4Y19D

Immune complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
205
structure length
205
Chain Sequence
b'MQQVKQNSPSLSVQEGRISILNCDYTNSMFDYFLWYKKYPAEGPTFLISISSIKDKNEDGRFTVFLNKSAKHLSLHIVPSQPGDSAVYFCAASVYAGGTSYGKLTFGQGTILTVHPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title T cell receptor reversed polarity recognition of a self-antigen major histocompatibility complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 38
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2015-02-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y19D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y19D02
1PSKL 4WU7B 2OSLB 1OM3H 1MFAL 4Z77B 1NKRA 2XWTB 4WV1C 8CGTA 4HV8B 2YN3A 4M7ZB 5E8DH 1F11A 5CJ8A 4ZFFB 4JRXD 2IPKB 2VR5A 1BJ8A 5IMOB 2WP3T 5HYSG 4JFXB 4PJFF 1P4IH 4WV1A 4QYOA 1G7PA 1JWUA 1CGTA 4G6FB 1N0XH 3H42L 2GJ6B 1S3KH 4E41D 4FNLL 4HCRH 4C56B 4LSPH 4C59B 5JW4R 1FL5B 3IETB 3MUGB 3WFBH 1NGWB 1MH5B 4HS3B 5ITFA 3GMOB 3TCXA 3LMJH 3GSXB 5J1AB 3K81A 3BH8B 5J4MA 3P9MA 1NAMB 3QG7L 5KW9L 5SV4A 4L8CB 4YIQB 4NN7B 1Q0YL 4QRUA 4RAUA 1IZJA 2LVEA 5EUOE 1KEMH 1UJ3A 3MUZ1 5DJ2A 5I16B 4LSQH 2A9NH 3L7FA 4WY7L 2OL3H 5HHXH 3TN0D 4G8GE 5HJ3A 3MRFB 4ODTL 4WI2A 4K2UL 3STZB 2Z8WC 3THML 1MIML 4F7PB 5ID0B 4FQXC 3O4LD 4KJPC 3N1FC 4CMHC 2XKUA 5D1QB 1VENA 1HZHL 1P7KA 1DJSA 2OTWB 2WIIB 2BVOA 5EBMB 1FFQA 4LGRB 3GI8L 3MRPA 3QZWG 3V0VB 4Q9QH 1I1AC 4JPIB 2Y06H 4P2QD 5IVXF 1D6EA 1CQKA 3STBA 1FDLL 1CL7I 1I1AA 2FYYA 4NQEE 4FN0A 2EDLA 5SWQB 4LHUD 4UDTA 3LEYL 3O6FD 4GKNA 4QWWC 4R0LB 5IF0A 1IAOA 3MRMA 2R0WL 2W9EH 4MZ3A 5KZCB 1X5ZA 1FYTB 3N1MC 3H7BA 2P24B 2VXQL 4LLAA 4F7MA 1DBBL 3QO1A 5EU5A 4ZO8A 4YHLL 1YZZA 4ELMA 1A6VL 3X12A 2PNDA 1DUYA 3C60B 3RPIA 1I3UA 3ECBA 5FV2A 4N1EA 3UTSE 5MERA 1DN0B 4UDUB 3VGBA 3FTGB 2IFGA 4H20H 2BOBB 3BEVA 4NKQB 1J0YA 3HAEB 4F7EA 2ARJA 1IRAY 3T2NH 3U82B 5EN2B 2AQ1A 1HYRC 1AHWC 4P5TD 3OHXA 2F74A 4XCCL 1UA6L 3OKOA 5D8JL 1XIWB 1WZ1H 5DC9B 1PYWA 4EI5B 3MGOA 4WUUB 4OLXL 5F9JA 1YEKH 4JPKL 1AHWA 3L3OB 4I5BB 5SV3A 3QWRD 1UG9A 3HE6C 4NO0D 3D9AH 1NJ9A 3CVIL 2CGRH 2P5EA 3OMZA 3VXSD 3CH8A 5FM4A 3L1OL 3VXQA 3HE6A 4G6KH 4OGZA 4U1SB 4M7LT 4NQUA 4YHKH 5BS0E 2AJUH 2ZUWA 4JQIL 4LDOB 3UJTH 3R0NA 5HVHC 5ETUA 2VITB 5EU4A 3QG6B 1HXYB 1KPUB 2DDQL 5DJ8B 1IAIM 3C5ZD 5CEZH 4E0RA 3F6LA 5EZLB 2DYPA 3D25A 4KK9D 3SDAC 4GMSL 3W0WD 1XZ0A 1G7JB 3DGCR 4HHAB 5DMIH 4MNQA 1BEYH 4UT9H 1RZ7H 4LFHD 1YMMA 3QCVH 3SDAA 2APBA 1ZHBA 4RAVA 4RGND 5DJDA 4N68A 3WL9A 2LFGA 2ZOLA 3VCLB 2B8OT 2DBLL 2Z93A 4Y5XC 4UB0L 2Q7NA 2IH1B 4OD2A 5E8PB 4ZFZB 4JZJB 4OZHB 1AC0A 1ND0B 4GKSA 3RWEA 1VDGA 4YDVB 5C0CD 4OCWL 5KG9A 4M61A 4Y5XA 2AV1A 4HZAA 1FJ1B 1BBJA 3D0LA 3M1BA 3QDAA 1RPQA 1T5WA 2NTFA 2BVYA 5D7JB 3VFPB 4YAQB 2PW1B 1ZEAL 4TQEH 3RY5A 5DI8A 3RL2B 1CGVA 2R2HA 5K9JL 3ALXA 3TO4D 3QHFH 4HUUA 3CDCA 5D7LA 5ECJE 4LIQE 1MFEL 3KJ4C 3B4NA 3KHOA 3MX0A 4Y16B 2YUZA 1GPOH 1MCPL 1FE8L 3PUCA 1WCBA 4ONOA 3MACH 1ZT1B 4U1GB 1F4WL 2EO9A 5IB1B 1W0YT 1J7VR 2MQ3A 5BZWB 2Z31B 3JWNC 3D69A 1VGEL 3F65A 4OJFH 2A0LC 3CFDA 4LOUC 4XPAL 3V0AC 4JY6B 2IBZX 2IANA 2AXHA 1U3JA 4Q2ZB 3U6RA 3RGHA 3B9DA 3ZKMD 1CFTB 5HY9B 2B4CC 1I7TA 4LCUA 3VG9C 2O93L 1CR9H 4ETYA 3QDMA 1C8PA 1GGBH 5T3ZH 4PRBB 1OP5K 3MJ9A 1EHNA 3QSKB 5F1OB 3TJEH 1GCFA 4XPTH 2H2SC 4S1QL 4P23D 1MELA 4HPOH 4IRJC 2H8PA 4XRCB 1Z9MA 3BSZL 4PJ9B 5I74B 3L3IB 4NYLA 3QDGB 4PB0L 5GZND 1TENA 4I3RH 4FQQB 4IRJA 4X5LA 3PHOB 1JRHH 4AIXA 4CDHA 3LVEA 1UXWB 4M93B 1YNTA 2CDGA 5GGVH 3LRSB 4TULL 4MA1C 4XGZA 3F5WB 4X6CF 1YC7A 1EGJL 1MFBH 3HZMB 4C83B 1I9RL 1T6WA 3MOBL 5GZOD 5C0DB 5CKAA 1NGXB 4KK6C 5FM8A 1LO5A 2BJML 3L3JB 4MJIA 3F58L 1QBAA 3ZL4L 1DANU 1NEZA 4O02L 2FWOA 3DVIA 3NA9H 1CLYL 3A67H 4NCDA 1YYLL 2KH2B 3B5TA 3Q6GL 4XH2A 4Y89A 1S5IH 1BJMA 1EERB 1MCQA 4Y5VC 4ZYKB 3V7AE 1ETZB 1JHLL 1I1YA 4O4YL 4WJ5A 2MQ0A 4P2RB 3MRCB 3VDCA 4Y5VA 1BZQK 5IB4B 1MREH 1T89C 4BYHA 2Q86B 1QACA 3KDMB 3IAQA 2XZQH 3VA6A 1OGAD 4JR9H 3WLBA 1N2RB 4M5ZH 1RK0A 4A6YA 1T89A 3VH8B 3PV6A 5GS0L 2EC9T 2QHRH 2A6JA 4DCQA 3MOAH 1ADQL 2X2YA 4X99A 2XXCB 1WAAF 4H8WC 4Q0XL 1T80A 4U1JA 3FKUS 4PGCA 5M94B 1DTUA 3ILQC 5JNYB 4L3ED 2MNUA 4P9HL 1Z5LA 3ZDXF 4JKMA 5BV7L 3D85A 2FL5B 4KRNA 1KJ3H 5TQ0L 1A6TA 3IFLL 4K94H 1U8OA 4JDTL 3EAKA 4YGVB 2X4UA 3K2MC 3U0TA 5BRZB 2BSSB 1YC8A 4LASH 3PNWB 1TZGL 4P2OB 4UBDD 3IKCA 5TGBB 2AEIT 1RIHL 3H9SD 4LKXB 1ZXQA 3LQAH 4XWGH 2VUOA 3O45B 1FBIL 1P7HL 3LHPL 4ZPTB 2PO6C 4E42B 1AGBB 4K7PY 1ZMYA 2LABA 4K8RL 4LU5H 1XGRA 3BN3B 4LPVA 3HRZB 4MYWB 2XTJD 4HPYH 5C0AE 1FNEB 3D3VB 4O00A 2PO6A 4ZOBA 4PJHF 4IDJL 5T1LB 4LLVB 2IGFH 4WGWB 4PRDA 4N5EC 4Y4KB 3HE7D 2A1WL 2ED8A 5F6HI 1N6VA 4OQ1A 2XWTA 4HV8A 2AEPL 3PHQA 2CKBA 5JR1L 4K9EC 1IGTA 4YDKL 4QRPD 4PV9A 2ICCA 2OR9L 1RZKL 5JW3H 3TBTB 1WZLA 4LSTL 4BK5A 1H0DA 1HHKB 3WNPA 5H35A 3QUMB 3MC0A 2V6HA 3TIEB 1A6ZB 3IETA 3BI9X 3MUGA 4R26L 1EO5A 3OKKA 2DQJH 3JWOL 4WFHE 5DMKB 5D2NB 3QA3A 4HS3A 2AGJL 2X4RA 4M6ML 1CDHA 3SDCD 3S96A 5KSBE 5H37H 3CFKB 5IHZB 3DX6A 3PGDA 3DECA 1HH9B 4HKJA 5L7XL 1F90H 5CWSA 3NGBC 1S78D 1VB9A 1XF3A 1JZ7A 3AS0A 4N0YL 1NBQA 2A2QT 4YIQA 3WLWC 3MMEA 1M05A 3FQXA 5I73C 3AGVA 