4Y1AB

Immune complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
192
structure length
184
Chain Sequence
SGDTRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGVGESFTVQRRVYPEVTVYPANLLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSLTSPLTVEWRAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title T cell receptor reversed polarity recognition of a self-antigen major histocompatibility complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 32
structure length 184
sequence length 192
ec nomenclature
pdb deposition date 2015-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y1aB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4y1aB01
4TNVF 3OXRA 2YEZB 2FSEA 4RNRB 1UG9A 3X12A 4GH7B 1AD0B 4QGYA 1REIA 2KKQA 1LDSA 2HFTA 4JANA 2PR4L 5KSVB 3RVUD 3DSFL 3NFNB 6FABH 1QQDA 3SPVB 4XWOD 4WRLA 3AS2A 1AXTH 5F7LB 1KCRH 2YHGA 1OOAA 5I73C 1DQMH 4UZGA 1WFUA 1L0YA 4XPHL 1AO7D 4CL7A 2AXJA 2MPAL 3RKDC 4BQ8A 5KZCD 4HIIA 3H0TB 1UJTA 3SDCA 5IFHH 1MI5D 4LLDB 4EQ3A 5C6WH 3RGVB 2VLRE 5GISL 2P8PA 4TSCH 4GAFB 3CC5B 3CGTA 4WI2A 4HGWB 1NC4B 4I2XE 3BEWA 5DMGD 5DMKA 3PWNB 4MDIA 2W0LA 3GMOB 4C55A 5EBWA 3NACH 1ZEAL 4J6RH 2FR4A 4X7DC 5EFIA 1WZ1H 3QDAA 1BFTA 5CJXC 4ZD3L 3GMLA 3MXWH 4MD5A 3VXQA 1EMTL 1QPXA 3TP4A 5HXMA 1YEHH 4BFIA 3ZKQD 1P7HL 1C5BL 1NQBA 2P5WE 1A21A 5DUBB 3RNQB 2VLRB 3MLTA 2Y23A 5GGRB 4QRRD 3OJVC 3OKEA 3WFEL 4MD4A 1BVKA 1DLFL 2NY4C 3DVIA 2E7HA 3QXAB 4I2XB 5EWIL 1J5OH 3MA7B 5DUMH 3OKLA 1YJDL 1UM4H 1FCCA 1NCDH 3LN5B 4UUJB 4OM0L 4PRHA 3TT3H 3N9GH 1KIPB 3U7YL 2XQBH 4U7SA 4LLMB 5H94B 4DWHA 1B90A 3BP6B 4MQXD 1QLEH 4RMUA 2P5WB 8FABB 3GMQA 4OTXH 4TUKH 3TA3B 2CKBA 3GMRB 2XWBB 3V9FA 4JB9L 2VLJD 1U3HC 2B20A 1A5FH 4LLAA 1ZGLB 3WS3A 2DLFL 1KYOJ 4G9DB 3OL2A 4YHOL 3DVNA 4O9HL 1QRNE 1GOFA 4HWEH 4FXLA 4P2QE 1EAPB 1DVFA 5B39A 4K7PH 4ISVB 2J8HA 2BVQA 3RBGA 4P2OB 4YHNB 4KVCH 4AEEA 1YY8B 4UIMB 1ITCA 4XCCL 4U6HA 3Q2CA 4K9EH 4AQOA 1A1OB 1OWRM 2ZCKL 4LLUB 5JUEL 4LDLB 3IT8D 2CDEA 2EE6A 1JYVA 2VC2L 1RZ7H 5EOCH 5IHUH 2CJUH 3UTPD 1VERA 1A14H 2GJ6A 1GRWA 3ZDXE 1CXFA 1QRNB 4W70A 3CFKB 5C07D 4GG6A 4P2QB 5DD1H 3ARGB 1AFVL 2CDGA 3HI5L 2AV1A 1IQDB 1MFEL 2EO9A 4JFFA 3T65B 5DFTA 1I1RA 5F88A 5LGKA 4EI5C 2YK1L 4HUMB 5EA0H 4FQ1H 4HXBH 1VPOL 2FHCA 4AT6B 4LBEA 3Q3GA 5MEND 2GK0A 3WSQL 3PWLA 2YZ8A 5IW6A 1JNNH 3O45B 3I6GB 4NUGH 3CXDL 4LHUD 1UEYA 1G9MH 3C2AL 3MRDA 1FZJB 2VH5L 2Z91A 5E2VH 3RWIB 4G7VH 4NM4L 5ADPH 4NO0A 3NFSH 3U9PH 2MNUA 1WC7B 1OTUD 3BI9X 4PBXA 5ID1A 4QOKD 3NN8B 5JIKA 3X11A 2WUCH 2ZCLH 1OM3H 1CGWA 1JYWA 5HHPA 4OFIA 2AJXL 2VL4A 3MRRB 1BM3H 1S9WB 1L7TL 2GFBB 1AHWC 1J1PH 1OB1A 2QQKH 5JOFA 1JPSL 3ARBA 1INQB 5ICXA 4BK4A 5DJXA 1MCLA 5HGGS 1HXMB 4XNXL 5HHQA 3CLFH 4HWBL 3U0PA 4JGMA 2R8SH 2O93L 4J3VA 2IBBA 4HWZB 1EFXD 2M26A 5D70L 2EE9A 4KHTH 2P7TA 3CPLA 3MXVL 3PL6B 5AD0B 2OTUB 5IW1A 4N8VB 3QXTA 1ED3A 3VRIA 5BVPL 1NBYB 1IBGL 3MFFA 4JFDE 3GBNH 3LKNB 1BZ7A 3DRTA 2NLJA 4M00A 5ISZE 4BELD 1R3IH 4ODHH 3WNKA 4LOUD 4DKDC 1FNEB 2V9RA 4XCYA 5KSAD 2FECL 1U9KA 4JM2F 1S78C 5DT1L 1XMWA 1QLRB 4Z95H 1ZMYA 1DCLA 5CJQL 4M1CC 3BKJL 3SN6N 3OQ3B 2DQIL 4RMVA 4X5WB 1WV7T 4LQFL 4OKDA 3QG6B 4JFDB 1MAKA 3WFHB 3DHJA 1WBXA 3O6KH 5ISZB 3D6GA 3QI9C 3EDJA 5C0CA 1CDGA 4NQEA 2FHFA 5IT2L 1DLHB 4XC1L 1P5VA 1FNGB 4BZYA 2NY6B 4CKVX 1CL7H 2VIRA 3VGBA 1GAFL 4M5ZL 3RQ3A 2QSCH 1SJVA 3NIDF 5D8JL 3VGDA 4HBQA 4F57L 2OQJB 4CRPA 5FF6A 1X5KA 1TFHA 3MBEA 3V79C 1INEH 2H6PB 2BVPB 2R4SL 4UQ2B 3FO9A 4H88L 1D6VH 1MY5A 3BQUA 3TO4D 5EULV 1BLNA 4K2UL 3WV0A 1MHPL 1JWMA 5DJ2A 1QFWL 2FB4H 3SE8H 3NIGF 4PB9L 3NPSB 4UNTA 5CD5D 3U36B 1WK0A 1OQXA 2MKWA 3PQYA 3A6CL 4Z7VE 3TYFA 2IWGA 1E6JH 4JFYA 3JV4B 2EICA 4R9HA 1INDL 4ZNEE 4BFGA 4KMLB 3L6FB 1ZA6B 1R5VA 4NRZA 2OZ4A 5E2UH 4HH8A 2P43B 4HUVA 1XGTB 3KPQA 4XP5H 3QXWA 3SGEH 4IRZH 5F9JB 5T5NG 1F6FB 1UADC 2E6PA 2X1WL 4D0DB 3TIDB 1C12B 4C4KT 4F7TA 4XAKD 3MMEA 4Q9BA 3MNWA 1VA9A 4Z7VB 3SKUD 1E4XH 4OQ1A 2ZCHL 3MV9D 1MIEH 4K7FB 4NBZB 3WJLA 2WBJD 4L8SA 3DVGB 1NDMA 3WIIL 3QDJE 4TUJA 3BVNA 1WCBA 4PG2A 3SDAB 5D1ZA 2MSPA 3EDEA 1LO0L 4MX7B 1NFIA 3MLXH 4DTGL 2D03H 1EJOL 1RZIA 4K7PX 4NZTL 3T0AA 3OB0H 4LK4A 3WKMH 3MLRH 2ATPA 4JFHD 5F1OB 4QF1A 1Z6JT 3MRGB 2J6EL 2A6IA 2VSDA 1BQLH 3QDJB 4OZFB 3QXDA 3FQWA 1I3GH 1GC1C 3A67L 3KPSD 2EEDA 4RGNE 4R90L 4DEPB 3P4NB 4E42A 4NOFA 5AZ2L 1SYVA 4LRIC 4WGWB 1U3YA 2DM4A 4C57C 3CFEB 3EYUL 2GITA 2WWMC 3OG4B 2EZ0C 3SGKA 3T4YA 1E4KC 2X4UA 3JSSA 3U4AA 4H5SA 5DSCA 5SX5H 5MEQA 1EVTC 2W0KA 4MQ7A 2VDRH 4KQ4L 1D9KB 4XPTL 3V6BR 4EUPG 5BW7A 2SEBA 4AENB 5FM4A 4CDGC 1J8HE 3BDXA 1AE6H 2DQDL 4G42B 4NWTH 1FL6A 2YUWA 3PE9A 1OAUL 5E24E 4P3DA 4RGNB 3ULSA 1OD7A 4LMQE 2OJZH 4GBXA 3GUTA 3LS4H 4MD0A 4YBHA 5DVOA 2DS4A 4XPGL 1T5XA 5JNYA 1UKTA 5KN5B 4PJFA 1QFUH 4HLJA 1J8HB 1XGRB 4BQ9A 3D0VA 3S3JA 4LLYB 2PR4H 1IAOB 2PTUA 5GGRY 4ZMAT 4CMMA 3NABH 2DQUL 2GHWB 3BIKA 5FXCH 1S9KC 5D4QA 1U93A 2F5AL 4XRCB 4OSUH 1W72A 3VRJA 1X4YA 3W0WD 3DX6B 2PO6A 5GS0L 1N6QL 4UBDD 5KANI 1VFOA 1NMBL 1ZS8B 2QQQA 2HN7A 2DN7A 3GGWB 3WYRA 4XPHH 3CDGA 1WIUA 2DMCA 2MPAH 5J57B 4U4BA 4Q6IC 2DLTA 2XN9D 1C1EL 5EU5A 4KDWA 3JWDL 3PV7A 4PJ9B 