4Y19E

Immune complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
241
structure length
241
Chain Sequence
AGVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASRPRRDNEQFFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title T cell receptor reversed polarity recognition of a self-antigen major histocompatibility complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 60
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2015-02-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y19E01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y19E02
4DGYH 2NY7L 1I8IB 4QXUH 2GT9A 5IHZB 4K07A 3IDYC 2WQ8A 4PJEF 5FECA 4PJXB 3ULVE 1RU9L 4YXHH 1AQKH 4YO0B 1CDBA 5DLMH 2KH2B 3BE1H 1NJ9A 5CZXC 1FZJA 4WY7H 3MA9H 5DEFA 4PJ9B 2BFVL 5DURB 3B9KA 5LWYL 1MY5A 4HXBH 1HKLL 2GJZA 5DTFB 3NGBB 1I3VA 5F1KC 4MJIB 3CSYB 3H9YA 4OCXL 5GIRB 3OJVC 1BOGA 3GGWA 3MPCA 4QHMB 4Y1AE 3RGVA 3BDYL 1F8TH 4HWBH 4ONOA 4ZO7A 3V6ZB 2B0SH 3WHE1 2WBWB 4PJ9C 2EEDA 5AZEL 4Z7VF 1HHGB 3AREA 4JFEB 5EZIH 1VACA 3NGBC 2EDYA 2APBA 1J1PH 1UEMA 4UDTB 4D9QE 3ARDB 5KN5B 1AJ7H 2OQJA 4G8FB 3GSRB 2OYPA 1AIFA 1OGAA 4G6AC 2XN9B 4WUUB 2IGFL 2BOCA 4A6YL 5I1EH 5CHNB 1IGYA 5C0AA 4HT1L 2JELL 3QIBD 1KF9B 3CX5J 1F6FB 5D9SB 4X0KB 4OJFH 1NEZG 3ARDC 4MMZC 1NGZB 1DSFL 1T7VA 2FBJH 4XP6L 4Z5RB 4JR9H 3P0GB 1RUQH 5GSRA 1DLHA 4NIKB 1CDGA 3O4LD 1E4WH 1IAOA 1G7HB 2ADFL 2MPAH 1DZBA 4WEBL 4W6XB 3HZKB 4RGOL 3TBYB 1XGTB 4ODHH 3MFGB 1VHPA 1TZIB 3HI6L 4WNQB 3U46A 4BYHA 3W11D 3HRPA 2CRYA 5F9AC 3QFJE 4G42A 1TCRB 5IM7B 3RU8L 1HHHA 3DVIA 1T2QH 1UQSB 4MQXD 1JGVH 1N8ZA 1RZ8B 2D3VA 1KBGL 1S5HA 4HWEL 4JFOA 2F5AH 5T3ZH 1DDHB 2Y7QB 1T0MB 1TENA 1LNUB 4MD0B 5F9OH 1YN6B 5CEXB 3D2UA 3ARGB 1IGJA 5JOPE 2OI9B 2W9EH 3HE7B 4Y5YC 1T04A 4JB9H 3EYUH 4LQFL 3KJ4B 1IAIL 3HR5A 2F5BH 3S4SB 4E9LA 1A14L 4U6VL 3S37L 4HJ0D 3L1OH 1X44A 4PBVC 4HFWB 3O2VH 1J87A 1P9MA 4KK9C 4O00A 2AXGB 1DQLH 5IEKA 4Z7VE 5L0QB 2QV2A 4Q6YA 5B8CB 3LEVH 3GJEA 3ARGC 4LLVB 4WWKD 4JZOA 2G2RA 3MJ9L 3HE7C 4RMVA 5F71A 4YHOL 3KJ4C 1YC7A 3HI1B 4XNXL 4DVRL 2IAMB 3CFDA 4ORZC 2Y1VA 4UQ2B 3QWOA 3JWDC 2Q76A 2HTLC 4XPBH 3HTLX 2BDNH 3KR3L 3LN9A 4N0YH 4NUGL 4KZEH 3GMOB 1G9NC 1T21A 5ETUA 1QRNA 3F7VA 5K9JH 4UTAL 5L0QC 2D4DA 5B8CC 4L4VE 4OM0H 4M8QA 2Y72A 2YD6A 4L4TE 2J1KA 1I3RB 3L3IA 5D1ZD 2IANE 2RB8A 1MAML 1AGFA 5IFAL 4DZ8A 2IAMC 2X4UB 3MRCA 1I4FA 3JTSB 3CPLA 1VFUA 1P6FA 3MRKA 2FIKB 2VDML 2QR0B 3QCUL 2FLRT 2A9NL 3GUTA 4LLQB 5IW6A 2CDEB 2Y5TA 3DXAE 4MCYB 5T1LB 2J3SA 5ID1A 2ENYA 1YN7A 1CZ8L 3MNZB 4NQCD 4P23D 4TVPH 4JFPA 3MLXH 4LU5H 3WJJA 1FYTB 2Q8AH 1NAKH 5K9QI 1BFSA 3DVGB 4KK5D 1KJVA 2JCCE 5ID0A 2W9DL 2OP4H 4N9OB 2GJ6E 2EXYC 4OLUH 2A77H 1UB5B 4XZUB 3S6CA 4M00A 1DTUA 2VMFA 4JY6A 1H0DA 1AE6H 1C5CH 3VA2C 2VC2H 3V4UL 1QSFB 3LZFL 2Z91B 5I1IH 1A1OA 1LD9B 4XNUL 4Z0BH 1IC5H 3MLPA 1M71B 4R7DB 2CR6A 1PY4A 5J6GA 4OCSH 4E42B 1RJZB 1DEEA 5L8LB 1SBBA 1F3RB 4NBXB 5INCA 4JFFD 1C7SA 5E56A 5H37G 2KKQA 4Y2OA 3TNMB 1RQ5A 3KPMB 3AGVA 3QCTH 3TH2T 4ZUTB 1YJDL 5ICYA 1UCBH 3UPAA 4GG6B 1KTLA 3RIAK 1U8OB 3LKSB 5DS8B 3O3AA 3QPQD 3WS6A 3F7QA 3HNTL 3IDIA 5DVNA 3ULUD 2IBGA 3RZWA 3FB8B 3ZKQD 3QIUB 4UIKH 4PLOB 1UADC 5I8EB 5DK0B 43C9B 2VR4A 4U1HB 3QA3B 1I8MA 3S5LG 4FQIH 3OKMB 3HE6A 4DGIL 2FH6A 3C5ZB 2PO6D 3BZ4B 4M1CC 1KCUH 2IPKB 4OGYH 4WDIB 1EAJA 1N5YH 3UBXA 5KSUA 2D03L 1J8KA 3QIUC 4KJYA 3AS2A 3DI3B 5FDYA 2R2EA 4G8GE 1QFWL 2P24A 1ZT1A 5CBAA 1G84A 4POZD 2AS5M 1L9NA 1CE1H 5CIPB 3UTTE 3ESVF 3C5ZC 1ZXQA 2FECL 1X5AA 5CJQL 2EKSA 1MRCH 3CVIL 4Y5XB 4F2MA 4PFEA 3ARZA 4LGPB 2ATKA 1JV5A 2ESVD 5DMGC 5JOFA 3MRIB 1FHGA 4PJXF 4G5ZH 2G5BB 2JIXB 1ZA6B 5EC1B 3K4ZA 4NZDA 5MEOA 2JJUA 2H8PA 3PF2A 3IKKA 3GSUA 3F58L 4KQ4H 1T66C 4X4XB 4Y5XC 2VSDA 4M4PA 4NZTH 5DRZB 1MEXL 1BQHA 1VADB 3GB7B 4KI5D 5HDOA 3RL2A 1H3PL 1JGDB 4BELD 3ZT6A 4RGNE 1T1ZB 1GH7A 4QYOB 3WHE0 1S7RA 1BJ1J 1EMTH 4JFQB 3MJGX 4B7IA 3PWVB 4W4OA 1YZZA 1ZHLB 3VD5A 3O8XA 5BVPL 1W8NA 3GMQB 4ONGL 4TULH 4HQQL 4TSCH 1G6RA 1CIUA 4PJ5A 4PRBA 3SCMA 4FMKA 3WKMH 1KIPA 4M43L 5F97E 5I1AA 4LCUA 4P2QD 4Y5VC 3VFRA 2X1WL 3IFNL 1AY1L 3FO9B 5DQDH 5BV7L 4LHUB 4CDGC 3QO1B 1GZQB 4DTGH 1SJXA 4GO6B 5GGRY 3NFSL 3QDGD 1EXUB 4GLRH 2HFGH 3ZYOA 1GC1L 3KPLA 1ZKAA 5B39G 4YDJB 4AEHL 4S1SH 2FJFA 2WUCH 3LKNA 5DMKB 3MJ6A 2NY3B 3VG0H 4JDZA 3KPSA 2YPLA 4LF3A 1H9VA 3DBXB 2MNUA 3BESR 2PN5A 3VXQA 3S3PA 4ZS7L 2CD0A 3G5VA 4NQVB 5D4QA 3DURA 1BZ7B 2YD9A 2AJXH 4P2OD 4P9HH 4TUJB 1OP3H 4XWOD 5I8KL 4MA1B 1NGXB 2D31B 2CLZA 3DROA 2VZOA 4XGZB 5HGAA 3UJTH 4UINH 4JREB 4ONFL 5GGVY 4M1GL 5DGQA 3FL7A 3TCLA 3O3BA 2RFXA 1W72B 4UT7H 2BY2A 3P0VH 3MGAA 3MUJA 2NY3C 4NSKB 2P5WE 4AZ8A 3CMGA 1M1SA 4O51B 4LSRL 4BZ1H 4UUJB 1N6QH 1HE7A 2I25N 4PJXE 3RDTA 1OT2A 3SE3A 2Q20A 1QEWB 4MA1C 3VFMB 2WIIA 1A6AA 3MR9A 2R69L 4JREC 1MCPH 2BP3A 2X4NA 3X11B 3X3FH 1HI6B 4XBEL 1AD9A 1S9YA 2AK1H 5SWSA 2DWEB 3AC0A 2H1PL 2R2BB 4ZOEA 4JG1L 2X1OA 3HNVL 4P5KB 4MJIE 2DDQH 5C9KA 4A2MA 1S7XA 4N0CC 5DYOB 5D1QA 3TF7C 1XF2B 3TVMD 1FGNH 1S7SB 3ZTJG 5BRZD 3MCLL 4MLSA 5KVGL 1F90H 2WW8A 3OG4B 2IG2L 3MXWL 2SEBB 4YBHA 2BNQA 4QHLA 4X6CF 1FNGA 4JFEE 4H8WC 3SJVB 2L7JA 1LMKA 