4Y19D

Immune complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
205
structure length
205
Chain Sequence
MQQVKQNSPSLSVQEGRISILNCDYTNSMFDYFLWYKKYPAEGPTFLISISSIKDKNEDGRFTVFLNKSAKHLSLHIVPSQPGDSAVYFCAASVYAGGTSYGKLTFGQGTILTVHPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title T cell receptor reversed polarity recognition of a self-antigen major histocompatibility complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 38
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2015-02-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y19D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y19D02
1TJHL 4P2QA 2IFGA 1HH9B 2YEZB 3PWPD 4DFHA 5D93B 5FYKL 5EO1B 4YR6A 1Q72H 3GO1H 3WXVL 4JHWL 3DUSB 5F9WB 2Z93B 4FXLA 5GGRB 3O8XD 1GGIL 4G3YH 4HJJL 1FYTA 4J8RB 2GJ6E 1M71B 1XGPA 5E9DD 3S4SA 4KK6D 2OK0L 4GRLC 5FUOH 1ZAGA 5EOCJ 3U7YL 1EEZB 3SO5A 1JV5B 1SYVB 1U3YA 3FAXA 1RFDH 5F89A 1HHHB 1TFHA 4CADA 4N90D 4PBXA 1G9NL 3V6ZB 4NO3B 5C0DB 1KTLA 1TVHA 5CAYB 3Q6FA 3QG6B 5SWZB 3BE1H 4JFYA 3GMRA 4MCYA 2VKXA 3OTTA 3CFCH 4OGXL 4RDQF 4AM0B 3BJ91 3AC0A 3S5LB 1TZGL 3W9EB 1NDGA 4TTDD 1A6TA 4X4YB 4Q9BA 1NBQA 3EO9L 1MJ8H 3FRPA 3G5VA 4YNYB 5GGSY 5KSVA 4HS3A 2CR3A 5KAQG 5HGBB 1RJLA 1G9EA 1CGYA 1OGTA 1KTKE 1QKZL 5CEXA 3GB7B 1UKSA 1Q9LB 4QTHA 1UB5A 1NGQL 1FZKB 3ISWA 3UJIL 1INQA 3MRCB 1JZ3A 4DGIH 4JB9H 1EEUA 3O3UN 5JA9A 3MOBH 4UTBH 3CDGA 1KB9J 4LVHC 1HHKA 2R1YA 1X5XA 4K23H 4ONFL 4HUUB 1X4XA 3EO0A 1MI5A 3BZDA 4MQXD 2B39A 1KYOK 1I7UB 4P9HL 4BSVB 1PSKH 4WUKH 3TVMD 3HPLB 3IKCB 3F58L 2NY3B 5AUMB 1ZS8A 4WU7A 1RU9L 4XVSL 2H1PH 3ALXA 3B83A 1CD8A 2PTTA 3L3KB 4FMFA 1BFOB 1A7QH 4E5XB 4YPJA 3QCVH 2VDMH 2PNDA 2F5AL 3C09B 1YY8B 1UZ8A 1YNLH 4NQDD 1A5FL 2XRAH 1PEWA 4IIQC 4X0KB 5I71C 5D5ME 2P5EA 5ESAA 4RMWA 1I75A 3DURB 3T3PF 1VGKB 5JXAH 1T1XA 5DEZA 4HQQH 4NGHL 3TPUB 1ZMYA 4N0FB 4LDLB 3B6SB 4N8VB 1NUGA 5E00B 2UWEA 2EXYD 1Y6MR 1NCCH 4G8IB 1I85A 3RPIA 3WFDH 2NY1B 1L6XA 2AK1L 2E8YA 5DR5H 1M4KA 4X6BB 2V7HB 4GFTB 3B43A 3BZFB 4N0UA 2VLLA 3IDJB 3RUGB 3TO4D 4XCNA 2IPUG 4CVZB 4LLYA 3CLFH 3QDGE 1I7TB 4JZJB 2KKQA 4ZG1A 3I50H 5INDA 3C2SA 3SE9H 2NY5C 3ZTNL 3KS0H 3QP3A 4I0PB 2XTLA 5GQBA 5H35A 4HUNB 5HPOA 1H5BA 3DROB 5FM4A 4K3EH 4FQCH 4HWUA 4XZUB 1VFBB 1FCGA 3GJFA 3VXSA 5TDOA 4LCIH 5L9DH 1GZPB 1V8HA 2VR4A 4XRCA 4JR9L 3VRLF 1TZHA 3N06B 4F8TA 5IV2B 2ZCHL 3MLYH 4WWID 4WRLA 5MEQB 4KAQH 4NKQB 3CFIC 2ADGA 4N68A 1JYWA 4IIQA 2YBRB 4RX4A 1QUNA 2XZCH 4AMKH 1KJ2A 3S37X 4PJ9D 3QIWD 5T1LA 3ZYJA 3VDBA 3DHMA 4G8FB 4PRIE 5I6XB 2IAMB 3U46A 5DJXB 3VJ6B 2ZSVB 4WFFE 1XIWC 2XQBL 2O26U 5CBEB 3D48R 1NEZA 2RCSH 4LARH 3C8KA 3U6RA 2A74A 4HPOL 4JFDD 3BRFA 1YYLH 1L0XA 3WLWC 2XWJB 1JZ6A 5L8JB 5IBUB 3BP6B 4OLVL 1YEFH 4BFGA 4FG6C 5IG7B 4HC1A 2HN7B 1C08B 4RGNB 1B6UA 3QEQD 2MKWA 4HKXB 5DC0A 2IFFH 1R5IA 3GUTA 3NABH 4PJ8B 4CU8A 2XKSA 3NCYP 1J8HB 5D2LB 5IJKC 1IFHL 8FABB 2UZIL 1R6VA 4JY6B 3D85B 5ANMB 3L5XH 1D5IH 4DW2L 2YMXL 3G6DH 4JFFA 3F12A 2Y36H 2O61A 1MCNA 1P9MC 1ES0A 1U3JA 1U2HA 2V2TA 4RFEB 3MFFB 1JF1B 1NC2B 1I1YA 4G42A 3S37H 5IW1A 5D7SL 1BD2D 4X9HA 2HKHH 2ICWI 3KYNA 2IF7A 4G43B 1ZT7B 1E6JH 3HZVA 4DTGH 3L3OA 4HJ0C 3TA3C 1DSFH 1HH6A 3T2NL 2VLRA 3FHAA 4MLSA 1CZ8L 4Q6YA 2PYED 3MLWH 4MJIB 3IFNH 3H3PH 3L3GA 1F5WA 3MODH 1QSEE 1XIWA 2Z4QA 5GS3A 3ZSTA 5DJ0B 5ILTL 5J7CC 1UKQA 2YPKB 1A0QH 1OF2A 1ZHNA 3SE8H 4UV4L 5ESQB 3B3IB 5C08D 3I6KA 4PB9L 4PJDB 1N5YL 2LQRA 3CC5A 1UYWH 2CLZB 4GW4A 4Z7VB 3P4NA 3TO2B 2E6PA 3QUZC 2MSPA 5BV7H 4UUJA 4PGCA 3MRHA 1WTGT 1Z9LA 4PRNA 4D9QE 1J18A 3DRTB 4O2EB 4FFWC 2HFGH 3LQAL 5IJKA 3L9RB 1NMCB 3BP5B 4M1DL 3VD5A 4N0YL 4HIIA 4GBXB 5EU4A 2CRMA 4P2OD 5HGDA 5HPMB 4WU5B 3PGCA 1OQOA 1P9MA 4MA1B 1LP9F 1IC4L 5DFTA 5GS0D 1AKJA 1FO0H 3PIQB 4PS4L 4DGYH 4L4VD 1ORQA 3BJLA 4HWNA 2J88L 1A3LL 1JNHB 2Q7YA 4ODSH 1Q94B 3X11A 4HBQA 3S35H 1C12B 2V7NB 1K4CA 5JORB 1A8JH 3UX9B 5GISH 4KTDL 5IB1B 5JOFB 4PGBB 1AR1D 2Q8BL 3TBTB 3CK0L 4RGOL 1LE9A 1MWAB 3QEHB 4OCWH 5IWLA 2HWZL 4ZTOL 1BMGA 1EBPA 3C08L 4R7NA 3CVHL 5D7JB 5I16A 4LSPH 3PABA 2JTDA 1JHKL 3BZ4A 1U93A 4Z95L 5EU7C 1T04B 4K3HA 5IQ9A 1CICC 4PV9B 1WWAX 3QUZA 1SM3H 5IB4A 1XF3A 3OGCB 1AGEB 2HMIC 3GSQA 4KQ4L 4TNWF 1HXMA 4HGWA 2BJMH 4MYWB 3UTQB 5C9KA 5D1XB 5KOMC 1OP5H 1A6WL 3VD9A 3SKJL 3MNVB 1HHGB 1KPVB 2DWEB 4X7TB 4EUPB 3PWJB 3MRQA 4JO4L 4C56A 2V6HA 1I9RL 4LHUD 4S1RH 3MRGB 3KPPA 1KG0B 4XMLL 4D3CH 3ULUF 1A7NL 1MAJA 3ARVA 1FFQA 4K7PX 5TE4L 2R23B 4HCRH 2NZIA 1G6RL 3UZQA 1IM3B 5T5NG 2R1WB 3C87A 3LZFL 2GK0A 4L8CA 3KPSA 1YJDL 2APBA 3SDCA 4AH2B 3BO8B 3PP4L 4TSCL 4IDLA 1W0WA 5HJ3B 2Z9TA 5C0JB 4QRTA 2G5RA 2DQUH 4HPYL 1JPTL 1BZ7B 4Z5RB 1CICA 1YEGH 3ARBC 3C5ZB 3RY4A 5KSAB 4ODUB 3MUGB 5KANI 5C0BB 3CSBA 3HE7B 3EKCA 4LGSB 3H7BA 3PNWB 1PYWA 4JRXE 4WW2B 5D6DC 3W82A 5HHXL 4UTAL 2VDQL 1I8MA 4NQXB 5EWIH 4V2BA 2DI9A 4K7PH 4Y16C 4QTIL 3VI3E 3DPBA 3IAQA 5D7LA 5BQ7B 5E8OA 1NBZB 3DSFL 4UILH 2E9IA 3HKFA 4OFIA 2PW2B 4Y2DD 1B3JA 2H32A 5F8QC 4U1NB 1XR9A 2NY7H 4JQVC 1ZVYA 3GGWB 2W60B 4U6VL 1S3KH 4ZDHA 4LDOB 3BGFB 1A1MB 1ZWIA 4MA8H 4GRLD 1GC1C 3TZVB 1NGYB 2ICCA 4UT7L 2PCPB 4UT6H 3U7WH 4Y4HB 5D1QB 2J12B 3FO0L 1MNUH 