5DJYB 5FM8A 5KSUB 4GSDL 1FG2A 5DD6A 5GISH 3CVIH 5DK0A 5HGDB 3ROLA 1OAYL 5E9DA 2FNBA 3MCG1 4LSQH 5E4EB 4MJ5B 4JFEE 4NRYB 1MCSA 4F8TA 1F02I 4X99B 1OF2A 1JGDB 5A2JH 4I0PC 1NCUA 4HK3N 2C9AA 3LDBC 1EHLH 4Y1AE 1EMTH 4OKVB 1G7IA 1W0WB 2AGJH 1AP2A 2H8PB 4HV8B 4NFCA 1JPST 5E4IA 2R15A 4YXLH 2K7QA 2E3VA 1UQSA 2NY5L 5LAXB 3MYZA 2AJVH 1DLFH 3FRPG 3ULUL 5EWIH 1ZHLB 4LSDA 5E6IB 1FFPB 5KVDH 3ARUA 3P4MA 2EH8L 4JFEB 3AY4C 1G84A 4LGPB 3QDGD 4YFDB 1Q1JL 2P48B 3U7YH 4Y1AB 1XGUA 1X44A 3O2VL 5ESAB 3WIHA 3BP7B 3VXPA 3ZKND 4PJGA 3D39D 4WTXA 4IRSB 4XP4L 4HT1L 4LSPL 4X8JA 3MA9L 1F58H 4JB9H 4WFFE 5EU4A 3VXRA 2DLFH 3CUPB 3B8SA 3G6DL 2UZIH 4YHOH 1OHQA 3G08A 4O9HH 5C0BD 5B3NA 5L8LB 2WM0A 3MRMB 1FRGL 1NMCB 4XC3H 1KIQA 3QCVL 4CU7A 2HT4C 2MHAB 3TH3T 5B8CB 3B9EA 2VO5A 3VCLB 1K85A 4EN3B 5HVHB 4N1EA 2Q87A 3RWEB 4XCCH 2ZCKH 3QAZC 4JHWL 4MA3A 5AG8A 3PWJA 3QDMD 4RBPH 4Y16B 4OLZH 3TA3C 4M93C 1KLUA 5EZIL 4S0TD 4OFKA 1YMHB 5I0ZA 1NH6A 5C2BH 4YDKH 3NH7L 3QSKB 4ZXBB 2MOVA 2YK1H 3O81A 4I4WB 3MQIA 4XBEH 1VPOH 5IVXA 1N8ZB 1M1SA 4ELME 5MEOB 3FOLA 5FECB 1UM6L 4R4BB 1MFDL 3WSQH 3TFKD 4WTZG 5SWZE 3IB4A 4AJ0A 4KK5C 3I75B 5IHZB 4PJ8C 4NRXA 2BC4A 5IFJA 1YPZF 1EEQA 5C09D 4P46B 4QNPF 4PTTB 5MHSD 4NM4H 3EYFB 1W0VA 3K1KC 3PDDA 2ITCB 4ZS7L 1K3ZA 3C6LD 2J3SA 3TBYA 4ELMB 5AAWA 4RCAA 4C4KO 1PSKL 3W9DA 3IDGA 1R3HB 3TZVB 5E8OB 5SWZB 2KL6A 3EYOB 1J0YA 1T2JA 1U8OA 1BOGA 1L7TH 1J05A 5J6HB 4G7YH 3OZ9L 4I48A 2IALA 1BQUA 4K23H 1AD9B 4QRQB 4XNXH 2HJLA 3N1MC 3WHXB 5C92A 3MYJB 3VWKA 5D70H 2J7LA 2X9WA 3ALPA 5D93C 5EO9A 3ARFC 4MA8L 1ITBB 3L1OL 3D18A 3MXVH 5GRYA 1N6UA 2RB8A 1XGPA 3MRBA 2OI9C 3D0LB 1QSEE 3P30L 1SBSL 5BVPH 4XVUC 2EECA 4JLRA 1Z9SA 1N5AB 4WU7B 4OD2B 1T1WA 2AJZA 1NAMH 1HYSC 1PZ5B 2WP3T 4HLZG 5DRXB 1RJZB 3C60C 1OAXL 5HGAA 1U2CA 4LRNL 4DVBB 2BY0A 4UV4L 1BFVL 4KRMB 5DK2A 5HI3D 2PXYC 5C0GA 4U1HB 4AZ8A 3V4UL 4GKNA 5CJQH 4ODTL 1ZE3C 3SO5A 1ZLSL 1ZA3B 1QSEB 3C8KA 5JHDA 2R69L 4PTUB 2DQIH 3OF6D 5FHAL 1FGNL 4NNYB 3ARDB 1TQCB 1A7NL 3UTQB 1UXWA 3DHMA 3KLHC 2HH0H 5DEGA 5TPWL 5A2IH 1BX2B 5BRZA 5FYKE 3JTSB 4NC2B 5IT2H 1BVLA 4O5LL 2YD2A 3AAZA 4P4KD 4M5ZH 5DEFB 3WKNA 4FQQA 4PLJD 4F57H 2Q3AA 5TDNA 4WCYL 3TJHC 3QUXD 4MXWL 5EO1B 3QUMB 4HDIA 3TWCL 2ZSWB 3QIWD 4EOWL 2R4SH 4J1UB 4B50A 3NMEA 2DQHL 4HKZA 1SM3L 1I1FB 4S1DD 2XI9A 1JZ4A 4H1LB 3QXUA 4M6MH 1MHPH 4GJTB 4I77H 4YHKH 1QFWH 5ALCH 4H0GA 4JY5L 4O4YL 2ZWLT 3I02B 4F7CB 1T5WB 1CDYA 3GRWL 4F9LA 1CFTA 3A6CH 1YC8A 1DDHB 1QYGL 1INDH 2IQAB 2W60A 3G6AB 4GKZB 4ZS6D 3MLZL 2I60L 3WXVL 5T33H 4RWYL 4GG8A 4AQ1B 2YC1B 1VADB 4UB0L 2BRRH 5DS8A 3QUYB 3VMNA 2YPLE 5CGYC 3F6IA 5JW4Q 4F37F 4IRJD 3Q48A 4NPYB 5EC1B 1U8IB 3QULA 4IMKC 4HKJB 1XFPA 4JRXE 3LN4A 1HHHA 2CLZA 2DWDA 3ESVF 3FO2B 4NKIL 3IDNA 3KYMA 4HXAL 5KBNC 4LLQA 4HIXL 3L95A 5LCVL 3QFJA 1CFNB 1RU9H 3O2DL 4P9HL 1N7ML 2P4AB 4YHLL 3KPRE 3WN5B 4QXTB 2DIAA 1LO0H 2WAHA 2YPLB 4R4ND 3U0WL 1MSPA 2X9XA 2VZ3A 4YWGH 4CVUA 4CDHA 4DTGH 4E0RA 1MIML 1BP3B 1MCKA 2VLME 1HDMA 2UVEA 3HLAA 2ARJA 1J1XH 4JRXB 2F74B 4JZJB 3VXSE 4NZTH 3EO1B 5LVEA 2C5DC 3O9WC 5L2KA 1TZIA 2X4OB 4Y2DB 5MI0B 1I8MB 3S6CA 4XMKH 4Y19D 2J6EH 3DV6A 5T3ZE 3AS1A 1DBKH 3Q6GL 1JV5B 1JCKA 3GSRA 4U0RC 5ALBL 3IFPA 3KPRB 1OGAE 5TE7H 3TN0B 3U7WH 4R90H 1QFOA 1D5XB 3TYGL 3MLVL 2PW1A 5AZ2H 2QEJA 5E5MA 4JN1L 3EYUH 3LKQA 4ZFOB 4RMQA 1S78D 1CICA 3VXSB 5I6XB 2VDKL 3RX8A 5KS9A 4W6YB 1T1ZB 2CIIB 2Y7QB 4ZUWB 1SEBA 4KUZL 4KQ4H 3S36L 1F4YL 1YEJL 1OW0A 4JEGB 2X42A 2QR0B 3HG1A 2DQDH 4WWKC 4F7PA 1KJMA 1OP3K 4EBQL 4XZUA 1MNUL 2IH3A 1B3JA 1F4XH 2P46B 4ONHA 1GZQB 1T03L 2NNAB 4OCRH 3UBXB 2CR3A 1R3KA 4F33B 3RAJL 2KQMA 5F3HB 4LCCC 1NCCH 4HWUA 5D7JC 4WI8A 1FL3B 4GMTH 4X9FA 4HF5H 2YBRA 4F7MB 1M71B 2X7LB 3OPZL 3GHEH 1JZ3A 1CT8A 5F1KC 1KPVA 2F8XC 1WEJL 3QWOA 2BZDA 1LEIB 1KCKA 2ZUQB 4JDVA 2JB5L 5IMLB 2X4QB 4WDIB 4D9LL 3TVMB 4OI8A 3UAJD 5I1AB 2JK5A 2DQUH 1IL1A 2R1WB 4MA7L 3MNZA 3D3VB 1CE1H 4R3SB 4TSBH 3O4LD 2F5AH 3T3MF 1OPGL 4WVRA 1LE5A 2H32A 1NMBH 3BRDA 1ONQB 4L8CB 4PRIE 1WUNT 1D5BB 1MJUL 2J8UA 1GC1H 4PJBF 5MERB 3OHXB 1RUML 3QRGH 2VB5A 4FZ8H 2NYYC 1T89A 1DN2A 3JWDH 3DLQR 2JJUA 2DICA 4GSDH 1UJ3C 1RVFL 2AXHA 2VE6B 1JRHL 3VE0A 3PABB 1WFTA 4XTRC 5L6YL 1ORSA 2VWEE 4X6DF 1OARL 3KYNB 3LN9A 4R7DB 3BPNC 4PRIB 3BSZH 1XIWA 1U8PA 5C0EB 2HT2C 3VFSA 2IQ9L 1NC2A 3CH8A 5DDHB 3VD3A 3BPLB 5I18L 2JELL 3CK0H 4PUBH 2WK2A 3OXRB 2FSEB 3X12B 3D2UD 2BSTA 4KV5E 4N0RA 4YC2B 4JANB 1Q1JH 1D5MA 1QQDB 4XP6L 1QZ1A 4PRBA 1F4WH 1RUPH 4XP4H 4LSPH 5DRNA 1Q9OA 1U58A 4IIQC 4G9FD 4HIIB 5CP7A 4OLXL 5DJCA 3HAEG 3SDCB 1AIFA 4ONFL 4QRUA 5D7KE 3V6OA 1R3LA 3VFRA 3IDUA 3C5JA 2WWMD 4Z7OE 1H3TA 2P8PB 3LEYH 2IAMA 3SE3C 4LSSL 3QJFA 4JRYD 4Z8FL 3WO4B 4X8XA 5DMKB 3AREA 3BEWB 3W2DH 2VKWA 4XGZA 4MDIB 3I2CL 3ROOA 5EBWB 3MNVA 1MELA 2EYTA 4XNYL 3OAZK 4MAUL 4PRHE 2FR4B 5EFIB 2YN5A 1P9MC 3GMLB 4MD5B 3VXQB 2QV2A 1I1AD 1ZT1A 4ZUTA 4BFIB 1W8NA 1YN6A 1TZGL 2BXYA 4BSVA 4YHZL 1WBZA 3MLTB 2J4WL 4CJ1A 3IFLL 3NH7H 3OKEB 3ULUD 4MD4B 1BVKB 4LVOB 3DBXA 3L5XL 3OKLB 3GSQA 3BAEH 1HHGA 4PRHB 2G60H 3QISA 4OGXH 1AQKH 1ULVA 4KK8C 3PWPA 4PYGA 5FA4A 3T0XA 3GMQB 2CKBB 3GDBA 2FZ3A 2RHEA 2VLJA 4PFEA 