4Y1GA

Sav1875-e17n
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
171
structure length
170
Chain Sequence
TKKVAIILANEFEDINYSSPKEALENAGFNTVVIGDTANSEVVGKHGEKVTVDVGIAEAKPEDYDALLIPGGFSPDHLRGDTEGRYGTFAKYFTKNDVPTFAIHGPQILIDTDDLKGRTLTAVLNVRKDLSNAGAHVVDESVVVDNNIVTSRVPDDLDDFNREIVKQLQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein SAV1875
publication title Structural and functional insight into the different oxidation states of SAV1875 from Staphylococcus aureus
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus mu50
molecule tags Hydrolase
total genus 59
structure length 170
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4y1gA00
4ZGGA 4B2YA 1P7YA 3CZ9A 3VU3A 1GPMA 2R1VB 4P5PA 1G2IA 4ENRA 1QVWA 1VHQA 1Q2UA 3NOVA 1T0BA 4OGFA 4B5KA 3R75A 1QWSA 3MIIA 4ZDJA 3UJNA 3NOQA 4I46A 4L8FA 1A9XB 3TTTA 1GG9A 2AB0A 2W7TA 5IP5A 3R76A 2AD5A 2RK3A 4Y1RA 5E9AA 4Y1GA 4L8YA 3EN0A 4D1YA 1GGEA 1N57A 2ZUSA 2YWCA 3F5DA 3P9RA 4L7QA 2ABWA 2YWDA 3RHTA 3PQ3A 4HCJA 4OJYA 1QF7A 2RK6A 1OX5A 2ZUUA 4P35A 5JZMA 4Y1RB 4PXYA 3OT1A 1O1YA 4QYTA 4LGYA 3B36A 1FY2A 4AUEA 4ZDIA 3M3PA 3UGJA 1GGKA 1P81A 4UCFA 3TTSA 4ENVA 2D7JA 3ZJ4A 1ONSA 5DFAA 1OX4B 4OGGA 4ENWA 2LXNA 1C30B 1T3TA 3L3BA 3OT1B 3PQ8A 3B3AA 3ZR4B 1IZZA 3BHNA 1I1QB 2XF2A 3CYFA 4S0ZA 4R7GA 2R1TB 2ZUVA 1P7ZA 2ZUTA 4ENUA 4RKYA 4GUDA 1KWGA 4B31A 5JZOA 1L9XA 4BTEA 3PQ5A 4WINA 4GE0A 4BFLA 3PQ2A 5K4AA 4P36A 3R74A 4ENPA 1IZYA 2H2WA 4B7AA 2GHRA 1I7QB 3P9SA 4XLLA 1R9GA 1PDVA 3NVAA 1J42A 3TTUA 4AJ9A 2VRNA 3B38A 3D54D 2OR3A 2VDJA 3TTWA 2RK4A 1M6VB 1OX4A 2A9VA 3N7TA 5SY4A 3TTYA 1SY7A 1GGJA 3PQ6A 1P5FA 3PQ4A 1Q7RA 4L95C 3L18A 1BXRB 1C3OB 1GGHA 3TTXA 3SF8B 2R1TA 1IPHA 5SY9A 1PE0A 3ZJ5A 3TQIA 4ADSG 3UK7A 4E5VA 3EJ6A 3MGKA 4MGHA 5LIRA 1QVZA 4E08A 3SOZA 1JVNA 3EFEA 2IUFA 3L7NA 4GE3A 4N0MA 4AUMA 1U9CA 4B40A 1QVVA 3ER6A 3EZGA 3F71A 4WXYB 1SOAA 4ENQA 1P80A 3CY6A 4UNIA 1GPWB 3UOWA 4UOZA 3NORA 4I4NA 4UZSA 4UOQA 3KKLA 2V4UA 2VKTA 1CE8B 1K9VF 1OY1A 4OFWA 3GRAA 1FYEA 2VPIA 3PQ7A 4AULA 1JDBC 3SF8A 1S1MA 4OIFA 3EWNA 1VCOA 4AUNA 2ISSD 1KEEB 4L8WB 1UCFA 1KXJA 4MTCA 4LRUA 4JQSA 4RKWA 2GK3A 1GGFA 4N12A 4P34A 2VXOA 3TTVA 4K2HA 5BV2P 3WFZA 3NONA 5SY6A 2YWJA 1PV2A 1OX6A 4Y0NA 3P9PA 1PDWA 3FSEA 1CF9A 4L78A 1VCMA 5SYAA 2WJZB 4QYXA 1CS0B 1I7SB 2YWBA 3UMMA 4Y1FA 4Y1EA 2FEXA 1T36B 4P2GA 3FIJA 4ENSA 4ZDKA 3BWEA 3CNEA 3P9QA 1QDLB 2R1VA 2ZUWA 2NV0A 2R1UA 4OQ4A 1WL8A 2NV2B 1KWKA 4ENTA 1OI4A 4BIMA 3NOOA 4MNTA 3CZAA 4I2NA 3L4EA 1VCNA 1KA9H
chains in the Genus database with same CATH superfamily
4S12A 3SJBA 2EHJA 1XTZA 3F4LA 1ISSA 3M82A 4HWSA 5JQGF 1WTCA 5L7TA 1RXWA 4BNLA 3B5EA 5CITA 4U2GA 4BJ5A 1XEFA 2ZB8A 4MPJA 3RREA 4GSLA 4HQ0A 5GV8A 3Q5EA 1NUUA 3A1VA 1CQIB 4JLVA 3MWKA 4BZZA 1FUYB 1ZGGA 3C24A 4WZZA 2GCPA 3AKZA 2J0EA 5DOVA 1EK5A 1DS6A 1MIOA 3L6RA 3V00A 2YWDA 2WWIA 4O4HB 4CKCA 3RLFA 4JI8B 1R2QA 1V16A 2BFNA 2I62A 1YF3A 3ETNA 3AVVA 3Q4GA 4R54A 4EHAA 1WETA 1B0ZA 2RC6A 4URZR 4PY2A 2DQ4A 2VNKA 3KLBA 2ZI5A 3PEEA 4UPDA 1M5RA 2BZSA 4ALJA 1YZ3A 3DXYA 3IX7A 4U6QA 5IVDA 3TPZA 1KU0A 2PJZA 2X7JA 1XA4A 5F21A 2D2FA 4YONB 1S2OA 4CMKA 2PX6A 4TYNA 1MH9A 4C4ZA 3EDYA 2WJJA 1DAKA 4J3FA 1P17A 1P0QA 3WFIA 4HEA1 8ATCA 3OQBA 1WZCA 5F12A 1N1DA 2FTKE 4IDPA 3W34A 4ENUA 1H1LA 3JYHA 2OQ2A 3AOEC 1J7KA 3SIWA 4M7RA 2Y0BA 1WDMA 1TVEA 1UP6A 3PJGA 1NI3A 4PZ9A 1WBJB 4Q3OA 2C7BA 4KQHA 4UDNA 4ZT3A 2DQZA 4DQUA 4ECAA 1PQ4A 5EQTA 2Y0DA 4YR9A 4CXMA 3KVVA 1PHRA 3VSBA 1IM8A 1PDVA 4LHZA 4TT3A 3PL5A 5KNBA 4H7KA 4C78A 5EKDA 3T9BA 4DEVA 1EFVB 4BGEA 1RS0A 2GN9A 4G8JA 3PDJA 3IDZA 4PQGA 3U4CA 2GBCA 3D3EA 4JYMA 2OC4A 5JEDA 4TMZA 1K4KA 4BRUA 1I1NA 3WGKA 1XB2A 2LKDA 4BNDA 4J94A 3SEAA 3QUBA 4FOOA 3MSCA 5H3CA 1SKMA 3Q5DA 1L5MA 2GVDC 1P0FA 1YI8A 3QOXA 4GE3A 2X58A 2F64A 2UVDA 4H0CA 1L8QA 4QHSA 5DISB 5B2ZA 4BP9A 5K1ZA 2IU0A 4BNXA 2F9FA 1UR5A 2PZKA 1R4NB 1FOEB 3IQWA 2YZNA 5DTQA 3AYZB 2VZ8A 3I1IA 1MTZA 4BMOB 4D43A 1KS2A 3KHTA 4ZTUB 3G2NA 2FSUA 2GMWA 1ORIA 3UZUA 1YCFA 4Y7CA 3A1TA 4NENA 2NTVA 1Z3IX 3FPHA 1Z0ZA 1M67A 3N05A 4MRAA 1XRSB 1ULAA 2Y9PB 3CGWA 1O2DA 2J48A 3N2YA 5E7JA 5EYPB 3WL8A 2IYVA 3DONA 2QW1A 1YS9A 2Y2VA 2AE1A 3NHKA 3X1YA 