4JFZH 3PWVB 2MCPL 5KG9B 2I9TB 4AEIL 1HYSC 5AG9A 5L2JB 1J5OH 2KPNA 4GLRH 4F7EB 5K59E 3GMQB 4DAGH 3RA7H 5M94B 2DB8A 3IT8D 4Z78A 2GUOA 2YZ1A 3I84A 4LPYA 1ZLSH 3DGGA 3MRRA 4F57L 2ITDA 3WMSA 5CZXC 1OLZA 4GH7B 4AEHH 5D6DA 3U1SH 4FOMA 4F7PB 3G5YB 4TQEL 4PG9A 2BOCB 5F7YC 1JRHL 3QG7H 2GYSA 2PW1B 3VXNA 3FFCA 3O9WA 1AH1A 2VDKH 3MV8A 3OF6A 1RI8A 3PP3K 3HPJB 4RGNE 5FGCB 2ZCKH 2HT3D 3IXAA 3V2AR 3RNQB 4QHUB 3OXRA 2VZ3A 2X4NA 1F3JA 1AHWA 2EDYA 3RVWD 1J8HE 5D2LE 2HH0H 1OD7A 3FQUA 3NZHL 4YHKH 3FN0H 1N59B 5AYUL 3S36X 1N0LA 3AY4A 2ESVA 5ANME 3SPVB 4YC2C 4U6YB 1JN6B 4UV7H 1X3DA 2X4OA 2A6DB 3HZYA 2VLKD 3T4AA 1PKQA 3Q6GL 4LLUA 3A67H 3QDJB 2AK4B 4I3GA 5A2LH 2Y72A 1IVLA 5MEOA 5DJCB 3BRDA 3QUMH 3N1FC 1CK0L 1C5CL 1A1NB 5GSRB 1XZ0A 3KYMB 4PLKD 3KGRA 3GSRB 4NRXA 3QIBC 2AV7A 3FT3A 5HVGB 4LPCA 1SBBA 1NEUA 2DTMH 1A7OH 4MJIE 3E2HC 2CK2A 4RZCB 3BQUC 1S7TA 4ZFFB 4WJ5B 3ARYA 4I5BB 1FZMB 3DYOA 2DD8H 1KJMA 2R4SH 2VQTA 2AEWA 3IXTB 5DTFA 1N6UA 4M62H 4NNXA 4NZRL 3CU7A 2AGJL 3MJ9H 2AJYH 5DYOB 1OPGH 3GDBA 1SMAA 3DXAD 4PJEE 4NN6C 4QCIB 4PJDE 1RZJC 4KRMB 5D71L 2EH8H 4Z7VE 2ZKHH 4FXGB 1IGCL 5IFAL 2VIRA 1A1OB 3RGVD 4IJ3B 5JO5A 1T0NA 1MOEA 4IBLT 1BOGA 4FQXD 2VR9A 4KGJA 3V0VB 1BQHB 1JWSB 4OZIA 2EDJA 2VRAA 1MHPH 2P42B 5IBTH 4EQ2A 1G7IB 4X7EC 3NZ8A 1F4WL 4ZTPL 1KELL 3ETBF 3HNVL 3IDXL 2WNGA 3MRFA 1I1RA 5LWYL 3UZVB 3RWJB 4J4PD 2OJEA 2OR8A 2BOBA 2Q3AA 3OKDB 4TRPH 2IMMA 3GHEL 5H94A 3RWGB 4WEUD 1A3QA 1FH5L 3JZ7A 1RZKH 3FRUB 3ALPA 4Z7NF 4HS8H 4N0RA 1KEGL 4E41A 3TYGL 3UYPA 3MRMA 3QIBA 4YHIA 3TYFA 1LO5A 4YDLC 3S7GA 5HI3D 2GJZB 4OCYH 2DKUA 4X5WB 1P2CA 5DVLA 1A7RH 4XNYH 3HZMA 3KPMA 4Z76A 5HVHC 1TTFA 5F9OH 1MFBL 3B9KD 4FZEH 5ACLA 4CRPA 4MD5A 2I24N 4AL8L 5C07A 5ALCH 1BM3L 5CJXC 4PGEA 2NR6D 3GK8H 1JHLH 4DKDC 2VABA 3MV7D 2JKXA 3IVKA 1LO4L 4P59H 3E8UL 5SWZD 4D0BB 4XCEB 1ZVHA 4HG4J 3G5XB 1INEH 5E1AA 3VGBA 5DO2C 1LEGB 2XA3A 5J06A 1S7QB 1ND0B 5HI5C 1MPAL 2OP4L 4U0RB 1Z3GL 3CFEB 3MROB 4MS8C 1ZVSB 4CW1A 4PJGB 1HDMB 1C5BL 1H0DA 3G08B 4IRZL 1QHOA 5D2NB 3CVHA 1KTDB 3BP7B 1BQLH 1J0JA 2D0HA 5T5NF 3GSVB 4U6HA 2J4WL 3KNBB 3KJ6L 3C9NA 3SO3B 2CLRB 3MV9A 5C0EA 1MIEH 2XWBA 2FJGB 3SE4A 4OZGF 4YDIL 3RGHA 3GRWH 3HC4L 4NNPH 1IEHA 4YWGL 3QZWG 1OSZA 1ZGLP 3P9MB 3V79C 2AJVL 4HJ0D 1G7PA 4L5FL 5FOBA 2ZPKL 4ZNEA 2X5PA 5GGQL 3O6FB 3KPRA 2DI7A 1AGFA 3D6GA 3UDWC 1YNKH 5CJXA 1DZBA 5J56B 2ZOLA 4WO4B 3JWDL 1ZEAH 5GS0L 1MIML 5IVXA 2CDEB 2R2HB 2EYTA 2PXYC 2QHRL 4JPVL 3SCMB 4U1SA 2NX5B 4Q6IA 5A2IH 5C2BL 1U8IA 4PLJD 5C0BE 5CFHA 1G6RA 4IRJB 4JY5L 4JZOB 3CH1B 4XP9H 1G1YA 3ZT7A 5JIIA 4K94H 1B4JH 1WBZB 2VQ1A 4NZTH 4EIZC 4OF7A 2OZ4L 3VCLB 4XH2B 2FYYA 4J3OC 4Q7DA 4W68A 2E8ZA 2NLJA 1QA9B 1BX2A 1LDPL 5BVJB 1OAXH 2WANA 3H42H 4HF5L 5E9DA 4NUJA 1MY7A 3GMNA 1S7UB 4HUWA 5IHUL 2FJFB 3V0WH 5DMJB 4NHCH 3NPSB 1D6EB 1QFWM 1FNHA 4U2YA 4LRIC 4OZ4A 4NKOA 4I18C 1WBYA 4EN3B 2FGZA 1IT9H 2W65B 4CVXA 3M17A 3UDWA 3SOBL 4I0PD 4UNUA 5HD8D 2E7HA 4PUBL 1LO2H 5ERWA 5DXWA 1WZ1H 2V2WB 2FX7L 4I3SH 4ALAL 4F58H 2G9HB 3QB7C 2VERN 3F7PC 3VI3F 4L8BB 1I3VA 4PBVC 3LKQA 3O0RH 4HD9A 5IR1B 4NO5A 3C2AH 1UJ3C 1YEEL 2L7JA 4R3SB 3VFOB 4RIRB 2VC2H 1U8QA 5LGJB 1MREH 3TBYB 1F3DH 5C70A 5I74B 1ZT1B 3O3AA 4G9FD 1KXVC 4X99B 2IAMD 1JGLH 3ZE1E 1YMMB 2VUOA 4XNXH 3N1MC 3FONA 3UPCA 2CGRH 2AQ2A 5FGCE 1RUPH 3PHQA 1S7RB 3WFEL 4JREB 1K4DB 3K4AA 1P4BL 4Q9RL 3WL9A 4GKZA 2CRYA 4YHZL 1U92A 4L3CA 4M61B 3U36A 2Y23A 3T0EC 2J6EH 1LE5B 1DQQA 3UP1A 5MHSE 4Q74A 4JPKH 1H8SA 2XY1A 4IOIA 4S1DD 2G75B 1L0YA 2OTWA 3VXQB 5JQ6H 1GZQA 3VXOA 4CMMA 5K59F 3L5WB 3LRGA 5TDNA 2XNAB 4PJ8D 2EE9A 2NYYC 2AK4E 3QDJE 3BKML 3O2DL 4M5ZH 1AY1L 3FO2A 4NYLB 3QUKB 4HGMA 3TLRA 2FECI 1PJ9A 2PO6A 5JZ7C 4NQDA 4KTEH 2DLIA 1NFDE 1GGTA 3GMLA 5KOVC 5FB8A 5IEHA 4M93C 2ERJC 4BZ2H 3K80A 5D6CA 1LO3H 4PGDA 1NC2D 4OD1H 2Y25A 4JQIH 3Q1SH 4F9PC 4XVJL 2QQNL 5KS9E 1S5HA 1QR1A 1MH5A 1UJ3A 2NXZB 2VDNL 2VTFA 2X4TB 1EGJL 3SHSA 3U7AA 4OLWL 3UROR 3IS1X 3OMZA 7FABL 1KXQE 4KDTC 2FB4H 2APWA 4KKLD 5DJAB 2NXYB 3O6MH 5D2LF 5C0IA 4GG6B 3FQTB 3IDMB 3NVQA 2GSIA 4GSDL 3MRPA 3VXUB 1L6ZA 3CFDA 4U1KB 1EHNA 1YEJL 1FFNB 3UO1H 3RRQA 3KXFE 5DD6B 5J11B 3L7EA 1JGUH 5GSVA 4Y16D 3BXNB 3O2WL 3TO4A 4UBDD 5F9JB 1G7HA 1BJ1J 4JO1L 5E5MA 4F3FA 4ZUVB 4QLRA 3VXPB 3T0EA 4JM2F 2BY3A 3V5HB 1IKFH 5E70A 4JN1H 5F1NA 5IOPA 3TNNA 1RZ7H 2C3GA 3QO0A 1X5AA 4G5ZH 2A77H 3DX8A 3HRZA 4PRDB 3BN3B 2Z31C 2X7LA 3QUYB 4GW5B 5IROC 4J3UA 4XNQB 4I4WA 1U8OA 3MUY1 3RWHB 1N64H 3EFDH 4GBXD 4O2FB 4QXWA 4PJEF 1NMBL 4PJDF 2IGFL 3OXSB 2AV1A 1MRDL 4MAUH 4TUKH 1GJIA 2X44D 5JW4M 1B0GA 3CFKA 2FX9L 4F9PA 5GRVK 2GW5A 4NKIH 1HE7A 1RIUL 4M6OH 5IHLB 5B39A 3KLHC 1AE6H 4LQFH 2DS4A 1JZ8A 1V3JA 4L4JA 2KQMA 5JOPE 4XX1G 5E08L 1QLRA 3TWCH 5KZCB 2UVFA 3LS5H 2EYSA 2CO6B 4ODXB 1T5WB 1J0YA 3K1DA 1N2RA 4KRLB 4BJLA 4R0LC 1K6QL 1T2QL 4UINH 5FYJU 2NY2B 5BXFA 3EHBC 3O41A 2QQKL 4XCYA 2J1KA 1H3WM 3IU4H 4DVRH 3OZ9L 1MEXL 5D7JD 2VISB 4NKDA 3D18B 4ZSOB 4ODTH 5KW9L 2JLLA 5DEFB 4UI2A 1FLRH 5DMKA 2I60H 4YGVB 3LB6D 4WFHD 4AIOA 5DUPL 3T0DA 3WUWA 1I3RA 5D2NE 3V4UH 1SMOA 3QXAA 3BVNA 1BOYA 4ENEC 5IIEA 2YXFA 3UXFA 3OAYH 3D9AL 4JDVA 4P2RA 4XHJC 4RCAA 5E94A 