2B7DT 3WS3B 3AM8A 1H5BA 4M62L 1WAAF 2GJ6E 3DVNB 1KC5H 1CZ8L 1W8OA 2CGRH 2FBJL 4GG6E 2J88L 3MV8D 1DVFB 5B39B 1KCSL 2BVQB 3QUZA 5C71A 2OL3A 4FXGB 4J4PA 3I6LD 5IBTL 4JFFE 4U6HB 1IGML 5F7MC 1K8DA 5I1IL 3BN9C 4AY0A 1T83C 1BWMA 3IDMA 1OTSD 4LARL 2CDEB 2WANA 2VDPL 2JCCA 3FN0L 5INCA 2GJ6B 4WHYG 1PY9A 4NHUA 4L9LA 4S1SH 4GG6B 4JQVA 5K9QG 2N7AA 4L4TA 4QHLA 2CDGB 2AV1B 4FFVC 4HJ0D 4JFFB 4MA8H 1N64H 3L1OH 3RGVD 1NSNH 5F88B 2YA2A 4WEMB 4ETYA 1KENH 3P30H 4LCWA 4FG6C 5DVNA 1NC4D 4PREA 4LBEB 3Q3GB 4CUCA 1Z2KA 4JJHA 12E8H 2GK0B 3F62A 2P49B 3PWLB 5IW6B 4X4XA 5FB8A 3T09A 1WZKA 4K71C 3W81A 4NN5B 1HOCA 4RGOL 4E41D 1OAXH 3MRDB 4LRNH 2Z91B 4FFYL 1KPUA 1KG0A 4OV5A 2VLRD 3EYQD 3U4BH 4NO0B 3KPTA 4FMKA 3V4UH 2ZP0T 4ODTH 4JFZH 1KJ2A 1TZHA 5ID1B 1OVZA 3X11B 2OJEA 5FHAH 1ZT7A 1A7NH 3TO2A 1TPXC 2HVJA 5HHPB 2E27L 1J0KA 1IKNA 3VFWB 1QKZL 1II4E 4O5LH 4QRSA 2VAJA 4FN0A 1OB1B 5JOFB 4DGYL 4U1GB 2P5WD 3VI3E 1MRCL 3MJ9L 3ARBB 5ICXB 5DJXB 3TA3D 4WCYH 4MXWH 2C4XA 5HHQB 1DFBL 1GL4B 4GKSA 3U0PB 2YMXL 2ZKHL 2V2XA 2FO1A 2EDHA 4RRPG 4M48H 1SM3H 1T21A 2P7TB 3CPLB 1MCDA 5IW1B 5F44A 4P2OD 4JE4B 5JPNA 1ED3B 2APTA 5JDSA 3T2NL 1ROWA 4MB4A 3OB8A 2L0DA 3MFFB 4UIKH 4XVTH 1HE7A 4ENED 1BZ7B 2Y5EA 3DRTB 2IFFL 2B0SL 3GSNA 4J3OC 2NLJB 5C0CE 3GRWH 3SE4A 1IE5A 4NQEE 4KUCD 2H26A 4HIJA 1QYGH 1QRND 4XCYB 4P2QD 5DMYA 3W82A 3MLZH 4M03A 3ARGD 5C0FA 2KZWA 3EJYC 5GSVA 1I3UA 1I85A 2APWA 2AVGA 5BMFL 1WBXB 1FNSH 5C0CB 4NQEB 2ZPKL 3EHBD 4NKIH 4JM4H 1TETL 4HXAH 2VIRB 4MMXC 5I9QC 1OTTD 1RIVL 4YQXL 3NPZB 1GGUA 1FORL 2E8YA 4HC1L 5KAQF 4P9HH 1N7MH 4YHLH 5JR1L 3PQYE 4PJHF 3MBEB 5E08L 1JJUA 1HI6A 2DOCA 2YD4A 4HMDA 3FO9B 1MIMH 3QG7L 3BQUB 1BLNB 5E03A 3CMOL 1JWMB 3IJYA 5DJ2B 1KN4L 3VJ6A 1U3JA 1A2YA 5BOZG 4LPCA 1V3JA 3Q6GH 5ALBH 3PQYB 3TYFB 4U6VL 4JFYB 1Y18A 2B1HH 3TYGH 4TRPL 4M3JA 1P1ZA 3ZKMD 3LB6D 3QUML 2LVEA 1R5VB 4NRZB 3M45A 2PXYD 2OTWA 4JO4H 4HUVB 1KXQE 2VDKH 3KPQB 5FYKL 3PL6D 4IDLA 3REVA 1F4YH 3RY6C 3IDXL 1V05A 2H45A 3P11L 4KK6C 2E7LA 1CXLA 5LWYL 3HTLX 5DLMH 4F7TB 4J3UA 3VXMA 3MMEB 3MNWB 1IC7L 1XCTA 2DQFA 5I1CL 3TN0C 1QBLL 1T03H 5LJYH 2R0KL 4ZSOA 3RAJH 3L7FA 1NCBH 5C0RL 4L8SB 1YEDA 3BESR 1NDMB 4MAYA 3LVEA 4TUJB 3BVNB 4Y0GA 1WCBB 3OPZH 4YK4B 2CUHA 2NY7L 5D1ZB 5KVFL 1WEJH 3N1FC 1EEZA 3MGOA 1NFIB 1U42A 3JV6A 2AJSL 5F9WC 4D9RE 5JOEA 1KBGL 1A6TA 1K3IA 5AG9A 1U6AL 1A3QA 1JZ2A 3ESUF 4JFDD 2AW2A 1PW3A 5CMAA 5J1TC 1NEZG 5EOQL 2XNAA 1RZIB 4YXHL 4F80A 5MP6L 5ISZD 2O5XL 4MA7H 2ATPB 3WBDA 4A6YL 1OPGH 4QF1B 1S5IL 2A6IB 2NY6D 1MF2L 3TT1L 3QXDB 3FQWB 4UI2A 4LHUG 2V2WA 1MJUH 2FJHA 1S7TA 1NUDA 3PXJA 4E42B 4GAGL 1SYVB 3OAUL 2VZ1A 2GITB 1C16A 3T4YB 1TMCB 1MAML 2X4UB 1IILE 5F9DC 4H5SB 5DSCB 1S7XA 5MEQB 1X5HA 4MQ7B 4PJFE 1WCQA 5JQ6L 3MZTA 4IOFD 2SEBB 1JRHH 1AGEA 3PDGA 4AEHH 2K3TA 5C70A 3P4LA 4Y4HA 1OARH 1FL6B 4P3DB 3ULSB 3QEQA 5D2LF 3BYTA 1MFAH 4G8GA 2W0PA 4QHMA 1E4JA 4PLNC 4GBXB 1BIHA 3GUTB 2IQ9H 4GRWF 4MD0B 1N6VA 5JXEC 5JNYB 1T5XB 3RI5K 4PJ5A 3FKUS 4PJFB 2OYPA 4ZFOL 3DMMA 2B4CL 4KROC 2VZOA 3D0VB 4ODVL 5FGBA 1BZQK 2BNQA 4CMMB 4NZRH 2E9JA 3BIKB 1U93B 4JJ5A 5F7YC 5IIEA 1W72B 4M6AA 3VRJB 2B2XL 1N5YL 2YOCA 4YIQA 2PO6B 4S1QH 1AY1L 2MCPL 2HN7B 3KGRA 3ZT5A 3SKNA 3BWAB 3CDGB 4N1HB 3RVVC 2XN9A 4OLXH 5EU5B 3UTSA 3SDAD 1YYLL 1IEAA 4ONFH 1FG2B 4J7RA 5I1JL 1AI1L 5K9QI 5DD6B 4XXCA 2QSVA 2BFVH 2CUIA 5DK0B 4LSSH 3ROLB 4RMSA 4XI5C 4Z8FH 2EYSA 3M17A 3NVQA 5ENWA 4TNWF 3I2CH 5E9DB 3CFJA 4RA3A 1QVOA 1OF2B 3I6KA 4NGHH 2A38A 3MC0A 1G7IB 2O26U 1AP2B 2KDGA 3RHWF 1TZGH 3T0DA 4PJGE 1P4IH 3AVEA 2D7PA 5EUKA 2J4WH 4F7EA 3IFLH 3FT3A 4ODWA 1UQSB 4D0BB 3FB7A 3VXTA 5M95B 3K4AA 3VXRE 3EOTH 3L5XH 5J56B 4RMRA 4JHZA 5F97E 1D9KD 3LKOA 3P4MB 5EU6A 1W0YT 4L1HA 1XGUB 2EH7L 4X9HA 4M5YH 3IS1X 2XQYK 1MJ7L 3P3YA 3DUSA 4RGND 3L3OA 3VXPB 4PJGB 4GS7C 1NANI 3BIBX 5E0QA 4X8JB 4MSWB 1BQHA 4Y88A 3ZDYF 4YX2L 4Z0XA 5EU4B 3VXRB 4JM2A 1FC2D 3G08B 1CZ8H 1FYTA 2FBJH 1KIQB 1UWEL 4NJAH 4GRMA 5HYJA 3IDIA 1J8HD 1KCSH 4Z7NF 4KTDH 1J0ZA 1HINH 1CLZL 4Y5YA 2ZOKA 1BIIA 1A64A 1XR8A 2X70A 3IJHA 3T0VA 5IVXE 4MA3B 3PWJB 3GJFK 2VDPH 3E1F1 3NCFB 1EA9C 2PW2A 3FN0H 5F7FA 3TNMA 4MA1B 1KLUB 4CN6A 1SYSA 2UY7A 5INDA 4UILL 5C86A 3QYCA 5DZLA 4PJ9D 5CSGA 4W6XB 4ONOA 1AKJA 5KAQG 4M7JH 4P5TC 2YRPA 5I1DA 1TTFA 2DIJA 1G1CA 5E7BA 2W92A 1P6AB 5IESH 2BY3A 5IVXB 3FCTA 1QBBA 1HIMH 3FOLB 1G7MA 1A7BA 1PAMA 3DYOA 2LU4A 1D7FA 1XF3A 5HBBA 1G7HA 2C4FT 4RGOH 1QA9A 4R2GB 4NRXB 2BC4B 1JI1A 4NJ9L 5DK3A 5IFJB 2OR7A 4WHDA 4NBYB 1WTLA 3SDDC 4I18C 1GGIH 4FABL 1F2XK 1W0VB 4KRPB 1X6NA 2G9HA 3NZ8A 1EHXA 5DVLA 4NYLA 3TBYB 5C0IA 3I85A 5E6ID 3W9DB 1UXSA 3L5HA 1D5ZA 2LAGB 4FZEL 4JFED 4N90E 3M8OL 1L4IA 1XF5A 4KJPD 3ZSTA 1U8OB 1BOGB 1JHTA 1J05B 5DHVA 3S4SG 2W9DL 5HYQA 4IRSD 4I48B 2IALB 1MOEA 5SWSD 1EERB 3IXTA 2NY5C 3K7UA 4L29A 5CJXA 2CKBL 3H9HA 4LDOB 2HJLB 1EH9A 5GHWL 2YMXH 1MLCA 1V3KA 3VWKB 2IG2H 3S3PA 1BJ1J 3S5LA 5EO9B 3EOYG 5GRJL 3LEVL 3HUJF 4HQQH 4Q74A 1XGPB 2BX5A 1KFAL 1L7IH 3MRBB 3OKDA 4PIRF 4EN3D 5M7QA 2WQ8A 1DQJA 2W0FA 3AB0C 4JLRB 2A0LC 5D5MF 2IFFH 2QJDA 5BRZE 1T1WB 1DANT 4WFFD 3NCJL 4Y16D 3STBA 2AJZB 1IAII 2BNRA 5HGAB 3FRUA 3UZVB 4EEEA 