4RD0A 2O19A 2IIBA 4DY4A 2JARA 4GSYA 5JQWA 3ZDAA 1KYTA 4GEGA 4BFYA 2XKJE 1DBQA 1ONOA 3IO3A 3O4JA 3OETA 2OQIA 3VTKA 2GX6A 4CFZA 1PJAA 4L3OA 4UUNA 3LWZA 4LF8B 4D74A 2J6HA 1NL3A 3I64A 3U6KA 3B1WA 3CBGA 2JLVA 4OQEA 1DC8A 3DUFA 1KKUA 1F48A 4C4YA 2QX9A 3KQTA 3LY7A 2JGFA 5BV1A 2FWMX 1YZGA 2QG9A 3BTVA 3IMGA 1KY3A 1AGNA 3U13A 1Y8AA 2VEDA 3E61A 2Y4NA 3ZPXA 2GJSA 2I0FA 4XFJA 4AKEA 5U9CA 2PH7A 4IWNA 1IRIA 3VC2A 4J0EA 1JDJA 1DUIA 1XLUA 2QY9A 5LB4A 4G09A 2SHKA 4BNYA 4BLVA 2HH9A 5ALXA 5J1TB 1R27A 3QRWA 3EPLA 3ZTYA 1LS1A 1FVHA 1A7AA 5L3RA 4EJFA 4FBLA 2G7MC 2HF8A 5SZIA 1LNZA 1OV4A 2ZSDA 2E55A 2QYTA 2M1XA 1CTQA 1E6UA 2VNIA 2YJGA 3AY7A 2WWHA 2IW3A 3H6KA 3JYPA 4ANFA 2E37A 3LL4A 2OPHA 1ZH0A 4KBYA 4LF6B 1ZU5A 3V4PB 1O0SA 4BC1A 5K0TA 2P6RA 5AW3A 3KHKA 1B74A 1RMTA 3HO8A 2P3SA 3U7EB 3DH0A 3KOZA 3R5HA 3T7IA 1ADYA 2WVAA 1G98A 2GJ9A 1JA9A 2W8BA 3GJ7A 3Q3HA 4IDNA 4K03A 4LRYA 3N2KA 4P5DA 7GPBA 1LGYA 3TLEA 5GTDA 2BGRA 3L6OO 5TARA 3I01M 4JHXA 2UYHA 1JEQB 5L3SB 1WG8A 2DTDA 2X42A 3JTEA 2H2IA 3G8DA 3BC1A 1GZ3A 4GI3A 3GLSA 2QKYA 4EEKA 4L9AA 3D5QA 2DF8A 1C30B 4NDAA 2YUTA 4R2WA 1A71A 1YQGA 1CULC 2B4QA 1DINA 1CIPA 4XYGA 3O9ZA 5TY0A 3U80A 4JJAA 3LNCA 2XAAA 4Q4JA 2J67A 4WY5A 3VV2A 4WINA 3ZY4A 1N3BA 3VR5D 4J76A 4YUXA 3B20A 1IE3A 4P31A 1G4AE 4BZWA 1LC0A 4GH5A 3RS9A 1I7QB 3GP3A 2R60A 4GC5A 3BK7A 3ZX5A 2C4HA 2CK3D 3ADBA 4ZEXA 2EG9A 3OAAA 1V1RB 5KQSA 3OLQA 5IFKA 1WSBA 5I7RA 4AKGA 2AQIA 3VJKA 2FPGA 1XO1A 1XQ9A 1XZGA 5G1OA 1KL7A 4HAZA 3ZQ4A 3QKWA 4EI8A 2OHIA 3JWEA 2W2TA 1XWFA 1EINA 1YVEI 4L5BA 3BIJA 1GPH1 2Z4SA 3IUEA 2AG6A 4KITB 3KWJA 5CDFE 4L08A 4P3YA 4P4TA 4D3FA 4LF4B 2R6JA 2ZS7A 3NORA 2JFZA 2SKEA 3DOHA 4PX5A 2W22A 2BTOA 3O2NA 3I6YA 1Y6ZA 2NO4A 2VPIA 1WZNA 1HLDA 3L79A 3BK1A 3OMWA 4I55B 5JS6A 1O0CA 2JRLA 4YDSA 3IAS6 5E6SB 1XR3A 4D7AA 2I6SA 4M6WB 4EJMA 4RJIA 3EXHB 2VOEA 2CNBA 3DHNA 3OTHA 1B15A 3FTDA 3DLAA 4GZ5A 4R01A 2Q3FA 5C1PA 3BA6A 5C2JB 2YZMA 3DL0A 1E1YA 4HK4A 2VDNB 1E0JA 4KQEA 3WL5A 1H65A 2VT2A 2AEEA 3P2YA 4PPFA 5LXTF 1IUPA 3LHDA 3JQGB 3MF4A 3MJCA 3WGNA 3D81A 4UASA 2H52A 2QVYX 1G20A 2QRKA 1SULA 1AZWA 4PAQA 4PG4A 3OEEA 4JUFA 3RRFA 2WD7B 2YWXA 1IPFA 2GZSA 1A98A 1ZINA 3NBZC 4Q12A 1Y6JA 3DEJA 2D1SA 1D04A 1E1QA 3HBJA 4I2NA 4JP2A 1HE3A 4HQFA 5CGQB 1RFGE 3T7TA 4GPIB 4CMGA 3I62A 3KBBA 1QZUA 5IABA 1NVGA 4LJSA 4HHEA 1BCSA 4EJ0A 5KPJA 3IP8A 3PR2B 5FPPA 1GRVA 3LC7O 4II7A 4ND6A 4OX9B 4YI3A 2D1YA 4ROSA 3DE5X 4GKAA 4JOCA 5IWAB 5A4DA 4JI1B 4J43A 1PD0A 1T4CB 1UEJA 4MVJG 5K0JA 4YQZA 4IIEA 1CJUC 5BN5B 1O96B 1FSGA 1D3AA 2NW6A 2PG3A 1E8DA 4WXMA 1A9PA 3GFRA 2WF8A 2OT3B 4M36A 3MTGA 4CF4A 1OLSB 1ZPDA 2Z08A 3L2OB 1I2MA 2IE0A 5HHTA 3VZQA 1NGSA 1T3SA 5EP2A 4DUZB 5LOVB 4OQYA 2B30A 2O2EA 2P69A 1EDDA 2Z9BA 4N6GA 1CZHA 5AW7A 2ILVA 1NZJA 2HLDA 4F06A 3H5NA 4EWLA 3BZUA 3ESAA 4AY6A 1XDZA 4HMOA 1YCHA 3WS7A 1QO0D 3S5UA 1OTHA 1VLQA 4N39A 3OCVA 2ZIUB 3AF6A 1Z7GA 2XBUA 3BERA 1Y6QA 5AKYA 1VMEA 2DB3A 1LDNA 2YV1A 2IBTA 3R7LA 3GMSA 2HPZA 4EUEA 5TB5A 4I3FA 3HJGA 3CUTA 1U1FA 3THYA 2ETVA 5BR1A 4CN9A 1XNHA 4M8LA 3RRYA 4CG2A 2ASVA 1LRLA 2NT3A 3LU1A 4JQYA 5AKJA 4L95C 3SNKA 5AUNB 5AT1A 1T4MA 2GM5A 3P96A 4IINA 2QMQA 1DQZA 2R7LA 4FNGA 4AN4A 3ZEAA 4B8ZA 5IH7A 16PKA 4Q7QA 3ZJUA 1UC5B 3EXFA 1YB7A 5DNEA 1NTRA 1YOVB 3NHJA 1HC7A 3P97A 2P6UA 4C2BA 1HTTA 2HV9A 1RWXA 2PMCA 2RCYA 4ZJYA 3AR9A 3OD5A 1UXJA 2GNOA 3I6QA 2UU9B 4UTVA 2VUIB 2PX8A 4JLJA 2D5CA 3D8RA 4X8HA 3LQKA 4UVHA 2OCIA 3CUVA 3KAQA 3D5TA 2XLBA 5AJVB 5DM1A 4N8EA 1LNSA 4M3NA 3R5JA 2YJ3A 2BKVA 2GO1A 4C0LA 4M88A 2Z2KA 3Q0TA 4G9GA 1SC4A 3F5QA 3RANA 3FMVA 2XT9A 3ETLA 2XA1A 1JEOA 4HXFB 5GP1A 3WTBA 4PWYA 5M34A 2HX1A 4KMRA 1C4OA 2P0YA 2WPDD 2D3WA 1T3LA 3H2ZA 3IDAA 3JQ9A 4YI5A 3KNZA 5IT0A 2ERCA 4FZJA 3H6HA 1PS8A 3ND9A 3ZKWA 1XKLA 3AVXA 4IGAA 2P3OA 1TK2A 2BFDA 1N0WA 4WOCA 2XVYA 5IRCD 4EOGA 2NZUG 4NR0A 4Y1FA 4BVKA 2JBAA 4DMFA 3AR3A 2R5NA 4FZ5A 4UD6A 3SN6A 5M5BA 3GDWA 1NV8A 2KMLA 3ENQA 3OQHA 3MMZA 1V2HE 4Q3CA 3WWCA 1I1HA 1C3VA 2EKLA 2WI8A 2FPPB 3B6IA 3HZOA 2XNSA 1TQ2A 4OHMA 2G9ZA 3PYMA 1CQJA 3KKEA 1WA5A 4BVGA 5IKXA 2WICA 1XCPA 4Z99A 3PR1A 4AF7A 3GA5A 1ILWA 3EAGA 3IVAA 3SQMA 3NGXA 1DQPA 3WE7A 1RAFA 3ZD9A 4KVGA 5A0TA 3EOAI 