI6A 5GJSH 4M6OH 4OT1H 4RGOH 2AQ3A 3O2WL 1F2QA 1RIVH 2V7HA 3P0YH 3FFCB 3EGSA 4JFFD 3RAJH 4LEOB 1J10A 4UDUA 1CGYA 1BP3B 4JAMB 2XPGB 1H8OA 5C0RL 3BVNA 4Y8DC 3BN9D 2YKLL 4PJEB 1CFSB 4FQXA 3GSVB 5DZLA 5E94A 3EYSL 4X98B 1JNJA 2GTWB 5JZ7D 2FHFA 3PDOB 4DN4L 1N5AA 2WK2A 3NFPB 2CDFA 3CC5A 3QJHA 4POUB 3GMQB 2MCPH 2J8HA 3LY6A 3LQAC 4B7LA 5FM5O 5FYKL 5D1XB 3CVHH 5IESL 3HNTL 3IU4H 4R90H 5F97E 4B5EA 1KG0A 3KPNB 2WWKO 3AC0A 4XPTH 3LKOA 5ALBL 1YPZA 2D4FA 5CJOL 1J1PH 5D9SB 5DSCA 3DO7B 4X6DE 3TT3L 4GW5A 4WWKD 3E8UL 4XC1H 3MLRH 1CL7H 4PGDA 4M03A 2NY0C 4HFUH 3CDYA 3UXFA 1FO0L 1HN1A 1LP9E 4MJ5A 1AGFA 5FYJU 1Q94B 4J7RA 4HIXH 5F89A 4NQEB 5L7XH 1FL3B 2CLZA 4A2LA 4P4RB 4U6TA 5C2BH 5LG1A 5TF1L 3FOLB 1W8NA 5EU5B 1TCRB 4GXVH 4XBPA 5JHDE 3MLZL 1HHJB 5D5MF 1GGCL 2BOCA 4P2YA 2K9UA 4JZNA 1JPGA 4G43B 3BKJH 4TRPL 1OL0A 3B2VH 3CSYA 2ZSVB 2VH5H 5J8OA 1NMAL 3WKML 4ENED 4HH9A 4AL8H 3K1DA 2Z8SA 4AJ0A 2J8UF 2VDKL 3GO1H 3DUSA 2VR5A 3IETA 4L3AA 3IFNH 5CJQL 5EO0B 4KJPC 5J1TC 1A6ZA 4KY1H 3PXHA 4NP4L 5HYJA 2ARJQ 4YO0B 1XZ0A 4LASL 3QG7H 1E4XL 1EFXB 5HGDB 1QBLH 1Q9KA 1MIMH 2OQJA 3PHOA 3MFFB 4JJ5A 5HVWA 4CVUA 4PJGA 4M4RA 5K59F 1KNOA 4LPWA 3OKOB 2DQEH 4LVOC 1KC5H 4S2SA 3DI3B 4TVPL 4JN1H 4HXBH 4OFPA 3VFNB 1KSRA 4NN5B 3MUHL 4KRPC 2P8MB 1XF3A 3ULUF 3PQYA 2VXVH 1G9MC 2W0KA 1Y6NR 2BXZA 4K3EH 4JM2B 4DEPC 3A0OA 4QWWD 4OF7A 1MCIA 4YHOL 4JE4B 4J3VA 3DV4B 3UTTB 3HE6A 5IK3B 4JFDB 1CVRA 4MDJB 4PRDB 1OTSC 4EUPB 15C8L 4FFVD 3CGTA 5A2FA 4HKXA 5F3BB 5E5RB 3KXFD 5GRZA 3WFCH 5F21B 4NQCD 4ONGL 1I7RB 1IE5A 3WIHL 1EFQA 5EU3A 4GW4B 1I8IA 3JWDL 3MXWL 4MSWA 5IGXH 3SGDI 5J11B 2X1XR 3I6GA 4PS4L 5B38B 1MNUH 1C12A 3HPJA 5E2UH 1X5HA 1JYWA 5BVJA 3DRTB 5EULV 5FO8A 5JO5A 3HE6C 2BY3A 4KK6D 4JKMA 2VKXA 3N1MC 4JCMA 4WHYG 5IB1A 3FN0H 1WIOA 2RJMA 3V0VB 3QHFH 5IJVB 3S4SG 4YDJB 1YMHB 4RMUA 1I7TA 1CN4A 4A6YH 4LVHC 4HJ0D 2X9YA 5F7FA 5F44A 3IKCB 4LRNH 4Z7NF 2D03L 2MTPA 2R69H 5GRWA 1DUYA 5CKAA 4OFKA 1IGFL 1P2CA 3MRMA 1BMGA 1JK8A 2AJ3B 3ROOA 6CGTA 2XNAB 4PJ5E 3NACH 3W2DL 3ZT6A 1F97A 4H8WL 2XIDA 4AH2A 1IZJA 1YN7A 5I8OH 2BCKA 3N9GH 1TJIL 2YPVH 2NLJB 3QIUD 1BVKA 4NFCA 5D7IA 3U36B 4ETYA 1OLZA 1PX4A 1A14H 1UWXK 1XR9A 3O2DL 1IFHL 3MYZA 1UZ8B 4KJQC 