5DK2B 1HK6A 5C0GB 1ADQH 3V6FA 4RIRA 1U3HA 4GKNB 1E4WL 4ZXBD 3TEUA 5D71L 3C8KB 1DSFH 1WTGT 3OF6A 2FWOA 1L6ZA 1UXWB 5FOBA 2XICA 3LAFA 4N0UA 5DEGB 2PN5A 5BRZB 3UTTA 2QQNL 1BVLB 4ZQKA 5E2WL 3O6ML 3AAZB 3PGDA 2VQTA 3CSBA 1MCOL 4PJAF 1TNMA 1Q0YH 1UYWH 4OGYL 5C0NC 4FQQB 1RIVH 4GMSH 4WI5A 1F6LL 4KTYA 1FORH 3GKZA 5TDNB 4P46D 4YGAB 1DBJL 4YBLC 4HDIB 1JHLH 5E08H 3IDYC 4QXUH 4MQTB 4ALAL 4HKZB 4MXQC 3QG7H 1HHKB 5IBUG 3ARZA 4S11A 4WW2C 3CMOH 3TZVD 4EI5A 5SWZD 1GPOH 5DJZA 3BRFA 1KN4H 4P2RA 4ACPA 1D5IL 1S7QA 3STLA 2H1PH 2AJ3A 4LEXL 2R0WL 4ONGL 4KDTC 1CFTB 4U6VH 3ISWA 1C5CL 1ETZA 4EIGB 3PP4H 1CFBA 4PJDF 2X9YA 4LSRH 2W60B 4DZ8A 2UYLA 3QUMH 3CFDA 1LK3L 3QFJE 5HHXH 4PY7B 4GG8B 3MO1A 2VDML 4P59L 5FYKH 4WFHD 5DS8B 1BECA 3ILQD 3FJTA 4H1LH 4JHAL 3P11H 1Z9OA 1JK8A 3ORJA 5LWYH 2DQCL 2R9HD 2FEEI 4IEFB 4M7KL 3QULB 4M4PA 1KEMH 1IC7H 1CFVH 5I1CH 3LN4B 1QR1A 1HHHB 2CLZB 2DWDB 1QBLH 2UZXB 3IDNB 4Z6AT 3KYMB 5L2KE 4FQLL 4LLQB 2R0KH 1AHWA 3L95B 4OQTL 5EBLA 1IGFL 4ZOBA 5C0RH 3QFJB 5CIPA 2DAVA 5F7EH 4ZOEA 3KS0J 3DNKA 4KFZC 4NQVA 4AM0A 2NY2C 5CGMA 5KVFH 2CD0A 2JB6A 2BSSA 5FGSA 5GRXG 3DUUA 4FS0A 1PDKA 1GOHA 1QSED 3LRHA 2AJSH 4ODUA 4YHIA 3RDTC 1KBGH 1QO3A 1U6AH 1I9RL 4E0RB 2ESVA 1HDMB 3BD3A 2ARJB 1TVBA 3HLAB 4YXHH 5FO9A 4OZHF 3T3PE 5MP6H 5E8PA 5L2KB 1TZIB 2O5XH 1FAIH 5KS9E 2H2SC 1QP1A 2VDOL 5HVWA 1S5IH 3DV6B 2HMIC 4DQOL 3TT1H 3GSRB 3IFPB 1H3PL 2AQ2A 1IC4L 1R5WA 2WLZA 1I7RA 2PW1B 4X5XA 1G7JA 5CILL 5E5MB 3OKNA 4JKWA 3LKQB 4QRPA 4LQ1A 1CICB 1Q9LA 2NXYC 2VXVL 3RY5A 4EIZC 5IP4A 4M43L 5FYKD 1X4XA 3EJYD 5KS9B 3KWWA 1SEBB 5DYOA 1N0XL 5FYJL 3HG1B 3BPOB 2VABA 1N3NA 3C09C 4F7PB 1KJMB 4V2CB 3QI9A 4XZUB 4EDWL 2IH3B 2A6DB 3OG6B 4ONHB 1I4FA 2BP3A 1R3KB 3A0OA 1RPQA 3T0BA 5IB2A 1FH5H 4XVSL 3ZHDA 2YBRB 3AMKA 2A1WL 1CT8B 1KPVB 1AH1A 2OZ4L 2O5YL 2J8UE 3QWOB 3CU7A 1WZMA 5GRUH 2B4CH 5DJDA 4JDVB 2QHLA 3QUYD 1CBVH 3IFOA 3FO0L 3ZKXC 4DN3H 2JK5B 5T3ZH 4LF3A 5I66A 2AEPL 1IL1B 3MNZB 3E3QE 4XNZB 2B2XH 4OCNC 1N5YH 1A3LL 4XPBL 5FHBH 4NT6A 1LE5B 2H32B 2MCPH 1CLYL 3GM8A 3NIFE 3V52L 2X4SA 2J8UB 1WQVT 3BKML 4X4MA 4PP1C 4FFWC 1F6AA 4JDTH 1YYLH 2RIKA 4KKCC 2YPLD 1UEMA 3KNBA 5I1JH 1AI1H 5TE6L 1ERNA 1QBAA 1G9NC 4B7IA 2FX9H 2ICWI 4OBRA 5FA3A 5I75B 4JRXD 2ZJSL 2EDXA 4U49A 3V5KA 4BQ6A 3VE0B 2GT9A 4Y2DD 1MRDH 3MOBL 1ORSB 1V5JA 1IGJA 2VDQL 2F15A 1R24A 4MJ6A 1DBBL 1XIWB 3V0VA 1U8PB 5GSRA 4GXVL 3VWJC 3BZEB 4XHJD 3KPRD 3TN0D 1BHGA 5DVKA 2I24N 4QHNA 5FM5M 4G6AC 3VFSB 2VZTA 1XZ0A 3G5YA 4HUUA 1BQSA 1NC2B 3ULUF 3VXOA 5KOVC 4X9IA 3OJMB 1NKOA 3QNXA 2VLMD 5D7SH 1AO7E 4RZCA 3VXSD 4OF7A 1CWVA 5CLTA 3LH2L 2DQTH 3PUCA 3D2UA 4U05A 2BSTB 4B0MM 3V6OE 2F53D 4JY6A 5T3ZD 4H8WL 4WHTA 1D5MB 4JREB 1PG7H 1MJ7H 3BX7C 4PRBB 5F6HI 1CXKA 5DRNB 1Q9OB 3V7AG 3BZFA 3P40A 5GIRA 1U58B 3OKKA 4DK6A 4ZUUA 1ZHNA 5CP7B 5DJCB 5T1LA 4L3AA 1BJ1H 1AIFB 4QRUB 1ZKAA 2R2BA 1U8KA 4KZEH 4LRIA 1R3LB 5FKAA 4I5BA 3VFRB 3C5JB 3HE6C 1DBAH 1E4KA 4NN7B 2D7NA 3S35L 3IU4H 2IAMB 1MEXL 1CLZH 1CXIA 3TVMD 3HRZA 3QJFB 3AREB 3PGFL 5D1XC 3BD5A 4XGZB 3KYKL 2YSSA 3ROOB 2YRLA 3D3VD 3MNVB 3MRIA 2EYTB 2OP4H 5LBSL 4U1NA 1W72L 1HNGA 3FL7A 3PWPE 3MTRA 5CS7A 1ZT1B 4ZUTB 2F58H 1J86A 1VFBA 5J7CC 1YN6B 2Z8RA 4NQTA 4UILH 4BSVB 4KKAC 3ME0A 1WBZB 3O8XC 3HR6A 1CLOH 3DXAA 1EK3A 1A7PL 2VLJE 3O11A 5DWUL 3DBXB 2UUDH 1IC5H 3GSQB 3HZVA 4GRLC 4WW2F 1HHGB 5J11B 5BOPA 2V5TA 3PWPB 2R23A 4PRID 2QQLL 5FA4B 1R0AH 4PR5A 1MWAL 4PY8I 5L7XH 2FZ3B 4LPXA 4FABH 2OMBA 2VLJB 2HVKA 3B9DA 2JCCE 4X5LA 2YRZA 3V7MA 1H5BB 3WUZA 1T7ZA 4Q6IA 3V4VL 3MV8A 1P84K 4IDJL 2BDNL 4L4TE 1KTKE 3QUZB 2OL3B 4FZEH 5ITBL 4OIIL 1K8DB 1HQRA 2XFXA 4XI5D 1MFCL 2IMMA 2H9GA 3IDMB 1EX0A 3MFGB 1N4XL 4LCWE 4H0HB 5E99L 2E6QA 3WIHL 2W9DH 4PRAA 2JCCB 4GLRH 3MUHL 2EDOA 5INCB 4I0PA 3QB7C 1PKOA 2CKBH 4NHUB 4L9LB 1EHNA 4OT1H 4H20H 5FO7A 4L4TB 4QHLB 1RURL 3LEVH 2BRQA 4BKLA 3BUTA 4DUVA 1KFAH 2Z35A 1OP9A 3O6LL 3UJTL 5HGBA 4LCWB 1FIEA 4PREB 5CCKL 4C83A 3LPWA 2XIDA 1MCQA 5I1EH 1JWUA 2OXHA 4X4XB 2DQEL 5FB8B 5K33A 3NCJH 5IQ7H 5JA9A 1HOCB 2FX8H 3QHTC 3QR2A 4XMPH 1KPUB 5D7KD 3VH8A 5B4MC 1KG0B 4OV5B 1G9EA 3KS0H 3SCMC 4HMCA 4OD1L 5I74B 3FZUD 1KJ2B 1TZHB 4MJIA 1OAQH 4XCNA 3CH1A 4YBQC 2OJEB 3QEUA 1ZT7B 3TO2B 1CLCA 1RIUL 2IGFL 4HGKC 1VFUA 2HVJB 4JPKL 4PD4K 4M6NL 4UOJA 4PRHD 2P24A 3HB3D 2QQNH 4QRSB 3HRPA 3MRFA 3INUL 1SJHA 3QPXH 3DX8A 1A6VL 5KTEL 2Q8BH 3DETC 1HCFX 1LHZA 3CDFA 1FLRH 4UV7L 1VGEL 4NM8H 4GKSB 3U82B 2V2XB 4MNHA 3VG9B 4HBCH 4PGEA 3VD4A 3UJJL 1T21B 1DVFD 4X7SL 5CLWA 4K3GA 3FQUA 3IFNL 1NGWA 5BV7B 5JPNB 5JDSB 1E6OL 1D5IH 3VFVA 3QH3A 4LEXH 4RQQA 1MH5A 3GSNB 4NFBA 1G6RL 4YZFE 4CAGA 4ONGH 3U6RA 1J12A 4KHXH 1DJSA 1VKXA 4LNRA 2H26B 2GJ6D 4HIJB 3ZDZE 3HMWH 4PJ8A 1Q9WA 5KSAB 5FM5O 1YDPA 1GGBH 3SDDD 5C0FB 5ESQA 1LK3H 2OLDA 4JFFD 1DBML 5GSVB 3LS5L 3MJ7A 3WUWA 2VDMH 4P59H 2DTSA 3P0YH 3WDJA 1TJHL 5B22A 4JHAH 1OP5K 1I8IA 2DQCH 4NKMA 4M7KH 4P49A 5TE4L 2L4OA 1KPRA 1JFQL 1XEDA 2QSTA 2VZSA 3DO7A 5EU7C 1NGQH 3L3JA 4FQLH 1PG7X 2I9TA 1KF9B 4PJEF 1C8PA 1IGFH 1VFMA 5EOTA 5B38A 1C7TA 3BZ4A 4NO0D 3WFZA 1HI6B 1HKFA 2DQGH 3AMLA 5JHLH 1IFHL 4PPTA 4YHYC 1CGYA 5FUOL 3TNNA 3ARFA 3C5ZC 2V6HA 