4Y19B

Immune complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
192
structure length
184
Chain Sequence
b'SGDTRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGVGESFTVQRRVYPEVTVYPANLLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSLTSPLTVEWRAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title T cell receptor reversed polarity recognition of a self-antigen major histocompatibility complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 44
structure length 184
sequence length 192
ec nomenclature
pdb deposition date 2015-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y19B02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4y19B01
4FS0A 4BSJA 3SDAB 1OWWA 5H35B 5KS9A 4O2EB 3DIFB 5F9JB 4Z18A 4PJCF 3IFLH 1T5XB 3QSKB 3OR7A 1ZLVK 5A2IH 4OCRH 1OAYL 4AENA 4KHTH 1AI1L 5C0JA 3S4SA 2OI9B 3PDDA 3V5HB 3KPSB 3QA3B 3G04A 5I1GH 3JTSA 3PGDA 1JYVA 1DQDH 3D6GA 5I15L 4TVPL 4C56B 3NCFB 3WS3B 3PWJA 2V7HB 3GM0A 5FM4A 3PIQA 5E2TH 3OAYK 5JOPE 4QHLB 5D7LE 1P4IL 4PJ5E 2EE2A 3I9GH 3ARGD 1UACL 4Y4HD 4U31A 4JDVA 4WUUA 1AGBB 1I1YA 1BZ7A 5IVNA 3OJ2C 3SE3A 1QEWB 1AIFA 1OL0A 4YXHH 4R96B 2OR7A 4FZ8L 7CGTA 3SPVA 2Q76A 1EDQA 1JF5A 1F42A 3S36H 2B20A 1QLEL 4J2XA 2QHLA 3WFCH 3IDJA 2MKLC 5SX5K 5HTSA 2WBJC 2AV1A 2K1MA 5DC9B 3SKMA 5GJSL 5C0IA 2DDQH 2WQ8A 5JQHC 4Z7UA 2VLJD 4WEUD 1P7QD 3FO1B 2XZCH 4ZPTA 2V5SA 5HD8C 2F5BH 1K6QH 2R0LH 4HCRA 2ZCHL 4Z7QE 4QXUL 4R2GC 4LU5H 2R2HB 5D7JD 1HCFX 1MCIA 2P5WA 3OKDA 4K3EH 1TVDA 4NOBA 2A6IA 3ARPA 3FO2A 3PV6B 5IROC 4M7KL 5KTEH 4E5XA 4GRLC 4JFHE 5D5MB 1MFAL 1OAKL 4CMHC 4HBCH 5C0BB 3HKFA 3BIKB 1G7QA 2P7TA 3GO1L 2R29H 5D2LF 1RK0B 1H8OA 3MRPB 3ORJA 2FJFB 3RZWA 2J8UE 4KUZL 4JRYB 3BIAX 2A6JA 4OZ4A 4YUEH 2FH6A 4RMTA 5F7KC 5ALCL 3S35H 4EUPG 2ESVD 3IDYC 3SGDH 3GI9L 1LILA 4P4RA 3TH4T 2JELH 3ARSA 4O2FA 3A6CL 3ARED 3CPLA 5KN5B 2B0SL 1RY7B 1TJIH 2IFGA 5GIRA 2NY4B 3QO0B 2PW1A 3HI5H 4PJ7F 4UILL 1QR4A 2YXFA 3DROA 3C08H 4ZOEA 3BDYL 3DUUA 3ZT7A 4YHPB 3IFPA 3MRCA 5D93C 5BVPH 3B9KB 3N1MC 3U6RB 4HJ0D 5FUCE 3SDXA 3RJDA 2FHCA 2KPNA 2D0FA 1ZT1B 4N0UB 4WFHE 4K7PX 4R7DB 1IBGH 4G8GB 4HIIB 1N64L 4XMLH 1C7TA 3P11H 2X70B 1XCTA 4YHKL 3LKRB 5DI8B 4JVWA 3WJJA 1KIQA 3PGCA 3QEGL 1HQRB 5BRZD 1JPFB 1LO2H 4NT6A 3RVXD 5HVHB 1BLNA 3IFOA 3MLWL 1CGTA 3T4YA 4Y4HC 4JB9L 1TPXB 1NCDL 3GMMA 1S7XA 1KCLA 2F5AL 3QDGB 4LSSH 4JGUA 1RJCA 4RX4A 3FTGB 5DR5H 4A6YB 5EO9B 3U9PL 3TP4A 3TNNB 3KLAB 3KPSE 1CXFA 2YBRB 4XVJL 3VFWB 4C56E 1IARB 2OJEB 1I7ZB 5IFJA 4MA8H 4YFLF 5EZLA 1FRGH 2FB4H 4LDEB 4PLJD 2XXMB 1YY9D 3CU7A 3IAQA 4KUCF 4HMEA 5HVHC 4TQEH 3PP3H 5D7JC 5I8OL 1WEJH 3BZ4A 3QWOA 2ICES 4PB0H 4HUXA 4M5ZH 1UVQB 3BKMH 4ZFZB 4KTYA 1RQ5A 1S8DB 3TJEL 4EN3B 4IDJL 3MA7B 4L3CA 3VFSA 4OB5H 1EJ6A 2IH3B 3QNYB 1DBML 1BAFL 4KAQL 4RWYH 1QZ1A 1UQSA 4L5FH 3M1BA 2J2ZA 2A73A 4ZDHA 2F58H 3L3IB 1WT5C 5FO9B 1KUMA 1MI5A 5FKPA 3U9UA 3WN5A 1C12B 5EBWA 3O3AB 5TQ2H 1FO0H 1A3QA 2DIBA 3AREC 2H8PB 3S3JA 4WWKD 5TDOA 4AH2A 4JN2A 2CR3A 2O5ZL 3BP5A 2X89D 2Z4QB 4K3JH 1SJHA 5FYKE 5ICXB 5C0BE 4LKCA 1FVCB 4XCNB 5D7IA 4GQ9L 1R5VB 2Z93A 4KJYA 1A3RH 1RZJC 2Z31D 4JRYE 2ZUQC 3MJ7A 3OAZH 4EN3C 2BC4B 3HE7B 3UBXB 4X6BA 4OQTH 3I75B 4MVBD 1I9RL 4NC1E 4HJ0C 1CDIA 3DTXA 4HX1A 4OF3A 5IBLD 1CFVL 3GSNB 2VDKL 5ALBH 1FL3B 3GHBH 1FIGL 4OD1L 4XC1L 1UWXH 4PLKD 5J6GB 4G6FB 1HOCA 3WNKA 1MJJB 4Q9QH 2HH0H 1GZQA 1I9JL 3DGGB 1WLHA 2BNRA 5JUEL 1U8NB 1AXSB 2DQGL 5E5RB 1WWCA 2YRZA 5GGTH 4XHQA 1M05A 3HTLX 1AGFA 1PFCA 3RVXC 1QBML 3CDCA 5ID1B 4Y5YA 1DBJH 4N0UE 4X5XB 4CN6A 2WBWB 4BZ2L 2IQAA 4D8PA 2C26A 3ZE1E 4G8GE 3O6LL 5DD5H 2FJGB 4ZTOH 1YY8A 1A14H 3VFPA 2CGRL 2OL3A 4JDTL 1GJIA 1BBDL 5EPMB 4YXKL 1AP2A 1QYGH 1I9IH 2ARJB 1FNSH 4EBQL 4RCAA 1MHEA 2VNCA 2CMRH 2ARJQ 3AC0A 3HR5A 1IAKA 4GO6B 1RHHB 2VN7A 4YXLH 5AYQA 2YKLL 4EZMA 1YEKL 4PLJC 4TVSa 4Q0XL 1NCWH 4WWKB 3MLVL 4LEOB 5EU3A 1YY9C 5T1DH 3QDGE 5FYJL 3QQ9D 1L6XA 1F3DJ 1C5CL 4LK4A 3V8OA 4M43H 5E70A 5CEYA 4OIIH 2A6KA 2ITDA 4ZPVB 3TBYA 5JPMB 5TDPB 2DJUA 1DUZB 3VXSB 4HC1A 1F8TL 3TBTB 3P30L 4LPYA 1QSFD 3QEQB 4PRNB 1INDH 1TJHL 3FFCD 3O4OB 5CZVH 4IOIA 4J4PA 4M6AA 5JHDD 3PDOB 1DQML 2ITCA 4RIRB 3UYPA 8CGTA 1JNNL 5IKCB 4TNWK 4N8VA 4WW2C 5F1OB 3FQWA 1SJVA 3S9DB 1RUKH 1I7RB 4O2CA 5EIIA 4U33A 2Z91B 5LCVH 3RBSA 3V5KA 4WWKC 2DLTA 2R2EB 32C2B 1U8OB 4K94H 4ZS7L 4QRPE 5I9QB 5C0DB 2IPUG 3BP7A 3S37L 4QHKI 3MNVA 5FOBB 4LPVA 1Q1JH 4HKJB 4NN5B 1HQ4B 2MPAH 3P4NB 3PUCA 3AXLA 2DQTH 4QXWA 2C9AA 4XPAH 2Z31C 1JHKH 4XMKH 5ILTL 3UPAA 3NOIA 5DUBA 1CR9H 3P4MB 4MVBC 1KACB 3O4OC 4UNTA 4K8RD 5IBLC 4TPRH 2HFFA 3FT3A 4YBQD 2WWKT 1Z6JT 3BO8B 5GS2D 1AR1D 3HS0B 3ULUL 4PLKC 3FONA 4RQQB 4XXDB 1UB5A 1JE6A 3X17A 5I9QC 2PO6B 2HT3D 1MJ8L 4L4TB 3VI4E 4CU6A 1X5GA 2CH8A 2HJFA 4NN5C 3CC5A 1J8HD 1IGCL 4TSBH 5FDWA 1PBYA 4KJPD 2YC1A 4GW5A 1U42A 2B4CL 2H2PD 1NANI 3GIZL 4YR6B 5CP7A 5JHDB 2CIKB 1L6ZA 2H45A 2IMMA 4CVWA 3RL2A 1IEBB 4PJGE 4X0KB 5D70L 3X14B 5KVFH 3HFML 4HS3B 2WUBL 5DRNA 4PR5B 3QNZB 4WHCA 3T1FB 1B6DA 3V6ZA 4QNPE 4UU9A 4XNZB 5BVJB 4HPOH 1EFXA 1D5IL 2V2WB 1YUHB 3WFHB 4ZSOB 3SQOL 5T5NF 4G9FD 5DQDH 2DLGA 1DVFD 5HYQA 2HTLD 5MERA 1ZGLA 4IBLT 