4Y19E

Immune complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
241
structure length
241
Chain Sequence
AGVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASRPRRDNEQFFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title T cell receptor reversed polarity recognition of a self-antigen major histocompatibility complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
total genus 60
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2015-02-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y19E01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y19E02
3S4SB 5DHVA 1UM5L 2I9LB 3NPZB 3B9EA 3UBXB 1TJHH 3VRJA 2W9EH 1MCLA 5EOTA 1FNEB 2XQYK 5T1LD 3P4MB 1F2QA 4WWID 5EPMB 4JKPH 4LHJB 2ZSWA 3RVTC 4X6FA 1A9EA 3ZTNH 3QHZL 1MI5D 5HHOB 4M48L 5L7XL 2V9QA 3X3FL 3IFOA 3UDWC 3JV5A 1MVUA 1T5WB 3QEUA 5ESQA 1TQBC 2RJMA 3IF1B 1HKLL 1JWMA 3I9GH 3MLWL 4MCYA 4P3DA 3D3VA 1I8MA 3HC4H 3ARDB 5GXBB 32C2A 5F7WC 3QUMA 1KCVH 1HSAB 4JDTL 4Z0XB 4YPGA 2AP2A 1PZUB 4KK9C 3IU3A 3NH7L 4U6HA 3NFNA 3VMPA 3Q6GL 3FO2A 1JNLL 5E56A 2DDQH 4CADA 3B9AA 4YHYB 4PJ5D 2F8OA 1BD2E 5EFIB 4I0PB 1ZHBB 2AXJA 5HDBE 5FOJA 2V5SA 3HR5B 5I8EA 4JPKH 2IBZY 4YHPB 1A6ZA 2ITCA 2VWEC 1N8ZA 4XBPA 2BNQD 4FQQB 4MYWB 5CP3A 1PFCA 3QG6B 4AL8L 3M8OH 1SM3L 4EDXA 1RUMH 1R5WB 4WFHE 4WDIB 3RHWF 4LAJH 4LOUC 4M7LT 4P2QE 2ORBH 2C1OB 2A1WH 5SX4H 3IDIB 2JIXB 3U1SL 1P7QA 4PJ8A 5GRUL 5C0IB 1OGTB 3C60B 4U33A 4G9FB 4GS7C 5E08L 5IF0A 3H8NA 4OM0H 4J4PA 4JZJC 1QBLL 1LO5A 1SMAA 3WLBA 4YHML 4QOKB 5HJ3A 2QHRL 3ZTJH 2FZ3A 5GGRY 1MJJA 4KDVA 3TJEL 2IANA 1ED3A 2G5BB 4QNPE 4QHKJ 1BOGB 4YXKH 1N64L 1QLRA 4QNPF 5CLTA 4K3DL 2ARJQ 4YBHA 4MAYB 1RZIB 2WINA 4JFOA 1JPFB 4PJ8D 5I1GL 5A2IH 4LP4A 3GZKA 5DLMH 1DQLH 1QSEB 4UT7L 1UG9A 4X8JA 2JJTC 5DS8A 4PJHE 5KOMC 3C6LA 1NL0L 5C3TA 4WTZA 3MUJA 1F8TL 2AJYL 4OB5H 1UXWB 4Z0BL 4YO0B 2D7TH 4JM2D 3RNKB 5FUZL 3TZVD 5FECA 5ILTH 3RTQC 3V7AE 1NC2B 3IKCB 5D96B 3GSNH 4RCAA 3C5ZD 5GSRA 3N1GC 4P23D 4ZNEE 1E4XH 3T0VA 1T1YB 1KIPA 1MEXH 4IOSD 4I9WD 2H3NA 4Y19B 4OZIB 1SBSH 1J8HA 5E2TH 3F12A 2XRAL 3K74B 4KROC 4YHZH 4RSVA 1JNHB 3MXWH 5I1KL 1EHXA 4HXBH 4ONFH 4QYOB 1YECL 1UZ6E 4OZIE 1CF8L 2BY3A 3L9RB 3WCYA 1ZAGA 3ZE1E 3GBMH 4NHCH 5D7IE 1IGMH 3GB7B 5JW4N 5T3XL 1KC5L 2ZOLA 1KN2L 5J6GA 1ZHBA 3P0VL 2HFGL 3KYNB 1JWSB 4FXKA 3BRGC 4HUKB 4RNRA 3DRQA 5IVXF 3RPIB 1IVLA 1UQSB 2XKUA 2FX9H 3INUH 1EHAA 5GGRA 3MRQB 4GAYA 4QWWD 5FO8B 4J3SA 5CCKH 4JANB 1UM4H 4BM7A 3ARTA 3VD7A 4HPOH 1AD9B 1MRFH 5F9JA 5EPMA 1MI5A 3C2SA 3QXDB 1XCQA 3MLXH 3FFCB 4LARL 2SEBA 3ESUF 4KAQH 5DSCA 4NO2A 5BS0E 3EYVB 3A6CH 5JA8B 2DQEH 4PBWD 4JGJA 3WD5H 4PJIA 4DOHB 2OCFD 2GJZA 3HHRB 3IFPA 3UYRL 1S7VB 1A5FL 4PLKD 5E70A 2CLVB 5IMMB 5CIPH 1E4XL 1CGWA 4OCRL 5E94B 3T77B 1M1SA 2VRAA 4LEOA 5LGHL 5EU4A 4LEXH 4NKDB 2Z4QB 3DX6B 1CDCA 2YRPA 2XA8L 3U4BH 2IEPA 3PL6A 5F7YC 4Y5VA 5I1KH 1W0WB 5EO9B 4MWFB 2GQHA 4Y2DB 5C2BL 2VABA 4XP5L 3O8XA 4S1DC 4WY7H 1GXEA 3GRWA 4PJCF 4AH2A 4XNXL 1ZANH 1PKQE 4CU8A 4OM1L 1G7MB 1JGEB 2F54D 1INDH 3F62A 4YE4H 2J6EH 2IFGA 1QEWA 4XPAL 2G5RA 1E28A 1DUZA 1UB5A 5HD8C 4AK1A 3RWCA 1ACYL 3MLYL 4K9EH 2CLZA 4NNPH 2OTUB 1RIUL 3PGCA 3K7UA 2DOCA 3IJHA 2E9JA 2E6JA 3MNWA 3O3DA 1RUPL 3K81A 1KFAH 3HI6L 2ZUTA 1KCLA 4WFFE 4YDLC 3W81A 4K7FA 1HHGA 3RBGA 3SDAB 4OSUH 2LTQB 5EH1A 1FYHB 4OV5A 4G80B 2BXYA 1MFAH 5IIEA 5TF1H 3QDMB 2QHLA 4KXZI 3WUWG 1E27A 1B9ZA 1ZGLA 4D9LH 3QO1B 1BJ1H 2HTKD 4PJIB 4KKAD 4S1SH 5HGHB 1QG3A 1QSFA 5JW4R 2Q87A 4NQEA 2NW2A 5C1MB 4OCRH 2AQ1A 1RZKL 1JF1B 1AIFA 4L4VE 4PJBB 2E7MA 1G6VK 1ZLWH 4LDLB 4CW1A 3CVHL 1P69B 4EUPB 3GJFH 4UV7H 1EFXD 3VFNA 1QFPA 5JXED 3ZSSA 1YY8B 2CXGA 2KPNA 1CE1L 2J5LB 3OKYA 1D5XB 5GZOC 1X5JA 3VMNA 3CH1B 1RZFH 4OM1H 1JHLH 5CFHA 1NJ9A 4JFFB 5D7IF 5HI5C 5FM8A 3Q6FA 3GO1L 3JV0A 4FTVB 4UU9A 1FH5L 3HE6C 1VSCA 2ATPB 3HZMB 4X6CA 1WZ1L 3DI3B 5SX4I 4O00A 3S35H 4JFFE 5ENWB 3F7RA 4NNPL 3B6SB 2X5PA 5FHAH 4M6ML 1ZGLB 4BZ2H 1U8OB 3C8HA 1T0PB 3CVHH 5MI0B 4H20L 5DFWH 2ED9A 4JFPB 2NX5A 1G9MH 5J13C 1WVZA 2ZJSH 3AS0A 5CEYA 1IC7L 4X0KB 3KPSB 2EYTA 1MUJA 3OF6A 4CMMB 4DJMA 4JY5L 4OIIH 3RTQD 5C0DA 5L0QB 4HUVA 2VC2H 5E6IA 4Z5RA 5E8DH 5HVWA 2VIRA 4H25B 5IW6A 3L3GA 4HXAL 1R5IB 2YN5A 5DRWB 4EQ2A 2G2RB 3O8XB 3VI4E 1DVFC 1S78D 2WANA 1FGNH 2AQ3A 3FMGH 1IGFL 3LDBC 3MACL 3O9WD 1CT8B 4R4NC 4LLVB 3NGBB 3VG9C 3D39E 1SVZA 4ZQKB 3U30B 4C4KT 2BMKA 4JLRA 5BV7B 1KEMH 1FZKB 4X4XA 5CKGA 3THMH 3VFVA 1LD9A 1U8PA 2ESVB 3C60A 3OV6A 1I7RB 2NY1D 3F58H 5FOBA 2G60H 1XF5B 5K9OA 1XZ0A 4J3XA 3RZWA 5F88B 1BOYA 5IBTH 3WUWA 4F9PA 4XXCC 2YK1L 5T1KD 5IW1B 4FABL 4JJ5A 4R6UA 5FA3B 4ZYKB 3NGBC 3VG9B 1CFTB 1N59A 4JHZA 3VXRE 1AR1D 4JB9H 2HWZH 1Z6JT 3B5TA 1INEL 3KYAA 3O8XD 4P59H 4MDJA 1UB5B 3MRBA 4R4BB 4KDTC 4D94A 4YHPA 3VXRB 4N9OB 1TJHL 3DVFA 2BOCB 2XWTB 3MLUL 3OKLB 3S8WA 3PWVA 1JMXA 4XAWH 4XWOC 5FK9B 2ZNWA 2FD6L 3MOAL 1QVOB 5E03A 5J1TC 1SJXA 1T66C 2BNRB 1C08A 3LEXA 5E99L 4POZC 4M7LL 4N5ED 4PRIB 3SDCA 2YUWA 3TJEH 3FOMB 5I15H 1L7IL 3MRNA 4TNVK 2BHZA 5LCVH 1MHCA 5ID0B 1QRND 1Q0YL 1YEKL 1I3GL 3GSVA 1D6EB 3L3HB 4DGIH 2KKQA 1FGNL 3GKWL 4HK0B 4Z7QF 2DICA 1JGDA 1NUGA 4GKOA 