2LW7A 4O4IB 1ZM7A 1YS7A 1KQOA 3L8MA 1XT6A 3KUXA 2Q62A 4NH4A 1V1MB 2ZBPA 2HBZA 3OTQA 5E4FA 1E7RA 4X92A 2SKDA 3GI1A 4HWGA 1LBSA 1ZQ1A 4NG5A 3ZWNA 5AW4A 1GA1A 2OXFA 3QWHA 2UAGA 4O29A 3SYKA 1WLSA 2RG7A 1QFMA 3VVBA 2QI9F 1JTEA 2A57A 3ZDYB 3QUTA 2HY7A 1FRFS 1SN7A 3VO2A 1A8SA 1DTWB 1LRJA 1V0JA 4FN5A 4DNOA 1E2IA 4OQZA 4CNBA 4XX0B 1GZDA 4ND4A 2OFXA 5KB3A 1OMOA 3U3RA 4BU1A 2JA1A 3FRJA 5JCXA 3DNPA 1NATA 1JXMA 1QO7A 2FEAA 2WZBA 4MWZA 4HV4A 2H8KA 2HXSA 3SVTA 2Z43A 1N2OA 2A0UA 4OXKA 1CRWG 3HFRA 4OAQA 2QV7A 3RB8A 3SLGA 4EW6A 4YYZA 1I3CA 5AJYA 4HDKB 3PZBA 2DQYA 4MV0A 2F3QA 4UUOA 1X74A 2WJVA 2JRCA 5KDDA 2L17A 5BMVB 2VSXA 3AETB 4H2DA 2PFGA 1LJ8A 5IJZA 3PGXA 2FKNA 4IGKA 3RBZA 2X5NA 1RR6A 1ETHA 1KH1A 2JJ1D 4HDSB 2EJUA 2BZ0A 4JBGA 2WD8A 1V37A 5EJIA 1IM5A 1QONA 1OLUB 1M1YA 3LZCA 2ROQA 3HB4X 1YGYA 1I01A 3VI4B 2RJOA 1RAGA 3K8YA 4OLAA 2CXOA 3T5DA 1RCFA 1CE8A 1JFRA 1JVNA 1Y8RA 1GNTA 3WQSB 2Z5LA 1L3BA 1FFDA 2Y1FA 5ER6A 2WSSD 1J09A 1MAVA 3NVKI 1ZBQA 1E59A 2J87A 4LA4A 2J4FA 3RS0A 4AZ3A 4LDAA 4CIWA 3TCKA 1JU9A 4UEWA 2FPXA 3WKAA 2PMWB 2G3YA 3QOFA 4PC7A 1QF6A 2KB0A 1DZ3A 2X8LA 1XCBA 2IZ6A 3I83A 4YJFA 2VI5A 4CN8A 3HY6A 3JZFA 3QU5A 2BJVA 2DZDA 1QX4A 4O59O 1YCDA 4I1VA 5J40A 2A5LA 3ROPA 3HPRA 1IN1A 1OH6A 2OQVA 5C7LO 1KMNA 2DFVA 3QWBA 4CTMA 1UDWA 4ITRC 1OBFO 3I04M 3RU3A 4Q1FA 3VR6D 5ESDA 4BFZA 1UT6A 4OP1A 1Q22A 1DQYA 3LXMA 4D4KA 4HX5A 3K1YA 1FMLA 1W0JA 4W1RA 3R9WA 4DIDA 1XHLA 1FFSA 2LIVA 4ZCLA 3LWBA 3G8CA 4YCLA 1Y7TA 4X6LA 1ULTA 2XV1A 3PENA 3T8YA 1HSZA 2BPOA 1I10A 3K5WA 1U9YA 3ANMA 4KU4A 4U2KA 4AY5A 4K9NA 3ZE9A 1GGMA 2AEMA 5BVHB 1E9VA 3EG5A 3KYBA 4P2BA 4DG9A 4D4GA 5HIAA 5TPZD 2WG1A 3MIIA 1E2MA 3ZK7A 1JJ7A 1EI9A 3ITNA 3RK0A 4EX7A 2OO3A 2WJPA 4FFLA 3EEYA 4FE7A 4IX1A 4O4JA 3SKYA 5AP9A 1HV8A 4ZXPA 1XTRA 5LXTA 4IIVA 1ODJA 2AX3A 1W5TA 4OUDA 1H2FA 1M2FA 1UBMS 3GLHA 4DDMA 2N9UA 3ECCA 4YMTA 3VU9A 1MC4A 3B82A 5L95A 1UC4B 4DJ5X 3AY0A 3SZRA 1P0MA 3OIWA 3RIXA 2HWXA 4CEIB 5HRUA 3AP2A 5DHQA 5ERGB 5D86A 5BQPA 1DJPA 3FLEA 3KPVA 3L7KA 1A9OA 1FMTA 2M6LA 3RHTA 2DJ5A 5A4AA 1F6BA 4OJYA 4DM7A 3I92A 1O95D 1UODA 1LW7A 5TE9A 3RHZA 1E3SA 3IIIA 4N40A 3DDNA 1TJ4A 3DBHB 2CMHA 2QVGA 2XMSA 5DYTA 4UEOA 1GHTA 1W52X 3NHYA 3NP7A 4JKOA 4RKRA 1R0ZA 3DTVA 5A3QA 1EM8A 1XU7A 2R97A 1GQQA 2GWRA 2O2SA 2BFOA 2P9GA 4PYMA 4F4HA 3QEBZ 2C95A 5JDCC 3FKSD 1GPUA 1KP9A 3AL2A 1Z0KA 2WOJA 2FZGA 4RKYA 1E20A 1X14A 4MVJP 4YRZA 5HTOA 4WTOA 1E89A 1HRKA 2F3SA 2JHPA 4LSMA 1Z8NA 3N7AA 1WX1A 1KHTA 4OAPA 3ZTTA 4AG6A 5K8IA 4DA9A 3N86A 1B3RA 1FFXB 4LNAA 2BE9A 4AJ9A 1W94A 2PL1A 1IDOA 5KYGA 2HWUA 2H08A 3L43A 3ZLUA 3Q2IA 1LQTA 1CB0A 1WMDA 3PVSA 3WLLA 3F5FA 5JS2A 3V55A 2H1SA 4RNDB 3DOEA 4OREX 1NW9B 3PGA1 3QY9A 1MJFA 2BJHA 3HCFA 1BMFA 1AUVA 2ANBA 2PDAA 3AJ9A 1NPYA 3D3NA 1Q7CA 1COZA 1RADA 3IV7A 1YDWA 2XHEA 3QW4B 4EMTA 3NHZA 1GPWB 5DTMA 4DIBA 5SZKB 3CF4G 3RHFA 2WTNA 421PA 5JY1A 1IUKA 2Y1EA 2VRWA 2ZIWB 4U5XA 1EGQA 1Y7PA 2GZ1A 3QKTA 2W71A 2PMBA 4OM8A 1NLFA 4H16A 4Q9HA 3FNGA 2CNWD 3GAFA 4LZWA 5BOSA 2UXCB 3FMFA 3KC2A 3W06A 2BEVB 4JXKA 4CWAA 1PDOA 2XCIA 3UJPA 1TJPB 2RAVA 1LX6A 2WTBA 3DSRA 4DPKA 1U1DA 4KQXA 4G5QA 4RK7A 3H1AA 5IS2A 1B6SA 2BWJA 2QT0A 2X5XA 3IESA 3PCRB 4HEA6 4I81A 3V33A 3JAKA 1J2TA 1W8IA 2FMIA 1VB3A 4L02A 1OFIA 2AN9A 4PG8A 5A4KA 3ZWOA 4UTRA 3DV0B 1F2UB 3OFJA 1KTIA 1PL8A 1OC4A 2GXSA 3HJUA 1XMVA 1DJOA 1DHTA 1JU3A 3OPMA 2HHAA 4QDKA 4ZDWA 5REQA 4BFTA 5LP6B 1T3HA 2AOVA 3H5WA 4QOIA 3RVNA 3EPKA 1T36B 2IEYA 4QGAA 2H2HA 2PD6A 4JX8A 4X3OA 1NM5A 4CRWB 3KSMA 3JX9A 1IH8A 4NEGA 4WBNA 4B2LA 5HOQA 5IFLA 4HNQA 2I6UA 1O6ZA 1TAGA 3CZAA 4QU5A 5H80A 2VSYA 1A1VA 2JJ8A 2EZ9A 4KG7A 1TZKA 5K3AA 3W5VA 5LQAA 1WEHA 3BL5A 4M0CA 1QP0A 3PRYA 4LDJA 2E5WA 4F9TA 3TXYA 3E2IA 2YOHA 2D2IA 4G8DA 3S2GA 4DDUA 1XMOB 1W36B 3C85A 1R15A 4R1OA 4FWTA 3JD0A 1KQFA 1BFDA 1I4WA 2DFPA 1ADJA 1DAIA 3TM5A 3UN1A 1PZNA 2HIHA 2PYIA 1SBQA 1WSAA 3HB1A 2ZUEA 2OAEA 2ZRDA 5AKEA 3H0KA 2X40A 2D3TA 3JWJA 3LV8A 1V5FA 2B61A 3P0EA 4JJ8A 3F9IA 1T34A 4OXQA 1U90A 4RMJA 1V9CA 3GCWA 3D1LA 1MQAA 2EP8A 2IP2A 3GDOA 5G4KA 1E1NA 2UZ4A 1MOQA 1ICEA 1RYMA 3WHPA 4EGQA 2VK1A 2PU7A 1F3OA 3ZWDA 1HEIA 4PONA 2FFRA 4WK2B 5DHSA 2FW6A 3VNVA 1PR0A 3A6ZA 