4Y1AB

Immune complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
192
structure length
184
Chain Sequence
SGDTRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGVGESFTVQRRVYPEVTVYPANLLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSLTSPLTVEWRAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title T cell receptor reversed polarity recognition of a self-antigen major histocompatibility complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
total genus 32
structure length 184
sequence length 192
ec nomenclature
pdb deposition date 2015-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y1aB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4y1aB01
3WUWA 1R5WA 1W72A 4WU5B 4L3EE 4WW1B 4QTIL 2VXQL 4GSDH 3MRFB 1KCUL 3QIUD 4JHAH 4J23A 2NW3B 5CWSB 5DMGC 1JCKA 1RAMA 5J6HA 1H0DB 3LKNA 5DJ8A 4G9FB 3M17B 1FORH 3WHXB 3GHEL 1KFAH 2BX5A 2ARJB 1QTYT 4F7TA 3ESVF 1AI1H 5IHUL 1Z3GH 4Z0BL 1PQZB 1YEEL 1T7YA 2M8XA 5DUPL 4KMTL 1KJ2A 3CZJA 3PWLB 1QEWA 4TUJA 5FHAH 1BHGA 3LKPA 1UM5H 5D72L 3EGSB 2EDOA 4PP2B 1NCUA 2V2TB 4LMQI 2NY4D 5D93C 5E1AA 1T89C 3Q1SH 4XMKH 1N8ZB 4K9EH 3SCMB 4POUB 2GJJA 4HH9A 4D9LL 4I4WB 4L4TB 2ADIB 4N0UB 4MJIB 3CGTA 4PR5B 3I84A 3KXFD 1RUPL 1UZ6E 3GMMB 4JY6A 3X3FH 3QCUH 3BKML 1KELL 2FNBA 2DBJA 2H9GA 5T5NF 5HHNB 1AGEA 5KW9H 4K7PY 2GUOB 1BF2A 4O02L 3T3PF 4LLYB 1EO7A 3RL1A 4EI6A 3BGMA 4QOKA 1A0QH 1NGQH 3QYCA 3U46A 2EXWD 4LLUB 2QQNL 3QRFM 2OMBA 4QF1A 4K7PH 3MOBL 4HJGB 1CE6A 3FO2A 1VGKA 3MRRA 5DFVC 3DV6A 3QHFH 5D5MB 5JIIA 1XGQB 1A7PL 3Q3GB 2EDFA 1KLFA 4YUEL 2AP2A 2VE6A 2X1QA 1NBYB 1TQCB 4JRXE 5JOPE 5TQ0H 1Z9MA 3PGCA 3B3IA 4PPTA 4HMCA 2X7LA 4L9LB 4X80L 1EFXB 4R2GC 3CAFA 1WT5A 1BM3L 1NLDL 3L7EA 3IFOB 3MFFA 5LCVL 4F7EB 3BGAA 3PJSB 2A38A 3VXRB 3LKSB 2DDQL 4QXWA 3GB7B 5J4MA 1CR9H 1G6RL 5F9DC 1UACH 3EYVA 3HG1A 3TIDA 4X6FA 5T3ZE 2EDTA 3MROB 1AQKH 2WW8A 1ZLSH 5DSCB 3I6KA 5D1QC 3C08L 1GYAA 2V17L 5AD0A 2ITCB 2Z0BA 2OR8A 4GAYB 3P73B 5IBLC 5TE7H 1MCSA 3RA7L 3SGEI 4JY6B 5C0AD 4XI5C 4MSWA 1QFHA 4YGVA 1J0ZA 4PJ9B 1UJ3C 5AWNH 4BFGA 4HGWA 1AGDB 3U4AA 4P9ML 1MIEL 1KEGL 4M1DL 3IAQA 4HH9B 4MD5A 4IMLA 5HYQB 4X6DE 2ICCA 3LY6A 3HUJA 4OZHE 3HMXA 4EUPH 1UXWB 4PJ8C 1UFUA 2F54B 3OR7A 1QRNE 4L4VD 5KSBE 3TA3B 5D2NC 4G8FB 1R6VA 4MXVF 4R4FL 1NEZG 1SHMA 2HG5B 3VDAA 4YAQA 1RHFA 2J8HA 1XZ0B 3K81A 1I3VA 1JWSA 4EI6B 3MV7E 2DIAA 4QRTA 2IGFH 4WHYG 4P2OD 1J0YA 2NTFB 2ZUQB 1NGXA 1GVIA 3G5VB 3BW9B 1F8TH 1FNAA 3VFNB 1RK1A 3MRLA 1C7TA 4HKBA 4UBDC 4LQFH 4H8WC 3BH9A 3LDBC 4FP8L 3DOSA 4QHNA 1LE5B 3UROR 1N7ML 5I1HH 2FO1A 3NN8B 2RHEA 3OKDB 5DD6B 2KQMA 3ROLB 3VE0B 5CCKL 1UZ8A 2XN9E 4Z0XB 1YMMD 1MRCH 1BZ9A 1KCKA 4W4OC 4MJ2A 3RP1A 3JVGA 5D7IB 3X12B 2LU7A 3QDGD 3MRIB 4JFYB 4V1DD 2BC4B 1ZTXH 5ANME 5CHNA 5IP4A 2HA1A 3PWPE 4DEPB 5I66A 1SBSL 2QEJA 1KENL 3U7WH 3E6FB 1WZMA 2IQAB 1I8MB 1AXTL 1YDPB 3L3HA 3NCYS 2I9LB 5DJXB 2DB8A 4NQSB 2DLIA 3IB4A 1C5CH 4P4RA 4ODTH 2ICWB 3STBA 1VA9A 1NUNB 4NIKB 2XY1A 3ARGD 1PLGL 2IPUG 2GITB 3FFCD 4AG4L 4DVBB 1BWWA 3QJFA 1A7OL 4QY8A 2OXGA 1RJLB 5IFHH 1JL8A 3ALPA 3SDXF 4JG1L 1MF2L 4BH8B 4KKNA 4O2FA 2R69L 2HMID 1PKOA 2DLGA 1CDGA 3DV6B 1QBLL 5I71B 4ZAKC 1XEDA 2NLJA 5TQ2L 2RAMA 5IMMB 1A4KB 1EGJL 4F57L 2FATL 2FEDD 3PWNB 4G7YH 4H88L 3VXPB 2R0WL 5EIQA 3FB6B 3MC0A 4DGVL 1PG7W 2AK4B 2EICA 5EU3B 3K8LA 3OAUL 3QXTA 2DWDA 3NPZB 4Y4FC 1WTGT 5E00A 2ZP0T 1U8JA 4G6KL 1A3RH 4EUPB 1FSKB 1ZLWK 4CMHB 4HS3B 3HG1E 3HI6L 4ZUUA 1JF6A 3IDYC 1E6OH 1FE8L 1OD9A 2AV1B 5FO8B 1L0XA 4UQ2B 4FQJL 1PSKL 4XNYL 1YY8A 2OI9B 3PXJA 4Q0XH 3O2DA 4IRSD 5DTFB 3TPKA 1OCWL 3LPGA 2VLRA 1BOGA 4Y4FB 3QI9C 3BI9X 1NANH 2HJKB 4ELKA 3ILPB 4R7DB 3W81A 1NCDH 3KPPA 3BAEH 1ZVYA 4OIIH 4OGAC 1D5BA 4P2OA 5I75B 1QFWM 4OD3H 5ENWA 2WBKA 4WEBH 2QHRL 4U1NA 4JO1L 4FA8A 3LZFH 4GMTL 1LK3H 3QDJA 4O5LH 4CDHA 2X4OA 4WHYH 4MYWB 1RMFL 4EEEA 4GAJH 4P2OC 5D7KD 3MCLH 43C9A 4UNVA 3VD9A 1T66C 4G6AC 1I9JH 3PDOA 5CD5C 3NGBC 1RZFL 3UYOD 1OWWA 3PWNA 4DGIL 4HMEA 2A6IB 1F13A 2Q6WB 5D71L 1RIUH 4JFZL 4ZYKB 4BH8A 5KSAC 4OV5B 4UZGA 2WIIB 3DURB 3C09C 4WUUE 2DWEA 4S2SB 4Z7UA 4I0PA 4JQIL 1I1AA 4Y2DD 1OD7A 4P2QE 5B4MC 4G9FD 3L7FA 2D31B 2BZDA 1T21B 2XN9A 2XOTA 4OZHF 4UU9A 1A6TA 3V6ZB 2W65A 1GC1H 5DD0L 3IJHA 3WLWC 5I1CL 4XGZA 3H0TA 3GUTA 4PRPB 4ZOCA 2LVEA 2DL2A 1QLEL 3WDHA 5GRJH 2N1KA 4PJIA 1CFBA 2B7DT 5F44A 4Z7QF 4EJ1C 4OD2A 5E2TL 5MEQA 4X98B 5ANMB 1LK2B 1NDMB 3FQTB 4PJ5D 4KJWD 2P46B 3TEUA 4CU8A 3SKJL 1CDCA 2Z92A 1GGYA 1JGVL 1BPVA 3I75A 4UV7H 5E6ID 3KNBB 3NBNA 1FFNA 2VC2H 4EIZC 2AEPH 3DSNA 4MNHB 2VO5A 3DBXA 4RWYL 1CD0A 3ILQC 4BZ1L 4OQTL 1T03H 1WITA 3G9AB 3TT3L 1KNOA 3OKEB 3VGHA 3TT3H 1RJLA 3BKCL 2H32B 4HGKC 1T03L 3DX8B 4BZ1H 4ELMA 5KOMC 3VWJA 4G9FE 2JK5A 3AU1B 4BFBD 4G6FD 1NC2D 4GT7A 3S5LA 4HLZG 3RIFF 1DBBH 1BJ1J 1FV1A 1HCFX 1JE6A 2W07A 5BCAA 2ORBH 2ZG3A 3CSYB 4UOJA 2PYFA 4WY7H 4H26A 5HDQH 4KRMB 1CU4L 3RTQB 4GS7C 3QA3A 3C60A 3MV9D 4OB5H 1NBZA 2X4UB 3FB7A 3QPQC 5CZVH 3NCYP 1KN4H 2VJXA 2AXHA 5GRVL 4NM8L 2W92A 3CXHJ 4WFHD 3BZDA 4OAWB 4HWEL 4KRPD 4ZFGL 4ALAL 1IC5H 2GJ6B 4OZHB 2IBZX 3ARFA 2VAAA 3FT4B 4TOYH 4PJBE 3WS3B 3O3AA 5C09D 3GHBH 1FBIH 2CIIA 