1P4LA 1J11A 1DQLL 4X7TA 3LV3B 3O4OB 4PREB 4YGAB 3BD5A 4JDTH 1D9KC 5ACLA 3MROA 2B1HL 3CGTA 1KB5B 1KJMA 2P1YA 5INDA 3LQZB 1UWXH 3AXLB 4J23A 1U36A 4NBYB 4HJGB 2V5TA 2OMBA 2PUQT 3NOIA 1NCAH 3KXFE 4ZNCD 5HVFB 3R1GL 1G7JA 2CO6B 3K0WA 5L8KB 1NKRA 2WK2A 4DKAA 4BQCA 5C0FB 2HJLA 5TGBA 2I9LA 5HHVL 3TFKC 3AS1A 3G6JA 1EGJA 3RY6C 5I6XC 4HXBL 1WBZB 2FDBP 3SGEH 3T8XA 3WL9A 1YQVH 5E2WH 3H9YA 4BQ8A 2V7HB 4WEBH 4D9QE 3SDXE 2F74B 4KZEH 4U4BA 4ELKB 4XVJH 4UB0H 1SQ2N 15C8L 3PWUA 4NQCE 1OTUC 3HMWH 4JY4A 4P23C 4RWYH 4Q2ZB 4LCYA 3TIDA 2ZCKL 3AAZA 2FEEI 3SDXB 4PJ7F 5EU6B 3VWJA 1S7TA 4DN3L 4NJAH 4PGDA 5IB3B 1P7QB 2EO9A 2P5EE 5D2LF 4KJWD 1J8HB 4JM2A 2ZKHL 1A6WH 2IH1B 2GJ6B 3MCKB 4RFOL 4TSAH 2WINB 2BRRL 2WQRA 4H5SA 3KPNA 1G7HB 3EW3B 4HUWB 1HOCA 5DJAB 2N56A 4LLYA 4YHYC 4UQ2A 4I18A 4KC3B 2XFXB 2XQBL 2EC9U 5IESH 1QUNA 3OKKB 2IAND 4PTUB 1RJZA 2XPGB 3BQUB 5IK3B 1VPOH 5AUMB 4FQJH 4ZUUB 3OR6A 5DJ0B 3P0YL 4HPYH 1ADQH 4EI5D 4GRLD 2VAJA 3WIFA 1JTOA 4ZPVA 2G2RA 1ACYH 3MRJB 1J1PH 4H0GA 4OD1H 2DTML 3QIWB 5FHBH 3PDOB 4OCSH 3EOTH 1V7ML 4GQPH 4RGOH 1KPUA 1JHTB 3EYFA 4HIXL 5D7JC 2FBOJ 4I48A 4NQDB 1J9CT 2IQ9L 1EEYB 1UKTA 2CXKA 1CDBA 3LRSA 43C9B 4QF1A 1B2WL 3QWOA 1F4YH 3B3IA 5JZ7D 1P53A 2BNQA 5IQ7H 4Q6YA 3UJTH 4ERSL 2BC4B 4XCFH 5MHSD 4AT6B 3UJJH 5CGMA 1OSZB 2ZSVA 2K3TA 2LAAA 4XXDA 4LLUB 3RI5F 4E42B 2PW1A 2V9TA 3FO1B 3F5WA 3VXPB 2MCG1 3S7GA 4AMKH 5I30L 1W8OA 4WFEE 4IIQA 5DQJB 5DVLA 3IXTB 3B9KB 1NCDH 3T0EB 4KDWA 4KJPC 1CFNB 3BW9A 4ISVA 1AGEB 3G08B 2F8VA 1OGAA 3D0VA 2VZSA 2FJGA 4LNVA 4OLVH 1OT1A 1NSNL 1SY6H 4BKLA 4UV7L 5F3BB 4NC2B 1RUQL 3NZ8B 3VFRB 3GI8L 3SEPA 2IF7A 3L3KB 3WSQH 2FNBA 5JW4Q 3DOSA 3KVQA 1B6UA 1LO0L 1XF4B 2XZQH 1OSPL 3U7WL 2NZIA 2A73B 3P0YH 5TQ0L 2RCSL 3LOWA 4ZMAT 4Z7OF 5KN5B 4MA7H 4OBSA 4NQEE 2YXFA 4ZS6D 1JHKL 3PV6A 1DLFH 2DYPD 3UPRA 5DO2C 3RIAK 3DMMC 2JJSA 4DVBB 4HIXH 1QR1B 1AXIB 1A6VL 1CU4H 2C4FU 2X41A 3OXSA 4JO4H 1DJSA 4NRZB 4H20H 3O8XC 4UIMA 3SO5A 4ETYA 3T1WA 4ODHL 2ZP0T 1A7PH 1E0OB 3RWGB 3V6BR 4PGZA 5K9KA 2XG5A 3OJ2C 1NDGA 2AJSL 3NCMA 2HJFA 3FFDB 4WO4A 2CJUH 5DJ2A 2R8SH 5JQ6L 1S9YB 4XPGL 1NUNB 1IL1B 2B1AL 2EDKA 3GMNA 3QUZD 5E8PA 4PGBB 1MQKH 1T2QL 2DQDH 2R9HD 1VDGA 2Y5TA 1X44A 4ZOAA 1OAYH 1OAKL 1OP9A 1TCRB 1MJ8H 4GW5B 3EKCA 5GIRB 5SWZD 4P46D 2KH2B 1JPTL 5KJRH 4F7PB 3O3EA 4WHDA 3KPOA 5SV4A 3VXSD 4R4FH 4HKXA 2YPKA 4YC2B 1VFBB 3DX9B 3WFZA 4XCEA 2JELL 5C08B 3WSQL 1LILA 3IAGC 5F7EH 3NFPB 4PD4J 1X4YA 2P48B 4MQXD 1S5IH 4M1GH 2F5AH 1TCMA 3D5OF 3QIWC 1BGXL 1OP3H 3HE7B 5JQ6H 1CXEA 4AG4H 5FYKL 1MHHA 4Z7UF 4U1GC 1XF5A 5K9OB 1BWMA 4N8VG 3HE6B 5SWSD 4WI6A 4M48H 5L7XH 2ESVA 1VGEH 2FLRT 5E8EA 2Y06L 3GGWA 3OPZL 5ICYB 4NQVA 2VE6A 1U3HC 4P46B 4F9LC 1F3RB 1IT9L 1K3IA 5HHQB 3VDAA 1WCBA 2UZXB 3FB5A 5J6HB 2FJFA 1GAFL 1L0QA 1I3VA 5SWSB 2D4FA 1XT5A 1EDQA 1YN7A 2XT1B 4Y4HC 4HC1L 2FBJH 3V5KB 3RHWK 5D7JB 2OP4H 5KVDL 5JDSA 3TA3A 4NQXB 3HPLA 1KTKE 3M17A 5DJ2B 1JVKA 5IJKA 1PEWA 3ZTNL 3L5HA 2PW2A 1U3YA 4BSVB 4PJXB 1JGLL 5I74C 1BQHG 1A22B 5HYJE 4U1IB 3VXMA 1BFOA 4OCYH 4L8SB 5CP3H 1AFVL 3IJSA 3I6GA 1UQSA 3RAJH 4WW2C 5AZ2H 1FN4B 1I3GH 1WICA 4FQIL 4YX2L 8CGTA 3E2HC 2D3VA 1ORSB 4XHJC 3MGAA 1IJ9A 1M6OA 1P4BH 1UH3A 5BZDB 5CBEB 3ARED 2NTFA 5C70A 5EO0A 5HHOD 4JCMA 2D9QB 1GGTA 1FSKB 1QP1A 4TPRL 3OMZA 5BZDA 4WCYH 2XV6B 2CUMA 1U8IA 1A7NL 2E3VA 3WE6A 3QDMD 4FQHA 3ILPB 3PE9A 2BVPA 2JK5A 3ARUA 5C0GA 3MR9B 3TO4D 3H3BC 1UH4A 4MX7A 5F8QC 5DDHA 1CLOH 5JLZA 1CVRA 2XI9A 2J2ZA 3KPQB 5H35A 3SE9H 1OAXH 1KB9K 1MFEL 3MLTA 4HK3J 3DBXA 1FGVL 2VLRD 1ES0B 3P9LA 3DVIA 5J3HC 3AS3A 2DTSA 4MNQD 1CG9B 3AROA 4YO0A 4B53A 3SGKC 5DQJA 4JN2A 1P4BL 4FP8L 1N5AB 1DBML 4F7TA 4AY0A 3C5ZC 3QIWA 3WEXB 6CGTA 2NYYD 4RMSA 4DN3H 4TTDD 4KQ4H 2VSDA 4QRPA 1WCBB 2APTA 1DBAH 3BKYH 3UTOA 4DVRH 1WAAA 4U0QB 2WM0A 3ZKSD 5IGXH 2H6PB 4MJ6B 4HHAA 1U42A 4EBQH 1XGPB 3DURB 3KPSE 4JJHA 1NMCC 2J4WL 4XT1C 3B9KA 3MA9L 4KVNH 3CSYB 4XP4H 5GS1B 4YFLF 3VA6A 3LIZH 4FXGB 2JTDA 3DHMA 4KUCF 4QHMA 2AK1H 4S2SB 3ARFC 4F15C 4M7KL 3JXAA 4XZUA 5TFSH 5GGTA 4NWTH 1IM9B 2B8OT 3QIBD 4HGWB 1OT2A 2IADA 1F90H 2ZNXA 4Z0BH 4I77L 4MWFA 4HS3B 3O6FB 1LDPL 4Y4FA 3OXRB 1LNUA 1C5CH 1S7RB 3EO9H 1DZBA 5DUPH 3ZLQC 3O3AA 2AERT 3FQXB 4RFEB 1NPUA 2ITCB 2PO6B 4JRXB 5DI8B 3BDYL 1QEWB 3MV7B 3OAZH 5DJYA 1BLNA 4P2CG 4TTDC 3IRZA 3SCMA 1F4WH 1CICB 4YHZL 2H2SC 1HH6B 2UY6A 2D7MA 3DV6A 4Y1AE 3MCKA 1H3XA 3LQAL 3QEQD 5EO9A 3HB3D 1RHHB 5L2KE 5CJXC 1YEFH 4P3CL 1T1ZB 2J8UF 4EN3C 1CBVH 1NC4B 4OLWH 4F3FA 3QNXB 1U91B 1J5OL 4XBPB 4Z0XA 1MFDL 4HW6A 2NXZC 2DM2A 2YSSB 4LHUD 1GGBH 2ICEA 3B83A 4NSKB 1LDPH 4GG6A 3GMQB 1XMWA 2HT4C 5DFTA 4L4TD 5IR1B 3ALWA 1MNUL 2JKXA 2QR0A 2VZTA 4DKFH 3AXLA 5GGRB 3VXNB 1OAUL 2W60B 3KPNB 3SE8H 1RIHH 4JRYB 4KTDH 1I7ZA 1JPSL 2O5YL 4JO3H 3U30C 3JWDL 1U8LB 2P8MB 3RY5A 2AW2A 4IDJL 2EKSB 5B8CB 1JZ6A 3DPBA 1UENA 3DWTA 2HYMA 2ZSWB 4Q2ZA 3TIDB 2W9LA 1E6JL 1JMZA 3GM0A 1IRAY 1RK1B 2P8LB 4ZOCA 4IIQC 1YUHB 2JB6A 2PR4L 1GPOL 5DMIH 3G6JE 1XIWC 4Z7VA 2X44D 2ADGA 4NO3B 1Z9MA 4KI5D 4O5LH 2FB4H 2NZ9C 2CLRB 3OB8A 1DUYB 2Y1VA 3QUXD 2VDKL 4HJJH 1F4AA 2CLRA 4HK0A 5JZ7C 2FGWH 4X6FB 5BV7L 3IYLW 4F33B 5DJYB 1SYVA 1OARL 