3VFPA 4JGJA 4FABH 4K55A 3IU4H 3TFKD 1FZMA 3HC4L 3NA9H 2VQUA 3QHFH 4HS8H 1ONQA 4OCWL 1UWEL 5JO5A 3MLTB 5GRZA 1JYNA 1OW0A 3SQOH 3TIEB 5IR1B 3H0TB 2LFGA 4F37F 2CDFA 4OCRH 3BN9D 4PP2A 1AXSA 4JHWH 4R2GB 1F4YH 4MLIA 3JWNC 1R3IL 2X4TB 4ZTPL 4U3CA 5FYLE 1NCNA 5TE6H 3PGCA 3BD4A 2HLAA 2BC4B 3PWNA 4O58H 4N8PA 4Z9KB 3MBED 1F6AB 5F89A 2P7TA 4Y4KA 4K3GA 2E6PA 3TT1L 5HBBA 3MUGB 3RNQB 1BF8A 3ET9F 4ZOAA 4CW1B 1KCRL 1OQXA 1PZ5B 5HGHB 1ERNA 2DQFB 3OKLA 5J8OA 4PRIA 1LE9A 3QZWB 4R2GC 2YXMA 3IS1X 1NCWL 3PL6B 1SM3L 4XCNA 1FV1B 1I9RL 2YBRB 1V5JA 4OGXH 5ISZB 2PNDA 5ENWA 4Z7WA 4K23L 4HKXB 4NQSA 2XRAL 2EYSA 3VD9A 3TC9A 5T5NF 2NZ9C 1JMXA 5JHLL 1ULVA 5EU4B 5SWZE 2XA8H 3T09A 1FORH 4JANB 4Z77A 1IGIH 1MFBH 1WK0A 2EYRA 4NZUH 2DAVA 5IMOB 4PJFB 3TBVA 1FLRL 1JFQL 1F4WL 3JV0A 3FB7B 2DQIH 1I7TA 3QUXA 1R3LB 5F7EL 1K3ZA 3CZJA 4PJ7E 1ADQL 3N85H 1JYVA 5HPOA 3QUYA 3UX9B 2XXCB 3IJSB 3SKNB 5AG8A 1P69B 3VRJA 3GIZL 5D70H 3GKWL 2ITCB 3CU1A 4Z18A 3KXFD 2V7HA 4HXAH 4L5FL 5DO2D 5C0JA 5F3BB 3MV9E 1LO4H 4PJCB 3WHXB 3QIWB 4X6CE 2C1OA 43CAA 4HUXB 4MCZB 4NM4L 4GG6F 1JNLH 1EZVY 4HIIB 2DM2A 4BZ2L 5IESL 5I1HL 4IRSD 5BJTA 4XBPA 3IDUA 3LIZL 2A6JA 1OHQA 4MJ4A 5DMIH 4XX1E 5E2JA 4K7FA 1IZJA 5HJ3A 4C56E 3FQWA 4WI2A 1HH6A 3OTTA 3MOQA 3T8XB 5GS1B 1BVKA 1ZAGA 3FRUA 4YZFF 3RWJA 3DARA 1KPUA 2FR4B 1A0QL 3SDCD 4IRJD 1L0XA 3H9HA 1JIBA 5KS9A 5JPMA 3D39D 5GGVL 2OTWB 1QVOB 2NX5E 3FO0L 3HC0B 4N5UA 2K7QA 4GKOA 1U8PB 3STZB 4KHXL 1OCWH 4FZ8H 3BH9A 3EOYG 1DVFD 4ZYKA 5FHBH 2AGJL 2OJZL 1AR1C 2R2CA 4I13B 1RJLB 5GS1C 3BUTA 1C8PA 2IH3A 2IQAA 3DSNA 4OZFH 1WAAA 4GT7A 3V0VB 2VZVA 2OK0L 3MA7A 3H3BC 1J1XL 3WNNA 3RL1A 1A3LH 3MOAL 4L8BA 2AJZB 1CFQA 1DFBL 1M7XA 2EZ0C 1FYTE 4LHQB 3HKFA 1X5JA 2KPNA 3RUGB 3V95A 4JQVC 4LSSH 1BLNB 2VLRB 5TGBA 5FGSA 2X2YA 4NWUL 1Q9OB 2YKLL 4GQ9H 1AXTL 4FFZH 1KIRA 3TO4B 5E6YA 3RRQA 2BERA 4PS4L 4OT1H 1CL7L 1CK0L 1JGUL 3VXTB 1QSFE 3AU1A 4L3EA 2VLKD 2A74A 1LQSR 3QDJD 4HS6A 3LQAL 1QNZL 5DD1H 1OP3K 5IVNA 5BO1H 4JY5H 4AENB 3KLHC 3ALPA 1F58L 1A6WH 4WUKH 4OCMC 3BT2L 3VWJB 4ZTOL 3TO4C 1TVDA 1TNMA 1BFOB 4KGLA 5D7SL 3O81A 3D0LB 1ORQB 1T20B 4H26B 1GGYA 4PJBA 1EEYB 3ZDXF 2EKJA 4GG6E 5IF0A 2AJUL 4HCRL 3VXSE 4NC1C 1RFDH 1KXQE 1I1FB 3BVNA 2PYED 3EOBA 1MHPL 1R5WB 1G0YR 4KY1L 2Y25A 4NQCA 2DQDL 3VWJC 4AK1A 3JVGC 5JHDB 3PQYB 4TN9A 2G9HA 1YEGH 1QR4A 4NDMA 2VDKL 3FHQA 4KHTH 4WU7B 4MB4A 2A1WL 5EU7C 5CMAB 3TN0D 4NPYA 4M6AA 1O7VA 2IBZX 3KPRB 3LRGA 3ROOB 5EOCJ 3U4BH 1L6ZA 4JKPL 2VH5H 3VFWB 1OTTC 3TPUA 1N5AB 1SYVB 5GHWL 4FQLH 1T3FB 5D71H 2FH8A 1IRAY 4RMQA 4N8VG 4F57L 4GJTB 5CD3A 15C8L 1CU4H 3GHEH 3SGKC 3QUMA 4NQDB 5F44A 4NZRH 3T0VA 3OPZL 2LVCA 1S7UA 1TETH 4YIQB 5GRUL 1NCBH 5DUPH 4QRUB 3WUWG 3G08A 5SX4I 3MCG1 4FXGA 1N0LA 1RURH 4HKJB 2EIBA 2DLTA 3DTXB 3MRFB 5FGBA 3WN5A 4CJ1A 3QO0A 3QH3B 2XZAH 3RBSA 1LDPH 4PV8B 3MGOB 5HHNA 1U2CA 3GMPB 5DD5H 5E1HB 1OLLA 2P48B 2B8OT 2AV7B 1WVZA 2BY0A 1MFNA 2FWOB 5DEGA 1IT9L 4Q6IA 4HLJA 2DQHH 3MNWB 3UCRA 1MREH 1U8MA 4CVZB 1LWRA 1EUTA 3BD5A 3WL9B 5IMLB 5LBSL 2FYYA 3VH8A 4DN3L 1WZMA 1FZKB 1U2HA 4AH2B 3KYNB 4P2CG 1LO2H 1LEKB 2V5SA 1AHWA 4RIRA 1R5VB 4U49A 1BAFH 4I4WB 2QADD 5C92A 1IL1A 3T77A 5JQ6L 3ZDXE 4QTHB 4YGVB 5KSAB 2CLRA 4QHUA 2LQRA 4MXWL 3SO3B 3NFPB 3T3PE 5C9JA 1IZKA 1FAKT 2GCYB 2R0KL 3EO1A 5IHLB 5HYJA 3UTPD 1P5UA 4PG9B 2AP2A 3C5JB 1A3RL 1NBZB 3MLWL 5F7KC 4NN5B 1N26A 2EDJA 1MCKA 3VJ6A 1Q1JH 1A2YB 5TFSL 3H9SA 5GZNC 5GSVA 5KSAC 5D1XB 3NZ8B 2J5LB 9CGTA 3SO3C 4FQJL 3MLUH 4BKLA 1OAKL 3DV4B 1FP5A 1LK3L 3BUYB 5C0BD 1KJ2L 5TE7H 1FFOB 2H6PA 3ULUH 1NCCL 1U8JB 1JCKA 1XAUA 1QA9B 3T4AA 2DWDB 2J8HA 3K4AA 4ODUA 2KDGA 1CFTB 1Q94B 3LEYL 4NN5C 5EZOL 3AS3A 3TO2A 4HWUA 2O5YL 5CP7A 2ADJB 3U7YH 4RWHA 4CVXB 1INDL 4RAVA 4POYA 1G7QB 2NXZB 5EOTB 3BH8A 1F97A 1S7QB 1MI5A 4UBDC 4JDTL 5D1XC 1IM3A 2J5LC 1P2CA 3VXUB 1UZ6F 4QY8A 1FFNB 2BX5A 2H2PD 1G9MC 3BPLB 3MRHA 1B0RA 3VD3A 4Y19E 4ESKA 5EU6A 3NIDF 4KTDL 1I85A 1I1AD 4MNHB 2AJSL 1GGCH 4ZUUA 3NFNB 3MRBA 3OX8B 2D7TL 2EDQA 4NO0D 2AK4E 3S36H 4G6JH 3FN0L 5JW3H 3F7PC 4YAQB 4LKCB 2NXZC 2VSCA 3QNXB 4PJFF 4EN3D 2ZCLH 3PWLA 1SVZA 1U95A 2XNAB 3BPLC 4YHNA 2BNUA 1AO7D 3EYFA 4OIIL 5FCSH 5MHSE 5DC4B 1OAYH 5GRYA 5ELIA 2Z4QA 4DZBB 1UWGL 3SGJC 5TF0A 3AS1A 4JM2A 4L8DA 2CLVA 3E6HB 4WHDA 5HDQL 3EJJX 2CKBA 3HI5L 5F7MC 4QOKA 1JGLL 1IJ9A 2HH0H 4JN1H 1MH5B 3FFDA 1ITCA 2BVOA 5F9JA 2FATH 2D0GA 5D7KD 5D72H 2EEBA 5TQ2L 1IEBB 3B43A 3UYRH 5GGUB 3FONA 4JRYE 5HYIA 3FB6A 4KI1A 3D3VB 4JG0L 4JPWL 2A83A 5EOQH 1VEMA 4NCC2 3V79C 3SEPA 2YA1A 5KW9H 4N68A 2CIIB 3FQXA 1KIQA 2AEQH 3EYVB 3HZVB 3MODH 2DQJL 4HG4K 4XXDB 1E27B 4F7EA 2CQVA 4EI5B 4OZIB 2IFGA 1YPZB 4UOW1 3RZCD 5FM5M 3HAEH 4HMDA 3IJYA 4FFWC 2YK1L 1DBMH 4WI7A 1SJHA 4TUOA 4RRPA 2H45A 3WXVL 2NY2D 3U0PA 3EYOA 4UV7H 5FYLL 3D1MC 1AGEB 2JB5H 1PLGH 5HHVL 1L9MA 5D96B 4KZDH 2VL5B 4X6EB 5EBLA 1K9TA 2KL6A 1V7NH 1I9EA 4D9LH 4EI5C 5F1IB 3GMNB 1J8HA 3RUGF 3JZ7A 3R1GL 3NIDE 1EHAA 1GSMA 1HHKB 4XHJD 5CLTA 3RVWC 1XGUA 2JCCA 1YUHB 3T0WA 4P3CH 3VXRD 4PGCB 3W39B 3NABL 4LAQL 1NKRA 3QNZA 5D96C 4JN2A 4P4RB 4LRNH 4EBQH 5CEZE 1E4JA 3GBMH 4PJFE 5HI4C 5IB4A 1AI1L 3U4AA 4LDLB 1UENA 3BAEH 