4WO4B 3C6SA 4KTDL 4OD2B 4L8CA 4M1DH 4RMTA 3STZB 3UTZA 1EBAA 4ISVB 3O11B 5CBEB 4B53A 3AB0C 1BLNA 2H3NA 4KV5F 1MCPH 1NGXA 1YEKH 4PJ7E 4CBPA 4S1RH 1WBYA 1SVZA 4DCQA 5C70A 1FJ1A 3HPLB 4R6UA 2XTJB 1B4JH 2F5AH 5I8CB 3CH1A 1DQQA 5DYOA 1QFHA 3DETD 3U6RB 2VWEC 3PWNB 1QRNA 5IB3A 1MJUH 5KG9A 1BQLH 4L3ED 3PWJB 4NO3A 4OQTA 4UDTB 4UT9L 3MQIA 4PP2B 5SV3A 5LXGL 3UTQA 5BO1H 3QQ4A 4YHYC 4L4TA 2APBA 4OF8A 2P5WD 3T8XA 4O58H 2OZ4A 4DGYH 2FJGB 4UT6L 2CKBL 1EXUA 1V05A 2R1XB 3WL9B 3FFCD 1LWRA 3KLSA 4Q6IB 1NMBH 2FBJL 4CMHB 2X41A 4IRSB 1VKXA 4WW1A 4HC1L 4LLAA 4OLUH 1KN2L 1OD7A 1I8MA 3S37L 3V4PL 2HJFA 1BREA 1A7BA 5GPRA 4PJ9A 2EIZB 4DW2H 4YBLC 3ROLA 4I13B 1JGLL 1KENL 1D5IL 4HUWB 3F7PC 1V5JA 3G6AA 4K07A 4ZSOB 5D1XD 4HT1L 3S5LB 1PG7X 5T3ZD 1VADA 5GGVY 5JNYA 4CNIB 4LKCB 4XNYH 5D70H 3F5WA 3ECBB 1AXSB 4P9ML 4UTAH 3MLPA 3ULUL 1AI1H 1SHMA 1HYSC 2OX5A 3UZQA 2FIKA 3D5OF 1PKQE 4U6XA 4PJ9C 4BSWA 1A7PL 3CDCA 1MCWW 3MSPA 2BVPA 3RBSA 1HH9A 2OXGA 1B0WA 1FFOA 2EIDA 3SPVB 4NQED 2H6PA 1ZT7A 2DQGH 2DI8A 4X80L 1QR4A 4NDMA 3MV8B 4NO5B 3MROB 1KJ2L 1OGAE 5I30H 5IM7B 4APQC 1W0VB 2Y5EA 2CO6B 5DFVD 3CFCL 4IOSD 2KQMA 4YR6B 1L4IA 3SDYH 1MHHA 3JWOC 3WS6C 1RPQA 4G8EA 2ZUUA 4ZS6C 1CQYA 5DT1L 4ZFZA 3EDDA 2C1OB 1JZ2A 1AD0A 3VWKB 3BRFA 2X70A 5HD8D 3GHBL 4PJIA 1BGXH 3HE7A 5T3XH 1P7QA 1TVBA 4XPBL 3VE0B 1GXEA 4PJFF 3L7EB 2CR6A 5ANME 3ZSTA 5HHPB 1EFXD 3MLVH 1RUPH 4OIIH 5DLMH 5HI4D 5JQ6L 1NDGB 2B20A 4I3GA 4UV7H 5JQHC 5I66B 3H7BB 4PJCA 1URLA 3WFBH 2B4CL 4NZUH 2F58H 1UH3A 1AGCB 3VFOA 4ZFGL 2DQJH 3S35X 2XXMB 3QH3B 3U2SB 5FUZH 3OV6A 3LN4B 2AEPH 3HE7C 4KDTA 2NZ9C 1Z9SA 2HKFL 4O9HL 4ZQKA 3ZE0E 3V6ZB 1K2DB 1MJ7H 3EO9L 1IJ9A 4JM2D 3KYMB 4CJ1A 5C08E 3H3PH 4YLQT 5IIEB 1NFDF 3VXSD 3CFBB 1WZLA 3UTTD 3RGHA 2BRRH 2FL5B 2Y36H 4FS0A 3HUJF 4UILH 3QCTH 3PWPB 2Y72A 5C0JA 1IL1B 1KCRH 1T6VN 4YEFA 5E6IA 3TIEA 5D1QA 3FB7A 3VRIB 4MA1C 4JR9L 5I17A 2LQRA 1JNHB 3IS0X 2HRLA 1ZXQA 2X1OA 3MRBB 4KDTC 3VRJB 2H9GB 2Z31A 1AXIB 2IBZY 3IDYC 3RX5A 3QWRA 4FXGA 1YMME 4PJ7B 1A7QL 2YD8A 3Q5OA 1AC6A 2DF3A 3HRPA 3D25B 1A3RH 1MCWM 1J87A 2YPLE 4FG6C 1KB5H 2X4UB 3JTTB 1JPFB 5FHAH 1F4YL 2E6PA 3HZVA 1KCSH 4YBQD 3BH8B 4LQFH 5E6IC 5D7KE 5D1QC 4DK6A 3IDXL 4GKSB 3VFTB 