1UH2A 2P5WD 4M6AA 2RHEA 4FRWA 4L8CB 2XACC 3VRJB 1ZA3A 2CD0A 3BP5B 1YECH 4I4WB 1LO4H 3DXAD 4K8RL 4O58H 1INDL 4I0PC 3REWA 3EIFA 5CGYC 5F88A 3QO0A 5ETUA 4N90E 4YHNA 2E8ZA 3HI1B 4ZSOA 4OZGA 3U46A 2QJDA 2ZPKH 5D1ZC 5F7HA 5DD6A 1EH9A 5J4MA 1RI8A 4PR5B 4O2CA 4LLMA 5D6CA 4JFDE 5C0EB 1FO0L 2XTJE 4Y1AA 4XP1H 2J88L 1T3FA 1CLZH 2WNGA 5KG9A 3BKCH 1UZ8B 1U93A 4F3FB 5J1SC 1GOHA 3ZYZA 4TSCL 2IBGA 4O4YL 2FCBA 2B2XH 5ICXB 3TNNA 1CF8H 1CE1H 1NEUA 1F4XL 4XC1L 1I8LC 2QR0B 3A6BH 1MLBB 3CX5K 3ISWA 2VL5A 2ZCHH 2F15A 4KDTA 4FQJL 4MXQD 5E7FA 3VXRA 4P49A 4HUUA 2B4CC 3TF7C 4CMMA 2VZUA 3JV4A 4Z9KB 4UINL 3DBXB 1AQDA 1HOCB 4NZUL 3CU1A 2FGWL 4H5SB 4LGRB 3TNMB 3CJJA 1OLZA 1H8OA 1YEGL 1KT2A 1EO7A 4RMQA 2A77H 4OFYA 1A4KB 1WAAE 5ALCH 2DWDA 2CKBH 2P7TB 4O4YH 4U1KB 5EU6A 5ABDE 5GRZA 5F70A 4LLQA 4UTBH 1JNJA 5IBUB 4Z77A 4LLVA 4XVTH 2PTTA 3PDDA 4YNYA 1ZS8B 5FYKH 2PYED 3HAEB 1X7QA 1D9KA 1NGXB 4K3EL 4GW1A 5E8NA 5DDHB 4PGCA 4X7FC 4GSDL 2EYSB 4UOW1 1CD1B 5JOFA 1MWAL 3C5ZB 3MLYH 4K9EL 4BFIB 1EFXB 3IJSB 2CDEA 4O2EA 2AEPH 4TNWF 3SJVD 4DN4L 2PYEB 2XZAH 1UJTA 2ZUUA 2PXYD 4NOFA 4GMTH 4DKDC 1CL7I 4UTAH 4R0LC 2NY7L 5DEFB 5EO1B 4WY7L 3G5VB 5CJXA 3VFOA 1JWMB 3K3QA 2R0WH 5B39G 5JHDD 2VLJB 2MWCA 3VD5A 4K2UL 2APWA 5ELIA 5DJXA 3MTRA 3MREB 3Q3GB 1YN7B 3EOBB 1DQMH 1BZ9A 3D2UA 1XH3A 1BJ1J 1JK8A 5IFHL 1JZ7A 1P7HL 3SE4C 1MOEA 3B9DA 4EIZC 2GTZA 5I66B 5CWSA 4PBVC 3OKEA 4HK3N 4PY7A 3ZDZF 3V5DA 4S11A 2AEPL 4B50A 3WJJC 2H32B 2Q86B 3VGGA 2DKMA 5E5UB 1OW0C 2H2SD 5EO0B 5FB8A 3HE6A 3KR3H 4ZPTB 3ZE2F 2C3WA 3BKJH 1FFPA 2L7JA 5GGVL 5DMKB 3GM8A 4FQHB 1TFHA 1PD6A 1UACL 1K4DA 1DE4A 8FABB 1IC4H 4RMUA 1I85A 3DUSA 3CXDH 3FQWB 4L5FH 1G7IA 5FCUH 4IOFD 3VWKB 1MFCH 4Q9RH 1P2CB 3VXMB 3VW3L 3LSOA 4IOIB 4GSDH 1E28B 4GQ9L 4PLNC 4HEPG 3RZCD 3M17B 4Z7UB 4AH2B 1HQRB 1LK3L 3L7FA 1A9BA 5DEGB 3OKMB 3HNSH 4APQC 5BRZE 2PO6D 3BPCB 1OTSD 2YUZA 4Z7UE 4JG0L 3BN9D 2XY2A 3TESA 4M7KH 4I0KA 3QUKB 4MD5B 3MV11 1URLA 4FQXB 3FHAA 2OP4L 3B4NA 2J12B 3BSZH 5IMMA 2DQHH 1HZHL 1MFBH 4LVOC 1KCRH 1NANH 1QQDA 1CGUA 1T0NB 2BVQB 5KTEH 1NCBH 3RWIA 4JHBA 4YGVA 3SGJA 3BE1H 4F57H 3TBTB 2Y07L 5DVNA 5F21B 5CMAB 5T33L 4NQSB 2W0LA 2EECA 3L5IA 5D7LB 5D6DA 4RISL 1EO8L 4P4KC 1PKQA 1CDYA 4U1JB 2VLME 4Y0GA 1MCOL 4AEEA 2OBGA 2UVFA 4TQEL 2A73A 1GGUA 1UGNA 3QXWA 2CIIB 4U3CA 1H9VA 3D2UB 3DTXA 2HJKB 1ZK9A 4LQFH 1G9NH 3RKPA 4U6YB 3FT2B 2XWJB 5AYUH 5HVHC 3S88H 2DJ4A 5AG8A 2HH0L 4C58B 4NFDA 1G9NC 4JPWH 2YPKB 4ZPTA 3KYKL 3TV3L 4KTDL 1VENA 2BRRH 2OZ4L 3ARFD 1ZHNB 1NGZA 1LK3H 1JUFA 2AABL 3X12B 3OGOE 1F6AA 5DYOA 1B0RA 4KU1A 4MQ7B 1B0GA 5CD5C 2EEAA 4ZNEA 1K8IB 4JKWA 1P1ZA 1N4XH 2OJZL 1CD1A 2YEZA 1LK2A 1MPAL 3RDTA 2MHAA 1F8TH 5C0RL 5TDOA 2V2XB 1RVFL 1KC5H 4HCRL 1XGUB 3O45A 2AEIT 4F58H 3K8KA 3HG1E 1QFOA 3VE0B 1EERB 1VFMA 2GK0A 4XNQB 2YUVA 4UNVA 4R8WH 1MY7A 1QSZA 3BH9A 2HVJA 5J57B 1A2YB 1FNAA 3L3JA 1FG9C 3QA3A 4WNQB 5T5NF 1NAML 2UUDH 2Q8AH 5CEZE 4PJAB 5AWNH 1YNKH 1JP5A 4Y5YC 3JVGA 1OW0A 1I9IL 3B2VL 1NKOA 3QWRD 5FA4A 5MEOA 3U36B 2YOCA 1KCVL 3CVIH 4KZDL 3RIFF 3NAAL 4QOKD 4XVSH 1S7UA 4ZUUA 4AEHH 3D85A 3DV4B 5EBLA 2VQ1A 3K80A 5HYEA 2R2EA 3G5ZB 3UYRH 4EOWL 3QUYC 2NY6D 4OLZL 5IB4B 3HI5H 4IHOB 3GI9H 4N8PA 4OZHB 2V7NB 1WBYA 5DRXB 3ULSA 2VXQL 3HAEA 3UZVB 2FJHB 1PQZA 1U93B 3WV0A 1RV6X 1IGCH 4PFEA 2BDNH 4XWGH 1NBVH 2Y6SC 4RBPH 3BGMA 2DQFA 4XP5H 1IGJA 5FFLA 4XNYH 5KVEH 1F45A 1N4XL 3ARGD 2P7TA 1YEFL 4ENEC 5C0RH 5DD5H 5I1EL 1F90L 2HG5A 2NY0D 4J8RB 1KPRB 4P9ML 2J6EL 3JV6A 3OG6B 3G9AB 4I48B 4NQDA 3UC0L 1VERA 4AJ0A 1IE5A 4YUEL 3BWAA 3QCUH 1S8DB 5E6YA 3O3BA 4XCYA 2E9IA 5K59E 1OAQH 1UZ8A 2DQJH 3O4LD 1U58B 3GBNL 3BQUA 3CX2A 4P2OC 4W4NA 4HFWA 4UIKH 3V6OA 3U4BL 5HHNB 1YEGH 1FNSH 4LLMB 5D6CB 32C2B 4NO0D 4QRTB 4NUGL 4ZFFA 4R7DB 4JRYD 5GGVY 1ITBB 1A1MB 1MSPA 2ZOKB 2RBLA 5I9QB 1DEEB 3KAAA 3QUZC 4MCZB 4ZSOB 1DUYA 4YE4L 5HHXH 2OR9L 4O2FB 3QB7C 4LASH 4PREA 3P0VH 4G6JH 4DGVH 3QZWB 4Y1AB 4U1NA 3SDXA 4PRDB 2VZ3A 3OJVC 4RZCB 2QQLH 2VDKH 2BNRD 3Q48A 1JWUA 2WLYA 3ULVE 2LU7A 2BOBA 5ETUB 5JOPE 5EFIA 3VXTA 2NY5H 4JPIB 4ZXBA 4CADB 3V2AR 4U0RB 4R90H 5KVFL 2EDTA 4Z95H 1HEZA 1E4KA 4P5TA 4CRPA 3OKLA 1RFDL 4FQPA 1LEKB 3ZDZE 4X4ME 5IVOA 4KAQL 2ZUWA 4OZGE 5CD5D 5IEKA 3IFLH 3A6CL 3SDXF 5IR1A 1OAZH 3AGVA 5FYJE 1FNEA 4H8WC 3MRBB 4ELKA 3BH8B 4OCLC 3EJZC 1NCTA 2B4CH 1A3LH 1M7DB 5C86A 5I2IA 3ET9F 1RAMA 1XGYH 3VRLF 2OK0L 4DN4H 5CCKL 2VXSH 1AHWB 1T89C 1TVDA 2OXGA 4CDHA 4X4ZA 5HHMD 5CP7B 2V2WA 4YHOH 4LSUH 4QCIB 3IETB 1B88A 2Y9RT 1NGWB 2BCKB 1JWUB 4Z7VB 4HIJA 3EYQD 5L2KA 3EAKA 3RWDB 4GRMA 1A7QL 4X83A 1UXWA 1KACB 1LVEA 4PJ5B 5HDLA 3GO1H 4A6YA 2ZUQB 5KVDH 1FP5A 1KJ2H 4BUGA 1T21A 1JCKA 5GRVK 4Z7VE 2YD7A 1QSEA 1R3IH 4JQIH 5C0AA 2EH7L 3E8UH 1JGLH 3ROLB 3TPUB 3C5JA 2PXYC 2Y5EA 4G6MH 1C5DB 1HH6A 1CGYA 2GCYA 3U0TA 5DJCA 2J6EA 4X98B 4NNYB 3DV6B 1OB1A 5HD8D 1EXUA 1TQCB 4JGMA 4CL7A 3BO8B 1BPVA 4XAKD 3GRWH 1ZT7B 2E9WA 2W91A 4WI4A 3CH8A 4WU5B 5JUEH 1KSRA 1I85C 1U8KA 3I6KA 1CFTA 3QXVA 1N59B 3QP3A 1Q9LB 4KK5D 5LAXB 4KHXH 1QYGH 3AFLA 5DRXA 1RHHA 2HT3C 2CGRL 1H15A 1PX4A 4GAGL 4PTTB 4EDXB 4PJGF 1OPGH 3L1OH 4ODVL 3MLPA 4O51B 1N8ZB 3R06B 3MJ8B 1V3JA 