4OCNC 3ZDZE 4RISH 4JO4L 3GK8H 1NSNL 3FZUD 5I9QB 1UA6L 4S11A 1YEEH 4MXQD 2QSCL 3IETB 1BX2B 4OQTH 1MOEA 3QHZL 4Y16A 5J1SC 4QWWC 3RVXD 4R8WH 3T0ED 3ZE1F 3SE9L 1RVFH 5CD5D 3W0WB 5I9QC 1I9JH 1QPXA 3DIFA 4N9GB 1FAIH 1FL5A 1VFAB 3QYCA 1H8SA 1A4JB 2BSRA 2HT3C 2V7NA 3Q48A 4GRWF 4XPFH 3U9PL 5HD8C 1FNSH 3S4SG 3JWDL 4IHOB 4PJIE 5JXAL 1BIIA 1G9NL 3UTZA 3MJ8A 4JPIB 4P2RE 2VISB 5E6ID 2HKFL 2E7LA 3HN3A 2HWZL 3SKMB 5LAXB 1AP2A 2GSGB 3CK0L 1I7UA 3FN9A 4K94C 4AQOA 3KHOA 4D9RE 4XRCB 4XX1G 5D7IA 5IK3A 5DWUH 2VL4A 2WBJB 2HFFA 4I5BA 4Y4HA 1X4YA 3DMMD 1T03H 4FQHB 1FZOB 3BKYL 3CVHA 5MENE 3K81A 4U6HB 1PKQE 2AVGA 3B9AA 1CTNA 2P8LB 3W11C 4W81A 2ZKHH 4I48A 5C08B 1KTDB 1QG3A 2V5TA 3LRSA 3N06B 4MQ7B 2I5YH 4PB9H 5CCKL 2F58H 5MERA 3S35X 5C8JA 2WBJC 2XWBB 3V4VH 1JYWA 3S96B 4M7ZB 5JA8B 1MFEL 4PJHE 5FUZL 3X14A 3QQ4A 5IKCB 2EDDA 2VKWA 4L9LB 1KXVC 2FZ3B 5E7FA 5J3HD 1YEFL 2BVPB 4FTVD 5D2NB 5DJ6A 4CN4A 1DUYB 3LMJH 2BHZA 4OD2A 2VR9A 3P4NA 2I60H 5GGTA 1KFAH 1U58B 5H8DA 1EVUA 2Z93B 2GQHA 2OJEB 4FOMA 2C3VA 4GRLB 3MJ7B 3QI9C 4X5WA 4NO5A 4P5TD 5T5NG 7FABL 5K9QG 4M7ZC 4MD4A 3ULSB 4HJ0C 2OR9H 5F7HA 1PAMA 2VZ3A 4FQXD 4L9LC 2NYYD 4AJ0A 2DQCL 5D2NC 5EU7E 3C2SA 3NCJH 4M7KH 5FYJU 2CO7B 3ZE1E 3DGGB 3U4EA 4GRLC 2ZZUT 4HMEA 3MRLA 3GJFH 1PG7H 4GMTL 4I9WE 1FFRA 1GPOH 4U1MA 5TPWL 2FD6H 3LN5A 3MRPA 1NCDH 4KQ3H 4GRWE 5C0GB 2LV4A 5JHDE 4X99A 1CGSL 2B39A 3OHXA 4NGHH 4NQEA 3BO8A 4MD5B 1U8QA 4XCFH 5C3LD 1HQRB 1RZJH 3D25A 1JHTB 4H88H 4P23B 4HZAA 1G1CA 3FQTB 3S34L 5JXEC 5T5FL 3CFIC 3IXAB 2JKXA 1JPFB 3RVUC 4CADA 1MCQA 3WIIL 5KVDH 2Z92A 3QEHA 1RULL 1FRGH 4WFED 5GGTH 4NQDE 4GAYB 3BPOB 5EO0B 3A6CL 4R96B 4OLXH 2M26A 5EWIH 2DRUA 4P23C 4JGUA 5EOCL 5FYKU 1P7QD 3ILPB 4EVNB 4PRHD 4U05A 3K8KA 3VXMB 4KK5C 3TA3B 5J56B 1HXYB 1ZGLP 3MV8D 3V52L 1FO0L 3P9WB 5BVJB 4YDVB 3CDYA 4R6UA 2ADGB 4NJ9H 1MAJA 3ILQD 1C5DB 4PRPE 4ZFOB 1CIDA 1L0YA 1KENL 1T7YA 4JFFB 2FSEA 4PREB 1X5KA 3D85B 4OLVH 5E0QA 2VWEC 4LPCA 4LPWA 3BPOC 5INDA 1P7HL 3L3DB 3T2QA 3VRLE 3GI9H 4I8DA 2UWEA 4PY8I 4UB0L 1E6JL 3ZKND 5IFHL 5IIEB 3OSKA 5I16A 3TA3C 3VMPA 3RWDB 1PZUB 5DJDB 3MRNA 3WFEH 2XKUA 1PX3A 1MCWM 1NFIA 2NY5H 2ARJQ 4BUHA 3AAZB 1UXWA 4NQXA 2R29H 2Z0BA 2A9ML 4CAGA 3REVA 3G5ZA 3F62A 1Q72L 3EFFB 3KDMB 5T3XL 5E00B 5DZOA 1NKOA 1YMHA 1AQDA 4PRDB 2IPTL 4ZNEE 5CWSA 4GW5B 1MJUL 3HPJA 5JORA 4U1SA 1TJHH 4ZUSB 4HUMB 3LSOB 1IAMA 1MCWW 4P5MB 3PDGA 3CFJB 4HWZB 4X7TB 3RWHB 4UOW0 3RPIB 2GEEA 1A7PL 1A1NA 4JO3H 2BSED 4XCEA 5EO9B 5FFLA 4IDJL 2XPGB 4XAWH 4OSUH 2FNBA 2ZG3A 4LHUG 3VFNB 4WHYG 2PF6A 1TJGH 4PY7A 3PJSB 1IGFH 3MCKA 4KDTA 3L5WA 1ED3A 3BSZH 4LSUL 3UTSA 1NC2A 5GXBB 3MUZ1 2E9IA 2H32B 4WTZG 2CMRL 2WINB 1YMMD 4HS3A 5EN2A 3T1FA 1HZHH 3AUVA 4Y2DA 1QSED 3QSKB 3VXUE 1VFBA 2FJHA 3ABZA 4MSWA 5DRNA 4PUBH 4LPYA 4R3SB 1QFOA 4MNGA 3V7MA 4XPTL 3V6OC 3VA6A 2VITA 1DE4B 5JPNA 5IVOA 2HN7B 4NRXB 2O93L 4FXKB 1SBSH 3MRRA 4EZMA 5C0CB 3UJJH 1JK8A 4JO2L 1RK1B 1XCTB 3HMXL 3HUJA 5SWZA 1W72L 2YC1B 4DKFL 3QG7L 4APQB 4LSTH 2YEZB 3GNML 2P42B 4JY4A 3F12B 4KI5C 1Q0XH 2ARWA 4NO2B 3BGFB 2AQ3A 1Z2KA 3O6FB 4P2QB 4M6OH 3VXNB 4O2EA 1TIUA 2F8VA 4P9MH 4EOWL 2PR4H 5BQ7A 4WW2C 2YUZA 5EZJA 32C2B 3BKML 1E4XI 3HAEB 5EH1A 4PJ7A 3N50A 2AXHA 1EA9C 3Q6GH 2FJGB 3IAGC 5DFVC 1L7TL 4EQ2A 1NC4D 5F9DC 2Z31D 3B9EA 4X7EC 5DK2A 4APQC 5C0BA 1BQUA 1D9KA 5L2KA 3HNSL 3BGFC 3PXHA 4H8WL 2GTWB 3O6FC 4PJ8B 2JB6A 2J7LA 5F1NB 4G8EA 4F9LA 3HFML 3WBDA 2WWMD 4QRSA 4MJ6A 5EIIB 3TZVD 4YHPA 3P4LA 4HF5H 2HJFA 4C56A 2IFFL 3D3VE 1M7IB 4Y1AD 3PDOB 3RJQB 1SEQL 2B2XL 1YYMH 4NUJA 4P3DA 1CE6B 4I18B 4DN4H 1H3XA 5ICXB 5C0FB 4KMTL 4GKSA 1A6TA 3GMMB 4PJ8C 4G6FB 1ZLWH 4WTWA 3DUUA 5I30L 2EIZA 1P84J 1KNOA 5T33H 2NX5A 5DQ9B 4TTGA 2JJVA 4U6YB 4D9QD 5CJOL 1Y0LB 1GAFL 4D3CH 1LE5B 3IFPA 2O5ZL 4FFYL 4EN3A 5GGSB 4LLMB 3RX7A 2QHRL 1HDMA 1QHPA 1UWXH 1AO7A 3BZEB 4I18C 3SKUD 2I07B 4ETQA 3C60A 4X4YA 1WGOA 3INUH 1U3YA 1WC7A 4HKBB 3GRWL 3BX7C 3IB4A 1VENA 4H5SA 5F70A 5ERWB 4XPHL 3BP6A 5DQJA 4YHIB 5ANMA 4Y4FB 1QBML 2VDLL 3LQZA 5A2KH 2P4AB 4D0CB 2FDBP 3T08A 5BRZB 5I73B 1IFHH 3DX9B 2B4CL 3QZWG 3PWPA 1MJJA 4QGTA 5JNYA 4OFYA 1IQDB 1YDPA 4IEFB 3ZDYF 1CI5A 1JZ4A 2BNRE 2NY7H 2YA0A 5A40E 3MUY1 1KPRA 4Y4FC 5FXCH 1U42A 4K3JL 5A16B 3L7EB 4M7LL 1MQ8A 1WBXA 3GSXB 5I73C 4XBGB 3P9LA 3QFJD 2W65B 4UIMA 4GS7C 1RU9H 3EYQC 1A21A 2EE2A 3QPXL 4G9DA 4KH2A 3V9FA 5CEZL 3U7AA 2B1AL 5KTEL 5ICZA 5DJ2A 5KVEL 3MBEB 1J10A 3LOWA 1G7LB 3IDJA 2BFVH 1D7FA 4JJ5A 5JOPD 5IB5B 1U8KA 5LWYH 3W0WE 1KYOK 1HKLH 4NNYB 1QFPA 3I9GL 2JJWA 1B9ZA 4AG4L 2YD1A 2VLJB 3GFUA 3IJHA 1VGEL 4OCXH 4RAHA 4FQQB 2L0DA 5FAAA 2EC8A 1EGJA 3BDYH 2NW2B 3IDMA 3NCYP 1HHJB 4TNWF 4J8RA 3QEUB 3FQUB 5AZEH 3MV7E 4PP1C 5DHYB 4P46A 3VCLB 5IJVB 2P5EA 3SGEI 2DQUL 3NACL 4E5XB 2CPCA 1RI8A 3C8KA 1SY6L 3L7FA 3MRMB 3WFHB 5I66A 1J05A 1HCFX 3EHBD 1HILA 4RBPH 1PSKL 5FA3A 2IGFH 4A6YH 4OZ4A 4HIHA 4C4KO 1ZV5A 4L4VD 4UU9A 2XT1B 4HT1H 2JELH 3GJFB 2EICA 4L4TD 3BRFA 2IAND 5EUKA 4MWFB 1C5BL 1DSFH 4K8RC 1EBPA 4OLWL 1A9BA 1U41A 4KK6D 4XP6H 3KXFB 5EFIA 2RBLA 2ZSWA 2FEDC 3B9KB 3DXAD 1V3LA 4X6DB 1M7DA 4F7TA 2DM7A 4BSVA 2ADFH 1MFCL 4WEBH 4Z0XB 1CFBA 3KYMA 3UDWC 