1VPOL 3RDTA 4EDXB 1H8NA 5C0AB 5ID0A 1HN1A 3R06A 5INCB 3VE0A 1K8IB 2F74A 4K8RC 4U1GB 4KU1A 1OGAB 2YUXA 4U1JB 3VWJC 1M7DB 1TNMA 1CGSL 3T08A 4DGVL 1Z9OA 2FBJL 2A6IB 3LN9A 1IGMH 2NX5E 5I18H 2YPLD 1AXIB 1Z9MA 3L3JA 3ULUC 2IG2L 1LNUB 5DD3L 4KI5E 2GTWA 3H9SB 3MLSL 3P0YL 3IB4A 1ZA3A 2R39A 4KJQC 4OCRL 4WY7L 4NQEB 3CNKA 4JVWA 4DJMA 3NCEB 1FGVL 3C5ZD 3IFPB 5KSAD 3KPOB 5C0BD 3VRJB 3PWNB 4LVOB 1QBML 2NY0C 3RX5A 1E6OL 5IFJB 1FG9C 5K9KB 3O81A 3BN9C 4ZO7A 4AK1A 1T03H 4J7RA 4R7DB 4HLZG 1OAZL 2XFXB 5HGAB 5J3HD 1DP0A 1P7QD 1VGEL 4DCQA 3JSSA 1MCDA 4QF1B 2OZ4A 1YEHL 2Y06L 1CT8A 3VGHA 4K3JH 3NFPB 4OLXH 3SE3A 1H3GA 3QUMB 4LF3A 1T1ZA 1GL4B 3GSWB 5D70L 4X80L 4EDWH 5I8OL 5DWUH 1QFPA 5I9QB 5GRWA 2VL4A 1WTLA 3NCJH 3KJ4B 2DIBA 4YXLH 2W92A 2XTJC 5B38G 4J6RH 1I1CA 4Z18A 4X7CC 2CDGA 4BZ1H 3C6SA 1KYOJ 1R5VB 3BWAA 5HI5D 5EC1B 4OI8A 4FTVD 1H3UA 5EOQL 4UIKH 3QI9C 3MA9L 3BMVA 4D9RD 2RB8A 4P46B 3RAJH 3SKNA 3CMOH 1IM9D 2ED7A 1P4IH 5I19H 3QCTH 5CJQL 1NJ9A 2D03H 1H15A 5ID1B 1F2QA 3QCUL 4WNQA 2XG5A 2VDRL 5DT1H 4EIGB 3FZUD 2ZJSL 1CE6B 3EGSB 1WVZA 4GRMA 4QHLA 4R4FL 1S7XA 5BVPL 5IGXH 5MHSD 4FABL 5LVEA 1MRCH 4LCYA 4NZUH 5EU6B 3RL2B 2EDXA 2P48B 2EEAA 4MXQD 3DVGA 4WFEE 2EXWC 4XBPA 4KROC 4I3RL 1DL7L 4R96A 5EG6C 3ZE1F 3QUXC 1ZLWH 5IM7A 1WEJL 5EBMA 4UQ3A 3UYRL 5GJSL 4D9LL 4NSKB 4P4KC 2VXQL 2MQCA 3M45A 3BYTA 5EUOB 5D5MA 2BVEA 3Q3GB 1MCWW 5I1JH 4RAVB 1CI5A 3VFPA 1QLEL 3O2DA 3ULVH 3LQZA 4LCWB 5E5UB 1NDMA 3IGAB 4ODHH 1IAIH 3VFMB 3VXUE 4GMSL 4LAJH 4U7MA 1HXYA 1A14H 4NM4H 3LKOA 4MQ7A 3E6HB 1FIGH 3AUVA 4FZ8H 4N0CD 1UWEL 4Y2DA 1WWBX 2O5YL 2F19H 5LCVL 3ARED 2WQ8A 2YC1A 3P77A 5C9JB 4D2NA 1WLHA 1NFDF 3DV4B 1QLFB 4Y5YC 2XZAL 3O6LL 3PHOA 4DZBB 2R9HC 1Q9WA 2J8UE 5KS9F 3MBEB 3QDGA 3T0AA 1QBLH 4KKAC 1BFVL 4JG1H 3OAUH 1YY9D 4M03A 1I8LC 5L6YL 4G8EB 3FB8B 1JIBA 3FO1A 4OQTL 3QUXA 4MAYC 3WIHL 3GI8L 4XGZA 4XVTL 1YYML 4JM4L 1XGUA 4HIJB 1CD1B 1T0MA 4DFIA 2K9UA 1MCKA 1YN7A 1CDBA 1WIPA 2OR7A 4P4KA 3C8DA 2XACC 3MOAL 3MXVL 3WSQH 2APXA 4PGZA 1CBVH 1FN4B 4Y0GA 2DIAA 5AWNL 4OV5A 5LGHH 1NAKH 4PRIA 4G9DA 1AQDA 5F7HA 1CIUA 4LEOB 5JOPD 1G9ML 2AI0H 4ZSOE 4ZAKC 1T7WA 32C2B 3W9DA 5HHQA 1P69B 3SBWC 3AXLA 2BHUA 5L7XH 4Y8DC 5D9SA 4XP1H 1T6WA 3KWWB 4EQ3A 2C9AA 4HWEL 3TGXA 5SX4H 4LLQB 3VGGA 3BPOC 3HMXA 4HLZH 4HZLA 1OTSD 3REVB 1FL5B 1F6LL 1IC5L 3GMOB 1R3LA 2WWKT 1CLYH 1UM4H 1OARL 4RMQA 2NYYD 5F21B 1XGTB 3SKMB 3WN5B 2WP3O 4U1LA 5DQ9B 5D8JH 5F9WC 4X7DC 2PETA 4MA7H 1R5WA 4HX1B 3QPQD 4YLQT 3P4MA 4CMHB 3MCKA 3NA9H 4P2YA 2EIEA 4XXDA 4Z7OE 5EO9B 5DMYA 1X5ZA 4WVRA 1Z0MA 1S9VB 1MFEL 3BIKB 1MSPA 1DN2A 3QQ4B 1AD9B 4RGMC 3PG2A 4Q9CA 1AQKH 1OSPH 3UBXB 4HUVA 4NC1E 1P7KB 3LSOA 1QSEA 3QJFB 3VFWB 1G7LB 1VSCA 5LJYH 4OF3A 3RGVA 1TZIB 3CFBA 3VFRB 4IMKA 3H9SE 3T65B 4EXKA 2X1WL 4FQXA 4ZAKA 3P4OB 4JAMA 1MFCH 4TSAH 1D5MA 5GRYA 2BHYA 5E03A 3SBWA 3SCMD 2NX5D 5DFVC 4GKOA 2W0PA 2FBOJ 2HLAA 1I3GH 5HDQL 3L3DB 1IEBB 4IRJD 1FV1A 1T1WA 4J4PA 4HXAL 3P11H 1UACL 3K4DA 2FH8A 3I3DA 1MHEB 3FT4B 1HH9A 1KOAA 2YEZA 3TF7C 1S9YB 2O5XL 4HIEB 2DMCA 1MFAH 4FQLL 5KJRL 5EO1A 5GS1B 4PRBB 3BT2L 4X7FC 2L0DA 4YAQB 2KL6A 4Z7WE 3L3HB 2Z93A 4YH6A 5IB2B 5GGRA 4JCMA 4J8RA 3ARFC 1M71A 1XF1A 3FOLB 1KACB 1F42A 5C09B 2FHCA 2XQYK 4RWYL 1EEZA 4KI5F 1JV5A 1S7WB 1SYVA 3HMWH 3WV0A 1OAYL 4O9HH 1CFTB 3MUHL 4EN3D 4NO3A 3REWB 5C0DA 2M8XA 4JJHA 1NL0H 5HYSB 3QG6A 2D7TH 5SWZA 5GZNC 1HI6B 3KPTA 1UADC 4F8QA 1W0YT 5HYJB 1IGJB 3C09C 4AM0A 2XKUA 3S5LA 5JMRA 2NPLX 1ADQL 3O3EB 1OCWH 3W9EA 3VXRB 3EHBD 4PTTB 4X4YA 5J1AB 2C4FU 4YNYA 4FQ2L 4NO0B 1U91B 1F45A 1YNTB 4OT1L 3GB7A 4B53A 4K71B 2IC2A 2WIIB 2QR0B 1FZKA 2Q76B 4QRSB 1FPTL 2X1QA 1MVFA 4LSRL 4RNRB 2FATH 5E7FA 2QADB 1WT5A 1TJIL 2NY1C 4ODVL 1BGXH 1YMMD 4KJYB 1K2DB 1FFRA 4ZD3L 2ARWA 4K94C 4KVNH 3EYSH 4HUUA 1HHJA 3UZEA 4X8JA 1YC8A 5C92A 3OJDB 3ROLB 4BSVA 4JG0H 2BX5A 3QQ3B 5DD5L 5EU6E 4HFUL 4NO2B 1IE5A 1JWUB 1CU4H 4PRPE 5E8EB 3VWJD 4MLIA 4YXHL 3L3KA 1CLCA 1BFOA 5E2UL 4JZNB 4UIMB 4E5XA 2R8SL 3EOTH 4LSTH 3TBVB 1UM5H 5JA8B 3UYOD 1YY8A 2CSPA 3D0VB 4CN1A 4M8QB 4X0KA 5EUOE 1CWVA 5IMLB 2LAAA 3HR5B 1IBGL 2EICA 4LCWE 4WI7A 1DFBL 3VW3H 1M6OB 1WFUA 3O4LE 3DURA 4RMTA 1VGKA 5F1SA 2NXZD 3AB0C 4KJQD 1RZ8A 1BECA 3TPUA 4FXKA 4N0FA 3B6SA 4N8VA 3W5MA 5E00A 4WUUB 1GH7A 4G8IA 3U0TB 4AJ0A 3QPXH 3I02A 1BQUA 4GT7A 2VSCA 5F7EH 3VXUD 2EDKA 1YMHB 4X6BA 2V7HA 5GGVH 4ZYKB 3BZFA 3QO1B 1CFQB 3IDJA 2QSVA 3RUGA 4RBPK 2UZYB 5HHMB 3EJJX 3WDIA 4RGNC 3QIUC 1TQCB 5GRUH 1KCVH 5I17B 4CVZA 1I7TA 2B4CL 3OB0H 4JZJA 4PP1D 5IT2L 4HUXB 5ELIA 1D5XB 5E6ZA 4I0PA 3AU1B 4X7SL 4L3EE 1TQBC 3C6LD 4PRHE 3W81A 3P0VL 1G9MC 3DROA 4GAYA 4XZUA 4PJAB 1VFBA 2VLJD 1GZPA 1RIVH 3QUYD 3ZDYE 5MEQA 5I1AB 2FO4B 1U2CA 3T77B 2W0FB 2CO7B 1XF5B 4RAHA 1Q9KB 4JM2C 1ZANH 2N7AA 2AEQH 4X6EB 3WLBB 1N6QL 1KB5H 1HKLL 3T0VA 1RUMH 3GBNH 2BERA 2VDLL 1KJVB 1HOCB 4G8FA 2IAMA 1D3CA 5DJXA 2XTJD 3VJ6A 2ZSVA 4QT5B 4LRNH 4ODWB 3V7AE 5MENB 2J8UF 5CBEA 4P9MH 4CGTA 4NP4L 4QRRB 2EDQA 1XGQB 3ZL4H 5KZCD 4N9GB 4U1IB 5CUSL 4OQTA 1Q72L 3WIHA 1ACZA 4WI6A 4GJTB 4Y5XB 3LRHA 4LFHG 2XWJA 3TEUA 4G3YL 2NY2D 3GSNH 3BP6A 2HT2D 4NOFA 5CGMA 5IG7A 2HN7A 1C08A 1HZHH 2DBLH 