3LKOB 4P2QB 5DEFB 3STZB 3MRQB 2PW1B 4RQQA 5FF6A 1LWRA 3MROA 4CUCA 5HVHB 4YHMH 1BJMA 1AQDB 1T2QH 3MRGB 4Y5VA 1ZGLB 1AY1H 4WI8A 3RU8H 1RK1B 4XPBL 4NRZB 1J86A 1YEJH 3ULVL 1RZFH 4PRIE 3BVNB 1D9KD 1I9JL 2VLRE 4PY7A 2LVCA 2YSSA 2EDKA 3S98A 2W0FB 3ARDB 3V95A 4AM0B 2X4PA 1T0MB 1DVFA 5C6TL 4JFPA 4MS8C 1U41A 1OGTA 3ZYZA 2BSED 4OGAD 2QADC 2AJYH 4UT9H 3T09A 2XZCH 3I6KB 1MFBL 4JO1H 3IKCB 4QRRB 5IOPA 2PCPA 3FQRB 4KXZI 1VGKB 4G9DB 3RVXD 4HJJL 4S1DD 3SDAB 1CICB 1Z0MA 2GT9A 3DPBA 5FKAA 2R2EB 4XP4L 3PWJB 1GGBH 2YEZB 3LPFA 2APXA 2VL5B 3V7AE 4P9HC 3SKOA 5JIHA 3L7EB 2IH3B 2NY0C 2ZPKH 2WUBL 4OCNC 4M43H 5J12B 3VCLB 4PP1D 2PW2B 3BQUB 2BCKB 3X3GH 5B8CA 5KAQG 2UWEE 3KYOB 2HJLB 5BZWB 3F7QA 1I1FA 4ZSOE 4QRRE 5HHMD 3VDCA 2VZ3A 5HI5C 1HXMA 1XGRA 4HF5H 5ELIA 2D4DA 5IBTL 4XCNA 3KYAA 3ARED 5F88A 1MJJA 3TT1H 3UXFA 3IFPA 1XFPA 3S4SB 5HYIA 2HH0H 3SCMD 4G6KH 1UWGH 4GMSL 2P7TB 1WZ1L 4WFED 3P11H 1M1SA 1RY7B 4B7LA 3GNMH 5IB3B 3PJSA 4DGVH 1I7TB 4ZAKD 3SGJC 3AY4C 3B2UD 1HYSD 3OB0H 4F57H 2VDOH 1A22B 1EGJH 4YEEA 3TCLB 5DZNA 1YUHB 3LRSB 5T1DH 4MA1B 2DOCA 2OYPA 4ONHA 5MEND 1HSAB 1DBKH 4DQOH 4WCYL 3AROA 5M95B 1FC1A 3ARRA 4NNYB 4P2RD 3DWTA 2NW3A 5IR1B 5C0IB 3VXMD 3CNKA 3ZDYF 1JZ5A 2BDNL 5IJVA 4S1SL 1WEJH 1L4IA 4XC3L 1CQYA 4HUXB 1JF1B 1S78D 4AIZB 1H3WM 4L8CB 3I50H 1XCQA 1E28B 3VFVA 3JV6B 4O00A 4ZUVA 3VFTB 1CDBA 4KUCF 3BW9A 3AREA 2GUOA 3NFSH 3BIKB 5CD3A 1JGDB 1XGTA 4PJBB 3QFJB 2FEDC 3QUXC 4MJ6B 1S7QA 4LIQH 1QSZA 4HT1L 4XPHL 4I18B 3TBSB 4ZD3L 4LGSB 4KK8D 4CBPA 5JHDA 5C2BL 4UAOC 2C3VB 3DO3A 4DUVA 4EUPG 4GXVL 2CDGB 4QHMB 4G8GE 3H9HB 3QQ9C 2DBLH 4ONFL 5IB5B 1J1OL 4AY0A 4NKIL 2Q8BH 1N4XH 2IPUK 3QUZD 1ITBB 1FFPB 4OM1L 1YEHL 4X4XB 5IEHA 2CUIA 3P4OB 1MCWM 4RGND 2NR6C 1UKSA 1YECH 2FJFA 5I8KH 4B0MM 2WBJA 2APBA 2JJSC 2R2CA 3RPIB 1F4XH 4LEOB 1DQQA 4JFFE 3WHXA 5F9WC 2R2BA 3MBEB 4HZAA 4B5EA 4LHUB 5HYSB 2X2YA 2J1KA 1PX3A 2VZVA 5EBWB 4CKVX 2PYED 5HDOA 3C60D 1CDJA 5KN5B 4PRNA 4GAGH 1FNLA 5F6HI 3SE8L 1U3HC 1IAIH 3DGCR 3OHXB 1BLNA 3HS0B 4FXKB 2I60H 3P2TA 4DN3H 1ZE3C 2B5IC 5BVPL 4P3CH 3EYUH 4FXGA 1YUHA 2D3VA 2EDDA 4FG6D 3IXTA 3AAZA 3U2SB 5DQ9B 3KPLA 1EHXA 3V0WL 1IKNA 4XI5D 2XG4A 1OP9A 4M1CC 5F89B 2DTMH 1I9EA 4HT1H 3JUZA 3M45A 3A0OA 4GOSA 4D9QE 3CXHK 4P9MH 2H41A 1X5GA 3O0RL 4OF8A 2FIRT 2X4NA 3RWHB 2D7OA 3VG0L 5B38B 4JM4L 4IDJH 4PD4J 3WEXB 1ZLVK 1I8IB 2X4RB 4I2XA 1D6EA 2VXVL 3BSZH 4J6RH 1HINH 4PJFB 4GKZB 3EYSL 1K4DA 3C8KB 4AYFA 4LCUA 2V17H 1RSFA 1S9XB 3MLVL 4QRRA 1X4ZA 2ZUUA 3IF1B 1AQKL 1OF2B 1B0GA 1P7QB 5KVEL 2XYCA 2IH1B 4L29A 1J8HB 3U9UA 2NYYD 3C9NB 2A9MH 3X13A 2YD7A 1XIWA 1Q9LA 1IL1A 2OL3L 4F37F 2Z4QB 2ADJA 1F90H 3FFCE 4POZD 5BJTB 2XKNA 4IRJC 3WJJA 4JRXA 4HX1B 3D2UB 2ZSWA 1ONQA 5E70A 4X80H 2R0KL 4CMMA 1A1OA 2R23A 4KJQC 3IDJB 3RWJB 1NEZB 4U1KA 3RZWA 4X7DC 2ADIA 4N0UA 2GAZA 3SN6N 2NY6C 3QHFL 4G3YL 5EIIA 4QHLA 5ICYB 2IQ9L 3B9KA 1E6JL 3GSVB 4DKFL 1TJGL 1TLKA 3TZVC 4F7MB 2XA8H 4JFDE 3CDYA 3CFCH 4UINH 2YK1L 4JKKA 1FO0L 2V2XA 4U6HA 2K7PA 1T1WA 5HI3D 4DTGH 1IM3A 1X9QA 4O02H 3QUMH 3DRTB 4FRWA 5KW9L 1T20A 3F12B 1QSEB 4X98A 2HFFA 2HT3D 3E1F1 3LD8B 4YZFE 5IEKB 5BO1L 3KJ4B 3FT4A 4HWUA 2J5LC 4IS6A 1J88A 1HWGB 5ALBH 4O9HL 5BV7L 3GUTB 4JFQA 5I74C 1GGBL 2J7LA 4PJDB 5IFAL 3U30C 3LHPL 5EOTA 3MSPA 1FGVH 1TENA 1T21A 3QO0B 5KANI 1P69B 5GGRA 2ZOLB 5FO7A 3STZA 2R1YB 4GKSB 2X4UA 3FB7B 3M8OL 1U2HA 5D5MF 2XZCL 3IETA 1UM5L 3MV8E 5K9JH 2H26B 2RQ8A 4GS7B 4U33A 1PKQE 3GSUA 3QG6B 4U3CA 4WW2A 2VZUA 4U1JA 3X11A 4NNPH 3TZVA 5KVGH 3S6CA 4PJAF 1U8LB 5E9DD 5I1AA 3OKOB 4PJXF 5SWSA 1RZIA 2GK2A 1OGAE 4Z7NF 2B1HL 1RHHB 2YPVH 3RKDC 3IDXH 5HHME 3VFWB 2AKRB 4QRQB 4CL7A 4M7LH 1IQWL 4ISVA 4KWUA 4XPTH 1IC4H 1EEZA 4HUNB 5E5RB 1CFQA 5C0CA 4U1MB 1FBIL 1MFNA 1N2RB 3LIZH 1Y0LB 5E56A 3WN5A 5EZOH 4K3DH 2J2ZA 2DIJA 3R06A 2VDPH 3RVUC 3JTSB 1DE4B 4QHLB 5ICYA 5JOEA 2P5EE 1KIUA 2GAZB 2M26A 1FVCA 1S7RA 1J05A 1T7VA 4HWBA 5IB2B 5E99H 1UXSA 5JXEA 1C8PA 1FZJB 3EDDA 3OV6A 2YPKB 3MRMB 4JRXB 4P0DA 2JE8A 5DHYA 5CJOL 1RUKH 2FB4L 3JV5A 4J7RA 5EU4A 4URTB 3R1GH 5BJTA 3C2AH 4WTZG 4LCYA 3MUHL 4PGDA 5HYJB 4EN3A 4OT1H 1T20B 2X70A 3VFSA 4CNIB 5EZLB 1UYWH 4YBQD 5T5FH 3VXSA 4PUBH 5TH2B 4TNVF 1IGFL 1TVDA 5H35B 2WBJD 3KLSA 1IGML 3W11D 2R2HA 2V2XB 1F6AA 3BDYH 5MP6L 5MENE 1A7NL 1QSEE 5F7EH 4C56A 1XGPA 3FFCA 1TETL 5I8EB 5IWLA 3VH8A 5HI5D 4RAVB 3MNZB 1NL0L 2XXCB 3W2DL 3TF7C 4M48L 1YY8B 1INEL 3F65A 2WBJC 5GRJL 3WV0A 4JGMA 1QKZH 3C8HA 2F74A 3MV9E 1M7DB 3LRSA 2EDJA 4DAGL 1AFVH 4J3TA 4FQPA 1QYGH 2EXWC 3GIZH 4JO4H 5FO8A 3TO2A 2KZWA 5FYJL 1JWMA 2FGWH 2YR3A 4NQEE 4Q9QL 1TZHA 4H25B 1EO5A 3S36H 1CN4A 1YMMA 4P46B 3FFCB 1YEDB 2W38A 4LSUL 4QCIA 3HR5A 5D71H 2B1AL 2EDNA 3QEHB 4XP6L 4GKNA 5F7DB 1P4BH 3UYRH 4ENEC 2JJTC 4NHCL 1U92A 3MJ8A 2X42A 3TIEB 2W9DL 4KAQL 1ORQA 3MNVB 2RIKA 4YDJB 2RB8A 4TYUA 3QPXH 2DQJH 1AH1A 2YD3A 4HC1H 4MD0B 3V5KB 3QEQE 3TYGH 5KSBF 1RZ8B 5F9JB 1A7RH 4Y19B 5GS1C 5HVHC 4GKSA 4Y4HC 1HN1A 3OGCB 4WEBL 5GS2D 2P5WA 5D7KE 2AXJA 3O11B 3SO5A 3RKDD 3T0DA 2NY0D 2VAJA 4OGXL 2D4FA 4X8JA 3OG4B 4N9GA 1U8JB 4NQSA 5C07A 1S5IL 5D8JH 4LLVB 3VFMB 5ABDE 1XGTB 2YN5A 4PJXE 1MNUH 2IAMC 4RZCB 3MRCA 4Q97A 