3IAGC 2BSED 4WI6A 4XCEA 2GJJA 4MDIA 1X5IA 3JV4A 4NUJB 2YD4A 1IM9B 1OAYH 3L3JB 2X05A 1AI1H 4BKLB 3L3HA 3CAFA 3RL1A 3QCTL 2QR0A 2Y36H 3D3VB 1I7TA 4PGBA 1SVZA 4MWFA 3IU4L 3F5WB 4UNVA 5I15H 5D1ZA 1ZGLP 4OLEA 4L3ED 5ACLA 5D1XA 3BT2L 5DFWH 3QULA 4HAGA 3BRFA 1BJ1H 4DGYL 1D5BB 1P4IH 5F7HA 1UACH 3VXSE 2FX8H 3QEQE 4Z78B 4XC3L 1J1PL 1EBPA 1J8HB 5C0ND 4FZ8H 1A7PH 4NZDA 1UM4L 5F6IC 5L6YH 1BIIB 1VENA 4UT7L 4K8RC 1PSKL 1QLFB 1S7WA 4YBQC 2AQ2A 3QP3A 2VLME 2CSPA 4U6VL 3W5MA 4U7KA 5AZ2L 1AR1C 3RGVA 2EKJA 4P5KB 1BZ9B 4QXUH 4TSAL 2WANA 1FL5A 1XT5A 3A6BL 1K2DB 2P5EA 5L2KA 4JHWL 1U8MA 1N59B 2DQFB 1NGWB 4M7KH 4OFKA 1BD2A 1MFAH 5E56A 4MQ7B 4PD4K 2VLLB 1X5YA 2LVCA 3V0VB 4XCCL 3MRNB 3GO1H 1VEMA 4TSCL 2DTMH 3GMLB 4KUZH 1J7VR 1F3JA 2H2PC 2EDTA 3DYPA 4NIKB 3MV01 4B0MM 2X9YA 4UOJA 4NNXB 1ZHKA 3EOTL 4UB0H 1G9ML 4MSWA 1ZT4B 2JIXA 3WJLC 2DBLL 2CIIA 5I16A 3LH2H 2B0SH 3HPJB 3UJIL 1KLGA 4L4TE 5E1AB 1MAJA 2UZYB 2BNUB 3ARDD 3DMMD 3NBNA 1KTLB 1AJ7L 2DQCL 4QTHB 2APTA 3A67L 3KWWB 5SWQA 1D3CA 1DVFC 1R5WB 2HTLC 3CX2A 4OCNC 5BS0A 1INEH 4KRPD 4UBDC 4Y0GA 2OQJA 3HN3A 3V6FB 4KVCL 1HHIA 3GNML 2C1OA 1N64H 5BCAA 1MCPL 4ZUSB 4QLRA 4Y2DA 1LK2B 4D9LH 2XTJB 4ORZC 4YHKH 2X1WL 5FO7A 5HHOD 2COQA 2XTLA 1IC5H 5K9QI 4ZSOE 4KJWD 1PY9A 2AJ3B 1FFOB 2X10A 3RWEA 5IHBA 2HRPL 1B9ZA 1CCZA 2YS4A 2AKRB 3MLWH 1T3FA 4NZUL 5CBAA 3LQZB 1NCCL 4OI8A 3QEHA 2H6PA 4PG2A 4PJAE 4JB9H 4EIGB 5F7UA 4LAQL 4NJ9L 1T2QL 4N8PA 3KXFD 2VL5A 5TGBA 3HG1D 3U9PH 5C0NC 4GOSA 1XF5B 4YBLB 1YMMA 4ZNCD 2YN5A 3D3VE 3MRQB 4XVJH 5JR1L 4WV1B 3LV3A 1EHLL 3DYOA 1YMHA 5D8JL 2EDFA 6CGTA 3ZE0E 1TQCB 3MUZ1 4PJGF 4P59L 1ES0A 3P4LA 5F3BA 2DD8H 1G7LB 3WD5L 2APXA 3DXAA 3W5NA 4QNPF 2PXYB 2DF3A 5JIKA 1QVOA 5ITBL 2QL1A 4H5SB 4ZAKD 5FGRA 4JM2B 2XKSA 3TJEH 3H9SA 2I07B 1S9XA 5CAYB 4F15C 1BAFH 5EU7E 4XAWL 2X4OB 1VESA 4GRMB 5ISZD 3HR6A 4O51B 3QUZB 1IAMA 4L9LB 1TQCC 1IGJB 3ROOA 4UQ2A 1NGZA 12E8L 5CJ8A 3CDGA 3QI9A 1Z9SA 1K4CB 2O5ZH 5EB9A 3UZVB 3ARDC 3DMMC 3KPNB 1RFDL 4KKCD 1NFIB 3FMGL 2R4RL 4F58L 4GQ9H 1EERB 4LNRB 4DGIH 5J12B 4JFED 1ZHNB 1IEAA 3BXNA 3IFNH 3WXWL 1FO0A 4RA3A 1CYGA 1CLZL 1IRAY 1GAFH 4KRPC 2VDKH 4PGCB 1AKJA 4YDKH 4HZLA 4HKBA 1J0YA 2NNAB 2UY7A 5I8KL 4X99B 1FIGH 4OD1H 1T6WA 4XC1H 3B5GA 2E9BA 2AI0L 1DBAH 1I9JH 4TNVK 5JUEH 4KJWC 4BSVB 5CMAA 1W72B 2DQGH 1BM3L 3I50H 2E9JA 3F7VB 2ICEB 3T2QA 1C8PA 1D6EB 4HG4K 1NAMA 3O9WD 4WFED 4ODSL 3WIIH 1QBMH 1F90H 5DJZB 5FKAA 4ZAKB 4PJFB 3EAKA 5DD1L 1SEQL 1T03H 1PY4A 3OKEA 3O6LH 2W60A 3P4OB 4NFCA 4JDTH 2XTJE 4NSKA 2WBKA 5ACZB 2FL5A 4YHML 4YFDB 1JCKA 4EBQH 1DR9A 5BXFB 4OLXL 1U8PB 3STLA 1D5XA 2I9TA 1OAXL 1N6VA 4HFUH 2YKLH 3LVEA 3WE6B 1YEKH 4Q0XH 3GSRA 3MLVH 1A6PA 5D2LA 1GGIL 1Z3GL 1GOGA 3L5WA 3MV7A 5ANMA 5DA4A 1C5CH 3QRGH 4U1IA 4XHJD 3RUGF 4L29A 4JPIB 4ZAKC 4WHYG 4FQJL 4LVHB 4PUBH 4TUKH 4X8JB 3T0DA 5EOQL 1F8TH 3MROA 4R0LB 3P30H 1H5BA 4M7ZC 1TJHH 3I6LE 3MUGA 3N1FC 4PJ7A 1DQMH 1KCVL 1PG7X 3U0PA 5HPMA 1JNNH 5D6CA 3ULVL 4HGWA 5IW1A 3STZA 2AQ3A 4AEIL 4E42A 5LQBL 3CLFH 3C09B 4LRIA 3RBGA 3MCKB 4K3HA 3I2CL 1IGYB 2A6DA 2CJUH 2FD6L 4FQ2L 4GMSH 4ZS7H 3VH8G 2GTWA 4ALAL 1Q0XL 3S37H 3C5ZA 3TCXA 1NBZB 4PRHD 3O9WB 4Y88A 2VDOH 4IMKA 2CDGB 1OQXA 4PJAF 2GJZA 4HKXA 4JHAL 4DKFH 3RNQA 5MEQA 1M7IA 3GGWA 5FECA 3V52L 2VZSA 3ETBF 5ILTH 5FDYA 5TE6L 4CJ1A 4OM0L 1QLRA 2GTZB 2D31B 4LCYA 4WO4A 5EWIL 4QRRA 2VLKB 5KG9A 4JG1L 3UCRA 4Z95L 1NGPL 2XN9A 4P57A 4OKVA 2JLLA 3PWUA 4OCWH 4L4VD 5L8KB 5HGDA 3ZE0F 4EI6B 1NDGB 5IVXB 1HSBA 5D1QD 4P3CL 4MB3A 5FHBL 1X7QB 1NMAL 3WV0A 2R4SH 4XTRD 3O9WC 2H9GA 1IC1A 2IJ0C 4LQFL 1IM3A 5DFVD 2APFA 4UQ3B 5C0RH 1CBVL 4HK0A 3PL6D 1KTRL 5JNYA 5DS8A 1JJUA 3P77A 3K2UL 5T1KA 1U8JA 2B4CH 1MHPL 5DWUL 5E9DB 3W2DH 1MY5A 5IHUH 2XFXB 5C6WH 4XMPH 4XCYA 3RWIA 4HSQA 2MJWA 4GKSB 3JWOC 1DE4B 3HFMH 3S4SG 1R24A 2Y6SD 3G5XB 3IS0X 1CFTA 1KB5B 1MSPA 2LU4A 4PJFE 4HUMB 4FTVB 1WJ3A 2H2SC 2XWTA 5FV2A 5LG1A 3S5LB 3V5DB 1H0DB 2PF6A 1WCBB 2ICCA 1J11A 5F3HB 4XHJC 4PRHB 1G7HB 2D7QA 2ZCKL 1N4XL 3REVA 1EO8H 4FQPA 1G7IA 4KC3B 3HAEH 5T1LD 2EE9A 5L0QC 1KCRL 3GMOA 4YNYA 2VIRB 2CDEA 5D7LA 5ADPL 2AK4D 3AS1A 4PJ5A 3QCTH 3U82B 4HWZB 3ZL4L 5L7XH 3L5JA 4APQD 3VXTB 2W38A 3IU4H 3Q6GL 1JTTA 1ZLWK 2EIEA 2CKBH 3E6FA 1V7ML 3MJ8B 4U1KB 3BT2H 4JKWA 3L95A 4XVUD 4HEPG 2XQYK 4DGYH 3D39D 1I8MA 4ODVL 4KDTC 4JJ5A 2E6JA 3QQ4A 2P24B 2OP4H 3OJDA 1JFQL 4F9PC 4XC3H 4HQQL 2R1WB 2HFEB 2EEBA 3FT4A 1UM4H 4LL9A 1FV1B 2NW3B 5BZWB 4U6YB 4XPHH 4UT7H 3MGOB 3T1WA 4AL8H 1FSKC 1KTDB 3UTZB 5EU6A 4FQIL 3OKYA 3QXAA 2UUDK 4J3TA 4U6VH 2X4NB 4M02A 4NP4L 4YDLB 4LLYA 4OUOA 3ZTNL 5C0CD 5AZ2H 1S5HA 4FQXB 1JWMA 2NW2A 3X11B 5DJCA 4U7SA 2AXGB 5HYJB 1AGEB 4I77L 5D1QC 4CVXB 2PCPB 3DYMA 3UTSD 3A6BH 2J8UA 1BFOB 3LD8C 4ISVA 1PKOA 1NLDL 3GMPB 4XTRC 4Q6IC 4AQ1B 3QWQB 2PN5A 5KVGL 4PB9L 5DFVC 1XF3B 4M61B 2VLKE 1FL6A 4P4KA 4YO0B 3WFZA 4RDQG 4XCCH 3PL6C 5GRJL 2W0FA 1HHHB 2GKIA 3GSVB 5I1EL 1VKXA 1SYVB 5CEZE 4OV5A 4X4YA 1S7VA 1EGJL 1WIUA 2YN3A 4QY8B 3VWJA 4KKLD 1GZPB 4G8IA 5IVXE 4MAYB 1G6RL 2WUCL 4WHTB 2ZPKL 3UJIH 1OGAB 3VWKD 1S7TB 5GS3A 2Y6SC 4CBPA 3L7FA 4JM2F 1UFUA 2FGZA 5GISL 1A6TB 3A67H 1ZA6A 4L1HA 5E9DE 1IAIM 2EYSB 