3M5WA 1K97A 3W5BA 3KQVA 3QVUA 3OEHA 4ZVMA 2DQKA 3DEKA 1WXDA 1U0OC 4QREA 4FKBA 3P9NA 4N9WA 3GLIB 3ZE7A 4GAEA 3RS5A 2JDID 1L9XA 2OFWA 3PQ5A 4C06A 3D3WA 3NG1A 3KJFA 4GE0A 1RYNA 1XCMA 2J7PD 4P80A 3RC2A 1TKAA 2VF8A 4IXDA 4UHFA 5HJ2A 4OX9Y 2KBEA 2AUMA 4MZDA 3GRUA 1KOLA 4PSUA 4TKUB 2VP0A 3P9ZA 4B83A 3UMGA 4DLVA 3VPBA 1U7PA 5MFPA 1U8TA 3PE3A 2YXNA 2SKCA 5AKZA 4U2EA 1E77A 1K27A 2ZE6A 1SHTX 1DC3A 3G1UA 3SSOA 1M72A 2FSSA 5E38A 3RFUA 2YX1A 2OWDA 4A0GA 4CM7A 4RIEA 1TTQB 1GPLA 4RPIA 2CV0A 5JCOA 5DWVA 1DJLA 4ZI2A 4AD8A 1DXOA 4ND1A 2XD4A 4S2UA 4J0IA 4K9RA 2GRAA 2QNIA 2ODPA 3INTA 3L40A 3PUVA 3CY6A 4QJ5A 2FMFA 3WLMA 1E3DA 1N5RA 3VNBA 1BFKA 3ZGNA 3R6GA 2WF6A 4HLUC 1Q6YA 4IMIB 3GP5A 4M9XA 5EMKA 2RBKA 2CB0A 2CHEA 3C6BA 3TSAA 1C9MA 9LDBA 1ENPA 1TUBB 2H1HA 2JLQA 4L73A 3GOHA 1JDBC 1OA0A 1U81A 1WCIB 2PUTA 2YOGA 4GP7A 3S68A 4EFDA 1T15A 4ESOA 5K45A 2VATA 4FMDF 4EI2A 5B55A 2X23A 1V4BA 4UNQA 1KEPA 2BR3A 1KGDA 2FE1A 4II3A 2FQ1A 2J4CA 4F1JA 1D1SA 3K70B 5AUOB 1PSWA 1S2IA 3KVOA 4UEQA 2QQ5A 1G8KA 2IXTA 2ZYTX 3VHQA 4B4DA 4A0HA 1UAAA 3LT0A 1YB1A 3OCXA 2P5UA 2C96A 3ET5A 3VU1A 4KGZA 3OP4A 1QHYA 2C92A 2WKWA 5LLSA 3TBKA 2BMJA 4AP5A 1FTNA 2JLZA 5JNSA 3AUXA 3QEOA 4NG4A 3BFXA 1RYYA 3RASA 5DSTA 4KLCA 3IIJA 4IXNA 3ZS9A 4C04A 3D59A 3T7RA 4MHTA 2EFDB 1T6YA 2H4HA 2DH6A 4XQEA 1N8KA 4IJ6A 4NC9A 1R1DA 4YUYA 2PV7A 3KKPA 3A4IA 1OB2A 4JJ7A 4WECA 1Y3AA 3FI9A 3NGMA 1ZH8A 4UUAA 5THXA 3LRPA 1Y1SA 3PDIB 4P53A 5CM8B 4XWOA 1G59A 2A92A 3TZBA 4K6MA 3GAAA 4ZCSA 4ZXFA 1R0WA 3EZ2A 3E1SA 2MSCB 1A5ZA 4PCVA 4HWTA 4JIGA 4IO1A 3MCZA 3RVQA 1KPGA 2SECE 3UG6A 4HRXA 3PFBA 2BEWA 4PRKA 4UUPA 4UMVA 1TT5B 4GNKA 5AIAA 4EG6A 1Y5NA 1E6EA 3DB1A 1DC6A 4N3CA 2XRMA 5HNKA 1JAHA 1XZMA 1U94A 4KWTA 1DEHA 3IVMA 4LJ7A 3GLFB 4WT7A 5DTJA 2PSJA 1SBIA 4JB8A 1QRUA 4HMQA 4FLEA 2VYNA 5EIAA 1ZUNB 1A9YA 5K3BA 4ZHSA 1SRQA 3PHCA 5K0GA 4Y1RB 4QXOA 3O3MB 3ZQUA 4LRSB 3ZUPA 4DUGD 3QM1A 1DAPA 3NKFA 3RRBA 1ZH4A 5KHOC 1LI4A 4L5JA 4C7XA 1Z39A 5L8VA 1NBOA 3L7IA 2QMEA 3DZJA 2F8TA 2FE4A 3I73A 3X1DA 1NLYA 3WDKA 3RKUA 3B60A 4RFVA 1EUZA 3FKJA 3JS5A 3UAVA 1LPOA 1T2DA 1P2GA 3GJSA 3INNA 4NYJQ 3LPMA 3CYFA 3K30A 3DM5A 4NECA 4BFVA 2ZROA 3C3EA 3ER8A 3ZHBA 4G0NA 4BTEA 3D0QA 5GGYA 1OHHA 2DT8A 2FOXA 2R87A 4JL8A 1L8XA 1X1BA 2V0GA 4JMLA 2IP1A 2W8ZA 3ZI4A 2IHKA 4EQ6A 4X7MA 4KV9A 1AGXA 2I7CA 1DJNA 1FMCA 2R11A 4XVCA 4FCTA 4PZYA 5JXIA 2IYXA 1KK3A 1JECA 4J0KA 3IAAA 1R8SA 1RRKA 1MOPA 2B20A 3L18A 1TQ4A 1ISJA 1EGVB 4K9SA 2X2PA 1CDZA 3FUWA 1VLLA 3QZUA 4GPTA 2QS9A 2WZDA 1G5FA 1Q84A 3M9XA 3LPAA 1T0JB 4LMPA 4MQFA 4H4EA 4U2DA 2RKBA 1OFUX 2FPIB 2ZW9A 3L7NA 3HCWA 3O5AA 1DV1A 3CLUD 3CUWA 3NLLA 4GL2A 4G1CA 4EECA 1CDOA 1Z83A 4IIFA 1CBUA 5FNVB 3G88A 5FKJA 4BGIA 4NCKA 4EY8A 3AOEA 5F73A 2C3OA 4K86A 5KJFA 4GPEA 2QT9A 4XR9A 3K1AA 4OEHA 1I4EB 2PS9A 3QW2A 1JEDA 2YIMA 4KJZA 3UWOA 5EIEA 2ZSBA 3KFVA 4B3JA 2BMVA 4JYPA 1KVUA 2RI6A 4INOA 4PLHA 5HF6A 1PZMA 2FEMA 3TIFA 4DC0A 3ICQB 1QQTA 2HSWA 5HQTA 1FTQA 1WABA 1RRPA 2JEZA 5NLLA 4JL5A 1GZUA 2GK3A 2A9OA 1KJQA 1M66A 3OKFA 4X1KA 5EMMA 4D3ZA 4I6GA 2VDOB 3F5SA 4UTPA 5I4IA 2AI1A 3OIGA 3U7RA 3WQQA 3WFZA 1P8JA 2CJWA 4FHFA 5BO5A 4J6EA 2ZRQA 5HCIA 1BKDR 3S4YA 1F2DA 2KJQA 1U02A 3BE5A 2YL2A 1XMIA 4WZ6A 3STYA 4CZ2A 1THTA 5JDIC 4XJXA 2A4MA 2EBHX 2Q3CA 3KCQA 1KAQA 2FFAA 1PYDA 3QG1A 3IE1A 3FCUB 3ZW7A 1ZOLA 2PQMA 5AM1A 2WFZA 4MI9A 4LFCB 1U4SA 1N25A 4PV7A 4RF4A 1SCQA 3ZV4A 4ENTA 2PZBA 3TSYA 1QMGA 3LT5A 1UPUA 3OUZA 1MV5A 1IBCA 4ZQIA 1QC5B 3TOZA 2AZDA 1LZKA 1VL5A 1YNOA 2G82A 3OMLA 4KDFA 2X8JB 4MQUA 4KQKA 4BO9A 1TCCA 4QJ3A 3GEPA 4PG7A 4TVOA 4C3VA 2I2AA 4RV4A 4YRAA 1H66A 1SIOA 1T9ZA 5BW4A 1T8WA 3LLCA 3RF6A 4O2BB 2OCYC 2PKQO 1X92A 1S8OA 1MFPA 4HADA 4L72A 4C29A 2XYVA 4TL8A 2AD5A 1MD9A 1SU8A 2H3EA 1ZS9A 3PYLA 1T5HX 1YOBA 4GRDA 4MVJA 2RGEA 2A88A 2G9NA 1LK0A 4EG5A 1EHCA 4N18A 1I7DA 4EK9A 3JAMA 1DDIA 2HSZA 2XCUA 4FIZA 1Z0AA 2FP4B 1H69A 3GJ5A 1R5NA 1M1NB 2ADFA 2H2AA 1U80A 2ZJZA 1F1BA 4RU1A 2QRGA 5HUQA 2V55B 4MCIA 4EB6B 4MQ6A 3PLNA 8LDHA 2A1UA 1JKJA 1OPXA 3KAPA 4I9GA 3PC3A 5DHFA 2ZKIA 1GRNA 3M6UA 3NEYA 4I50B 3U1TA 4OSEA 4ARBA 2OWEA 5FL3A 2FZEA 3GLKA 2JAHA 1U5BA 3TUIC 2P6MA 2YHSA 3HMQA 3V4SA 4KUGA 1NW4A 