4DN3L 4JO2L 2CD0A 4DVRL 4FQ2L 5ID1B 4WTWA 3FQRB 2EXYC 2X44D 2UZIL 2NY6D 3G5YB 3MLRL 5E8NB 3MRFA 2DJSA 3K74B 3MREB 1MCWM 3DVGB 1KENL 4P59L 4U1IB 4TSAL 2BVPA 1R5WA 1LE5A 4KI5E 4G7YH 1I3RB 4KQ4L 2VWEE 1D5BB 2AJYH 3KYMB 5GS2H 1WUNT 3M45A 3CXHK 2NLJB 1A7PL 3TCLA 1UXSB 1ZANH 3VD9A 5TDOB 2BXZA 5HYSA 1A1MA 4HJGB 4BUGA 4AT6B 2IQAA 1R3IH 5IMKA 4XC1H 4L4VE 2J88H 2A74B 4XMLH 4U31A 5EORL 2H26B 1JNNL 2W9DL 5ADPH 1NPUA 4QGTA 3QIWC 5HI4C 4R0LA 4ZS7L 3DXAB 4FQLL 1KGCD 3QT2A 2GTWA 3L3KA 3QIWA 3SDXA 2VR9A 4FQ1L 1QHOA 1J0KA 4XP9H 3TNMB 4K3JL 1MJ8H 1NCCH 1XCTB 5B8CB 3L3HA 3W5MA 1PG7L 2Q8BH 1IEBA 1NAMH 3FT3A 1A3RL 2XNAA 3SQOH 3HPJA 5IFHH 3CFJA 2E7LA 1N7MH 3ROLA 4V1DE 1ZA6B 3HAEA 4YXLL 2E9WA 1QZ1A 1LEGA 1S7XB 3VXMA 2NW2A 5K9OA 3GUTA 1TQCB 4PLNC 5D2LF 4NRYB 4HH9A 5I71B 3SGDH 5C0BA 4CVZB 4Z6AT 3AXLB 1OM3L 3OG4B 3MRDA 5F9OL 1R3HA 2J8UA 4LAJH 3LKPA 4PRID 2F54B 5GSRB 2VISA 2R69H 4AL8H 1RULL 2PETA 1YN7A 3BZFB 3FB6A 4J3WA 4WTXA 2BVEA 2OJEB 3QHZL 4NQVA 1F13A 2B0SH 1N0XL 3ALPA 2DTSA 5GIRA 3KPRE 1X6LA 4FQXD 4KJPD 4KJYA 3K2UH 5I8EB 3PWUB 4M8QA 4R97B 4YBHA 5IVOA 3I3EA 4I18C 2VO5A 4LCWD 1CI5A 3SEPA 2MKLC 3QJHB 5GGQH 2GKIA 2NY3C 4I18A 3B3IB 2H1PH 1KNOA 3SJVD 1UZ8B 4U1NA 2WBKA 2P42B 4ZTOL 5I76B 3H9YA 1IARB 1B4JL 5E9DA 2PR4H 3P2TA 2OXHA 2WLZA 3SPVA 1JNLH 5ICXA 3V7MA 1U36A 4LSQL 4HIIA 5LWYL 4PV8B 1OY3B 1MFDL 2HN7B 2OL3L 1E0OB 1BQLL 5FHAL 3V8CA 1M6OB 3HS0A 5E00B 1JPFB 4NKMB 4RX4D 4BQ6A 3U7WL 4NQTA 1AP2A 4JRXE 3S7GA 1QSVA 5I0DA 5IW1B 5L2KA 1Q38A 1I7ZA 4UTAL 1U8LB 5EU3B 5HHMB 4EN3D 4CBPA 3ZTNL 4E41E 4UNVA 2EZ0C 5IVXE 1JGUH 5EA0H 2VDOH 3RX7A 1GH7A 4F7TB 3GNMH 1U8NB 3BJ91 3RL2A 3OKEA 3FFDA 3O11B 5L88H 1AIFA 3PL6C 4KKBC 5AUMB 2DN7A 2YWZA 4ZQKB 2BERA 3MLTB 4Y2DC 3PWLA 4O51B 1X7QA 1U3HB 2DICA 2BFVH 3PL6A 3RZCC 1KN2H 3P11L 3MUY1 1RZJL 1BGXH 1Q9OA 3KS0H 2W9EL 4OUOA 2D31A 4PGBB 4Y2DA 5EZJA 1E28B 5C8JA 1S9XB 4E5XB 2CIIA 2Z31A 1C08B 5DDHB 3RZCA 2Z4QB 4UV4L 5SWZD 2OR8A 5E6ID 1V3LA 4ZOEA 3IF1B 1UWEL 3O4LE 4ELMF 4G43A 3WFDL 2DYPD 5DQJA 3WDHA 1BIHA 1P53A 4UT7L 1BVLB 3EJJX 3MUJA 1G6RL 3C5SB 1QD0A 4KJQC 4JN1H 4NNXA 4KXZI 1W0WA 1WIOA 4HG4J 4P2QE 4TVPD 1A1NB 1C5BH 1WBXB 1TPXC 2FEDC 3DNKA 2BOCB 2CRIA 1QNZH 1DQLL 3VFTA 1A1OA 1SEQH 4HLZH 4ZUTB 4RDQF 2D9QB 4OGAC 4ACPA 5DUML 4NT6B 5C6TH 2CDEA 4ALAL 3VXOB 5HHVH 4X8XA 2MHAB 1J8HD 1QEWA 2AJUL 1RU9H 5DMYA 3L9RB 3QEHA 1KACB 1GGTA 3BIBX 3ZKNC 3QPQD 3QJFA 5C71A 1YN6A 3WIIL 3U9PH 1CDJA 5EPMB 3MA7A 2HRPH 2WBJC 1CE6A 2EYTB 1JUFA 5EBGA 4JO4H 4G7VH 1NBZB 3OX8A 4H1LB 4Z8FL 1SYVB 4U33A 4UT9L 5HI5D 2DIAA 5A2IH 2VQ1B 3RIFK 2WBJA 2HJKB 3MODL 4YR6A 1RFDL 3MXWH 4HMEA 4ZNEE 1MAJA 2UUDH 3H3KA 3U0PB 2E7BA 3BDBA 5DLMH 1WC7A 3W9EB 1H3XA 5BXFB 1ZHNB 5F3BB 4I0CC 1EGJA 3MGAA 5EOTB 2BSRA 5C7XH 5CINL 1NL0L 3DVNB 3KXFA 4MZ2A 3GMQA 2JK5B 3VXSE 5I17A 1YEDB 5T1KB 3HUJF 4XPHH 5KVEH 4K7PX 1K85A 2BZDA 3EFFA 5F6HJ 3FONB 3OB0H 3FT2B 2P8PB 4J3OC 2VXUH 3DX8B 5IGXL 4G9FA 2AK4D 2QSVA 4A2MA 5CUSL 5DFVD 1NC2D 4KKNA 3FQWB 5D5MB 5KSAB 3W0WE 3EIFA 4XC3L 5I1DB 5GS0C 2PTTB 4FG6C 1U58B 5HGBB 1T2XA 3MACL 2BRQA 4PRHB 3U2SA 5J9PB 3HR6A 4TUJA 4RGNE 5FGCE 4QRQA 4XCEA 1KT2B 1ADQA 4P9HC 5JTWA 5BV7C 2OZ4L 4XZUB 2EKSB 5IJVA 3JTSA 3J7HA 5C0CE 4RA0C 1JV5B 5CBAA 3T0EB 3PIQA 4PJ5A 3TFKC 3S97C 1CR9L 3MLWL 5L9DH 3QCUH 5IHUH 3UROR 5C08A 5ISZD 5JQHC 3K4ZA 5T3ZL 1OLLA 5KS9A 4XVUD 1LD9B 4XPFH 4K8RC 2LAGB 1U0QA 2P8MB 4HJJH 4TNVK 4XPTL 2UVEA 1RURH 4OF6A 4R4BB 4WRLA 2XA8H 4OTXL 3VGGA 2H3NB 1QBML 1PD6A 3TIEA 3FZUC 5C0IA 4N8VB 3O3DA 3GEWB 5EBLB 5L8KB 1HNGA 3HNTH 3UAJD 1ZT7A 3VI4E 3CDGA 4KC3B 5D1ZC 2BNRB 1BZ7B 4KRPC 3R8QA 4LIQH 1RZKC 4G8FA 4RNRA 2VXVH 3G6DH 1AJ7H 3K1KC 3HG1D 2LU3A 5D1ZA 2P46B 3NA9L 5DRNB 3FJTA 4WEBL 1RUKH 3DPBA 4PJXB 5EWIL 2DQIL 3JWOC 2YEZB 4NO5B 1J5OL 2R29H 3FQRA 4M1DH 2HT3C 1MHHB 3VFMA 1M7DA 5DC4B 1KIPA 2YC1B 2HJLA 1JYWA 1CE1H 2V17H 4DUWA 1EBPA 5ALBL 3GSOA 2ICEB 4JJHA 4DW2L 5K59E 3GJFH 5DJZB 3QIBD 4JG1H 4M5ZL 3S36H 3T1FA 3W39B 2H32B 1DSFH 3OG6B 2VH5H 4MQ7A 3MOAL 4XCYB 5TDNA 5LCVH 5AAWA 1KB5B 3QQ4A 4DKFH 1WAAE 2QR0A 3WKMH 1IT9H 2X4NA 5FDYA 5IUSA 3QEQB 3ZDXE 1C16B 1Q0XL 1YJDH 1PKOA 2WMPA 5EU6A 1IKFH 5CMAA 3QUMH 2ZCLH 3S5LB 1KJ3L 2B1HL 3MRHA 1RVFH 3VWKD 4S1RL 2JELH 4HSQA 5CIPB 1Q9KA 4Z7QF 3U83A 4X7FC 4LASL 1EX0A 2ZKHL 2ID5A 1OOAA 2BVTA 2XICA 3WJJC 1OGTA 5JIIA 1CD1A 2EDOA 3LQAL 4RQQA 4XWGL 2W65B 5CZVL 4IOIB 3NMEA 1NANI 3G6AB 2MTPA 4NJ9H 1MRDH 5BMFH 3EJYC 3NFNB 5JLZB 4LU5L 4NHCH 3E6FB 1ZA6A 3LDBC 1RHHA 3OBAA 1S9YB 3OZ9H 5LAXA 3QUXD 3V4VH 3KJ6H 3TP4A 4PJHE 4DGIL 1OGAE 2EDJA 5F1IA 5DK2A 1AR1D 1JZ2A 3WHXB 2IGFL 3GI9H 3N85H 3O2WL 3D18B 4XP6H 2J4WL 3UZEA 4ODWB 1IC4H 3TZVC 5I18H 4J3UA 1FAKT 2WUCL 2F54A 4N0UB 5H37G 2Y23A 1EAPB 4J1UA 3R8BB 4I2XB 5D93C 5JUEH 4NZUH 4Y19A 5I2IB 4L3EE 5DJ0B 3BZFA 4W4NA 3HC0A 3TZVA 2O26U 3GRWL 1SY6L 3NPZB 3S4SA 3C2AH 4Y4HD 1QQDA 2LE9A 5H94B 1D5ZB 5AG8A 2DL9A 3F8UB 2R1YB 2E27L 2NXYC 3OV6A 3VW3H 1NCNA 3H9SE 4JDVA 1ZK9A 5FB8A 3SOBH 4PP2B 2NX5B 2WWKT 4NQDB 3P30H 4TNVF 3WUZA 1ZVSB 3BZEB 2G75A 5IK3A 2HAZA 2YHGA 2XTJE 5DUPH 1MCSA 4XBEL 4WHYH 2XRAH 3BGMB 3ZTJH 4P49A 3EOBA 1ZHKA 3IDMA 1EO8H 3W81A 