1L7TH 4JDZB 1X5GA 4PJ8A 1RFDL 2NY4B 4NM8H 1E4KA 1J8HA 5FKPB 5D2LA 1KUMA 1NMCC 8FABA 1KIQB 2IH3B 3AM8A 4Y19D 4WTZA 5I1KL 1IAMA 4JY6A 2XN9E 1TXKA 3D85A 4NC0B 5ANMA 4DOHE 3SDDB 5TDPB 4XAKE 1MQKL 4RFEA 3MFFA 1JF1A 1NC2A 3SGJC 4R2GB 1BP3B 3V6OA 4N8PA 4I13B 1I9IH 3U9PH 1FG2A 5HHPB 3KPNB 5IBLD 1MJ8L 4G43A 2EC9U 2JIXD 4JM2A 3SGDI 5FGBC 4EI5B 1ZT7A 4OGAD 4HMDA 4MJ2A 5I30H 4P57B 4UDTB 5C0AD 4HIXH 4MJIA 3PDDA 1JNLH 4ELME 4Z0BH 1AC0A 1QOKA 4LCCC 1OGAD 1QRND 4X83A 5DJ0A 1QEWB 1HCFX 2NQCA 1RUAL 2GT9B 1UH2A 4DGIL 4JB9L 3LQMA 5ESQA 2D9QB 3B3IA 3BEVB 4WGVB 4PJEA 4PJDA 3B2VH 3OKLB 1JYNA 3DYPA 4NQCB 2CLZA 2ARJB 4Z7VA 2DWDB 3TO2A 1IAIM 2C5DC 1YC7A 4FA8A 3EO1B 1PSKL 5GGVY 3WXWH 1G7QB 3CSGA 3DRTA 4O2EA 4Z7OF 3L9RA 4NQED 2R9HD 1U58B 1TJGH 3H9ZA 4A6YB 1H9VA 5D1XC 4NNYB 2H1PL 2ADIB 2CKNA 2JE8A 4GBXA 5HPMA 1A7QL 4WU5A 1RULH 3X3FH 3QCVL 2VDML 5I0ZA 3PIQA 5MEPB 1YNLL 3SJVB 1OQXA 2CK0H 2XRAL 1BF8A 1JNHA 4PREB 2B0SH 4RFNB 1Q94A 4H25A 3BPNB 4MAYD 1C12A 2V7NA 4GG8B 5JORA 3LKRB 3WO4B 3PWUB 4HQQL 4NJ9L 2BHZA 1Q9OB 3BFOA 3EJYC 3FQNB 2QSCH 4GS7C 4W4NA 5JOFA 4PGBA 1IQDB 3TBTA 1MWAA 3QEHA 3ZSSA 2JJTA 1BVZA 1IAKA 4OIIH 5HYJE 4S1SH 3RZCB 3WFDL 2NNAB 1IILE 2OMBA 5TGBB 5K9QI 1I1AB 1H3VA 3VXRE 2MHAB 3IDUA 1SY6H 4QRQB 1W2KT 3ZKXB 2EDOA 1LWRA 1T04A 5SV4A 5CIPH 4PV9A 4Z7WF 2Q3ZA 4R9HA 3H9HB 1UWXH 2DJUA 5AZEL 3OGCA 3ULSB 1AGEA 3HE7C 3ILQD 3SE9L 4HWBH 1FL3B 3KVQA 3UTQA 4CNIB 2DKMA 2WBJD 4R8WH 5D1XA 1DQLL 1HWHB 3UTPD 5KBNC 2FSEB 5LXGL 3MNVA 5KANG 4LCIL 5L9DL 1HHGA 1KPVA 5GRJH 2DWEA 2YD2A 4X7TA 5C0NC 3HCVB 3TH3T 3MRGA 4KAQL 4YPGB 4MJ6B 3E0GA 4P46D 4UU9B 3T8XB 3OR6B 1A6ZB 4OF5A 1BAFH 4JPIB 2LU7A 2XZCL 2R23A 3TN0C 5I8CB 2Z8RA 4I77H 2H8PB 1IM3A 2D0FA 4WHYG 4ZMAT 2R1WA 5T3XE 1DANU 5JR1H 4WI2A 2DOCA 1U8HB 2RCSL 3QA3B 4KRPC 4Y4HC 5D1QC 1MVUA 2O5ZH 5FO7B 4AH2A 3BO8A 3JWOC 3EYQC 5EU6D 2OSLB 3HB3C 2D4DA 4KPHH 5HJ3A 1MCCA 1YEFL 5C0JA 3CCHB 1BZ7A 1TMCB 4Z5RA 1EBAA 2B4CC 4NN7C 3NFSH 2WUBH 3NABL 4S11A 3C5ZA 4OBRA 4UQ2A 4G6JL 5KSAA 4ODUA 5C0BA 3HE7A 3PQYB 2AJ3B 2N1KA 2BSTB 3PNWA 1MAML 3I3BA 4WUUE 4WW2A 5C6TL 1JMXA 4FQHB 4I8DA 4WGWB 3L5XL 5MP6H 4NQXA 1WC7B 2DMBA 1JWMB 2Y36L 1P84K 3HG1D 2EZ0D 4ZXBC 3S37L 5BQ7A 1NBZA 5FCUH 1OVZA 1XEDA 1G7MB 3X3GH 2PW2A 2HKHL 2C1OB 1KFAH 3EJZC 4U1NA 4KHTH 2VAJA 3UAJC 1E6JL 4DTGL 5KVEH 1C5DB 1DSFL 1A4JB 1NGWB 1ZHBB 4B50A 4Y4FB 2SEBB 5EUKB 1NKOA 3GGWA 2W60A 3ARFD 3H3PL 4Z6AT 4J1UB 3MODL 1A1MA 1WZLA 4QWWC 5JHDD 5F44A 5DA4A 1U6AH 5TQ0H 4FS0A 3TZVA 3MBED 1NGYA 4OLZH 6FABL 2PCPA 2ZUVA 2HFFB 1A0QL 3CVIL 4Y4HA 5D1QA 3SE8L 1JPSH 3C60D 2ILLA 1U95B 3ILPB 2DM3A 2VH5H 3BKCH 3PWVA 2JJVA 2I9TA 5KG9A 5L2JA 2J8HA 1KPRB 3JTTB 4N5EC 5MI0C 1KENH 3SGKC 2FX8L 4F7EA 5BV7L 3BD5A 4QHNB 1CGUA 1RIHH 4M7KH 2HFGL 1NMAH 3DO7B 1ETZB 5ESVA 4XC3L 4HBCL 3ZKND 3WS3B 4F7PA 1UM6H 3G5YA 1EUUA 1H3PH 2BOCA 4OTXL 3LN5B 2BY2A 5FK9B 1OLLA 4M7LH 3S4SG 1BIIB 2PW1A 4P5KB 2Q20A 3LKPB 3P30H 3MV01 3HPJA 1MI5E 4ODSL 3RNQA 1EJOH 4QHUA 5CHNB 1N3NB 3HAEH 2NW2B 2F8VA 3DMMC 4HIHB 5GISL 5FYJH 4PR5B 3MYZA 1N59A 1V3LA 1ONQB 5BS0B 3VFNB 3ARDB 3SPVA 5J0BA 4U6YA 3H8NA 4P0DA 2R0ZH 4OCWL 5F6IB 2A6DA 2CRIA 3FRPG 3QDJA 2AK4A 2DBJA 1KCRH 5I66B 1YEKH 2XI9A 3MBXH 4LSPL 1MAKA 5DJCA 4GKSB 2D31B 1A1NA 2IQ9H 3CU1A 5GSRA 3KYMA 3MJ8B 2HYMA 2XKNA 3GSRA 1MUJA 3MLVH 4LLVA 1LEIB 4F33B 1SM3L 4LVNC 4RZCA 2W1NA 2FGWH 4ZFFA 4AQOA 4TVPE 4WJ5A 5KS9A 3OKEA 5F70A 5T1KB 4I5BA 1FZMA 2BJML 3OBAA 4Q58C 4HW6A 3STZB 3IXTA 4YBLB 5CGYD 5K9JH 4L9LC 4U7SA 1KF9B 5DYOA 5FV1L 5GPRA 1JGVH 4OSUH 4QCIA 1JPFB 3QSKB 5F7WC 5E2WL 5L0QB 4FXGA 4S1RL 1A1OA 3X14B 4KKBD 3KXFA 1D7FA 4XCFH 2FEEL 4W6XB 2QSTA 4V1DD 1BQHA 1JWSA 4HCRL 1WBXB 4YE4L 4F7CB 4L29B 2VXVH 2DQDH 3GHBH 4UAOB 2QQQA 1KXTB 4S0SD 1ORSB 3BH8B 2FRGP 3EDEA 1S5IL 4P3DA 3RWJA 3MZTA 3MLTA 3OKDA 2V9QA 4ELMF 3SJVE 2I07B 5FO8B 3WNOA 4TN9A 3RWGA 4QRPB 3L5HA 3VFVB 4WHYH 3MACL 2DQUL 5ICXB 1PEZA 1QNZH 2VYRE 2ZSWB 1OT1A 2CXGA 1YEGL 5KTEH 2GJZA 2LE9A 2ADFH 4YIQB 4X5WA 1AI1H 5KSBB 5C09D 3ZZ1A 3UJJH 2QV2A 5CMAB 4XNUH 4HV8B 2B5IC 3ZKQD 5EWIL 4L9LA 1PLGL 4K7PL 1CDHA 1OTTD 1XR8B 4RAUB 3V5KB 4LPUA 1CTOA 4WO4C 5EOCH 3M8OH 3QAZC 2E9BA 2HLFD 4PLOB 2GCYB 3ME0A 3V6BR 2A38A 3HE6D 3HZKB 3LD8C 4D0BA 4GMTH 2AW2A 4LLAA 1S9WB 3G5XA 2R4RL 1R3HB 1FCCA 5ADOH 4JRYD 1LEGA 2DLFH 3OR7B 4KI5C 1S7QA 4YX2L 1ND0A 3G9AB 4MA8L 3C5JA 4FFYH 4NO0D 3CFEA 3CLEL 1QBAA 3S8WA 3MROA 4G6ML 1JPGB 1MELA 4UT6L 3U7WL 1HDMA 2EDWA 3G08A 1L9NA 1MNUL 5D2NA 2DLTA 4Z7UF 1KTDA 3BP7A 2X1OA 5CEYB 4JFZL 5JIHA 2Z92B 4DUVA 4JFXB 5EZLB 2QBWA 5DJZB 1FFOB 1FHGA 3JV0A 2QADD 3PGDB 4Y7MA 2CLRA 1GRWA 4JO3H 4NWTL 3RA7L 2BNRD 4UNVA 3U48A 1ZLSL 1NEZG 4UMGA 3P9MA 4AEHL 4LIQE 3U1SL 4XWGL 4PJHB 4JFHE 2OBGA 1CDUA 2JCCB 3WYRA 5A40E 3O6FA 4CDHA 5C71A 4EBQL 2VDKL 2ZG1A 1I7ZB 4WO4A 2CDEA 3R1GH 2R2HA 2ZCKL 1CLZH 3SCMA 2NX5A 2P5WB 5DUBA 1UXWB 5EC2B 2P8PB 1FQ9C 3AAZB 2AJSH 2APFA 3D3VD 2HH0L 1SQ2N 3MRLB 4IRJA 4YHKL 3OAZK 4JZOA 3ZDZE 2F53D 3CH1A 2R2EB 2CIIB 5FKAB 1WBZA 3OL2A 3VCLA 2DQTH 4WTXA 3O2VL 2KBGA 2X09A 3A67L 4YK4C 1I7RB 1BZQK 4PJIF 1QA9A 3V0AC 2HTKC 4QEGA 3K8LA 3GSNB 3QUML 3U4BH 2D9CA 4JREC 5BVJA 