4PRAA 3RY6A 1F02I 3F12A 1FVEB 4GAYA 1ZWIB 1L7TL 3MRRA 4K55A 3SE4A 1M7DB 1WV7T 5J06A 5DD0L 4KVCH 3SDAA 3GNMH 2VABB 1MCPH 5GRZA 1KSRA 3CSYB 5F9JA 5ITFB 4NZTL 1IC7H 3JV0A 3BVNB 4S1QL 2BVQB 5INCB 1T5XA 2Y7QB 2IG2H 4LMQI 5F9AC 4FTVE 5IBTL 2ORBL 3SKJL 1RIUH 4APQC 4X6EB 5EO1B 2YD7A 5DHYB 5SX4I 4KU1A 4JVUA 2NY7H 2HRPH 3MNZB 3D0VB 1HSAB 1JN6B 4XVUC 3V5HA 2CRYA 2QTEA 3KPSA 3QA3A 4NZUH 3FCTB 1H3WM 1NCCH 5FYLE 1RJYB 1NMBL 1I8IB 4LAQH 3ROLB 4C56A 1RU9L 4J7RA 1FGVH 4QHLA 4P23D 5HDQL 2H1PH 1JZ3A 5JR1H 4ZXBB 1AGBA 3NCMA 2N7BA 5A2JH 1EHLH 1QEWA 3BD5A 3D69B 1P7KB 4R96A 4HBQA 5D8JH 1RK1B 3CCHB 5EUKB 4HK3J 3S98A 3VRLE 3OR6A 4S1RL 5C9JB 3NPZB 4P59H 2Z8VC 5HHMB 1RVFL 4XCFH 5EG6C 3LKOB 3VWKB 4F80A 1MCHA 2QSQA 3WD5H 4U1NB 1U8LB 5C0AB 3PWPD 4P2OB 2CLRB 4PJFF 4N8CL 4KRNA 3TN0B 5ITBH 3FO1A 3ZE2E 2AEIT 5EC1B 2F74B 1FFNB 1OT1A 2FWOB 4M6ML 3N1QC 4NO2B 2R2HA 1OF2B 4HUWB 3I3EA 4LHUB 4ACPA 2VRAA 3Q5OA 4XAWH 3PV6A 4GXUN 1U3HA 4KKLC 3GDBA 3MLYL 5C0BA 3BIKA 3FB5B 5HYJE 3K2MC 2EYRB 1RK0A 2FJFA 2HKFL 4POZD 4JRYA 1AR2A 1OGTB 2QHRH 5IGXH 3ARTA 4NCC2 3QR2A 3VWKC 2Y4SA 3B6SB 3ARRA 2RB8A 3N1GC 3T0ED 3TN0C 3GRWA 5AD0B 3THML 1T20B 5KN5A 5HHNB 2A2QT 1RJLA 4V1DB 3QO0A 1KJMA 5L2JA 3WXWH 1F11B 2FNBA 1GGBH 5EN2B 3U4AA 1CLZH 5IMOB 3MYZA 2XZQL 2GT9B 1OGAE 4YHPA 2QSCL 4OZIF 1E4XI 2IADB 2NY5L 3B9KA 3TPUB 3U6RA 4C55A 1XGRB 5J57B 3VJ6B 5TF1H 4HUVA 4N0UA 1MJ7L 3BW9A 4R7DA 4LP4A 4G8GA 4HIIA 4NM4L 5GZND 1U93A 1R3JB 5IEHB 4P5TD 2X70A 4H1LB 5KVMC 3B3IB 4ODSH 3LKRA 3ZSTA 5DI8A 3UP1A 3OSKA 5B21A 1DEEB 1HQRA 5JA8B 1RUAH 4WJ5B 1JPFA 3LPGA 5GGVY 2AEQL 4P2CG 4P23C 3LPWA 1KCSL 3N06B 3KPLB 1A21A 4Y4KB 3RY4A 3QDGA 4YHMH 2AJSL 3MA9L 3UJTH 3FTGA 4PGZA 4PJ8D 1RZ7L 1UYWL 3V0WL 5IVXF 1AH1A 3E0GA 3TNNA 3KLAA 2BY1A 1OAXH 5I1IL 4QHUB 3MUY1 4N8VG 3V9FA 4F7TB 1JMZA 2YBRA 3KPRD 2P49B 5E08H 3VFWA 2AEPH 2MOVA 2X7LA 1Z3GH 2OJEA 1I7ZA 4W70A 4Y8DC 1SYSB 3QBTB 5F7WC 4NHCH 4ORGB 5CD5D 5E6IB 1GOHA 3R0MA 1F00I 2CXGA 5FOJA 4FQJH 2V2XB 4W6WB 2EDDA 4HPYL 5EOQH 4NKQB 4KI5E 5I1HL 2VXVL 3LN5B 1UKQA 1F5WA 1KCVH 1FN4B 3U7YL 3UO1L 1UVQA 1AD0B 4QRPA 5HHME 4ZFZA 2B2XH 3CX5K 3P9LA 4XPGL 1LO4L 1S8DA 4EN3A 4AT6B 1HYSD 1MVFA 3MA7A 4BQCA 2IH3A 1A7NL 5C0AE 3QNYA 3FRPA 4X9BA 4QHKJ 3HI6L 2WM0A 4POZC 3L3IA 5FGCB 4CNIB 4FQ2H 3VI3E 4ALAH 3IS1X 5FO9A 5EOCL 4WI5A 5GRWA 5HY9B 1C12A 2X1PA 3O3AA 1KCKA 4KV5E 3UXFA 4PJDB 5TFSL 3T0EC 2H8PA 43C9B 5IT2L 3V52H 1JWSB 1E4WH 1DP0A 2Z4QA 2O93L 1CFSB 5TE6H 4OM0H 5ICXA 2R2BB 1FVCA 5EWIH 3VFOB 1R5VA 4Z95H 1NGPH 2L7JA 2XNAB 2BC4A 3HE7A 3UBXA 3WKML 5T3ZE 2OR9L 1R0AL 4ZTPH 2APVA 3EDFA 4KVNL 3VRLF 4G5ZL 3GSNA 4FFYL 4RNRB 3EZJB 1FL3A 4V1DE 5GZNC 2P8MB 5CIPH 4RMSA 5HHVL 4WTXA 5J6GA 4P5TC 1KB9K 3FB6B 5IMKB 1QP1A 3DGGA 1CBVH 4PJGA 1U8NA 1AXSA 1BX2B 4XNQA 3MOQA 4HJGB 2XY1A 3K2UH 5HGHB 1MHPH 4Y19B 3T65B 5ID1A 1IGFH 4LVOB 5F88B 3S6CA 4X5XA 4ODXB 3N50A 3TH3T 2FJGA 4PJ8C 1GL4B 1JGLL 4YLQT 5DD3L 3DX6B 4WENB 5EPMA 2ARJA 2GJ6D 5E8OB 1F4XL 1OTTD 5DDHB 4D9RE 3HZVA 1GYAA 4OCYH 5SV4A 1RHHA 1U8KB 1A64A 1LK3L 2VO5A 3T2PA 1FNHA 5DSCB 2ZCKH 1Q9LB 5I2IB 2VSCA 4TOYH 5GGQL 1KIPB 1OQOA 1Z5LB 3O8XA 3IGAB 1X9QA 2BJMH 4LVOC 4ZPVA 5ADPH 4B7IA 1VFBB 5JPMA 2ZCLL 3OKNB 5TDPA 3VXSA 4KK8D 3ZL4H 4MA7L 1HYSC 3TBTA 2DLEA 4R7NB 3LN4B 3QEQA 4PRNA 1L4IA 3PDOA 5F7LB 3SO3B 4RIRA 3L9RB 4CGTA 1NFKA 4PLOB 1JHTB 4UDTB 5IKCA 4P9HH 4JANB 1F4HA 3RHWF 1I7RA 1U58B 2EE6A 1KENH 2Z91A 1JFQH 3ESVF 2VMFA 1HIML 4HQQH 2HFTA 4NQSB 4I0CC 5GGRY 2NTFB 2R2EA 32C2A 1U8OA 1NGQL 3LKQB 5C0DA 4UV7L 2CKBA 5TE7H 4HIXL 2YSSB 4Z76B 3QWRA 2VDNL 3NFSH 5GJTL 5D2NC 4HULB 3IVKB 4HKJA 1HQ4A 3OZ9H 3P4NA 4FQLL 3W0WB 1KT2B 4MJ2A 4B50A 1U8IB 4DVBB 4FQIH 4K3DL 3JWDH 5FGCE 3E1F1 2FBOJ 3WS6A 4B53A 4NN7C 3Q3GB 1M7XA 4NP4H 2DI9A 3V6OE 4CW1B 3ZTNH 3P4MA 1ORQA 2MMXA 4PJDE 4F37K 3H7BB 4A6YL 3MRJB 5HHXH 3BO8A 3STBA 3HS0A 2BRRH 1NLDH 2XICA 1YPZB 2Q3AA 1P5VA 4NQDB 1MFCL 4RQQA 4XXDA 5DTFB 1IT9L 4M7LT 3SE8L 4JFFB 2PR4L 5HYEA 2PO6A 5I1EH 4L4TA 4KI5F 3F7YB 1SY6L 4U6HB 4X6DE 1TDQA 1W0YT 4S0SD 1JYWA 4LARL 3T08A 2Z9TA 1G6RH 3DX9B 2ZPKH 2BSRA 3HMXH 1IKNA 4YR6A 1A47A 1I1FB 2XA8L 1IZKA 1RZJL 2CIKA 3ILPB 4OSUH 1IEBA 2ICWB 1OTTC 2HFGL 3DVIA 4XP5L 1U6AL 3X14A 5AWNL 5INDB 4HS3A 5E0QA 3QNZA 1IVLA 4Y19E 3MTRA 4X4XB 3T1FA 1CDBA 2JB5L 1B4RA 1L7TH 5BVJA 3ZO0A 4JGMA 1EFQA 2V2WA 3WFHA 3QAZB 1U0QA 4ZSOA 5ICYA 5C92A 3RX5A 4I18C 5T3XE 4Z0BL 4LPWA 1SJEB 4IS6B 1G9NH 1SEBA 3IXAB 2DKMA 4KK8C 4PJAA 3SKJH 1EXUA 4NUJA 1T04A 2OXGA 3L3JA 1QRNB 4HMDA 2Z8WC 4Z0XA 3SQBA 2VWEE 4BKLA 4RMQA 3UTOA 2X44D 2LTQC 3D3VA 2J88H 1PLGL 3BUTA 3V7AE 3F5WA 4BQ9A 1NMBH 3SE9L 1FYTD 5DEGB 1PGRB 5JXED 4FMKA 4KROD 3VFUB 3WYRA 1L0QA 1D5BA 3SGEI 5C08B 4OFVA 2ID5A 3V95A 1VFAB 4GS7B 4YQXL 4Z78A 4NKIH 2DL2A 4G6KL 5MI0B 5GGSY 5BV7B 1O7SA 1TCMA 4XBPB 1NL0L 4PD4J 1RVFH 3RKPA 1QSEB 4LF3B 2X5PA 4P9ML 1QLFA 1KJ3L 3KPQB 3FOLB 4N8CH 5KVEL 4QTIL 4MNQB 3BN3B 5JIHA 5EBLB 3CNKA 4WTWA 4W68A 5KSUA 2Q86B 3WFEL 1BZ9A 4E41D 1OSZB 2EDBA 4GW4B 4OZHB 3OHXA 3W0WE 1QFWI 2FATL 1K5NB 3P0YL 1K2DA 2RR3A 1HWHB 3ET9F 3LEVH 1N59A 5JO5B 2DQFA 4P3DB 4XNUH 2FEDD 1NGWA 3CVHL 2YWYA 5MI0C 4MQ7A 1KIRB 