4QRTA 2K7QA 5DR5L 1UWEL 5I8EB 1HXMA 4F9LA 2C4FT 1HKLH 5IOPA 4RFEA 1J0ZA 5CEYB 1KIQB 4G9FE 5JNYA 1WWWX 4WI9A 5CJ5A 3V5HB 3VXUA 4DEPB 4C54A 4UTBL 3NFNB 4LFHD 2V2TA 4ODXB 1OP3K 4OQTH 1JHLL 5HY9B 1RSFA 3UO1L 4HZLB 3C2AH 4KK5C 3GDBA 3P77B 3BH9B 2EH7H 3E8UL 4LIQE 5ITBL 3VWKC 4X7SL 3D3VB 4GUPA 3M07A 3T0ED 3BKYL 4UMGA 2NCMA 1D5BA 1G6RA 2YA1A 4JFHE 4G8IB 1ES0A 4DFIA 4UDUB 1RJLA 2WUCL 5FKAA 2D7NA 4DK6A 4N8VB 4HIEA 1I1AA 5DHYA 1UWEH 4LSTL 3FO0H 5IW6B 3LN5B 3FJTA 5DUBB 3ZYOA 2AI0H 3LB6C 1XR8B 3ABZA 2MPAL 1FJ1B 43CAA 2FEEL 2XWBA 1UKQA 1KLUB 4Y19E 5EBWA 2IFFL 4WWKA 2DQGL 5BW7A 3UPCA 3I2CL 5H35B 2LE9A 3ZDXE 3JTSA 3QCTL 1T7WA 5DRNB 4Y16D 5L6YL 1DBAL 3O9WB 4QT5B 4HIHB 4JO1H 3WDJA 2I07A 3RI5K 1WLHA 1NGYB 1AGFA 2E9BA 5C92A 2OSLB 2VLJE 4IM8A 1HDMA 3T3ME 2AEWA 4HH9A 2BY1A 3QRGH 3D18A 4J1UB 3SDDC 3HMXH 4XCCL 2OJZH 1DP0A 4XP9L 3ARPA 2NLJA 1KCUH 4K71C 5I73C 2EICA 2YUXA 1FV1B 1U8JB 4M62H 4UNTA 4KKCC 2DQUL 2XWJA 3QPQD 2DI9A 3NIGE 4GW4B 1QFUH 1EPFA 5DT1H 1LK2B 3RDTB 1UWGL 4CVWA 2ADJA 5GHWL 3ZE1F 3I6GB 2ESVE 1FQ9C 4ZD3H 3HCVB 4G8EA 4KKAC 4RQQB 5L88L 4OT1L 1B0RB 3A67L 4U1IA 4RBPK 1I4FB 2NYYC 5FYLD 1E27B 4WENB 3ILQD 1JGEA 4XWGL 3ARBC 3CVHA 3GMRB 4FFWD 1G6RH 5D96C 4XMKH 1I8IA 3H9SD 2YXMA 3TCXA 4XVJL 1NCUA 2QTEA 3EYSH 4NO0B 2OTUA 4X9GA 4MS8D 1FFOB 1YMMB 3I2CH 5C08A 1ZVSB 3MNWB 3NIDE 5JPMA 3S96A 3QCTH 5BRZB 5E94A 2XTJC 4V1DA 5HHQA 3QDHA 4DGYH 4YHKH 5K9KB 4IRSB 3SE8L 1YMME 1DDHA 4PJ7A 3IXAB 3OKNA 4JANA 3SDAA 4L1HA 1ADQA 5DD0H 4PP2A 2XRAH 1VEMA 3CU7A 3VU2A 4U6XB 4JDZA 2BDNL 3UAJD 3BGFC 1DE4B 3BPCA 2ICES 1VKXB 1QSVA 3GSXA 5HGBB 1VCAA 2Y5TB 3UZEA 1IQDB 3CSBA 2Z91B 4I0CC 4PRBB 5IQ7L 1BP3B 3NACL 3BZ4B 3TVMB 4ORGA 1OCWL 1Q38A 4D8PB 3GMOB 3ZT6A 4EJ1C 3LKSA 2C3HA 4XNMA 5IB5B 4Y2DC 1IBGH 3HZKA 1I7TB 1Q9KB 2OSLA 1L0XA 2HTKC 3FRPA 4PJ7E 1V3MA 2QSTA 2WWKT 2K9UA 2HH0H 4OKVA 4DGYL 3LKRB 1OOAA 5IMOB 5J7CC 4QXUL 2R4SH 2GUOA 2VDQL 1MH5A 5J1AA 2QKIA 1Q1JL 3T0EC 1FFPB 1BF8A 3QT2A 5K33A 3ETBF 4L1DA 4HMEA 4WHYG 1F11B 4KMTL 4BFEA 1FFQA 4PJHA 3UTSE 3AS2A 5EUKB 5KVGL 3TEUA 3ARQA 1J18A 1YQVL 4G6FB 4CN1A 4QWWC 4X9IA 2O26U 3BP7A 4GBXC 4LCWE 1H3TA 1P2CA 3TYFA 5C6TL 4NRZA 5B3JF 1CXKA 2XZQL 3U7WH 3UTSB 4OCXL 4X8JB 5DQDL 4AEHL 5ISZD 4OZ4A 1F3DH 3QUMH 5I1CH 3B9VA 4NO2B 4E41B 4MJ2A 3Q2CA 3OXSB 5I6XB 2YD8A 1ZV5A 2EYSA 2F53D 2CO7B 3BYYA 4U6VL 2IPUG 4JZNA 2QADB 3DSFH 4DEPC 2NY6B 2RAMA 2E8YA 1J8HE 4HUNB 3KLHC 5I19L 4WWKB 3GMPA 3WDIA 3EFDL 1KN4L 2ID5A 4GKNA 4NNXA 3MLZL 1XGRA 1G7PB 4KHTH 1WV7T 3UBXI 3F5WB 1C12B 1RHFA 3H42H 4D0BB 5ACZB 4PJGB 1ZVHA 3FAXA 4Y4KB 4XPAH 2CK2A 1ACZA 4KTYA 3MRKB 1CVSC 5KSVA 3LKNA 4QHLA 2X4SA 3C60C 1S9XB 4G8IA 1R0AH 3VXOB 2ICWJ 4WI3A 4K7PH 3OAUH 2R1XA 1W0VB 2NXZB 1GGIH 5D72H 1CZ8L 3IXTA 1BD2A 2NY2D 2IH3A 5I0ZA 3P30H 3T2PA 4QTHA 3MBEA 2AV1B 4QTIL 1CGSL 1KIPB 3PDOA 3EFDH 5D1ZA 1BQHA 3S35X 3KLHD 4FMKA 4GLRI 3N1PC 5HGAB 1NC2D 1G7LB 5FM5M 2I26N 5HI3C 1IEHA 2M8XA 3WS6C 2IWGA 2W07A 4LLQB 3MOBL 3RVUC 3HR5A 4G7VH 3Q5YA 4MS8C 2OZ4A 5FEBA 5CZVL 1ZT4A 4RFNC 3MUY1 4HJJL 3HS0A 2FX9L 5CLWA 2YPLA 5I1DA 2VL5B 3LPGA 4PJFE 1GL4B 1QZ1A 2OR8A 2EDXA 5DJZA 3IETA 1ZA6A 4P5MA 3ECBA 3N1MC 3RU8H 2A6IA 1P7KB 4OI9A 4QGTA 3W0WE 4I4WA 2Q6WA 3BD4A 1KIQA 4GS7B 1I3RB 3FRPG 3TCLB 5HVGB 4PTUA 1MCCA 4A6YB 3H9HB 3IKKA 5DJ0A 5IOPB 4CU7A 1EX0A 2MQ0A 1S3KH 2DMCA 4O58L 3V7AG 2ZJSL 3E3QC 4M8QB 5K9JL 5IBLD 1AI1L 1HXYA 1CXFA 3VD9A 4P3DB 1T1WA 4QCIA 4GKSB 2A83B 5IEHB 3P4OA 1MCKA 2BCKA 4Q9RL 2N1KA 2F74A 2Y25A 3MNZB 2X4SB 4NNYA 1J7VR 1YNLL 3VXQA 2VC2L 5I1AA 4NM8L 4PV9A 4ELME 4X6CF 5AG9A 3CPLB 1TETL 1NEZG 3UTPE 2C1PA 1JGDB 1NMAH 4PB0H 1CFBA 3MRIA 4PRNB 4MA3B 5F6HI 5F93C 5IB3A 4ELMB 2FO1A 4JFZL 4JY4B 3WHE1 2G9HB 2EZ0D 5EU7C 5F9AC 5F1NA 5FIEA 3VGAB 1U6AL 4F33A 3AAZB 3BKJL 4N0YL 5CUSH 2VISB 4MA8H 1JRHL 3LQZA 3LHPH 1L6XA 1BVKB 5GGQL 1EXUB 2ZCLH 1R3KA 1HIML 4Z7OE 1QVOA 3CXDL 1WBZA 4E41A 4JZOA 4U6HB 3WL9B 3NCJL 5HPOA 5C0FA 1V3LA 3QSKB 3WKNA 5HI4C 2R15A 4EVNA 3BPNB 3HC3L 1TJIL 2FYYA 3G5XA 3L3HA 3CFCH 4RMTA 4EXPX 3ZE0F 3L95A 3IAPA 3FOMA 4HJGA 4OLXL 3BIKA 5FYKD 5LBSH 1MHCB 5ID0A 5DHVB 5IVZA 4ONHB 4YHOL 1HNFA 5TDNA 3WIHL 3ARWA 1U91A 1B4RA 3CFKB 3P9WB 4R2GB 5L2JA 5LXGL 2CRZA 1HILB 4U31A 1SYSB 1RZFL 1S8DA 1QYGL 3RP1A 1TTGA 1XF1A 2FX8L 4MB3A 4AYFA 4YDVA 4J6RH 2VISA 4LCIL 4PJHF 1OQXA 4OGXH 2GJ6D 1I9RH 4PJFF 1T2XA 4FXLA 2UVEA 5LJYH 1T2QH 4ORGB 1T83A 6FABH 2ZUVA 4UNUA 2ENSA 2EH8H 2YWYA 1OAYL 3GJFK 5IMLA 1N6QH 1Z0NA 2C1PB 1C08B 3LEXB 4G8GE 4KI1A 3IDXL 5SWQB 2F54B 3PL6C 4PJCA 3BZDA 4OZHF 4JDZB 4XX1G 3OHXB 3PWLA 1WBYB 4F7CA 2A83A 1FNGA 2XTLA 4M43H 3TC9A 4M02A 1BAFH 4BQ6A 1TNNA 5K59F 3ZKMD 4K07A 3FTGB 4Y2DD 2VN7A 1FCGA 1UXSA 1AJ7L 4GRLB 3VCLB 1NLBL 2P24A 1WEJL 5DI8A 1IFHL 3DETC 1KBGL 2HLFC 3I75A 3NABH 4QEGA 5A2KH 5BO1H 5GS0L 4HHAB 2OTWA 1ULVA 2EYTB 2Z93A 2DWEA 2X4PA 5FA3A 1JN6A 3DGGB 4AZ8A 3ECBB 1BQHB 4IHOA 3QAZC 3SDDD 3U9PH 5EOQH 5FO9B 2W59A 3BWAB 2V7NA 4NZDA 4JN1H 3O2WL 4XI5D 1U8MB 1LEIA 4Q9BA 3KPRE 5D9SB 1EEZB 3SKOB 2PF6A 4JN2B 4GFTB 1NGQH 2WUBL 4FG6C 2R0KH 4I0PD 4HKJA 1KENL 2X9YA 2WBJA 3EJJX 4L9DA 4K94C 3KDMA 1S7WB 1BBJA 3PWJB 2PYFB 1EMTL 