1U6AL 4XNZB 4RGOH 5IBTL 3HI6H 1IC1A 4OFDA 2GJ6D 2XWJB 1Q9KA 3UROR 3C8HA 2EECA 2ZG1A 3ZE0F 3BP7B 4IRJB 3SDCB 3RU8H 6FABL 1OTSD 3X3GL 5JLZA 3B9KC 3AREB 1MY7A 1VACB 1KBGH 1XR9B 2IJ0C 4RFNB 3VFUA 4HWEH 5E03A 1P4BL 1X5LA 1WWCA 1KC5L 4WO4B 4XNZC 5C0DA 2OQJB 2P46B 3KYOB 4PLNC 2V2WB 5DT1L 1AIFB 1OGAB 2PKDA 4PYGA 3W9EA 1Q9LA 5BOZG 2BOCB 3BIAX 4LQFH 1A5FL 1IAIH 5E5UB 1DQJB 3ARBA 4IRJC 5C0AB 1E6OL 4R0LB 3AREC 4F7MA 3QXWA 5DJAA 1A14H 4U6VH 3S37H 2O61B 4QHNA 3SPVA 3UTQA 2R0LL 5IW1A 4RFNC 2WBKA 4JFXB 1CICA 4GQPH 2C7UA 4N0UB 3P3YA 4WO4C 2DTSA 1U8NA 2J8UA 4NP4L 3UEZA 1FVCB 3NCBB 1B90A 3MJ9H 5GSRB 1DLHB 4M9PA 5HXMA 2IEPA 3JBG7 4YHOH 3O6ML 5E4EB 1CFNA 4XNXH 5EB9A 5I6XB 4DVRH 1XMWA 4R0LC 4WFGE 3Q6FA 5HSFA 3PWJA 5HPMA 3KR3H 4NUGH 2HJLA 4JE4B 4UTAH 3U46B 3VXME 4GKZA 3QDJB 5JR1L 4WW2F 1YNKL 1ZTXL 5JZ7C 5J13B 5FDWB 5DRWA 5EPMA 4P4KD 1HHHB 5E4EC 4G8GD 5I6XC 2JK5A 5IFAH 1N8ZB 1RZGB 5E9DA 1QRKA 2AEWA 3UTTD 2ORBL 2ZCHL 2IPUK 5HI5C 4JZJA 5IOPA 3QCUH 2A9NH 1ZLWK 3RKDD 1OL0A 1NAML 4FA8A 3MQIA 1WWBX 4PY8J 2OSLB 4ZFZA 1D5BA 2VNCA 4HJJL 5J13C 1CZ8H 5CBEB 2BSTA 4ZUWB 2OR8A 4XH2A 1UWXK 1MWAA 3BWUC 5J9PA 1IGMH 3PHQB 2W9DH 3ARYA 1CG9A 5JIIA 3PXJA 1CGYA 3ZE0E 3V5DB 5DF0A 3TN0B 4NKDA 4I2XB 1JPGB 3GJEB 2Q8BL 1VFMA 3U2SA 3QQ3A 5I74B 2XV6B 1HH9B 4EEEA 2G2RB 3RWEA 5E8NA 1A7OL 4RGND 3V4UH 4H1LG 3F7YB 3LZFH 4XNUH 2XYCA 1JNJA 3CFDB 5DGRA 3QWOB 4ZDHA 2Q76B 3M07A 1T21B 1X6LA 5ETUB 3F7VB 5H37H 3SDXB 4WV1A 4JO1H 3O6KL 5I74C 4M8QB 4LKXA 1XH3B 1ZT7B 3L3IB 1YJDH 4QF1A 3MO1B 3HS0B 1F2QA 4YR6A 4YHLL 1AGFB 1RUAL 3MRCB 3V6OE 4WWID 3CPLB 3ZLQC 3HNTH 5J11B 3MRKB 1ZHNB 3VFOB 3DO7A 4M48L 4RX4D 5BS0E 1T0NA 2FEEI 4WI5A 5IWLA 5IW6B 1MPAL 2E7CA 3O41A 3KS0H 4XMKL 3EUUA 4LHJB 2GFBA 5F7YC 4ODBD 4UQ3A 3CFEB 4DGIH 5BMFL 3DVNB 2V17L 3P4MA 3ZSSA 1FL3B 1U8HA 1KJVB 2GSIB 3LKPA 3U36A 3QHTC 5DDHB 5J11C 5C07E 4LSQL 2D03H 1J1OL 1KB5L 1A8JH 5CZXD 3OKNB 1HEZB 3LPGA 4GW4A 2QADB 3WJJC 4BSJA 5CJQH 2P5WD 3CVIH 5J6GB 4L3CA 1E4KC 3I50L 1DEEB 1HQ4A 1QPPA 3RIAF 5BW7A 1UG9A 3TYFA 1LP9A 1VESA 5DJCA 4AIXA 2XA3A 1CDJA 4RBPK 5D7LB 2VE6B 2YMXL 5CKGA 4X6BA 5GQBA 4M6NL 5E99L 5KSBB 1WCBA 3F58H 4PJ9D 1KTLB 2O26U 3O3AB 4OZGF 4HBCL 4XXCC 4RMWA 5M7QA 3IDIB 3VXOA 1CDHA 2WWKO 1MEXH 4RMRA 3K2UL 1D5ZA 4IMLA 5GJTL 3WIHA 4MJID 2I24N 4JFDA 5GS2D 1H3PH 2ZPKL 1B3JA 3GSQB 2QL1A 4HUWA 5I17B 1I8MB 3DX6A 4IBLT 4TOYL 1UKTA 4PJIA 3UBXI 5BVPH 4DQOL 3FCTA 4HQQH 1KEML 4WHTA 4BH8A 3UBXB 3WS6C 5BCAA 4JFED 4G9FB 1LO5A 5IVXB 5KSUB 4J12A 1P4LA 4M43H 2N1KA 3ARDD 1BD2A 2VDPL 3M1BA 2P24B 3IFNH 1AY1H 1JJUA 1I1AB 1F3DJ 1YNTA 1ZT1B 3VD4A 5BV7H 2QSVA 3ZTNL 3WFCL 4F9PA 1YQVH 1FDLL 4DVBA 1KCLA 4R4FL 2Q86A 3VGAB 1S7VA 1OSPL 4F2MB 3NFSH 5FYLD 1GC1H 4QRQB 1JN6B 3CUPA 3QEQA 3BKCL 3S88L 3SGDH 2X4OA 4AEHH 1DJSA 1PKQA 1DQDL 4NRYA 3E1F1 2ADIA 5DD6A 1ZS8A 3QJHA 4ZG1A 4E41A 3OAYH 4NHCL 4XTRC 3OJMB 1I1AC 1RUPL 2DS4A 1QYGL 2VLLA 3CLEL 5MEOB 4ZS7H 4U3XA 5ADOL 3C6LB 1ORSB 3FOMA 3V5HA 1ES0A 3CIQA 3WO3B 5I8KH 4PJHA 4B5EA 3RL2B 1BQHB 2W38A 4YUEL 1MCLA 3OR7A 3B9VA 3RY4A 2PTUA 1D5MA 3QDMA 2PXYA 1TZHA 5HYQA 4CU7A 1ETZB 1H5BB 4JZNA 2F53E 3O8XB 4LSRH 5HYFA 3RIFK 3C6LC 4UV4L 3NIGF 1G6RB 1GRWA 4LCWE 3G6AA 4DKEL 2R69H 5GISL 2Y4SA 1WTLA 2YD3A 3IFOA 3N1FC 3NPZB 4KK9D 5BXFA 4LCUB 3P77A 2RGSA 4NN7B 4Z78B 4XBEH 3VFRB 4OZGE 3ARGD 2GTZA 5CSZA 2H1PH 3LB6C 1H5BC 3RZCB 4W4OC 4JG1H 3HE7D 2XXMB 3O3EB 3O8XC 3HNVH 4CNIB 4HJGA 2VLJE 4U1IB 4BQ6A 1MUJA 3ZTJH 3KPLB 5EORL 1BJ8A 4N1CA 5J4MA 2YPVH 2HTLD 5IB1A 3MCLH 3LKNB 5DVMA 5KVGH 4O5LL 3MV9D 3TIDA 4NN7C 2WMPA 2IG2H 3OXRB 2YPLB 3MXWH 4K94L 3LS4L 3VXQB 4PPTA 3RTQA 3G5VB 3RZCC 3DURB 1DANU 4U6XB 2P45B 3V8CA 1CLZL 1YEDA 4QRRA 3HC4H 2JLLA 4OCWH 1UWEH 1F4XL 2YD2A 5D7JA 3TCLB 5DJZA 3O3BB 5IGXL 2RFXB 3VXRB 4PJEA 2DTML 5CUSL 2NTFB 3ARPA 2ARJB 3T2OA 3CMOL 3Q1SL 4PGZA 1ZMYA 1CT8A 4P59L 1R3IH 4ZTPH 3DHMA 2F54A 3HLAA 4EUPA 5CJ8A 4XP1L 1KOAA 5IP4A 4PGDB 2WIIB 3HG1A 2A6KB 1FE8L 4V1DA 5I2IB 3TT1H 2X4NB 1NFDB 3GSNA 1AD9B 2EDKA 1KCRH 2ZUQB 4TTDC 5FO7A 1OAQL 1S9YB 5B38G 1RIUL 3D18A 3EOAB 1NCWH 1PEWA 4LAJH 5HHME 1SM3H 3T0EB 4Q2ZA 5BOPA 1HNFA 1KTKE 1FG9C 1I9RH 1S7XB 4LIQE 3SE3C 4ZS6C 1FYTD 2DMCA 5D1QB 3TH3T 2D0FA 3RAJL 3BHBA 4K23H 2XRAH 4MNQA 1LEGB 5FKAA 3QWQB 2ZUQC 3G6JB 3I6KA 3O9WA 4WFHE 5JHLH 1ZGLA 4JHBA 5E6IB 2XIDA 4G80B 4QHLB 2X1XR 3O2DA 1T4KB 1C08B 4JM4L 3LN4A 2BVQA 5EU5A 3VFPB 5GGQL 5T3ZE 1DEDA 1QSFD 1ONQB 1BQSA 5D1QC 5E5RB 2C4FU 4ZNEA 2AV1A 1AH1A 1FLRH 1CBVL 1JFQH 3OXSA 1F4WH 1OGAE 4KJQC 3E8UL 1RZIA 5AYUL 3T4YA 5F7EH 4OLZL 3V0WL 1BZ9A 3ARRA 5E6IC 1XGQB 1TPXC 2EYTA 4FMFA 3SOBL 3GIZH 1JPSL 4XVUC 3JSSA 3GKWH 3PGCB 4JRWA 1ZA3B 5BZDB 1M05A 4R90L 1U3HA 4L5FH 4M1CD 5F89B 2P7TB 4QCIA 3RJDA 3AM8A 4Y4KB 3UMTA 1MSPA 2W0FA 1OW0C 3VXSD 3MREA 1I75A 4NM4H 3STLA 4BZ2H 5IESH 1AGDA 5I1HH 1SYSA 3OKLB 3LIZH 4PRIB 2R9HC 5HYSA 1DBKL 3O45A 2XG5A 4XCNB 1CGUA 4GAGL 4OKDA 3QXUA 4E0RA 3C5ZD 5IFJB 1A0QH 2J8OA 4Y4KC 2OM5A 2HVKA 3B2UC 4NQSB 4GBXA 4WVRA 2EYSB 1HXMA 1I8LA 4B53A 3L5JA 5GGVH 1VDGA 3CSGA 3B2VL 3FO0H 5DMGD 2VXSL 4P5TB 1SMOA 4I3GA 2DI7A 2W60A 4KHXH 1JL8A 4YHKL 1JTOA 1SJEA 5FK9A 1T1WA 