5GJSH 4N0FA 4M7ZB 5GRVL 3IJYB 3VJ6B 3KR3L 1A2YB 4HK0A 2XG4A 2PTVA 3GO1L 2P8LA 3VXME 5EG6C 3ARBD 4I3RH 1FN4A 1Y18B 1EGJH 3C60A 2D0GA 3E6HA 1P1ZB 5EU3A 5CILH 4ZSOE 4NC1E 5HYSG 3ZE0F 4L1DA 2PXYA 2OTWB 5D9SA 3QPQC 4M43H 5C6PB 5ACLA 5IB1A 3REVB 4O2FA 2AK4A 3VFGH 5F96L 3VXMB 1HKLL 3CFCH 1XCTB 2DQFB 3K8LA 3ULVC 1WWBX 3SO3C 3L5IA 2HAZA 4ZSOB 3L7FB 2R4RL 1YEDB 5DUPL 2NY1C 3KHQA 4MAYB 4XVSH 3HNVL 1H3GA 5I8EA 5CGTA 3MGOB 1EEZB 5CJ8A 3LHPH 2IANA 1NEZA 2YUXA 3JV6B 4RISL 5FUCE 1A6TB 3K4DA 3P0GB 4JR9L 4NKDA 5C0AA 5CMAB 5IJVA 2AXGA 2XNAB 3WD5L 3FO0H 4Z7VF 4AG4H 4UNUA 4I9WE 2AEPH 5C0CD 4NQED 4K3EL 5ADOH 1A3LH 2NY3B 4M7LL 1LE9A 3S9DB 4X4ZA 2V2WB 5EH1A 2FJHB 2Y36H 2B1AL 1S7TB 4K3JH 5J3HD 1MUJA 3QEQE 3U83A 4G8GE 3MBED 1A6UH 3WE6A 1WAAA 2QBWA 1C16B 4EDXA 5TE6H 2YD3A 3IU3A 5GZOD 4WI9A 1G0YR 4PJ5E 1S7XB 3BQUD 2CMRL 3RWCA 2BMKA 1AGEB 3EJZD 5HHVL 3MOBH 4P23C 5C9JA 4DN4L 4WO4C 2Y07L 4Y4HB 3U7AA 5CKGA 1AGFA 2YKLH 4ODSL 2VDQH 4NO5A 1DBBH 4IMKA 3RIAK 2BNQE 2XRAH 3QEQB 5J12B 4GXVH 4G8GB 3PQYD 2EDYA 1GJIA 4QHMB 4K55A 4HG4J 4N9GA 1A6PA 4FQ2H 4M02A 1KJ3H 1Q8MA 3OV6A 5DO2C 3OSKA 3NCYP 4PJ5B 1CIUA 5J13C 3KPPA 3DMMB 2XN9E 3RTQC 5CINH 4QYOA 3WNMA 1RI8A 4Y4KC 1P84J 4H8WH 2BNQB 4YGVA 4B5EA 5HPMA 3W5NA 3ZE1F 3O9WA 4JJ5B 5IIEB 1IAKA 4YIQB 5TQ2L 4X83A 1P4BL 5DZOA 3SKNB 1S7WA 1RFDL 1CDJA 4OJFL 1TDQA 2XN9B 3NGBC 5DJ6A 3UTSB 5D1ZD 1IEAB 2CRMA 2CK0H 4Z77A 1Z9LA 4KMTL 1KXVC 4ZFZA 3S35H 1MEXH 3LY6A 1O7SA 1ZOXA 1AC6A 2EYSB 3M17B 5ENWB 4BFEA 3KYKH 1UB5A 2ILLA 3CFJB 5CEZE 2HA1A 4WWKA 5EU6E 1RZJL 1QVOB 1W72H 1K6QH 3I6KB 5DD0L 5DMJB 5GPRA 3HZKA 2DYPA 1QNZL 2VXQH 4WEBH 5CZKA 4LCCA 4D9RD 1EO8H 5EUKB 5D7JA 4F7EB 2DF3A 1TIUA 3FT3B 4ODWB 3FB7B 3VXTB 2R56L 1A7PH 4OLWH 5DWUH 3P9MA 3FFDA 1FYTE 3LKOB 5EU6B 4QO1A 3E0GA 3QIBC 4KJQD 5L88L 4AEIH 1PGRB 4PD4J 3DECA 1VDGA 1PLGH 3DUSB 4K94L 3L3OB 5JPMA 3IGAA 2WWKT 5C08A 1BEYL 2HT3C 1BQHB 4KKLC 4OIAA 4Z0XB 3CJJA 5CEYA 3VGHA 2OTPA 4JM2B 4LGRB 3NIDE 4OZ4A 3V4VH 4G80A 1FYTB 4GRMB 2VNCA 3IDIB 5HYJB 1UJ3A 2EXWD 3MOAH 3C08L 5IF0A 4N8VG 4Y5YB 2H2PD 2ERJC 2ZOKB 1BIIB 1MFCH 1CDHA 2VAAA 1XR8B 2X70B 2CRYA 3IJHB 4U1KA 1N4XH 5J06A 5E99H 3WIHH 2DBLH 1SBBA 2PO6D 3ALWA 3H3BC 2PW2B 4DUWA 4MNQA 3TNMB 3AS3A 2ICWA 4R0LA 1VHPA 1IGIL 1SYSB 5INDB 1OAZL 4G6AD 2X89A 5D6CA 4PJHA 3X3FL 2XY1A 1AKJB 1VCAA 4OZGF 5I1DB 1KB5A 4FQCL 2VR9A 3O6LH 3UJTH 3FCTB 5TGBA 1G7MB 5E9DD 1L0QA 1PQZA 1XF3B 2AJUL 1G7HB 5K9JL 4R6UA 1QA9B 5HHME 3WFDH 3Q5YA 1LO3L 1RIHL 4DKEL 1WF5A 2YXMA 5I73B 5I16A 4NQCA 1CD8A 2G9HB 3NZ8B 1FGVL 4IIQA 5IFAL 4NYLB 2APVA 3BDBA 3ZYJA 5C0IB 1RIUH 4POZC 1TQBC 1UXSB 4JPKH 2GCYA 1D5ZB 3NA4A 2Y6SD 3SE3A 5HHMB 1XF5B 5TDOA 5IMKA 1JHTB 5DHVB 1A6VH 1AXTL 5HYQB 4YFLF 4N0CD 1KCRL 2DQJL 5SWSA 5GGVY 3IXTB 4L29B 1P9MA 1VGEH 3H9HB 3LKPA 1J1OL 4UT9H 3VXRD 1MLCB 4APQC 3TESA 2FH8A 1CVRA 2BNRE 1CS6A 4Z7WA 3S5LB 5IFHL 3UO1H 5DHYA 2WV3A 1TNNA 1LO5A 1KTDA 1PFCA 2NY4B 3OKDB 4K8RH 2EDRA 2OL3L 1DQJB 4TSCL 4XP1L 2W0FB 3ABZA 4DFIA 2DD8L 4EQ2A 3NACL 1NUGA 1PVHA 4J6RL 2OXGA 3UTTE 1MCJA 1IEBA 3OWEA 4P4RA 2BNRB 4C59B 1OLLA 3FRUB 4M7LT 1JYXA 3V5DA 5JOPE 1MCRA 2HJKA 3V6FB 4RIRB 1U3HB 3H3PL 1PJ9A 1XCQA 1DBMH 4OCWL 1F8TL 2X10A 3LOWA 2FWOB 5MEPA 5FOBB 4N0UB 1CGUA 3TT3L 1DR9A 3N9GL 3UTTB 4CBPA 1M7XA 5DD3H 3S7GA 2HLFC 4UMGA 2ORBH 1JUFA 2XQBL 4ZQKB 5CBEA 3PGDB 1T83A 4P48A 3UP1A 4P2RE 1WZLA 4R2GD 3R8QA 3N85L 4OZFG 5D2LA 5B21A 1DE4A 5FFLA 3CFBA 2HFFA 1JTPA 1B6UA 4ODXA 4PGCA 3U79A 4KRPD 3UDWC 1V7MH 3MLYH 5GZNC 4DGIH 1S9XA 4HWEL 1IFHH 1KCUL 3ARXA 4K7PL 4XBGA 5FUOH 1MCBA 4K8RD 3BO8A 2EC9T 4KVCL 3JWOC 4EI5B 5DJZB 3S35X 4K9EL 4P2RB 2X44D 1S7QB 3KR3H 2Z31C 3STLB 1Q38A 2AJ3B 4KK9D 4QRTA 3GO1H 3MSPA 2CJUL 2R1YA 1A9EA 5DD5H 3W5MA 4F2MA 4M1GL 1ETZB 2KBGA 1JTTA 2ATKA 1ZSDA 2KH2B 4DZ8B 2UYLB 3QIUC 4GT7A 3VWKD 3CFDB 3OXSA 3QEHA 3MO1B 1T2QL 1ZLUK 2N56A 3K1DA 4TPRL 4FQ1L 2XTJC 1JK8B 4HXBL 5CUSL 3RVXC 5BV7L 5F96H 5E2TL 1HKLH 2ESVE 1ZTXH 4OBSA 4NCDA 2P8MA 3SJVA 4FQXC 4FMFA 4LGSB 5C6TH 5H8DA 1JNNL 1QR1B 3GSNL 2IPUG 2CRZA 4OI7A 2CXGA 3STZA 1AHWB 1G9ML 3PDOA 5EBLB 1YECL 3CSYA 1UGNA 5E2VL 5CIPB 5DUPH 5KW9L 5IB3A 2V7NA 5HYIA 1EZVY 5ADPL 4NQVB 4AM0B 3NFSL 2JB6B 3U9PL 2BSSB 3DUUB 2FEDC 4ODUB 4LAQL 4YHIB 5JHDD 2JF1A 1QO3B 4JR9H 2FO4A 2WUCL 4KI5C 1OM3L 3MJ6A 3SQOH 2ESVB 1TVBB 4QRPE 3WD5H 1X5IA 4X7CC 5FO9B 5E8PB 5BRZD 4HKXA 1BM3L 1JYNA 4OCYL 1J1PL 2QQKL 1UWXK 4MVBC 4YUEH 4M7LH 3WFCH 3B9KC 3AS0A 1R5WB 5J1AA 1FVDA 3K80A 2B5IB 3CLFL 4RFNB 4X6BA 4OCLC 1IM9A 1I7RB 4X5XB 1E28A 1G7JB 4HX1A 4U2YA 3OKNB 3LRGA 2H41A 2EDQA 4QRPB 2ICCA 3V0AC 2CLRA 4KHTL 5A1AA 3FMGH 3KWWB 2CMRH 2NXZC 2C7UA 3RWJA 1UH3A 3EFFA 3RJDA 2VABB 2VZVA 1N3NB 2DM3A 4WUUA 4C56A 2Y07H 3GBNL 1NLDH 4WHCA 2QADC 3QI9B 3UPRA 2YUVA 2EDWA 1R3IL 1I4FB 5M94B 3L5WA 2EIBA 3ULVH 4PBVC 3RIAF 3BGFC 5IB2B 1FFNA 1IGTA 3RZWA 2A73A 4KQ3H 5I1HL 4HGMA 5FEBA 1H8SA 2CO6B 3QCUL 4X80H 3EFDL 5DJDB 3O6FC 3FAXA 4X4ME 1XAUA 3G6JF 3CVHA 3IFOB 1HH9A 4LVHC 4DVRH 3LIZL 3R0MA 1FLTX 3C5ZD 2QLVB 4LF3B 1I8LC 1M7IA 5I66B 3C5SA 1IC1A 1FL5A 2NZIA 4F9PC 4NT6B 4JAMA 1CL7L 2MWCA 2NZ9C 1RFDH 3QFJD 2X4SB 1RHHA 4MS8C 3V4PL 3G9VA 