1P5JA 1S3SA 3GLFA 1P8AA 3C4QA 3CVWA 3SHWA 3E2PA 3RSFA 2I2CA 2JKYA 4CKEB 4JXZA 2VHTA 2V7GA 5DM2A 1JQKA 3GG9A 3L07A 2GM9A 4FDLA 1OBHA 4GXTA 4H35A 2PUVA 4YJ2F 2R62A 3SZUA 5IDWA 2AK2A 3C3WA 3T34A 5LQMA 5TR9A 1JA0A 4BBPA 3KTOA 3NVAA 4HEJA 1MZVA 4FMCB 3MHPA 2WF5A 2IYOA 2ZJ8A 3CRW1 1GUAA 3AILA 1NE7A 5C53B 2Q6VA 3JSAA 2B36A 3JV7A 5JRJA 3C5VA 2RBGA 5DNVA 1FMFA 3CZMA 3I45A 1Q0SA 2AWNA 2CXHA 4F2PA 3EOBI 3LXXA 2PMFA 2R8ZA 1IN4A 2H1IA 5EKTA 1ICIA 2Q0QA 1HK7A 1K7XB 1GUYA 1QVVA 3ER6A 2X1LA 2LV8A 4JJEA 2IPNA 5EIOA 3WGLA 5BWMA 4XPIB 4GDFA 1Y1RA 1J23A 1OZHA 3TINA 4COOA 4BO4A 5I5EA 1AQIA 3GUYA 2UUAB 1S2MA 2BBOA 3QLVA 1G8HA 2Z30A 3K1TA 3WYEA 2OV3A 4A5OA 3PV0A 2PIAA 2O52A 4G4SP 2OZKA 1Q77A 2V0NA 4MUBA 3FNIA 1CF4A 2MHCA 4M60A 4BO6A 4CEHB 1YKGA 1O6CA 2W2MA 3OTWA 4QXMA 1KMCA 1H6DA 4ARSA 3DF7A 3EEOA 5DNWA 3HFJA 5JCJA 1KXJA 3K4PA 1NPDA 2OD9A 2H4ZA 3BFJA 3K0EA 1EFPA 4IY1A 2FWBA 1C7ZA 4FFBB 3WIUA 3ZDQA 1OIXA 1AVTA 4DCPA 2R6FA 4BN5A 4QQ8A 3GK3A 5DX8A 1KAMA 2EFYA 3MHTA 2X15A 4L4XA 2W6CX 4AM8A 3LXUX 3TJMA 3VAAA 3ZK9A 4CIYA 2WTXA 2QLMA 5EINA 1PUJA 1IY9A 2DBYA 2HPAA 4LXQA 3RIMA 2XOKD 3D6HA 2DPHA 3BIXA 3M6IA 3O8QB 2G8NA 1HKUA 2O2GA 1QHGA 4L15A 4RHYA 2HXYA 3ANSA 3KQUA 3EE6A 4BXOB 3BWCA 2QRMA 1O7JA 3FB4A 2CUNA 2HCJB 2WK1A 2XEDA 2A0WA 1RJ9A 3PF9A 3R5XA 2I4LA 1VCNA 1SK9A 4FFWA 5IM4F 1D2HA 2CFSA 2AXPA 2QK4A 3AR7A 4BNKA 3NYQA 5A2GA 3MB8A 4BNUA 3LVQE 2C00A 1G8GA 3EPPA 5IF3A 4RS4A 3AEKA 1VIMA 4RXTA 5CR9A 5IBQA 4IUBS 3R75A 4D9CA 1E0AA 1BHJA 1U0EA 1OXTA 1QYDA 821PA 3I2YX 3OCUA 2IXGA 1XYYA 2KLBA 1VIAA 1D2GA 1ESEA 4BWVA 3P9RA 4LYEA 1TA0A 2OKGA 1V3QE 2WWGA 3MFYA 1I3KA 1L4HA 1W85A 5CXQA 3UWDA 3OX3A 1K6XA 5L9AA 3IOYA 1TT7A 4BVAA 4Q47A 1MIOB 4KNYA 1BKSB 1NBEA 2IGBA 3B36A 3FLMA 3IDFA 2VNJA 3L93A 4JJFA 3DZCA 1P2DA 2UZIR 2UUOA 4M0EA 3ASZA 2IDKA 1HQDA 1Z26A 4ENVA 3GLVA 4LVNA 4PICA 3OJXA 4BX3A 3IQZA 2IXDA 3TK1A 4H3SA 4DVJA 5G4LA 2P0AA 3AVPA 5EMHA 4OJNA 4AP6A 1ECGA 2RMKA 4E5MA 5BWCA 2I6GA 4H7EA 5K8CA 1SVLA 3OZFA 5DCYA 1XN4A 4HDOB 3PTAA 2OBNA 5CFZA 3GD5A 4C7KA 1XKTA 4QSMA 1YJ5A 2NO9A 3BXEA 4KXUA 4R2KA 2OXTA 3CLRD 2VQFB 1BXRA 3G5TA 3HKEA 3MWYW 4REQA 2C98A 1HQKA 2I54A 3OZRA 4XYMA 1UZLA 1VLVA 2HNKA 5C31A 3AYXB 1Z2AA 1W47A 1Z08A 4MW0A 2C31A 3HJTA 1H2HA 3R77A 3X1WA 4G5YA 4E31A 2IYTA 1TF2A 4OHYA 4AMUA 1NN5A 2QE7D 2E6UX 1JJIA 1AKEA 3ZI7A 1G5RA 2Q5LA 2AA3A 3CPJB 1V9LA 2N42A 2VRCA 4WOJA 5H9VA 2D2VA 4MV8A 4NVRA 5DYIA 5IAGA 1Z73A 4WSOA 1MO6A 3VR2A 4BNDB 4UZSA 1GFZA 2ZCJA 1WW3A 4WQMA 5FA6A 1NNLA 1Y9JA 3TOVA 3MG9A 1GILA 5AQ1A 1DAEA 3ABSB 3I9JA 5DN6A 3E3OA 4HEQA 4A2CA 1NR1A 3GELA 3I23A 1DOAA 2OGWA 5FUBA 5I4CA 2WZCA 1JHQA 4J6FA 4RDXA 2QVZX 1E2NA 1JDNA 3P26A 3AONB 3KZNA 4V0ME 4AUNA 9LDTA 3CWCA 4CMIA 1RZUA 1JQEA 3K73O 1DTSA 1VDZA 4FNMA 1EGAA 4K87A 2GR9A 3ACCA 3TW0A 2B83A 4KPUA 1YZFA 3TZCA 1JQ3A 2ZE5A 2ZT8A 3HI6A 4JQSA 3EBPA 4NENB 1XV5A 2FUKA 2VBCA 3TTVA 4EDHA 3ORYA 4AZ3B 4I2VA 3L8ZA 4DLYA 3K05A 4HC4A 4ZEWA 1IZ8A 2HDNB 3KKOA 3QVLA 1Q0HA 3L8GA 4Z9XA 5EPEA 4ER7A 3LJKA 2YJ5A 4MRPA 1O6BA 2CLIB 2E85A 4HGQA 2ECQA 1J21A 3HRHA 3GPIA 4Q16A 5ESRA 1RM4A 1L7PA 2A84A 3E8XA 3SJUA 4JOSA 3EUEA 3CJRA 4CT5A 3W5CA 3BB3A 1U98A 2DY1A 3H8WA 2WUDA 4RYLA 1XTSA 3HKCB 2M6SA 3BYZA 4LN1A 1MLDA 3CTMA 2WWFA 1G3MA 1FDSA 2QTTA 2ZRJA 1K8RA 3A4VA 2B4RO 3JR7A 3D8UA 3DUFB 3AK4A 2OBMA 3N0XA 4BKQA 1LD3A 4O2AB 4BNVA 4ZARA 1U7XA 2ONCA 4X85A 3FBWA 2HLPA 3RVJA 3SFVA 3JW8A 2YMLA 3DMHA 2ZR9A 4BEJA 1G291 4NCHA 3HJAA 3IOEA 3N07A 2ODNA 4R05A 4K9LA 5ESWA 1FU8A 5ED4A 1DSSG 1OBOA 1ZM3A 5CVUA 1JIQA 1XN1A 2X9GA 5HP4A 2HI0A 3B7WA 1V4VA 2SICE 1C1YA 3M8KA 1TADA 1DP4A 5BN4A 3PJRA 3LDAA 2J9FB 3QX8A 2QX8A 4GQBA 3X2SA 4U8GA 3PRJA 5DV9A 1ZUHA 3LFTA 1NUHA 4NU5A 4RJKA 1JDPA 2X0DA 3T9AA 4X8LA 5ARBA 5BV8A 5CYOA 1OR8A 4BKMA 4GM0A 3KT8A 4FEGA 1U99A 4IYRA 3CX4A 5A6VA 3TUJC 1VKZA 4DJDC 5LYJF 1FFBA 5IK2A 3AVUA 5J23A 3SXUA 3B85A 5EOVA 1R0RE 2OGTA 3P45A 3RAFC 2AQKA 4BGDA 2HR1A 4F5ZA 1MPTA 4WXPA 3CLUC 3D2AA 3B7PA 2BGKA 2PLAA 2OOSA 3E22A 3L1IA 5EJAA 5EZYF 4CL2A 2PX2A 3EEBA 1ONNA 2IY7A 4XWKA 4DNQA 1J8DA 4OM7A 4GT1A 4E5PA 2WSMA 1Z29A 5UKDA 3NBYC 2XUQA 3RPEA 1A4UA 1NVBA 4LMAA 4KFRA 3WQBA 5BWBA 1PP4A 4YEDA 4BWGA 