3HPLA 1SEBB 2OJZH 3OB0H 4Z77B 2Q7NA 4CU6A 3L95A 2DJ4A 2EYRB 1T66D 5I1CL 2H26B 4ZQKA 1X4ZA 3JWOC 1I7TB 3KPOA 2OK0H 1J1XH 4N8CL 4LRIA 3MOAH 4D0DA 3QUYB 4P5TC 1DFBH 4ZFOL 2JIXD 3VRJB 3IXTA 1KCVL 1QO3A 3U1SL 2YS4A 4IDLA 4ELMA 3S5LB 3WLBA 4MGXA 3P40A 4X9GA 4FQ2L 2AABL 2X6MA 4YBQC 2C1OB 3KLAA 4NWUH 4Q74A 2YKLH 3OF6A 4XC3L 3VGGA 43CAB 1AXTH 4PTTA 2ZOKB 4XBPB 1PEZA 4PS4H 3K7UA 2A6JB 5T3XD 1CL7H 1CK0H 4K7FB 1IGTA 3QUYC 3BEVB 5HJ3B 3EO0B 1JGUH 3OAYK 1QLRB 3E3QE 4YNYA 5AZ2L 3OKKB 3QISA 3WUWA 1QFWI 2X44D 1BVKB 3FRUB 3LQAH 1QNZH 4X8JB 1JWMA 1KPUB 1GOGA 4OLEA 1QRNE 3H9HB 1F58H 1LK2A 1R3JA 5C2BL 1DBBL 3BT2H 4ZTOH 3S36X 5JPMB 3I3BA 1DN0A 4O2CB 5IQ7L 4U31A 4GG8A 1P7QB 1G0DA 4KMLB 2GK0A 4PRHB 5IVXF 5TDOA 3BH9B 3BW9A 4LDEB 1O5DT 3R4DA 3MV8B 1RZFL 2FX7L 4LHUD 2AJUH 1FG2A 2NY1B 4HCRH 3NZHL 4HIEB 2F8XC 1F02I 3AMKA 1QOKA 4NBZB 2CGRL 3BFOA 1MHPH 1DBAL 4KY1H 5I18L 2DQDH 3CLFL 2PYFA 3CCHB 1E28B 5J6HB 1HOCA 3KPPA 4PJAE 5DXWA 4N1HB 4H25A 2VDKH 2NY3D 1INQA 2A1WH 1H15A 5E8DL 5E7BA 3O4OB 4U2ZA 2NY1C 4KKCC 4LNVA 3P73B 4JKPH 2DYPA 1LGVA 1P53A 1NDMB 4MHHI 3S35L 4MZ2A 1KIRB 3B6SA 5GHWH 3WDHA 4NRZA 1FLTX 15C8H 2BVYA 3QULA 1CD1A 3D9AL 4IOIA 3ZKNC 1LO3L 3AU1B 3OPZH 3WDJA 5GRUH 4X98A 3O4OC 1R3KA 4LQ1A 3FFCA 4F3FA 4Y19D 4X6FB 1GGTA 3F65A 4N0CD 5BV7B 3GSWB 4AM0A 4YWGH 1UJ3A 1LILA 2HT2C 5B39B 2VABA 4J3TA 2LE9A 2EH8L 5IF0B 4GSDL 2OR7A 3MMEB 1BM3L 3BZDA 1W0WA 1IT9H 1YQ2A 4BH7A 4DFHA 1E4XL 2QTEA 3MXVL 2EO1A 1Q0YL 4ZO9A 3GSVB 1EV2E 4M3KB 3EBAA 5LBSH 4DN3H 5DHVH 5HGBA 1FJ1B 3VE0A 4KC3B 1G1YA 1NCUA 1G7IB 3L5XL 3L5IA 3SJVD 2WSKA 3I3DA 5IW3A 3TPUB 1F00I 4M3JA 1GCFA 1I8KB 5JQ6H 3MV7A 4POUB 4KV5F 4YFLI 1D5IL 5CD3B 4MXWH 2UYLA 1FFPA 3KGRA 1G9EA 1BMGA 2R0KH 5DZLA 3SDYL 1S7UB 12E8L 4OFIA 3MLWH 1KG0A 5EC2A 1N7ML 4YO0A 3TJHC 1Z3GL 3FO1B 3U9UB 1YECL 4YHML 7CGTA 5CILL 2PUQT 1Q9WA 5TFSH 2ZNWA 2CK2A 4HHAB 5C09E 3R8QA 2J88L 5HHNB 3GIVA 4FQJH 3DX7B 2NZ9D 1OAKH 2J6EA 2JJSA 5I1KH 1LK3H 1KJ2H 2E27L 1NFDF 2Z31B 3MC0A 1MJ8L 1SVCP 4JJHA 1NCCH 4OAWB 2Y07L 3S97C 1FNAA 4M7JL 3LEXB 1CQKA 5EZOH 3LEYH 4JPKL 5DEGB 2VLMD 3RA7L 4Q6IB 2O5YH 3WN5C 4YDIL 2XQYG 2M2DA 4K3EL 1INDH 4GH7B 1U8MB 4QRPA 3V6ZA 3Q5OA 1YEIL 3IDXL 3FAXA 3ULVC 4JDTH 2F8OA 3CDCA 3DRQA 1FC1A 1UJTA 3SBWC 2FYYB 4XWGL 1WT5C 3MBXL 4Y1AB 5D6CA 2Z31C 3UTOA 2BMKA 1JZ8A 1HNGA 3IYLW 4KTDH 1AHWB 4PJ5E 4N1EA 4OFKA 2HRPL 4J1UA 5KN5A 2AJSH 4G8FA 1IL1B 4Q6IC 4WTXA 3GSRA 2D7TH 3PGFL 5CEZD 1BQLL 3P11L 3FN0H 2XN9A 2WWMC 4PJDA 4KUZL 4WUUA 1IKFL 5HYJB 3R06B 2OZ4A 1V7ML 1H3VA 4HGMA 3V6FB 5D9SA 4OIIH 1FH5L 2NTSP 3OB0K 4XP5L 4X0KA 1XIWD 3IF1B 2NY4B 1AHWC 1NGZA 1FFQA 1UWGH 4R26L 1UACL 1NBVL 5LGJB 1HHIA 5FHAH 3DWTA 1G0XA 3KPSE 2YPLE 2EIDA 3HI5H 2BJMH 1ZANL 4YX2L 4BKLB 3MRGA 1JGLH 3NIFF 3L9RB 5E8PA 2H6PB 1ZLSL 3LS5L 1ZT4B 5E6ZA 3T4AB 4KV5E 3LHPL 5GS2H 4WGWB 4EQ3A 1NGYA 1RZ7L 3HZKA 2OL3L 5TQ2H 1AR1D 4PRNA 1WFOA 3P2TA 3TBYA 1XGTA 2NY4C 3LPFA 3TO2B 3MRJB 1TZIA 1IM9A 1UM5L 4WNQA 1MCSA 4JG0H 4BM7A 4RAVB 4JPWH 1FNEB 1JMZA 3BH8B 4HKZA 1MI5B 4Z7WF 1IBGL 2XKNA 4QY8B 3J8F7 2HVJA 3MRHB 1UQSA 1B0RB 4K7PX 1RZ8A 1XF1A 2R1XB 2EZ0D 1BJMA 5EU6B 4HLZG 1LEIB 4D9RD 1DDHA 1PG7X 1T0MA 4K8RL 1R6VA 4R9HA 4Z95L 1AJ7L 3TBSA 1YN6A 2Z8SA 4XHQA 5CEXA 1C12A 3ARGA 2VO5A 4CKVX 2YK1H 3A0OA 2QJDA 1S8DB 5SWSE 3WXVH 1QBLL 5LXGH 2YZ1A 5MEND 1Z5LB 1R24B 4NYLA 1U95B 2MKWA 5FYLH 5GGRB 3S4SA 5HHVH 5CJXC 4ORGB 2O5XL 1I85C 2Z4QB 4U3HA 4M61A 3UPCA 4HH9B 5DA0B 3VGFA 4OD1L 2ZUYA 2FBJL 3KLHD 3R1GH 4LLVA 1WLHA 4JM2B 2CLVB 3AROA 2CKBB 2BNQE 2IH1A 3QWRA 4QOKB 3TO4D 1CGWA 5ITBL 2VOTA 1U92B 3QUZD 3S3SA 3FFDB 5F9JB 2IAMA 5FB8A 3QXAB 3NABH 4LAQH 2YN3A 4LIQL 2HA1A 2NMSA 1G6VK 3L3OB 1U8IB 1KN2L 2X70A 3GMOA 1AI1H 2EDXA 1FNFA 3FB6B 4Z7NF 4XNMB 1K8IB 1EPFA 1W0VA 4JM2C 4JO4H 1NSNH 3VWJD 1UA6H 1KULA 1I3RA 4G43B 5IBUB 4J4PC 5KS9F 1J11A 1T22A 4PGBA 4Z7QF 2X4UA 4LBEB 1I1RA 2QSCH 3JTSA 3QHZH 3NIFE 4HC1A 1EFQA 5IQ9A 4J3WA 2IANB 2AAVA 4I9WD 2V5RA 4KPHL 4MCYA 1OTTD 5T1LA 1SJHB 3SE9H 4PRIE 2D9CA 3GM0A 3EYOB 3MNZA 4V2CB 1WAAF 5A2IH 5JHDD 3PQYD 4MA3A 3U9PH 3QXDA 3JWDH 5JXAH 2VZ1A 1G9NH 4Z7WE 5GRVL 5AAMA 3JUZA 1SHMA 1UB5A 1J8HB 1NLBL 2HKFH 4JFYB 3LVEA 1CVRA 2HWZH 5DMJB 3WS3B 3CK0H 2JCCB 2DIBA 5MP6L 5CZKA 5C07A 1TTUA 2DKSA 2Z91A 1IAKA 4R7DA 3RVVC 4O9HL 4NQDD 4JN2B 4E42A 1DBJL 5IB4B 2XFXB 3BKYH 5IMKB 5J89A 3K46A 2BCKB 3KPMA 3D87B 5F7DA 4WCYL 4ZUTA 1Y6KR 3N0PB 4PRPD 5B3JF 3P30L 3VU2A 2AERT 3RVTC 1U8OA 3LKSA 5CCKH 2HMID 3V2AR 3TM6A 4Y16B 4PJBF 3QIUA 1B0GB 1BEYL 1K6QL 1MFEH 4F58L 4Y7MA 5FUZH 4YHZL 3H6JA 5DK0A 3TGXA 2W1NA 3ES6A 1YEFH 4LU5L 3OKMA 5D93C 2G5RA 1X5IA 3BZ4A 2BSRB 4HG4J 2IPKA 1BIIB 4LCYB 4AL8L 1JP5A 4ODVL 4OD3L 2YSSB 7FABH 2ED7A 2A77L 4Y16C 1RIVL 3U30B 5KS9E 4Z7QE 2YD7A 4LEOB 4NOBA 2DQCH 1CDIA 5F1SA 3ARUA 3IFLL 5IK3B 3U79A 4FN0A 5CEYB 3PABA 3K74B 4WU5A 3BDBA 2HFFB 4G8GB 4I5BB 4GMTH 4Y4HB 4YFLF 5LKNA 1DANT 1MRFH 1WAAE 2DICA 5TPWH 1BBJA 4TRPL 5TDNB 3KG5A 3U30C 2FHCA 4YFDB 3UTTB 2E7LC 3OZ9L 4FG6C 1ZA6A 1BECA 3EZJB 3UJIL 1CGSH 3QCTL 3F8UB 3RWFA 1MVUA 4YXLL 4UBDD 5D1XD 1TNNA 5ALBL 3IGAB 1XFPA 4OGAC 3S34H 3ULVF 1ND0B 5T5FH 3MLSL 1RMFL 