2IPUG 1OAXL 5TFSL 4U31A 3QUYB 4LFHD 3HI5L 3T3PE 2Z31C 1T6WA 2WSKA 4JANB 1G7PA 1TETH 4ODVH 2P5EE 1JWSA 4LIQH 1G7HA 2WW8A 4Y19A 5H37H 1ROWA 5BV7L 1WQVT 4XX1G 2DQHH 1MVFA 4G7VL 4LEXH 1FIGH 4DZBA 2IMNA 5IFJA 1CE6A 2KZ1B 3FQNA 4F7CA 1OP3K 1S9VB 3L5WA 4QHLB 4F15C 4IMLB 3GB7B 4NKDB 1D5ZA 1F4WH 5K9QG 1Q8MA 2G60H 3FQWA 4D0CB 4OCYH 1RURL 2ESVA 1JGUH 4OLYH 4HLZH 5D96B 3VXTA 3KYAA 4HWZB 3MLWL 3QAZC 5EORL 1BWWA 3K4DA 4ETQB 4POYA 5FB8B 1YY8A 2D31A 4GW1B 1YYML 2DKMA 4WO4D 3H6JA 3BAEH 3PP3H 3M45A 3B5HA 2DAVA 2F74B 4M1CD 4AENA 2XZZA 3TYFB 3ZDXF 5MEPA 5HSFA 2XT1B 3SJVA 4XTRC 1J86A 3DWTA 3V7AE 3U46A 1T66C 2P7TB 4KUCD 4Q58C 2Z91B 4L8SB 1G6RB 2WANA 2DICA 4H1LB 2CDEA 2H2PC 3MRHB 4KVCH 1DUZB 5CJBA 3KLDA 3MPCA 4YDIL 3OKEB 4YDKL 2XTJD 2HA1A 5HGAA 1JFQH 3C8HA 1OQOA 5C8JA 4HEME 3RTQA 4ZFOA 4FQ1L 4NKIH 1H0DA 2DQCH 2YN3A 4F7TB 4MXWL 5EDXA 4QHKJ 3KPMB 3LEXB 4M5ZH 1AQDB 5JDSA 3G6DH 1H3TA 3OKNB 3QXDA 4QKXB 3LQMA 2GSIA 3B83A 3K81A 4JZJB 3WSQL 1T83A 2ZCHH 4X83A 4LDOB 1P84K 3DX6A 2HVKA 4JFPB 2YK1H 4M3KB 5C0EA 5I15L 4QYOB 4OZHF 4IRSD 3C60B 2BVQB 3RTQC 1MUJA 3OJ2C 4LHUG 4M8QB 2YA1A 3IAPA 4LDLB 3TH3T 1WC7A 1D5XB 1A7RH 4G6AD 1NBZB 3L3IB 3R1GH 1IEBA 1NGYA 1GGYA 4IEFB 4QO1A 1NGQL 3RIFF 1MFBH 3OJDA 2NW2B 4XH2B 3QEGL 3NFNB 2AJZA 1A2YA 3ARYA 1T83C 2H1PL 4OM1H 4H20H 3B9VA 5IVZA 4PTTB 3RHWK 2PNDA 1LEGB 1JGEA 1A1OA 4N8CH 3V4VL 4YHKH 4R4BB 1CIUA 4P5KB 3EJYD 5D2LF 4MAUL 1CDIA 3IB4A 1JMZA 2FH6A 1OSPH 2IANA 4P48A 1WLHA 4ZUSA 4KK9C 3BX7C 3KYKL 4CMMA 3QO1A 4GMTH 1QO3B 4XBEL 1I1AA 1EVTC 4EUPH 5JPMA 5ESQB 4P3DA 3TJEH 2DIAA 4WU7B 5H94B 5F96H 4PRAB 4G9DB 5HI3D 5EBLB 4ZD3L 3STBA 1J8KA 1HKFA 3MV8D 4MD5A 4GJTB 3ALWA 3DVGB 3LKQA 1ZANL 3U9UA 5J9PB 3HS0A 2VDOL 4RAVB 2JIXB 1YMMB 4R2GC 1XMWA 2HMIC 2YC1A 5GJSL 2B1AH 4M6OL 3UTSB 3G6JF 3O4LB 4RGOL 1KBGH 1RIVL 4B41A 3P0YL 3CFKB 3RAJL 2A0LD 2QQNH 3MUJA 3S4SA 5CLWA 4NQDE 3VWKD 3IDUA 4G5ZH 4HK0B 2F19H 3BMWA 2ZZUT 4N0YH 4Q2ZA 1EERB 2WUCH 2FZ3A 5EU6A 1UWGH 3ZMRA 2VLKE 1PQZA 5L6YH 4ZYKB 1ZGLB 1HE7A 4K71B 4FQHA 3MRQB 3CUPB 3DXAA 2MCPL 3MRJA 4KMTH 4N0UB 1RUKH 2RR3A 3MV9E 3KYNB 4LLVA 3CVHL 3IU4L 4R90L 3O8XA 2IQAA 3WCYA 4Z76B 1BFSA 4JRXA 4MNQB 4XPTL 1NBQA 2E9JA 4GKZA 5FO9A 5TDOB 