3LVEA 5JQHC 3FTGB 4HJ0D 2CDEA 4WFEE 5SWSE 3C09B 2KH2B 4X9BA 5DD3L 4WFGE 3BWAB 5IKCB 1FYTE 4P5MA 4XNYH 2G9HB 1ZHLA 5C0JB 3KYKL 1ZWIB 4L9LC 2CD0A 3QFDB 4TUOA 3RWDB 1UEYA 4U7SA 8FABB 1R24B 3VGBA 5SX5K 1A3RL 1ZT4A 4TRPL 4S10A 5J7CC 4M5YH 3RWGB 3P0YH 1DL7L 5IHZA 4LKCB 2C3VA 1HIML 4QOKD 2ATPA 1MJ8H 4O2EB 5T1MB 4FQLH 5F96H 2FZ3B 2RJMA 5D4QA 5EFIA 1NDGA 4X4YB 3B2VH 4R4ND 3QG7L 4L1HA 3WCYA 2E9WA 3EHBD 1NBZB 3ES6A 2BRQA 1CDIA 3TBTB 4D0CB 4U31A 1I7UB 4G80A 1MWAA 4MXWH 4ZSOB 2SEBA 4HIXH 4NNXB 4U1GB 5EN2B 1FL5A 3MRNA 1N64L 5T1KB 5T5NG 5E2JA 5GJSL 3BP5A 2VXTH 4CVUA 3C8KA 3KR3L 5I1KL 4Y4HB 1B0RB 5IV2A 3OX8B 5SWZD 1R3HB 2HT2D 1QSEA 3NN8A 2JJUA 1CIUA 4PREA 5GGQH 5F1IB 1RZ7H 2R29L 4AK1A 2EO9A 1U0QA 1EK3A 1RK0B 1CLCA 3B8SA 3EO9H 5JXEC 4I3GA 4C59B 1YN7A 4DGYL 1HNGA 5IBUG 3TN0D 3PWJA 4N1CA 3RVVC 3CUPA 3BZEB 3U4BH 4XXDB 3KXFA 4LVHB 5D2LA 2YA0A 1GL4B 4KJYB 5GISL 3K4ZA 1JYNA 5SV4A 4KI5F 4TVSa 2E7MA 3PDDA 1AR1D 1MRCL 2IMMA 1OP3K 2FWOA 3GRWH 3O2DH 5CCKH 4D0DB 2FYYB 2X1XR 4P9HH 2AJUH 5F7HA 1T1XB 1MCWW 1OAXH 4TPRL 5DJ6A 4DWHA 1G6VK 4HX1A 4N8VB 4OCRL 4KY1L 3AVEA 3V79C 4N1HB 4IHOA 4PR5A 4YLQT 1Q38A 4DVRL 2AJXH 1I1AB 3FO1A 2KDGA 3ELAT 3FN0L 2XKSA 1XGQA 5DK2B 2BSTA 1LO5B 1J8HA 3QXDB 3LQAH 2DS4A 2P48B 4LDLB 2D0HA 2VUOA 1NCTA 1MREH 1BQUA 1SY6A 3RTQD 3MV01 3VRJA 1I4FB 5JA9A 1IFHH 1FYHB 1FN4A 2YD2A 3FHAA 1NKRA 3PDOB 4DCQB 3GBNL 4LSDA 2NX5D 2F8VA 2VDLH 4M5ZH 2AK1L 2DJ4A 3ORJA 5T3XD 3VXNA 3DUSA 1WZLA 5DK3A 1OAYH 1TPXB 3C5ZD 4H0GA 4I18A 4KDTA 1CE6B 1RZJL 1UT9A 3LN5A 3N1PC 1CK0L 3MR9A 4YPGA 3BZEA 3UZQA 5MHSE 3FHQA 2BVPB 3B3IB 5H2BA 5GZNC 1F6LL 2HTLC 5HHOA 5F6IC 4FTVB 4U1LA 4GO6B 1A8JH 3MODH 4L3CB 3WFDL 5MHSD 4PREB 4ZNEA 5ERWA 3OAYK 5I19H 5AZ2L 4ODWB 3C08H 1P4LB 4OKDA 5F1SA 2AJUL 4LSPH 3VD3A 3VA2C 4EVNA 3DHJA 4QO1A 4OSUH 3X14A 4KVNH 2F15A 5F3BA 1UACL 2XQBH 5IB1B 3HHRB 5JO5B 3RI5K 5T1KA 2Y1VA 3EGSA 3T0XA 3ZT5A 1ZGLM 4HS8L 3O9WA 3U7YL 5LCVH 3IFNH 3ULVC 3QUXD 3C6LD 1VFBB 4BA8A 4OLZH 3PUCA 3BIBX 4P2CG 3T0EB 4HHAB 4PS4L 2DQTL 3U4BL 4MA1C 5J57B 3EFDL 3SDAC 4ORGA 5TDPA 1HKLL 5IV2B 5DVOA 3KS0J 4PJIB 5I18L 4QRPB 2ZG1A 5CSZB 5BVJB 5HHQB 4G42B 1DQMH 2KKQA 3LKPB 5I6XB 3L5JA 1S7XA 5I0DA 3DX9B 4ODVH 3PE9A 2XZQL 4Y5XB 3VD5A 4MAUL 5ADOH 4XNUH 4D0CA 4P5TD 1D3CA 2HLFD 4XPFL 1YEFL 3TNMA 2P24B 3KR3H 5AYUL 4OFKA 5ICXB 4QRSB 1P5UA 1N64H 3DX7A 3P0VH 3HNTH 4BFIB 5KZCB 3MV11 5K9OB 2LU4A 1U93A 1HH9B 2QSQA 4KJPD 5FM5M 3DURA 4YXKH 3EDFA 3MACL 3OJ2C 1WF5A 2QKIB 4GW4A 2YUZA 4GG8B 1K2DA 2AQ1A 2BCKA 4IMKA 1YNLL 3HE7B 2Y23A 4PYHA 1AKJB 3B9KD 3A6BL 3X3FL 3ME0A 3CIQA 4WWKB 3K0WA 1MJ8L 4PRDB 1NCWL 4U6YA 5F7NC 5I73C 5ITFA 2QTEA 2QJDA 4PGBB 1BVKA 3NGBB 3DV4B 3G04B 1JWMB 3P0YL 1C5BL 3GMRA 3N9GH 5J9PA 1JHKH 3MUZ1 4FQIL 1C12A 1DVFD 1FGNL 1NCCH 3T4AA 3RNQA 5I1LA 4U6VL 3P77B 2DQUH 3JUYA 1MLCA 4KMTH 5FUZL 5DUPH 1S9WA 5IHUH 3D85A 1AI1L 3H3KA 1HSBB 1CBVH 5IHBA 1VENA 4JZNB 4PLJD 4X83A 1R5VB 5D70L 2AABL 2BY0A 3MNZA 3SY0B 4GG6A 2YPLA 1B6DA 2XG5A 2JB6A 1IC7H 4Z5RB 2HYMA 2KL6A 1KCUH 1E4WL 3KPOB 2AEQL 1I75A 2GYSA 4JVWA 4KTDH 5D8JL 1T4KB 5HDLA 5DVMA 5B3JE 1NGXB 4OIAA 4M7LT 3CU1A 4P57A 1U8KB 2EECA 3EYFB 4RAUB 2DYPD 2PO6D 3ZTJG 4YWGH 5JW4R 5B22A 4WVRA 5I76A 1J9CT 3RX8A 3DUSB 2PTUA 3TYGL 5HYJA 6FABL 2DQJL 3CVIL 5EUKA 2UY7A 1O7SA 1QFUH 3ZSSA 3JWOL 1QPXA 3O2WH 4R97B 3S35L 2R0ZH 1BFVL 2PXYA 3T04D 1UCBL 2PYEA 2X1OA 2W9EL 4I2XE 5GHWL 5DTFA 3EDJA 4UDTB 1OAQH 4S1RH 1KIQB 5L2JA 4PJ7E 3HR6A 4ACPA 1CL7H 5EB9A 4YHLL 2CLRA 3C6SB 4Z7VB 4Y4KB 1C16A 3GIZL 4M4PA 3QFJD 2NY5H 2NZ9D 3O8XD 4R97C 3CXDL 4X6DF 4AEHL 5I15L 4UOW1 2E27L 1AD0B 2XIDA 1ES0B 4HEPG 2GJZA 2Y06H 1M6OA 1EVUA 2ZOKB 4HC1A 5CLTA 3FQWB 3BJLA 1CLZH 2AK4A 2Q8AH 4P3DB 2E3VA 1L9MA 1Q94B 3W2DH 2FHBA 5DJ0A 5IIEA 3MBXH 5CUSH 3L3JA 3K4DA 4CJ0A 5JQ6L 3HZMA 5I8OH 4DUWA 1J1XL 1EFXA 3FB8B 4X6EB 4YNYA 2J88H 3GSQA 1UVQA 3WJJC 3QWQB 4HKZB 5MP6H 1JGUL 1QLFA 4XBGA 4WNQA 1IGMH 2HFEB 3HLAA 5F3HA 4OTXH 1IGFH 3BOVA 3KGRA 4PUBL 2BXZA 4DVBA 1OSPL 2GITA 2J6EL 3KPSD 5D93B 4JFHD 1JNNH 1TQBB 2OS7A 5GRVK 1RUKL 2IALB 2WP3T 4CVWA 3VI3E 4XCCH 2O61B 1ZEAH 2VH5H 5HHOD 4TSAH 4NUJA 5I16A 5DMGD 3T1WA 2IC2A 1V7NH 1D9KB 1K6QL 4QXUL 4L3EA 1HHIB 5CJQL 1M71B 2OJZL 4PG9B 3S96B 3N85L 2CRMA 3BPCB 3NA4A 3KNBA 2VDPL 2YBRB 1GCFA 4YK4B 4K3DL 2NTSP 1G9ML 2DMBA 3LIZL 3D6GA 3IU3A 4Z0XA 5DMYA 4YEFA 3SCMA 1MVUA 2H6PA 4MD5B 4P46D 2ESVE 4NUGL 3G5YA 4DK3A 3FQWA 3BT2L 5IW1A 2EDXA 3QJHB 1LO0H 4PJDA 5C0DB 2VDKH 3CU7A 4GFTB 2B1HH 4L4JA 1HH6A 3KPRB 5FYJU 3RX7A 5IW3A 5JNYB 4OZIA 6CGTA 1GOFA 4Y1AA 2VLKA 1EV2E 3QT2A 1YQVL 2E8ZA 5C7XL 4R2GB 4NNPL 1VPOH 3PWVA 3NCBB 3VXUA 4KI5C 4RFEB 4POYA 1RULH 1Q72H 4TVPH 2JTDA 3KYMA 1F3DH 5E8PA 4FQ1H 4UDTA 1E27B 1IM3B 1BAFH 1OB1B 3SJVE 4PV9A 3GSNA 2XWBB 4GKZA 4CMMB 4PJ5B 4JRYD 3GMOA 1KACB 2CPCA 4Q58C 1FGVL 1FFOA 1A7QH 1U3ZA 3PGDB 1EAJA 1IGJA 4O9HH 3HMWL 1LEIA 4TTDC 3U0PB 2B4CC 2VDNL 3I85A 2YD5A 1OSZB 3QHZH 5AUMA 2YS4A 4LPWA 1A4JA 5KSBB 2EXYC 3U9UB 1NBVL 1XGUB 1JRHH 2NY3C 1B88A 4F8QA 1KOAA 4HBCH 4JZJC 4U1NB 2F58H 4JPVL 4CU7A 3ZHLA 4H5SB 1VFAB 3QCTH 3QUML 3VFOB 3D3VD 1G7LB 5EBMB 4FXGB 4DTGL 2EKJA 3MLRL 3GSNH 1YC7A 4K7PX 