5HGDB 2QKIA 4Y4HC 3GB7A 3WIIH 4AIZA 3F7RA 3X14B 3QQ4B 5C3TA 2FEEL 1RULH 1NCTA 1T1ZA 4XB7A 4JFQA 2MFNA 4B0MM 1KCSL 4CMMA 3P4NB 3PWVA 4LP5A 2NXZD 4L3EE 1O0VA 3GMQA 4WI4A 3A6CH 2C3VB 3VXUD 2Y23A 4IMKA 4HAFA 5EOCH 1CD9B 4X5WB 1QACA 4PGEB 4KJWC 1T7ZA 1T7XA 5AUMB 1N59A 1MLCA 4MD4B 1NL0L 5B3JE 4TSAL 4UOJA 3OJDA 3V52H 1FO0H 2BOBA 4XP4L 1QTYT 1UGNA 3FO9A 3N1MC 1VKXB 1KENH 5CIPH 4PJBE 4AMKL 5CINL 1ACYH 2QLVB 4UTBL 2VDOL 3QCVL 4KXZI 1A1MA 2HJKA 3H9ZA 4UB0H 1E6JH 1FNHA 4U1MB 4YDJA 5IFHH 5AD0A 4NQCE 4D8PB 1KJ2B 5DMKA 1T1YB 3CFKB 4X99B 2C4FT 3OHXB 4NQEB 3BO8B 4C4KT 1U8QB 1PVHA 5TE4L 1BZ7A 3D25B 4KK8C 4W6YB 2A9MH 4TUJA 3M8OL 3ETBF 1Q72H 1NGXA 1Z6JT 2D31A 4HWBA 3EIFA 5GRXG 5C1MB 3DECA 3DSFL 5T3XH 2IPTH 4HGWB 1MJUH 4YEEA 3D3VD 4NSKA 4ZAKD 2XWTB 4JAMA 2CKNA 1OAZL 4KUCF 1JNHB 1MIML 1HCVA 8FABA 1MAKA 3VFMA 1A7PH 3UBXG 3BZFB 2E3VA 2P5WB 4IDJH 3WNKA 3X11A 5EBGA 1HI6A 4EI5D 4OF8A 4UI2A 4WHYH 2ZP0T 3ZHKA 3RVWD 1S9XA 3ARFA 3MNVA 1ZGLM 4LSUH 4Z8FL 3EDKA 5DYOA 2CMRH 3DX8B 1OAUL 1NPUA 4TYUA 5HI4D 1CWVA 3NCMA 1JPTH 1WF5A 5DUBB 1NFIB 2SEBA 5L8KB 5KVMC 2D7QA 1UXWB 3BPCB 4XPTH 3BEWA 3SJVA 4JM2F 3M17B 4QRTA 1W0YT 2X09A 3GI8L 4JO2H 3ARTA 3HMXH 3MLTA 3I85A 1BQHG 1W72H 1OP5K 1RD6A 4DKFH 5JW4R 2MWCA 1YEJL 1YMHB 3QG7H 1AQDB 4JEGB 5IR1A 1Z0MA 2BNRD 4OCYL 3QR2A 4QWWD 4JKKA 3THML 3GNMH 3LKOA 5T1KD 5JORB 2FO1A 2OTUB 2R4RL 3PP3H 5HYJE 3KYKL 4G6KL 5TDPB 1MVFA 4EOWH 1T7WA 2BC4A 2CK0L 3BKMH 1G6RL 1OAXL 1RJYA 4F37K 5HD8D 2HT3D 1A1NB 5HDLA 2XACC 1L7TH 3PG2A 3H9SE 1ACZA 3T65A 4CW1A 1PZ5A 4OI9A 4D2NA 3HNSH 5EZLA 5F7FA 4H8WH 1DQML 1FQ9C 4PY7B 3PL6A 4QXTB 4MAYA 4HMCA 3W0WD 1ED3B 3UTSB 1NC2B 3HFMH 5IEHB 5ISZA 3DRTB 1MCIA 4BZYA 4HS3B 5EN2B 3RQ3A 1F13A 4YFEA 2IFFH 4HKXA 4OGZA 4UILL 1F90L 1SEQH 4Y2DB 3EGSB 2B2XH 3ZE2F 1C16A 3ORJA 1MI5E 2FRGP 1VFBB 3KHQA 5DRNB 4KMTH 2NY0B 2IBBA 5SV3A 2VITB 3FMGL 4HK3N 5JPNB 3I02A 4KDTC 5EU6E 1ZHBB 3MRRB 5I30H 4Y5YB 3QHFL 2JCCF 2Q87A 5DMYA 5SWZB 5IMOA 4K9EL 3I6LE 5CJOH 1GAFH 2WBJD 2ICWJ 2O5ZH 4FFYH 4WW1A 1R3LA 4Y2DC 2QHRH 5JMOC 5FM8A 3ARSA 5IBLD 3S37X 1RIHL 1HSBB 4PLKD 2NY0C 5BQ7B 2ITCA 3GMRB 3W9DA 5C08D 1NMBL 3GRWH 2X4QB 1L6XA 3PHOB 4JRXA 4PJ7B 3VD7A 4C54A 4PJCA 3BP4A 3U0TB 4XPHH 3QIWA 3WHXA 2BSSA 3QI9D 4WGVB 3TYGL 2VXUH 1J88A 2UV3A 5DK2B 4U4BA 1QBMH 4DCQB 2VDLH 3EDEA 4QOKE 4RQQB 1XCQB 4LSVL 1CDUA 3MV9B 4LCIL 4X6CB 4F15B 2JB6B 4M9OA 5E94A 3OKOB 4G8EB 5HVGB 2V5YA 3PP4L 4WI9A 3T2PA 4YHPB 3GDBA 1NUFA 4BFIB 1R0AL 4GRLD 4C56B 4FZEL 4W6WB 1K8DA 4GRMA 4K3JH 5B3NA 4NUJB 2WLZA 3VMNA 4DGVL 4M7LH 1D9KC 1U8PA 3STZA 4R7NB 4A2LA 1YA5A 1OVZA 5HHQA 4RZCA 4URTB 4F15C 2VJXA 3QPXH 1RJLA 3DUUB 2CUMA 4F9LC 2LAGB 2EIZB 5CEZH 2NX5B 2B1AH 5AG9A 4XVJL 5KTEH 4C58B 5JXED 5D7IF 3L3JB 2P8MB 5KVEH 4LPVA 2V2XB 4KKAC 3RVUD 2YUWA 4U33A 4ZPVA 1K5NB 2AJZA 4AEIL 3I9GH 1QFUL 4AG4H 3C60B 2W0PA 3SDAD 1WC7B 3ZE2E 4L8CB 3L3KB 2VLRA 4H5SB 2X9YA 2KUTA 2WZPD 4PJAA 1J8HE 1Q9OA 5DQJB 1RAMA 5ANMB 1WBZA 3J7HA 3PWPB 1MJJB 4KVNL 4XPGL 5GRJL 2DQUH 5JNYB 3NACH 1TJIL 1YDPB 3C60C 1A6VL 4LASL 4JHAL 4WFGD 1SY6H 2PTVA 5I8OL 2WWKT 1MCRA 4AENA 5CGMA 1MCFA 3JWOL 1X4XA 3RX5A 1MHCB 1PSKH 3QAZB 3FQNB 3JVGA 2NXYB 1BFOA 3VXMD 3TA3D 1WBXB 4OIBA 1T20A 4H26A 3P9LB 1YY9C 1EEYA 1N4XL 1OT1A 3D85D 1C5BH 4O2FA 4OLWH 5F8QC 5DJ2B 5HHOA 3QAZC 3IDJB 1AKJD 5AEAA 4JJ5B 1ODAA 1U8KB 2NXYC 1CXKA 3VXSB 1MFCH 2G75B 1JNNL 1MCOL 3IJHB 5JW5A 2IALA 2ID5A 1U6AH 3KPRA 4TPRL 3ROOA 1EFXD 5IBTH 2DLFL 3B5HA 1OM3L 5DC9B 4HBQA 5C0IB 1T3FA 4J8RB 4F8TA 3X3GH 6FABH 1A4KB 4P46B 5D7IE 2P5EB 1FIGL 2FGWL 1P4BH 1S78C 1KC5H 4QRUA 4F7PB 1FO0B 4J6RL 2GITB 4QT5B 5FV1L 5BO1L 5DT1H 4HKJA 1HILB 2DJUA 3WXWL 4WUKL 4Q0XL 1ZE3C 5FA3B 3QH3A 1A5FH 4PV8A 4HIHB 4UU9B 3GKZA 2DLEA 1E6OH 3RP1A 4P46C 1VEPA 5I0ZA 4JLRA 3PP3K 3NTCL 4KAQL 2R0LH 2AKRB 3VFTB 1GGBL 2HAZA 3BWAB 1CVSC 2FX9L 2YUVA 5EUKB 2AV7A 4X4ZA 3IVKA 4ZXBA 5C09A 1A9BB 4NP4H 1TVBB 5BS0D 4GXVL 3MNWA 5EFIB 4GRWH 4HPOL 1NMAL 3RBGA 3O6MH 5CSBA 4QHKI 5F7UA 5IMLA 2X41A 1FZKA 5DR5L 2XZQL 3MROB 4JKLA 3KYNA 3JV5A 4JCMA 4Y5VB 35C8L 5IROC 4ELKA 1Z0NA 1LEKA 3U0WL 1CLYL 5FCUL 5JR1H 1Q9KB 1YNKH 1ZTXH 4X4MA 3MYJA 5F8RC 5C0CD 3PIQA 5DFVD 5KSAA 1EIBA 2CUHA 4MHHG 4APQD 2NR6C 4ODWB 2GCYA 3VFUB 2BY3A 3BXNB 2ZCHH 3C5JA 5DUML 3BQUA 5FOBA 3O6FD 1P7KB 2FL5B 1J0HA 1RJCA 3SDDB 1SJVA 4Q7DA 4AEFA 4M7LT 2F15A 1PQZA 4WRLA 5SX4H 4C55A 3W9EB 1Q9LB 1G7JB 3ECBA 4HJJH 1FPTL 4LCCB 3NZ8A 4NQEE 2VIRB 4HK0B 3N1PC 4N0RA 5KBNC 3UTQB 4KKBC 3SPVB 3BUYA 4NKMB 5IW1B 2ZG2A 5E8EB 1FFOA 3EFDL 1CICB 1P1ZA 1X3DA 1JWSB 3WLWC 2DWDA 1REIA 3SDDC 4PJ8D 2KQMA 3ROLB 1Q94A 2Q8BH 5F6HJ 1XF3B 5FM5O 2DB8A 5EO1B 1IEAA 4CVXA 4H1LH 1A7OH 3PUCA 4LCCC 4UDUA 3W5NA 4F7CB 1G7QA 4DW2L 2VLKE 1CFNB 1UC6A 4XVTL 3Q6FB 1FFNA 3LV3B 3PWJB 4ODXA 1CICC 3MLZL 2VDRL 1KPVA 4G6FD 4GKZB 3PE9A 4F33A 3O6KH 4NHUA 3SGJA 3VFSB 1JTTA 3EDFA 5DRWB 3FAWA 2ZOLB 1T5XB 3TNNB 4OV5B 3HZYB 4Y19B 4YAQA 3KAAA 4OQ1A 4YHLH 5I1DA 3HUJF 4U1NA 1RUAH 3QUML 3VFGL 3QNXA 3ZHDA 2VERN 5C0RL 1QSVA 5B22A 4HX1B 2JJTC 2XZCL 4M48H 5IOPB 2D4FA 2AK4B 4G6ML 1ZEAL 2UWEE 1RUKL 4NCC1 4XMKH 5T1MA 4U1GB 2ZNXA 1D5BB 4G7VL 2MMXA 3ULVL 3E6HA 