3OKDA 4OCNC 3FONA 1N2RA 3QSKB 4XC1L 1CL7L 3N1FC 3VI3F 1UB6B 1ZT1A 5IMOA 1HSBB 4DKEH 4HFUL 1YEFH 1G1YA 2HFGH 1JTOA 3VXQB 4UU9A 5E4IA 4IIQA 3U0WH 1WIUA 1H15B 2WIIA 2DS4A 3PWUB 4MD4B 4PP1D 4X7DC 4HIXL 3WHXA 3OF6D 3UYRH 2CSPA 1CXEA 2QSQA 3O8XC 3TBWA 5C2BL 3PWPD 5T1LB 2D3VA 1KIRB 2A73B 4R0LB 2FECL 5F72S 1ZHBA 1P4LA 4GXVL 1P1ZB 1WFOA 5IHZA 5BXFB 5EBMA 5J13C 4PJAF 1Y18A 4OTXL 1B88A 2MKWA 5I9QB 5FYJD 3BKJL 4S0SD 3B2VL 1G7LA 4KGJA 2VH5L 4IIQC 2Q87A 1U3HA 3ALPA 2ATPB 3MA9H 4AL8L 3MMEA 1YPZE 3WDJA 5GZND 5HYIA 4U6VH 4Y88A 3GO1L 3M17B 1XCQB 4JPKH 1D6EA 5L2JB 3O6FC 2QSTA 3H2WA 4IDJH 1GZQB 1PLGH 4LLDB 4KY1L 4D9RD 2ZPKH 3RBGA 4XGZB 1JF5A 2Y07H 4ZUTA 2SEBA 5CJXA 2Y9RT 3QUYD 3QQNA 3QG7L 4JRYB 4P5MA 5DC9B 2W0FA 4FMKA 3PABA 2JTDA 1QBLL 1MIML 4Y5VB 3GMLB 3BKYH 3P4MA 3BKMH 5IG7B 2F15A 2ZOKA 3ZYZA 5FFLA 5KANG 1U3HC 1BX2A 1D9KA 5BRZB 2BNQA 4MDIA 5HVFB 5FECB 1KOAA 4LF3B 2YSSB 4R3SA 1DDHB 3P9LB 2DQEL 2GJJA 1FN4B 4O4YL 1KC5L 3VD3A 3AY4A 3L3OA 2J5LC 3FFDA 4HXBL 4JN1L 4JN2B 1E6OH 4F33B 1EMTH 2BXYA 3NGBC 5CJXC 2VXVL 3MRFA 3ZTNH 2YD1A 2XFXA 4MZ2A 4K7FA 4K3EL 5I73B 3GFUA 4JFOA 1JWUB 3BUYA 5EUKA 3LAFA 2VL5B 4X6BB 5C0NC 3Q6GH 1D9KC 2E7HA 1DVFD 3X17A 2CGRH 4R7DA 5E8DL 5GGSB 3EIFA 3VWJB 5HYJE 3ISWA 3WFCL 4TUJA 1DP0A 2APWA 3UBXI 3ARVA 3AY4C 4H8WC 5E4EB 1GZPB 1KTDA 2ENYA 3UX9B 1Z9LA 4LAQH 1U8KA 3HR5A 4X99A 3ARFA 4WDIA 3MJ7B 4MNGA 1WK0A 1B9ZA 3KPTA 1MNUL 4PJGE 2DBJA 2EDHA 3NIGE 1FBIH 2VABA 5E2UL 2IGFH 1AFVH 3UJTH 1CU4H 2KZWA 3KYOA 4XVUD 3AS3A 1PZ5B 3VDAA 2BNRA 5C0AA 3GBLA 1R3JA 3FO0H 1MFDH 1FYTB 3PQYE 3U4EA 3S36X 4X4YA 5JIKA 1EAJA 3FN0L 1IT9L 3LD8C 3U7AA 4TUKH 1AR1C 5E8NB 5INCA 5KSBB 3ARFC 1YY9C 1CI5A 2DMBA 1MVUB 3MLUH 1Q38A 3QIBB 1OT2A 5JOFB 1TFHA 4A6YL 5CJ8A 4Y1AA 4QRQB 4O2CB 5T1MB 4LRNL 4Y0GA 1ZLUH 2XN9D 2R69L 1OAKH 3F62A 1G7IB 2KDGA 3C60D 5E8EA 4J3WA 3KJ6H 4OI8A 3WFEH 5KN5B 4TQEH 1BQHB 4W6WB 2ADJA 2PTTB 3BW9B 3NACL 3I3DA 1AR2A 4Z7VB 5I8OL 1DEEB 2ZSWB 2IG2H 3EFFB 4MA3A 3N9GL 3I75B 2YPVL 1JV5B 4OFYA 4PJBF 1A14L 2R0KH 1NC4B 1BIHA 5IW6A 4MXVF 2V2WB 3P9WB 2R39A 5KJRH 4M1DL 1PKOA 2BC4B 5DJ6A 4C55A 5CSGA 3ARRA 5HXMA 3NTCH 5E1AB 4QEGA 4K3JH 5EOCJ 2Z92A 4NKMB 1KJVB 1MCPL 5EWIH 1YEKL 1IM3A 1EDQA 