3KS9A 2Q4OA 1Z4PX 2QE6A 3BD6A 3TTUA 1N6LA 4NS4A 3LDGA 1MF7A 4KW7A 2ZTUA 2DKNA 4DZZA 4E88A 5EXXA 1YA4A 1U3VA 2PX3A 4ZREA 4GEKA 2G72A 3TN7A 2XRZA 3UK1A 2W6QA 3UAXA 1K7FB 3CLSD 4YCSA 1ACMA 4JODA 1KAHA 4M8KA 4QTXA 5AVYA 3RC9A 5A3JA 2AR9A 3KDSE 5JH7F 5IJAA 4QTYA 2OL4A 4WFIA 2FPGB 1D6MA 1VP9A 1GR0A 3O47A 4OJQA 2JC3A 4BV3A 3ETGA 4RZUA 1XIVA 4TQUS 4QXQA 1G60A 3AB7A 1RC1A 3CF4A 4LXYA 2EFEB 3LCVB 1OC2A 4G8BA 3VH4A 2IEBA 2OO5C 3QVXA 4JEMA 3TBFA 1W1IA 1SKYB 2C61A 2Q07A 3E23A 2CNDA 1IN5A 2HN9A 5I9MA 4BJ3A 4CF5A 1T5SA 2EOAA 5BY2A 4BRZA 1V3UA 4G5GA 1GRCA 4Q1DA 3EIQA 5FTWA 4YV1A 1LJUA 1ZK3A 3OZDA 1NPTO 3U6BA 4UPVA 1OAKA 2I2XB 2J9GA 3AHEA 1RHUA 4BYGA 1P77A 1HL3A 4H59A 1Y82A 4HAUA 1YI1A 1WS6A 3P8ZA 1PG5A 3RVKA 2OP1A 5LLDA 1EDZA 3O21A 3H97A 1NLMA 3CINA 3Q3JB 2RJ3A 3ABIA 4HJRA 3EDMA 3IBSA 4NTZA 2LKCA 5AD1A 1JMVA 4YMVA 3LA8A 3PPXA 2E49A 4YGYA 1QNFA 5BT9A 5WRFA 3FR7A 4F6CA 4ENSA 1A7UA 5KYWA 1W2WB 4NE2A 1WXQA 3R6TA 1XD8A 2XWQA 1GN8A 5DW0A 3QWIA 3V3KA 1G20B 4YJ3F 2CMDA 3L1HA 4WMLA 2DP4E 1RZ3A 1CJBA 1WRBA 1TIBA 1BKYA 2DRIA 4YCJA 4UDYX 2JGLA 1T8TA 4TT8A 4BJ1A 5BMOA 4TTJA 4E13A 3ZBUA 1RRGA 1IN6A 4TLCA 5IH3A 4GI7A 3BWMA 1WV0A 4LC9A 1MHTA 4I46A 3TGLA 3KBOA 5FO0A 5FULA 3R5KA 4IDBA 4QM7A 3Q0IA 5IUNC 1ZLXA 2FMTA 2D0OB 1XEWX 4OI1A 3RBXA 5BP7A 1GZVA 1BCSB 3DHWC 3MRVA 1THGA 5CFOA 1JILA 4MI6A 4ESHA 3O8LA 4CPDA 3OO0A 5IM4A 5HTKA 5JFOA 3ZU5A 1DU4A 3UANA 2W2QA 5CLIA 1M8KA 2AJTA 4Z4FA 4MV7A 1C29B 1WM1A 3LD9A 4TWBA 5CT9A 3AXSA 3WL3A 3G85A 1VB5A 4WK6A 3PUIA 5HX7A 4B74A 4I7EA 5KUTA 3OTIA 4AZTA 1U2PA 3MYYA 1EVEA 1KHHA 2WJ3A 4G63A 4JBIA 5BR8B 3L7LA 3V2GA 5ALJA 3WLOA 3V8VA 3D8HA 3VR5A 2RHOA 4TS4A 4GYKA 5K4AA 1LZLA 4GRAA 4B34A 4XSVA 1ACLA 4MHSA 3AUUA 2MDTA 3A26A 3OT4A 4FDMA 4GZ3A 2CK3A 1MX3A 1B3BA 3I28A 4WEQA 5CH8A 2FY8A 3ZDRA 3QIVA 4B85A 4BV9A 2GTPA 1JAZA 3OWHA 2XGGA 4PPQA 1ZISA 4JDUA 3REOA 5AQEA 4BCDA 2EP7A 4G0QA 5B3JC 3D4BA 4ISCA 1FZTA 1QQAA 3W2HA 1QIJA 1DBWA 2R1TA 5GIOE 1LX7A 2FNAA 2QRPA 3ZCPA 4WXRA 3JD2A 2QQFA 3JWGA 3BICA 2WM8A 4J75A 3THYB 1J0BA 1MB9A 1WXFA 5F2NA 1OU0A 3CCBA 2F6RA 3L0CA 3M6VA 1T4DA 1KI4A 2XW6A 3OQJA 1ZMRA 3CLHA 2V8BA 4KKVA 4M8SA 4B0OA 2H3HA 5EAIA 1YR8A 1ADCA 1K4YA 2R4TA 3H6GA 3BRSA 1A95A 3G89A 2Q2WA 3IFSA 1WXEA 3EXFB 1QGYA 4C20A 3ZWAA 4I1SA 2J85A 2BF4A 3LPLA 5GM1A 2D1TA 1KMHA 1UBGA 3G2MA 3KQMA 2JZOA 2VSOA 1XDWA 2C77A 3DCIA 3RSOA 2VP2A 5LSAA 2F1HA 1Z17A 3S29A 4E07A 4IKPA 2C2MA 3EMDA 4RMIA 2CLSA 1RCUA 2J08A 5E95A 2VJYA 1PJTA 3QEJA 3ZLVA 3FM9A 4D3SA 2HYIC 1E2LA 2G9UA 4PHGA 2G9RA 2J3LA 4G4IA 2EEPA 1YFKA 5HK9A 1RWNA 3TNYA 1T2UA 1ODTC 1AY0A 4CFYA 4BB9A 3IKLA 4TWJA 4A1FA 3HXKA 4MICA 3CXUA 3SY8A 4HZGA 3QHAA 5DTRA 5TGZA 3ZHOA 1UFKA 3DBRA 3PHIA 1JA1A 1E6CA 1C1XB 1Y6RA 2Z9CA 2X3FA 3M6WA 4JC5A 1A69A 3K0BA 5FDFA 1Q0RA 5KYUA 1Q1EA 5AJWA 2LP4Y 3HN2A 1L5VA 1E0KA 4Q6BA 1NWCA 3A9CA 4KE8A 2NMVA 1TM5E 5HKKD 4P0PB 1F0PA 2AMLA 2BFDB 4LQLA 4EJSC 1EVQA 3OQ1A 3W9UA 2JBAB 1M73E 3OOSA 5KCMA 3L0BA 3LDUA 2HA2A 1J56A 3I8XA 2CKMA 3LDFA 4OBWA 4ROTA 5IYZF 3W7BA 4CYMA 5KTRA 5FAXA 4J0GA 4V1CA 1U8XX 3TE7A 2Q1SA 3Q9NA 4ZVLA 1H2YA 2Z8YM 5DXJA 1PGOA 2OYRA 4ZZIA 5LU8A 4UXIA 2BF7A 3RS2A 1IQ0A 3A6LA 4MVJI 4DLKA 1RWWA 4C4OA 1CQJB 3CLRC 4BQEA 1K98A 3KQLA 1YQEA 1ZUD1 4DA7A 3GGJA 3JQFC 2WV9A 3N75A 2Z4TA 2ZANA 4MYDA 3UJ3X 3RO7A 2WF7A 4H27A 2G1PA 5K0FA 4O1MA 4RD2A 1GAJA 4P4LA 1ZD5A 5DYWA 3V8EA 3D4PA 5C9ZA 2QQGA 4G1EB 1H5UA 1KFCB 1UJCA 1A5BB 4J0HA 1S4MA 2TMGA 1IEQA 4KV7A 4WOPA 1N6OA 1L5RA 4R41A 1X3LA 3VOSA 2G9VA 3ND5A 2O8EA 1C7QA 4Z1MD 4MHOA 2ZBDA 3AHIA 4ENWA 1X1AA 1E62A 4B7CA 4C6HA 5FJIA 3WGGA 4FYIA 3TZ6A 3W8RA 1WB4A 4YMUA 1VSBA 2C20A 3U09A 3OU7A 2CLLB 1B2LA 2HJSA 4ZT5A 1JHRA 1SCUA 2IY8A 6REQA 3SFZA 2Y1LA 2C8JA 3T7EA 4WJKB 1PWXA 4NULA 4Q4DA 2VYCA 2Y3IA 2YBDA 5K09A 2W98A 2QJWA 4YBRA 1AUQA 5IEJA 5JLJA 2APJA 5ALGA 4OMCA 5EEGA 2P2GA 5C18A 5LYJA 3ORRA 1XLTC 2BUCA 2RK4A 2XA2A 3JQEA 2HXGA 3ROZA 2V6GA 1BS9A 2C4MA 1D2MA 3IP6A 5CD9A 3FVRA 3TTXA 3DNMA 1IMJA 3AKDA 3H83A 1IXRC 1W88A 3M1LA 1OU4A 2PKRA 2R8PA 1WUYA 3C3CA 3NETA 3QVMA 1YZLA 4I9HA 5EZYA 3N6RA 1FYXA 3TL3A 1KYZA 2RDMA 3IJEB 5LBIA 2PS1A 3KL2A 1JFTA 4PZZA 3SXPA 2MSWA 4IJ5A 2B4AA 4IJVA 4HNTA 