4PJ7F 5BMFH 3H7BB 2V17H 1G9MH 3IU3A 4Y4FD 1MWAB 1A02N 1MH5A 2M8XA 4EDXA 5J9PB 3EDJA 1CG9B 1OD7A 4LSQH 3QJFB 4CVWA 2C1PB 3EYQD 1FCGA 1IEBA 4NKDB 1JHLH 4PB0L 3QG6B 2QSQA 4I77L 1J1OH 3QQ3B 3OGCA 4U1GC 3MACL 3RWEB 1KB5H 5E8NB 1PW3A 4MDIB 4WFFD 3VWKD 1EJOL 3V6BR 1PY9A 1GGIL 4ZDHB 3VH8G 4JRYB 1EK3A 2F53D 1NMCB 3EYVA 2BVEA 4CN6A 5I1JL 3I50H 4XXDA 1CF8L 2J4WL 4WV1B 2WAHA 3TT3L 3P4OA 4OZIA 1YPZA 2EH7L 4LCWD 4PJGA 3V5KB 5HY9B 1T80A 5ACMA 2YMXH 1IGCL 2HYMA 4QF1B 4M6NH 5E99H 25C8L 3LAFA 4NKOB 1CXHA 2N7BA 3FB5A 4PP1D 4HBCH 1AGEA 1URLA 5IJKC 3UTSE 1NMCC 3K2UH 1T0NB 4LNRA 4U0RB 5GJTH 4AYFA 2AQ1A 3BIKB 1GXEA 2VLJD 4NFDA 5GS0C 2ZPKH 4WV1C 5CJ5A 3MRQB 5F1IA 3GMNA 5DRXB 3NH7L 4TOYH 2VTFA 4DWHA 5E08L 4UT6L 3H3PL 4DQOH 5IV2B 4MVBD 4MNGE 1U8HB 4JN1L 1KEMH 1YUHA 2BXZA 4PGCA 4DFIA 2PW2A 3KNBA 5JIHA 1A7QL 1L7IL 3SE4A 4U0RC 4EI6B 1N2RB 3HUJE 4K8RD 2DQGL 2VDPH 2B4CC 3UTPE 3ZTNH 5FUOL 4AEEA 4HIJA 3WFCH 2ICES 1FDLH 2FEDD 4R4FH 2X4SA 4K7PY 3S3JA 3ZKXB 4OZFA 1OSPH 3PGDA 3BKCH 3S88H 4XAKD 1HQ4B 2E9BA 3IETA 5EULV 3QIBA 4P99A 1DQDH 2A6IA 3H3KA 1ZLUH 1XIWB 3CH1B 3OKDA 4Z7UA 4NHCH 4X8XA 5C0BE 1RUPH 3VDCA 1QYGH 4FFVC 3CLEH 5L2KE 5ADOH 1MF2L 3ZHLA 2GHWB 4JQXA 5FO8A 1TQBC 2X7LB 2Y36L 3B9KD 1M6OA 1VFAA 2VAAA 3QNYB 3ZKXC 1A4JA 1VA9A 3VXOB 1PLGL 3G5XA 4H20L 4LL9A 4IMLB 4YUEH 3O4LA 4JFDB 4JPIA 4LSDA 2VISA 1V7NL 4MDJA 4HV8B 3O11B 4HUWB 4D0BA 1XIWC 2AI0H 3SKMA 2CKBL 2GSGA 1CQYA 4PJIB 4GXUM 1OF2B 4WFHD 4EIZC 4P2RB 1MCJA 4UV4H 3TBTA 1KLFA 3L3GA 4AT6A 3ARED 4U7SA 4JCLA 3C6SB 3K1DA 4L1HA 1LO5B 1UM4L 4DKEH 1P4LB 5GISH 2K1MA 1ZVYA 5C0EA 4L4JA 4FQHA 4WO4D 4ALAL 2FX8L 1F3JB 1HSAB 1AFVL 1QLEL 5ESAB 1YNTB 4U6HA 5C7XL 1OGAD 3LCYA 2RJMA 1AO7E 3VFVB 4DVBB 2P8LA 2EE3A 2ZUSA 5C08A 1NBYA 4W4NA 1Z9OA 1NEUA 2CDGA 4KRPB 3KPQB 5IBUG 5C0AD 5F88B 5EORH 3CUPB 5MENB 3VI3F 2NCMA 3CAFA 4OF7A 1PKQB 5KZCD 3CJJA 4O5LH 3G5YA 5TQ0L 2ADIB 3QJHB 4XT1C 5ANME 2RIKA 3QXVA 4E41B 4IS6B 5IKCA 4L3AA 2V2TB 4L9LA 4K94H 2FZ3A 3LS4H 2BVPA 3AY4A 5D2NA 5JZ7D 4F9PC 4RRPG 4HDIB 3EW3B 3FOMB 4LARL 3V5HB 1ES0B 1ZVSA 3PWPE 4N0FA 4WWKA 4HUVA 1CLZH 2GUOA 4KRPC 4LOUC 4QNPF 3KWWB 3CFCL 5IB3A 4PJHB 3FRPA 4GUPA 5HHPB 1F4XH 2W92A 3MJ7A 2R4SL 3QUZB 5GZOD 4JFZL 5IGXH 2X4PA 1D5MB 2NW3A 2DTMH 5HI5D 1CXLA 3QDMB 5CUSH 3FT4B 1G7MA 2ICEB 2XKSA 2BRQA 3CMOH 1RZKC 3Q1SH 5HYQB 4M1DL 4JZNB 4P59H 1B88A 3QEGH 2MQ0A 4XP1H 3DGGA 1CR9L 1FE8H 1S3KL 5D1ZA 3QUZC 3IFOB 3RX8A 5BXFB 3HHRB 5H2BA 1CLCA 1X5HA 1OAQH 3OWEA 3Q3GB 1RIUH 5C0GA 2NLJA 2GTZB 2W0LA 1KGCE 2QQKL 3T3PF 4MD5A 3MFFA 4RA0C 2UVFA 1HQRA 4HJGB 1MUJB 5HGGS 3RI5F 1JHTA 4P23A 5H94B 4GRWB 1TFHA 3FQTA 3RAJH 3ALXA 4B7LA 3IXAA 5IB1B 1KXTB 4NKIH 1CFVL 1XGRB 5FO9B 3EO9L 3BYTA 1CDYA 2J8UF 2NNAB 4JM4H 3VRIB 4L8SB 3X13A 2FHFA 1NLDL 2P5EE 1CDCA 2I60L 5GGQH 1YEDB 1KTRL 4QRRB 5EO0A 4R96A 3A6BH 2D7OA 1PX4A 5D7JB 5FKPA 3ARVA 2WANA 3ILPA 4ZSOA 4EVNA 1A9EA 1CBVH 3E8UH 5AYUH 1T6VN 2IADB 3TA3A 3MUHL 5EBMA 4OLZH 1QRND 1S7WB 3V0WH 3RNKA 5BVJA 1CT8B 3VI3E 3D69B 2ADGA 3SO5A 1C5DA 3SOBH 4X7CC 4MZ3A 1MCNA 1JPSH 3RTQC 4MA7L 4JFFA 5FYJE 3GBLA 4L8SC 4EUPB 5I15L 1NAMB 4R90H 4ACPA 4G8IB 5I1GL 2DD8L 4K7PL 1TMCB 1OOAA 3NN8B 3MZTA 5D7JC 3D6GA 4PRPB 3CVHL 3GSNB 2VDNL 5FO7B 1IARB 4QNPE 5DJDA 3UO1L 3WNPA 4K3DL 1DBKH 2XI9A 5EA0L 4Q2ZB 1T2JA 2APWA 4GAGH 3HCVB 3VGDA 2X5PA 3AAZA 1GHFL 4QHKJ 3TWCL 1P6AB 4LLWB 4H1LB 3BHBB 2P43B 2PO6A 2LU3A 4FQCL 4MNQB 5KVDL 2E5EA 4GMSL 5JIKA 2VN4A 3I6KB 3O9WB 3B2VH 2HMIC 2R8SH 5JW4M 4PRDA 3QQ9C 5M94B 2VXSH 5ITFB 1I7ZB 4O4YL 4YHKH 2NPLX 2BVQB 3IRZA 1MCDA 4ZUSA 4QEGA 5EU5B 3LSOA 4P5MA 3PWUA 1B6DA 5FYKE 4HWZA 3CFJA 4X7TA 3MTRA 4XC1L 3RWHA 5I1CH 3CXHJ 2AV1B 3RPIA 5M95B 1QBBA 3OXSB 4AY0A 1MCBA 1RZIB 3T4YB 4N8CH 4LPXA 3O9WC 4J3SA 3OG6B 4RFOL 4BSWA 1JYXA 4JDVA 1MFAL 2ESVA 2ZSVA 2YXFA 3VW3H 5D7LD 1KCVH 1M05B 1BOYA 4TUKH 1T83A 3U1SH 1U3HB 4WHCA 4QCIB 4LVEA 3BGAA 3MV01 4FQ2H 1R3HA 2AABH 2FGZA 2DQEL 2J8UE 2W0FB 1QKZL 4XC3H 2DLIA 2XG4A 2WINA 1T1XB 2R23B 1SYSB 1JUFA 3CFBA 1ZLUK 5MEQB 1FIEA 4KJPC 5HYSB 1Y18A 5AZ2H 3X12A 4E0RB 3HE6D 3RHWF 1N3NA 1U3HC 3B8SA 1KB5B 2HN7A 3GMLA 4NRXA 2GAZA 1BFTA 2HVKB 3DV6A 4FXKA 5HYEA 4GBXB 5C2BH 5JW4Q 1DBBH 3GSOB 4G9FD 5IQ7H 5IG7B 1PGRB 3H7LA 1VEOA 2IF7A 2YEZA 2CRZA 3F12A 3MOBL 3S9DB 1SJEB 1OARL 4XTRD 2FX7H 3HC3L 5E9DE 4P2QA 3PV6A 3VXNA 5ABDE 2IWGA 3NZHH 5H35A 1A7NL 1FL6A 2CGRH 1BGXH 32C2A 2A6DA 1VGKA 3HAEA 5IHBA 1UVQB 3LKRA 2ICWA 5C2UB 4ZQKB 1DBAH 4GBXC 5I18H 3KPOB 3CLFH 1I8LC 4S1DC 1Y6MR 3QDGA 5DVKA 3ZDZF 2KZWA 4HZLB 1F11A 2X10A 1RK0A 2MJWA 4P2YA 4NBYB 5E8DH 3IXTB 1LP9F 1WIPA 1QO3B 2VR5A 4ODSL 1IGFL 4ZPTA 3WLBB 3C6LD 5F1NA 1OB1B 5EIIA 2H32H 4Y8AA 5J1TC 3S35H 1MJ7L 4LPTA 4PTTB 4P2OA 3MRDA 4LVHB 1M7IA 4LRIC 1IGTB 3D9AH 5KVFL 5E2TL 1LO3H 2UY6A 4YNYB 5C0FA 3DO3A 3LB6D 5E5MB 3GMMA 3O8XD 1JWMB 4ZAKB 4PJIF 4YPGA 3C2AL 1R3JB 4LDOB 5DJ8A 3B3IB 5DQ9A 1DN0B 2PCPB 4PJ5D 4U6YA 3SCMD 4JVUA 1WJ3A 4LVHC 3F5WA 2GK0B 4LLMA 5GGSA 5GJSL 4NC0B 5TDOB 1JGEA 3TESA 3BW9B 4NC2B 1KT2A 3WDIA 4P57A 3BZEA 2EH8H 3C08L 1KB9J 4GSDH 3GZKA 4M6OL 4OQTA 2I07A 5L2JA 1BM3H 1FN4B 1K2DB 1PD6A 5KG9A 1QSZA 4M6ML 4ZMAT 4ZAKC 