1TZIA 5DJDB 1KULA 1OAKH 5L7XL 3ILPA 3TV3H 1B2WL 3VXMB 4W6WB 4GLRI 1QSED 2DQHL 3EOAB 2VIRB 1OAUH 4RGOH 4B7IA 1TJGH 1OAZH 1OF2A 1P7QA 3H8NA 3SDDC 3C5JB 3ZKXC 3MCG1 3HRPA 4YBQC 4M6AA 4HBCL 1MELA 4ODXA 1U8IB 3DJ9A 1F2QA 4UQ2A 1NBVH 3SDCA 1MFCH 1AO7B 3DETC 4FQXB 4G6JH 3P9LA 3FONA 3P4NA 5I66B 4PJGF 1N6QH 4JJ5A 1S7UA 3L3KA 3MV9A 3HMWH 2EYRA 4QRUB 4WIQA 3ARFC 3EOTH 1LP9A 1J5OH 2ZNWA 4Z76B 5I1JL 1QBMH 4M6OH 5IW6A 5DRWB 1IKFL 4G43A 3VRLE 4KI1A 1Q9OB 4YHZL 5E9DE 1H8SA 1Q72L 4F7CA 3K1KC 5ESAB 4CVZB 2VXVH 3BSZL 3RGVB 3ECBA 4U6XA 1UM6L 1ZVSA 2X4QB 4QWWD 4JM2C 2AGJH 1ZHBA 1E27A 3BO8B 1B0WA 5FGBC 3DXAA 2OBGA 1BQHG 2EDRA 4P99A 4MDJB 4NN5B 3NABL 5KVFH 2OTPA 2P43B 4K2UL 3AXLA 3NCJH 5MI0B 4YIQB 3GMOB 4YE4L 3L3OA 2WIMA 3MLYL 2VLKB 4JRYE 5J1SC 2P24A 2ZKHH 1UC6A 4OFYA 1KCLA 2NY3B 1NMAH 4P4RB 5CGYC 4WUUD 4R9HA 4RFEA 4P3CL 3BXNB 2FH6A 4K07A 3TLRA 3DYMA 3OJDA 4WO4C 3MLUH 2IPKA 4PJ8A 1IAIL 3PWLA 2P5WD 4OLYL 1AGCB 3BH8B 3O6FD 3TBVB 3IU4L 1DZBA 3T4YA 3TYFB 4PJXA 5SX4I 1HCVA 1QRKA 3GSNB 4X6CF 5HHMB 5C0DA 1X5JA 5E1HB 2ADGB 3AM8A 3OKKB 3RVUD 1CFNB 5CAYB 1OLZA 3BUYB 3HNSH 8CGTA 3LEXA 1JNHB 5E5MB 1F4XL 1M71A 3NMEA 4FQXC 2WK2A 1JNNL 4LPYA 1TQBC 1UM4H 3LV3A 4U1IA 4QRQA 4UB0L 4WW1A 1YECL 4LK4A 5I8KL 1R5WB 2J6EH 4JG0L 3GGWB 4E0RB 2YPKA 1VACB 1YN6B 3QIBB 5J0BA 1N6VA 2CMRL 5ICZB 5I1AB 1INDL 3SDAD 4QNPE 1SMAA 3OSKA 3QEGH 2DBLL 4U1SA 4YC2C 4OM0H 5T33L 5SWQB 5JPMA 2EEBA 3U83A 4Y19D 4LASL 5HDBF 1HE7A 3KLDA 1I85A 4ZD3H 1DEEA 2Q76A 3MX0A 4XPHH 1NANI 3ZHKA 4NFDA 5GGRB 2VE6B 1KPVB 3MCKA 4L5FL 3S9DB 3ULUC 1CI5A 1BBJA 1E4XH 1MCLA 3RIAF 1KPRA 2F19L 15C8L 4DCQA 5D7JD 3MMEB 3TO4B 4UILL 3U48A 5CGTA 1BWMA 2HN7A 4M7KH 3WFBH 1UEMA 1VEPA 1JWUB 2HJLA 1KIRB 4XWOC 5ACZA 4IRJD 4LNVA 5LAXB 5KS9B 4P3DA 1WEJL 3OKOA 4RFOH 3LRHA 3HI1B 3QUXB 2VDML 3RNKA 4DN4L 1EZVX 3KPNB 4S1RL 2H9GB 3B83A 1FRGH 5DD1H 4Z7VA 2W9EH 2EKSA 5E9DB 4CN4A 1N5YH 3ZDZE 2G2RB 1UCBH 5D7JC 2DD8L 2ZOKA 3WJLC 2DQDL 5FKPA 3DYOA 1M05B 4OI9A 3EFFB 3G6DH 4YBHA 1D5ZB 2MMXA 3EYVB 5L8JB 4D9QD 1RVFL 2EEDA 1MFEH 2EH7H 3LN4B 3IJYB 4ZODA 1OM3H 2X1WL 1BX2B 2E8YA 1T0MA 2OK0H 2XXMB 1D7FA 1JHTA 1FC2D 3DMMB 4WDIA 3DVNA 3GBMH 1JV5B 3B6SA 1CICC 4XP5H 3NCMA 1CD9B 1E4XI 2ZCLH 3IKCA 2GJZB 3KLHC 1KSRA 2KPNA 4N0YH 3H9SE 2PW1A 4Z95H 4RISL 3FO9B 1KJVA 1TXKA 5E2WL 3ZKQD 4N0FA 3IXAB 4JM2F 1E4WH 1U8KA 4JPWL 5EU7C 1U91A 3X3GL 5C0CD 1MOEA 4UIKL 4XBEL 1IC7L 3KPSB 2JIXD 1T1XA 2UYLA 1R3JA 1F3RB 2XACC 4LBEA 2HLAB 2FWOB 1GZQA 1N26A 4PJHE 1RURH 1S7VA 3GMQB 5D2NA 4JFFD 4L1DA 1WWAX 4JFPB 3NTCL 4KZDH 4KC3B 5FF6B 4HJJH 4P3WA 3LH2H 4NZDA 2DQUL 2PXYB 4U6VH 3L5XH 3OXRB 2A73A 1FGNH 1T1YA 2WINA 3N9GL 5IT2H 3P4MB 4KK6C 1JFQH 3SDYH 4ERSL 1ZMYA 2LAGB 4JGUA 2EO1A 1TJHL 1OTUC 5C9JB 4I5BA 3P40A 4Q6IA 4ZDHB 4MDIA 2VLJB 1J10A 5I1EH 4WFFD 3U4EA 5M94B 2XRAH 4LSVH 3NIFE 3RWGA 1S7TB 5MEOB 3GMRB 2P45B 2BVTA 3KPSA 1WAAA 3EJYC 5GRWA 1T2QL 5ETUB 1ZT4B 4OUUA 2G5BA 3C60B 3D87B 3QXAB 1FYTD 3HZYB 4Y16D 5D1QD 1KPRB 5GGSY 1IILE 1X5AA 4OGYH 3FB5B 3G6JB 1A4KA 1A3LL 4TOYL 3R0MA 3RBSA 4NC1C 4U2ZA 5ADPH 5HXMA 2IALA 2QSTA 4PJGA 4ALAH 2F5AH 4NO0D 4HWEH 1QO3B 3IFLH 4XNUL 2AVGA 3LN4A 4LLDA 1R5IA 3BKJL 3UTTE 4NM8H 1H3VA 3EAKA 2CR6A 2FJGA 2IG2L 5SX4H 4C56D 4XAKE 4QXTB 4R96A 5EUOB 1BZ7A 3PL6D 4OCLC 3QUZC 2CLVA 1CD1B 1HKLH 4RMRA 3LV3B 4U1IB 3PG2A 4IMKC 4OLZL 1F11B 3OTTA 1DQLL 5K9OA 2JB5L 1CFSA 1D6VH 3PQYA 4R7NB 1NGYA 3GJEA 4GW1B 2XQBL 1ORQB 3E3QE 1MCPL 3HA0A 1S9VA 2EIZA 3MNVA 4GUPB 4Q9BA 4N8VG 4B41A 2ED8A 5C0FB 1FZOB 5GRUH 1K2DB 4N5UA 3SCMC 1WC7A 1VCAA 5H37G 1DDHB 5T1LD 2DI9A 2YUXA 4R7DA 4G42A 5DRNB 3MODL 4UV7L 3H3PL 4PJ7F 5F3BB 4PY8J 1S7TA 4AENA 5C0IA 2IAND 1BVKB 3BRFA 3GKWL 3VG9C 3QH3B 4NDMB 2F53A 4XHJD 1VERA 5L6YH 1LDSA 3PWPD 4NQTA 2D9QB 4P5KA 5HY9B 5C9KA 1G7JB 1OTSD 3W39B 2V5SA 4X6DB 4NKDA 5LWYH 1Y6NR 1J11A 2QSCL 3EJZC 1U58A 1JGDA 3MUGB 5I30L 3MXWL 3QDMD 1CFTA 3B5HA 4JE4B 4PRHB 1UWEL 3V4VH 2H3NA 5BZDB 1JYXA 4K23L 3T0EA 4WO4D 2DKUA 4LPCA 2XV6B 3CFIC 4OKVB 2OCFD 2OTUB 4G8EB 1K9TA 4TSBL 5B3JF 2IANA 4NJAL 5KZCD 5JXAL 1ZAGA 2NXYB 1RIUL 4DJMA 3NCFB 4LHUG 4XNZB 4ZQKB 3AS2A 3U6RB 2V7NA 1CXLA 1GPOL 2ZUYA 3LRGA 1KB5B 1D9KC 5CILH 2EYRB 4QRUA 2EDLA 2PTTB 1ULVA 1NCNA 1JPST 2NY1C 2HVKB 4KY1H 4DFHA 4OCRH 4OZGA 1X6LA 4N90E 4PJHA 4MXVE 3RZCD 2XZZA 1RMFH 4EI5D 3VD7A 3B6SB 1VFBA 5JHLH 2LTQB 1ED3B 4GMTH 4JM2D 4XAWH 5H8DA 3FOMB 2B8OT 2B4CH 2YC1A 2I5YH 4PGEB 3BMWA 5EU4B 5GISH 3HI5H 2R8SL 4U1GC 3FJTA 1KJ3H 1P4LA 2XPGA 5FCUH 1ODAA 3MNWA 4LU5L 1EO8L 5ISZB 4HWZA 4PJ9C 4L8SB 3SGKA 1D5XB 1S7RB 5INDA 3MRPA 5EU6B 1WC7B 3VRJB 4Q0XL 3QAZB 1H3UA 1X44A 3DRQB 5GGQL 3IT8D 4RIRA 1CXIA 1F6FB 1XF4B 1T6WA 3KS0H 4CVZA 1UH3A 3MJ9A 2XWTA 2W0PA 4UOW0 3HAEH 3LCYA 1CF8H 2EE3A 2XQYK 1U95B 3QZWA 5D1QA 4HIXL 1CG9B 2YRZA 4LAQL 4M8QB 2LQRA 4LEXH 2GKIA 1EUUA 2CDFB 2DLFH 4XRCB 3MMEA 4MJID 1P1ZB 1A6VH 1XR9B 4P23A 1LP9B 3QG7H 2AK4E 4JANA 5FECB 1DN0B 4JFHE 4LHQB 1R3LA 5C2UB 1MRDL 3QXUA 3IDMB 3QP3A 4FQLL 1MI5A 1MRDH 5TQ2H 4F3FA 1H8OA 1DVFB 1BVZA 3L3HB 5HGHA 5HYJD 1EMTL 5JPMB 3EYQC 5GPRA 1YYLL 2FGZA 1MAML 4Q9CA 1A6VL 1ZANH 1MY7A 2APTA 3L3DA 3SKMB 4BZ2L 2RCSL 4FQHB 5GS2H 