2VZOA 1ZE3C 4APQC 3MGAA 5EU5B 2A6JA 3F7RA 1S7UA 2DTML 1A7OL 2BVOB 1CGTA 1JCKA 4AIXA 3UTSD 3S88L 1D6EA 5HHMD 5DGQA 5FYKE 4MD0B 1B9ZA 1X5KA 3B5GA 2DD8L 4BQBA 4LKCB 4EN3A 1OP3K 2HAZA 1MCBA 1BJMA 4FQIH 4M6AA 3MJ9L 2W65A 3B8SA 5IVOA 1OPGL 1X6NA 3HS0B 5TE7H 4IMLB 1FFPB 2WBKA 3HC3H 2BRRH 2EH8L 5C0FB 2ZZUT 1IEAA 4W6WB 1UVQA 3S36L 2V2WA 3ESVF 1JNJA 4L8BA 2ZNXA 5IR1A 5HDOA 4M1CD 5F3BB 4JHAH 1DVFB 4R3SA 1Y18B 3VFOA 4RIRA 1EFQA 2EDRA 4N8CH 5J6GA 5LGJA 2C3WA 3O3BB 1AO7B 4G6AC 3TBYA 3F7VB 1ZT1A 1Z6JT 3DVNB 1QSFB 4LK4A 4X99A 5DUMH 1YMMA 5B8CC 5F7DB 5MEND 2X2YA 3TJHC 3IAGC 1F2XK 3HFMH 5J11C 3WEXB 1RZKL 4QRRD 4HS8L 5J13B 1K4DA 2D7PA 1MCPH 5CEZE 4M61A 4O4YH 5ISZB 1AGDB 1DBKH 1KN2H 4OCYL 4QXUH 1LE5A 3T2QA 5BS0E 1DBMH 1J7VR 1A7RL 4XNYL 2C7UB 2G75A 4RMRA 5E6YA 3CXDL 1ZT4A 4JFEB 3L5WA 5E99H 4PB0H 5F9OL 1NCAL 2XNAA 4NN5B 3VH8B 3RPKA 3UTTB 3QULB 3GNMH 4LQ1A 2NY4D 2ZUQB 4HS6B 5ALCL 4NYLA 3STLB 3GK8L 1JHLL 3QUKA 1QFUH 1G6VK 1K5NA 1NBVH 3KG5A 4F80A 2LTQB 3SDDD 2YPVL 4P59L 2V5SA 2ZG2A 3GKWL 2NW3A 2FR4B 1INEL 3MRBB 3P9WB 3ZHKA 2X4TA 4OM1H 1TIUA 1H8OA 4JPWL 2ADJB 5FDYA 2IBZX 4X6FB 4PG2A 3PWPB 43C9A 5DJAA 1RVFH 3BHBB 4GG6A 1D9KC 3FQTA 2QEJA 3IDMA 3D39B 2HRPH 3VXUA 4B7LA 1BQLL 5JUEH 1J87A 3VU2A 3O8XB 4L9DA 3PHSA 4FMKA 4U1KA 1FFNA 3T09A 3WFCH 5FIEA 3RVTD 1DQMH 5DD6A 5IESH 3CJJA 2N7BA 3GJFH 2VXSH 3BXNA 1MIEL 35C8H 1GOFA 3GRWL 4PJXB 4ZUVA 3CZJA 3VXPA 4CU7A 4NQCD 3V5HA 3WE6B 1KJ2H 4KC3B 5TH2B 1QD0A 2CUHA 3ZTJH 1T80A 2J8UA 2X4QB 1WF5A 4C59B 4PRDA 1WUNT 5JIPA 4ZFZA 4BQ8A 3FMGL 1ZEAL 3QUYA 4GW5A 3QJHB 5I1HH 5GRZA 2CKBH 3RWHA 5T1DH 4HMEA 4O2FA 4XMKH 1ACYH 1S9XB 1T7ZA 1C16B 3OXSA 3DVIA 5EIVA 2DICA 4YHOL 4HCRA 4U3CA 2VDPH 2D0GA 3DHJA 3RY6C 2ZCLL 4HC1H 5CJ5A 1QR4A 5FF6B 2X41A 1ZK9A 4U1GC 4NZTL 4I0CC 3IDIB 2MCG1 3QHTC 4FP8H 4QYOB 1JHTB 4WDIA 1DQDH 2XPGA 2NY5H 1ROWA 4KGLA 3LMJH 4ODXA 1T5WA 1BWWA 3FCTB 1OAXL 3H42L 1SEQH 4NC1C 4K9EC 5T3ZH 1V7MH 4LSQL 2AJZB 1U3HD 1T7XA 2VISA 1I1AD 4ORZC 3L1OH 3TVMB 4F9LC 3G6JE 4ZSOA 3UJTH 2ESVE 4NHCL 1VFAB 5DEFA 4YGVA 5GGTL 4P23C 3BGMB 2DLEA 1PKQE 2D4FA 4AZ8A 3ULVD 1T7YA 3JV4B 5FGSA 4LVOC 3G04B 5F7FA 1W8OA 3FQWB 5IQ7H 2IPKB 5HI4C 3FB6A 4KQ3L 4U1HB 1LO2L 5IFHH 1IARB 1I8KB 3BEWB 2GFBA 5ITFA 4I3SL 4F58L 3QXUA 4LP4A 4EDXA 5C0AA 2OJZH 3OJVC 4LLWB 3RWCB 2VC2L 3MLRH 1MREL 5DA0B 4ISVB 5INCA 1K8IA 5JLZB 3KPLB 4U33A 3RL1B 2VO5A 4Q2ZB 2JCCE 2YA1A 4U1JA 1M7DA 4LOUD 5IK3B 1QYGH 1PX3A 4X6CE 4XNXL 1FNAA 4JGMA 4XP5H 2A6IA 3ESUF 1RUPL 2P5WE 4HKJB 1NGXB 5TJWK 5I9QC 1X6LA 3RWIB 5ICZB 1UZ6E 4PJ5E 5JPNB 2V5TA 1LNUA 3LN4B 1P1ZB 4XXCC 2WUCL 1OTUC 3H9SA 4F9LA 2J6EL 3VFGH 3ZKMD 4JPKL 1HHIB 4AIZB 5JQ6L 1XMWA 4OD3H 1KIRB 1YUHB 3IFPA 5C2UB 3LPFA 3KPOA 4M5ZL 2DQHL 4X8XA 3VRJA 3PQYD 5IEKB 5JXEC 2YD4A 1P6AB 1XF2B 4JKPH 3ARGC 3S97C 4GKNB 3DGCR 5IFJA 3R4DA 4KTEL 5K9KA 4FQPA 2CMRH 1WWWX 4JVUA 5E6IC 4R7DA 3BW9B 2XFXA 1LO3L 5HGAA 3HAEB 1BQSA 5GS2H 5GIRB 1OW0A 2MMXA 1GGIH 3Q1SL 4JQIL 1ZGLM 3UPRB 4OUUB 2A9MH 4XCCL 2R0WH 4QF1A 3U7YH 2FB4L 2XOTA 2AAVA 1XF4B 3P2TA 4JFDB 3F7YB 1RZIB 3NFPA 3LHPH 3W11D 2QL1A 1YPZB 1EX0A 3QUMA 3GSWA 3EUUA 3QEQB 1NAMH 2DQIH 2HT4C 2IH1B 4YDVB 1TZGH 4WWKC 4XXCA 2QJDA 5F1OB 1A6AB 2G2RB 5F88A 3EO9H 1IKFL 4XT1C 4HDIB 1AO7E 4OV6F 1EAJA 5T33H 1QSFE 1PY4A 2X89A 3WDHA 4U3HA 1R5VA 3ZDXE 3TFKC 4U6XB 4F7MB 4G5ZL 5DK3A 5EC1A 5IP4A 3ROOB 4NQSB 5JXEA 3UJIH 2AJUH 1C1EH 4JO2H 5I1LB 5FO9B 2MKLC 1N64L 3EFDL 3N1PC 4P46A 2ZUXA 4TUKL 1T5XB 3L5IA 1JZ4A 5LGKA 5F1IB 2PYEB 4NKIL 5ID1A 1HQ4B 4PJCB 1ZGLB 3S96B 1AE6L 4LQFL 5D1ZC 5HDBE 3KPRE 1A3RH 3FOMB 1CE6A 2EEBA 3EGSA 4HGKC 3HNSH 4OBSA 4W70A 3TBSB 3EDKA 3LS5L 4TOYH 2AKRB 1UEYA 4TVSa 4XVSH 5C08B 4C4KO 3M07A 4FQ1H 3ARDD 3GMPB 3WJLC 1JUFB 4OI9A 5EU6A 3RL2A 4UINL 2Q8AH 1TCRB 2DQCL 4OFKA 1X9QA 4PRPA 4ETQB 4OD2B 1SYSB 4DVRL 4NZJA 4LPXA 1B88A 4WWKA 3NIGE 1PQZB 2MWCA 1A5FH 4ODTL 4OZFB 3BPLB 2FZ3A 1EO5A 4ONHB 5DMGC 3N9GH 3PWPE 1L0QA 5EH1A 4NSKA 1UFUA 4KK9D 4KDWA 2GITB 5EUOA 4HULB 5FOJA 3Q3GA 3SDAB 4RAVA 4P2OB 43CAB 4LLDB 4NGHH 2YRLA 4FFVC 4I9WD 4LCWA 3V4UL 3VFMA 3IGAA 4BA8A 4HZAA 2DRUA 2VNCA 5E9DE 2DI8A 3E6HA 4XI5C 1WFOA 2FL5B 5F7LB 1NH6A 2AK1H 4PJXE 4H1LG 1FSKB 3LEVL 4N90E 3VWKC 4UT9L 4ELKB 1QLFA 4HEME 2OLDA 2H2SC 4DZBA 1MHHB 5CJ8A 3MBEA 4CVWA 5E95B 3ZTNH 2EO9A 2OR9L 5C0RH 1F97A 3WUZA 4NKMB 1NCWL 4ZS6D 1BVLA 1IGML 3IJHB 1RMFL 1XH3B 4L3EA 3FKUS 2EO1A 4G8EA 3FB8A 4JR9H 2BY1A 4ZOBA 1F13A 2ZCHH 4QRPD 5FYLH 4HIJA 1CD1A 5CSZB 2RHEA 1S9KC 5CS7A 2BSRB 4WV1B 4WI3A 3SQBA 4Y1AD 1WQVT 1FN4A 2X70B 3T4YB 2I5YL 4LHUB 5K9OB 4IRSC 5F3HB 1T03L 3RKPA 4NZDA 3QQ9D 4KWUA 1RK1B 1J1OL 3QRGL 3TJHD 32C2A 4OLVH 1CD9B 4TNVK 3KWWA 4AY0A 1UWGL 4JVPA 4OFVA 1HKFA 4XPFH 3IS0X 4LLQA 3TCLB 1ED3B 1OB1B 4LCUB 4OLXL 3REVA 1FL5A 4NQDE 4GAJL 4QXTA 3GMOA 3F62A 2FH6A 1KTLB 4G6KL 3Q6FB 2DL9A 4EDWL 4OLEA 1XGTA 2F54D 2XN9A 5DWUL 5GS1C 3SKMA 3WN5A 1F11B 4X6DB 3MREB 5DJDB 1J88A 4KXZH 5DQ9A 2OS7A 4P49A 3NCJL 1R3KB 2MQ3A 3F65A 2DIJA 4IOFD 2VXTL 4MB5A 3EW3B 4HX1A 3TBWB 5GGTA 1VKXB 4HS3B 1PW3A 1ZHLB 1MHCB 4N1EA 1J0HA 4J6RL 4WHDA 4L8SC 5EO9A 1QO3B 3B5TA 4BZ1L 3RTQC 1WV7T 3IFOB 5I1IL 1S9VA 3AS0A 3G6JF 