3SCMC 1IAIH 3CCHA 3QIWD 5I1AA 4JFYA 1X5HA 2I9LB 3G5XA 5AYQA 2F5AH 5E00A 4X5WB 5AG9A 4QRPE 2Z0BA 3OKDA 5DYOB 1HHIA 2NNAB 3GB7B 4C4KO 1CZ8H 1D5XA 1LDPH 1LP9B 1U8NA 3P4OA 1X5YA 1OW0C 4XAKD 3ULSA 1EA9C 5DMGC 2PUQT 1MI5A 4ZPVB 1SHMA 3OSKA 5FKPB 2FJFA 4X4XB 5AUMA 1IGIL 1OW0A 1GAFH 2OL3A 3P73A 1EHLL 4Z7VB 4LBEA 5IHLB 2FO4A 1WBYB 2EDWA 1ZGLA 3MRIB 1UVQB 3CPLA 4HS8H 1P4BH 3GSUA 4E5XA 3BX7C 1TXKA 4WWKC 2A73A 3ZE1F 2J7LA 1T1ZB 1JCKA 5F9WB 5J12B 4LHQB 1DFBH 2A83A 4WWKA 4RWYL 2C7UA 2Q8BL 4HFWB 4QHNB 3HTLX 1YQVH 5IFHL 1N7ML 1RZJC 5MEPB 5TDPB 4HIJB 1WFNA 1MWAB 2QSTA 3OGCB 4JRYB 3ARBB 3ARYA 5D2LE 1S7QA 3UDWC 3NN8B 1NBYB 4YXKL 3VRJA 1A7NL 1UWGL 1U8PA 4QHUB 1WBXA 4H25A 4BQCA 4KQ3H 3UDWA 4GS7B 2VDNL 5ANME 2CQVA 3PWNA 3RWHB 2AKRA 3OWEA 4ZUTA 4TSBH 2VLRB 1ZT4A 1RK1B 2DQGH 5F3HA 4NT6A 1NAKL 2J8UF 3NACH 4ZTPH 1KGCE 3CXDH 3IFPB 5IM7A 5ACMA 1MVUB 1N0LA 1XF4B 3MZGB 2QV2A 4FXKB 4UUJB 5GS1C 1K4CA 1G6RA 1P7QB 3W9DA 2F53D 4BSVA 1JGLL 4HIEA 1CDGA 3G6JB 3WFZA 3QH3B 3VFUB 5GS1A 3LV3B 3QUZC 3BPLB 2PCPB 4KDWA 4PTUB 1NBZA 1H9VA 2HVJA 3H3PL 1IFHH 5C9JB 2AXJA 2M26A 5B3NA 1F4XH 3IJYB 1N6UA 3QUZA 4Z7UA 1R6VA 4KKBD 3DV4A 3GSVB 3L3GA 3QDJB 1JNLL 5F3BA 5HD8C 2MPAH 5B4MD 4M4PA 4NBZB 4KTEL 5CLWA 4I9WD 3VMOA 4PRIE 1KXVC 5IEKB 5T5NG 4Z95L 1MFNA 3ZYOA 1NLDH 2IPTL 1I4FA 3TNNA 4JPVH 3TIDA 3UZQA 4DZBB 5D1XC 3PWVB 2A9MH 1GC1H 3RJQB 5BO1L 4JFPB 4XCNA 1URLA 4LVNB 4P57A 2IPUK 3GNML 1TTUA 1T7XA 4X6DA 1KIUA 2X1QA 3ZHLA 5D1XA 3TBVA 2DQEH 1MCHA 5BJTA 5K9KB 2DI7A 3GIVB 4PJDF 5DJ6B 1S9VA 4AM0A 1SVZA 3MRLB 4APQB 4LEXH 1X6NA 3LN5B 3SJVE 3FB5A 1MAML 1YUHA 5HGBA 3GKWL 5EBWB 2BFVL 1KN2L 1ED3A 4JHBA 5BZDB 3B5GA 1BGXL 4NUGL 2R2EA 3QUKB 1OQOA 4I4WA 1KT2A 2ZUUA 4GXVL 4OD3H 2HVKB 3GK8L 3OAUH 3NIFF 1CGWA 1FP5A 1A9EB 4GRWB 2G60H 4ELME 3N50A 5J3HC 1AXTH 4HLZG 3HI5L 3DUUB 4LCIL 4LCYB 4MAUH 4Z5RA 2OLDA 4KY1H 3ARDC 5FYKU 1CD0A 4WI6A 4NBYB 3SDDC 3T3PF 5GJSH 1P2CB 1K8DA 4JN1L 4QF1A 1XH3B 3ARDA 4PGEB 1QSED 3I9GH 3B2UD 3DSFL 3PXHA 2X42A 3SE9L 1AGFA 1FFPB 2Z8VC 4ETQA 4KZEH 2H3NA 3RVWD 4OZFA 2QL1A 1JWSB 5C6TL 1DBKH 5GGSA 4QCIA 5DO2D 4ZAKB 4ZG1A 5HHVL 3RIAF 4XVSL 1G7HB 1NMBH 5FA4A 3RAJH 8FABA 2QKIB 1IQDA 5C09A 1HWGB 3CMOH 3EYQC 3QEGH 1UB6B 3SE4C 3BUTA 1ZE3C 4JGMA 5SWZE 4PD4K 2R1WA 4X4MA 5EO0A 1LWRA 3C09B 4IMLB 1JPST 5FM5M 3OJMB 3SE4A 2GJZB 3V4UH 2A6KB 5HI3C 2MCPH 3GHEL 1A4JA 3QWOB 2C4FT 2I60H 1XGQA 1U41A 4GG6F 1L7IH 5FK9A 5JDJA 3VXNA 3TA3B 3VMPA 4L9LB 4XX1E 2C3GA 2AS5M 1JRHI 4NN6C 1HI6A 3MXWL 5GHWH 3LSOB 2YOCA 3U30B 4TVPE 3Q1SH 4FG6D 3QHTC 5D9SA 4JDZA 4AH2B 4OUUA 5DSCA 4WW2F 3LRHA 1K3ZA 2BHUA 1A9BB 4LQFH 4X8JB 3ZSSA 1X3DA 4NQEB 4P99A 1IGYB 5DJZA 3NIGF 4OQTH 5J13C 3HUJE 2VE6B 3W39A 4PJ5D 5EO1A 4PY7B 1J8HE 3P77A 2BY2A 4G80A 1EEUA 1CICC 1N8ZB 4LLMB 5ESAB 2NY1B 1DDHA 1RUPH 4DN4H 2FO1A 3MLXL 2Z35A 4HXBH 1C16A 4GG8B 1CICA 5IKCA 4LLUA 2ZCHL 1MEXL 1BIIB 1MAKA 3L5IA 3TPKA 1CN4A 1R3JA 1Q8MA 5SWSD 3I50H 3CVHB 2EDFA 2VXSH 4HKBA 1PLGL 3MYJB 1T1XA 3ARQA 3KLHC 3FO9A 1A7QL 2VYRE 1M7IB 5A16A 4RCAA 2XPGA 4WFFD 1TTGA 3T08A 4LMQI 1H15B 1KTDB 5D7IB 3U46B 4DAGH 1HQRB 3FZUD 1VEMA 2AV7A 3RWCB 1REIA 2HH0H 1F4HA 4K7FA 3PQYA 3DTXA 2FHCA 3AU1B 4Y5YB 2JF1A 5JHDB 1N5YH 4X7EC 4WHDA 1WK0A 1NFKA 5D1ZD 4R90H 4YX2L 1KPVB 3IXTB 2P5WD 4YO0B 4OLUH 3WHXA 2COQA 2XQYG 3BP4A 3LQAC 3QXDB 5E2WH 3EO0A 4YH6A 4UINL 5CGYC 3DV6B 3KYNB 2FBJL 1JNHA 3LD8B 5KS9F 3MZTA 3BIAX 4R2GC 1Z3GL 2FLRT 1BBDH 1RURL 5DJ0A 4NPYA 3V5KA 2AK4E 4OLWH 3CDFA 3DRQA 3WXWL 3FHAA 2RAMA 3NPSC 4PGJA 1QSFD 4PRAB 5DEFB 4RGOL 3T4AB 3PWPD 1KB5H 3F7QA 5EC1A 3TVMD 4MQTB 4UI2A 3BW9A 1A14L 3VFNB 3P0VH 1FNLA 1X4ZA 1VFMA 1NGPL 4WI9A 2AK1H 3PDDA 4CNIB 4BSWB 4UQ2A 1ACYH 4X6BA 1PZ5B 1MCWW 1F6FB 2OJZH 3BZEA 4LIQL 3WE6B 3HLAA 3G6DL 3MQIA 3BGMA 2VLJA 5EU6D 1NSNH 3GRWA 5I1IH 1SY6A 1RZ8A 3G5VB 4YDJB 4UIMA 3QXAA 5ISZE 1YEGH 2I07B 2EDTA 3NCFB 3GMMA 1INDH 2MMXA 4OV6F 2W0FA 2IFFL 4MA3B 4U0RC 4ZUUB 3SN6N 2P1YA 1XGTB 2MFNA 3BPNC 4D9LH 2V17L 1T03L 1GGYA 1SBSH 3MRKA 1LP9A 2IADB 4GQ9H 1CXFA 1DSFL 2VH5L 2BSTB 3BDYH 1XGPA 4IJ3B 5LCVL 1T7VA 2V9QA 4GJTB 4OF3A 1IT9L 3V4PH 2Z8RA 4FQCL 4LPWA 1HIMH 3QRGL 3WXVL 2ZSVB 3HI1B 2QADB 2YD4A 1UKSA 1MHPH 1B2WH 1ZLSL 1T22B 2K1MA 3HG1E 3WEXA 2YPLA 4J6RH 4K71C 5AZEH 3L5HA 4Z7QE 4F8TA 2N7BA 4IRSB 4Y1AA 2R0ZL 5FA3A 4R8WL 1CFVL 1HH6B 1EH9A 3ES6B 5I1LA 4QRSB 3QUYB 5KBNC 3QNZB 2ZNWA 3CH1B 1HSBB 2HA1A 5C86A 4YPGB 5I1GL 1KJ2H 4Y8DC 5FO8B 1MRDL 4L4TA 4P46C 3KVQA 4HC1H 4G8EA 1CDUA 3O0RH 2VLLB 3OGCA 3OZ9L 3QEUA 2CK2A 43CAA 4QHLA 3O3EB 4LSSH 5IESH 4P46A 4WEMB 3N0PB 3RUGB 5C0EA 3BMWA 3MBXH 1KBGH 3GI9L 4M7LH 4X9IA 4NZTH 1HE7A 4ZXBB 1X5IA 5I18L 3MV9D 1VKXA 2IH3A 4JFQB 1E4KC 2O5ZL 4MWFB 1G7MB 4PJAF 3SCMD 1D5MA 1YYML 4FOMA 4KHTH 3C6LC 3C6SA 4WHYG 4U1KB 3R1GL 4GAYB 3ZTJG 3W2DL 2ITCB 2Q8AH 1E4KA 3MV7D 3OAYK 5CILL 3OAZK 3CAFA 3EDEA 1KUMA 1CF8H 4AEIH 4FXKA 3L95B 3LN9A 4F9LC 5I1KH 1JE6A 3BT2L 5I30L 3JV0A 5AYUH 3S3JA 3ULVD 3NOIA 4PTTA 5IHBA 1H5BB 5IV2B 1HEZB 1MI5D 1CLZH 4Q7DA 4F9LA 5D6CB 1WBZB 3SGDI 5T5FH 4J4PA 4GW5B 4P3CL 1HWHB 1VPOL 1QRNB 2RHEA 2EH8L 3L5XH 2EIBA 5DUPL 4TNWF 3MRRA 3BRDA 2A6DB 2GAZA 1EO8L 4OCRL 