4P2QB 3TNNB 4S1RL 3FQTB 1YEDA 5HYEA 4Z7UF 3BVNB 1B4JL 5TQ0L 2F5AL 4NQSB 3O3AB 4FQXB 4X9BA 2NY4B 1ZSDB 3C8KB 5C0FA 2YRPA 5EU4B 1VFBA 1ADQA 2EE6A 4XT1C 1CS6A 1BQLL 3NZ8B 1T0NA 4WEUD 5HHOA 4FFYH 2A6DA 5BO1L 2JIXD 3OWEA 5D7IE 1KIPB 5GGTH 3RIFK 3RVWC 4O58L 1MHEA 3UTSD 4URTB 4DGYL 3O4LD 2VWEE 4FNLH 2EICA 2AK1H 1L7IH 1EGJH 1EV2E 3OPZH 5IQ9A 2DRUA 5HJ3A 3ARUA 5DJXA 1NSNL 4HUMB 5DJ8A 1S5HA 4JFQB 1VB9A 1T7XA 1X7QA 3D69B 4OLUL 1R5VB 2EDEA 2OK0H 5LGHH 2JK5B 2W38A 2X4PA 3RL2A 1OSZB 4X4XA 4DW2L 2IADA 1F3JB 5A43C 3K4AA 1FQ9C 3IXAB 1CXKA 2OYPA 4QOKB 1QRNE 4FQIH 3G5VA 1IAOA 4XBGA 2EYRB 4QF1A 3P4NA 1AO7A 2N1KA 4MNQD 5ABDE 4NM4H 4XNYL 5D70L 4PRBA 4L4TE 2V5TA 4IMKA 4K23H 3K4ZA 4CVXA 1AI1L 4P2CG 4NSKA 2CH8A 4ZDHB 3FOMB 3BOVA 2Q7YB 5IEHA 5C07B 3QJFB 2P45B 5ACMA 4MXQD 3U82B 1NCAH 4JHWH 3V79C 1CTOA 1JNLH 4ZAKB 1KLGA 1OY3B 1I3RB 2DQGL 5LVEA 2ENSA 2R9HC 5IR1A 5T1LD 2MPAH 3MRLB 4U1SA 5MI0B 1U91A 5I30L 3DSFH 4H1LH 5IW1B 2QADD 2EDLA 1JE6A 5GZOD 2P1YA 1JN6B 3A6OA 4PJGB 5EN2B 4J3TA 2O93L 3OR7A 3GSXB 3SDYL 4O2FB 4PRNA 1KTRL 1N0XL 1T3FA 2LFGA 3DV6A 2XQYK 2NTFB 1XR8A 3NCFB 5FXCH 1S9XB 3HI1A 4BFBD 1SMOA 2OSLA 2CK0H 3NCYS 2OCFD 4X7TA 4X5WA 2ZUXA 4EXPX 3RIAK 5CZVH 5I19H 1BGXL 4PJ8B 5T3XL 1AIFA 2UWEF 3QI9B 4KZDH 1VHPA 1IGCH 2HH0H 3E6FB 4AK1A 43C9B 1UM5H 2X1QA 3BT2H 2P47B 1P84J 3MLVL 4JRYD 4WFFD 1RUPL 4OIIL 1FNLA 4TN9A 2F8OA 2GITA 1YEEH 4LHUA 2DJSA 5GIRB 4UV7L 5LBSH 4I0PA 5DMIH 3WFBL 5EZJA 5BRZD 4YWGH 1LVEA 4NZUL 1HHGA 2F58L 3OAUH 1FFRA 2A1WH 1WSST 2DQJL 2GJZA 1ITBB 4D8PA 3HI6H 2CLVB 4U1HB 3DBXA 3MODH 3E2HC 1NFIB 5FUZL 2ICWA 2AEPL 1DN0A 1HXMA 4ZTPH 3RPIA 5IMMA 3VFUA 5A40E 1MI5B 3DMMD 1MJ7L 3TV3H 5ID1B 5JR1H 4KKLD 1GGBH 3FO1B 4LBEB 2G2RB 3PP4H 2Y06H 1M05B 3H3PL 4UNVA 4I0PC 4LSUH 2VZ3A 2Y36L 4PJIE 4UILL 4HJJH 1XF2A 3QCTL 5CJ5A 4LKXA 1UEMA 1KCRL 1CBVH 4PRIA 4LQ1A 4YDVB 2C4FU 5CCKH 3DROA 12E8H 5JA9A 4PJCE 1S9WA 4F7EB 3JUZA 4U3CA 1RVFH 25C8H 1A3RL 1KTLB 3WEXA 1BIIB 4NKOB 2X9WA 1KB5L 3CJJA 5CEZE 4NYLA 5FHAL 1ZWIB 3LKRB 1PYWA 3MCKA 5IB2A 2OL3A 5DEGB 4JFXB 3PNWB 4U33A 3OHXB 1KCSL 2Y6SC 4LQFL 4P2RB 1SJEB 4X7CC 5CEYA 1QLFA 4D9QD 1FYTD 1GC1C 4EBQH 3BPNB 3BDXA 4KI5D 3RDTB 5TDPA 3GIVB 5MHSE 2PO6A 3MRGA 