5F1SA 3MLYH 3JUZA 2VLLA 4IEFB 3V0VA 5BV7C 3MRNA 3UDWA 1OAQL 3GMLA 2NR6D 3MCLL 4NGHL 4XAKE 2DLHA 5J0BA 3C60D 2W1NA 4NNXA 3E3QC 4NQDE 4ENED 4PJEB 4ODHH 4JFFE 5FB8B 3T2NL 1XR9B 3VMNA 3THMH 5LWYL 3HPJA 2D03H 2IH1B 4YHLH 3ABZA 1ADQL 4M8QB 1UH2A 4MDJB 2BNUA 1KTLA 1HHKB 3RDTD 5FEBA 2YPLB 3G6AB 2VDML 4J3VA 4P48A 3KWWA 3U7WH 2QSCH 3C2SA 5TH2B 4XNMA 5GS1C 4RGNB 3ARBB 1KOAA 1MJ7H 3V6FA 4GMTH 4NRYB 4JREB 1E4JA 1OLZA 4PJDF 4D0DB 3V4UL 2V5YA 1IGTB 4HAFA 1LK2A 5KJRL 2YPVL 1MCBA 4Y4FB 1MY7A 4KPHH 4MCZB 2P1YA 4FG6C 2AJ3A 4OLYL 1RUQL 3GJFH 3LDBC 5JXEC 3GFUA 3VD9A 2AKRA 2AEQH 5ENWB 4KROC 4E41B 3MLTB 2EDOA 3LQZA 4X7DC 3FB7B 5KSAB 2DQUH 4LPXA 4U2ZA 4X6DF 3CMGA 2QQLH 3MJ9L 3MA9H 1OTUD 1WBYB 1QRNE 1RZ7H 5F6HI 2DWEB 1XF5A 1FZMB 2FBJL 1JPTH 3BSZL 3D0LB 5IM7B 3MRQA 2QV2A 4WV1A 3LHPL 4Y16B 4Q2ZB 5D6DA 3X3FL 3DHMA 4B41A 5I1KL 3SKNB 5C9KA 1M1SA 4P2YA 2I5YH 5C08E 2NXYD 2MCPL 1MIEL 4JFDD 4QYOB 1G7LA 1P1ZB 1CGSL 3MX0A 1J05A 3KYNB 2PXYA 2VXVH 5I1HH 2A74B 4Y2OA 3RWDB 4H5SA 3UTTA 4JM2A 3QNXB 5HI5D 2AJYH 4HWBL 1ZXQA 2FEDC 4XPGH 1QSEE 5D4QA 1A7BA 2ZJSL 2NXZD 1A7NH 2D7TH 1UA6L 3KPPB 4LLDB 1NFDF 4MNQE 5FAAA 2X4OA 4GRMA 2NR6C 4YX2L 2AV7A 4O51A 3C60C 3QUZA 5EOCH 2BY2A 1UXSB 3S88H 4ENEC 4NCDA 3MC0A 4L9LA 4ELMF 4OZHE 1HXMB 2OTWB 5IT2H 4KTDL 5JLZB 2K3TA 3CJJA 4K8RL 4D0BB 1K4CA 1OCWL 5EU5B 4CMMA 3PQYD 3BQUB 1NFIA 1P4LB 3RDTC 4ERSL 3C9NB 4LNRA 4HG4J 4LVNC 3VXPA 3DX7B 1ZHNA 2NY0D 3WKMH 1WFNA 2OR9H 4X7FC 5FHAH 4KVNH 3CXDH 4S2SB 4PJEE 4M1DL 5C09D 4G5ZH 2CD0A 2DMBA 4N0YL 4H1LH 4FFYH 4XP1H 1CD1A 1GSMA 4RFEB 3M8OH 1QPPA 2B1HL 1ZA3B 2VB5A 1VEOA 2BP3A 2WSKA 4X99A 3GSUA 4U3CA 5HHVH 1ORSB 3BPNB 1CLOL 2VDRL 3ARFD 4Y5VC 3UZEA 2YPLE 3CD4A 3MRHB 4BSVA 3TCLB 1W72A 3F7VA 2B1AH 4GBXB 3NIGF 5J9PB 1D6EA 4HW6A 1S9WB 4QWWD 3SJVD 4P2RB 1KLFA 5DJZA 4RGNE 5SWZB 5CIPA 4PJFA 1JGVL 1KNOB 1IGML 4NKDB 1ZEAH 1L0XA 1U8HB 1OTUC 2JJUA 3WXVL 4QF1B 3NAAL 1JGLH 3P4OA 2O5XH 3SBWC 3O45B 4F57L 5DVKA 2AGJL 1OAZL 3PABB 4ELKB 2IANB 1F4XH 3F7QA 2A1WL 2LAGB 4KMQA 4H20H 1U8PA 1A1OB 1YZZA 1G0DA 4MZ3A 1LK3H 1VGKB 4IM8A 1F4WL 2Y07L 2PYEB 3WE6A 2NXYC 1MUJB 2YUWA 4MA3B 4L1DA 3S36X 3SCMB 4WW2F 1P6FA 1F6FB 2EH7L 4EQ2A 4L8SB 4LMQE 4JPIA 3BI9X 2VXUH 4WUUD 3SDYH 1FNEB 5BZDB 5HI5C 4X8JA 5I73B 1CTNA 2D2OA 4MA7H 4JQVA 4R0LA 2NXZC 3KS0J 3Q1SH 3G6JE 1KEGL 1GRWA 4MLSA 1FVDB 4ZYKB 1JZ5A 4P2QB 4OZFB 3MPCA 5CWSB 1RZKC 1MCQA 5ID0B 4QHNB 4OFYA 2CO7B 1TVHB 4KTEH 1MQKL 4FFZL 1U8QA 4NZRL 1EBAA 3MCKA 1HIMH 1IGYA 1RZFL 2W9DL 3VGBA 4NO0A 4Y5XA 3ELAT 4M6NL 2OK0H 4DUXA 3R06B 2P5WD 2J6EL 1J0HA 5LAXB 3OAZK 4NBZB 4ZUWB 5GJTH 1KXVC 5DVOA 3VDAA 5IHZB 4J12A 4JAMB 2NY0C 4BQ8A 4NOFA 1MF2L 3QQ3B 1HKFA 3CUPB 2GTZA 2D31A 3T8XB 3IXTB 2VLKA 5IFAH 5CGMA 3OG6B 3VXMB 4N68A 1MHHB 3DSFL 1AGDA 1HNGA 1NDGA 1JGEB 1MFCH 4EI6A 1DANT 2YPKB 5IVXA 3ARFC 1IT9H 3SE8H 1R5IB 3B9EA 1YNLH 3VG9B 3IJHB 4GRWB 1YQVH 4LSQL 5IIEB 3EHBD 4KHXL 2CUMA 2IMNA 4QWWC 2KDGA 4LARH 4UQ3A 3TZVB 1I1YB 1UM5L 2ADFL 1AFVH 4XRCB 4YC2C 3SPVB 5E9DA 4KKBD 2XFXA 4WU5B 5GPRA 2XA8H 4WRLA 3PF2A 4GSDL 5C0IB 4CDHA 5CSBA 1EEZB 3OKKB 1U6AH 1U3YA 4OGZA 4XP5H 4CRPA 4NN6C 2BVYA 5AWNH 4GKSA 1DE4A 2RHEA 4OZHF 4JZJB 2G2RB 4UT6L 5HHQA 4ZPTB 3G5XA 2CLZB 1VADA 4P2RE 1GIGL 4JFOA 5SWZE 3HMXA 1DN0A 2JB5H 1VGEH 1PG7W 3S5LA 4C58B 1F4AA 1KC5H 1WCBA 2YK1L 2SEBB 5F3HA 3OKDB 2YD6A 2A6IB 1G7HA 3FO2B 5F21B 1J86A 2E7CA 4F7CB 3DGCR 4M03A 4RX4D 3SE3C 4GXVL 3GSOA 2X9XA 2IANE 3OKMB 3ULUD 4KK9D 5BQ7B 2P7TB 1FNAA 1FIEA 3U0WH 4OZ4B 2VIRA 4YK4B 3MRFB 2PYEE 4HWZA 4I48A 1MAMH 1MCNA 1N3NB 5IF0A 4O2FB 4LSDA 3IDIB 1YC7A 3MJ8A 1F4YL 4U1KA 3NPSC 3JVGA 5DT1L 4ZFOL 2P24A 2R39A 1HEZB 4YQXH 4RWHA 4YDIL 3DUUB 1VFOA 2R1WA 2HFEA 4G6KH 2AP2A 3IFPB 3RZCB 4P2QE 2ZNXA 2BHUA 1FV1A 5E6ZA 2NW3A 5BZWA 4U6YA 1YC8A 5T5NG 3MGOA 4NBXB 5EZJB 3KPMB 3O0RL 3UTZA 1PD6A 1XAUA 1H3PL 3LRGA 4OBSA 1MI5D 3QIWA 2X4NA 4PPTA 3LY6A 1D9KB 4FQXA 4IRJB 2BOBA 3WFEH 3PGCB 2AXHA 4FNLL 3V6BR 1TZGL 5HYJA 1AGEA 4CVXA 4QRTB 2FATH 2XKNB 3P0YH 3EHBC 1MCWW 3GMPA 5GRVL 3CVHH 4NQVA 3GB7B 3UPRB 1XF3A 1LDPL 2UVEA 5K9OA 4YO0A 5B38B 1BPVA 1BGXL 3P0GB 1HHHA 3BEVA 3GSVA 3VXME 1OAQH 3ZDXF 1SYVA 3MCLH 3G6JF 1X5ZA 3RKDC 4F3FB 5JPNB 4KKBC 4JPVL 3RY5A 1GZPA 2ERJB 5C6TH 4MAYA 5JHLH 2HLAB 2APBA 4GRWE 4HUKB 3T2NH 1BJMA 4FQHB 4WHTA 3C5SB 1OGAA 1H3GA 4XWGH 1S7TA 1ADQH 2BNRD 3WJJC 4HUNB 1J10A 4F7PA 4HK3N 1CK0H 5F7NC 4OTXL 1UKSA 2EDQA 1A6TA 4NM8H 2ILLA 2LU3A 2D7OA 5IW3A 4X6CB 1MWAB 3PV7A 2E7BA 3N9GL 2EYSA 3SGKA 1KG0B 1FVEA 1ZWIA 4PFEA 4ZD3L 4L3CB 1M7DA 4OCLC 5C1MB 4KK9C 1DQQB 4YDVB 1OP5H 4ZDHB 4JO2L 3WLWD 5K33A 4YHIB 3BVNA 3DWTA 2YPVH 2BVQA 1BOYA 4H25B 5INCA 4Z5RB 2Y7QA 4I1NB 2BERA 2VZTA 4FN0A 4X6EA 5EO1A 5BOZG 5DHYA 4OLYH 1CQYA 4UTAH 4PJBB 3MNZA 3D0VA 5TDOB 1HSAA 1JN6A 3QXTA 5BW7A 5MEPA 5D7SL 1NDMB 3FQNA 3JWOL 1ZE3C 1RJYA 3IYLW 1I8IA 3ROLA 3C6LB 5CJXA 2FBJH 3KS0H 2A0LD 4Q9BA 3VFNB 1KLUB 4J4PD 5FFLA 4ZXBA 3K80A 5DJ2B 3FRPG 3D69A 1P7KA 5I1KH 3VGHA 1HH6B 1FG9C 1RK1A 3CCHA 1IKFL 5EUKA 4HGMA 1I4FB 3WN5C 2ZWLT 2MCPH 1MIEH 1HOCB 2W0KA 5DK3A 3LKOA 1HKLH 3CZJA 4U1NA 1U8LA 5I74B 5C0AA 4ZMAT 3LSOA 2CLRA 4P2OA 3QH3A 5L8JB 2X2YA 1MCDA 