2FHCA 4K7FA 4RMWA 5EC1A 4PLKD 2V5MA 2ICEA 3H9SD 3SBWC 3MRIA 1SEBA 4NZTH 4O58L 3V6OE 5B39G 1CXHA 3CPLB 5TDPB 4ZS6D 4KDVA 5HHPA 1MHCB 3F7YA 2CIKB 3ARGB 3PL6C 4Y2DC 2W0LA 4NSKB 4RWHA 1ZGLP 1KJMB 4PJIF 5DHVH 4K94C 1AXTH 2Y5TA 4LKXA 5DC0A 2I9TA 2KBGA 3EO0B 3OXSB 5BOPA 4OFPA 1KENH 3RDTA 4F7TB 1FVDB 4KZEL 4FHBD 4LU5H 1ROWA 1S5IH 3U0PA 5JW4M 1NDGB 5K9KA 4OI8A 2NY5C 4PJCA 4Q9RH 2I07A 4U7MA 3RPKA 3G6JE 2X40A 3VW3H 4ZUWB 1OY3B 1DP0A 3VXRE 2B4CL 4FFVD 4U1KB 4XAWL 3VFMA 1SEBB 4LSTL 1L6XA 4GLRH 1YY9D 1VDGA 3MRNB 1FL5B 5I1HL 1N59B 3BWAA 4FQ2L 5D6DC 5DJAB 3DX8A 3EJYD 4I0CC 4P4KD 4ELMB 5IQ7L 3QPXL 4QRTB 3H6JA 2W9DH 2JKXA 1WZKA 3IDMA 4KAQH 1FNGA 3CCHB 4V2BA 3F7VA 4QHKI 3VXUD 4Y1AB 1JPGB 1P4BL 5KJRH 5HGHB 4IMLB 5C07B 3UTSA 1ZWIA 2VDQH 3OXSA 4LSUH 3GSQB 3VI3F 2VLKD 3BPNC 3MYJB 4NGHL 1MJ7H 4HDIB 4MNGB 5EZJA 3JTTB 4BELD 1DN0A 4FTVD 4JQVA 4X5WB 1BX2A 3NZHH 4LSRH 2EE2A 3U46B 4HG4K 1U8HA 4MZ3A 4LARH 5FYJH 4WFHE 3G6AA 3CPLA 1QA9A 4JO4L 2Z9TA 4JFXA 3RDTD 3D1MC 2QSCH 1QBAA 1QYGL 4HGWB 3PWUA 1DR9A 1AFVL 3NFNB 2I25N 1FNSL 2EKSB 5D5MA 1A3QA 2VKWA 4OLUL 5L0QB 5CEYA 2ENYA 4HS6A 1WFOA 1OQXA 5HD8C 2R9HC 4MNQD 4FQXA 2A6KA 3H7LA 1D5IH 4R3SB 3WD5L 2R4SH 4M48H 3PXHA 5E8OB 3D18B 3WHE1 3FQXA 1OT2A 4XMPL 5IBUB 3HI1A 3QUXA 2YOCA 3VI4E 3MRCB 3U0TB 5T1KD 5A2JH 5MEPA 3D25B 4ETQB 4NN6C 5ID0A 3BO8A 2V9RA 3SDXE 4FABH 3FOLA 5BOZG 2BY1A 2VIRA 5C70A 1FNHA 3FOMA 1U8NA 3QEHA 3BDYL 3UDWC 1JNLL 1I1YB 2BNRD 2O5YH 4HWNA 4KDTC 3SE3A 1DBJH 3TZVD 4QXGH 3RVTD 2BVOA 2ICWI 5JW3L 1CR9L 4M1CD 2DDQH 1RZJC 1QUNA 3WIHA 4JKMA 4YDKH 2E6QA 1MUJB 3BN9C 3BGMB 4QOKB 1L6ZA 2F53B 4F15C 2NY2D 2Q3AA 3F6IA 4FZ8H 1H5BA 4UQ3A 3C2AL 3RJDA 4TULL 4JREB 5J13C 5ITBL 3BP5B 4AH2B 4POZC 1NLBL 1H3TA 1A1MB 2R9HD 3VXQA 2W9LA 4HZLB 1CFTB 2VL4A 1BD2E 5DHYB 4IRZH 1N8ZA 1XR8A 5DXWA 4F9LA 4EN3B 5T1MA 2APVA 3WE6A 1JN6B 1IZJA 4OGYL 1ZS8B 5EOCJ 3VU2A 1P84K 1GGIH 4X7TA 1HEZB 5GGSA 1IC4L 4M7JH 1U2CA 3DXAE 4QRPE 4M7LL 2Y7QB 1KCSL 3CFJB 4JLRA 4UBDD 4OJFH 2ZCKL 1RUPH 5CBAB 5I1GH 1QRNA 1C08A 3BE1H 4WEUD 4LGPB 1TJHH 2CLZB 4IOIB 4NZRH 1JFQL 2XFXA 4OCSH 2VLLB 4S0SD 1W0WB 4FFWC 4OKVA 3UMTA 2ZSVB 5GGUA 3WS6A 4MNQE 1MEXH 3QQ3A 1FZOA 2HWZL 4JB9H 2YPLE 1EUTA 5CJXA 5KVDL 3INUH 1U58B 1FLRL 2MKWA 2Z8SA 5IFAH 1YZZA 3QNYB 4GRWF 1RURL 3P9MA 1KFAL 1PYWA 5ALBL 3GHEH 2O61A 4MNGE 1I9IL 3RTQC 2E5EA 3BE1L 4X0KB 3AB0B 4XX1G 3CVHA 4BSVA 5DD6A 2XTJE 3IDIB 4MXQD 4NCC2 1DEDA 5T3XE 5E94A 4OJFL 1J0KA 3D3VE 1LE5A 4JHAL 4W68A 3OGCA 2NY2C 3Q6FB 5DF0A 1WCBA 2Y72A 1GGTA 4RX4D 3QUKA 5BW7A 5EORL 1T2XA 5C8JA 4UV4L 3G5YB 4NQDD 2YK1H 3TPUA 4XNZC 1NAMB 3ZE0E 1ZT1B 1CFVH 2OK0L 2HG5A 1KJ2H 4GQ9L 5DMKB 1A1NA 1VKXA 2BOCA 3HCVA 2VZTA 5SV3A 3O8XB 1E6JH 2UYLB 4JY4A 3BPOB 4X9HA 1BZ9B 3Q6GH 1V8HA 3SKOB 1IM9D 1UZ8B 3HZVA 1NLBH 2DQDH 1MIML 5IK3B 5E2VL 2Z31B 3A6CL 1FYTB 4WWKA 4WO4A 3T1FA 3N1FC 1FLTX 1HWHB 4NN7C 1FVEA 2GSIA 4KKBC 1TVBA 3L5HA 4XCYB 2MPAL 5H2BB 5IM7A 4J12A 2VDMH 2OL3H 5DD5L 5DFVD 3UTZB 4MA7H 4H5SA 2A9ML 2CSPA 5GRXG 4RFOL 1MCQA 3REVB 3BN9D 1ZA3B 5AEAA 4XCEB 1V7MH 4HXBH 3ULVD 1AP2B 1YEIL 2DN7A 3EYSH 3DECA 5I73B 5M7QA 5TFSL 4EQ2A 3W5MA 2IH3A 3WS6C 1T1WB 5CIPH 4JM4H 4NO5A 2CKBB 4NO3A 2FX7H 3O0RH 4P5TA 4D9RE 1R3JB 1Q1JL 1UKTA 5HHXH 4R0LB 4PV9B 4HG4J 1U91B 4JDVA 4OLUH 1OTTD 4RBPK 1FNSH 2BNUA 5DUBB 2VN4A 3EUUA 1RUQH 1GZPB 4R2GD 1FG9C 1INDH 5HD8D 4LCUB 3CMOH 3ISWA 3DHMA 1ZKAA 3TO4D 1MFAL 5IVZB 2L7JA 3QDGA 4Y4KA 1DFBL 1Q0YL 2PYFB 3RDTC 1JIBA 1KC5H 3KPOA 1KPVA 3MCKB 3B9KB 5TPWL 3TJEL 5LG1A 4KROB 5JIPA 5KJRL 2YMXL 2I24N 4HPOL 4PJ5E 1KNOB 5T3ZD 4HJ0C 4XC1H 3EO1A 2GCYB 4LAJH 5IQ7H 5DMIH 2CK0H 4OLYH 1I3RA 1RFDH 2BVYA 3VGAB 3P0GB 1WGOA 4OM1H 2NXYC 1HZHH 1EFQA 2Z93B 1TJIH 4ZXBA 3JBG7 2FBOJ 2Q8BL 1JHLL 3ULSA 3QWRD 4NKIH 4HCRH 1J1OH 1FYTA 1U42A 3T8XB 1CQKA 1R3IH 2A6DA 3K2UL 3OJVC 5JOFB 2A9NH 2FJFB 4Y4HA 3FMGH 1IEHA 1X5HA 2VLKE 2NY1B 5GS1A 3DMMD 5CINL 3OQ3B 3AC0A 4KZEH 2LU3A 4N5ED 1AJ7L 3UZVB 2V7HA 12E8H 1FNEB 4MMXC 5IUSA 4YHPB 4J8RA 4X99A 4PJXB 1SEQL 1IGCH 2DI8A 3DX6B 2XN9B 4UU9B 3SO3B 1INQA 4Y4KD 5CZXC 4IHOB 3TWCL 1TCRB 3DUHA 2LTQC 3PHOA 5E8NB 5E5MA 2A0LC 2FSEA 1NSNH 4LRIC 1TVHB 4F8TA 1S7WB 4R4BA 1B4JH 3DVFA 1IEBB 4JO2L 4L8SC 3DYPA 3W9DA 5CD3B 4LVEA 4MJIA 2D7QA 1FL3B 4PJBF 4S1SH 4ZYKA 1JTTA 2OZ4L 4ZUVB 3GI9L 5I1JH 2RCSH 3MLWL 1DJSA 1VACA 1YN6A 3NFPA 1ZANL 5ACZB 4NHUA 1YYLH 5JMOC 3OKMA 1EMTH 3U82B 1S7SB 5F9AC 3RI5F 3O4OC 2J12B 3H9ZA 3RDTB 3HZKB 5D1XA 3CH8A 4J3SA 2C4XA 1A14L 2XTJB 4PJ9D 1G7PA 1AGCA 3QULB 1K3IA 1W8NA 3E0GA 4KKCC 4XCFH 2I27N 3GNML 3LKNB 3ARGA 4XH2B 2VISB 5I17B 5KAQF 1N5AA 2HTKD 1OAZL 2NXZD 1GOHA 4NN5C 1G7HB 4LAQH 1NGWA 5L2JB 1SYVA 1UWGL 4XT1C 3WSQH 1LE9B 1PAMA 5H94B 3RJQB 2GFBB 4I1NB 2IFFH 3HC0A 4LP5A 3MGOA 5FYKL 4ORZC 3W11C 3CDGA 5F7LB 3NFPB 2E6JA 3ZSTA 4A2LA 4U0RC 2NMSA 4EBQH 2CDGA 5EU6E 2F58L 4P59H 5EZIH 1MHPL 1YEKL 3O6FB 4GBXC 2YA1A 3PHSA 1LP9E 4EI5A 5KSVB 4Y19A 3RZCA 3MYZA 1A6ZB 1FL6A 5ESQA 1DSFL 3CZFA 3Q5YA 4LFHD 3WO3B 2VZ1A 3MJ8B 4LHJB 1NFDA 4WEMB 2CKBL 4NQDA 2A1WH 4PJAA 3SGDI 4XP4H 5DVKA 1D5MA 3VFRA 3D0LA 3PL6B 1SJVA 3H9SB 2I5YL 5A16B 5DJ2B 1JF1A 1BAFL 1F4HA 25C8H 4GRLA 