5EOCJ 2XN9A 2I25N 3GMLA 4WV1B 2DQHL 3ULSB 4CGTA 1VHPA 4G8FB 3V6OE 2APXA 1MELA 3FB8B 1JRHI 3FAWA 3SKUD 5DJ6A 3VH8B 3CSYA 3G6DH 3WN5A 1JPGA 4GKNB 4KY1L 4XB8A 1CL7L 5EOQL 4PRHD 1JV5B 3CFDB 3ZHKA 4WHTA 5E8OB 1GVIA 1Q9OB 3HUJA 1HSBA 3IAQA 2AJUH 1Y0LB 3HNSL 5BOZG 1FGVH 1DLHA 1MCIA 5HPMB 5GS0C 3VE0A 1Z5LA 1FSKC 4J3WA 3MRHA 3PQYE 4KZEL 4BK4A 2DQCL 1M7IB 4OI8A 4X6BB 1NL0H 2X4OB 2XNAA 3MFFA 3C6SA 4K94L 4OF8A 3SE3A 1JNNL 4CJ1A 4D0BA 5ACZA 2YD9A 3JUZA 1F13A 4YDIH 3QULA 5DVOA 3MYJA 1T5XA 2FB4L 4LQFL 3F58L 1HH9A 3QNYB 4P2OD 3I50H 1QPXA 3EOTL 5DVMA 5EB9A 5F9WC 1LO3L 5L88H 1U3HA 3O2WH 5CJOL 4XMLH 2VLLA 4QRRA 2NW2B 1EO8H 4NQSA 5TDOB 5B3JE 3LKPB 5HSFA 3BIBX 3QFDB 3E3QE 3N50A 1BJMA 3WIHA 2XZCH 1WWAX 4M5ZL 4PS4L 3RKDC 5E5RB 1NUDA 4ZDHA 3LKQB 1UZ6F 1A6UL 5D1XA 5F7LB 3RVWC 4OCXH 3HZKB 4C56D 3MLUH 3UC0H 5MEQB 4ODUB 3QUML 4PJ8C 1NFDE 1CTOA 3LEYL 4AMKL 5I30H 4YAQA 4TVPD 5E2VL 3V5KA 4PGEB 4LF3B 4P4RB 4TOYH 1GGYA 2FIRT 5DC0A 5DEZA 4KRNA 4YQXH 5CMAA 5C0BA 1GOGA 1VB9A 3GSXB 5HGBA 2WQ8A 3QUZB 3NA4A 1GCFA 4JRXE 4K8RC 3FFCE 2LVCA 4XMLL 4JR9L 4PP2B 5EU4B 5J9PA 1HXMB 3QFJA 3LKSB 5CGYD 5E00B 4P2RE 2J8UA 2CIKA 2HKHH 2VE6B 2YC1B 4QHUB 4PJEF 5GZNC 2VLKD 4B0MM 4PG2C 3JBG7 1J1OH 3RL1B 3MV8D 1CE6B 4ZFZB 4IRJD 3EO9L 4HV8A 3DX7B 3VFWB 3EYVA 1OWWA 1FC2D 1LHZA 3DETD 4NJAL 1A9BB 2VH5L 3BWUC 3MCLL 4M1CC 5DEGA 3EYUL 1E6OL 4HULB 1A64A 4XRCA 1DVFD 3MRRA 4WTWA 2VXQH 2BSRA 4LBEA 4IRSA 3NN8A 3V5DB 3I6LE 5BS0A 4MD5A 4XTRD 3S3PA 4LPWA 3U0WH 4QHNB 4JFYA 1IC1A 1RMFH 5ALBL 3UX9B 4XMPL 4J4PC 4JZJA 3HAEG 1JZ3A 1ZANL 1VADB 3WS6A 3O6ML 3T3MF 1T2JA 5EC1A 3OKMA 4X4YA 1IILE 2P5WB 1KLGA 3TN0D 2IJ0C 2ZOLB 3FFCA 2DM3A 4HLJA 4GLRH 2PTVA 3NIFE 1DLFL 2SEBB 3GSRB 3O6KH 2DQDL 1AD9A 4LPTA 4WW2F 5JPNA 1MCBA 3AB0C 5GS2H 4EVNB 3D18B 4RGOL 4JFQA 4TNVF 3O3EB 4KPHL 1HHHB 2QQNH 3H3KA 4MAUL 4Z76A 5E5MA 1NGWA 4LSUL 2ARJB 2VDPH 4ZO9A 4F2MB 4RAVB 2VZVA 2V5YA 1QFWH 5ALCL 5E1AA 2J8OA 3VFMA 1IM3A 2JE8A 1JYXA 3TP4A 3Q3GA 1ZXQA 4UUJA 3U0PB 2E7HA 5TDPA 5GGQH 4PJIF 3ZE0E 5EWIL 3S5LB 1N5YH 5F1KC 3AREC 1J0YA 4PJIE 5T3XH 1DTUA 5FECB 4G43B 4RDQG 3RWEA 3OKEB 1EBAA 4GAYB 5I8CB 3CFIC 2HMIC 4B5EA 1CK0L 1UM6H 3TWCL 3ZTJG 3EDFA 5FHBL 1L9MA 1FYTA 4WI8A 3HNVH 3Q1SL 3DYOA 3AU1B 4QRQA 3ZL4H 3RGVB 5I1AB 2EIEA 2M2DA 1TZGH 2Y23A 4G6AD 2XTJB 3BDXA 4U6TA 2R0ZL 35C8L 4O9HL 4DAGH 2AK4D 2FLBT 3FB6A 2X6MA 4LMQI 4PY8J 1PVHA 4KROB 5DK3A 1A1NB 3UJTL 1EEYA 4ERSH 5IHZB 3BEWA 3W2DH 5F1NB 4QYOA 3CXHK 5ID1A 4BA8A 1OGTA 1RULL 1MF2L 4LOUD 5BJTB 4LVOB 4ZS7H 1HHJB 1MCWM 3MRCB 5C07A 1XF4A 1G1CA 3EYFB 1N6UA 2IAMD 1EAPB 3FQRA 4XBGA 1I1AB 5DHYB 3OAUL 5F1IB 1BOGA 3TWCH 3PWJA 5K9QG 2GT9A 1CZ8H 2HRLA 1N6QL 3P30L 3BKCL 1M05A 1WF5A 1FL6B 5IF0B 3G08A 1FVDA 3HPJA 4P2QA 3S3SA 5DS8B 3WJLA 1IM9D 3QIBB 3QHFH 3MBXH 5DFVC 1YNTA 2VZ1A 5DK2A 4ODHH 2GITB 3PWPE 3KHOA 2CRMA 4FFVC 4D3CH 2NR6C 3CK0H 3CUPB 4M93C 3SBWA 2R0LH 1RZIA 4HEME 4P2QD 4NQCA 3B9KC 3RZCC 2W65B 3ESVF 1N0XH 4S1SL 5DVKA 3RNQA 5F89B 1CXLA 2AEQH 4NO5B 5F8RC 1GSMA 1I9JH 3CLFL 5DD6B 5DRZA 1AO7A 1XGQA 4ZUWA 1C5BH 4L8CA 3EDEA 5C0AE 1IGJB 1UCBL 4MQTB 1P4IH 3B5HA 3TYGH 2A6DB 2XZAL 2HFTA 4WGWB 5FUOH 2E7LC 2Z8VC 5C07D 3LKNB 4QHLB 4X98A 2LAGB 3ZKND 4R4FL 4JKMA 5CIPB 4MLIA 3KLDA 1JZ4A 3KXFA 2Q20A 2ZCLL 4A2MA 1B4JH 1AQDB 2GSGA 3WIIH 2IH3B 2UWEE 2O5ZL 3JSSA 1PBYA 3L95B 5A2LH 4RIRA 4RMRA 3EO0B 2VQ1B 5FGCE 4N0FA 4POYA 3RWHB 4WUUD 4L4JA 4G7YL 1KXTB 2UWEB 4M93B 3WFEL 2VKXA 2QL1A 1ETZB 2HLAA 2NY3D 1FYTD 1TLKA 3CFCL 4ETQB 4R7NA 1Q0YH 4OF3A 3QRGL 4JFZH 1FBIH 4I9WE 3MROB 4HWEH 2DIAA 3OJDB 2E6PA 2JB6B 1C1EL 2DLIA 3MC0A 4RGNE 4Z76B 5DZOA 3UTTD 2AV7B 5B39B 4LVNB 1A9EB 4OUOA 4S0SD 1QLEH 1G9NL 2NPLX 1Q9WB 2MQ3A 2EDEA 2AV7A 1Q8MA 3QCVL 3E6FA 5DUPL 5D2NB 4PRNA 5GQBA 1T5WA 5CBAA 1UB6B 1K2DA 4CU6A 3P3YA 4XPTH 3AU1A 5IMOA 4KKBC 1NCCH 3BP4B 4DGIL 3F7YB 3MRDA 3LIZL 4LSTH 1T1WB 3CCHA 3TN0A 2WBWB 5ECJE 2XZCL 4ZAKB 4U1NB 4K3HA 2Y7QB 5B3NA 1YMHB 4HS6A 5TE7L 3DVNA 5BS0D 2ATKA 3GJFB 1I7UA 1T80A 3ULVL 3D48R 1LEGB 3BXNB 3D39A 3PV7A 4KJYA 2A6DA 5C0CB 2BOCA 5FOBB 3ULVF 5E4EC 5ADPH 4MDJB 2IPKA 1MCFA 3E1F1 3O3AB 4H26B 1WZKA 3R4DA 4PUBL 4XRCB 2YSSA 1KJVB 3CFBA 4OZFB 5TE4L 2BMKB 4TYUA 2EXWD 4WEBL 4KKLD 4M43L 1T20A 4OGYL 3T2QA 3CUPA 1IGML 3PWNA 5D7KD 4L8SC 1NLBH 3ARFB 1CE6A 5IUSA 2AV1A 3VRIB 2DQUH 3QFJD 4TPRH 2ZOKA 3RWFB 5MP6L 1MNUH 1HZHH 1YNTB 4CVUA 3GMRA 3CVHB 1VACB 2F54E 1LE9B 3MRMB 2ICEB 4JO1L 2YPLE 2CMRH 2W9DH 5C0CD 5F9OH 1ZT1A 5A3ID 4CNIB 5D93C 4EUPG 4YHIA 4M8VA 2WIIB 1LNUB 1S7RA 3OXRA 1OARH 1RZ8A 3KLAB 4ZUTB 3KPSA 1ZGLM 3BUYB 5C0BB 3L3GB 2IGFL 1V3KA 5MERB 2A9MH 1CDHA 5IB2B 1VA9A 1Z2KA 2VITB 4FXGA 1U3HB 1ZE3C 2GSIA 2GW5A 4HUVB 2PR4H 2R2EB 1LD9B 1U8PB 4LCCB 3QFJB 2B0SL 3LSOB 4IOIA 4FQ1L 2A6JA 5I1LA 4S10A 5D1QC 4RQQA 3NMEA 3JWOL 3ZDYE 5E0QA 2EC9T 2AAVA 3U2SA 3ARVA 5E99H 1U3HD 4U6VH 4KRMB 2DJSA 3Q6FB 4JG1H 2X1XR 4YHMH 2WP3T 4XPFH 1FVEB 4L29B 2D9CA 5D2LE 2MNUA 4JHWH 1P84J 2CQVA 4CDGC 2Q8AL 2C7UA 2DI8A 3GKWH 2Z31C 5ICZB 3V4UL 5I1HH 3ALPA 1BREA 3AY4A 2EO1A 5I1GH 2A9ML 2NY6C 1KYOK 4M5ZH 1H0DA 4YDJB 5ICZA 4KZDH 1PG7X 2PW2B 3RUGE 4IMKC 4YHLL 4QRPB 3GIVB 1AGFB 2E27H 