2CH8A 4NBXB 5CZVH 5JOEA 3BIKA 1XFPA 2VAAB 3QQ4A 1AD9A 4KJPC 4O5LL 3OPZL 1NCDL 3CX5J 3B9DA 3UBXA 3HI1B 1P7KA 4UIKL 3W5NA 3QJFA 4ELMA 1G7LA 4WHCA 2P1YA 5TF1L 3V5DA 5JPMB 3RAJL 3CMOL 2E7LC 1TZIA 1P4IL 4PB9H 3VFRA 2DJSA 3T65A 1N5YH 3QCTL 2H2PC 3P4OA 4IOSD 4D94A 2P49B 2LVCA 4GRLB 4O00A 1EHLH 1DANT 5HVWA 2Y9RT 5DT1L 1G0YR 3F5WB 3QFJD 5T5FH 3L3DA 1GIGH 1JL8A 1IEBA 3LQAH 6CGTA 2O93L 2X4PB 3VG0H 1MHEA 3BGAA 1NUDA 1MRCL 3FT4A 2PTTB 1FDLH 1S9YA 4HIEA 4RFOH 3OV6A 3IJSB 1PVHA 5GS1A 4X6CF 1VESA 3VXMD 4MCZA 4PS4H 5ENWB 5ACMA 3D2UA 3KYOB 1BIHA 4YAQA 4M5YH 2A1WL 3JBG7 4QO1A 2J6EA 3L3HA 2J88H 1A3LH 5IB2A 2C3VA 1U8JA 2KDGA 1KIPA 3FOLA 5ESAB 1CYGA 1HINH 1UZ6F 3K81A 1KJ3H 4JFDE 5I1JL 3BYYA 3ULVL 1YPZE 1IAIL 1CFTA 3D25B 4HEPG 4RGOH 5GZOD 3A6BL 1QFWI 5C7XH 2UWEB 2Q86A 1A14L 4NM4L 1MCEA 1FIGL 4FZ8L 3REWA 3QEQE 3U30C 3C08H 5HYSA 1V05A 3I6GB 4G8GB 1HI6A 1JYVA 3CVHH 4I2XB 2XA8H 1KLUA 5HYJA 1IGJA 3O3EA 2YHGA 3VXRA 4QOKB 2P4AB 3L5JA 4PTTA 1A6PA 3EYOB 4MMXC 4NO0A 1I9JH 2VLKB 1U91A 2YSSB 2BVQB 1DVFD 1QBLL 1YNTA 1BD2E 3H3BC 4H1LH 3OAUL 2WIIA 5HHNA 3MX0A 2QR0A 2Q76A 1A6WH 1BZ9B 4QRSA 3SKJH 1N5AB 3O11A 1TVBB 3VXSB 2WP3T 4RNRA 2VZTA 3MLUL 2ED8A 4JO4H 5B39G 1KPUB 2PYEE 4GAGL 3WO3B 4KJYA 3TT3L 1K2DA 4X4XB 25C8H 2HJFA 4XMLH 4IIQB 5I71B 1KJ2B 5DHYB 3MYJB 4XPBH 4ZUSB 5ISZD 5T1LB 3WSQL 4DKAA 1G6RH 1IC7L 3OJDA 3ROLA 1MY5A 3VD4A 4NCC2 5C08E 1CBVL 3DXAB 3QQ3A 3NIDE 2J5LC 4NO2A 5LGHL 1NAKL 1JWUA 4JFED 4L4TD 2CKBB 3PL6D 3S3PA 3W0WB 3UTTD 3ZDXF 3FQRB 4PRAB 1G7JB 4HFWB 4JZNA 1KCSH 2AI0L 4UIMA 3TP4A 3TBVA 2JB6A 3D0VA 3W2DL 3WUWG 4HPYH 1JPTH 4M8QA 3WDJA 5L7XL 5F7UA 4MGXA 5IMLA 3WD5H 4XP1L 5GXBB 3HR5A 5L2KD 2Y5TB 1M6OA 4NDMB 3DV6B 1XCQB 4L4VE 3HLAB 1Z2KA 3IKKA 5HHXH 5HDBF 4UTAH 4LAQL 1A6UH 5EULV 4WUUA 4TNVF 4QTIH 5IVXF 3U0TA 2V2TB 1I1YB 3D39D 4OLUL 1YMHA 1CG9B 5ETUB 4ZYKA 1FNGB 4MA7L 3QO1A 1CFQA 3N1GC 3KYKL 3PGFL 3GSUA 3DWTA 1RD6A 5E6ID 1UXSB 3N0PB 5E8PB 3B9KB 5I17A 1YEDA 3DRQB 3NIGF 4U6VH 3H0TB 5CCKH 2EDTA 4HUXA 5HYEA 1AQKL 1XIWB 5FM8A 5FV2A 1OSPL 3MV7B 5A16B 1BJ1H 3AU1A 2Z0BA 3NFNB 4M6NL 3VGFA 3MGTB 3B5HA 1GGBL 3INUH 2FEDC 4PJAA 2V2XB 4R2GC 4AEIH 1MFCL 4TSAL 3RWDB 5JW5B 5I1AA 4KK8D 2FO4A 3QHFH 4YBQC 2W0FA 1XF5A 5HSFA 3MXWL 1Q9KA 4OM0H 4PJXF 2DDQH 4X6EA 4Y89A 1I3GL 3QDMB 3WLBA 4F57H 5B4MD 5F7NC 1KJVA 1GXEA 1HOCA 3EZJB 5CEZL 4QT5A 1P53A 1BBDH 1M1SA 2F58H 4ODWA 4EKXA 4R4BA 1I85C 1G0DA 1MFAL 4CJ0A 4U1IA 3DLQR 3IU3B 4Y5XA 2EDBA 4NRZB 4KZEH 3JV5A 3TA3B 4DUXA 1IGTB 3JVGA 4FN0A 4JDZA 3NZHH 4HJGB 2A0LC 1BVKB 5HHOB 5FKPA 4K07A 4LFHD 4B41A 1KIQA 1H5BC 2IH3A 1VFUA 4YEEA 3Q6GH 4X6DE 3SDDA 2D7TL 5TDPA 1M7IB 2NY6C 1B0RB 5E7BA 4BFIB 1OCWL 2D2OA 5IQ9B 3KPNA 3O4OC 3QUZB 2YUVA 4XPGL 4EI5A 3ARPA 2HFEB 3K8MA 3MC0A 3GSQB 4M7JL 1XCTA 4MJ4A 4P57A 4UDTA 3OQ3B 3DUUB 2BNQD 2OQJB 2HJKB 3EYFB 5DMGD 4BH8B 4NZRH 2AGJH 4HK0B 2MQ0A 3GI9L 1QEWA 4C58B 1NAMB 1ZLVK 2GT9A 5L88H 1TENA 1BGXL 2AERT 5D71H 3MMEB 3BEVA 2GSGB 1IGCH 3T0BA 3KPPB 5F8RC 3OKLA 4NQCA 2CUIA 2ARJA 4KVNL 2DWDA 5IVZB 3EYSL 3VWKD 5K9QG 3EO1A 4H5SB 4JG0L 1G7QA 3L7FB 3RBGA 3IDXH 4G7VL 1EAPB 4H8WC 5LWYH 1CU4L 2H2SD 1BJ8A 3L6FB 1U58A 3KPSB 4A6YA 2WMPA 4NNYA 2AS5M 2ADIA 3IDGB 5IB5B 1QACA 3ZT5A 5HXMA 4WEMB 3EOTL 4R97B 1DE4A 1FH5H 2D3VA 3RVXC 1CFVH 1KEGH 5MEPA 3SDYH 1X5HA 3SJVA 3TYGH 3KPQB 4PREA 4JEGB 4OFYD 1N0XH 3VW3L 4G9FB 4GG8A 5FYJD 3LKRA 3PWUA 3EDJA 1Q9OA 3FQNA 1IQDA 2EKJA 5SX5K 1MFBH 2W0LA 5DEGB 4G8GE 2QKIB 1BM3H 4I2XE 4GXUM 2NZ9D 2VZSA 3QPXL 3RZCA 2NNAA 4R4ND 5F7EL 5TGBA 1CS6A 1I1AA 2F5BL 3CSYB 2MHAA 4Z0XB 4QOKE 1QFOA 3E8UH 1QQDB 4QRQA 2CQVA 3UCRA 3MLXL 1U8LB 2D7NA 2VLKE 4DWHA 3H9HA 1NQBA 1IMHC 3ULSA 4PY8J 1NPUA 2A83B 4Y4KD 4U3XA 1FL3A 1EO7A 1UCTA 1NANI 4CNIA 1DBAH 2MTPA 1YPZF 5CJOL 5J12C 4NPYB 2FSEA 4P5TD 2F15A 1RIVL 1U36A 4PJFE 1IZJA 3HCVA 2OCFD 1R3IH 4YJZL 4WCYL 2E7BA 3CXHK 3BX7C 5EBLB 4YPGA 4MJ6A 3WHXB 2YD8A 3T8XA 1A6ZA 4JPIA 2AEQL 2GUOB 3ARBB 4WI4A 3KLDA 1P5UA 5J6HB 2WWMD 3DXAE 4POZD 4Y4FC 1RUML 3GBNL 3WFBH 4GRWF 5I8CA 1FYHB 3QR2A 3V4VL 2H8PA 4LRNL 3W0WE 4MVBC 5IWLC 1NFKA 3S35X 4P9ML 4PG9B 4FQJL 2VWEC 1EZVY 1QTYT 4MNGB 1J0ZA 1F8TH 1U8HA 4Y16B 3QA3A 5FUCE 3ZL4L 5FO7A 2Z35B 2YUZA 3MV8B 3ZMRA 4PJBB 3G5ZA 5I15H 5FM5M 5E2JA 4I1NB 2OSLA 4JPVH 4AG4H 1NCBH 3EDDA 3GSNL 5C2BH 5C6PB 2CDFA 1HZHL 2DBLL 3CCHA 2E5EA 1L7TL 3SGDH 1MCJA 3FQUB 3ZE0E 3RKDD 4H26B 2Y6SC 4NM8L 4CUCA 1G9NC 3PQYA 4LNRB 2BSTA 2OZ4H 3IYLW 4K8RH 3B9AA 1CVRA 1LO0L 4CN6A 4MWFB 3SDAD 3QWRD 4FQHA 4J23A 2IAND 1WITA 1WC7A 1JWMA 2CJUL 3RHWK 3TT1L 4DK3A 3NIDF 1T3FB 3OJMB 1G7MA 2YA0A 3U9PL 1AC6A 4UOJA 2C1OA 2WAHA 5IHUH 3ULUH 4PYGA 1C5DA 4N9OB 3PXJA 1NGWA 1ZHBA 4WW1B 4Y4FA 2SEBA 1CL7L 5EUKA 4WEBH 1MF2L 3MV7E 1JNLL 2DAVA 4Z0BL 5SWZE 3DX7B 3SDCC 1AGCB 2HFFA 5ICYB 2EECA 1UH3A 2K7QA 1U95A 1ZTXH 3ILPA 2BMKB 2VIRB 5F96H 1LK3H 2FX7H 3B2VL 5JO5B 4ALAH 4NWUH 5HTSA 3WKMH 1KPRA 1BOGB 5IKCA 3JTTA 1JI2A 4KKNA 4P9HC 1DDHB 4QHNA 1NLDH 3WXWL 3SDXB 3DO7A 4MXWL 5DURB 5E8NB 2Y7QB 3DETD 4NUGH 3OKKB 4YBLC 2AEPH 3VFUB 3ET9F 1G84A 1RULL 4P2QD 5DJ6A 3LN5A 5FK9A 3UBXI 3H9YA 3LKPA 3WFEH 3I9GL 3CIQA 4E41B 1P4BH 4Q9RH 4Y2OA 5DC9B 