4UT9L 3V0AC 4X4ZA 4JREC 5JHLL 1TZHB 1Y6KR 4G5ZL 2VR9A 3KJ6L 4JPIA 4W6XB 1OTSC 3VI4F 2K1MA 4ZO7A 4HWBL 5EOCL 1C7SA 4V1DB 1ZHLB 5C0JA 4XAKD 5CILL 5KBNC 3GFUA 2MFNA 1H3XA 4APQD 4OCWH 3HE6C 1KTDB 2HRPL 5B8CC 1IZKA 1LVEA 2H8PB 1LO0L 1D5XA 2DMCA 5JXAH 3EO1B 3SDAA 4PJ5A 4FNLL 3FN3A 3U36A 3QIUA 1A47A 5INCA 5GSVA 1TMCB 3BYYA 3DV4A 3SE3C 4L8BB 3MXWH 3PWVB 4R0LC 1TTUA 4I3RL 3HB3D 4NOFA 2X4PB 4PTTB 4ZFGH 3N85H 3MLXL 2QHLA 4ZPTB 3GMLA 4X7EC 1ADQA 1PGRB 2HVKA 4IRSC 4LCWB 3I6LE 1KN4L 4LLWB 1E4JA 3MRGA 4WHTA 4YHNB 5HHVH 4GBXA 2MNUA 3AS0A 3GKWH 1LEIB 2Y6SD 1IGJB 3BGFC 4WY7L 5GJTL 1L7TL 3D69B 3EOBA 4Z7VF 3D0LB 3PL6A 5MERA 1D5MB 3OMZA 5D7JB 4JPKL 2B0SL 3TNMB 4XTRD 2DQGH 1EEYA 4WUUA 2JF1A 1QR4A 3QDME 5L88H 1Z0NA 3HNVH 1F4AA 3TBSA 3MRLB 5ESQB 4EDWL 3TBTA 3SE9H 4HV8B 1JGUH 2GFBA 1X7QA 4KUZL 2JB5H 4I8DA 1RIVL 3C6LC 4NRXB 3BEWB 4M6ML 2AEPL 4MNQB 2VC2L 2J88L 1BD2D 2CRIA 4JCMA 4X7SH 5HVWA 2L0DA 3KXFB 3I9GL 4LKXB 4NCDA 2DKMA 2DJSA 2YSSB 2FEEL 4YO0B 1G7PB 4KKLC 4U3XA 1IGYB 3UBXB 4KJQD 4WENB 1P1ZA 3V4PH 4PRIB 5DGRA 3BKJH 5C0RL 3WNOA 1RUAH 1I7ZB 4NUJB 1WK0A 4NWUH 1DBAL 3O81A 3L3GB 4RBPH 5DD0H 3BH9B 1EBAA 4PD4K 1QLFB 1XH3A 3PDGA 4ONHB 3W0WD 4U1HA 5HHPB 1WJ3A 2CJUL 5CP7B 5FOBA 1U8LA 1KBGH 1XF4A 3V2AR 2XA3A 4H1LG 3ARBB 2DQFB 3UTSD 1WBXA 4MJ5B 3F7PC 3CFEB 4NT6B 5EU6A 3OAYH 4FQXD 2D03L 4MB4A 2Y36H 1VADA 3P73A 4GAYA 2EC9T 1YJDH 4WNQB 1HHJB 3I02B 4Y19E 2ICWJ 1JK8B 3EW3B 4HXAH 2QQKL 4H8WL 2FZ3A 4YHYC 3IJHB 3FAWA 3MV7A 1UG9A 3MCLL 1ORSA 1Y6MR 6FABH 5FGBA 1G0DA 4OD1H 4PRAB 3O2VL 5DJZA 1NDMA 1MCNA 5IIEB 1LK3L 5KTEH 1MAJA 2XTJC 2FX8H 4RDQF 2ED7A 2QHRH 4I0PB 4JHBA 3D69A 3EOBB 1B4RA 2JELH 2QR0A 3DRTA 3SE4A 1WQVT 3MLZH 2FD6L 4KZDL 1QD0A 1R3KB 5IBLD 3MLSL 3MLPA 4OZGF 4ZOAA 4RIRB 2A6IA 2W65B 4KTDL 1A6TB 3LS4H 5E8EA 5D2NE 3ZYOA 4FFVC 4GRMA 1IT9H 4UDUB 5CGMA 4PB9L 5KSAA 1OCWH 3C5ZC 5DVLA 5DJ0B 3HE6A 2AABH 4RISH 5MEQB 3PV6A 4U0RB 4M7ZB 1CBVL 3QDJB 1G7MB 2C9AA 2H3NB 3QIUB 2FD6H 1FE8H 4WV1C 3D39B 5FUZH 3VRLF 1BQLL 4ZTOH 5ISZE 2ZUWA 3LB6D 1CXFA 5CFHA 1N6UA 3NCEB 5D1ZA 2P5WB 5F3HB 1C5BH 4LVNB 4Y5VB 1OM3L 1ZGLA 1QHOA 4HV8A 3ARTA 4OZ4A 1QSVA 5CMAA 1RVFH 1JNJA 1UQSA 3W0WA 5MENB 4OCYL 3NIGF 5GRYA 1GJIA 1CGSH 1KB5A 2B5IB 1LEGA 4G7YL 4H88H 1YNTA 5EWIH 2DD8H 4HFWA 2J8OA 3VWKA 4LVHC 2NY4B 2X41A 1DANU 3A6BH 1U92B 3HZMB 3P30L 5IB4B 4MQSB 2Y36L 3WXWH 1YNLH 3G08B 2J8UA 3S35X 2OTUA 4JVPA 2DF3A 5FDYA 2HJKA 1LDPL 1JGEB 3MACH 4JFDD 4YXKL 1YMMB 2OM5A 2ARJA 5E6IA 2IF7A 5JPNA 1IAKA 5JZ7C 2Y5EA 4AL8L 4HKJA 3MO1A 4K9EC 4NWUL 3WFHA 1XAUA 1C5CL 1WBZA 4MAUH 4WWKC 3FAXA 1YA5A 2AK4D 3GSVA 4OUOA 3KPPB 1D5ZA 1UH2A 3ARQA 1CS6A 3STLA 2AAVA 5CEXB 3MA9H 4NN7B 1MHEA 3T3ME 3I9GH 3NIGE 1SBSH 2HFGL 4MQXD 4LASH 4PGBA 4M6MH 4X9FA 3FN9A 3O4LA 4L4TE 3QJFB 4UI2A 3D18A 5FHBH 3FRPG 1XGYL 2C3XA 4HGMA 1LGVA 1CGVA 1BJ1H 1KT2A 5B39A 1BF8A 3K4AA 4R8WL 5E08L 4KVNL 5C0GB 3QIUC 3C9NA 3FB5A 4LSPL 3T4AB 1XMWA 1ERNA 3DX9A 3HMXH 2N7AA 4GG8A 2B0SH 4LHUD 5AZ2H 2QKIA 4JPKH 3UTPD 4EUPA 4PJEA 1UM4L 4LQFL 3JV4B 2BNRB 2F8XC 2YXFA 1RHHA 1L7TH 3FO0H 3VH8G 3DX7B 5B38A 3WKMH 3QDJE 5ITFB 4PRDA 5HTSA 4ZMAT 2VXUL 1IGTA 5DO2C 3ULVF 1CTNA 1RZKH 2EYTB 1ZLVH 4OBSA 2IGFL 1BZ7B 3O3BB 4J2XA 4HW6A 3MV7B 1ND0A 1MWAH 2NY4C 4U1JB 1XF3A 5IWLC 1IEBA 1QHPA 2DIBA 3L5WA 4A2MA 3KVQA 2H26A 1WLHA 5EC2A 3GSWA 4HLJA 1YDPA 4R4FH 4QHKJ 5CEZH 1KLUA 5C1MB 1NMCB 2VDLL 4G8GB 2VR5A 2VLJD 1A9EA 4NQED 5C0BD 4Y1AE 2Q6WA 5AZEL 4ODHL 5KVMC 2QQQA 5HVFB 4BFIA 3T08A 1NMAL 4X0KA 2ZKHL 4ODUA 1V3MA 1OPGH 1MREL 3HZYA 3NOIA 2XFXB 4PGZA 2HJFA 3T0BA 2AXGB 5C0CB 5IJVB 4M1DH 3QQ9D 3S5LG 3FN0H 1CD8A 2AJXL 4TNVK 5K9KB 3TH4T 2AGJL 3N06B 4TTGA 3WNMA 4GAFB 2ERJC 5J1AA 1EX0A 1T7XA 3T4YB 3TM6A 3KJ6H 4X7FC 5IVXA 4TPRH 4GW5B 3CH1B 3RY4A 1FN4B 5BW7C 4OQ1A 4OBRA 4NSKA 5ETUA 1BJ8A 1S3KL 2GSGB 4MCZB 1G6RH 2HTKC 3PWPA 4YPJA 1RZGA 2UZXB 3CC5A 3DUUB 3PGFL 1HQRA 3EKCA 2ITCA 3EOTL 3H9HA 1CDUA 1EHLL 1TITA 4RAVA 1TIUA 2Q7YA 4RSVA 2AQ2A 9CGTA 3R8QA 1OLLA 3MO1B 5IROC 3T2OA 3EO9L 3QDGB 5TQ0L 4BQ6A 3LKSA 3Q5OA 5ACLA 2WLYA 1A7PH 3PP4H 5FUOL 3BIKA 2P8LA 2C5DC 1H5BB 1CDYA 4JFXB 4K7PL 5A2KH 4OFIA 3IGAA 2PW2A 3BQUA 2HFTA 4XVTL 5FYKH 3OG6B 4AIZA 1NBYA 2DQHH 3MGAA 2Z35B 5I1IL 2C7UA 3CK0L 4HAGA 4MSWB 4YGVB 1ZT7A 2MWCA 5EUOF 5IB1A 1J87A 3WLBA 2OTWB 2ATKA 4ZPTA 2FRGP 3RGHA 2AV7A 4LSSL 2D2OA 2F54E 3GJFH 5DK2A 4Z78B 1A7BA 2CKNA 1JRHL 3CVHL 2GTZB 4KU1A 1A14H 3HG1B 5MEPB 2AJVL 2BY3A 5E9DA 3QUYC 4KKAC 2D9CA 4N8CH 4IOSD 3DO7B 4JCLA 1WFNA 3K3QA 2OR7A 2GCYA 3QCVH 4I3SL 5SWQA 4RRPG 1I7TA 1A7QL 4JFEB 4WI7A 4FFWD 4PB0L 1ZVHA 1T22A 4PP1C 2Q1EA 4KDWA 4NRZA 3S37L 4JFDA 3MLTB 2NXYD 2I9LA 3QEUB 4JO2H 5FHAL 2XI9A 5CJ8A 5DZOA 4NKMA 2C1PA 4LNRB 5E8DL 5GSRB 5C7XH 1KIRA 1IQDB 3BHBB 1RU9L 5FDWA 1MQKL 2YRLA 4XP9L 2VDRH 1SEQH 3ARBA 4OQTA 3DO7A 2BSTB 4YQXL 12E8L 3KYNA 4K94H 1AJ7H 2VXQH 4GSDL 1PG7L 1I8LC 4QTIH 4Y4KC 1MJUL 4KRPB 3FQUB 3QO1A 5JR1H 4X4XA 1R3IL 2Y07L 1G7QA 1G9MH 1Z2KA 4HCRL 1KJ2B 4ZQKA 5C07E 7FABL 3WLBB 4KFZC 3G5VA 3UJTH 3R8BB 1A7RL 5IHZB 3MUJA 2GW5A 5MERB 4DKEL 3GM8A 5DMIL 4P48A 5HYEA 2BVQB 2CDEB 3R0NA 5KG9B 5HI3C 3OKEA 3HC0B 1R3LB 4BH7A 3FQNB 5AYQA 