2XZAH 1F6AB 1INEL 1J10A 1SEQL 3KNBB 2Q76A 3O2WL 2C3VA 5DMIL 5FA3B 5KSBF 2UWEF 3V5KB 3RY6A 2FB4L 2GT9B 1XF2A 2IJ0C 3UTZA 3QRFM 3P77A 1HQ4A 4HCRA 1IGJB 2AABL 5DD0H 1R24B 4MJ6B 3V0VB 5GSRB 2H32H 2MKLC 4Y5XC 2LAAA 3ULVD 4HWBA 4QHNB 1XZ0B 3G5YB 4HUUB 4WNQA 5IK3A 4TTDC 3QQNA 3DI3B 4PP2B 3VXOB 3QNXB 4WTWA 4G6MH 1ZHKA 2R56H 4RZCB 2LU3A 5E2UL 1CICD 4QY8A 4ELKA 4XP5L 3HUJA 1NFDF 1AQDA 3D2UB 1OT1A 4LSTH 2F53A 4JY6B 3HG1D 4EZMA 5HDOA 4WHTB 1E4XL 1WISA 3CAFA 3F65A 4TQEL 1JHKL 5ECJE 1HSAA 1ZGLP 2ZZUT 3BZFB 5GIRB 5A16A 3OKKB 4LCUA 1N2RA 4ZUUB 1ZHNB 2A2QT 3P0VL 5T1LB 5IG7A 2R2BB 1U8KB 2F9BT 5FKAB 4I5BB 2ITDA 3DTXA 4F15C 3MLXL 4LPTA 3DXAE 2D03L 1S3KL 3HRZB 3MJGX 1SJEA 5IOPA 4R8WL 4EVNA 2YSSB 3MLRL 4NZDA 3MRIB 4WI3A 1AR2A 25C8L 4U1NB 2DWEA 3OKOA 1YNLL 1BQLL 4PG9A 2OSLA 4PJAA 2F5BL 1I3GL 3VGFA 4PB0H 3UYPA 1IGIH 1VFBB 4KV5F 3IAPA 5IBLD 3DXAB 2BCKA 5JXEA 4YNYA 4O51A 3O11B 2M1KA 4FQCH 4YPGA 1U8NA 3RVWD 2VDRL 3PV6A 1MHHA 1NMAH 3HZVB 4JFQA 1J9CT 3MV8E 4JY4A 5T1KA 2QHRL 2I5YL 4Y2OA 1T22A 2VXUL 2RCSH 3BDYH 2R23B 3BWUC 5D1QC 4WV1C 5K9JH 1XIWD 4XVJL 2OJZL 4PR5B 4L5FL 2ZOLA 1LO3H 1ACZA 5DFVC 1MY7A 2D7OA 3LS4L 2E9BA 1NCNA 2HVKB 3Q0HA 1NC2D 3QA3A 1GZPA 2OK0L 4LCIL 4OM1L 5TF0A 3RZCA 5ITFA 5HDQL 5IFAH 3CSGA 3LQAL 4Q6IB 3MLWL 1B88A 3EDKA 3MV8B 4KI1A 1YNTA 5T1MA 5CEZL 4H1LG 3K4ZA 3S98A 1FSKC 3NABL 1HQRB 2XFXB 4TSAL 4C58B 2H9GB 4YDIH 2VMFA 4OSUL 3MCKA 4PRAB 3SDXF 3T1FA 2DQJH 4I0PB 4U33A 3LDBB 2VUOA 2A6KA 3EKCA 1J1OH 2UVFA 3OGOE 5FO7B 4E41E 5T5NF 1URLA 4BKLB 3TGXA 2GSGA 5CD3A 3CVIL 2Z35B 2IAMD 4KI5F 2OL3H 4YHPA 5HGBB 4XP1H 4MJIE 3ARED 3CX5J 1MCNA 3GIZL 3U9UA 4C83B 2DD8H 3UEZA 3ZKSD 3NCBB 2R39A 1JWUB 3PG2A 5JZ7C 4LSQL 2XV6B 4HS6A 1EHLL 5FGCE 4E41B 1FC1A 2FYYA 1ZANL 2AGJL 1QRKA 3VH8B 3T0EC 2P44B 3H3PH 5L0QC 3R8BB 3WNLA 2PTTA 4YXLL 5IUSA 3RP1A 2AJVL 4OCWH 4MJIB 1F8TH 3TJEL 4XCNB 3CH1B 3JVGC 3D1MC 3QEUB 1N26A 3MRJA 1UZ6E 2BOBA 5KVDL 4RDQF 3RVTC 1JN6A 2X4RA 4P9MH 2P24B 3H9YA 1JZ8A 3L7EA 1FJ1A 5FGCB 1BBDL 3PWPD 2Y06L 3MRFB 1SJHB 3QAZB 4YEEA 3PJSA 3DX8B 4LIQE 2C26A 1EO5A 3N85H 5J6GA 2GJJA 3MR9A 1F58L 2X1PA 4HMEA 4OUOA 4M93B 5J9PA 1U0QA 4MNHB 2UZIL 4QWWD 5HPOA 2JJTC 1KJ2H 4PGEB 4XC3L 1KCUH 1LO4H 3TH2T 1V3MA 3FQUB 3QUZD 4P5TA 3DVFA 4J4PD 1NGWB 2EXYC 1WBYA 3VFVB 3QH3B 2W59A 3EZJB 4RQQB 4BQBA 1MH5B 3X3GH 3U6RB 4OLZL 5F70A 4MLSA 1VKXB 4LNRB 1CG9A 3OKMA 3UBXG 4M1GH 2EC8A 4PJ8B 1Q9WB 2N1KA 4D3CL 2HKHH 1YDPB 1S7VA 4JO1L 4OFPA 4MXVE 5FYLE 4L4TD 3SDDA 4I18A 1NGPH 5C2BL 5ESQB 3BFOA 2GEEA 3PIQA 4LLVA 4YDKL 4ZPVA 3TCLA 5ACZA 3H7BA 3MJ7B 1T2QH 3WUWB 3S34H 2GJZA 4TPRH 2HP4A 1I8IB 2CQVA 1NPUA 2HJFA 4LCWD 4XBEL 5CUSH 5BV7H 4NKMB 5E2TH 5EZJA 1FNHA 1KPRB 1K5NA 1LDPH 2NY0C 4PGBA 4TTGA 3DO7B 4L3CA 3GSNH 3VA2C 3NAAH 4S10A 2I9TB 3L3JB 1WWCA 1F4AA 4JFOA 3TIEA 5D7LA 5HHNA 1YECH 3AU1A 5AEAA 5B38B 2W07A 5E95B 5EOTB 2P5EA 1MREH 5KW9H 3BZ4B 1SMOA 4KGLA 5GRVK 4Z18A 4LAQH 3PWUA 5D93B 1MFBH 3TNNB 3ARFB 3UYRL 4N0FB 5GGVH 2OI9B 3BKYL 3MLUL 2NQCA 1M4KA 4N8CL 3JWOH 2R0ZH 4OCYH 2AK4E 4HK0B 3EO9H 3BHBA 4E5XA 1U8HA 1KCVL 1CIDA 2P8LB 3EGSA 1Q9KA 2X4NA 4G7YL 4BZ1L 5HI4D 1FN4B 2BHZA 4K23L 5FKPA 3FT2A 1RY7B 3C60B 3E6HB 1XF4A 5EU3B 2PXYB 5D9SB 4YFLI 1ZT4A 5IB1B 4O2FB 3W11C 1LD9A 2AK4B 2VISA 5D72L 5C0AE 3U46A 5C7XH 1I9IH 3QFDA 4OZIF 3D5OF 1NAML 4UTAH 4RFNC 2B5IC 2EDJA 1BWWA 4LSVL 3VGAC 4L3EA 3FOMA 4U1LA 1F00I 3GJFA 4XX1E 1JGUL 2C3GA 5F7UA 5I1HH 2FBOJ 5I8EB 2IANB 1NEZB 3HE7C 3QCUH 3EFDH 3WLWD 4F3FA 4NKDB 1A02N 5C0AB 1WAAE 5IJVB 1CVSC 2AXGB 1F5WA 2HH0L 2PYFA 3LIZH 2Z92A 4V1DA 2AK1L 4WW2A 4N8PA 4R7NA 2R2HA 2ED9A 1LE9B 3B5TA 1L0XA 4I0CC 5FIEA 1EGJA 1FZMA 1KNOA 4KDTA 3V4PH 1QFPA 4HZAA 1MUJB 4GKOA 2E6JA 3WE6B 2DKMA 3X14A 3QQ9D 1SEQH 1U91A 4EDXB 3IU3B 1RZKC 5DURB 3O2WH 2DLGA 4FP8L 5DMIH 2VITA 3EBAA 3BEVA 3RWCB 4M6ML 2BMKB 4I77L 4PJCA 4YHKL 5ALCL 3GSVA 5J4MA 5C9JB 1HHJA 1AGFB 4PV9A 2AABH 4NO5B 1HH6A 4ERSL 1MRFH 3FN3A 3VFOA 3O3EA 4N9GB 4HFWA 4Y5VC 3OAYK 3KLAA 3TCXA 2WQRA 4JRWA 3CDYA 3QQ4A 3KPPB 5E70A 5T33L 4EUPH 1CD0A 2MQCA 3E2HC 4JQXC 1X5JA 4F37K 2BRRL 4JZNA 3RDTA 1RSFA 4QYOB 2HTKC 5FCUH 4YGVB 5HPMB 3VXMD 1T0MA 5J89A 2HG5A 3O9WB 4ZTOH 2WBKA 1IAKB 2D0HA 4TQEH 1JHKH 3E8UH 2D31A 4PLKD 2W38A 4U0RB 1S7WB 1RU9L 1KT2A 4MAYD 4LHJB 4QKXB 5DJ6B 2V5RA 3P0VH 5DI8A 1NBVL 1KTRL 4Z77B 1AR1C 4YWGL 5FCSH 4ZFZB 5FDWA 4ZO9A 32C2A 1J1XL 1S3KH 2AEWA 3OTTA 4R8WH 1UB5B 1NGZA 4RDQG 1JL8A 4XMKL 25C8H 4LVNC 4WWKB 4H25B 4PRPA 4U7KA 3SGJA 3HZKB 1YNLH 1DBKL 2NY3D 2DYPB 2F5BH 2QADD 3RIFF 1PY4A 5TE7L 2MQ3A 3U7WL 1F3DJ 3IVKA 4LCCB 4J2XA 5C08E 2E9IA 5D7JB 2VSCA 1MLBA 4NQXA 4I9WD 2YD9A 4YH6A 3P9MB 1CDCA 3FFDB 4L4JA 3WDIA 4XAWH 3EYSL 4YLQT 2B8OT 2QHRH 2I5YH 4Y4HD 2VXUH 1IRAY 3A6OA 4XVJH 1F4XL 5JPMB 3IGAB 1H3VA 3QEQD 4OCRL 4L5FH 5C08B 1KOAA 2UV3A 3CXHK 4G8GD 1B4JH 4DAGH 3QEGL 3TBVA 5EPMA 1NCCL 2QL1A 4GMTL 4HF5L 2OK0H 4LCIH 4OM1H 4PJ5D 3ZHKA 3CFIC 3GHEL 1JNLL 1PYWA 1YY9C 4MNQE 3TV3L 5HDQH 3QP3A 4OZ4B 3LQAH 2V9QA 4G80B 4HWNA 3MLWH 2VYRE 3DMMD 5KG9A 1UJ3B 3KLDA 4JO3H 4PJHE 4IS6A 5IF0B 5IMOA 5CEZH 4YDLC 5H35A 2BNQD 4TSAH 2VAAB 4U1KB 1EEYA 3WNNA 1CE1L 4TSBL 1OLZA 3BPNB 2ZG1A 