4D0CA 1L0QA 2LVCA 1JF6A 5C6WH 1LO3L 5JZ7C 1JPGB 4NKDB 1DBJL 4HKZB 2F5AL 1DUZB 2XN9D 1PKQE 1CK0H 3LS4H 1MWAH 4HT1L 2R1XA 3N9GL 1AE6H 3HN3A 4X7SL 1JZ6A 5IB5A 1NC4A 3QQ9C 2X70B 4JKKA 3Q3GA 2YBRB 4JFPA 4MXQC 3VDBA 4U0QB 2CO6B 1S7TB 3C8KA 2XG4A 3MBED 4F57H 1N6QH 4GXUN 1Z6JT 3V8OA 1A7RL 1ZSDA 2PYEA 4M6OH 5HGAB 4LPUA 3I6GA 1PY4A 2C1OA 1SM3L 1YEEH 5DT1H 3VFOB 3ULVF 2IAMB 4APQA 1YPZF 2X4OB 3OKLB 3NZ8A 1GAFL 3MLYL 4CJ1A 1A6UL 5FO7B 2Z91A 2ZPKL 4NM8H 4HS8L 5DRWB 3CD4A 1OP5H 3ZE1E 3OF6D 4XTRC 3KPSD 1U95A 4OFDA 4U6VH 3D48R 2H6PA 4OIIH 4JHWH 4LSVL 4XNZC 1LEKA 3H0TB 4JM2B 4XNXH 4U6XA 3TBWB 1UQSB 2BDNH 4HS6A 3GBNL 1DVFD 4QOKD 1FORL 1YECL 3HZVA 4DGVH 2GTZB 3QIUC 3K1DA 2IWGA 4M48H 5EFIB 4HWZB 3QUZD 1UM6H 2ICWB 3S35X 1PZUB 1ZVHA 1F00I 3DBXA 4XAKE 4GRLD 2ESVA 1QKZH 5CJBA 3VGFA 1HXMB 5H8DA 1SJEB 2VLKA 1MUJB 4G8IB 3A6OA 1Y0LB 4CMMA 5KSBB 2DQGL 1RZIA 3WFCH 5IMLA 1X5XA 2HLAA 2FD6H 3NACL 2Z92A 3I84A 5CEZD 2XZCL 3FO2B 3VI3F 3BIKB 4NRZB 2HG5B 5INCB 1OSZB 2R0LL 1L0YA 5EUOA 2NY5H 3MJ7A 3DLQR 5IEHB 1LK3H 5A1AA 4NFBA 3VE0B 4G8GA 4KU1A 3T3MF 2DQTH 5GJTH 2V2XA 3PF2A 5MP6L 1S5HB 1CDIA 1QR4A 5E03A 4GRMB 1VHPA 1F8TH 1B6UA 1BQUA 1IFHL 1TFHA 1X5KA 1X5GA 1Y6KR 2X4PA 3PDOA 3RGVD 4GRWH 3CC5A 4JANB 3O9WC 4L4VB 2MPAL 1WQVT 3CFEB 4Y4FB 2Y25A 2NZ9C 5TQ2H 3GBML 1RV6X 4NQEA 4LLWB 3DIFB 3OXRA 2QQLH 4YWGL 3VFGH 1J0IA 4PUBH 3V5DB 1UYWL 4G9DA 1NLDL 1T2JA 4WI3A 5DEGB 3RTQC 4LPTA 4LDEB 4HMCA 4V2CB 2FATH 3IDGB 4S1DC 2F53E 3DHJA 3HR5A 4EDXA 4ERSL 3DARA 4PJDE 5I6XB 3RTQA 3SDDD 2G5RA 1KCVH 1BIIA 2MOVA 5D96B 4OCMC 4LEXL 3V6FB 1FL3B 2X1WL 3UTSA 1JYXA 4XAWH 3GSRB 1WEJL 2R4SL 4U4BA 4V1DB 2PTVA 4PJ7B 1DEEA 3FOLB 5L8LB 5HHPB 3PP3K 2F8XC 2C3VB 4Z0XB 3QI9C 1MHEB 3MNZB 2ED7A 1A3LH 1HQRA 3T0XA 4DJMA 3NIFE 5JOFA 3GMLB 1CLOL 2ZOKB 3GGWA 4FTVD 4HFUH 4NZRL 3D39B 4TUKH 4ZS6C 4KDVA 4I9WE 4AQOA 3QI9A 2BHYA 4GKOA 4OZIB 1GHFL 4HWEH 4Y0GA 1JPTL 1KPVA 4B5EA 4KY1L 4PJFB 1JBJA 3T3PE 5CP3A 5A3IC 2CR6A 4RZCA 5IQ9B 1LE9A 1KIQB 5GJSL 4YNYA 2GSIB 1S7WA 4RRPA 4HKXA 4PJCB 1AGCB 1S8DA 5BS0A 3OR6A 2RJMA 5TE6H 5HI3D 3T4YA 3PP4H 5FUCE 5IFAH 3I9GL 1MJ7H 1HQ4B 5A40E 3KPMA 3CIQA 3KNBB 1KLUA 1OB1A 1BFSA 4NZJA 4GBXB 3TT1L 1JN6B 1XAUA 1YNLH 1DANT 4YBQD 1YEJH 4LK4A 4OI9A 3VFNA 1RUAL 2D0GA 2CLZA 3INUH 1A6AB 3IDNB 3RDTC 1TETH 1OAYH 3LB6D 4N9GB 4C54A 2W59A 3LN4A 3RDTA 3RWIB 1FVDB 3IVKA 4CADA 1JTTA 3LQZA 1CFNA 2UWEB 3VXRA 1HOCB 4NC0B 2FX7L 3UCRA 3W11C 2QSCL 1U92B 1YEIL 2MCPL 4GG6E 3H8NA 4KVNH 2NY4C 5EO9B 5ESQA 4YDLC 4PREA 2L7JA 3EYSL 1ZS8B 5DWUH 4RMUA 2DIBA 3ARED 3CU7A 1QSEE 2C4XA 3SKMB 3FMGH 5E5MA 3ARFB 3TYGL 4LHUG 3I3BA 3FOMB 4N8VG 2ZJSH 4RMSA 4NC2B 3BP6B 1TJGH 3NIGE 2R23B 1H3VA 1KLFA 3V5HB 2CK0H 4DK3A 2NY0B 5HGHB 3RZWA 3GJEA 4J2XA 1IL1B 1RUQL 4OF0A 3QPXH 4G5ZH 3VWJC 3BH9A 4FXLA 4BK4A 1M71B 1YMHA 1EEYB 4LSRH 3G04A 5IB2A 3ARGD 2FX8H 2PXYD 4XNQB 1QUNA 1JYNA 3P9LA 4YHIB 3VWJA 2AI0H 3I50L 4UILL 2X05A 4S2SB 4R2GD 2HMIC 4PJIA 2O5YH 3V52L 1BQSA 5JO5B 2DI8A 2NY2B 5KVMC 1ZLWK 5CD5C 1JYVA 1C5DA 4JCMA 4PJEF 1P5VA 4WO4D 5I66B 1HINH 1A5FH 4K7PL 3RWFA 4F2MB 1MY5A 2WUBH 1IZKA 1LO2H 4HMDA 5GISH 2EH7H 1AR2A 2K7QA 3SBWC 4OBSA 5JHLH 1DN2A 4BKLB 4PJ5E 5HYJB 4F7CB 2OTUA 2XTLA 3SBWA 3S5LG 5E2TL 4D0BA 4WNQB 3SY0A 1Q94A 4PJGB 2JCCE 1K2DB 2D7NA 1QA9A 5SWSE 2NPLX 4QRTA 2CDFA 1KLGB 3REWB 3Q6FA 3CSYB 1R5IB 5CCKL 4Z78A 3GSNL 4KVCH 3KPLB 3O8XD 4WFFE 1QBLH 4LDLB 4P5TB 5IVNA 4QRRB 1C12A 2QJDA 1WISA 3MROB 2AJVH 2DQFA 3OR7A 1IEAA 3DX9A 1XGUA 1ZVYA 2DWEA 1QOKA 3MCG1 3WNMA 3B9KC 4LLDB 4FFYH 4MNHA 4QXUH 3MCKB 2GW5A 3FN0L 4ODXB 1EV2E 3IRPX 3RX5A 1BD2D 1CIUA 1MHCB 4QKXB 3WD5H 2P5WE 3B9KA 5GS2D 3VXSB 2WINA 1CD8A 1J0HA 5DURD 1YEGL 2G2RA 1XT5A 4JO1H 5ILTL 5IG7B 1JZ8A 3CX5J 4JVWA 2FIKA 5KOMC 5I1HH 1XR8A 1NFIB 2X70A 1QSFE 2E6JA 5FF6A 4RSVA 3D2UA 2RGSA 4G6FD 1D9KC 3PWPE 2GJ6D 2QQQA 3KYKH 2Y5TB 1ZOXA 4C56D 4JB9H 1Q72H 4OFKA 3RWDB 4EOWL 3CK0L 1IAII 3B2VL 4OSUL 3BDYL 2JIXA 3EZ8A 4ODUA 1NUFA 1D9KA 1JJUA 5BQ7B 4OGYL 3V4PL 5T33H 1HIML 2D4FA 4OFIA 4GW4B 4XNUH 1OAXH 5C0GA 1MHPL 5TF0A 2Z9TA 3AC0A 2N4IA 4YE4L 5C0AA 4PJBB 5EU6E 4OLVH 4Z7WF 4JZNB 3K4AA 5AZ2L 2L7UA 5A2JH 4TUOB 4ZUVB 2JB6B 3C6LD 3RY4A 5TE4L 1JZ3A 4X9GA 1IGFH 4X4YB 1JF1B 2ADJA 2KPNA 1KJ2L 3BPCB 4L3CB 5HVWA 2CR3A 5I9QB 3O0RL 1FZOB 1NCAH 5D1QD 3J8F7 5F7DA 1BVZA 3X11B 1EJOH 3NH7L 1FZJA 4X5XA 3MBXL 4WHTA 4EI6B 5GGVY 1NCWL 4IMKA 1KN4L 4X6CB 1NLBL 3UBXB 1G7QA 4NZTL 3NFPB 3RJDA 5EZOH 4PJAE 1FAIH 1S9WB 4JKPH 1AO7B 1GOHA 4NNYB 4HZLA 4IIQB 2CRZA 4ZO9A 2E8YA 1Y0LA 2GUOA 5KSBA 1MNUL 3GO1H 4KHTL 4I0PC 3LH2H 4K3EH 3M17A 3OKNB 4LLYA 5FUZL 5JZ7D 4GSDL 3BIKA 5I19H 3EDFA 2YMXH 1NGZB 3B6SA 1NC4D 2A6IB 4I0PA 4AEIL 4FXGA 4DQOL 1ZWIB 3FCTB 4NQCB 4N0FB 2HFEB 4L29B 3QFJB 4KI5C 1FYTD 4ZFGH 4G3YH 4HUWA 5AYUL 3IRZA 1IAKA 2PYED 4ZFOL 4PYHA 5DJYB 1G6VK 1IVLA 5I75B 5GRVK 5F96L 3C60D 1V3JA 3F12A 3AM8C 2AJZA 4HUNB 5ICZB 1BX2A 2Y4SA 5B22A 5C1MB 1EFQA 4XVJL 1BVKB 2ZUVA 3IAPA 3CUPB 1C1EH 3AM8A 4OCNC 4UT6H 5L2JA 4X9FA 5CSZA 1MFCH 3MJ8B 5HHQA 1XIWD 4LAQH 3IDXH 5INDB 2OQJB 4EI5D 2GSGA 4WUUD 1ULVA 3MV9E 5DD0H 4DTGL 5M95B 4MCYA 1CK0L 2P49B 3QXWA 1MY7A 4MX7B 3TYFA 