3GEWB 5EULV 3U36A 3T2NL 5MERA 1G0YR 3PP4L 2XNAB 3O6KL 3GSUB 3MREA 1JHKH 3MLVH 5E9DD 4OM0L 1MCWW 4QRPE 5FKAB 3BVNA 1BZ7A 4MD0A 3PJSA 1HN1A 2EDWA 3PP3H 5EC2B 1B0GB 3QI9B 3MRGB 1T7YA 1DQDH 4JQVA 4NCDA 2R4SL 5HHVH 1DBJL 5IIEB 5T1MB 1HHKA 2VDNL 1YEJH 3ZT5A 3T0WA 3MRGA 4JHWL 2WV3A 4NC0B 5IBLC 2XN9D 1MVFA 4UOJA 5HY9A 3V79C 5HYJA 4XNYL 4L29A 2Z91A 1C7TA 2Z31A 5HGHA 3QIUA 1NBQA 4HIEB 4U6YA 3HG1A 3SY0B 4PG9A 5TF0A 3STZB 2R23B 4L4VA 5TH2B 4YHIB 3CH1A 2AJVL 4R9HA 4XNMB 5IB5A 3L5WB 3IXAA 4QRUB 1A0QH 4MXQC 4QXUH 3KPLA 3ARXA 5CZXD 4HBCL 5B21A 3UTZB 5F72S 1B6DA 4JO4L 1DBJH 1X5ZA 3MV9B 5FO9A 5SX5H 1X5KA 3QXTA 4GW5A 2AJZA 4MQXC 1D5ZA 1F58L 4U6XA 4Z7WF 1A7OL 2YWZA 1HQRA 3L7FB 3OQ3B 1FVCB 4TUJA 3U6RA 4Y2DA 3WS3B 1J1XL 1X6LA 2LU3A 5CILL 1SEBA 4QO1A 3CMGA 3D39D 4H26A 4U7KA 4U1JA 1Z3GH 3FQNB 1FLRH 5D6DC 5BXFB 4U3HA 3MRFB 1B90A 3UMTA 1F02I 3BP4A 2DIBA 1YMMA 5F7DB 5D7LD 1A0QL 3L6FA 3O2DH 1ZKAA 4JPVH 1D5MA 4R96A 2VERN 1L6ZA 4KJWC 5C08E 2JCCE 2VDRH 3H7LA 4F9PC 3J8F7 5IFJB 3O3DB 1ZT1B 1NSNH 2P4AB 4WUUB 5E8PB 4JAMB 4AM0B 4X99B 1JGUL 2CPCA 5CEZL 3I3BA 2Z0BA 2JCCB 3KG5A 3RL2A 1IAIM 1PLGH 4NC1E 3QUKA 5B39A 4IS6A 1J1XH 2CLVA 5DD1H 1KG0B 3X13A 2WBKA 1NFDA 3U4EA 5TQ0H 2OQJB 4NN6B 1FLRL 3PHQB 4XH2B 5KSAD 3V0WH 2WW8A 5CZVH 1TXKA 4Z7UA 2P44B 1W0WA 3RPKA 2A9NH 1YMHA 1AFVH 4BKLB 5F3BA 4ONHA 5TDNB 3UTTA 4K71B 1QLFA 4DZBA 3LVEA 5T5FL 2Z4QA 3G5VA 3FO0L 4LLAA 4OLVL 3VJ6A 4UT9L 1J0IA 1R3LA 1ZLWK 5L9DL 4QRRE 2FYYB 5FO8A 1KLUA 5EBWB 2VDLH 1A1OA 4E41D 1QRNE 3VWKA 4N8CH 3MRIB 5H8DA 2ATKB 3GJFA 4KJQC 2NY4D 4HDIA 3PNWB 2VXUH 1UEMA 5KSBA 4J3TA 1OM3L 1J0KA 5C8JB 4XXDB 3EJYD 2CSPA 4P3WA 2HTLD 1IEBA 3CFEB 5KSUA 2H32A 4XI5C 5KW9H 4RA3A 3BPLC 3KXFD 3TPKA 1FORL 1MI5B 2YA0A 3VWJC 2GIYA 3VH8A 4PB0L 1CFNA 3BW9B 2IALB 4OD3L 1YJDH 4HWEL 5AEAA 5AD0B 4OZFG 1AH1A 1XH3B 1QTYT 3FO1A 4F7EB 1OGAE 3TCLA 5T1LB 5D7IA 3GIZL 2CDGB 2FATH 1OTUD 3C08H 3GMLB 5DA0B 4O2FA 3MBXL 3VGEA 1UB6A 4OZIA 4JFOB 1AO7D 4X7DC 3EGSA 5FGBC 5JNYB 4F7MA 3WIFB 2Z92B 1RUKL 2GITA 1A1MA 4D9QD 4FFZH 1OF2B 3FT4A 1DBBH 5I74B 2OL3B 1SBBA 4NQCD 1A21A 3N85H 2X4RA 1DANU 4N68A 1MIEH 4HZLA 2EIBA 2F53B 1TETH 2AEQL 1U8MA 3MGTA 2EEDA 3HC3H 2ZUYA 4IEFB 4MAYA 5CHNA 2BFVL 5CIPA 4HBQA 5KJRL 3IS0X 5JOFB 5TJWK 2H3NB 5I71B 4M4PA 4GMTL 5CHNB 1OSZA 1NAMA 3IDJB 1AQKH 4N8CL 3MRCA 5EU5A 5AAMA 2I60L 2AVGA 5LXGH 1I1CA 1CCZA 5CSBA 2ADIA 1YY9D 1RY7B 1IMHC 1OD9A 4GOSA 4WUKH 1TNMA 1EZVX 1TVBA 2DQFB 5HXMA 1C5CL 9CGTA 1X4XA 3OKDA 1LDSA 1AGDA 4PJEB 3UBXG 1PQZB 4H1LH 5FYJL 1H5BB 3ME0A 1FCCA 3MRJA 4KY1H 2DMKA 3AMLA 1FORH 3V52H 5KZCB 2J4WH 3MGOB 1IQWL 2H9GB 3D3VE 5I8KH 2P47B 4PJCE 1RZJH 3SBWC 4C4KO 3MA9H 1FHGA 4KVNL 1HSAA 1MCNA 4HG4J 2AK4A 3JWOC 4G8GA 5T5NG 3MJ7A 5HDBF 3PWUB 2BRQA 4KUZL 3GMPB 5T1KB 3ARBA 4X8XA 4NKQB 3BGMB 1DQTA 1FO0B 2DIJA 3NAAH 1LE5A 3VXOA 1YEIL 1G9MC 1J10A 5CZKA 5I73B 3F7QA 5JR1L 2B0SH 3DI2B 5MHSE 1MFCL 1AHWA 5FYKU 1RZ7H 3V95A 5IFAH 3GSWA 5KANI 5HYSA 3EBAA 1KTLB 4HLZG 1AKJA 4K8RD 4R8WL 2A74A 3SOBH 4DWHA 4ESKA 2MQCA 2LU4A 3OB0H 4K7PY 3RUGF 2F53A 4HIIB 1NLDL 1R3LB 1SMOA 2GK0B 2VJXA 1KPVB 2YD3A 2H26A 3LKOB 4YX2H 5ESQB 3MRNB 1INEH 2V17H 4NZRH 1WJ3A 1CYGA 1FZJA 2YBRA 3UZQA 1KJMB 3T4YB 3GSNA 1CDGA 3GBML 4HWZA 1BIIA 4ORZC 1SVCP 5IM7A 2NZ9D 5F9DC 5EC1B 3LKRA 1A6TB 2BVPB 2JK5B 1JYVA 4PRPE 2NY4C 1RUAL 3DMMD 2EDDA 1AXTL 1Q94A 3TH3T 2P5EA 2UZIH 4RMWA 1A1OB 3GSRA 5EUKA 4Y4HA 3EYOB 3MLRL 3RWEB 5C8JA 1XCTA 1MY5A 4NUJA 4QY8B 1RZJL 5GRYA 2XYCA 4BH8A 4EN3A 2BVOB 2LV4A 4O02L 5DJDA 5KSBB 3RWJA 4JPIA 4ZXBB 1RMFL 5ALBH 3WKML 5E2UH 1RU9L 1DVFA 1SM3H 2D0HA 3VXNA 5I1IH 1I8KA 4FP8H 5DMIL 2HFGH 3HFML 1G7QA 2X40A 4E9LA 5A16B 2BJMH 4N1HB 4X99A 2V5RA 4CMHB 1MH5B 2QLVB 1E6OH 5KSAC 4OCMC 2KZWA 2VLKA 2DBLH 1EGJL 3SDAD 3U48A 1CDJA 3O3BB 1RIVL 4XCYB 3L6FB 1QBMH 1YEJL 1HHIB 3H7BB 3IRPX 5DURD 1NAMH 5C09D 4CBPA 1CICA 1P9MA 1INQA 3MLZH 4LF3A 3MLSH 2WMPA 5IQ9B 1TVHB 1D7FA 4KHTL 4JLRB 2ICCA 1LO4L 2IGFH 4K8RH 5EOCL 3V6FB 1FZKA 2VAAB 4NRXA 4KMQA 4L9LC 5C0BD 3KJ4C 2ZG2A 3MO1B 3H9SA 1CWVA 2ARWA 5ITFB 4Y5VC 1HNGA 2NY2C 2ZWLT 1BZQK 2BZDA 5E08H 2X89D 2WLZA 1PYWA 4L3EE 5F7DA 3MBEB 1O7VA 4JFYB 4MJIE 3S5LG 2NNAA 4NBZB 2OS7A 1KPRA 4LSSL 5BXFA 1I7RA 4OLEA 1DDHB 4PJ7B 1F4WL 4P9HL 2FGZA 1TZHA 4U1SB 4R4BA 5FKPA 5BQ7B 4QHUA 4TULH 1KTDB 3MV01 5GGSB 2WSKA 3ULUD 4IJ3C 3VDBA 4X6DE 4PG9B 5KSVB 4M7ZB 4XVSL 3GSUA 3WUWB 1KJ2L 2A38A 2X4NA 4K3GA 2I27N 1TITA 1GZPA 3T65B 4U1HA 3WFHA 5CZXC 1TTFA 4JCLA 1JIBA 4HX1A 3QIBC 1A2YA 5D5MF 3UP1A 2CIKB 3S3JA 4HGKC 4P57B 1RIUH 3AY4C 1MCJA 1I4FA 4KKBD 4ZUVB 5D5MB 4OF0A 3PGFH 1HH9B 1ITCA 3VG0L 1G7IB 2GTZB 4PJAF 3TO4C 1CU4L 1RIVH 2R23A 2EDJA 5CKAA 5J11C 4UIMB 5I1JL 4TVSa 4Y16A 4OSUL 3WNNA 4W81A 3ZKMC 2Q76A 1T1XB 2FX7L 2A6KB 3LRHA 5DUML 25C8L 2AJSH 1RJLB 3RGVC 4JFFA 2VDOL 5DRNA 4GT7A 5EO1A 4DZ8A 3LY6A 4PV8A 4J1UA 3NCJH 5CWSB 4AEIL 5D1XB 3O11A 4N0RA 5CINL 1JFQH 4NM8H 3AM8C 3W11D 5IVNA 4PBXA 2OYPA 1PKOA 1EHLL 2XG4A 4NRYB 2ED7A 2HN7A 1FPTH 4LKCA 3RVVD 5IHUH 2X4NB 5F6HJ 5DZLA 1MCPL 3MYJB 5EIVA 3LN5A 2WBJD 3SQOL 1GGIL 4C56B 3GHBH 1QOKA 2VLRB 1A6PA 1ZSDB 5DC4B 4UT9H 3QNZA 5E1HB 3RX5A 