3OKLB 5EC1A 2F74A 1FFNA 2FWOA 3ZMRA 4HWBH 3IDXL 1HWGB 2VZ1A 1XIWB 4XB7A 1KB5L 1KFAL 4PP1D 3SDCB 4D8PB 3B8SA 4HUWA 1OF2A 4LLAA 3UBXG 4LHUA 1Q38A 1UEMA 3MLRL 4YX2H 2R8SL 1E4KA 1T1WB 3TIEB 1CE1H 3F6IA 1FAIL 1MLCA 5I1CL 5DZOA 1A1MB 1RD6A 5J89A 3FB5A 5A2FA 2EYRA 4Q58C 1U91B 4M62L 3QIBA 1OGTA 4K8RH 3B6SA 1Y6NR 1A1NB 1GGYA 3PWLB 3MV9B 4Q97A 3UJJL 6FABL 3HUJB 5B3NA 3BKCL 1T20A 5HGBB 4ERSH 2P8PB 4IJ3C 5HHNA 2ZG2A 5KANG 5GS2H 4MXQD 3WFDH 4V1DA 1IC4L 3IAPA 4Y5YC 25C8L 1S3KH 1F11A 1IAOB 2ITDB 3IDNB 1F97A 1WZ1L 5EN2A 1ED3B 5I18L 3F62A 2RQ8A 4M1DH 5E4EB 5KZCB 5IMOA 2NMSA 4LLUB 1JPST 2GT9A 2B1HH 2YA0A 2IADA 1PW3A 3DO7B 3LKSB 1OWRM 3WLWC 3EKCA 3TPUA 1XGRA 2XRAL 2VDRH 5JW4N 1A9EA 2IALA 2YD9A 3BKJL 4X6CE 5C07B 3HNTH 3G08B 2AK1H 5C2BH 1R3JA 3V5KB 5IEHA 1EFXD 4H1LA 3B3IA 1ZLWH 2JK5B 3RVUD 3VGFA 3MNVB 1JGVH 1P7HL 1DEEA 2VOTA 1TTUA 4WJ5A 5SX4H 2EDKA 3O6ML 1MCWM 3WXVH 1UXWB 3NAAH 4F57H 5F71A 2A0LC 2AGJH 5JW4R 2VERN 2Y25A 3KPLA 4J4PC 4Y4KA 2DQIH 3FT3B 4FXLA 4PJBE 5F1IB 3CX5J 3WKNA 4QHUA 2D9QB 5D1ZD 5ESQB 4F7TA 1F4WH 2Y07H 4BFGA 5D1XD 2UUDH 2YRLA 3CMOL 1SYSA 4ZOAA 5IR1B 2EDXA 4MJ6B 2EH7H 3UX9B 4Z7VB 4ORGA 5E6IA 1FAKT 5GHWL 1SJXA 3QHZL 2V2XA 2R0KL 4PP1C 3QXWA 1DSFH 3VXRB 3QFJB 3DUSB 1QO3A 1V5JA 2DQEH 4LASL 5E03A 1BWMA 5GGSB 3LN5A 4GW5B 1FN4A 5CUSL 5IHLB 5DZNA 1AD0A 4LLMB 2DM2A 4AT6A 1CFNB 1V8HA 3TA3B 4PTUB 3RL2B 4PRBB 4FFZH 3GMRB 4NZRH 3MRKB 4GUPA 1ZV5A 1RZFH 4CNIA 2W9DH 4JKPL 3VA6A 4M6NH 1P2CB 2HLFD 3B9VA 1CDGA 3ARGA 3TYGL 3V6OA 4UU9B 3NA9H 3WIHH 5HY9A 4I9WE 2P5ED 1UJTA 1X5HA 2AXJA 4PJDA 1DZBA 2J5LB 3NCYP 5D71L 5E99L 2X4QB 43C9A 1KB9J 1BD2D 4MXQC 5HYQB 1FBIH 5IOPB 2NY3D 3CFDB 3HA0A 4GQPH 1KGCD 1JWSA 1ZGLB 2AXFA 3VFTB 1MF2H 3FN0L 4XCEB 3ZYJA 2R2BA 2FDBP 1CIDA 3JV4B 3VFOA 4JN1H 4F7EB 4OKDA 3REWB 1KJ2B 4EIZC 3L3HB 2XNAA 3PHSA 2JIXD 2A9MH 4X6DA 1EPFA 3MV9E 3QPXL 3HUJE 4R26L 2DYPB 2F54B 4RNRA 2C7UB 4LSQH 2EEAA 5CILL 4X9GA 3FB6A 1UZ6F 1OD9A 4RMRA 3RVUC 5IMKA 2OR8A 2I9LB 3WHE1 1NCAL 1J88A 4J8RB 2OZ4A 1J9CT 1BX2A 1UM5H 5F93C 1BECA 4HD9A 4V2BA 4HJGA 2XZAL 4U6XB 3BWAB 1OPGH 2IPTH 5HGHA 5CJQL 5CSGA 3UPCA 4Y19A 2R15A 5GQBA 3T65A 1II4E 4OF8A 4ODXA 1DCLA 4Y2DD 3ESUF 3BN9D 5C07E 4FFWD 5F9WB 2GFBA 4ODWB 3DX6A 5EORL 5M7QA 1RIHL 3MRDB 5D1ZC 1GIGH 3RGVB 1FFPB 5E8OA 5D1XC 5DC0A 4YHNB 4PJHF 3KYOB 3O6KL 3RIFF 1U2HA 1U8KA 2YK1H 4AQOA 5L2KB 5DSCA 5I2IA 3B2VH 4GXVH 4HJJL 5LXGL 2CXKA 2X4RB 1ETZB 3QZWB 5IB1B 4AG4H 1YMMD 1Z5LA 5KAQG 4OZFH 3CGTA 1RUPL 3IGAA 1A4JB 4LSRH 5ADOH 3TNMB 1U36A 3AB0B 2WAHA 1DLHB 1VFBA 3OKNA 4DKEL 3P40A 4R7NA 1PZUB 4ONOA 4X98B 3T4AB 1X5KA 2QQNH 4Z7VE 1KLGB 1F4YH 3RGVC 3IF1B 2IGFH 3L9RA 4X6CF 3RX7A 4D9QE 1JHTA 3DXAD 4JANA 5ESVA 3WNOA 5CLWA 3VXRE 3EOBB 1U58A 1MFDH 3HC3L 3QFJE 1EEQA 4NQSA 5SWQB 4TUJB 2NTFA 2NY3C 3LKQA 3RX8A 3D87B 1ZLUK 4AJ0A 3FL7A 2YSSA 4Z76A 5BS0B 3RPKA 5IG7B 4XP9H 3V4VL 2VLRB 3O0RH 35C8H 3W0WA 1KT2A 1H3PH 1YN6B 1U8IA 2C1OB 4O58L 4DVBA 5LJYH 2AJUL 3Q6FB 4EQ3A 1JGUH 1A22B 4PJBF 3IDUA 3Q3GA 3WHXA 4OLZL 4CW1A 4MXWL 4JO4L 3IDMA 4O9HL 3M07A 1J1OL 4DZ8B 5K93A 2ZSVB 4NC2B 4DEPC 3QI9D 2QKIB 3RWEB 3H7BA 3MRJA 4JZOB 1BVLA 1K8DB 4LLWB 2E7LA 5I6XC 4OFPA 3QEHB 3NGBC 4HUUB 2H6PB 4NQDA 5DTFA 1LDPH 1MCJA 4JFFA 3F8UB 1CGXA 3MUJA 2VDPH 1BGXH 2VL5B 2ZUSA 3LB6D 3F7YA 1AKJD 2IBBA 4JPVH 5E5MB 4POYA 1FZKB 1Q0YL 2BNQE 2OSLB 5DJ8B 2AJZB 3WDJA 4ETYA 4AZ8A 2F54E 1YMHB 1JUFB 3DX9A 4Y2DC 2Q8AL 3BN9C 2IQ9L 3MOBH 1I1FA 4O5LL 4FZEH 3ILPA 1FGNH 5B3JE 1H3VA 3J8F7 5I71B 4F37F 2QQKL 2O5YL 3O4LB 4PG2C 4P0DA 5HI3D 4X4XA 5TE4L 4YIQB 4ZD3H 3MOAL 1UGNA 3H9SB 1TQBB 1S9VB 2CUHA 4OGXH 3EFFB 3MLZL 1SJEA 4IS6A 2P4AB 3IXAA 5JXAL 1VEPA 3ROOB 3MACL 2Q3ZA 1QRNA 1PKQB 2BFVL 3HUJF 1NGZB 4NWUL 4PJCB 5L2KE 2Q8BH 3M45A 1HE7A 5D7SH 1HNFA 2RFXA 5EBMB 4ZG1A 5F6HJ 3TVMB 3JWOH 4YZFE 5LVEA 1ZHBA 4X8XA 3VFUA 4OUUB 1IEAB 1I7UB 4CN1A 4JPKH 4LNVA 1FO0B 4JO1L 2I24N 5C08A 3VXUE 4AEFA 1U95B 1BWWA 4HWUA 1VFAA 4YWGL 1XEDA 5ESAB 4W81A 3S37X 1LGVA 4HZLB 2IAMB 5IWLA 4KQ4H 1W0WB 3UYRL 4KRLB 5LBSL 1QSEA 4LF3A 1NKRA 3DHJA 3QIUB 3HNVL 4M9PA 1E27B 3KPQA 3FOLA 3QI9C 2VC2L 2J7LA 4HKZB 4MNQA 3C5ZD 5EBLA 3KYAA 1MNUH 5T3XL 4LBEB 4I5BB 5EULV 2Q86A 3HMWH 5GGUB 4BZ1L 3IDXH 5BS0E 2Y9RT 2WWKO 2VLRE 3BD4A 1OSZA 4GW4A 1Q9KB 4OZHA 3T2OA 1ZK9A 3SKOB 3OKEB 1IGIL 1K5NA 2PTVA 2BY0A 3MLRH 4QRRD 4WO4D 4ZOBA 2R8SH 4ESKA 3LB6C 5JO5A 4P3DA 4NSKB 5MHSD 2XN9D 5L88L 3HNSL 4RAVB 1W0VA 2C4FT 2GY5A 4M62H 3VE0B 4Z7VF 1GGTA 5GRYA 1I8KB 2AEWA 4DFIA 4PV8B 5FGSA 4PJEA 3UJJH 5FB8A 3MV7B 1XR9A 4RFNC 3BKCH 2IH1A 4WI8A 4CVZB 3W39B 1RMFL 4M8QA 1XGYH 1IC4H 4NRZB 2BOCA 5EO0B 1CGYA 5HI3C 4MDJA 2QSVA 2HWZL 2CRZA 1WZ1H 1HHKA 2NZ9D 5T1KD 4K2UH 2YPLA 3G6AA 5IB3B 4YHYB 4KUCD 1KN2L 4PJ7B 2EDRA 5DJ6B 1CLYL 2XRAH 3ARBA 5B4MD 1BHGA 3STZB 4PGDB 3X13A 1AGCB 2YUXA 4NRYA 5J1SC 2VR5A 3QUMH 3O4LE 4D0DA 1IGTA 4CU8A 4JZNA 4NQXB 3K8MA 1CVRA 4NQCB 1UENA 3KG5A 4Y4FA 3BZFA 3H9SE 1NEUA 4PRIB 5I75C 4MCZA 4WTZA 3I6KA 2KZ1B 4HXAL 4I3SH 5FECB 4NPYB 1UZ8B 3MLTA 5I30H 1H5BC 5ELIA 5KSAA 2FX9L 5AG8A 2HTKD 5H2BB 5D7LD 5JOPD 5KG9B 1B0RB 4PJCE 1PKQE 1FCCA 4PJ5D 2GCYB 1FZMA 1TFHA 1JF6A 3D0LA 3SGEH 