1B6DA 5E5RB 3P4MB 5DD5L 5ITBH 2BNQB 2DQCH 4H26A 3MV7E 4JFEB 5CZXD 5DEGA 2PW2A 4P4RB 2BVQA 3ARWA 4MJ6B 3LQMA 1YEHL 4JVPA 4P9ML 4ONHA 5E94B 4HAFA 2R56H 3MA9H 5GRWA 3ULVE 1LMKA 1EFXB 3EO1A 4S0TD 1C7SA 1ROWA 1YPZE 3QIUD 1MI5E 2ESVD 1RQ5A 5DT1L 5GGTH 1R3LB 3V6FA 1A2YB 1MF2H 3ILPB 4RISL 3EHBC 5J8OA 1I9JL 4ORGA 5T1DL 2VLKD 2F5BL 1CGSL 3O6MH 4NKIH 3MLZL 4V1DA 2OP4H 3QAZC 1GC1C 2DIJA 2DM7A 4X7TA 1NCTA 3A6BH 1ES0B 5DRZA 4JAMB 2Y72A 5LBSH 4IOFD 1KCRL 1BQHA 1N3NB 4IBLT 1OGAB 3QNYB 4LQ1A 4NNPL 5DJAB 2GITA 3G5ZA 1IBGH 4JY5H 4JHWL 1CT8A 4OFPA 1A7OH 2XN9E 3V2AR 4CW1B 5J1TC 3BQUC 4RGMC 4PJ8C 5L6YH 1YDPB 5IJKC 5JW4Q 2DF3A 1NDMA 2YR3A 2VDPH 1IKNA 4XXDA 3HNVL 4XI5D 1UM4H 3KPRA 3LKOB 4XBGB 3ROOB 2J12B 1UM6L 2XKNB 5D7JD 3KPQA 1LNUB 3A6CL 4PJ8A 3SGJC 1FPTH 5IJKA 5F7EL 2EC8A 3ORJA 2B1AL 1HHGB 5B39G 43C9B 1F6AB 4HDIB 2RFXB 2DRUA 2HJFA 3SGJA 1KJVA 2LAAA 3FT4A 3O9WD 5MENB 1N59B 2FBOJ 2FD6L 2H9GA 4OZ4A 3RWJA 4Y16D 2VIRB 3HFML 3FO1B 3IDIA 2P7TA 4G6JH 1J18A 1ONQB 3KPPB 4HWUA 4JFZL 1GZQB 1L9MA 4E9LA 2V2TA 3KPSE 2W0PA 1L9NA 4OZGA 3T3ME 3JV6A 3B8YA 1AGEB 3BXNA 4ISVB 2DLTA 2X4SA 4JRXA 5F44A 4QOKE 3VFVB 1O0VA 5MEQB 2BC4B 1F8TL 4JO3H 3FN3A 3ZHDA 2ATKB 5FAAA 2ZUTA 1YY8B 3VXUB 4E41A 5MI0B 2QQNL 1TZIB 5IVXA 3QB7C 3HZYA 3KAAA 1B0GB 5I0ZA 1UB5A 2VDQH 5MEOA 5HHOB 2FSEA 3FL7A 4JY4A 2E6PA 5TH2A 5TQ2L 1FLRH 2I5YH 4PJ9D 5KSVB 3VFGL 3QDGD 3FAXA 5CEZE 2XFXB 4PRPB 5F7KC 4ZSOB 2AXGB 3CFCL 3TN0C 3VGAC 2VDML 5ENWA 2FATL 2X89D 4HGMA 1IM9B 5C0FA 1T1WB 2X4TA 3I02B 3UYRH 4PB9H 2VDLH 5A3ID 3TN0A 3V0WL 3IFOA 1KCVL 1UACL 3O4LA 3VXPB 3DO7A 5HBBA 2R4RH 3LOWA 1B0RB 4XCFH 1RUMH 4MDJA 4WENB 1FL6A 5LXGL 5DJCA 4P48A 2EYRB 3VRIB 4KROB 4NHUB 4OF5A 4X0KA 4C4KT 4YDIH 4XMPL 4P2QA 4EVNB 5DHYA 1OP3K 1DBMH 5EOCH 3GMNA 3RI5F 4B7LA 1OP9A 5AD0A 1FFNA 4P2RD 2O61B 3RDTD 4NJAH 2YD2A 3O6FC 1XF5A 5ANMB 2NW3A 4YC2B 4FZEH 3QYCA 1DQQB 4LHUA 1F11B 4J23A 3O6FA 2FH8A 4HQQL 3RL1A 4RFEA 5IWLC 3D6GA 4OGXL 3WO4C 4WV1B 4QYOB 1JWUB 1G7PB 5TE6L 5JOEA 3DOSA 3OXSA 4EJ1C 5IWLA 1H8NA 1JGDA 4IHOA 2Q76A 4UAOC 2P47B 1P6AB 5B38A 5ITFB 1FV1A 2ZUXA 3BP7A 2XWBA 5IQ7L 5DZNA 5H2BA 1YEJL 5I15H 1KELL 3P9MB 3N1QC 3VJ6A 5FYJH 5BRZD 3INUL 2YXFA 5CJXC 1MSPA 1OAYL 4ZNEA 1MPAH 4QRUB 1KXTB 4TVSa 2YD5A 4RAUB 4ZUSA 1FCCA 4NIKB 5CEYA 1O5DT 4FTVE 1CL7L 5CJXA 5DJ2B 3L7FB 5HVGB 3IDYC 3QWRA 5HJ3B 4PRIB 3VWJD 4NO0A 2HKFL 4URTB 2X1XR 4P3WA 3NIDF 5DA0B 3EYFA 1QFUL 1P7KB 2YPVL 3MLVH 5DWUL 4TYUA 5T1LD 4Y4KD 4FQXB 2BVOB 3C5ZC 3LIZL 4HEME 5E1AA 5GRXG 5IG7A 3MRPB 3GSNA 4CMHB 5IOPA 4FZ8H 5LGJA 1RIUL 3C5JA 1OSPL 3C5ZA 2ZJSL 3BGFC 3G9AB 2JJVA 1I1AB 1G0XA 3W0WA 2FYYB 1OAKH 1T1YA 4RGNC 1KB9J 4S1SL 4UDTB 1GL4B 1N64H 4KKAD 4GKNB 5IF0B 1IAOB 3AY4A 3MRMB 3QPXL 5T3XH 1DQDL 4FFWD 4U7MA 4N8PA 4I3SH 4QXWA 3H7BB 3E6HA 4F7MB 4H88H 2FX8L 4BQ8A 3QO1B 5EU5B 5E4EC 4ELMB 3X12B 1OAUL 4MQSB 5C0CA 1DUYB 3R06A 4NWTH 3RPIB 2AI0L 1NMAH 3ECBB 4OT1H 5MERB 4GAJH 2J6EH 4KGJA 5E8EA 2JLLA 1BWMA 2ATPA 3BHBA 3BEVB 3REVA 1BZ9A 3I6KA 3TO4C 4F7EB 1X5LA 4PJIF 2ARJB 1V3MA 1VEOA 4PJEE 3WUWA 3QO0A 2F74B 4LMQE 1Q9LA 2ADFL 1CTNA 1T04B 4JFFD 2JE8A 4QXGH 3TO4A 3MGOB 1LEIA 5F9JB 2B2XH 5C0ND 1AHWB 2WUBL 1LO4H 1LO2L 2WQRA 2EH7L 5IFJA 1NJ9B 4PY8I 4TTDD 2P5EB 4HW6A 4TVPL 1CFQA 1I8KA 3VXQB 3HE6B 1GGIH 5JMOC 2X4QA 1OD7A 5TF1H 1AGDA 5D72L 1V7NH 3ZKMC 2FHFA 2C9AA 2J5LC 3QULA 5JPNA 4OIAA 1CWVA 1KJ2A 5ETUB 5EU4B 3BJLA 5M7QA 3WN5C 4NM4L 4E0RB 3DXAD 5D70H 2DYPB 3D25B 1BJ1H 4F15C 4HF5L 5CZKA 1IE5A 3VA2C 1XZ0B 5HVHB 4P23C 4N5UA 5E24E 4R7NA 1TLKA 4JFHD 5DVLA 3WN5A 4LP4A 2DD8H 3BYYA 4KVCL 4OCSH 2Y9RT 1YMMB 4AIZA 4U6TA 1RJYA 1J05A 1XR9A 2DQHH 3I2CL 3SDAB 4Z7OE 1ZHBB 4WEUD 2AJVL 4P23A 1V7MH 5DJDB 3LS5L 3WL9B 2RIKA 2ZOLB 3EYOA 4U6HA 4FFYL 5DR5H 2Z93B 5ICZA 1BVKA 4HLJA 4OD2B 1RJCA 3OJ2C 1DL7L 4DEPC 2YK1H 3T0AA 5KG9B 4M61B 4Y5XB 1I1RA 2AV1B 1OAZL 2W0KA 4LLQA 5GZOC 1JWMA 1INEH 4AK1A 1BBJB 4P4KC 4YQXH 3D0LB 3M1BB 2CLRA 4HUMB 4ZOCA 1WAAA 4NKOA 1T5WB 1I1CA 5E2UH 4XBPA 1G7IA 5K9QG 3BWUC 3H9HA 3KYAA 5DGQA 12E8H 4P4KA 5CLTA 1U8HA 4ZFOA 4CN6A 4EBQL 2OK0H 2QLVB 5DI8B 4D0DA 3OPZH 5FUOH 4HUUB 1SEBA 1IC5L 5D7LB 1K4DA 3BO8A 3KYKL 1XF2A 1KC5L 4W68A 2WLYA 4GXUM 1Q72L 1WCBB 3RNQA 3RKDD 3KJ4B 5GGRA 5T33L 3DYPA 4XNUL 3D69B 1GYAA 4Z7WE 1JTOA 2CJUL 3U36A 1BD2E 3O3BA 4PJHA 2YD1A 2DL2A 3BKCH 2C3WA 4EUPH 1BECA 2R8SH 5BOZG 3U6RB 2X9WA 5CD3A 1I7TB 4LCUB 3QP3A 1IGFL 4LNVA 2AERT 3QDMB 5FCSH 4O2CA 1FRGH 3VG9B 5ALCH 4L3EA 5LQBH 2AK4B 4MHHG 4Q9RH 2AXFA 4OD1L 1ZLUK 3BD4A 4UBDC 1HKFA 5KVDH 1NCAL 2H8PB 3I75A 3LKOA 4O2EA 4NYLB 1OCWH 2GJ6E 5JIPA 3MCLH 2R2BA 2G9HA 4C56E 4IRJB 3H9SA 2KQNA 1YNTB 2CDGB 2JJSC 2XTJC 4P0DA 4XGZB 1PAMA 2LQRA 3F7VA 4UMGA 1MJJA 3SKJL 3ULUH 1JPSH 5T1MA 2JJSA 4MA1B 4MJIB 3HE7C 5I19L 1U3HD 1NEZB 3O6KL 3WSQH 2FWOB 1OTUD 1DE4A 5IBTL 2W60A 3HE7A 4XH2B 1T0NA 1ZA3A 1E6JH 4HH8A 1M1SA 4MGXA 3C9NA 4HWBH 4LARH 5IW6A 2ZG2A 1I1YB 4YHOL 4QRPA 4WJ5B 5F71A 1M4KA 1BREA 4Y5VB 1MJUH 3IXAA 5HPOA 5C3TA 1MQKL 4QHKJ 1U93A 2NY5C 5HYQB 5J57B 1C1EL 3SDCC 3UYOD 3WLBB 2C26A 1RK0B 2FLBT 1MFCL 5IVZA 4A6YB 1D5IH 4Q9CA 5FGBC 5CJOH 3PV6B 2A6JB 2VZUA 1S78C 1GZPA 1NBVH 4HIXL 