5GHWL 3TYFB 2B0SL 4JHBA 5CHNA 3E2HB 3BQUB 1FYTD 5EFIB 2NW2A 1P2CB 4Z76B 4HIHA 4OAWB 4PR5A 1TLKA 2QSCL 2E6QA 3I85A 3BISA 1ONQA 4JANB 4UAOC 2FHFA 5BS0A 3VFNA 3ARDA 3VXTB 3O2DH 3RVVD 2YPLB 4ONGL 4OIIL 2AABH 4NN6B 4QGYA 4S1SL 1B0WA 1C8PA 4KY1L 2OXHA 3K2MC 5IHBA 5I66A 5JW4Q 4J3TA 4GKSA 2D31A 3THMH 2A6KA 3MJ8A 3HI6L 1LEIA 4F33A 3FN3A 2YOCA 2ZUTA 4UDUB 4GUPA 4EVNB 2VQUA 4HWBL 7FABH 1ZV5A 5T1KA 3U0WH 4LSVH 1AD0B 4JFPB 4LLMB 2B7DT 2VITB 1RAMA 5GGSB 3STZA 4R8WL 3IDYC 5SWQA 4GSDH 3O9WC 3TJEH 1AGBB 3RUGE 1JPFA 2YK1H 1P4LA 1P7QB 2CXKA 3MJ6A 1F4YL 4OCSH 4HHAB 4XWOC 4X5XB 5DVNA 3MV9B 4W6YB 1AHWC 4JO1H 5CWSB 3J8F7 4YDLB 1ODAA 4K55A 1WBXA 1OSZB 5D5MF 4I77L 4S1QH 3AY4C 4H1LB 4F7CA 4YZFE 4XTRC 3ARSA 4L29A 5HVHB 2BRQA 1E4WL 4Z77B 3U83A 1ORSA 3BH8A 5CP3H 5IVNA 2O5ZL 1MLBB 4NT6A 1PKOA 5FO8A 1PG7X 2I07A 5EU7E 2ZUSA 4YFLF 4QRPA 4FNLH 3NAAH 3MUJA 1WFNA 2IGFH 1N7ML 3V4PH 15C8L 5ICXA 5AEAA 5J8OA 4G9FE 3NFSL 4GAFB 2ZSWA 4N8VG 2WUBL 4ZFOB 2BVPB 4YIQA 3ES6B 2A9NL 4FTVB 5A2KH 1W72B 2R1XB 1AJ7L 2WINB 4P99A 5CMAA 4HV8A 5MP6L 3EBAA 3HMXH 1IM9B 4KMLB 4LL9A 5FHBH 1XR8A 4RAUA 3V5KA 5BOZG 5FCUL 1HYRC 3BOVA 3X3GL 2GCYA 3NH7L 4G8GD 1R3HA 5KW9H 3RHWF 1ZXQA 3OR7A 1FGNL 4QOKD 3G6JA 3KHQA 1PG7H 1E0OB 1RZFH 1JPGA 2Q1EA 1CXIA 3ZYOA 3V6OE 4XBEH 1JPSL 1T22B 1MFNA 4MNQB 1WIOA 1SJHB 2VH5L 5CEYA 3BKCL 3UC0H 2Z92A 5EZLA 2PXYB 5D7KD 3VXSD 1BFSA 1FFOA 3LKQB 3PGDA 1KENL 4P5MA 2NY6D 1VPOH 4NO5B 3BZEB 3CD4A 4JY4B 5D96C 4BUGA 3D87B 1HIMH 3LQAC 5HYIA 1OOAA 4RX4D 4M7KL 1NMAL 1L7IH 2WM0A 3NCYS 4MNGE 2V9RA 3RU8H 1CGSH 3H2WA 5T1LD 1GPOL 4R26H 1EFXB 1UM6L 4PJHA 5IBUG 2JCCA 4PJBE 1KT2B 2FBJH 4IDJH 4M7LL 3AREB 5IJVB 4X6CA 1I7ZA 3W0WD 3WL9B 1A4KB 1VB9A 2P5WA 1U92B 3U36B 2ENYA 1UXWA 5EC2A 2P8PA 4WTZG 4PJFF 3AAZA 4IOIB 4PJ5A 3X12A 5A2JH 3MRLA 5FYJL 4E0RB 2B2XL 2R2EA 4I18B 4IS6B 2CIIA 2HTLC 1FGVH 1HCVA 1TDQA 5FKAA 4MDJB 2M2DA 2R0ZL 2MJWA 1KN4L 2YD1A 2X9XA 4RSVA 2BK8A 2VMFA 1S7SB 1I7RA 4K3DL 1KCRL 3S98A 4YHLL 3MBXL 2DF3A 4JFFD 1MFDH 2IQ9L 5T3ZD 3SGEI 4P48A 3BDYH 1CLOL 2UV3A 3SE4C 1S5HB 5I75C 2BVOA 4M02A 1BPVA 1YEHH 3RNKB 4MD0A 4YHNB 2VLRD 1EEYB 2NMSA 4KUZH 2X1PA 5C0IB 4LKCA 5JIKA 3ZE0F 1A2YB 5SWSB 4LSDA 2GSIB 2ZUQC 3HS0A 4OSUL 4IMLA 1FFPA 4LVEA 1XIWD 4ZQKB 1PY9A 1A21A 5C0FA 4WFHE 5TFSL 3TV3H 2LTQC 4Q6IC 3QNZB 5BO1H 4XNZB 5C0CB 2VN7A 3WLWD 1JI1A 4XCFL 4F3FB 2BVUA 2XG4A 4S0TD 5I1CL 4LHQB 5CINH 5F3BA 3D0LB 3SDXE 4FG6D 2DL2A 5FECB 1EHXA 1DVFA 4NHUB 1Y18A 2R56H 1CQKA 2RFXB 3GHBL 4HK3J 4OKDA 1YJDC 3O3BA 1AO7A 3QDMD 5HGHA 3PP3H 3U0PB 1QSFA 1KCUH 5F6HJ 3VMOA 1X4YA 2JJSA 2R0KL 5EOQH 4PTUA 3O8XC 5F7DA 4JKWA 4PY8I 3PUCA 4FQQB 5DK2B 3WEXA 2ERJB 4KK6C 1OY3B 1AKJD 5JDSB 3ARXA 4WI5A 5CJQH 1MJJA 5HVFB 3ABZA 5ISZA 1AGDA 3WJJC 1W8NA 2KZWA 2C7UA 2VDRH 3D69B 4YHYB 3TA3D 2ZJSH 4JFEA 2YPLE 4XNUL 4BQ9A 5AD0B 3UTZA 3BP4B 3VH8A 3UTTA 3QULA 2VDOH 3VFTB 4HS6A 5HHOD 3WIIL 4FABH 4MB4A 3STLA 2VXUH 3DX6B 1T20B 1JK8B 3M8OL 4TTDC 3CAFA 5EIIA 4GMTL 5GS2D 4TUJB 1WEJH 5BRZB 5EOTB 2FR4A 3UYRH 3MRBA 5ADOL 5KVFH 5DMKB 1ZA6B 1DLFH 4M9OA 3QUZD 1XAUA 1F90H 2Z91B 4FFYL 4X6FA 3K3QA 3PWPA 2BVTA 4H0HB 3WUWB 1GOGA 4E42B 3BHBA 2Y6SD 1IGIH 4FFWD 4GMSH 1KLGB 5GGRY 3BSZL 5J1SC 3D39A 2Z31B 1VACB 1U8NB 4M43H 4EXPX 3O8XA 2XXMB 3B2UC 1UWEH 1U8PB 2RQ8A 5DHVH 2H45A 4YQXL 4MQXC 2J3SA 4JO3L 2DQJL 3TVMC 4KDVA 4O2CB 3WJJA 4PJXA 4HWBA 1I4FB 1Q0XH 3WE6A 4BKLA 1E4XI 1IAII 1XGRB 5TH2A 3C5SB 2H6PB 4BFBD 1BFVH 2X4QA 4M1GH 5EN2A 4JCLA 4R0LB 1LP9B 4OZHB 2W38A 2PO6C 4F7TB 3KPSD 4YXKL 3SDCD 2ZP0T 3QJHA 4R90H 4ZPVB 3R1GL 1WK0A 2ZUYA 4HUKB 3WIHH 3GI8H 1S9XA 3RUGF 1C16A 3TPKA 5GGUB 3T0XA 4FFZL 3ZE2E 3NOIA 1ZA3B 4FTVE 5DRXB 1CICD 4NQVB 3MA7B 4C55A 3MOAH 5FF6A 2EXYC 4D9RE 2I25N 3IDIA 4E9LA 2HMID 4QYOA 1JHTA 1LMKA 1K85A 5I0DA 5L8LB 4YZFF 3CUPA 4XC1H 1UC6A 3FCTA 5IHZB 3U4BL 4MA3B 1G9MH 3TO4C 5BV7B 5D7LD 1G0XA 4DKEL 4KUCD 2AJZA 3AVEA 4D0CB 3TVMA 1MCIA 2H41A 5F9AC 2GJ6B 4YUEH 1IQWL 4A2MA 3VWJB 1ZLUK 4DN3H 4FQIL 1Q0YH 3JV4A 5H2BA 1I8IB 1FO0B 5TE7L 2R2BB 3DX9B 1S78C 1T1ZB 4TULL 3G04A 4WFGD 5DQJB 3FQWA 3HC3L 2IPKA 2BRRL 4N1HB 4U1HA 2AJXL 1CFSB 1I8KA 2R0LL 3BEWA 3IRPX 1FC1A 4X9FA 3V7MA 2N56A 4PJ9C 2VOTA 3QIWC 3DVFA 1PZ5B 1B2WL 4JHAL 4LLWA 5E4EC 1OD9A 2DN7A 3RWCA 4DEPB 5SX4I 4ISVA 1MFEH 3ARBD 3KPLA 1GGCL 3RL1A 3EZ8A 4Q2ZA 2VSDA 5IK3A 4OIBA 5DUML 9CGTA 2NY0B 5DJ8B 1UEMA 1WZKA 4J3VA 1IJ9A 5GJTH 3EYVB 3HFML 5DRWA 2OYPA 2YZ8A 4HKJA 2JELH 1FZOB 1NGXA 4AT6A 3FFCD 3MV8D 3MNWB 3RWIA 5ICZA 4H20L 5JPNA 4FHBD 3AGVA 3LN4A 1P1ZA 5FYLD 4QXUL 1HHIA 4AIZA 1DBML 1OAUL 5A3IC 3C6LB 1KIRA 4PB0L 1YUHA 4BQ6A 4HXAH 3GNML 3AROA 2VLJB 2B1AH 3V9FA 1TETH 2EYRB 5IEKA 1QFUL 5DD0H 1XF2A 1MWAH 2O5XH 1N4XH 4GKNA 3O6KH 3FO9B 5KJRH 2FLRT 2XZQH 4K7FB 3BT2H 1E28B 4PJBF 3NGBC 4KHXL 5IM7B 2HJLB 3RDTC 4OFYA 3GIZH 3HAEA 4PJ9A 4Z7VF 5GIRA 3QIWA 1XGYH 1HYSD 4W4OA 2XTJB 3UPRA 4OUUA 3DNKA 1YN6B 3Q2CA 5SWSE 1OL0A 5EORH 1OAYH 5DHXB 4OGZA 1RVFL 1XF4A 1HQRB 3BRGC 4PD4K 4ACPA 4JFDA 3DIFB 5CZXD 3F7YA 1RK0B 4N5UA 1HXYB 3MPCA 2A2QT 1YPZA 2HRPL 1CDIA 3VRLE 5JUEL 1AIFA 3QEGH 3QI9B 4HH8A 1BQHG 3IJYB 3EFFB 3LS4H 1DQML 1BBJB 1GCFA 1AXTH 1IC1A 