4LRIC 3P9MB 3CK0L 2UZIH 4Q2ZA 4Y16A 3O2VL 2WLYA 3JBG7 3CMOH 3G6JA 3SKNA 5JA9A 5JW5B 5B3JF 4JFYB 4IIQB 1LP9E 4MQXD 1L7IL 2DIAA 3C5ZC 2O26U 2H9GB 1IQWL 5GHWH 4PTTB 3QHZH 4QYOA 4RMUA 4IMKC 1P1ZA 3TM6A 5CBEA 1N0XH 2R0KH 4HK0B 1A9BA 3KYNA 4LASH 5MENB 3RWDA 3KGRA 1ZT7B 3QDHA 3QNXA 1SQ2N 5CUSH 4WO4C 5EBGA 1OARH 4XPFH 5F72S 5C0FB 1NQBA 8FABB 4R3SB 3KPPA 4LLDA 2PW2B 1QFWH 3ZDZF 4JFHD 2A83B 3PGFH 1WITA 4JKPH 1UXSA 5E99H 5D71H 3NIDE 3S96A 5FUZL 1HXMA 4YZFF 2OTWA 1T83A 5JLZA 4IOFD 4D0BA 2L4OA 4P4KD 5EU5A 3FN0H 5DEFB 3BQUA 3P0VH 3RVVD 1P4LA 2NZ9C 3C9NA 3VWJD 3NZHH 3DX7A 4G6ML 2ZUUA 5AEAA 3WIHA 4EXPX 3K3QA 4MNHB 5D7LB 2VQTA 1AXTH 4S2SA 3EYOB 3QPXH 1MRFL 3MV7E 3RP1A 5B4MC 4R26H 3QO1B 5FM5M 3UAJD 4RFEA 4I3RL 4XB8A 4DN3L 4WCYH 3FHQA 5CILH 4WFHD 5BV7L 1I8MB 4KRMB 1ORSA 3LEYL 3S5LG 3N85L 5E2VH 1A0QH 2W07A 2W92A 2ATPB 3MRHA 3TCLA 4DUWA 5GZOD 5DJAB 4GBXA 5J9PA 2A9NH 1G1YA 2XZAH 2OXHA 4LPUA 5CJQH 1DQLL 4F33B 5SWZA 2H41A 1A6VH 2B5IB 3O6FB 3SDAD 2Z35B 2BZDA 3H9HA 2HTKC 2Q1EA 1U8HA 5EU6B 5DGQA 3BIBX 5DFTA 4QF1A 5A40E 2ED8A 5D96C 3WO4B 1RIHH 3RU8L 3O45A 4NQCE 1S5HB 3PABA 4ELKA 2IANA 4PRIE 1DFBL 2VISB 2XACC 3KPSD 1Q72L 1A1OA 4UUJB 4JPWH 4WI3A 2V5TA 4MQXC 1VGKA 1B2WL 2NY2B 3AS0A 4X80L 4C56D 2PYEA 3BHBB 3S34L 1MUJA 5KSVB 4MA3A 1QACA 1A4KB 2R1YB 3SCMA 1UCBH 4L8SA 1WSST 4U1SB 4O4YL 4POUB 5DVNA 1QHOA 3OMZA 1FNEA 5BZDA 4TULL 5SV3A 2H3NB 3QDAA 2PYFA 2DQJL 5C6PB 1S5IL 1FVDA 1PEWA 2EDLA 3TT1L 4LSVL 4P2QA 4WGVB 4XBEL 4OZFA 5CWSA 5ID0A 4QHNA 4YFEA 3AU1A 1N5AA 3EYFB 1TVHA 1CE6B 4FOMA 4XPBL 3WLBB 5ICZB 1X4YA 2NY2C 4L3AA 5MENE 5DHVH 4K71B 2VE6B 3F58L 4IOFC 3CDYA 4KKAD 1FNGB 4P4KC 2XWBB 4GAYB 3MRRB 3R06A 4FQ1L 5LAXA 4ZUWA 3RVVC 4IRZL 1YNKH 1NUNB 5IHZA 4O58H 3VWJC 4LIQE 4JAMA 3MRMA 3QCUH 1MRDL 2GSIB 5FYKD 1R3KB 2CLVB 5C0BD 3QQ3A 4OLZH 4I3GA 3CUPA 3TIDB 4O9HH 1J1OH 4M1GL 4JRYD 3IXTA 3T8XA 2BHZA 2BXZA 3UAJC 3VXMA 4QCIB 1BBJB 3DI3B 5FUCC 4PBVC 4G7YH 4XNYL 1LP9F 1K3ZA 1MHHA 2KKQA 4GLRI 2XI9A 4MB4A 4JFPA 3GI8H 1JGEA 2YPKA 2NY4D 4U7MA 1R5IA 4K71C 3RY6C 3IJHA 1WGOA 4BUHA 5IIEA 3VA2C 1P4BL 4MQTB 5GZOC 1YQ2A 3SDDB 3K4DA 3SE4C 5C0GB 2AS5M 4FP8L 3TZVA 1QBAA 1HHGB 4Z9KB 3SDAC 1Q0YH 3DUHA 4FABH 1Z9MA 3B9KD 2Q8AH 4XRCA 2ADJB 1FLRL 2IQ9H 5CJOL 2VJXA 3OR6B 1VPOH 3TBWB 4WU5A 5CINL 4G8GD 3LEXA 1LEGB 2I27N 4O5LH 4HDIB 1JYXA 5ABDE 3OTTA 3H6JA 1EEZA 3OKKA 1JRHL 2OI9C 1BIHA 4JZJA 2G2RA 4TVPE 1WWAX 5DQJB 5FK9B 3NIDF 4CL7A 2CLZA 4PRPB 3QXDB 5TE4H 5L9DL 3U4EB 3VD5A 4RSVA 3KYMA 5EU6E 1I3GL 3MLZH 2SEBA 5KOMC 2FECL 5IESL 3UZQA 1AHWB 3QDGD 4PG9A 4F7CA 1PX3A 1G0XA 3INUL 1U3HB 3OKMA 5JXAH 1C16B 3MMEA 4YGVB 2VDQL 4U3XA 5HDOA 4LVEA 5BQ7A 2UWEB 1UM6L 3D85B 3MACH 2BFVH 4U1GB 4NWUH 1J0KA 4MQSB 1I3RB 2YD5A 3MRFA 4M4PA 5CCKL 1ZANL 1H9VA 3TLRA 5BO1L 2EIZB 2I26N 1N3NA 1E6JL 3QHTC 3QUYB 3IDIA 1P9MA 1MRCL 1RJLB 3IU3B 1LO0H 4ODUB 4YE4L 5C0EB 1KJMB 1YEEH 5L2JB 1Y6MR 4DN4L 4JO1H 4KKAC 4XH2B 5BMFH 1K4DB 1OT2A 1HEZA 1F58L 4LHUG 4YWGH 1RZIA 4QRPD 4EN3D 3RZCA 3TESA 1U3HC 5F96H 1ZLSL 1VERA 3GKZA 4DVRL 3UYRH 1YEGH 5EZJA 5CSZB 5LBSH 4HUVB 4G8EB 1WWBX 3OPZL 3BW9B 3KPMA 3WSQH 4RISL 4MGXA 4XP6L 1DTUA 1U93B 2VC2H 4NC1C 4AY0A 1D9KA 1T66C 4M93B 4IRJA 1NCBH 1OB1B 3DOSA 1A5FL 5HPOA 1KTKE 2NY4C 1RZKL 2DOCA 1CICB 4QRTA 2MWCA 1IGIH 2XKNA 1A7QH 2F19H 3U2SA 2NY6B 5I17B 1ZTXL 5L88H 3GB7A 3UPRA 5IB2B 1RSFA 3HE7D 4YH6A 5B38A 2E9IA 3EFDL 1AE6L 1K3IA 3B9KC 1I1AB 1MREH 4F3FA 1QUNA 5F70A 5JPNA 4LLVB 1MPAL 2H26B 4PJXF 1KXTB 9CGTA 2X7LB 3ZT6A 2HLAA 1DBKL 3QG6B 4KDWA 3LRHA 4FQHA 3UTQB 4G6FD 3BMVA 1YEHH 3C5SA 4H1LG 4R90L 1BZQK 2MSPA 1RMFH 1ZAGA 2F9BT 4M93C 3ZKQD 2FEEL 3FJTA 5A16B 3BESR 1ZGLM 2HWZH 2WK2A 2BY3A 1BJ1J 2NLJB 1W8OA 2YMXL 2C5DC 4X6CA 1MWAA 3FT2B 4UTBH 4UV4H 1KN2H 3VG0L 4OF6A 3GK8L 4M7LL 4HT1L 1KG0A 1TPXC 4QRPB 1F6AB 2NYYD 3P9LB 1N7MH 5AG9A 4BFEA 1DQQA 4QXGL 1U3JA 2ZG1A 4YDVA 5K9QG 1NAKL 5FIEA 4PRPE 4YHIA 3ZKMD 1B4JL 4H25A 4Z5RA 2YZ1A 2X9WA 3MODL 1FFQA 1CI5A 4PJBA 5F7MC 2P48B 3TT3L 3O8XD 1NDMA 3QUMA 1Z2KA 3TO2B 2YHGA 2GUOB 2D0HA 1Q8MA 3C6LA 3VD3A 5MP6L 2UWEE 4E0RA 4C57C 5F1NA 3BUYB 3OB8A 3VXSD 2EEDA 3TYFB 3QEQD 3H7LA 3VFNA 1KLUA 1NGXB 1Z0NA 3CK0H 5DJ2A 4X7EC 4OJFL 2MTPA 1HH6A 2E8YA 1J18A 4H0IA 4DK3A 1I4FA 4OLVL 1WVZA 2YZ8A 1IQWH 4PP2B 2VLMD 2BCKB 4PJGB 5GGRA 1JVKA 4XNQB 5T1LA 3EOYG 2GK0B 5GS0D 3QWRD 3OKLA 4F8QA 4WUKH 4LEXL 1XIWA 2YUZA 4HCRL 4HF5L 4NKMB 1B0WA 2P47B 3SDCA 3HE7C 2FX7L 2D3VA 1WFUA 1T1WA 3TIEA 3HHRB 4AYFA 2Q7YA 3RHWK 2D9CA 3TV3L 3QHFL 3U79A 1A1MA 5E94B 3HZVB 1X4ZA 5FUZH 3MRBB 1U91A 1EVTC 1JGDB 2GAZB 2NY1B 4MJ5A 1A1NA 2GW5A 3KAAA 3PWLA 3MV9A 2PO6D 1QBLL 4L4TD 3LMJH 2BSTA 5J13B 3HUJA 3O8XB 5HGBA 2P8PA 4P5MA 1CZ8H 2XIDA 4G6MH 5DHXB 2YXMA 2D4DA 5DUPL 1IAOA 3IDNA 5C0CA 2NYYC 3RWCA 5H37G 4JDZB 1ED3A 3FAXA 3BE1L 4HIHB 4EJ1C 3EJZD 4LLUA 1EHNA 5CKGA 4JR9L 3DO7A 3LKSA 3ULSA 4XXCA 3HAEB 1NCNA 4Y1AB 2YUVA 3ZKMC 3GJFK 3N85H 3V79C 3ZHDA 5C07A 4NHUB 3G08A 3ZYIA 3VGAB 4OLUH 1RIVL 3BPCB 5FYJE 4DTGH 3Q48A 5JW3L 2JK5A 2CKBB 3O8XC 3V7AG 1LO3H 3GHEH 4N90E 1H15A 3CFJB 4JM4L 1RJZB 1UXWA 1QFUL 1A6WL 5F8QC 1IM9D 3RU8H 2VQUA 4GAGL 3X12B 4D3CL 2LQRA 1GGUA 