2ESVB 1BZQK 3BD5A 4KRPC 3AREB 1O5DT 1MRFH 1BBDH 3TBWA 2YZ1A 1GH7A 1N0XH 3EDKA 4Z7UE 4BQ8A 4F58L 2ZSVA 1KC5L 1LO2L 5IMOB 1Q0YH 3FRUA 1DQQB 1DFBH 5C0BE 3RRQA 2B20A 5DEFA 4YBLB 2FGWL 2BNQE 1B0RA 2C1OA 2GSGA 2OR9H 4NKOB 2BRRL 4PLNC 3OKMB 4RGMB 3C5ZB 1RUQL 2OMNA 3L3KB 1HSAA 1FHGA 3BP7B 3VXOB 2H8PA 5TF1L 2BMKB 3ES6B 4LDOB 4XP1H 1TTFA 1PD6A 4R90H 3W9DB 5JW5A 3AXLB 3O6LL 3QUKB 5C0EB 3V5DA 4X6BB 5E0QA 5IF0B 3T0WA 2Y06L 3GIVA 3DROB 2AQ3A 3ARYA 3HRZA 3S4SA 3CXDH 2X4QA 3IDIA 2OSLA 1V7ML 2AJZA 1NGPL 2OR9L 2LFGA 5GIRA 4MA7L 3C6LB 2X89D 5BV7C 2NX5E 1U95A 3T0ED 4ONGL 5TDOB 1QFWH 5DRWA 4C55A 3ARGC 2A77H 5DLML 2MPAH 1LO2H 1OAQL 3TJHD 3QQ3B 1A6AA 3ECBB 1XR9A 3CZFB 2X09A 1T83A 3R1GL 1BD2A 5CJOH 4YHIB 1T0PB 4P2OB 1CT8A 3WMSA 1WICA 2YHGA 5LXGL 5E5UB 5DRXA 2ID5A 1NFDE 2BHUA 1UZ6F 2VL5A 4KKBD 4DZBA 4JAMA 3H9SA 3TFKC 3UJIL 1RIHH 2R2HB 5AG8A 1KJ2L 4GQ9H 4WU7B 5BV7B 1QZ1A 5FIEA 4M93B 3STLB 4PJDF 4J1UB 5DDHA 5EO0B 2CXGA 1LEGB 4XMLL 5BRZD 1K4CB 3WBDA 1KTLA 4HIJB 5JHDD 4LHUA 3MBED 4XH2A 4UV4H 3HPLB 5I17A 1WBZB 1KEML 3WFHB 3V8CA 5HVGB 3ZYIA 2XN9D 1JZ3A 43CAB 3SDXB 4WFFE 1I9RH 1L7IH 4KMQA 4Z7NE 5FK9B 1OW0A 3M1BA 3U79A 5TE6H 1DQTA 4PYGA 5TH2A 1BIIA 1OARL 1KIPA 1EEQA 2X4TA 2QV2A 3ZKMC 1ZHNB 3FZUD 4JFOA 4F37K 5D70H 1MQKH 3VRIB 2W60B 4UIMA 4BSJA 4UTAH 3QXWA 5IFJA 1U8OA 3K2MC 4PJHB 5KVDH 4G8EA 5LGHL 1Y18A 2DLHA 5JUEH 2HWZH 5EOQL 3UPAA 3PIQA 4CNIA 1JHKL 2DLTA 1UWXK 3S37H 4P4KB 3MUGA 1S5HA 1AHWA 5K59F 4MCYB 1DANT 4V2CB 1WISA 1UWXH 5J6GA 4RDQG 3SGKC 5EO1A 4X9GA 4I3SH 2F74B 1KN2L 3QCVL 2NY6B 4LPUA 5K93A 3DSFL 4H26B 5J3HC 3U1SH 4L8CA 3FOLB 3IDNB 4W4NA 4EKXA 4K8RH 1P7QD 3TZVB 5FYLE 5JNYA 4OZIB 2Z91B 3CVHH 1Q9KA 1FVCB 1BVLA 3IDYB 1KXTB 1RPQA 5EC2B 1GGIL 3JTSA 3TBYB 3FQXB 3JVGC 1G7JA 3BP4B 1HHJA 3I02A 1WIPA 2DYPB 2PO6B 1HHKA 3W9EA 1VGEL 4KKLD 1FO0H 5I1IH 3O9WD 3B2UC 3CFCL 1PY9A 1VESA 2COQA 1ITCA 3FCTA 1YEFH 1CDHA 2XA8L 4NC0B 2MCG1 5LJYH 5D1ZD 3D0VA 4XPAL 3PQYE 3QJHA 1H8NA 3GSUB 3K74B 3QG6A 4JHWL 4C54A 2WWMD 4G3YH 3VE0A 2CIKA 1UH4A 5D9SB 2R0LH 4JRYB 1MCEA 3T8XA 4P5TC 2ZOLA 4XVSL 1I7ZA 2R1WA 5L2KE 5JDSB 4EXPX 3QQNA 1AE6H 3TO4A 2DQTH 5CJBA 3UC0H 5JOPD 3O41B 3SEPA 1KUMA 1F90L 1JK8A 3KAAA 4HS8H 5EULV 3PGFH 5DJCB 2Q7NA 3L3DB 3SKMA 2EE6A 3O6KH 2GIYA 5JW3H 1WTLA 3UZEA 2QR0B 1I3GL 4HSQA 5IQ9A 4X99B 2VZSA 3BD3A 1NJ9A 3GI8H 2CGRH 1GZQB 4FABL 1TQCC 3LKRA 2NX5A 2VLME 2ED9A 2F53D 4JN2A 4BJLA 1WVZA 4J6RL 4AEFA 3NVQA 2R23B 4J4PD 3VGFA 2WV3A 4I9WE 1FCCA 4LIQE 4N0FB 3D2UA 3QXAA 3WD5H 3T2PA 4KQ3L 1FDLL 1RZKC 3SDDD 3NAAH 5IOPB 4Z6AT 3ALXA 2HFFB 1FVDA 1RZJH 5EIIB 2DI7A 2W60A 4MDIB 3V0WH 4FS0A 2X1PA 1MHHA 3DVGB 1QRNB 5GGTH 1E4KC 4ODSL 3DVNB 5DR5L 5AZEH 2ADFH 1M7XA 2J4WH 3G08A 4LPTA 5ENWB 1Y18B 3JZ7A 4LCWD 1IQDA 3FCTB 2ZSWB 4LARL 4PRID 1U8OB 5CEZL 2A73B 1EGJA 4TVPD 5I71C 3MRDA 3L7FB 3NZHL 2R1YA 4LSRL 3ULUL 1WT5C 3SE8H 3MOAH 4GAGL 3RWJA 1IAIM 4NQCA 1JN6A 1AIFB 3WE6B 1YMHA 4FMKA 1MWAL 3LQAL 1SM3H 5CSGA 4XNQA 2FLRT 2NY1D 4QLRA 5K33A 2VXUH 3P4MA 5JXED 2XNAA 1NPUA 5GSVB 4DVRH 4KRLB 4LSQL 1J12A 3HC4L 1NC2A 3IFOA 3FO0L 3D39A 1ONQB 1NAMA 1MHHB 1OAXL 4NRXA 2QQLH 4AH2A 2EH8L 3S37X 3WKNA 1C12B 2ZJSL 43C9B 2YD1A 3O2DL 1MFDH 3UEZA 5JMRA 3TA3A 3ARUA 4L3ED 5C8JB 2PYEB 1QR1A 3KG5A 2Z31A 3BDXA 4UDUA 2X4SA 4OZFB 5ESAA 1JV5A 2ARJQ 3L1OL 1YY9C 4GXVH 4HK0B 1GGCH 4PRBA 5GS3A 1U3HA 2HFGH 4KQ4L 5HSFA 3HN3A 3QUYA 1D5BB 3UTQB 5A16A 3N1GC 3E6HA 5DMKA 2HRLA 4BQ9A 5DO2D 3VRIA 3TPUB 1RZ7L 5F7FA 2VLRB 4GBXB 3B5GA 1AGEB 1EVTC 1IAMA 5JDJA 2V5TA 1MI5D 3RVVD 4ZUTB 3V7MA 4ETQA 5HHOE 2XT1B 3DBXB 3QRGL 5F9OH 4F9LC 4KJWC 2JJWA 3S34H 1YJDC 1MI5E 1PEZA 4XC3H 1DCLA 1P84J 3PNWA 1T5XA 1J18A 1HHGB 2BDNH 3QIWB 1GGUA 3TIDB 4BZ2H 3UTPE 3V5DB 3EBAA 3BZFA 3VG9B 3BEVA 1L0QA 3OHXA 3UO1L 4P2QD 1CFNA 4K3HA 4HPYH 3LEYL 5T1DL 5E6ZA 3JV6A 2DQEH 3MBEA 1CGSL 3OF6A 2VITB 5B39B 5IEHB 5FO9A 1DL7H 2QBWA 1NBQA 5JO5A 1K8DA 1A6AB 3LS5L 3QUYD 4KKAD 4M02A 2DWEB 4GMSH 4S2SA 5TDOA 4NP4H 1GC1C 4YHKH 4NNYA 5CD5D 4ZTOL 5HGBA 1W72B 3ARVA 2CLVB 5I74B 5JW4N 5BZDA 1MWAB 4M6NH 5SX5H 2OSLB 4RNRB 4RAHA 3RVWC 4PGCA 1OB1A 1V3KA 2OJEA 4PRNB 4UUJB 2I26N 2B2XH 2XY2A 3T65B 3TP4A 4PB9H 3V4UH 1NCAL 5TJWK 1EBPA 4LPVA 1FH5L 4M43L 2DM3A 4O2EA 4KVCH 1OWRM 3O3DB 1Q0XL 3O6MH 2BHZA 4FOMA 4Z7QE 4LCIH 4OLXH 1JJUA 1G9NL 3G5XA 5E2UH 5F1KC 2G5RA 3MLSH 3I6GA 3HI5L 4HIHB 4JKPL 1A2YA 1A1MA 3OR7B 1YPZA 4OLWH 4JY5L 4MXQC 5CKAA 4OFDA 3EJZD 4N8PA 5ECJE 2F5BH 5KTEL 5CBAA 2AJYL 3O2VH 3MJ9H 3GMPB 1SVZA 4RFNC 4HC1L 4EVNB 3MA7A 2G60H 4NFBA 2P7TA 4NQCE 1MUJA 2BVPA 4NHCH 1P9MC 4HXAL 1AR2A 1ZS8A 4XP6H 3ULVE 2XKUA 3RZCC 2X9YA 1GOGA 3QB7C 2H32H 4XVJL 3KYOA 2CXKA 1RQ5A 1EERB 5F7KC 4Q9QH 2VWEE 3VXQB 3ZT7A 1IJ9A 4GQPH 5F88B 1UWEH 5T1LA 5KSUB 3VXPA 3KDMA 1JGLL 1LNUA 3PNWB 1KGCD 1W2KT 3CFBA 3SBWA 2V9QA 4R4BB 5LWYL 4HK0A 1JBJA 4PY7B 2PR4L 4XRCA 5IHLB 1UENA 2OXHA 3S88H 1YNKH 5JPNB 3VMNA 1QPPA 5GGVH 5L6YL 3E6HB 4F7CB 2OP4H 2H2PD 3VXNB 4Z78A 2MCPL 3TESA 5HDQL 5FGCB 4J8RB 2ORBL 3BRGC 4WWKD 1AGFB 3H3PH 5LGKA 4X7SL 3OX8A 3VFPB 1P6AB 5IB4A 3VGGA 1QSFE 4R6UA 2ICWA 5DT1L 1A7NH 4PJ7A 1SJHA 4Y5YB 5E8PB 4XXCC 5DQDL 3BPNB 5DRZA 5AD0B 