4ZD3L 3SDCA 4KHXH 3KHQA 3BD3A 2WIMA 4U1JB 5J6HA 5FGBA 5ITBL 4PGCB 2D7PA 1OT2A 1CFSA 5B39A 5DEZA 3TJHD 2YSSA 1VA9A 1Z5LB 2NY6C 3TESA 3ZMRA 3D85B 4L5FH 1A6TB 3BQUD 1U8OB 2X4UB 2R56L 5DK0A 1FYTE 3EOAA 5JDSA 3U0TB 5F1KC 3UTOA 2DMCA 2PYEE 3LZFH 3IKCB 3U1SH 5CHNA 3FQTA 1FCGA 1MF2L 1Q9WA 1TJIH 4RMQA 2X5PA 1J9CT 1RD6A 4G6MH 4M03A 1JGVH 2OP4L 5DTFA 2Y07H 1A0QL 1EXUA 4K9EL 1B0WA 1XGRB 3A6BL 3GIZL 4I77L 5D2LA 1UZ6F 4HBCH 3WNNA 1E4WH 2PO6B 2X6MA 3NZHL 4OM1H 3P9WB 1RMFH 5IBLD 1U6AH 4OV5A 3QCTL 1IBGL 4PRDB 4WUUE 1WWBX 4RMWA 1LDSA 5ANMA 4IRZL 1MVFA 2DMKA 4HK0A 4MLIA 3V6BR 1DQQA 5J89A 1E4XH 1K8IA 3PHQB 3WIFA 5D4QA 4XPGH 3MLUL 2CKBB 1Z9OA 1IGTB 4PV9B 3BUYA 4JGUA 1FSKC 1I1FA 1G1YA 3JTTA 2OXGA 5T1KD 1J10A 1EUUA 3PABA 1H0DB 5H35B 3GHBL 3BKML 1FPTL 4WGVB 3UXFA 2ESVE 3O6LH 2IG2H 3OKKB 4BFGA 1AQKH 1XGYH 3QA3B 2X4RB 1CXEA 2VLKE 3M8OH 2NYYD 3S96B 3DX6B 3PGDB 2XZAH 4HKJB 2VR4A 4HK3J 5CWSB 3W5NA 1XF3B 1KG0A 3ULVH 4PRHD 3SHSA 1MCOH 4W6WB 3MMEB 1M05B 3FQXB 2AABH 1FNSH 3NGBB 4KMLB 5EIIA 5DD6A 4PRIA 4W4OC 5ESVA 3S35L 1U91A 4OZGF 5I73B 1UCBH 2FZ3A 3FB7A 1T4KA 2BVPB 1R5WB 1C5CH 1LE5B 3T0ED 4W4OA 2X1PA 1HYSD 3GMPA 3IKKA 4FQXA 1SQ2N 3TCLB 3WIHH 1J1PH 2P8LB 5HYSB 1A1MB 4EKXA 4LCWA 4YBLC 2IQAB 2EICA 5IMKB 4PG2C 4XHQA 2BCKA 4OI7A 5DD3L 1F5WA 4MQXD 4UOW1 2I5YL 3F7YA 5JXED 3SJVA 2DMBA 4NRXA 4TOYL 4MXWH 1G84A 2V5YA 2Q1EA 3EOYG 4PG2A 5D5MF 1AFVH 5F89A 3AMLA 2Q7YA 4MA8H 2VSCA 2CPCA 4EXPX 4PY8J 4D9QD 1CVSC 1F42A 4TTGA 1YEFL 1QR1A 2GTWB 5EU7C 3L3KB 3QIWB 4MD4A 3SDXB 3MNVA 3VDAA 3X3GH 5FYKD 5TPWH 2UYLA 3UYRL 1KYOK 1WWWX 2BNRD 5SX5K 4QLRA 2IQ9H 4RX4A 2XZZA 4EN3C 4YHYC 3L3HB 2XY1A 1IEBB 3SKOA 3FT3B 4K3DL 2XNAB 3HPJB 3CFJB 3ROLB 4EN3A 1FVEA 5FECA 3MOQA 3U0WH 4YJZL 4OM0H 4BZ1H 1LEGB 3VXMB 1CGUA 1MCKA 2NW2B 5K9OB 1T04A 3GUTB 3DUSA 3QXVA 1QYGH 4XP4H 4HH9B 1IQWH 3LEXA 5C0BB 4KK8C 4NJAL 3FB8A 2VL5A 3IS0X 3HI6L 3QZWB 3OAYH 4M6NL 3MRDB 2ZNXA 1R3HB 3OAZH 4U1HB 2J8UB 3LKPB 3BVNA 3QDGE 4EDWH 4YHZH 15C8H 5JW4M 4Y88A 4CGTA 2VISB 2IMNA 4Q74A 5DVOA 4FFVD 3STLA 3KR3H 2MQCA 1YN7B 3FB6B 5E6IC 2DOCA 4B7IA 1J1OH 4KMQA 5CGMA 3KLSA 4NQVB 5GIRB 3PE9A 4GQPH 2X7LA 4KJYB 5SWZA 4FFZL 6CGTA 5E6IA 4M8QB 2AVGA 2B7DT 4LPYA 3QEQD 3NABH 1U8QA 1IGJA 1CXLA 4GFTB 3IU4L 4WI8A 4I18B 1KNOB 4U1NB 4PJXF 2D7OA 5KJRH 1MPAL 2NY3B 5E9DB 3LCYA 5AWNL 3S3SA 3SPVB 1PW3A 2VRAA 1CIDA 5ICXB 1AY1H 4J3TA 4R7DA 4P2RE 5IT2H 5DMJB 1EEZA 4HIIB 1L7TH 4EEEA 5DRXA 3VXRE 3HS0B 3NIDE 1AP2B 2EKJA 3V6OC 1IGCH 3HUJA 3MFFB 1OPGH 2APWA 5L2KB 1BP3B 4NP4H 1I7ZB 3QPQC 1J8HA 3NCJL 3MXVL 4J7RA 2APXA 3V6OA 4N8CH 3TBYA 2PKDA 3Q2CA 1KFAH 2XQBL 1T2QL 4FMKA 3OKEB 4M43H 3FFDB 3T0DA 5HI5C 3BDXA 1AIFB 2X09A 4IOSD 5L0QC 4MMZC 4GAGH 3PWLB 1MQ8A 1G9MH 4M7JL 5BRZE 1X7QB 1N64L 1GGUA 3PL6B 3NFSH 5CS7A 1Q9OB 4Y2DB 5EZJB 1KPRA 2D31B 5C8JB 5DD1H 5I1EL 2CIIB 2NX5D 4I3SL 4NQDD 2GY5A 1RY7B 4MXVF 1QLFA 3RZCB 5HYIA 1A6WL 4WU5A 2KZ1B 1HKLH 3DHMA 1FFOA 1NMAL 5FOBA 4G43B 4OT1L 1I3GL 3ZDYF 5E08H 1EVUA 2J6EL 5DQJB 3S37H 4PJIE 4ONFH 2FGWL 3MO1A 4NNXB 5DFVC 2BY1A 3RRQA 4X4ZA 1CTOA 1W0WB 3MGTA 3RHWK 1P4LA 2ZCKL 5FGSA 5C07A 3E8UL 3KPOA 1NDGA 2AK4A 4LHJB 4BH8A 4PBVC 1NC2A 5K9QI 1DLFH 5FCUH 1DLHA 4WUKH 1W72H 3VFTB 1A1OB 1TPXB 4MA7L 4OCYL 2CDEB 1J1XL 4GKZA 5HPMA 1ZGLM 1GGIL 5D2NE 2B20A 1QEWB 25C8H 2YRLA 3V9FA 3U7YH 5TF1L 3QEHB 5DHVH 4F3FA 4NO3A 5GGUA 3VI4F 1FGNL 1T0MA 4P4KD 3S36X 5D7SH 4C57C 3QJFB 1EHXA 2BMKA 3UJIH 1YN6B 4RWHA 4XVUC 1S7RA 5D70L 7CGTA 2IPUG 3MA7B 3PGCA 4X6FA 3UTZA 1CE6B 1JUFB 2J2ZA 3HMWH 35C8H 4LVHC 3OX8B 5TJWK 2EDRA 3DROA 1QLRB 5ISZA 2WBJB 4YR6B 5JQ6H 1KOAA 4AMKH 2ITDA 3TF7C 1F3RB 4BFIA 4LL9A 1V7ML 4JFFE 4MAYC 3BMVA 3FO0H 1WC7B 3H2WA 4MNGE 1U8KA 2BSRB 3UBXG 5EIVA 4KTDH 5HYQA 3UAJC 4MD5B 3HPLA 3KXFB 4JRYD 1BLNA 1VSCA 1WIPA 3ARBD 4MAYA 4MHHI 3GMQB 4KH2A 4X98A 5K59F 5I17B 1KIRA 3MJ9H 2B4CH 3TGXA 5HYFA 1KTLA 4G42A 3EFFB 4JHAL 3K3QA 12E8L 3GDBA 5DQDH 1JHTB 1ZTXH 3CX5K 2VLRD 1MLBA 3HG1A 4G9FB 3ZE2F 4KZDL 1F02I 4EUPG 2OMBA 3DXAE 3PP3H 6FABH 4HUXA 4KAQH 3NAAH 5F7HA 2FX9L 3CDYA 4JFHE 9CGTA 1P7QD 3DYMA 4QT5A 3N1GC 2K7PA 4R3SA 3U2SB 5E6ZA 4ELKA 4TUJB 2XACC 4QRQB 1VFBA 4XCEB 4TPRL 4ONGL 3QIBC 3CZFA 2PF6A 1CYGA 3EUUA 3BAEH 2Q6WA 4UV7L 3TT3H 5IJVB 3JTSB 1FH5H 3ARRA 3OJDA 3QIBA 4HGWA 1L6ZA 1QFPA 4KRMB 1JF5A 5CBAB 3CLFH 2F58H 5BV7B 4WDIA 3PIQB 3FFCD 3QDJD 4PJ5B 1DP0A 3VFWA 5D71L 3BKJL 5C08B 5KS9B 5LGKA 4FA8A 1A6PA 2RCSH 4ZDHA 1R5VA 3VWKC 4I1NB 4XNMA 1NUDA 2AJXL 5ALCL 1S7VA 3PGFH 5E1HB 3VD5A 2QQKH 5KVDL 3T04D 1KCLA 4NWUL 3VWKA 4A6YH 2DQUL 3MCLL 3TV3L 1H3PH 5C0IB 5FGRA 4WW1A 3S34H 4R96A 4MDIA 3O3DB 1HK6A 3HCVA 1AD9A 3QUXC 3G6JF 3SKNA 1ZT7B 3RU8H 4D3CH 3CDGB 2FIRT 3ULUL 1AR1C 4U1LA 4Q97A 4H8WH 4G8FB 4RNRB 1BOYA 3CMGA 3QUXA 3CXHJ 1EUTA 1YNKH 5D1ZB 4KRPB 1OARL 5E7BA 4YHMH 3RVXD 4ODHH 4XPBH 1PKQA 3VFMB 4LARL 2VZOA 3B9EA 1M7DB 3BZ4A 4Y4HC 3WDJA 2VABA 1KIPB 4PGDA 5IB3A 2NQCA 2OR7A 2HJLB 2J1KA 5DVKA 2F19L 1MJUL 4PFEA 1QSFB 4Y4HA 2Y7QA 1F58H 5EC2A 3GSOB 1KTRL 2P8LA 4JZOA 4WCYH 2BX5A 5E5UB 3T1FB 2V7NA 2AQ3A 4MQ7B 5DJXA 2CMRH 1I9IH 1KJMA 1HHHA 2HFGL 3TPUA 4PBWD 5TDNB 1NCDL 2CKBH 3QQ4B 2QR0B 3IGAA 4Z18A 