4RGNC 4GXVL 4ODTL 3SO3C 3U9UA 3ZHDA 5EZJB 4LU5L 3SE3C 1H3VA 4GBXA 4QTIH 3MNVB 3PHOB 4LARH 2NX5E 2VLRE 3X12A 3O6FC 4AIOA 4ZS6C 4LCUB 1QSFE 3K2UL 4MNQE 2CDFA 4DCQB 4QRSA 3MX0A 1FJ1A 3WO3B 4PB9L 4O51A 4S0TD 3H0TA 4WEUD 5CILH 4Y5YA 3BZ4A 5DJ6B 1FVEA 3SKJL 4AEIH 1Y18A 4K7PL 4JVPA 2IG2L 3LMJL 2HJKA 5BV7C 2BSTB 4OCYL 3MV9D 3P11L 4Z7WE 5T3XD 2QQNL 4MAUH 2X4TA 4D0DA 1G0XA 4ZFOA 1FBIL 3LD8C 4Y88A 3QI9D 5GGTH 3T77A 2X4QA 3IDGB 5E6IC 1XEDA 3MA7A 4LL9A 3H7BA 2DWDB 2FBJL 5FM5O 1F4XH 1FRGL 4XC1H 4HCRA 3KPTA 3TA3B 5CEZH 1S7VA 2R4RH 1SJEA 4LLDA 4YGVB 3K4DA 1JZ2A 1I9RL 5EIQA 4NKDA 3BAEH 4AIZA 3GSOB 3FQTB 3BOVA 1L0YA 5I71C 1J0JA 1V7NH 1HK6A 3BIKB 3GNML 3D0LA 2HFEA 3CZFB 1GZQA 1MCPH 4P4KA 5CD3B 1VACA 4O2CB 5E8EB 5DGRA 4UZGA 12E8H 2AI0L 3M1BA 4OBRA 1DQJA 1YJDC 3QO0B 4G5ZL 4KQ3L 4YIQA 1X5IA 4CVZA 4D9RD 4PRIE 4MA8L 3RPIA 1WTGT 4HS8L 2EIDA 4WGVB 5F7EL 3PIQA 1YEIH 1AI1H 3QDGD 1T20B 3QEQE 4WUKL 3ZE2E 5A2FA 4FNLH 2IBBA 5L2KD 2F5AL 3UXFA 5IMKA 4ZUSA 1DN0B 3KPMB 1FH5H 1NH6A 5IMLB 4LLWA 3QUYA 1I8KB 2MCPL 3IFNL 1N0XL 1KUMA 4EKXA 1G7QB 1RZKC 3DRQB 2F19L 5BVJB 5I8OL 4C57C 4WHYH 3TPUA 5T5FH 1YY9C 2FO4A 3RDTC 2VLJA 1R3HA 3GSNB 2W92A 5FB8B 1IL1A 4OQTA 3JVGC 1XIWD 4OFIA 1NBZA 1FRGH 1CD9B 4Q6IC 5DEFA 5IVXB 3QXDA 4KHXL 3EO0A 4HS8H 4U7SA 1RVFH 5HHPA 4KK8D 1A02N 1ZMYA 2EDOA 1YDPB 4Y19A 5EZLA 3FT3B 2A2QT 3BDYH 4KROD 5H94B 3S34L 2CR3A 3L3KA 4XBEL 1DANT 1IKNC 2F5BL 3OJDA 4LCWB 4PJ5E 1I9JL 3CLFH 2COQA 3S4SG 3WO4B 3HS0B 5CBAB 2R56H 3OJMB 1ORQA 3ES6B 2IANB 4J3VA 5KBNC 4R2GD 1KXVC 3ELAT 1IZJA 2BK8A 1OP5K 3RNKA 3CVIL 3TBVA 5LQBL 3X14B 2GSGB 5HHNA 1Q94B 2BNQE 3ZYIA 2H9GA 5B8CA 1FL5A 3QJFA 1JPFA 4B7IA 5ADOL 1MI5E 4P5TB 5MP6H 4BFIA 4MXWL 1KTLA 2AJXH 1I8LA 1EBPA 1IKFH 1NGPH 3NZ8A 1R3KB 4JRYA 4E42A 5IM7B 1ETZA 3W9EA 4YHKL 4JQXC 3TNMA 4TOYL 1UVQB 2VDML 3CFJB 4Y4KD 4DKEH 5KVMC 1WT5A 1ZTXL 3DX8B 1U8NA 2G5BA 5BVPH 2DBLL 1NC2A 4P46C 4M9PA 4G9FA 3GJEB 1DSFH 4JFDD 1J05B 1BVZA 3GFUA 4PRDA 5CEXA 3K1DA 3FRUB 4GJTB 4JB9L 4WO4C 1BIHA 4NP4L 4S1QL 3V9FA 1T1ZA 3MBED 3S37X 5I76B 4FZEH 4PJ8B 4NQDD 4H8WL 3F12B 3RTQB 3O6FA 1UT9A 4HS3A 4JG0H 4MNGA 5M95B 5IJKC 3HN3A 3QI9C 5ICXA 1BD2D 3ZT7A 1JF5A 1P7KA 4QTHB 2A0LC 4I3SL 2YRZA 4FQ1H 4JM4L 3DO3A 4FQQA 3BHBB 3D9AL 4ZUWB 1Z0MA 3MV7A 4OF5A 2ADIB 3WNPA 3C6LC 1KCRL 5INCA 2HT2D 2UWEF 2YMXL 3BDBA 3L3DA 5DC9B 3O4LB 4LSPH 3A6OA 5I0DA 3F7VB 4HWNA 1FL6A 1S7UB 3AMKA 5DJCB 1ZA6B 3SGDI 4PUBH 1EAPA 2WAHA 3MV7D 4ALAH 5AAWA 1FAIL 2FEDC 2X1QA 1MAML 4R3SB 4J8RA 1F3JA 1MRDL 4PJFB 4X5WA 1S7TB 1G0DA 1TVBB 1BVLA 5IHZA 1A7BA 1IGYA 5JR1H 4PG2A 4PLKC 1EMTH 3QWRA 1LP9A 1QSEE 5KSUB 4OLUL 2HTLC 4X5XB 3U1SH 4EIGB 5EOTB 4LHUG 1FLTX 2VDMH 2VH5H 3MLTB 4JFDA 1S9XA 4UIKL 1AR2A 4LK4A 3S4SA 3VD4A 1KELL 4JHAL 5EZIH 5F1IA 4HAGA 1C12A 2C3XA 1EEUA 2EDLA 4Y4KA 2J8HA 3S98A 5HBBA 4N0CD 3KJ6L 1Q72H 3SJVE 5DYOB 4R90L 4EEEA 5KVFH 3WXVH 4HUMB 4DZBB 3RDTD 4H88H 1SY6A 4R0LB 2AJYH 4OB5L 2D4DA 4RWYL 5EORH 4J3OC 5GRUH 1FN4A 1RZGB 5E2VH 1WIPA 2OQJA 3JWOH 4RAVA 2GEEA 3PGFL 5MEND 5A43C 4AENA 1T0MB 2FRGP 5FF6A 4RFOH 4G6KL 2VZOA 4BSWB 2O5YH 1KCKA 1YY8A 4BH7B 3VFUA 3V4PL 1NEZB 2R29L 3QXAB 2JJUA 4Z7NF 4IRJB 4PJXA 3VFGH 4JR9H 1T89A 1QBAA 2C3VA 2PTUA 1XGTA 3UDWA 5IV2B 1FAKT 4MSWA 1CBVL 3MCG1 2I24N 1CLYH 1MFDH 4KV5E 3F6IA 3D25B 1XIWA 4LVHB 4HDIB 1AGCB 4YLQT 5BOPA 2ZUSA 4V1DD 4L8SA 4MA7L 4NKIL 5EORL 4EOWH 3VGAC 4DKFL 4NZUH 5BZWB 3QISA 3GMOA 2M26A 4BSVA 3FQXA 1GZQB 2RFXA 4BJLA 3GRWL 3B2UD 4TNWK 3JZ7A 4JAMA 3ULVC 1I1YA 3KJ6H 1KGCE 3VFGL 2OJEB 3RWIB 2AGJH 2P8PB 3BP6A 2X4UA 5HYIA 4F37F 4PGEA 1BHGA 3QDGA 2YC1A 1J1OL 2FR4B 4KVCH 4RWHA 1R3IL 3ARGC 5DZNA 2PO6A 4RFNB 3CDFA 3MOQA 2NY0C 1AD0B 4YEFA 4ZUSB 2VMFA 4ZQKA 3DNKA 2HFEB 2CUHA 3D0LB 4ZFOB 4TUJB 3U6RB 2AXGA 1MLCA 4NN7B 3QQ4A 1OQOA 3SDYL 2ADJB 4P4KD 2AJZB 3P73A 5EZJA 4LDEB 3RY4A 4K9EC 3KLSA 5DMKA 3TBSB 2VXTL 1XZ0B 1SJEB 5D7SH 1B2WH 3MJ9H 4GRWB 3PL6B 4HWBH 1TQBB 3QDJD 4I2XB 4Z95L 2CKNA 3UTZA 4ODUA 2Q8BH 2H2PC 1ZLUK 5JPMB 2VDOH 3IDNA 5DK0A 2R0LL 3L3OB 4PP1C 1OAZL 5ENWA 2L0DA 2QADD 1SHMA 4L4VB 4PJBE 5JLZB 3O6LL 3PJSB 3C09C 3GNMH 3QNZB 4WFFD 3TJHD 1PY9A 1E4KC 2KDGA 3MV9A 3VG0H 4WIQA 4XP1L 4WW1B 5D1QA 2CUIA 3SDYH 3O2DL 1L4IA 2C3VB 4ONGL 4TUKH 3SQOH 3IB4A 2X42A 1MQ8A 3NCYP 2IBZX 5AZ2L 5MEQA 4RAHA 1QFWL 2NY4B 2P46B 4E0RA 3LQAC 3ZSTA 4Q0XH 3BT2L 2A77L 3V0VB 1C1EH 4FTVE 3DUHA 1IEAA 8FABA 5FAAA 1MUJB 2APVA 3DJ9A 3QH3A 3K2UH 2Q76B 3STZA 4KI5C 1M7IA 1PLGL 4HIHA 2DQTL 1EEQA 1MF2H 4LCIH 2GK2A 3O4OC 2PYFA 4OIIL 2C3GA 3ILPA 3QUXC 3QH3B 1FG2A 3IDYC 2PXYA 4Y5YB 3U82B 6FABL 4XNUH 5FYJH 1FPTL 1N26A 4XBEH 4Y8DC 3EJZD 2DLFL 4LCCA 1CLOL 1QPPA 3P77A 5JHLL 1T5XB 2YD6A 5I8KL 3OG4B 3WJJA 3VXUD 1XR8A 2P49B 5IB1B 1D9KD 4ZO6A 3TM6A 1K4CB 2Q3ZA 4HWBL 4NM4L 1W2KT 4U1HB 4QXGL 5ANME 1IAMA 3FN3A 4YJZL 5LQBH 1ROWA 1H8NA 2FWOA 3D6GA 4XTRC 5J06A 4GMSL 5D1QD 2FHBA 4JFFD 2CH8A 4ENED 2RR3A 3QCVH 3FB5B 5ANMB 4XPGH 4UDUA 3D69A 4YNYB 2FECI 4ZTOH 3SKJH 43CAB 4XVUD 3LRSB 1UXSB 3LH2L 1IAOB 3S34H 4G6ML 1JPGB 5BVPL 2V2TB 5JDSB 2Y06H 1HHGB 5SX5K 3WFDH 4Y4FC 4LLUA 4M61B 1CR9H 4OLXH 3QDJA 3BP6B 3KDMB 1P4IL 4AT6A 1NCNA 1PY4A 