2O5YH 5C3TA 3O3BA 4NJ9L 4CDHA 1FAKT 1X5JA 3PWLB 1ORQA 4ZFFA 4PTUB 1BFTA 1DBKH 4DVBA 1M7IA 4E0RA 3QIBD 4ODVL 5CP7A 1CFVH 4LIQL 5JPNA 4M00A 4JY5H 3VXUA 5FCUH 4L1HA 2DQHL 2DLEA 4LEXL 1FIGL 4ZXBA 1A4JB 1BLNB 4ZPVA 3RWJB 5K9KA 3BPLB 4ZOEA 1QZ1A 5C0BA 4C4KT 2EXWC 3B9KB 5DJ0B 4G6JH 3RGVB 3DNKA 1T03L 1YUHA 1RZIB 3FZUC 3L9RB 1F4WL 2MSPA 2G60L 1FJ1B 2PO6C 3QDGA 4OCYL 1V8HA 4PR5A 2DI9A 3BH9A 3BP5B 1JGUL 4XP1H 3DVNA 5LGJA 3BEWA 4Y2DB 5DK2A 4LLQB 5KG9B 3QPQC 1LO4H 1NC4D 3DUHA 4X6DF 4L8DB 3BAEL 4ZXBC 3H9SD 5ESVB 3HZYA 3BP7B 3OB8A 3VCLB 1AGDA 2ORBH 2NY6B 1XIWD 1LP9F 3MJ8B 1IEAA 4QRSB 3ARBB 3UPAA 2EZ0D 3V0WH 4B50A 4Y19E 2IBGA 1VEOA 5FA4A 1W8OA 2ZNXA 4LK4A 4EI5C 4RGNB 1R24A 4P2QD 1KIQB 4KVCL 3O2VH 3THMH 3VXOA 3DRQB 5SWSD 1D5MA 3W0WB 4GRLC 1JFQL 4N0CD 2I9TA 5F70A 3T0DA 2NY4D 1P7HL 2VDMH 2XG5A 3LH2H 1BF2A 4GAYB 4C83B 2W1NA 4MQ7A 1ONQA 4IJ3C 4W4NA 2Q86B 4NKIL 4Q9RL 4H0GA 2DQCL 1BFVH 1IGMH 5EPMB 2ESVE 4DAGH 4M5ZL 5CFHA 4XP4H 3W39B 3G6DL 5DURB 5KSVA 1EIBA 4Z7WA 3K0WA 4CN1A 3VXNA 3EOAB 2WAHA 2ZCHL 3T0VA 5DK0B 5JNYB 4BH7B 3MCLH 3D39B 2YK1L 1EZVY 5J6GA 5JXAH 3LDBC 3BZEA 1FVDB 3SJVE 5DDHA 3KWWA 4D0BB 3GM0A 5DJCB 4GO6B 3B6SA 4DN3H 2NXYB 3G5ZA 5INDA 3RVTD 2FX8H 2PYEB 1MFBL 3LN5A 1FCGA 3UAJD 3ULVD 3CVHA 3QXWA 4LMQE 2Q3AA 4H20L 3BDYH 4XCNA 2E6QA 4QOKD 3EOBA 1RK1B 4N8CL 5DQJA 3SDXB 4O51A 3H9HA 3IF1B 1OSPL 4LP5A 1JNNH 5GGRB 4JB9H 1QTYT 5GRUH 1MCSA 4NRYA 3OXRB 5IEKB 2UY6A 4GMTL 1BAFH 3EYVB 4L8BA 3RWIA 4BKLA 4ONHA 2EO1A 2VE6A 3EYOA 3MLYH 3WFHA 1RJZA 2W59A 2EKSB 5C07D 5I1LB 1JGDA 4XNMA 1AKJB 1NJ9A 3TJEL 1UWEH 4NNYB 2EIBA 4ZAKD 5F96L 4HMEA 2ZOLB 2QKIB 1I8LA 1Q9LA 4NHCH 1IQWH 5M94B 1XGTA 2IALA 2DL2A 4FABL 1JZ6A 4R96B 3VFMB 5FYKE 1B0RA 3REWA 3K80A 4JO4H 5D6CA 4GRWE 3OR6A 5J0BA 3VD4A 3D0VB 1LDSA 3KNBB 4M6AA 2B1AL 4X9FA 3MUZ1 4HFWB 4JDTH 5E2JA 4D9LH 5DVOA 1KBGL 3WNOA 4RGMC 3NABH 2IANE 1HWGB 1OHQA 5HGHB 4H25B 5GRJH 2QQNL 5D2NA 4EDXB 1I8LC 4G5ZL 3SO3B 4N0YL 4X6CB 1RZGA 3IFLH 5HDQH 5C0GB 3MNZA 4PJ8D 2AEQH 2WUCL 3WLWD 3QI9D 1VFOA 1UWGL 3TCXA 4P46A 5DGQA 3U83A 5I18H 4OAWB 1QYGH 4KKNA 5KS9F 1U8LA 5DQ9A 1I7UA 1XGRB 1U8JA 1MCFA 3LS4H 4GFTB 4PGZA 4KMTL 1RUKL 2QSCH 3BPOB 2YD6A 3DARA 4NNPH 3ZE2E 4LSTH 