3ZHKA 3FRUA 2X4NB 1J8KA 1J0ZA 3S6CA 1Z2KA 1QVOA 3U4BH 1FN4B 5EU6B 5CMAB 4ZAKD 1F4YH 1ZLWH 3MRHB 5JXAL 2SEBA 3FQUB 5KTEH 1X4YA 1FNAA 1Q9KB 3LZFL 2F15A 1RZGA 1MFAH 1OGTB 2IALA 1CD1B 4QY8A 5E99H 4RQQB 1JHKL 5KAQF 1TJIL 1E6OH 4GRWF 3MRNA 5J11C 4G6ML 3H6JA 1FO0L 3MR9A 2J8OA 1UZ6E 1RHHB 5I1JH 5LAXB 3TA3D 3NCMA 3RVVD 3H42H 1JZ4A 4FNLH 3IJSA 5F1IB 5DK2B 4DZ8B 3ARTA 1U6AL 1HDMA 3LDBB 4N9OB 3QZWA 1YY9C 1RJLA 1RJZA 4U1HA 2AAVA 2YD9A 5E8DL 4J1UB 3CSGA 1IJ9A 4Y19B 1TZHA 3BWAA 3TZVB 3HC0B 1P4IL 4BQBA 3S4SB 3QG7H 5KW9H 2VQUA 1S3KL 1Q0YH 1QQDB 3IU3B 3LKNA 5D93B 1FO0B 1WTGT 4FQHB 4HCRL 4HX1A 4LSPL 2D7QA 3WFBL 4CVWA 4AZ8A 4X83A 4ODSH 4WY7H 4JDVB 5FB8B 2GCYA 4ODTH 4K2UH 1J0JA 1MIMH 2EIEA 2DJ4A 2NXYB 3LMJL 3G9VA 4Q9BA 4X7DC 5F7LB 2CLVA 5C0JA 3ZE0F 4YHPA 2G75B 5IK3B 4AIOA 4YHNA 1HZHH 1T7ZA 1RSFA 3ULVL 3GI8H 3EOBB 3P4NA 3WBDA 1ZHKB 3IDMB 3CCHB 4YLQT 1KEML 1OF2A 5GGRY 1Y18A 2CKNA 5I1AB 2A9NL 1I75A 4JFYB 1FDLH 4OZGE 5HHXL 2V5SA 1ORQA 3G5XB 2IEPA 3SCMB 5JHDD 1EVTC 1NQBA 1WITA 3MFFA 4UZGA 2VKXA 3HAEH 1C5CL 3O81A 5F1NA 3OKDB 3LEYH 3MV7B 1HHIB 2Y1VA 4CAGA 1DQJA 3KG5A 2R0WH 3ARUA 3WIHL 3RVUC 1G0YR 4Q9QL 1BWWA 2F53A 3VU2A 4PJDA 1D5XB 2Y06L 3O2DH 3P4OB 1A4KA 2VXQH 3ZKXC 1DBBH 3DVFA 2P43B 3ULSB 3U4EB 3WNLA 4FS0A 1YPZB 1MI5B 2W07A 1A6VH 3IJHA 2FJFB 4LP5A 5D5ME 3UO1H 1F2XK 5KN5A 4MXWL 2OL3B 1H8SA 4LCCC 1AXSA 3P73B 4KMTH 3D0VA 1QPXA 4LBEB 5B4MC 2FO4B 1NMCC 1ZGLB 3GMRB 4KK8D 3B5HA 3CPLB 4PRHE 1ZLVK 3E2HC 4LCCA 3GSUB 5C92A 4XCCH 1UA6H 5TPWL 2A73B 5D7IF 4OLXH 3UMTA 1P9MC 1WJ3A 1CU4H 2A83B 4WWKB 2C7UB 2GIYA 1BOGA 5FUCC 3CVIH 3T0EE 4HJ0D 1II4E 4H20L 1P9MA 3EGSA 4PLJD 2HTLD 3WS6C 5KSUA 3T2NL 1WFUA 3G08A 4OM0L 1S7QB 4JQIH 4PLOB 2ADGA 1AC6A 4HK3N 1H3GA 1LGVA 4KKCD 3VRJB 3WFHA 1WZ1L 3L3DA 1IQWL 1U8PB 4U3CA 3WS6A 1YEKL 4H25B 3K8MA 2DDQH 2D2OA 3PWNB 4M7KH 4UOJA 4EDWL 4Z7NF 2AKRB 2WV3A 4YHZL 1CG9B 4GMSH 2DM4A 3D9AL 1ZT4B 2MWCA 5F3HB 2CGRL 5HHNB 3KR3L 3K80A 4P5MA 4D9QE 5IM7B 4G6KL 2J6EA 4YHKL 1XEDA 3B8SA 1TTFA 3UTTD 2UVFA 4MCZA 5FYKE 3GSWA 1K4CB 2BNRE 1G6RB 3UJTL 1AQDA 3W9DB 4BSVB 4HIEB 5CEZL 2EE6A 5GS1B 4BELD 4GG6A 4MB4A 2H45A 3B2UC 4IRSD 2HVJB 4PJXE 1ACZA 2APVA 1QLRA 5DMIL 1SMOA 1BEYL 2GFBA 3NA4A 5DFWH 1RZ7L 3L5WA 4WW2C 1JGEA 3GKZA 3GSQA 3QCVL 3QUYD 1QSEA 3HA0A 3QUZB 4Z7UB 2FJHA 3DV4B 3VXTA 3RVWC 3L3GB 4YEFA 1UKTA 4WW2A 4PLKD 5IT2L 4LSDA 5K9JH 5DO2C 4MD5A 3D1MC 4L8BA 1MFEH 2HTKD 1MCPH 2DWDA 3SGKC 1FE8H 3TNNB 1I4FB 2FCBA 3TIDB 3AB0C 4R6UA 4L8DA 5JW5A 1DZBA 4XCNB 4PG9A 4ZXBD 3SGKA 4P57B 1JHTA 4TQEL 4X6DB 5D1XB 4L4JA 4MJ5B 4OB5H 5C07D 3TBVB 3QEQE 5BJTB 3ZDZF 3DETC 1S9VB 3QHFL 3HC4H 4AM0B 4U1MA 3DMMC 4ZODA 1SYSB 4GAGL 1G9ML 3FB5B 5FO9A 1GPOL 1YUHB 1VFUA 1N26A 5CEXA 1ED3B 3BD5A 4MXVE 4RBPK 2R2EB 5DD1L 4I4WB 1JI2A 1FLTX 3K7UA 1HKLL 4OJFL 3T2OA 1QRND 4IS6A 3BSZH 1VGKA 3ZDYE 3DGGA 2ADIA 4Z5RB 1F3DJ 3T65A 2V7HA 3UBXI 3S37L 5B3JF 2GYSA 3RUGF 4IEFB 1GGBL 1K8DB 2R15A 4QF1B 4PPTA 3UPAA 1QRKA 1EGJH 2VN7A 3ARDB 3OKYA 4JG0H 3WDIA 4N0UE 3SDDB 3MOBH 3TJEL 1TITA 4I2XE 1V05A 2JCCA 4P2YA 4HPOL 2BJMH 1AGFB 3F58H 1DLFL 5SWSA 4ETQB 3B43A 4O02H 4WUKL 4I3RL 1NUGA 4OZFB 5EOQH 4MAYD 5F1SA 5GGSB 1YYLH 3Q6GH 2VKWA 3UP1A 1JRHL 4EUPA 4QEGA 4QCIB 1A7BA 1WFTA 5GGVL 5FA4B 8FABB 1JHLH 1IQDB 3EYVB 1MFBL 5C09B 3U7YL 2IAMD 2NX5E 4NQDE 4Z76A 4WFED 2EDNA 2XXMB 4KRLB 2R1WB 2W1NA 1T5XA 5EO0B 5CP7B 1QP1A 4MJ4A 5C6PB 1S7UA 2P5WA 1J86A 4OI8A 3CNKA 3A67L 1V3KA 1A4JB 2BNUA 1XGQB 5FK9B 1S5IL 2M1KA 3VXNB 2B5IC 1ADQH 5JQ6L 3ULUC 1HI6B 4JM2D 3O4OC 4QHMA 1TQBC 3BYTA 4Q0XH 4OIBA 3TVMC 5D9SB 1KCUH 4JDZB 4OUUB 1MREL 4GH7B 1UM5H 1QSFA 2GT9A 4NN6B 4P9HH 5DSCB 5BV7H 4KTDL 2HYMA 5TQ0H 3IFLH 1I8MA 1FIGH 2XZQL 3PWPA 4OFVA 3TVMA 4JR9L 1ORSA 2FEEL 4R9HA 4JVUA 1AD0A 2QHRL 1E27A 4BUHA 3RIFF 5EO1B 4HIHA 3P77B 2RQ8A 4JJ5A 4G80B 5J13B 4CVXA 1NEZG 4HUVA 1DDHB 3LHPH 3ZE2E 4K8RH 4OCXH 5TFSH 2Z35B 4Z7VE 1JZ5A 2A38A 1CICB 1FN4A 5IKCB 4LLUB 3HMXH 4N1CA 6FABL 1R3JB 2BP3A 3FQUA 4KAQL 4K94L 4KV5E 3ARPA 1OP3H 3KYOA 4JQXC 4HKBB 1TVBA 2A1WH 2ED9A 1JIBA 1T1XB 2DJUA 4JN2A 1BPVA 3FO9B 4UOW0 5A16B 2XPGB 1F45A 1GRWA 2AEPH 4JQXA 5DUBA 5EOCJ 3TEUA 5FDWA 1ZHLA 1KSRA 1SJVA 5JR1H 2AV7B 4YDKH 4LEOA 3WJJA 3BAEL 3BN9D 4K7FB 3PQYB 3DTXB 4HPYL 3TT3L 3T77A 2FR4A 1FH5L 4JRYE 2EDDA 1QPPA 1NH6A 1CFBA 1IC7H 4AENA 4Q6IC 4DZ8A 4NZDA 3BP4B 4PJAA 1EBAA 3U9UA 2E8ZA 3EO0B 5E2VH 4M6MH 4Q6IA 4Y4FD 2XKSA 1X9QA 5JORA 1HSAA 1JNHB 1U8JA 2YPKA 2VLRE 4AJ0A 3V5KB 4NPYB 2FJGA 1P1ZB 3I85A 2EIZA 5JW3L 3DRQB 3L6FA 4N0YH 4MSWA 3IU3A 1FO0A 4R2GB 1VADA 4FQHA 1H3PL 2D7MA 5EC1B 4JO2H 3BW9B 4NQXA 3NPSB 2DQJL 3G6JE 3IB4A 2UZIH 3MLRH 4UQ2B 4X6BB 1KENH 4P59H 4TSAH 4KQ4H 1CD9B 1E4XI 3HLAB 1F90L 3BP5A 3MRBA 2NXZC 3HNSH 2VLJB 1A7PH 3T8XA 2YA1A 3ARXA 5HDOA 1BFOA 3FFCE 3QDJE 1RZ8B 4UIMB 3RNKA 3QXAB 4HCRA 3MV9A 4YHML 3D39D 1E4JA 4ODHL 4XPBL 3SCMA 3GMMB 4LF3A 5EORH 2IMMA 5HYEA 1ODAA 2W9DH 3T0WA 2W0FB 3MRGA 4MB5A 4G7YL 1I7RA 2LU7A 1A64A 3MV7A 2AJYL 1Z0MA 2E7HA 4P5KA 3ULVC 1JK8A 5GSVA 4U0RB 1ZANL 1L4IA 3MRKB 5F9DC 2DKMA 4FQ1H 4ZO7A 5DK3A 4S11A 3BPNB 2PYFA 1R3IL 4K3JH 4XC1L 3U4EA 1YPZA 5IR1A 1I9IL 2J88L 1PVHA 4I48A 