1ORQB 4B7LA 1DFBH 4M48H 3UYOD 3O2DH 1IFHL 1Q72H 2MQ0A 3D3VD 3W82A 5F1IA 1CXLA 1B2WH 4X80H 5ESQA 3S34H 2R23B 3ES6B 3MYJB 3CSGA 5IR1A 2NQCA 4MJ6A 4ONGH 3DVNA 3B9AA 1OP3K 4Z7VA 4O4YH 4OT1L 4UOW0 1BFVH 5GS0C 3LQAH 5E2UL 5EZOL 4LIQH 2D7PA 3RUGB 3VXRA 2DQJH 3QFJA 3DUSA 1WUNT 1X4XA 3MCG1 3WS6C 5GGSA 2BSRB 5H94B 3TT1H 4LSVH 3SGJA 4XBEH 4LLMA 4LSTH 3MLXL 1UADC 1CFNA 3TA3A 4PTUA 5E7BA 1JL8A 4ODTL 4PRBA 4ZODA 1CDHA 3GMRA 1X5AA 3MJGX 2HN7B 2K9UA 3MRKA 4OCSH 4JG0L 3ZKND 1WC7B 3ZSSA 2E7HA 5E2WH 4RGOL 3EIFA 5CFHA 2R56H 1P2CA 2PO6C 3EYVB 4FQ1H 2HVJA 5ICYB 1EV2E 2X4QA 4I13B 4XVTL 5IOPA 1MRDH 1TXKA 2UWEF 3CFDA 3D25B 3L1OL 1FZJB 3VW3L 3VFTA 1G84A 1QD0A 4RAUB 4UBDD 1SEBB 4PJAB 1JIBA 1EXUB 4F7EA 1IKNC 1T04B 5EU4B 3REWA 3EJZC 3ZKSD 4Z0XB 1KJ2A 2BSSB 3B83A 2CRMA 1CF8L 4XNYH 1TVBB 3ALXA 2BNQA 3UEZA 4TVPH 1YN7A 4NNPL 2DYPA 2F54A 3QUXB 2AAVA 2C7UA 1P4BH 4XNZC 2JTDA 3FRUB 2I9LA 4UINL 4J8RA 2VSDA 4HFWA 4U05A 4U6XA 3BWAA 4R9HA 4KMTL 4Y1AE 1QLEH 4LFHG 5CINH 3QJHB 2MHAB 5GJSH 3AMLA 3ARYA 2VZUA 3B5HA 4EI5A 2XTJD 3MLUL 4JCMA 3MRIB 4ODWA 3T3PF 2M26A 4U2YA 1KYOK 5KSUB 3MRDA 2OL3L 3H3KA 1FFPA 2ZCHH 2EZ0D 3QUXC 1RULL 3PWVB 4YHNA 2PTTB 4Z7UF 3KYOA 1WQVT 3OHXB 4OM1L 3EOAA 1X5LA 4WVRA 5EZIL 3HZYB 3WO3B 2R0WL 3INUH 1T5WB 3C8DA 1OAKH 2X4RA 1ETZA 3QZWA 5IB1A 3KJ4B 1A4JA 1UM6H 2F53B 3K8LA 4OFDA 3TNMA 2FRGP 2JB6B 5CCKH 1DLHA 5ALCH 3VXUA 1SBBA 1TZIB 1UG9A 3E2HB 3I6LD 1J0IA 5EU7C 3GI9H 1E6JH 3HCVB 4KY1L 4HC1L 3A6CH 4X98A 3T4AA 3NFNB 4FQQB 3IF1A 2OCFD 3ZKNC 2LFGA 1AXIB 1AY1L 3AMKA 1J5OL 5CS7A 5DD6B 4DN4H 2PXYD 1R3IL 2CK2A 4UILH 3RUGE 3EOBA 3LN9A 4JM2D 3O2WL 1RAMA 3BDYH 5F8RC 4TUJA 3BRGC 1ZLSH 4XNMB 1T4KB 3RWGA 5CZXD 5HVFB 3UDWC 1A6AB 5IG7A 4MCYB 2VLRA 3NIFF 2IPKB 1U92A 5JDJA 1YN6A 2BVUA 4RDQF 3QUZD 4XP6H 1MJUL 3Q6FA 4NUGL 4HH9B 3MBEB 3MFFB 1FORL 5C3TA 4DZ8A 2O61B 2ZSVA 3QEGH 3VXQB 1A5FH 4DQOL 2QKIA 1XGQB 1CN4A 4PJIB 2ZUWA 4JZOA 2KBGA 2VKXA 5C8JA 1K8DA 4LLWA 5DUML 1JPGA 3C2AL 4HUUA 1NCDH 2F5AH 2B39A 1E0OB 4D0CB 3EFDH 3EYSL 4RGMB 2W0LA 3QDMB 4ZFGL 5E5MA 1MPAH 5LGJB 1FZKA 5DJ8A 2OSLA 2AJZA 1JUFA 2YA2A 2XTJC 4QRSA 4PYGA 3ULUF 3BZEB 3K46A 2X4UB 3MREB 2EZ0C 1LD9A 4WTZG 1J05B 5I8OH 3O4LA 3UTTB 4W6XB 4M7LH 4GXUM 4YIQA 3HE6B 2WNGA 3QPQD 4IDJH 1JMXA 4RGMC 2YD3A 1S9VA 2XQYG 4YBLC 3EFFA 1DBMH 4KAQH 3B8YA 4QXGH 4EDWL 4WV1C 4NJAL 2AV7B 1C7SA 5D6DC 4NYLA 1B4JH 4L9DA 5FCSH 7FABL 2XWJB 4LCWE 2AJVL 4PJCA 1PKQA 1QKZL 5EUOB 1RV6X 1JZ8A 2V5RA 5JZ7D 4W4OA 1WTLA 2RGSA 4MJ4A 2GITB 5EBMA 4CMMB 2PXYC 3TVMA 4JFXA 1QQDB 5MP6H 3WNPA 4JM2C 3FOMA 3VXPB 2F53E 2V9RA 3IFLL 1LP9A 4OUUA 3ZHLA 3WMSA 1I7UA 5B8CA 3FQTA 1U95A 1I9RH 4KHTL 2KH2B 1WISA 5CZXC 1CFVH 4M1CD 5D7IF 5ESAA 4OJFH 1CD1B 3BDXA 3L3DB 4OFYD 2IAMA 3QUZC 2KQNA 1I8LA 1PAMA 5SWSB 4CADB 1DQDL 3GSUB 4OLVH 4L9LC 1W0WA 3QIUA 3NCYS 2ENSA 3IKCB 4NQEB 4OQTA 3P3YA 4NO0D 1E27A 3NZ8A 3I9GL 4HKZA 5FUOL 4LBEA 4I5BA 4LDOB 5GGUA 4YXHL 4LEXH 4HCRH 5CIPB 5J12C 3CDFA 1G0YR 4BZ2H 1Q9KA 2FSEB 1V7NL 3QFDB 1KPUA 1JNJA 4M9OA 3SKOA 5HYIA 2OTUA 3BZDA 2FX7H 2CUIA 5GRUL 2CGRH 5IJVA 2VLKD 5C86A 2DDQL 1BBDH 4YXKH 3TV3H 5GGTA 3QHFH 4RAVA 2XZCL 5CEZD 4KXZH 1K6QL 2HAZA 1I1RA 4PJIE 3ZLQC 2QADB 3VE0A 3FQRB 4GKNB 4LU5L 4F8TA 4PGJA 1I8KA 2H2SD 4PV8A 1BFSA 1QSVA 1QBLH 1T0PB 5FYJH 3VU2A 4WFGE 4CVZA 3W39A 3QJFB 1T89A 4NRZA 3UBXI 4HBCL 5EO0A 3QDME 2R29L 1OP5K 3AS2A 3QPQC 4YUEL 5E9DD 3HI1B 2KUTA 5IB3A 1NMCB 4JR9H 4BFBD 2JELL 2EC8A 4H88L 5DJ6A 1TJIL 4PGDA 4OZIB 1AGCA 1U8QB 3EGSB 2UYLB 3UTTE 3HC4L 1NGYB 1ACZA 4FTVD 5KANI 4NO0B 4Y5XB 4NQXA 5JZ7C 1XR8B 1Z9OA 1HCVA 3RJQB 4NQCA 3ZDYE 2BHYA 5FA3A 4PRIA 2G5RA 4QOKB 4MD5B 2V2TB 4HLZH 4LVHC 5FYLD 4NPYA 1UZ8A 2AVGA 3AGVA 4JQVC 4R0LC 4NFDA 4XMLL 3P11L 4OBRA 4AK1A 5GRXG 1ZLUH 5H2BA 5IMMB 4M1CC 1B0RA 3ULVE 1D7FA 2GCYA 5EUOE 1IFHH 4OZFG 3ZYOA 4HS6A 4WGWB 2CDFA 4JRXB 3L6FB 3ULUH 3PDGA 3C09C 3CVIL 3P9MA 1C5BL 5TJWK 1A7RL 1AGDB 1LO2L 1N8ZB 3O3EB 5JW5A 4Y5XC 4JFYA 4IIQA 1MJ8H 1FG2B 2G75B 1DDHA 5I1DB 1H3TA 4J1UB 1CWVA 5E2UH 3DVGB 3O2DA 4P9HC 2YD8A 4PTTA 5DR5L 3DV6B 1IGCH 4J3OC 1IEHA 5MENA 1ZT7A 4OZGE 3FZUD 5SWSE 3GIZH 3RFZC 2YEZB 4BH7B 4MA1B 1XGUA 3QRFM 3IJYB 5C0FA 3MLXH 4G43B 8FABA 2WWMD 4NQEE 4OLWL 4ODTH 3L5IA 3QIWD 4R3SA 2FB4L 1TZHB 1MVUB 3ECBB 5D70H 2PW2A 4FQXD 1H8NA 2WUBH 2A83A 4JQXA 5HHQB 3JWDC 4G9DA 4RGOH 2XZZA 1G6RB 1VADB 5FM8A 5HYJD 1WCQA 4JFOB 1DN0B 4MJIB 4AIXA 1D5IH 2EDYA 4LCCB 4PIRF 4M5ZL 3SQOH 1HXYB 4UMGA 4OB5L 4ONHA 4RWYL 3GSOB 4L5FL 1KF9B 5E1HB 5KSBB 4KK6D 5DEFA 3ZHKA 2F58L 2OTPA 4FXKB 3I02B 4JY6B 5GSVA 3WNNA 4X9HA 2JJTA 5FM5O 4MNHA 4MAYD 5TQ2L 1CF8H 4LCIL 1FO0L 4I48B 4V2CB 3EYOA 2HA1A 1OGAD 1VACB 3CU1A 5IF0B 1CG9B 3OJMB 4WWID 3QO1A 3ZTJH 3T0AA 3W81A 1BF2A 4X9FA 2B8OT 3M17A 5IW6B 3DNKA 3SY0B 3RVWD 4UINH 2ATPA 1J1PH 5DJAA 5J3HD 2QLVB 3GUTB 4RBPK 3HC0B 2OM5A 2PKDA 1NAML 5ALBL 4F33A 3OB0H 2PTUA 3O6FA 2Z35A 1CL7L 3GHBL 4G80B 4OZIE 1PSKH 5DEZA 1G1CA 4FXGB 1B0GB 4OIBA 4QXTA 3F65A 2EC9U 3QIWB 4I0PB 1JPSL 4PJIF 4N5UA 4IRSB 1I1CA 1N2RB 1XGTB 1PDKA 2BOBB 3CFEB 1G9NC 1RULH 4QOKE 4KGLA 4TSAH 5JW4Q 2VISA 1YJDC 3JVGC 4OM1H 4UUJA 3GJEB 5JMRA 5FA4B 1DBJL 5EZIH 4JHWH 3G5ZB 