5F96L 3WEXA 2Q3AA 1U36A 5EBWB 1E4XH 3MXVH 3B4NA 1PDKA 1Q0YH 4YHIA 1NANI 4NOFA 3B8YA 4H25B 3TVMA 1INQB 4MQTB 5C0NC 5BRZA 3NCYS 4ODTL 2YPLD 3DX9A 5HVWA 4TNVK 4OZHE 1IQDA 1UZ8A 1JZ6A 3L5XH 2WUBL 3O3DB 1C1EL 3ZKSD 1MFDL 3B6SB 3PNWB 2D9QB 4NRZB 1WTGT 1K3IA 5MEPB 4PJHF 3QULB 2HKHL 1CD1B 4TTDD 3RY6A 5D6DA 3SDYH 3GSXA 2BNRB 4XBGA 5KJRL 3DI2B 2W65A 12E8H 3FFCB 5T1KB 3RDTD 2X4RB 1N7MH 4PTUB 1Z3GH 4ZS6D 1YECH 2A0LC 4YHMH 5CILH 1LP9E 2PTTA 5J12B 1UJ3B 3MBEA 3EJZD 1G7LA 2J88H 5DJYA 1F3DH 4HIXL 3ZMRA 1B4JL 2RHEA 5IB5A 3JTTB 4DEPB 5A2FA 1EH9A 2E27H 4HPYL 5SWSD 5D2LA 1MJ8H 2VQTA 2Y07H 4M7JH 3UZQA 3INUL 3WNLA 4JPKH 4JFDE 3WE6B 3RA7H 4FP8L 4YDIH 4BH7B 5D1QD 4K3EH 4ZD3L 3MLRL 1AD0A 3QB7C 5J12C 5E1AA 1UJ3C 5J0BA 1JWUA 1YEIH 3IDXH 4KJQD 3DUSA 3QEUA 2BHUA 3FQUA 2QHLA 2HT4C 3IKCA 4XWGH 5DHYA 4L9DA 4DEPC 5HGBB 3MBXH 2GY5A 3VE0B 2KZ1B 4NCDA 5IJVA 2RQ8A 4XVUD 4RSVA 4E5XA 4XVSL 1ZHKA 2HFEA 2HRPH 5CZVL 4TNWK 4NN6B 3MRMA 1K4DB 2EEAA 3WFHA 2AJVL 2HP4A 3MV7B 1BD2E 3PGFH 4MA8L 3ZT5A 1BQLH 3P11H 2UYLB 1X5XA 4KUZH 1FFPB 1IKFH 2MTPA 5LJYH 3FT2A 2L7UA 5C6TL 1V7MH 3GJFA 1FH5H 4I3SL 2R9HD 4UAOB 4XP5H 3UDWA 5B38B 4I0PB 4WI6A 1KG0B 3OGOE 3QEQE 5EC2B 4DK6A 2W0KA 3CXDH 4MWFA 4R26H 1UACH 1ZK9A 1NBVH 3BJ91 3BRGC 3HZMB 4NN6C 1J0JA 1Q9WB 2FHBA 4Y4KD 3B2UD 1FC2D 3KXFA 4E41E 2UZIL 4KRLB 3GIVB 4BFGA 3UPRA 1ZANH 4YX2H 4X6DA 5ECJE 3QFDA 3QI9B 1A6PA 4PRID 1ZLSH 3LS5H 4PRAB 3OAZH 4IRSA 3LHPH 1CN4A 4UAOC 4Z0XA 1RZ7H 2OL3H 4I0PC 5ESQB 4U0QB 5IBLC 3VRLF 3AXLB 4PLKC 5F3HA 4ISVB 3QDME 1UM5H 4OKVB 4QRPB 1CFSB 2XWJA 3DRQB 3BP7A 4IRJA 3SDCA 1IBGH 1GZPA 5J7CC 2JJSC 4HLZH 4YDKL 5D6CB 3D39A 1XR9A 1BFVL 2BMKB 1AGBB 1DUZA 1NGPL 4K8RH 4WO4A 4Z76B 5CP3H 3SGEH 4L1DA 4Z95H 1DVFA 4J1UB 3KYOA 1E0OB 2V2WA 4YBQD 4QTIL 2YRZA 5DD3L 3KPNB 4PJDB 1OSZA 1QBLH 1EO8L 3QUXD 1DQJA 4R0LA 1I7RA 3QUYD 2O61A 3C87A 5JDJA 1CYGA 3FO2B 4JFXA 5LVEA 2DIJA 2O5XH 4N0UA 5DSCB 4MYWB 1OTUC 2Q1EA 4OTXL 4NO3A 5D8JL 4OD1H 1HHIB 1FVCA 3SDAB 3P9MA 2DBLL 1MHHA 1J0IA 5ITBH 3MRGB 1EAPA 5E8PB 2HLFC 2R39A 1C7TA 2YN5A 2MHAA 3GO1L 4QRRE 4LIQH 1NGYB 1EEZB 4PRNB 3ALWA 5CLWA 1KN2H 4Q9QL 1FSKB 1WEJL 4ZFFB 1J0ZA 1EGJL 3G6DL 4PJEE 1IM9B 2VLKA 2YZ8A 4GW1B 3QDJA 1WSST 3SDAC 4NT6A 4HKZB 5IB2A 5FDWA 3CSBA 2XKNB 2CIKB 2HVJB 3FQRB 1DQQB 2F54E 2BRRL 1RZGA 1JZ5A 3FT3A 1U8LA 3HG1E 4V1DE 1IILE 5I8CA 3D0VB 1FSKC 3TBSB 2NY1D 2HG5B 4KKCD 1C12B 3ESUF 4LLDB 3UAJC 2YWZA 4KPHH 5IMMB 1RHHA 2OSLA 3QDAA 2CJUL 3VXPB 3B9DA 1Y6NR 4JVWA 5DI8A 5CBEA 4NYLB 1U91B 4ZUWA 2PYEA 2PW1B 4PD4J 5FYJL 4BA8A 2AEIT 1AKJB 4K71B 1KJMA 3PHQA 3RWCA 4M61B 3V5DA 4Q58C 4MNQE 1NLBH 2H9GA 1JPGA 1RHFA 1WWWX 4I2XA 3TN0A 2C4XA 4LSPL 2OI9C 5F7WC 4ELMF 1EFXB 3FOLB 1HH9A 3T0DA 4XI5C 2IH1B 3GEWB 2YRLA 1V3JA 1EEUA 5MP6H 1MQKL 3CC5B 4S1RL 2HT2D 3F7YA 2F19L 1KELL 5FB8B 3SY0A 2DQTL 1QFHA 3O2WL 4K71C 4O9HH 1ZSDB 4L3ED 1DBJH 2X70B 3IAPA 2W59A 4U1LB 4XPAL 4X80L 3SDXA 4UT9L 2HRLA 1X5ZA 1NBQA 1W0VB 3BP5B 4Y89A 1FBIL 3Q0HA 1XH3A 1EEQA 1ZT7A 1LVEA 1N6VA 1F4HA 4WCYH 2AJ3A 3MO1A 1JI2A 3HS0A 3WCYA 1T22B 4PGBB 3P30H 1KJ3L 2GIYA 5FYKL 3VFOA 1ZHNA 3OKEA 5DZNA 1BEYH 1I9IL 1K6QH 4L29A 4F58H 2E7MA 5IQ9B 4HH8A 4YHZH 1LO0L 4OF6A 3G04B 1FGVL 2DKUA 4PV9B 1I1YA 4LEXL 3CFEA 4MB5A 2DL2A 3JV4A 5BS0B 3DVNA 4MA3B 1UFUA 1EUUA 3QXDB 1SQ2N 1FL3A 2MCPL 1U93A 2GSIA 4MJ5A 1IGML 3QXTA 2Y6SC 4AL8H 2ICCA 3GM8A 3E2HB 5DDHA 4ODVH 4OD3H 1E4KA 1IKNC 2VUOA 1QHOA 4Y0GA 1RIVH 1MCCA 5TF1L 2XQYK 5EDXA 1S9VB 3JXAA 1DL7L 2EDLA 2H2SD 3TJHD 3LPWA 1XF5A 4K2UL 3DLQR 4WW2B 3OKNA 1HEZA 5HI3C 2RCSL 5C07B 2K9UA 4OF5A 3IFLH 1J9CT 1IAKB 3ZL4L 4XXCA 4X9FA 5K9KA 2QSTA 2FO4A 3CDGB 1GYAA 3BIBX 3E2HC 3FHAA 1CGVA 5CGTA 4TRPH 3U82B 4JO1L 1DLFL 4S1QL 3OZ9H 2VXVL 3UJIH 5D7LA 2VE6A 2W07A 5F7DB 5DFWH 2ITDB 4YXLH 3ULVD 4U2YA 5KSBA 1JF1B 2APVA 5ALBH 4ELME 2P1YA 4X7SL 4M62L 1HKFA 3MLSH 1RMFH 2P49B 2OBGA 3DNKA 1JRHI 3GSQA 3ES6B 3HRZA 5I17A 1KCSH 3DYMA 2B1HL 4OM1L 4S2SA 3T2NL 1PBYA 1AGCA 3WNOA 2AXJA 1MWAL 1NCAL 3OAZK 3IRPX 5EU3B 2E9WA 4G9FA 1R5IA 5DD0L 5IVXA 2VRAA 3GBNL 1NL0H 1J86A 4TSAH 1EHLL 1T5WA 4XP4H 4U1JB 4YJZL 1I1AA 1KEGL 4ZO6A 3K3QA 3MYZA 1A47A 3RWGB 4AMKH 1OPGL 1IMHC 3I2CL 5CINH 4NO0A 4UTBH 2VDOH 3QCVH 3PABB 5HYJD 3K8LA 4WU5B 1XGPA 4QRQA 1JN6A 1OWRM 5L9DL 2I9TA 5GS0L 1BBJB 2NY4D 1KLUB 4YXKL 3SHSA 4HFUL 3WD5L 8CGTA 1YEHL 3NCFB 3H9SD 3QP3A 2FB4L 5TE4H 3RWFB 1MVUB 2MSPA 3N1GC 2DMKA 3C6LA 1ORSA 5FGRA 3GJFK 4OV6F 3M8OH 1BBDL 2VZUA 1H8OA 3KVQA 5DVLA 5A43C 1N6UA 2QKIB 4AIZB 3DSFH 5BZWA 2AJYL 2R1YB 4GS7B 4RNRA 4NNXA 4KUCD 4CMMB 1ETZA 1D5XB 1H5BA 4IIQA 2XTJB 1OAZH 2GKIA 5SWQA 1MI5D 1KIUA 5DJ0B 1MIMH 3HMWL 4GAJL 3FFCE 3KPTA 4YQXL 4WJ5A 2C3WA 3VWKB 1U3JA 2QQLL 1N59B 4A6YA 4Q9BA 5EU6D 1MLCB 4KTEL 2F53B 3OJDB 2UZXB 4G7YL 4M4RA 4Z78A 4MX7B 2B20A 2BOBB 1D6VL 3AS0A 1NEZA 3I6LD 5IUSA 5KSVB 2R56L 4LCWB 3IDNB 1YQVL 3RZCA 2XTJC 3N9GL 3O3EA 2VYRE 3O6LL 1H3WM 3JUYA 4PJDF 4M5ZL 4CNIA 1A1MB 2HJKB 4IMKC 4U1IA 4Z8FH 1P5VA 1NUGA 4OZGB 3VWKC 3LKQB 2AEPL 1OAUH 5FA4B 5AD0B 3IDGA 4RFEA 3OXRA 5TH2A 2OL3B 4JM2D 4IOFC 1WZLA 2VDQL 3K8MA 4U6XA 4QOKD 1T2XA 1PYWA 3BD3A 4J4PD 4NFCA 1BVZA 3VGBA 3GI8H