4CNIA 2XN9B 4AL8H 3QHFL 4FA8A 4GUPB 2JCCF 1ED3B 4YDLB 3VXRD 3IU4H 3HLAB 4QXGH 3QWOB 5TFSL 1KCSL 2VSCA 2B1HH 1X5GA 5CS7A 3CK0L 3I85A 2XFXA 3DUUB 4OAWB 5KZCD 2GSIB 4IRJC 4HQQH 2HT3D 3U0TB 2V2WB 2MKWA 2MSPA 5KW9L 2P8PA 3V8CA 4P2RB 4BSJA 5LCVL 2H1PH 2ZZUT 3ROOB 1R24B 4MSWB 2WUCH 3OX8B 3R8QA 1YJDL 4M00A 2X89A 4YC2C 1CR9L 4WVRA 5GRXG 4ALAL 4NM4H 4LCYB 3PP3K 4JRYE 5I1IL 3VD3A 4HCRH 3REVA 3V6ZB 3VFSB 3HFMH 3MMEB 2GCYB 1F6LL 4YDIL 2J5LC 1UVQA 3R8BB 2GI7A 1OB1B 4KGLA 4BK5A 2VABB 1YN6A 4KJQD 2YMXH 1QR1A 1CICD 3LD8B 3B8SA 3EYOA 4UQ3B 5C09A 4L4TB 1FL5B 3QJFB 4NUJB 1Q9WA 2YHGA 5D2NE 3S9DB 2IAMC 4OGAC 4F57L 3E6FB 4XP6H 4HXAH 1AC0A 1T04A 1QFWI 1G7JB 2BNRE 2G75A 3QUXA 4GXUN 3I3DA 5IHLB 3I9GL 1SYSA 4OJFH 2ITDA 1W8NA 1MAMH 2AKRB 4ODWB 5EOCH 5F7UA 3K4ZA 1WWBX 5C6WH 4NC1C 5DD5L 1RPQA 3G6AA 1DFBL 5L8JB 5MENA 1UEYA 5TGBB 3Q6GH 3E2HB 4HWBA 5A1AA 4JVUA 2B20A 5F3HA 5DT1L 4MVBC 4EN3D 5FYJD 1KPVA 1BQUA 4KQ4L 4N9GA 4RRPA 4X7EC 4IBLT 1A8JH 3X3GH 1MWAA 1Z9OA 2P5ED 4HPOL 4YBQD 4NP4H 4S1QH 3U0WL 4R7NB 4NZRL 5HHME 1FE8H 2EE2A 4LHUA 3S36H 5A2JH 5JXEC 1XCTB 3SCMB 3VXTB 2ZUXA 4OGYH 1KN2H 2H26B 2CRIA 2P5EB 4RZCA 1AGEA 3O4LA 3QEQA 4HPYL 4Z6AT 5I1CL 1P9MC 3BKML 4N0FB 3NCCB 4DGVL 1V5JA 2ZPKL 2IANE 3QEHB 2X9WA 1R24A 1F3JB 4RDQF 3HUJF 4G6FD 3SCMD 3SOBL 1KT2B 5IW1A 5BV7H 4W6WB 3MGOA 5EU6E 3RQ3A 1EHNA 1AGDB 2LABA 3CX5J 4PJEA 4ZPVB 1A4JA 2AXFA 3ULUL 3OGCB 3KPPA 1R5WA 1DQQA 5C0NC 5IWLA 3OR6B 4N0UA 1RD6A 3CDGA 3LKOA 1PGRB 2R69H 5HJ3B 2AGJL 1M05B 4NKMB 4MXVF 4Q9CA 1AO7B 1XGQB 5F9WB 3OSKA 3MJ7B 2W65A 4KRPD 4IDLA 4I77H 5JW3H 2YD1A 4LLYB 4WI7A 1U8NB 3SDDB 4BUHA 3D9AH 4MAYC 5DJZB 4HG4K 4W68A 5J56B 4OV6F 3KS0H 3QDJB 3T2OA 4KKCD 3B9KD 1IBGL 5C9KA 4M1DH 1T6VN 3D85D 2X10A 5IHUL 1BFSA 5AUMA 4R7DA 5JIKA 3PWPB 5HDQH 4P2QB 1MEXL 1IARB 4QOKA 3TN0C 1FNHA 4YXHL 4EI5C 1E4WL 1T03L 3FRUA 1AGBA 1U95A 5FYLH 3SGDH 3O6FD 2X4RB 2P42B 4U49A 1H3PL 2Z92A 1Y6NR 3O2DA 1EJ6A 1NBVL 3VMOA 4V2BA 4Y4FB 5ANMA 1GOFA 1OF2A 3FT4B 2XKNA 2NXYD 2WWKO 3CLEH 3OGCA 3FQUB 2CDGA 4G9FD 5KS9A 1HYSC 4UILH 3T8XB 1WK0A 4D9LL 3HRPA 3WUZA 4OZHA 1WUNT 1CDUA 2GY7B 1MFNA 5JIHA 5I18H 1CFVH 3LS4H 5D71L 4YQXL 1TPXC 4TRPL 3P4MA 1RZKH 4MAYD 2A9NL 3ES6A 4PJHB 3K1KC 3TO4A 5B38B 1A1NA 4HC1A 5EU5B 3T0EE 5KOVC 2FJHA 2R0ZH 4JFHD 3Q5TA 2QKIB 2RQ8A 3O0RH 1QACA 1U3JA 3S5LA 4TULL 2YEZB 2UZYB 3WXVL 2APFA 1XGRB 4BZYA 1HHHA 4PIRF 1WZMA 3EUUA 5DO2D 2YS4A 3X14A 4EI6B 2JJSC 4IJ3B 1ZHNA 3I02A 1T04B 2G75B 1OLLA 3BEWB 4Y19D 4JZNB 2W0FB 4PLJD 1V7NL 2EKSA 1AIFB 1NCDL 4PJBA 4K55A 1I9EA 2QQLL 1YC7A 3IGAA 3LPFA 4JFEE 3VXMD 5JW5B 5DMJB 3TH4T 1C5BL 1UM4L 2A6KA 5J12C 2V2XA 4MLSA 5EZLB 4OTXL 3W9DB 2VDPL 1LO2H 4RA0C 2VLJD 3VFSA 1D5XA 3W39B 1RUQH 3L3OA 3C9NA 4S1RH 1QNZH 25C8H 2DQTH 5IVXA 4Y8AA 3TJHC 2DBJA 4KK6C 3WD5L 1Z9SA 3FB7A 3IFLL 1XF2A 4GG6E 1FDLH 1ODAA 4OUUA 3TT3L 1IGTB 2BVTA 1PG7W 3QUYD 1R0AL 1GZPB 3T65A 5GGUB 3RGHA 1TJGH 5D2NC 5ESAA 4I8DA 4GQ9H 4EZMA 4X4YB 4X80L 3OZ9H 2J1KA 1G1YA 5FDWA 1BX2A 2IC2A 2Z9TA 1KB5L 1OY3B 3K2MC 3HNVL 4KPHH 2ESVD 1S9VB 1NBYA 4YH6A 2VQTA 3IDXH 4DUVA 2NY1B 2VXSL 3O41A 4PJDA 4I3RL 5KSAA 5DURB 2CIIA 3DVGB 3RZCB 1W72A 2L7UA 4OTXH 4DW2H 4P99A 3OAYK 3WYRA 1ZHKA 4HC1H 5GIRA 3BJ91 1S3KL 3WHXA 3FT2A 4K7FB 5IFJA 1FVCA 2JJWA 2W0KA 4J6RL 5JOEA 4N1EA 1YEHL 1J12A 5BO1L 5GS0H 3LEVL 3VW3H 3IJHB 5ITBH 3QIUB 1JFQL 1XR9B 3O81A 4HQQL 2Y4SA 1S7XB 3DUUA 4OAWA 1PZ5A 4W70A 4YR6A 5IJVB 4OD2B 3H0TB 2F19H 1KIRB 1KIUA 1X3DA 3ZL4L 5D7LA 3CZJA 4WTXA 1TVHA 1YMMD 5IKCA 3MJ6A 4JFXA 4U1MB 3GSQB 4M7JL 5HYSG 3VH8G 4AIZB 2DLTA 3QUZA 3MJ9L 4GG8A 3QI9A 1AGCA 5LGJA 2BSED 1FFRA 2X1WL 4Z7VF 1U2HA 4P9HC 1GC1H 2ZG3A 4QRRB 3C87A 2GFBA 1WEJH 4QGYA 5SWSE 2CJUL 2VIRB 4H25A 4FQ2L 5ISZB 1F2XK 2FHFA 1NGPL 2FHCA 4NWUH 3SDAC 1ZWIA 5MI0C 1EVTC 2EYRB 4GRWE 2YD4A 4GH7B 3JWNC 1MWAH 1AE6H 1MHEA 1UJ3C 2X1PA 1IKNA 2GJZB 5GJTL 5EU3B 4HUXB 3EJYC 3FQWA 2BSTA 3QDME 1PW3A 1O7SA 2NMSA 3HG1B 3MR9A 4RNRB 2VLLB 2WIMA 4P48A 5LBSL 1BECA 4GBXD 3MRLB 2PKDA 1GAFH 1FV1A 1U8JA 5I16B 3FB7B 5IB1A 4XC3L 2OMNA 1F3DJ 1LQSR 1Y0LA 3SJVA 3TT1H 2O5XL 1S9WA 3JTSB 3P4LA 3QNYA 4ODSL 3VDCA 3MQIA 1UJ3B 2DM4A 4MNHB 2ADFL 2NW3A 5HYJD 3B6SA 4LSRL 3WIIL 3MRQA 3UO1H 1DBBL 3BGAA 4X6CB 3S35L 1IAKA 4M7LH 3QHTC 5CSZA 5DJXB 4F8QA 1TJIH 3U2SB 4HKBB 1LP9E 3IS1X 5I75C 1PSKH 4NYLA 4OF6A 4WFGE 4X6CE 3VFOB 2F53E 3FZUD 2XIDA 1DL7H 2YR3A 3PQYB 5E9DA 5AWNL 1KJ3H 3D0VB 2EXYD 2Z8RA 4OFYD 3I02B 2C9AA 3DGCR 3TBWA 4ISVB 5BQ7A 1ND0B 1FE8L 5E8OA 1J88A 4LSVL 4HUUB 5EA0H 2IAMB 5EIIB 3TT1L 3QULB 4Z18A 1KCSH 4F58L 4OIAA 4OF7A 5HYSB 4BELD 3DGGA 1RK0B 2DLEA 2X4OA 3MFFB 3P73B 1NCWH 2OTWB 3IFNH 4WW2B 1IAIL 3GSQA 1Z5LB 2QHRH 3QO1A 1HI6A 1NCBL 4MGXA 4M6OH 2H8PB 3MUHL 4OZFA 2VXVL 4MJ4A 1LE9A 4ZUVA 2H1PL 4CMHC 5EUOA 1HINL 5TQ2H 3ZKXB 3C6LB 1S5HB 3F6LA 4NN6C 1FAIH 4PJCB 1RU9H 4RGMB 3MACH 5EZOH 1WFOA 2D31A 5D8JL 3REWB 2DF3A 1A4KA 4XNZC 4G8FA 3ZDYF 3PXHA 4ODSH 4Y1AD 1CLCA 4N5EC 1F97A 2R1WB 4JKPL 1Q0XH 2BP3A 5I76A 1KXQE 3KNBB 2Y7QA 3H3PL 4L8BA 2NY3B 2BY0A 1OAQL 3KPSD 1W72B 1NFDF 1J05A 1DUZB 4GRMB 4X5LA 3I6KB 1SJHA 1JE6A 4OCSL 1T22B 1ZTXH 5IQ9A 4BFGA 3D39B 2D03H 4JN1L