4CN4A 3BHBA 5KSVA 4HXBL 1FZOB 4NQVB 2DS4A 1A4KA 4QGYA 3UROR 4ZTOL 2R1YA 5K9OB 1A14L 4MMXC 2E9WA 3BEVB 4TSCH 4U1SA 1QYGL 1I9IL 4ZXBD 1NEZB 1FNSL 3FZUC 4JRXE 4KI5D 3FO0L 2H3NA 2CMRL 1T7XA 3EOTH 1P69B 1WAAE 3V8CA 1G9MH 2GI7A 4YXLL 4KY1H 1NPUA 2WWMC 4HC1H 2DBLH 3QIWC 5HHMD 4H0HB 4LAJH 4YDLC 5DMKA 3TWCL 1NCWL 5A43C 4FQXC 2HVKA 1BVKB 3U0TB 5C0AD 4P2OD 1R3IH 4F7PB 4DCQA 4JKKA 3EYFA 3TN0D 4U1LB 1VB9A 1CE6A 4X5LA 3WLBA 1AJ7H 1DUYB 2PETA 3ZDYF 2DQCH 4OIIL 4QT5B 5ICZA 3MV8B 1I75A 5I8EB 2VE6A 3DV4B 1FNGA 3T77B 2XWBA 1INDL 5CZVL 3D18B 4LHUD 5B38G 5MEOB 4KK6C 1N5YL 3GSXB 1NC2B 4G8FB 3RI5F 1MJUH 3FKUS 2GSIA 1UJ3B 3RTQA 1R3KA 2CLVA 3ULVF 1AQKL 5EUOF 3EW3B 4MAYC 4MJIE 3TIDA 3IB4A 3QIBD 1FHGA 2CQVA 5T3ZD 4DQOH 1LEIB 4MS8D 4QCIA 3QXUA 1BBJA 5JIPA 3VCLB 1GC1C 3OJVC 1Q1JL 5MEPB 4S1DD 3FQNB 2ZSWB 5IV2B 5KSBE 3C2AH 4V1DD 1LDSA 4BQ6A 4NJ9H 1T2QH 1JHKL 3RVWC 4GH7B 3SGKC 3ARWA 3MGTB 4DKDC 1CR9L 3QDJB 4UIKL 3EYSH 5J3HC 3SDDA 5K9KB 1VSCA 5C0GA 4TPRL 3GJFB 5HYSB 4OZGF 5FXCH 3CFBB 1HHGA 3MZTA 4WFFE 1VFUA 2ADJA 4GJTB 3GBML 3TBWA 4N9OB 1LEGA 4U0RB 3ALPA 5D7KE 4HDIA 4YEEA 1MQ8A 3LSOB 3QH3B 5BW7C 4LP5A 2DI8A 3TO4A 5DQJA 5FK9A 1FQ9C 4PRPA 4D9RD 5EOTB 3QXDA 5CJXC 5FF6B 1AO7B 1Y18B 4UNUA 3U4EA 4X4ZA 3EO0B 1WIPA 5DO2D 1NC4A 3P73B 4L8BB 1HDMB 1N6UA 4Y4KD 4NJAH 1AHWA 1NUDA 4ZXBC 4QKXB 2W91A 1MLCB 4KI5C 1A8JH 3D2UB 5DJYB 5KVFL 7FABH 1C16A 2WP3T 4YGVA 1FYHB 2UWEA 2AJVH 3D85A 12E8H 1I3RA 1WTGT 3QIBB 1T21B 5BOPA 2EIZA 2HJKB 4P2OC 4X5WA 5DQDL 2RJMA 1RFDH 3QUYA 4IDLA 5E6ID 3FMGH 2R4RH 4F58H 4RZCB 3G5YB 2X4TA 3IU3A 4ODUA 5C0EA 1FC1A 4XH2A 2WBJB 3O81A 3QT2A 1K4DA 4FA8A 5HGAB 2NX5B 1E4KC 4JJHA 2DM4A 2XYCA 4PLNC 2Y36L 5I8KH 4PREB 2VL4A 2AI0H 5CSZA 4G8EA 4R2GB 1A9EB 2IALB 3QIBC 4A2MA 5HGGS 2ZKHL 3MV8E 2C3VB 1I85A 1BM3H 5JIIA 2AW2A 5GRVK 4MS8C 2DJ4A 2DICA 2LAAA 3BYYA 2FX8L 4NRXB 5FUOH 2IEPA 1MFBL 2MNUA 4GRLB 4S1DC 3SKUD 4CMHB 1CXKA 1OB1A 1A7PL 3NABL 5DD1H 1SEQH 1CXHA 1T22B 1V7NH 5L6YL 4LOUD 1CICA 1MOEA 2GQHA 3EDKA 1CT8B 1A02N 5GRUH 3PXJA 4GLRH 5I17A 3IDYB 2VQ1B 5IB2A 4CU7A 4Y8AA 3QB7C 1JF1B 5D72L 3KJ6L 3RWJB 1WAAF 4OCMC 4OLXH 5T5FL 5I1LB 3WNMA 1I1AA 1XGPB 3K81A 4H8WC 2DLIA 4LLVA 2H26A 1YEJL 4ONFL 1GGIH 3P2TA 3QG6A 1LO5A 3UTQA 3QDJE 3PJSB 4C83B 2ZNWA 3L7EB 5DK2A 5D93B 3PHQA 5A16A 5HXMA 1BQHB 2DTML 1PQZB 2NLJA 1T1ZB 4R6UA 5E8NB 4L8DB 4Y19D 1QO3B 3D9AL 3FT2A 5DO2C 2DKSA 4UB0L 1DEDA 2GEEA 2X09A 4Y4KC 1F6AA 2VXSL 4H88H 3H8NA 3LH2L 3ULVH 5T3XD 1QTYT 4AEIH 5LQBH 3I2CH 4GUPB 3HC4H 4WY7L 2FD6H 3MNWA 5DLML 1DL7L 5E8EB 3ARGB 1Q0XH 2NPLX 4Y4HB 1T7YA 5KW9L 1AO7E 5E6IC 2YA1A 5KSBF 4JHAH 3UTPE 1S9KC 5I1AB 1INEL 1ITBB 1MH5B 1IE5A 5J11B 5DURD 3GKWL 1XZ0B 2AXFB 1AD9B 3TO2A 2GUOA 1A3LL 2P45B 2UZXB 3MRGB 4MHHI 4JG1H 4D9LL 3BUYA 5DK0B 2VLJB 2VN4A 1P7QB 1IC5L 3VFVB 3TYFA 1LEKB 4X6DB 3FQUB 1NGXA 3GMQB 4CJ0A 3CVIH 1C5BH 1QOKA 3MLSL 1A7RH 2M1KA 1XF4B 2VKWA 3KPOB 3RIFK 5D7JB 4P3CH 5FHBH 3ARGC 3V6OC 1NMAH 5HDBF 2DWDB 4X83A 5CGYD 4LQFH 4A2LA 2YR3A 4PP2A 1JK8A 2NX5E 5DA0B 2BCKA 5J11C 4GW1B 2LVEA 1R3LB 2GK0A 1TMCB 3I84A 4LOUC 3WUWB 5DWUH 3W9EB 1FCGA 3W0WD 4NKMA 2ESVB 5IBUB 4OLWH 2V5MA 5F9OL 3AREB 4RAHA 1LHZA 2DD8L 2GFBB 4I4WB 3C6SB 1MCCA 2V9TA 4QGTA 5E5UB 2V7NB 2Y5TB 2R2CA 5HYFA 5E94A 5FYKL 1NFDB 4XAKD 4WIQA 2ZP0T 3MRBA 4YPGB 2ZUQB 1JGDA 4NQDD 1G7MA 2GAZA 3ARZA 4JFFD 1N4XH 4ELMB 4O02L 4O00A 5DURB 4TUOB 3GRWL 4YGAB 1YYML 3WFBL 2OBGA 1KCRH 5IFHL 5E00B 2X4PB 4MNGB 4LCIH 4JDZA 5IVOA 1ZSDB 4HIHA 4L8CB 3Q6GH 5BRZB 4KMLB 3LKPB 1V7MH 5D5ME 1S7RB 5F44A 2NZIA 2VITB 3HAEA 4CAGA 4ODVH 4Y1AA 5ESVB 4DGIL 4AIZB 1BOGB 4WNQB 5E95B 2VWEC 2MFNA 3IFNL 1K85A 2G5BB 4NHUA 2XV6B 3BPCA 1GAFL 1J0ZA 1K8IB 4PBWD 1NAMH 3QZWG 1OTSD 2IBZY 3CH8A 4YDKL 1CL7H 1DN2A 2FJHB 1JTPA 3H9ZA 1ZVSA 5TDNB 3CFJA 3VFRB 1DBAL 1RJZA 2ARWA 4LFHD 2PUQT 1IL1B 4HS8L 1JPSH 3WHXB 4NC0B 5M94B 3IDMB 1QRND 3X12A 4BZYA 3I50L 4BH8A 4Z7QF 3SO3C 2FHFA 5EOCJ 3DECA 3WIIL 1F90L 3IT8D 4I77H 5T33L 4OIAA 1M6OA 2Q6WB 5CJ5A 1BVLB 3DETD 1EMTL 2HT4D 1T03L 5CGYC 5KVGH 2R23A 3ES6A 4PB9H 1L9MA 4HXBH 3MYJA 3DBXB 2Z0BA 5C08D 5GRJH 2VLJE 4Q9CA 4X7TB 2J8UF 3GMNB 3PXHA 1ZMYA 1EGJH 2DBJA 3FO0H 4NZJA 4WW2B 4J3SA 3RUGA 4HFUL 3CVHB 2WUCH 3SOBL 3TWCH 5H94A 1QSED 3KNBB 3OXRB 1PYWB 5I19L 4U1JB 1QBBA 4M8VA 3E8UL 3QRGL 4MNQD 5GISH 1KV3A 2HN7A 4PUBL 2FIRT 4TUKL 3CIQA 1WC7A 4LLQB 3RWHA 2E7LC 2Z31B 2V6HA 5I8CB 4AMKL 4BQBA 2ESVE 2EICA 3EYVA 4ETQB 3NCCB 3H9YA 5HHPB 5DRZB 5DD0H 1N5YH 1MCOL 3D25A 1FZJA 4NZTH 5DJDB 1AQKH 4S1QH 3CLFL 1A7OL 5DRWB 4RAUA 3C87A 3F7PC 5IBTH 2ORBH 1NFDE 2CJUL 3JWNC 4KDVA 4QRQB 3OL2A 2ADGB 3PE9A 4GMSL 5EU4A 1LE5B 5ERWB 2UVFA 2BSSA 1IAIL 2VTFA 2JF1A 3S97C 3FHAA 2VDOL 4ELME 2RFXB 1TVBA 4DKFL 4FG6D 4JLRB 3GSNL 1ZHBB 3QUXA 1RU9H 4UIKH 3OV6A 1KYOJ 2EDJA 4MNGE 1JWUB 2YPLD 5HDQH 3FRUA 3QAZC 4I2XA 2HG5B 3CLEL 3S8WA 1OTSC 5IMLB 4WW1A 1GH7A 4OCWL 1FE8L 1J1XL 3WUZA 5BRZE 1MIML 4RGND 3ARBD 3GBMH 4S1RH 4XWOD 3L3KA 3QJHA 4NQUA 3NVQA 5AUMB 2MHAA 4NDMB 2R4SL 3HB3D 2HKHL 3MJ6A 3MRIA 4Y4FD 5C0RL 1G7JB 1HHJB 4XX1E 1CDCA 4M6MH 3DETC 2HT4C 3KDMA 5K59E 2BK8A 3PWVA 2PTTA 3NIGE 1HI6B 1QSFB 4LCWA 3W2DL 5IHUL