2R2EB 4N90E 4Y4KA 5DD6B 1A8JH 1EEYA 5D2NC 1FNSH 1RUAH 1KPVA 4WUKH 3FQXA 4F2MB 4QRRA 4LCCC 3CSBA 1MI5D 4DKEL 1NDMA 4Y4FA 4P46C 1YEFL 2AJYH 2HFGL 3DOSA 4WTWA 5GSRA 1NKRA 3CMOH 4PREA 3RWFA 5C9JB 3CDGB 1I3UA 4TTDC 3UCRA 4F7MA 1FHGA 2BOBA 3O9WB 5I71B 3WBDA 5F1NA 4EUPG 3OX8A 3UYRL 1MY7A 4XNXH 5EU6E 1FVCB 2LU3A 4Y4KC 2X5PA 1Q9OA 3LKPB 4ELMA 4I9WE 2H2SC 2EXYC 2L0DA 5ACLA 3SKMA 1CDJA 3L3GA 4OF5A 3DXAE 2B8OT 3NN8A 5B38G 4WTXA 1KJMB 2VLJB 4PGCA 4YK4C 4Y4FC 1SJVA 2E7LA 1BM3L 4NT6B 4JRXE 5F7MC 1MWAA 1S7SB 4RNRB 3IU3B 2X4NA 2DJUA 5IFAH 1OAZL 5H35A 5EBWB 1P4IH 4U6VL 5HGGS 4TOYH 1JZ5A 1RZ8B 1IQDB 4JPKL 1WF5A 5E8PA 4P2RD 4IDJL 1PLGL 3QQ9C 4AT6A 3ZKMC 5HHME 4ZUWA 4JFFA 1F2XK 4FTVB 2ZPKL 4LFHG 4LVNC 2Y07L 3SBWA 3BWUC 3MLTA 2YUZA 3MZGB 4Q74A 3SKOB 4L5FH 2E7LC 1DLFH 5FGCB 3BKYL 3UP1A 3BKML 3BPCA 3EHBD 4HF5H 3HTLX 2HTKD 3C08H 3GMOA 2FEDD 1P69B 4X6FA 2D7OA 1OPGL 1FFPB 3IFPA 3PGDA 5ICXB 3B9KD 3VGAB 4UIKL 1MOEA 3ULVH 3RGVD 4KROB 1E6OL 2W65A 3LEYH 3QO0A 1EMTL 5K9OB 1G7QB 3SBWC 1HEZB 3ZTNL 3HG1B 5BOZG 4NCC2 4N8VB 5F7YC 1A22B 5C8JB 3MA7A 4Y2DD 3BN9C 3QZWG 1WWCA 4MA8H 4WWKA 3BP4A 3Q6GL 3ZZ1A 3BO8B 4NUJA 5JZ7C 1UB5A 2CXKA 1CL7I 2CGRL 3EO0B 5JDSB 3VXMB 4OZGB 3QXDB 5HVHB 1JYVA 4HUNB 4JFEB 1OTUD 1RU9L 5HDBE 3TEUA 2NY6D 2DQTH 3EOYG 4LAQL 1E27B 3ARBD 5ISZD 1HNFA 3RWCB 4J8RA 3FTGA 5EBGA 2WMPA 3TVMB 2BNQE 1FBIL 2X4OB 1LO2H 3AMLA 4RGND 2WINB 4YPGA 5EUOB 1S7TB 2IGFL 1AFVL 3W0WD 1G9MH 4WWKC 3WE6B 4UIMB 4LCUB 3OG4B 5KVMC 2GCYA 1CU4L 3CLFH 2IH1B 1Q9WB 4UBDD 5DMGD 1A9EA 1QD0A 1WTGT 3RFZC 4G80A 3FO0L 1MFDL 1PW3A 2UZYB 4GQ9H 1RUMH 3S96A 4FP8H 5E99H 5DURD 4TUKL 1U8PB 3OKMB 5GSVB 1JGEB 3S98A 3T4YB 3T0EB 2DQFA 3CZFA 3MLUL 2C3HA 2BSRA 5F9WB 3GNMH 2NY1C 3DUUA 3WNMA 1G7JB 3D39D 3LPGA 2OP4H 3MACH 3H9YA 1FORH 3KLHD 5F9OH 1OAKL 3W9DA 1VGKA 1TPXC 5EO1A 3KJ6L 1UT9A 1SYSA 2YR3A 3WFEL 4MNGE 1QOKA 2NXYD 4TQEL 4ENEC 1ZOXA 2HT3D 2KH2B 2PYED 4Y2OA 4B7IA 1BZ9A 3IJYB 1NCNA 1MAMH 4MQXD 5D7JB 3VFWB 2W60A 1JWMA 2IG2L 4CADA 3FB5B 5LAXA 2FJHA 4F37K 5C0AE 5DD3L 2R0KL 2VUYA 1ND0B 3VH8A 1MCQA 2GUOB 3FT3B 5KJRL 5KVGH 4XZUB 3BDBA 4XMPH 2Z93B 3NTCL 3GHEH 3P9MA 1P7KA 4K3JL 1TJHL 2WUBH 4Y1AE 2P4AB 3C87A 3PDDA 2EH7H 3KXFA 5EWIL 