4PBWD 2VXSL 3QEQA 2BDNH 1RURH 2IH1A 2YC1B 35C8L 3QXDB 4LBEA 4YDVA 5I1DB 3GBMH 1A6AA 1SHMA 3S3JA 4HDIA 1N8ZB 4Y19B 4PYHA 4PJGE 1KJ2L 4P2OC 5BCAA 4U6XA 4F7MA 1K3IA 4XP4H 4LSSH 3JWDC 5GS0C 3ROOA 4NQSA 5DURD 1SJVA 2DLHA 1FPTH 4LEXH 1BD2A 4LSRH 2EE2A 5I1LA 5FO9A 2NTFB 3LEYH 2CKBL 3IAPA 2K7PA 4KROB 2QHLA 1TJIH 5J4MA 2JIXB 3PXHA 4XMKL 1ACYL 5HGGS 3O45A 1T5XA 4ZUUB 1FSKC 2VDPL 4LMQE 4U1MA 5F1IA 2PYEA 4E41D 4M7ZB 4ZOAA 2X1XR 3U2SB 1AR1C 1FC2D 1HQ4A 3QIBD 4PJCA 1SJEB 1ZGLA 4DKFH 3S96A 3BQUD 2W07A 1QRNB 3FOMA 4XMPL 2VLMD 3SDXF 5DD5H 3SE3C 2OL3H 3TBSA 4HFUH 4QXGL 2NY5L 2YRZA 2AKRA 4G9DB 5LQBH 5C08A 1FBIH 2PR4L 3GMPA 4YXHH 1JUFA 4QY8B 1TCRA 4JJ5B 3FQXB 4QKXB 4ETQA 5BRZE 4OD2A 3RWFB 4NQUA 1SYSA 1OP9A 1FRGH 3MFGB 3L1OL 1PQZA 4XPAH 4YO0B 4Y5YB 4OZFA 1UQSB 4ONHA 2LU4A 3RI5K 3MTRA 1BWMA 2PYFB 2GITA 3LIZL 4YEFA 5BZDB 3SDAA 1REIA 4P2OA 43CAA 4LLDA 1KCLA 2B20A 4BM7A 5M7QA 2AEIT 2W9EL 4OGYH 5B22A 5IQ7L 2ARJQ 4L4VA 2OI9B 1NLBH 4YHPB 5IFHL 5I2IA 4YDKL 2X6MA 2FL5A 2WZPD 5DZLA 3E6FB 1KGCD 4MAYB 3JWOH 5E4IA 5EA0H 1R5WB 2EC8A 1IZKA 2OJZL 3PV6B 4ELKA 3MV9D 3MLRL 3LRSB 4MMZC 2B4CH 4WW2F 3QH3B 1LP9E 4OZHE 4O02H 4HUVB 4NKMA 1QSEB 1URLA 4XP5L 1B6DA 1F6AA 2B1HL 3IJHA 1XH3A 2LU3A 2VUYA 3JV6B 4PJ7B 4LKXB 5TPWH 4RQQB 4HKBB 2R29H 2UY6A 1JJUA 3HC0A 3VFGL 1R0AL 4Q0XH 1Q1JH 5CSZA 2UUDK 3HNTH 4MB3A 4KZDL 3VG9C 5DSCB 3BUYB 4TPRL 4UB0L 1HKLH 2WBJB 5DO2D 5FDWB 1T1WB 2BSRA 2VDLH 5HBBA 4WV1A 1YMME 5TE6H 2P8MB 1W0VB 2GQHA 2X70A 3T4YA 4JKPL 4MS8D 4LHUA 4NP4H 4TUOB 3GSXB 5K9OA 4Y2DC 4PLNC 5CUSH 1SJXA 5F3HA 2CMRL 2PF6A 2XYCA 2YWYA 5JHLL 1RK1A 1JNNH 5DC4B 1A9BB 1HWGB 2QLVB 5F6HI 2A9ML 2R0WL 1DBBH 1V3MA 1M7XA 3QWOB 1AP2B 2YR3A 3ZE2F 1RHHB 4RGMB 3FTGB 3LHPL 3TCLA 1ED3A 1OB1A 3G6AB 3NACH 4LCUA 4C4KT 5I1KH 5DVKA 3JTSA 4XB7A 1FVCA 5CD5C 3ULUE 1VEOA 4MD4B 1MQKH 2QQLL 1F11A 4X6DA 1NAML 3MREA 5DJDA 2DQIL 3MGOB 3CFJB 4MNQD 1R3KA 1X5IA 2YKLH 2K3TA 2PXYD 4OCLC 4OZGB 2YA2A 3TBWA 1VKXA 1ZHLA 1MHCA 4GG6E 3MCG1 1QO3A 5T33L 5ADPL 3IFOA 3WIFB 4KTYA 1U8KB 1UCBH 3HG1B 2DM4A 2VAAA 5J9PA 5KVGH 1MCOL 2C3HA 2AJUL 1C1EL 4EI6A 4JO2L 3HI1A 3MNZB 1RUAH 3A0OA 1EFXD 3I6LD 2HT3C 5F9DC 5JPMA 5E8DL 5CZKA 4KMQA 3RVWC 1EGJA 3ARFB 3B2UD 5CD3B 3QHZH 1WAAA 5D4QA 5JHDB 3LV3B 4GRLA 2W9DL 4WTWA 1HHJB 5EZJB 1CL7I 1ZHKB 4X8JB 3KLAB 3F5WA 1A3RL 2VLJE 1MCLA 3HNSL 3BIAX 1J1XH 1NFIB 2X4PA 3C60B 4TOYL 4HUMB 5I73C 3WHE0 4FQ1L 2Q8AL 1T1YB 5IB3B 2FJHB 4PLKC 1WIUA 2EH7H 3IJSA 3ELAT 1DQJB 1DEEB 5ENWA 3KYOA 5I8EA 2PO6D 2G60L 2VJXA 3T0WA 2XTJE 4YFEA 1J05B 5ALBH 4ORGB 3MLPA 4KJWC 3N9GL 3P4LA 5BMFL 2ZOKB 2AXGB 4WIQA 1FL6B 3DECA 3KDMB 4NJ9H 4D0DB 1RZ8B 5C86A 3BWUC 4FXKB 3D25A 5JW3L 4P3CL 4JRXB 1Y0LB 1JZ7A 5FHAH 5SWSD 3RI5F 3RGVC 3I02B 4IMKC 4ZPTB 3I6GA 4G8GA 4HAGA 4FQXC 2UUDH 4JKLA 4TNWK 5BJTB 5FUCC 3BH9B 4I2XA 4PY7B 4B5EA 4XBGB 3CXHJ 1NCNA 1RHFA 4HWZB 1YA5A 4Y19E 4QOKA 5C0CD 3IRZA 1L4IA 3DARA 3TESA 5AZEH 3EYOA 4LP5A 2V17L 3T0ED 4NJAH 3FT2B 2VLKA 4J4PC 4ZO9A 2YSSA 2BVQA 5C0RL 3LAFA 3TH4T 3ECBB 1SVZA 5D93C 4GAYB 1DQLH 4WHTB 1YDPB 1IRAY 2AP2A 2VZUA 1BZ9A 4PP2B 5DHVB 3RWEB 5LXGH 1N5AA 1TVBA 4OJFL 2YD3A 3GJEB 4XP6H 4XVUC 1S78D 5C0AE 5I1GH 4JQXC 1BEYL 1KPUA 1RY7B 5HI3C 4M48H 5JZ7D 4X4XA 4K2UH 2VL5B 5FYLL 3V6FB 4PJFA 1OGAE 4X9BA 1QRNE 5I8KL 5DHYA 3MYJA 3B9KC 4OKVB 4PPTA 2XQYG 4ZUSA 3AB0B 3DXAA 4UOW1 2NR6C 3HI5L 1GC1L 4IEFB 4PJGF 4KKCC 1FJ1B 2CKBA 3W0WA 3FQRA 4PRAA 1G7JA 4HFWA 4V1DB 1OP5K 1J0IA 1UG9A 1NC4B 2P24B 2LVEA 1JVKA 3ZKSD 5LKNA 1EHAA 2IPUK 4NQEE 3QIUB 1NKRA 1EO8H 4ERSH 5BRZD 4G6JH 4WI8A 1OAKH 4XPFL 2Y5TA 4NDMA 1MAMH 5A3ID 3DV6A 1XCQA 2VKWA 5C6TH 3HLAA 1TQBB 4OI7A 2DYPB 1CR9H 1WT5C 2BSED 5CGTA 2Z31D 2B8OT 3DUSA 4JQXA 5F1KC 1CG9A 3BDBA 4LU5H 1FG2B 1P7HL 1Q8MA 4LSUH 5ETUA 4P2RD 1FNGA 4FRWA 4POYA 3IDNB 4JM2B 1UB6B 4NBZB 2BZDA 1UXSA 2IPTH 3RDTD 4O58L 2ZUUA 5E8PA 3B9KA 3BKJL 3DRQA 3H0TA 5CZVL 2NY3C 1HHHA 3KLHD 3B8YA 4QGTA 4XPHH 5A16A 3MV7A 3V6ZA 1JRHI 6FABH 5E1HB 4CU6A 4Z7NE 3CVIH 3HE6B 3NFNA 4PJ7E 5DK0B 3MGTA 4PLJC 3K8KA 4PJEB 2V2XA 4JRYB 4UZGA 3RWDA 5JW5A 4RISH 1CDGA 2FX8H 1EHLL 3IETB 5HY9B 3UTPE 5T5FL 5HGBA 5EZIH 3QDMA 1GIGL 2VZVA 1MJUH 3ARRA 4B0MM 3VG0L 2H26B 4U6TA 1Q9LA 2XY2A 4XC3H 4HBCH 1QFWH 1FDLL 3QRFM 4RFOL 4YDJB 2H9GB 3MRCA 3MR9B 4OTXH 4IM8A 5AG8A 4OZHF 3QEUB 4ENED 3IU3A 2JB5L 4OFDA 4M5YL 1RZJL 2BNRB 2E27L 4JLRB 4XHJD 4NRZA 4H25B 5CKGA 1T6VN 1HINL 1NSNL 3TA3A 1IGTA 1RV6X 4S2SB 1KJ3L 1J1PL 3HHRB 4JZJC 5I1EH 1I7UA 4HJGA 3HPLA 3IKCA 5MERB 4LASL 2GJ6D 1BVKA 5HHOA 4I0PC 1EMTH 5AUMA 2DQGH 4K8RD 5HD8C 2BP3A 4JFQB 5C7XL 4LCCB 4MJ5B 3QZWB 3MOQA 4LPTA 5KAQF 5AZ2L 3IFLH 1M7IA 3L3IB 4R97C 2Q87A 5CKAA 2XA8L 1B0RA 4OZGE 2GEEA 4OQ1A 3D3VB 1SBSH 4BFIA 1IGFL 2F53B 3FAWA 4NCC1 1WCBB 2IALB 5FYKU 3ULUD 2W9LA 2HFEA 3HG1E 4NC2B 1I9JL 4KVCL 3K2UH 5I6XC 2IAMC 3DUUA 3EYFA 1KEMH 2HJKA 2OQJA 1FORH 3WFZA 4G80B 4MX7B 4BH8A 5EO0B 2BY0A 1EA9C 3HUJB 3WKNA 3IF1B 4HK0A 1NAMA 1KV3A 3T1FB 2NY0D 5GRXG 5E2WH 3MMEA 2GSGA 2D7QA 25C8L 5JHDE 1CFBA 3BN9D 4S1DC 3UTSB 1BLNB 1Y6KR 5IVZA 4XPBL 1RJYB 1Z5LB 4PJ8C 3BKYH 4YE4H 4F2MB 3BD3A 1E4KC 4H5SA 4ZFOL 4GS7B 2NTSP 3L7FA 3AM8C 3BUTA