3QI7A 4CUJA 3IERA 1CE8B 1Y8RB 2BKAA 1OY1A 2G67A 1X8LA 5ENVA 1LF0A 1B93A 1IBLB 3JRXA 2XVMA 3GZNA 1SCJA 4YMWA 2ZT5A 3KZ1E 1X2EA 4FQ8A 4KDEA 2G5PA 4OFXA 3FD8A 4V03A 1BDHA 4RABA 1LSUA 3V8RA 4KQ9A 4YJFB 5KTNA 1PJ3A 2R5FA 4HLQB 4ESEA 3EF0A 2MSLA 1RP7A 4ITVA 2Z5FA 4M1QA 2WPDA 2O1WA 1E3JA 2N47A 2E89A 4J1TC 1XQWA 1Q15A 4S05A 3NXKA 3QU7A 1E1LA 4MPRA 5HF8A 3R9IA 3ORSA 1M5TA 1CS0B 2VF5X 2CXPA 2FW0A 3AUFA 3F49S 4PSCA 2WA2A 2H00A 4N8SA 5KOIA 1ZMOA 3SP1A 3DFMA 2CJYA 3DR3A 1EVLA 4W5RA 4HLUA 5GZ1A 5AKIA 3JRWA 4ZRDA 4LAFA 1I3OA 2POCA 2X0NA 3MMPA 4D0RA 1Y6GA 5BSGA 4A91A 4C6TA 4MCHA 3TD9A 4BQIA 1NDUA 4Q9JA 1N3YA 3VOBA 2CZQA 5CEEA 3CTPA 3HADA 4IUCS 5ESXA 5C34B 2GN2A 4JFAA 4UMDA 5BUZA 1Y5RA 5J4HA 2JGIA 2NXNA 2IHVA 1QNLA 3G79A 4WKOA 1NMXA 4D8UA 3I2HA 4CDNA 2EJCA 4IHAA 4JITA 3RGGA 1JHXA 2NPIA 4LV6A 3DCNA 4O4JB 2B8EA 4QXAA 1KO4A 3HBAA 1SQGA 3MJVA 4NLLA 3ZHCA 4OUDB 2B3TA 1DUSA 2QN8A 2NLOA 2CV2A 3H4VA 2YJNA 3GLHB 3UQZA 3Q8LA 4NYJR 5GJBA 1RRMA 1Z0DA 3VU9B 2PH3A 3Q7PA 3MLEA 4J7AA 3L1UA 1L5FA 2BJWA 3U3JA 5P8WA 1A2QA 3M4NA 3QH4A 1F06A 3CLSC 4QBFA 4UHJA 2CJPA 4NV1A 3O2SB 2IUSA 3VM6A 1GGKA 5JFTA 3S55A 2KPOA 4QNMA 3T7CA 4EPVA 2CFOA 1UAGA 3TAXA 5LWQA 3CH6A 2ZYVX 4OB6A 2XCRB 1YCGA 1YZTA 4TOIA 5EMLA 1L1EA 1VBKA 4YB8A 1ULUA 2I9KA 3ONWA 3DTVB 3UUEA 3R5TA 1EM8B 4BMDA 2G76A 2HU7A 3QFFA 3IPLA 1D4FA 4R51A 5F1OA 5HSGA 4L28A 3UAZA 4D25A 1X42A 4UHDA 4B7AA 4D9MA 5FPQA 5BRJA 1QUFA 3UATA 3O0TA 1WAMA 3PWZA 1HPLA 3CVVA 1SU4A 4RAOA 2JI6A 4LRTB 1XDSA 4HUTA 1P0CA 1W9HA 1GFSA 1SUBA 3PNVA 4YECA 1KZHA 2NAFA 5BQ5A 5CDFA 1HX7A 4WZBB 4A7PA 1HT1E 2G1UA 3GGDA 2C5EA 2UYYA 1XXHB 4LYAA 4KQ6A 3NVDA 3LHSA 4Q9LA 4E5SA 4HFJA 4S1NA 2WSSA 4AJHA 1QPGA 1GZ5A 2QR3A 3SC2B 1IHDA 2JFOA 2HA0A 1NR5A 3GDHA 4QULA 3ZBQA 2DETA 4UJ5A 3T1NA 1KOGA 5A4JA 1G5IA 2SNIE 3INYA 2VJPA 1FU4A 3ZGYA 3ICWA 3RM3A 5HKBA 3MCAA 1Z0FA 5KNDH 2ZYAA 1WSDA 4MIKA 4FB4A 3E7DA 3ZDZB 5JANA 2RH5A 4IHJF 1E7MA 4MQLA 5CG2A 1TC1A 2FEWB 1RI3A 4EUSA 1KTVA 2X41A 3K09C 5EERA 3O7WA 4RZIA 1N2BA 1HDRA 3VR6A 1JV2B 1VDMA 4JNCA 3GFTA 1FMJA 4R9VA 3R7FA 1USUA 2GXAA 1KEZA 1QAQA 4L75A 1V11A 2H6EA 4BO3A 4CEJA 1ZGZA 3JAKB 2J9ZB 2ZTSA 4Y1EA 3VNQA 4Y2RA 2TRSB 1JBKA 3D7LA 2ZUWA 1Q6ZA 2W70A 1AN9A 2PZLA 3VDMA 4BX2A 1KMQA 4C3ZA 1U2QA 5KQGA 2VT6A 4R9RA 5REQB 3AGQA 2DCMA 5TPZA 3TG2A 3C6KA 4BMVA 1R0BA 1R6UA 1GUBA 1W4CA 2EZ4A 2ADMA 2EGHA 3PX2A 4DMLA 3J80A 1AKUA 2V7EA 4TLLB 2QYOA 2JGRA 1BMDA 1CVRA 1UOPA 4J1NA 2P79A 4WBNB 4OGFA 1U8CB 1KYVA 3W7VA 2QD5A 5ALIA 4L5IA 4AJNA 2GEFA 1JFVA 1EFTA 4LV8B 2OXEA 2C88A 1PR5A 1FLAA 2JAPA 2P2DA 2OORA 2RIPA 2ODWA 3DAPA 5AVOA 2QG4A 1Z4KA 4YP9A 3I9NA 5HIKA 2VQEB 2NO1A 5JDIA 1BX3A 4A73A 1AG9A 2H92A 4FE4A 5C52B 1CUHA 3L05A 4UUQA 2YWFA 4AROA 5IEBA 5IYZA 5ALYA 2BHRA 3HSSA 2F9MA 4FYHA 1QHSA 1ES9A 1XRMA 2F3TA 3MMSA 4GP6A 4MMXB 1KI6A 5KSYA 3PPIA 4KAFA 1MXHA 5G4KB 5PNTA 3FKSA 1LI7A 1G3QA 1OFTA 2Q1WA 2HCFA 2H5LA 5HPYB 3A2MA 3X1XA 4EA7A 3CRNA 1QO9A 1PUIA 3VU8A 4Z3KA 1XP8A 3WSWA 4ND8B 1C3OA 3VH1A 3HDJA 1RHKA 2P9YA 3BWVA 1NSTA 2VRNA 4R1SA 5JSZA 1GVHA 2IHZA 3HJBA 4F2HA 4ZYVA 4DC9A 3ZIAA 1JLLA 1JJAA 5JSYA 4IOKA 4ZVOA 2P2YA 1Y1TA 4HBZA 5CJ2A 5I8ZA 3KE9A 3RBAA 2ZWAA 5DCUA 4I4CA 4A6PA 4HVCA 1P9RA 4URHA 1KZ7B 4W7HA 8MHTA 2PSDA 5DOZA 2WAXA 4R81A 1CXZA 2A0XA 2XB2A 4MGIR 3WISA 2R6CA 3QX9A 4I3HA 4ZT4A 1GAQA 3QX3A 1N6NA 2F4NA 5AKHA 1WWKA 2IS1A 1VMKA 2YIVX 4FHDA 4QTTB 4W5NA 5J2UF 3S1LA 5L6LB 3HKBB 4HPXB 2F43A 2JIZD 5DBFA 1C81A 2CNWA 3KM0A 4JGGA 2J0SA 2MWMA 3VC7A 4N0EA 5JG7A 2GHTA 1SOMA 2GSDA 3EEIA 2R8YA 3KXKA 3SBXA 3ROMA 1GUZA 2WKQA 4BNTA 1WU7A 4EO9A 4AIRA 1IU9A 3OOYA 1QR2A 2XAUA 1J0EA 4J0JA 4OYRA 4ZO4A 3SAJA 5FPKA 3QYJA 1XLVA 1SKUA 1QGUA 4OP3A 1NF3A 2HA4A 4U6NA 4QZVA 3ZTWA 3FIUA 3EBLA 4D3DA 1U4NA 1NR7A 1TZCA 2E4UA 3BMQA 3UA3A 2QTVA 5DGIA 2YN2A 4AG5A 5FPHA 3QPWA 3GQBA 1OOEA 2B8NA 1N92A 1ODSA 3ESXA 5LZ5A 5KS2A 5D7BA 3PXGA 3D5EA 1SVSA 1T5DX 1PNOA 1SELA 3ISVA 3OCJA 3Q3CA 4QDUA 1Z4JA 2A5YB 4X60A 2ZWVA 4MS4A 3RFVA 1AMUA 3RYHA 1PS9A 1X8KA 3TDKA 2A78A 2AFIE 5LCXA 4BGUA 3GT7A 3RFCA 3M2PA 2C2KA 3LUKA 5IP5A 4MEJA 2OVFA 4QBGB 5E9AA 1IUNA 5AVWA 1GZHB 1Q1BA 3PXCX 4NXMB 4KFUA 1Z18A 3UJHA 4TWAA 1P2VA 2XVAA 3DMYA 