1JUFB 1N64H 1ES0B 4NQCA 1FGVH 4HS8H 4RQQA 1AKJD 3V0AC 4QHNA 3V6FB 2JELH 3S88H 5HY9A 1H5BA 5I1DA 4WNQA 2Y5TA 3PV6A 4IDLA 4I18A 3NCCB 1OVZA 32C2B 1FVEB 4FQHB 2VC2H 3BHBB 3CX2A 3DXAB 3P4OA 4FFYL 3RP1A 2R4RH 4GKNB 1CD8A 5DS8B 4FFVC 5GGTL 4AEIH 1P53A 2VXTH 1MCCA 4FNLL 2EECA 2AK1L 1L7IL 1EGJL 3OPZL 1CICB 2V2XB 4I3SH 3W9EA 1T5XB 3VDCA 4HZAA 2FGZA 5I1GH 1AD9A 4ELKB 3L6FA 1ZT1B 1H5BC 3MNVA 5D7SL 2BZDA 3UPRA 5T1DH 4U1KB 2JCCB 2NZIA 1S7XB 3RL1B 3ILPB 3T3PF 1FSKB 5I16A 3WNLA 5LGHL 2NXZB 3GBNH 4A2MA 5CSZB 5E2VH 4R4FL 3ZT7A 1K8IA 5DHYB 1KELH 1XGPA 4UTBH 2HKHL 4OSUH 4MLIA 1ULVA 1RULH 4FQIL 4HAGA 2RHEA 2VL4A 3TNMB 3RWGB 1EPFA 1ZLWH 1LEIA 2B39A 1IC4H 3SKNB 1CGSL 5HHOE 4NM4L 5CZXC 1AGBA 1Z3GH 3QIUA 4N8PA 5CHNB 4HJ0C 1DR9A 4K23L 3BGMB 4HGWB 2HRPH 5AZEH 2C3VB 2ZUTA 3GIZH 1HHIB 4ZS7H 5L8JB 2X4QA 2CXGA 5J57B 3DGGB 4I3RH 4OQTH 3QCVL 4L4JA 4YUEH 4G8FA 3O9WD 4ZG1A 4W4OA 1NCAL 1JNLL 2EDRA 2DB8A 1BJ1J 3KJ4C 1IGJA 1R3KA 3EO1B 4YGVA 4NN7B 2MPAL 3C6LD 5JOPE 1ZLUK 2VXQH 3QPXH 1T0MB 1KFAH 3DURB 3QIUC 3WIIH 5HYSB 4Z0XB 4YH6A 1RK0A 3T08A 3DSFL 2R23A 4PBXA 2I9LA 3P4MB 4CVZA 3TA3B 1ZGLM 4YQXH 2VLJD 4S1QH 1E0OB 5DMYA 4WW2B 5ECJE 4MDIB 1EAPA 2C26A 3TN0B 4L3EA 4ZUUB 1CQKA 3CFJB 4LPTA 4C56B 1KB5A 3AAZB 1AO7E 4U1MB 5DJDA 4W4OC 4NGHH 2NW3A 3ZHKA 4WI2A 3ZL4H 3TBYB 2I24N 3L3OB 4Z7QF 3FRPG 5F1IB 2P5WA 2VOTA 4PV8B 2CK0L 4NIKB 5CZVL 3F6LA 5I19L 4TNVK 5T1KD 3JV4B 3FFCA 1P9MA 4H0HB 4KZDL 1S8DB 4FTVD 1IGCL 5IJKC 2HH0L 2P48B 4CU8A 1UM5L 4JAMA 3BT2L 5AYQA 4U2YA 3DETC 2XPGA 2ZUQC 4M8VA 4LSQH 2AJSH 1YEEL 1A1NB 3DYPA 4JM4H 5FKPB 5LBSL 4PJEA 1CFSA 4OD3L 3GSVA 3SE4A 5DMIL 4X98A 1WBZB 4QGYA 2GTWA 5T5NF 2LTQC 5E6YA 4YWGL 3JTSB 3PDOA 2ADIB 2A1WL 3NFPA 1KTDB 3JWOH 5GS0L 5GS1B 1G9EA 4WIQA 5IBTH 3HI6L 3QT2A 4KK5D 2VXSH 3MODL 3PG2A 5F8QC 5D1XA 5DFTA 2A6IB 3X13B 4KROD 2PR4H 1P9MC 1FRGH 4HQQH 1QVOB 4ZTPL 3OL2A 2OR8A 1DQTA 3DPBA 3KPNA 3TV3L 4LDEB 3HG1D 3MYJB 4H26B 5JR1L 1PVHA 1GGBL 4F8QA 3PP4L 5K9JH 1J88A 2UUDH 2Y06L 5D9SA 3DO7A 3SE4C 2XY1A 4MHHG 3UROR 1R3JB 1UXSB 1AY1L 4LSUL 3VJ6B 4PG9B 2ED8A 4J3XA 1QNZH 1JZ4A 3MRPB 1ZVHA 4HJJL 1Y6KR 4JPIB 4X4MA 3VXMD 3SKUD 1CBVL 4V1DB 3BYYA 4S0TD 5KSUB 3ARDB 1Q94A 4KKCC 3PDGA 4JFED <