3P9WB 1J7VR 1CE1H 3W0WB 1I7UA 2R4RH 3P9LB 5DQDH 5MENA 2CH8A 5F7UA 4OF7A 5L88L 1D6VL 5KSVA 1L0YA 1WIOA 2DQGL 1S9KC 3T0VA 1HDMA 2P8PB 3LDBB 5DJDA 4J3VA 2EIBA 1QQDB 3DXAD 4Y16C 1PBYA 4RGNB 3BQUC 4RFNB 4MCZA 3VJ6A 1FQ9C 3SKJH 2FB4H 4JR9H 3ROOA 2P49B 1PJ9A 2OP4L 1S7VB 3GMQA 4DZ8A 1F4WH 5HHVL 1SVCP 5J1AB 4YXLL 2P5EB 5HJ3B 3ZE1F 1ZSDA 2UUDK 4KJPC 1QLEH 4L8DA 2FO4A 4M62H 5LAXA 5KS9A 2PR4H 4C56B 1EHAA 5FOJA 5KSAB 5JORB 3ARZA 4FG6C 4M7ZC 1R3HA 2HLFC 1DBML 3HFMH 4Y2OA 2RGSA 2SEBB 1J8HE 1JZ6A 5J3HD 3HZKA 3KPRD 1KJMA 4JQIH 4A6YH 4W81A 1ZT1A 1JI2A 3B4NA 2APWA 5EZLA 5A1AA 4X4YA 4TSCH 3RHWF 1AXSB 4W6YB 4JFZH 4MNQA 2EZ0C 2HT3C 2YWYA 3IDXL 2YPVL 5D96B 1NFIA 4OCWL 2BFVH 1IE5A 5J8OA 4G8FA 4AMKH 5I1EL 2NX5B 3OB8A 4MNHA 2NW2A 4OLEA 1VFMA 3O41A 4NO3B 3RGVC 4HUKB 2G60L 4NQXA 4P5KB 3GGWA 3HG1D 1YMHB 5J13B 5EPMB 4GAJL 3RQ3A 1T0NA 4ZXBC 4G5ZH 1A6PA 4KTYA 4ZO9A 2NR6D 4O5LL 3SY0A 4GG6B 3D3VA 2F5BL 2JK5B 2VSCA 3LZFL 3MUY1 3M8OH 5IQ9B 3T0EC 4LF3A 3KYNB 2X9XA 3S7GA 4D8PB 3WS3A 3LEXB 3LH2L 4BQBA 1J8HD 1P6FA 3GBLA 5GZND 4DOHB 5JDSA 3BAEL 1G9NH 4PRPA 4OLXL 4IRSB 2P8MA 1G9NC 1FH5H 2M1KA 2A6JB 4WO4B 3T1FB 4JPWH 3ULSB 1MQ8A 5C09A 1LK2A 3FQTA 1YEKH 4X6FB 4PJEB 4UTBL 4JFFB 3GK8L 3TA3C 4Z95L 1P7KA 4OD2B 1PSKH 4JM2A 4M6NL 5IMKA 5D6CA 2UWEB 4KXZH 1QFWI 2ZCLL 1E6OL 3LQMA 4XZUB 1O7VA 3VXUE 1T89A 3BZ4B 2CO6B 4QEGA 4XP5L 1ED3A 3DGGA 3ESUF 3H42L 2X7LB 3O4LB 3WSQL 2O26U 5DUMH 2AW2A 3LN9A 3MTRA 4YC2B 4CU6A 1NFDF 4NRYB 4DKFH 1X4YA 1HOCB 2D7TL 3FL7A 4JFED 4GH7B 1MAKA 2FATH 3ZE1E 3WIIL 1Z6JT 1NGZB 3N0PB 2OTWA 1UADC 1EZVY 4XNMB 2R0KH 1T04B 2UZIL 4EXKA 3BX7C 3S97C 2Z8VC 1P4IL 3O45A 4RMQA 1XF2B 1PZ5A 3UO1H 5FA3A 1FIEA 2BNUB 5DUBA 3H9YA 1P7HL 3AMLA 5I6XC 2FBJH 1E4KA 2FL5A 5FB8A 3U9PH 4AG4H 2OQJB 1B4JL 4HHAA 3OF6D 2V7NB 4XTRC 4LCCA 3C2SA 3FB6A 4M7KL 1SYSB 1LO4H 2NXZC 1NMCC 3TN0C 1HINL 5K9QG 4HWZB 4MX7B 1NC4D 3VG0H 2BOBA 1IGCL 2K7QA 1U8NB 3IDJA 1U8MA 3VH8B 4K3EH 2HT2C 3GSXA 1AO7E 4O2FB 1WCQA 5DMJB 2R1XA 3QWOB 4LLQB 2PTVA 5T33H 1GGCL 4X6DA 1KTLB 4I13B 4Z77B 3HC3H 2DQCH 3C87A 1DQDH 3NZ8A 1C5DA 3TN0B 3WXVH 4F33B 1JHLH 3RL2A 5E8EB 2ZJSH 1KJVB 1QACA 5KSBA 3WFCH 3QUMA 5EA0L 3GZKA 4FP8H 1PY4A 2IANB 2FCBA 4MWFA 2QSVA 1CLYH 4NHUB 5IMMA 3AFLA 3BGFB 2VYRE 3CLEL 3TJEH 3QIBD 5HYJE 1VEMA 4YR6B 4X5LA 3T77B 3RWFA 2YPLB 5D2LF 1LO3L 2Y6SC 5EO9B 3ULUH 5D6DA 2PN5A 1I1AD 1T4KA 3D3VB 4CW1A 1U8IA 2CRYA 4PRAA 3WXVL 2UUDH 1DQDL 4ZUUB 4XNMA 2FDBP 3CVHB 4NDMA 1HH6B 3KPRA 2PNDA 5FFLA 4N0CC 2FJGB 1PYWB 2FL5B 2P42B 5C2BH 1UXSB 5IB2A 4LLMB 1HOCA 4YFLF 4K2UH 2C1OB 1A6UH 3NABH 4K3EL 1DTUA 3MJ7B 4LIQL 3MREA 1MVUB 4IRJB 4ZFZA 3VFOA 1KGCE 1WBXB 4D0BB 3RA7H 3CFDB 1CGUA 1LP9F 4JDTL 1HYRC 4HDIA 1F4YL 4E42B 1NGYB 3GJEB 5TE7L 4WGVB 5D6CB 3UBXA 3TBWB 3VXOA 3AS1A 4I18C 4M9OA 1T1ZA 2IBGA 4N68A 3K7UA 1CXEA 4HXBL 1HHIA 3VXRD 2BNQD 4KI5E 4QWWC 3G9VA 5HYFA 3CFKA 5F70A 5KG9A 1CD1A 3HUJB 1QBML 3O3EA 3JXAA 3BYTA 5DJAA 2JIXA 1UKQA 2P8MB 3QFJE 1MCJA 4QHMA 5DJZB 1SBBA 2V2WA 1BM3H 1NLDH 3CSBA 3DROA 3X11B 4HKBB 2EDQA 4MLIA 4O51A 1QO3A 1Z9OA 3I2CL 5E2VH 1MFCL 1JUFB 4PJCB 1S7QB 1CZ8H 3QIWC 4KV5E 5J6GB 3O9WC 2GK0A 2GI7A 2BSRB 4J4PC 2VABA 4CN6A 3MOBH 3RUGF 1WZ1H 2YA2A 4IJ3C 4QNPF 5CHNB 2W91A 5DURD 2HH0L 3QIWD 5EG6C 1EHNA 3IF1A 4YNYB 3V0VB 3TNNA 3FQUA 4YDVB 4DKAA 3RKPA 5FOBB 1NUFA 3BP6A 2F53E 5IBTH 1NUDA 3GJFK 4B50A 4D2NA 5JLZB 4YX2H 3WUWG 5A40E 3OKDA 4XHQA 4ODWA 2BERA 1ZLWH 3OL2A 3WYRA 5IMOA 1IVLA 4F9PC 3O9WB 3KWWA 4MQ7B 3QCUL 3LKQA 4LLWA 1I7RB 3K1DA 3VFNA 1WV7T 2WUBH 3DSFH 5J89A 4E42A 2ZPKL 5GS0L 1C16B 2NTFA 1HK6A 1U8PA 4F9PA 3CFBB 5E95B 4DW2L 1FLRH 1T80A 2UVFA 5KSUA 4K9EL 3MRPB 5D1ZC 4FFZH 2XICA 2IANE 1NQBA 4JB9L 3V6FB 1MFBH 1IL1B 5D72H 2P5ED 5JUEL 3FO2B 3RY6A 3LN5B 1Z3GL 4Z0BH 4NZRL 5C6TH 1PZUB 3GB7A 1RI8A 1EA9C 3QNZA 4UTAL 1UXWA 3KPTA 1A9BA 1K4DB 3QZWB 1Q9OA 4AMKL 4PJCF 4Y2DB 3ZDXF 2ZCKH 1AY1L 3RU8L 1BQHA 1KCSH 3BISA 3RWFB 3TVMC 5F21B 4M7JL 4Y5YA 5TF0A 4H0IA 4PLJC 1I9RL 3AUVA 2UZYB 4AT6B 4E41A 5F1NB 1G7IA 5J06A 1KEMH 2DKSA 3ZKSD 4HJGA 2VWEC 4N5EC 3SDDB 4M8QA 4P2YA 1CG9A 4V1DE 1DBMH 3HFML 4G80B 1HNFA 1ZT7B 3NA9L 2VQ1B 1IC5L 5D96C 3HRZB 1H3PL 4P46C 5CS7A 2B39A 2NCMA 2OJZH 1AC0A 2KUTA 2YC1B 4PGEA 3RUGE 4MJ5A 2P8LB 3WJLA 5J1TC 1IGIL 1F4WL 2PYEE 3RNKB 1HSBA 1PDKA 1LE9A 3FZUC 3ZKMD 1UB5B 2QADB 1CU4H 2V2WB 3QIBA 1RK0A 5AAWA 5TDNB 3P3YA 5DLMH 3MRRB 4ONGH 4PBWD 1OSPH 4MQXC 2O5XL 2C4FU 4JHZA 4WI6A 1SYVB 1CE1L 4GW5A 4EQ3A 1F3JB 1Q9WB 1KXQE 4CAGA 1A5FH 1DBJL 1MCOH 2O5YL 5IMLA 2VISA 4OQTH 1NGPH 3DVIA 3IRZA 4RWYH 5DT1H 4NBYB 4S1QL 4G9FA 4PG2C 1A2YB 2JJVA 5FGSA 4ZO8A 5F71A 1J1XH 1EAPB 4K71B 3EYFA 1A9EB 1A02N 3BH8A 3IJSA 5I8OL 1B90A 3JWDC 2MCPH 4UT6L 3GO1L 2AERT 2GQHA 1JUFA 3OGOE 1D5IL 3B9EA 2Q8AL 3ZT6A 2ZUXA 3GEWB 3QDMB 4XP1L 3RGVA 5EC1B 3UTOA 3BZFB 3MRFA 2EYTA 3TJHC 2E27H 1T3FB 4HUXA 5HGBB 1N0LA 4AEHH 4NN6B 1NGZA 3KPQB 1GC1L 3GSWB 5EUOE 2RBLA 1R0AH 3MGOB 3BIAX 4YXHL 4NRYA 1J05B 4PJBA 3O8XC 4UUJA 1QEWB 4TUJB 3SJVB 4LVOB 1X5IA 4A6YA 1CWVA 3V6BR 5B8CB 3QI9D 3P4NB 3DARA 5BQ7A 3I75B 5IJKC 4KUCD 5FO9B 5J9PB 3MRJB 3TCLA 1BREA 1WAAF 3G6JA 1H9VA 4WJ5A 3OJDB 4M03A 2GY5A 5FA4A