5K9KA 3O2DA 1DQLL 1OY3B 4LSUL 4MNQB 5E5UB 2ICWB 5BQ7A 5IR1A 4PJEA 3VWJA 4R0LB 3K46A 1S7RA 3HI1A 1GC1L 4FZ8L 3QRGL 1CD9B 3UTSD 3H42H 5D6CB 4PJHB 3UBXI 4W81A 1YEKL 5BJTA 2KPNA 4ZYKA 1R3JA 2R1XA 4NQCE 4RAUA 3BMWA 1KB5B 4GQ9H 1N0LA 1G0DA 1TCRA 5IVOA 1AXIB 3GBML 5TGBB 3GIZH 4XB7A 3UCRA 3MRKA 3RFZC 1PQZB 3QZWG 3BSZL 1IEHA 1ZANH 1RZFH 4N9OB 2VUYA 1K9TA 2OMNA 3NA9L 5I16B 4NQCB 5SWSE 5IVNA 2EIDA 4IIQB 3JTTA 3MJ8A 2RQ8A 3TJEH 1CR9H 1MJJA 1YMMA 4AMKH 3CK0L 4PUBL 3PP3K 2O61A 3N0PB 4Z7WE 2BJMH 1CXEA 2GCYB 3HE6A 3GSXA 5CEZD 5I76A 1RZJC 4Z0BL 4CN1A 5D2NC 5EU6D 4TOYH 4NUJB 2CO7B 1BBDH 3OBAA 5TDOB 5IMKB 2Y06H 5D1XA 1QEWA 3EZ8A 2RR3A 1M05A 1CQKA 1C7SA 1F4WL 1RUPL 5HI5D 1NUNB 5SWSB 5CZXC 3LKPB 2ICEA 5IEKA 2DLHA 5J0BA 2GTWA 4JM2D 1QOKA 4Z7WB 3VFNB 4WFEE 3O4OC 1FYTD 3O8XA 5DHYB 1YUHA 1FVCA 5HYJD 1LO5B 1KTDB 4X6CF 1HN1A 3LEYL 3KJ6L 4UT7L 4G43A 3LZFL 3W2DL 2PYEA 1ZK9A 4GRLA 1T7VA 4U6YA 3HNSL 4KAQL 2V9TA 3WFBL 1ND0A 5DHVH 1IEBB 4P4RB 1LNUA 4N5ED 3BIAX 4KJWC 4D3CH 3IETA 1CU4L 1FG9C 3VG0L 3LV3A 5E6ZA 5DFVD 3V5DB 7FABH 5C3LD 4JO1H 4OUUA 5D2LE 1KCLA 3IKKA 2HJKB 4NZUL 5A3ID 1CTOA 1XCQB 1AKJD 4GRWE 5CBAA 3RVUC 4NBXB 5MEPB 4BYHA 5E1AA 5A2FA 3BAEL 4XWOC 2EDNA 2XXMB 4FQJL 4LP5A 2G60L 4OGXL 1AQKL 3GNMH 1JUFB 3IRPX 1ZVYA 4YE4H 5CBEB 1LP9F 3G9AB 5AZEH 4P3CL 1K8IA 1EZVX 5D2LB 1DE4B 5JXAL 3CFBB 1U8LA 2HFFB 1LQSR 5HYFA 4ODXB 3VI4E 4GRWB 4PGCB 3RKDD 1KELL 1KC5L 1IVLA 1S9XB 2FJGA 3PHQA 3VXNA 1CTNA 2CGRL 1RULL 4XBGB 2D7TH 4OCXL 3UYRH 3BO8B 1WIPA 1G7LA 3MRQA 1B4RA 1QFWM 2VXTH 3BKYH 4KU1A 5GS1C 5HVGB 3MLUH 4X9GA 4WFHE 2XKUA 2BVTA 5HHMD 3O3AA 4JPIA 4N8CH 2JJWA 4G5ZH 3JV5A 1F13A 4QRTB 2KQNA 3EDDA 1I9JL 2EKJA 1KCVH 4DJMA 5KVGL 2R1YB 4BZ1H 1YEIL 1A9EB 4K71B 2GKIA 4JDZB 1I9EA 3C87A 3SJVE 4F2MB 4S1SL 1QSZA 2ATKB 1ZSDB 4IHOA 2LVCA 3WIFA 3TBSA 1QBMH 2WIIA 3OXSB 2LV4A 3SCMA 3QEHB 4HEPG 1N64L 2V17L 1NSNL 4JQIH 3RWGA 2NY4D 5F1SA 5H2BA 1KENL 2JJVA 2EKSA 4RSVA 4PLOB 1LMKA 5D72H 1TPXB 4LIQL 2P8MB 2RFXA 12E8L 3SJVB 1B0GA 2CDFA 2IPKA 5D96C 4UOW0 1NBZB 3STZB 1CI5A 2BNRD 2VTFA 2XKSA 3PDOB 4LSVH 5ERWA 4MZ2A 3CSYB 2Q8AL 1DQDL 4YPJA 5IB3B 2V7NB 1JGUH 3DX7A 3U4BL 1U3HD 3H8NA 4BH8A 4JFZL 3EW3B 3ZDYE 3VDBA 4Q7DA 3CZFA 2Y25A 3IDJA 5DA4A 1P5UA 2FO4B 4OLYL 1F45A 5I2IA 3B2VH 5F9OL 4HKXB 4CMHC 2AK1H 3UTTD 3L3HA 2AV7A 3WS6C 4Z7NE 1CXHA 4LU5H 2L7JA 4LKXA 1Y6KR 4WUUE 1JPTH 4C56E 5JOPD 1CGXA 2F54A 4DKFL 5J1AB 3HC3H 4XNUL 1F3DH 1FVDB 4X6BB 1JP5A 5CIPH 1IM9B 5SWQA 4Z78A 5I8CA 1E28B 4HJGA 4HX1B 4HUNB 3B9VA 5E94A 2CLRB 4TULH 4M48L 5DFWH 4FP8H 1CGVA 3N50A 5CJOL 1AXSA 4EI5D 2ZSVA 2C7UB 1EO7A 4Y1AA 3RWJB 4D94A 4OF0A 4NNXA 4P2RD 3FB8A 4WUUB 4C56B 2CR6A 4UIKL 4XVTL 2AEQL 3UPRB 5F1IA 4OFYA 3Q5OA 2WIMA 4ERSH 2XZCH 3L5WB 4WI7A 4MLIA 2FGWL 5I9QB 1FFNB 1H3XA 1OTUC 1IGTB 4HSQA 5GXBB 1VENA 3CXHJ 4MJ2A 2A73B 4WIQA 4NP4H 4AIXA 4OZGA 4S1RH 4Q9QH 15C8H 3CVHB 1HH9B 3C5ZA 4Z7UF 1FNSL 3GMNA 1M7IB 3MLPA 2D9QB 2ZNXA 3C5SB 1RAMA 1FL5B 4QGTA 4JM4L 4JAMB 1WGOA 3B9AA 1BAFL 3VDAA 1IMHC 4NKOA 1RHHB 1KACB 4Q0XL 2IPTH 3K8KA 5D7IF 5DJAA 2CUMA 1NBVH 2XYCA 2COQA 2Q76B 1RV6X 2C3VB 2ESVD 1BGXH 3BISA 1LK2A 1RZKH 5HDBF 4CGTA 3HUJE 5ELIA 1XF2B 3UTZB 4LOUC 3P77B 1HQ4B 4AYFA 2N7BA 2F53E 1A8JH 4JFPA 2O5ZH 1IKFH 1T04B 5IKCA 4D8PA 2B1HL 4WNQB 5IK3B 3B5GA 3MUY1 5FK9A 4R96A 5JIHA 2XTLA 5ESVA 3I3DA 4KDVA 1ZHKB 2LTQC 3CX2A 4QRPD 4JO4L 4QY8B 1P7QD 4ELKB 1HCVA 4WI6A 1PX4A 3HUJB 4DW2L 4HPYH 4M1CD 2B39A 4OGZA 3T04D 1AQDB 4JN2A 5F9WB 3EYSH 1LO2L 2F53B 5DLML 5GRWA 5DR5L 3LSOA 3QI9D 4UDTA 4QCIA 4X6FA 3D3VE 5CSZA 4N1CA 3QEGH 2IEPA 1HSAB 1RJLA 1NCBL 1SY6H 1T2XA 4U1IA 5A16B 4PJAE 4LCUB 3BP4A 3RU8L 3T2QA 1N2RB 3C8DA 2FD6L 1JNLH 3EOBA 2FEEL 3TV3H 3TO4C 5IG7B 2XA8H 5E6YA 3OB0K 2ITDB 2I25N 3DTXB 2GAZA 5E56A 2GSIA 4MHHG 5CD5C 3B43A 1SJEB 4ESKA 5IOPB 4G8FA 3RPKA 4EVNB 3O0RL 2NTFA 4GAJH 4XPFL 2DWEB 5DRXA 3OKOB 4P23A 3MREA 4WO4A 2C4FU 4ZODA 4PG9B 2OSLB 4PJAB 1DQLH 5FGRA 4LSUH 3L9RA 5EC2A 3D85A 3HAEH 5SX5K 1VEOA 2HFEA 4JPWH 4ZUVA 4KJYA 2VDLH 5BXFA 2BCKB 4YNYB 1YEKH 4O51B 3LRSA 4ZNCD 4YAQA 4YPGB 4PJXA 1U8NB 3QQ3A 3PV6B 4KROB 1MHHB 3HFML 3HI6H 3RTQA 5I8KL 4JFQB 3GBMH 3LKSA 4JY4B 5T1KB 4AEHL 1FE8H 1T22B 1T6WA 4Y4KA 1EUUA 2WBJC 3VFMA 1PKQA 2Q7YA 4R0LC 5JW4N 1MFAL 2ZOLB 4QHUA 3NA9H 3AXLA 3QA3B 5E2JA 1Q72L 5FV1L 2Q7NA 1GZPB 3RUGF 4WJ5A 4KXZI 3RZCB 5ITFB 3WCYA 3QCTL 4GUPA 1W2KT 1J0JA 1YNTB 5T1MB 4MYWB 3ECBA 4RFEA 3U30C 5IHLB 3F5WA 4GFTB 4Z0BH 3HR5A 4NZRL 4AL8L 4DCQA 3CNKA 4MNGA 3VRLF 1DANU 1OWWA 3MCKB 1QR4A 4S1QL 3T1FB 5EUOF 3BZDA 4AIZA 5GS3A 2A6KB 1ZGLM 1WWWX 5FUZH 5F8QC 5HGHA 4Y4FA 1WJ3A 5T1LD 1PBYA 4U3CA 2FJFA 2EZ0D 2GSGB 4FXKA 5CD3B 2BFVL 4TNWK 3KJ6H 4UT7H 1JPFA 4YHPB 1TJIL 1UM5L 5CJBA 1NKRA 4A6YA 3LZFH 3U9UB 1AJ7L 3QIBA 1F11A 4HKBA 3HNSH 1YN7A 4KAQH 3MLSL 4WHYH 3WFBH 4HS6B 1EPFA 3RHWK 4NGHL 4NO2A 4QT5A 2FYYB 4TUOA 4J3WA 3WDHA 1BPVA 4FNLL 4GS7B 1CU4H 3VG0H 1P4IL 1BREA 2VLKA 5T1DH 2HRPH 5C0JA 4NZUH 2PTTB 3DXAD 4U6XA 5JORA 4UOW1 3WMSA 4OD3H 3EOTL 4IJ3C 3MRJB 2BOBB 1DQTA 2YS4A 1JN6B 2X4RB 2K9UA 4FQJH 4KGJA 3R1GH 4FOMA 2OR9L 3L7EB 4UBDC 1FJ1B 1FO0A 5ACMA 5F1NA 2NPLX 4M5YL 3PF2A 3PJSB 