4XMLL 1XGPB 5FYLD 4J3XA 1NGYA 5ADPL 4GBXD 3U4BL 4DOHB 1PQZA 5BVJA 4I8DA 1IMHC 3GMRA 1YY9D 3WEXB 5ABDE 2YPLB 1F4YL 4YXLH 4PJ7F 4UU9A 4Y1AB 1RZFH 5FA3B 4XP9L 5DURB 1MJ8L 1NCCL 3WIHA 5I1LB 1GOFA 3IT8D 3VFRA 4K71B 4X9HA 2XN9A 1U3YA 4GRWE 5F9OH 4PP1D 5E99L 4DVBA 1NAML 1E6OL 1G0DA 3MBEC 3K4DA 4PRNA 5F7WC 3SQOL 2AQ2A 4LRNH 4NQSA 3UZVB 4OZIF 4L4TB 3CSBA 1RULH 5IROC 2Q20A 4G8EB 4BH7A 5I1JL 3LKRA 3MBEA 3QEUB 3QHZH 4LKCA 43CAB 2EXWC 4QHLB 1VFAA 4P46B 4OAWA 4PJCF 5IROA 2ORBH 5TE7H 5C0EB 3SE3C 1NEUA 4B41A 3ARFD 5DS8A 3TO2A 3MLPA 1VKXB 1T66D 2IH3B 3SE3A 1D3CA 4U7KA 1CG9A 1D5MB 2AEWA 4J3SA 3ZLQC 2R69L 4AL8L 3C6SB 5HHNA 3RWGA 1TVHA 2D4DA 3AMKA 1UJ3C 4FQIH 2NY0D 4ZTOH 3OF6A 4IM8A 2B0SL 1BJ1J 1IM3A 1B4JH 4YEEA 5I8CA 3KPSA 3C6LB 1AH1A 1DVFC 3K2UL 5FYJD 1T7WA 4ODSL 5LWYH 4PTTB 1MFDH 5GGQL 1BQLH 5FHAH 1DVFA 1PJ9A 4QOKA 2CIKA 3RVUD 3HAEG 3U7WH 2UWEF 3O3AB 3ZE0E 2ERJC 2E3VA 2OTPA 2H1PL 4GRLC 2VMFA 1W8NA 4UTAH 5LKNA 5ERWA 3ZTNH 1PG7W 2IF7A 3MRRB 4OKVA 2GAZB 2NY2D 2PR4L 4GRLA 4D0CB 2HFFA 3MNWA 3U4AA 3DRTA 1OT1A 5JA9A 1U2HA 3MV8A 4NSKA 2C5DC 3SKUD 1N5AA 3AS3A 5IIEA 3ABZA 3GM0A 4KJWC 2VAAA 1OVZA 1S7SA 2R1XB 4W70A 5IB5B 3P11H 3T1WA 1NC4B 5HYJD 1RZJH 3IDJA 3Q3GB 3C8KB 1JGUL 5EA0L 2VDOL 3EJZD 3ZSTA 3O2DL 5F6IC 4LCWE 4MJ5A 4UV4H 3JUYA 1ZSDB 2PYEB 1CDYA 3BPOC 5T3XD 1HHJA 3I6GB 5L88L 2C1OB 2GK2A 5J56B 1A21A 1KCSH 2V2WA 3MTRA 2EDHA 5HDQH 1UWEH 3RGVC 1SYSA 3NZ8B 3UO1L 3WFDH 4KMTL 2Z91B 4U49A 4UT7H 3MRQA 4CRPA 5ICYA 1P84J 3D87B 2OS7A 4X6EB 3RGVA 4DGYH 1G6RH 4KKLD 1TNMA 1INQA 4XWOD 5ACZA 4QRRD 3EDDA 5D7IE 2OX5A 4MS8D 5JPMA 3E3QC 1U95B 2J8HA 1R24A 1XMWA 1AKJA 4WI4A 1ZLUH 2H6PB 4YK4C 1LEKB 1CU4L 4H1LH 5EU7E 5JHDE 3ZO0A 4U6XB 1G9MC 1DQLH 4HS6B 3LKSA 5DUMH 3HZVB 4XNZB 1FNGB 4ALAH 5BVPH 1I85C 1T21A 2W38A 4PS4H 2MCG1 4NUJA 3SDDA 4PD4J 1LK2B 3CX2A 3DBXB 5CGTA 3QIUB 2ESVB 1C5BL 3X14A 1I85A 3WIIH 1FNHA 4Z7NE 4A2LA 1QNZL 2FDBP 2VLKB 4PJGF 2LTQC 4M7KL 3UTQA 4NN5C 2Y6SC 4CMMB 1SEQL 1RZIB 5IMLB 1HNFA 2HLAB 4Z8FH 2Z92B 2H41A 2QEJA 4X7CC 2V9TA 3MODH 4BM7A 4MVBD 3EYVA 1RU9L 1RFDH 5GRVL 3VFSA 4QTHA 1T3FA 2W0LA 3UPRA 5EUOB 4JLRA 3MJ7B 4FTVA 3AUVA 2ZUQC 3CFBB 1WT5C 2YUWA 1MCRA 4NDMA 5CP7A 2HP4A 4G8GB 5CINH 1G9EA 3U9PL 1IAMA 1NL0H 3DSNA 2HRPL 2H2PD 2V2XB 1WT5A 4JO4L 3T0VA 4G7VL 5F70A 1TCRA 1I7UA 5IMMA 1W72A 3DETD 3DYOA 4RFNC 2X4PB 3AAZA 3DMMD 3PDOB 3TC9A 4PR5A 3O41A 3CC5B 5DLML 1OTSD 4YBQC 3TBSA 4K55A 5IGXH 5DHVA 5C7XL 5CUSH 1I8IA 3LB6C 3O9WB 3OXRB 4XC3H 3SO3C 4G9DB 2X40A 4MLSA 1KV3A 4XPHL 5KVEL 3NCCB 4MMXC 4RIRA 5HGDA 3UTTE 3V6OE 3EOTH 1AO7D 2YD3A 2CUHA 3ZDZE 3HR5B 4EDXB 3KLAA 1PBYA 2VXUL 4OB5L 3RTQB 1SJHA 4YXHH 2OZ4H 3PXJA 4OZFH 3HC4L 3U79A 5F88B 3Q48A 3AREC 4PJBF 3UTSB 3HZKA 3CJJA 4ZUWA 4NFCA 1U2CA 4K3HA 2YWYA 4NQCD 3MLWH 5FYKH 1DEEB 3QFJD 3P0GB 3AREA 3ZZ1A 2FEEI 3DX7A 5E8OA 3EO9H 2FH6A 4PJEA 4GW1A 3P40A 1I8LC 1EDQA 4JFOA 3U7AA 3JV4A 5JOFB 3GGWB 4UQ3A 4JGJA 4RA3A 1J87A 1U8IA 3QI9B 1I8LA 4K94C 3VH8G 4OTXH 1QBMH 1FZMA 1F3JA 1K5NA 5B3JE 3RUGE 4QO1A 2UY7A 3ARGC 2I9TA 2PXYC 5L9DL 2VZVA 3QCUL 4RZCB 5IHUL 2ZSWA 1LE9B 4YNYB 1S7WB 4HKXB 1S8DB 5BS0B 3OR6B 4XPFL 4JG0L 4F33A 3T4YB 3ARGA 2PXYA 4HJJL 4WIQA 1B90A 5C07E 2P45B 3KPMB 4L8SC 1P1ZA 2BNQD 3V6ZA 1KLUB 3P4LA 5IW3A 2XA8L 4JFED 2JCCF 2JJTC 1FG9C 1OB1B 2H32H 3ULUD 4M4RA 3QQ3A 4WEBH 2EYSA 2MKWA 4L8SA 4D8PA 1WV7T 5EOQL 5EWIH 4WO4C 5F8QC 2DQIH 1J5OH 1NFDA 2CLZB 2JJTA 4ODVH 4PBXA 3HNTL 1EFXD 3B9AA 3WCYA 4WO4A 4HWNA 3EFDH 3LN4B 4KGLA 1VACA 3RDTB 2DB8A 2ARJQ 1QRNE 3IVKB 2VXVL 4CADB 1I9EA 3L7EA 1AJ7L 3LQZB 1CFNB 3VXRB 5CIPH 4LRIC 5GRUH 5ALBH 1RUKL 4DW2H 4JREC 3MSPA 4NFDA 5ESQB 5J6GB 2HLFD 3EZJB 3K46A 2AJSH 2R29L 4LRIA 4PREB 4M1DL 2AJ3A 2CUMA 5FEBA 3VGDA 1HILA 3QFDA 2NY4B 2OI9C 4GO6B 1GVIA 4YDLB 5DZLA 4N1HB 5E5MB 1X5AA 3JV5A 2CXGA 3S8WA 2JKXA 1KCUL 4K23H 1Q0XH 1UM5L 4GUPA 1CE1L 4N0CD 3O8XC 4FHBD 5DFTA 2B1HH 1FIGL 4S1RH 3ULUF 5HVFB 4JG1L 3S36L 4FABH 5SX5H 4EXKA 2ZKHH 3O8XA 4M3KB 1G9NH 3GJEB 4DKFL 2YS4A 2DKUA 1CGYA 5CZVH 3WKML 4WFEE 3BH9B 4H5SA 1YMHB 3G04B 5IB2B 5C70A 2VSDA 4OCXL 5TFSL 4LVOC 4Z7WA 1OL0A 3DI2B 5MEND 3P9LB 1YJDL 1BD2A 1IKFL 3HMXL 1CGXA 2XA3A 3QUML 3VWJB 2ZCLL 2D0HA 1RVFL 2JELL 4DGIH 3FQNA 1U8MA 1QO3A 4BJLA 4M7ZC 4PJIB 3UX9B 3O2WH 4WU7A 4BA8A 1CS6A 2OSLA 1MCBA 2W9LA 2J4WH 3GJFB 4M00A 4Z77A 5E56A 5K93A 2WUCH 4MB3A 5CFHA 4ZFFA 1C5DB 2BHZA 2IPKA 4NJ9L 4POZD 5IMOA 4M1CC 5BMFL 1G1CA 4JFXA 4NHCL 2IC2A 3GRWH 1SY6H 4XP1H 3RWFB 3V4VL 2P4AB 2HT4D 3KJ6L 2GJ6A 3VXUD 1IC7L 4C56A 1FL5A 3WHE1 4AEHH 2E27H 3N85L 4XP6L 4EIGB 2NXZD 1NGWA 4GT7A 5HHOD 1IC4L 2OTUB 4JFDD 1MH5A 5E2VL 2V5TA 3GMOA 4NN7C 3GSXA 5J1AA 4D0BB 2CRYA 5JUEL 4JCLA 4NZUL 3BH8A 3SY0B 1Q94B 1NAMA 4XBEH 1MIEH 4Q58C 4PRPD 3C2AL 3ZT7A 4L8CA 1QA9B 4K3GA 2VLMD 4QRTB 2F8OA 2R9HD 3C6LA 2CDFB 3C2SA 1IM9D 4R4ND 5I16A 3Q6FB 3DI3B 1R3KB 3VW3L 3Q5OA 3PDGA 4Z78B 3BEWB 5D1QC 3SOBL 3STZA 2GK0B 5ID0A 4F7PA 1C12B 3P30L 3O3AA 4JFFB 2DQFB 3OR7B 3K0WA 1IEAB 2YA0A 1XGUB 3DX9B 2DWEB 3HB3C 4MNGB 5D1QA 2BSED 4MNHB 4CVUA 2XRAL 4KROD 4LSUH 2WIIA 2OTWA 3HNSL 4PYGA 5EBMA 2YD7A 3S88H 3V0VA 1IAIL 4JPIA 3B9KB 1FGVH 2WINB 4U7SA