3MODL 4P3CH 1FIGL 4NQDA 3OR6A 4G8EA 5F89A 1ACYL 5ICZA 5J6GB 5JXAH 3MR9B 5LGJA 5J9PB 1IJ9A 3DYPA 3WLBA 4LAJH 3BP5A 1KELH 5I1GL 4NJAL 1RULH 1Z9MA 4OCXH 4KTDL 1WICA 5JW5A 1NANH 3G6JA 4P5TB 2DJUA 1HINL 3QWRD 2BERA 1WBYB 1OGAA 2DL9A 4NZJA 5DHXB 3VXUA 2V2TA 1I9JH 3FFCA 4QTIH 5KVGH 2A74A 4L8BA 1YEIH 1H15A 1CG9B 3OKMB 4I0PD 4OB5L 5BS0A 4XNMA 1S7VB 3CZJA 1A4JA 1A1MA 3SDDB 5D7LE 4I18B 2G5RA 3TCLB 3PIQB 4LLVB 4ZPVB 1MJ8H 4U1MA 5SV4A 1FHGA 2P5EE 3H7BB 4PJIF 5DTFA 5ACZB 4M7JL 3JUYA 2V17H 2GJZB 3BH9A 5I71C 5BO1L 5IESL 2HJFB 3MV7A 4M8QA 5KSBA 4RMTA 1HIML 3ZKNC 5EZJB 2UWEA 4LIQH 1EDQA 1K5NB 4PGBB 1BFOA 4L3CB 3SGDI 2OBGA 2LABA 4JFOB 3TIEB 2ICWJ 5D7LB 5HHNB 3AU1B 5E8DL 4X98A 2YPKA 2Q8AH 1DQDH 2P5EB 1GGIL 3MUJA 2J5LC 2ADFL 4RFOH 1FFOA 4APQA 2G75A 4MJID 3PWUB 1UWGH 3TF7C 2WINA 1NFDA 4OLYH 1WT5C 2HT4D 1YQVL 3S37H 3IRZA 3ZDZF 5F9OH 2J8OA 4Z76A 5K59F 4QXWA 4E5XB 3BHBB 3AB0B 1U8HB 2ZNWA 1EAJA 1HNFA 1Q9KB 2X4NB 2ZG3A 3EGSB 3ZO0A 3IXAA 5FYLH 1K4CA 4DKFH 1NGXA 4XNUH 5FKPB 1CDIA 3FT2B 3FONA 4I0KA 1XF4B 4QHKI 2IG2L 1YJDC 4BA8A 3NBNA 4L3EE 3HMXH 4HQQL 1ZT4B 5CJOH 5F6HJ 1L7IL 2D4DA 1CN4A 3TFKC 1LD9B 4MDJA 1EFQA 3VRIB 2VISB 1HXYA 3H7LA 3PP3H 3SKOA 3V0WH 1WWAX 1ZLVK 2AKRA 3U46B 2AEQH 3QFDB 1VACA 1G1YA 4V1DE 3K81A 1JGEA 3OKYA 4KK5D 2FGWH 4PJ8D 3C6LC 4L3EB 3FOMB 3LD8C 3GJFB 4U1LB 3QHZL 3L3IA 1ADQL 4YBLB 4OF3A 3UDWA 1VGKA 1UACH 4HD9A 1CE6A 1DSFL 3IDYB 1UH4A 4F3FB 3G5ZA 3KHOA 4LP4A 1IAIH 3QNYA 4B41A 2PYFB 2Z92B 4V1DB 4WW2B 1U3ZA 5JQHC 4R7NB 4KRLB 4MHHI 3KAAA 4PJCE 2R2HB 2DL2A 2Z31A 1Q0YL 1UYWL 3VW3L 2JIXA 4GMSL 1BAFH 5FYLD 2BHYA 1RJYA 2HWZH 1FZMB 1KNOB 4Q0XH 4U2ZA 5FF6B 5F6IC 2XWTA 2GYSA 4WUKH 1JHLL 4UT6H 5IEHA 2YXFA 3X14B 1U91B 3QIUA 4GO6B 4QXUL 3DROA 1IT9L 1TJGL 3ARFD 2VITB 3BEVB 5DVMA 1FZOA 4PY8J 2HKFL 3D48R 1GPOL 4PJCB 2JJSC 3GSVB 1HHJB 2H1PL 4PV9B 1RD6A 4XVUD 4RGMC 5CP3A 1HH6B 3MRLA 3PGCA 5IJKC 3I9GH 4FQXA 1FVEA 1A22B 5HI3C 3SDXA 3SKMA 1JNHA 4O58L 3VFOB 3O3EB 1HYSD 3PP4L 2WBWB 3C60D 2AQ3A 4HFWB 1MQKH 5IHBA 4LSRL 3KLAB 5I30H 4HFUH 4YR6A 3ZT7A 3HPJA 3AFLA 4O00A 3QQ4B 5HHXL 4D0CA 2NY2B 4U6TA 2UZYB 3UROR 1P6FA 4FXGA 3GI9H 4DW2H 4JZNB 3RDTB 3MBXH 1X5LA 1J88A 5GGTA 5KANG 2AK4D 2EIZA 1LO2H 3C8HA 4K3HA 5DR5H 3GK8L 4P4KC 4MB3A 1T0MB 3KLHD 4PLJC 1KEML 2HG5B 4ZFGH 4LNVA 1CFVL 4GW4A 3DX9A 4XPAL 3QUXC 3TPUA 5TFSL 3QIWC 2D31B 1T0NA 4LDEB 4PRPE 1ORQA 1KT2B 3B9KA 3RU8H 2G2RA 5F7EL 2FD6H 4S1DC 3TJHD 3KJ4C 2ADGA 1H9VA 5DI8B 3HC4H 2IAND 5DQDH 2NXYB 5FDWB 1Q94A 5C0AD 3GM0A 32C2B 3CVHL 5IROC 3K0WA 1U8QA 3FB5A 1FAIL 1NGZB 5TQ0H 3O0RH 3BPCA 4XPFH 5GGSY 1K4DA 1T7XA 3C09B 2VN4A 4PRPB 5DRWA 4URTB 4ZS6C 4V2BA 1U8MA 3IVKB 1JGVL 3N1QC 1MLBB 4NQXB 4LPYA 3ARTA 1LGVA 4IRJC 4EUPA 1G0XA 2C1PA 1X7QA 5DURD 3VFWA 2EEBA 3HFMH 3O6FA 1GHFH 5I8KH 1UENA 5CGYD 5K93A 1FBIL 3ZKXB 2HFGH 2AS5M 2M8XA 1I8LA 3RWHA 4HCRL 2Q3ZA 1L9NA 4JKKA 1I1CA 4F9PA 4K3DL 2EYRA 3TBVB 5EPMB 4R4NC 5EDXA 3ZE2F 1FH5L 1Q72H 3NCCB 4WU5A 2BHUA 1PYWB 4PJEE 3WXWL 3QCTH 4XCEA 5GRUL 5KG9B 5IGXH 2C3XA 1OGTA 4MCZA 5T5FL 4UTBL 4IS6B 4B7LA 1CBVL 3VGGA 5IMOB 4U1JA 3MV01 5H35B 1HYRC 4DN3L 4R4FH 5T3ZL 5DF0A 4AL8H 3S37X 2VN7A 3HCVA 1EEYB 3O9WD 3MRPA 2IADA 5I1LA 4OQTA 4TN9A 5FHBL 5E9DE 4WEUD 5K9KB 4QXGH 5IR1B 5BQ7B 3G5VA 4PJEB 1KSRA 3VWJB 4Z7QF 4Y5XA 1S7RB 5ID0A 3HI1B 5E8NA 1JZ6A 2GIYA 3RZCC 5ICYA 2HLAA 2ZUXA 2X40A 4JDTL 2E9WA 5BJTB 4ZYKB 1A0QH 5ABDE 1R3JB 2R1XB 4RAUB 4IOIA 2FX9L 2XPGA 3FAWA 5EN2A 1CFSA 1TJIH 1TCRB 1UM5H 3ZE0E 35C8L 1YMME 3QZWA 3MRKB 1A7RL 1AJ7H 5DJ0A 1MRDL 5FYJU 1TCMA 2Y5TA 4WWKD 3MLSH 1KTLA 2DYPD 2ZUYA 2JKXA 3M1BA 1MAJA 4FNLH 3ALXA 1F3RB 1MCCA 3FRPA 5D7JD 4O02L 1S9VA 3JTTB 5D7SL 3MJ8B 5F7HA 1RUKH 3UAJC 1MJJB 1YEFH 1YMMB 2NX5A 2O61B 1KB5H 2AQ1A 2DQTL 5CHNA 5CFHA 3HE6B 3GSXB 5I76B 2OR9H 3MUGA 1SVCP 2BY1A 2EDKA 2ZUSA 1PG7L 5D1XB 4D2NA 1QEWB 4LEOA 1M05B 3MODH 4OZIA 3KDMA 2ADIA 2PYEE 2E8ZA 4BM7A 1FIGH 4W68A 5C08D 1ACYH 2YA1A 4ODBD 3R06A 4JVWA 2AI0H 4RX4A 2ICEB 4NN6C 5IEKB 4EJ1C 1UB6A 5SX4I 2GTWB 3GB7A 1HZHL 5I1GH 4GW5A 3O8XB 2NYYD 4POYA 4KZEL 1RJCA 5DC9B 2X05A 1YUHB 1FVCB 3RL1A 5F7KC 1DBAL 1XGYL 4ZO7A 1JBJA 3IU4L 4G43B 1ES0A 5JW3H 2EDLA 1T20A 2F19H 2PYEB 4JPVH 5TDPA 2DM2A 4GRLB 4RAVA 4U6YB 2OP4L 3BKCH 4XTRD 3EO0A 1ND0B 3JBG7 1F4HA 5D1QA 4WV1A 1LNUB 4MNQD 1OP3H 4OB5H 3B5HA 1JVKA 2F58L 1KLGA 3DSNA 3GKWL 3IETB 3LV3B 2RGSA 2HT2D 3NOIA 4R97C 4OUUB 3AGVA 2X89D 1CLOL 4JFXA 1BD2A 1TTUA 2Q86A 3ARRA 2NTSP 3N1GC 5CBAB 3KPNA 1MCHA 3TM6A 1IGCL 2PCPA 4ZDHA 1IC5L 4KTEH 4UAOC 5E1AB 5BO1H 2PNDA 5JMOC 5EIQA 3CD4A 4YXKL 5GS0C 4WTZA 1NFKA 4KKBC 3BH8A 1DUZA 4ORGA 1R0AL 1IZJA 2A6JA 1K8IB 3L3KA 1YNKH 3JWDC 3ZE1E 1EBPA 2BXZA 5E8DH 1U8LB 5L7XL 4DKAA 4NQCD 2ADFH 2YD6A 3ARQA 1MFNA 1VFAA 3CIQA 2D2OA 3PHQB 2FJGB 1BZ9A 5C3TA 3VXNB 4BSWA 4UU9A 3GMMA 3ZSSA 3IDGB 1YQVH 1G7LB 3MRQB 3OJ2C 2IBGA 3O3AB 4JPIB 4Z5RA 1I1AC 3SE9L 3GI8L 4XXDA 5LXGH 4LASH 3PXHA 4IOSD 4C54A 2NW3A 1OSPL 3FHQA 4OAWA 3I50H 3ULUC 4OT1L 3GSOA 4H20L 4IHOB 4GRWH 3WIFB 3TBSB 2WIIB 3T0EA 3SCMB 1I7UA 3D18B 1JE6A 2FIKA 3RWGB 3JVGA 5H2BB 3DSFH 5F21B 5JHDE 2EKSB 3NZHL 3RJQB 3IKCA 2RFXB 5I1EL 1IGYA 1B0GB 2ID5A <