2BEWB 1ZCBA 4KOEC 3BBLA 2WAMA 2QM7A 4TLMB 2PS0A 5IDVA 4ND2A 3D8SA 4GMDA 3I4FA 4DF3A 1AE1A 1M8GA 1XI2A 4EGAA 5FAKA 4UE6A 1QRAA 2ZJ0A 4TV9F 1VBNA 2EBWA 3FPEA 3L8CA 3V8QA 2W6NA 2YVQA 2BM1A 5M04A 1JU4A 1V25A 2VHZA 4JT8A 3UHFA 5K0BA 2G08A 1KIMA 1V96A 5EIWA 5THQA 1HFKA 1WBDA 3WB0A 1OX4B 1X7XA 1ZW6A 2C3UA 2P9TA 4MV4A 1KMIY 1DBVO 3D43A 3GQVA 3PFCA 4MP3A 3W5JA 4Y9UA 1Z6XA 3WLJA 3X1MA 3THXA 1E18A 3R3VA 2R6R1 4V2UA 1PX2A 4EGFA 4F93B 2DUMA 5D3QA 1WF3A 4RLFA 1KFBB 1V48A 3FXAA 5K20A 3K53A 2J7PA 2ZBVA 1N5IA 3O2JA 1XAIA 4OHKA 4V2IA 3K0SA 1TYAE 1FXUA 2GERA 2NZJA 1J42A 5FO1A 3LZ6A 3NQ41 5ENZA 3UJCA 1S02A 4F84A 3R24A 4MXDA 2OBBA 4NFYA 1C3LA 4DA6A 4M87A 1RE0A 4PXSA 3I04A 2HF7A 2EIXA 1MJNA 3CLVA 4EQ6B 2CNLA 4PW0A 5BWOA 1TO2E 3P71T 1X8JA 5BOVA 1Q91A 2BI7A 1KEWA 1M10A 1PRYA 5IVKA 1EUDA 3B1VA 3KR9A 4W1PA 3WSTA 2V45A 1ATZA 3WNDA 2PXAA 4BFXA 4BMYA 2GCOA 1RJDA 1G8SA 3OCCA 4ARZA 3V5NA 1WB9A 3ICOA 4AX8A 2B8WA 2FWIA 1F7VA 3FH0A 3DEZA 4I5EA 2E4VA 1KEEA 4YRPA 3AHCA 2GBGA 4QUKA 3DZFA 5ALMA 4WJZA 3SF0A 2E5FA 3ESYA 4K5QA 3WGHA 3IC5A 5KNCH 1CW2B 2PRSA 3DOUA 1I94B 3IJPA 4LNHA 5IDYA 1FFYA 1W4BA 3CEJA 5DLEA 3TW4A 1SOVA 2IJGX 1C9JA 4N5HX 5G1PA 3RJ5A 4PE5B 3IQEA 4IILA 3DMTC 1BN6A 2B3DA 2JFPA 1KSGA 2CE2X 3FRHA 3K1AB 2C0PA 4HYQA 3U7HB 3JSXA 3NT5A 3ZI0A 2ZAGA 4M53A 2NAPA 4R1UA 2KSQA 1IIBA 4DB4A 4BMCA 4N54A 3W5IA 4OHVA 1SEVA 3KIPA 4DMUB 1V8FA 3JALA 2FPRA 5I9SA 1DEKA 3G2KA 4KXXA 4TN5A 2R44A 2ONKA 2RI0A 2XJ9A 3EW7A 4RIIA 3U31A 1EHIA 4C5CA 3IEPA 4R3UC 1Z0IA 2AMVA 4BCCA 4YRMA 1CT9A 5CA1F 4IHJA 4ZOEA 3SZGA 3U7QA 2NSJA 4EFMA 4FFNA 4I5DA 2HU5A 4UHCA 4P33A 2Q41A 1MAWA 2C94A 4ERNA 1LXCA 1OH8A 2CE7A 2HJHA 2WVJA 4KMOA 2XCQA 3PPWA 4KFSA 1DWQA 1ZJWA 3I72A 1WCV1 4ZCTA 2NTEA 2NZWA 3AJDA 3HNPA 3OIDA 4ZCIA 2J9YB 4WY2A 5KU7A 1E9SA 3KSZO 4XWYA 4ZWNA 4FFDA 1I4DD 2AHRA 4YV7A 4BO2A 3TRHA 1JKFA 1YVRA 3OOHA 2ZUFA 1ZR2A 4L7QA 1AK1A 2BR4A 3IQDB 1J4AA 3IUNA 1Y7IA 3LUFA 3NALA 3KEMA 3Q6IA 4G41A 4NBWA 3V7FA 5FQNA 3NU1A 1PTKA 1BVYF 2XUOA 3LP6A 3OQOA 4YMGA 5EXSA 5K8JB 1NX9A 4X1YA 4CV3A 2C7QA 4UTOA 4CLRA 1P39A 2I7DA 3LC0A 1X7DA 2G63A 4P4GA 3LVFO 4WK4B 3SJ7A 4UCFA 2YHBA 2ZVPX 3ZNNA 1RZRA 5DNAA 1Y9EA 2GF2A 4WESA 4Z8YA 4PFJA 3REGA 1PR2A 2QU7A 3IAHA 3NATA 4MSUA 1DZIA 1JHMA 4FQ7A 4IBOA 1SM4A 4S1WA 1KJ8A 2A1UB 2J5KA 3LMKA 5IKPA 1T9GR 3PP8A 1E5TA 1I24A 3F3YA 3FBTA 3HNRA 5I7EA 3P52A 4M86A 1U5BB 3ZLJA 1KDPA 2WABA 5G0UA 1O4VA 4LHVA 4FUQA 3C4JA 3TBHA 2C1EA 4MJ7A 4U7JA 4DWOA 2OYSA 4PAOA 1A8PA 2NU6A 3QFTA 4FYKA 1PYOA 4B75A 1VECA 1YAHA 3VXKA 2VCEA 4ND5A 1BD3A 3PF8A 1XZHA 1ZSVA 1AQYA 2X9LA 3CS3A 2ZULA 5SY9A 5FWNA 2YDXA 1WTAA 1WY7A 3NGLA 3ZGLA 3NJ4A 4PNZA 2EJVA 1QH1B 1FRZA 3GNLA 3SQWA 2D74A 3OFND 5G0TA 4DIUA 1CF2O 1VG8A 4CQMB 1BQ4A 2X5OA 3I0MA 3TB4A 4JVOA 1YQWA 2Q21A 3BXOA 5AJZA 4C1BA 3UCFA 2H9YA 4EYQA 5CK5A 4OH7A 4YALA 3W78A 2Q5FA 1Z33A 3N53A 2JZNA 4JQCA 4DIOA 4KSCA 2YYSA 4CV0A 1L2TA 3BDVA 3R3UA 4P32A 4UM8B 1CZUA 2PZ8A 5AUQA 2EARA 1JX6A 2Q7OE 4A03A 4IIJF 1F8UA 2DECA 1KJ9A 1N2GA 4LWZA 1VE6A 5BW5A 4FW9A 4DLBA 4IZ6A 3UUGA 1VGQA 3C8ZA 4KLAA 1PT8A 4L76A 4A10A 3OZXA 4F2WA 4DQXA 5HRAA 5AXDA 3NFRA 4I99A 4LC0A 3G7SA 1KE2A 2JZCA 4RSHA 5EJ4A 3WAGA 1KPHA 1HY3A 5FEMA 4NPAA 3NUZA 5EG5A 3H87A 4ZV7A 2I66A 4B4WA 4BLWA 5E9QA 1H2XA 4E3WA 4F6RB 3I5YA 1E99A 2YZ7A 4YRIA 1H6AA 1EFPB 4PNHA 4Q9NA 3GP8A 2HK8A 3DLHA 4OHOA 2IYRA 1HMPA 3RC8A 3QUQA 3ZE0B 2GZMA 1DWUA 4QQRA 1HTWA 4R16A 3O9VA 1F0KA 4FEYA 3LKDA 2YFYA 2OO5A 1QBGA 4W9NC 1JEYA 4WLVA 1XZAA 3AUTA 3FNQA 3ZQKA 2EQBA 3GC6A 2O2HA 1TDJA 2O0MA 3D31A 3OU6A 1F17A 4EKGA 3AERA 3TJZA 3E3MA 2DUNA 5KWEA 2A7XA 5I45A 3DE3X 2L0XA 1W75A 1X9HA 2YRFA 4HNRA 5P21A 1K6MA 1SXHA 1H23A 1FFHA 3GLGA 1XZBA 1J8FA 1SURA 1ZH2A 2Q4EA 1RJ9B 1R66A 3H1BA 3II6X 3PZRA 3RROA 4EJ6A 2Q6TA 2IS6A 2AVNA 2NO6A 1D6SA 3ET4A 4R8RA 2RGUA 4C22A 4Q24A 4EI7A 3AKYA 3A9UA 2OMEA 3FWYA 1QIGA 3ZJYA 3AEKB 1Y34E 2OV8A 1N5MA 4X5OA 1YIDA 2EZUA 1JS1X 2VHXA 2ZYDA 4JVLA 1AKNA 1IVSA 4GBED 4DIEA 2X8BA 4ZV9A 1VIDA 2O7VA 3LUJA 2DC1A 4ZEMA 5E7MA 4B3CA 1LPBB 4KYTA 2A3RA 1P72A 3ES9A 3PGLA 4FEAA 4UE3S 4XWGA 1RBQA 1W85B 4NY1A 5CVDA 3U3MA 4ZHQF 2NVBA 3AG6A 5IHPA 5ADVA 5AI4A 1KVSA 1EFDN 3EW9A 2JPDA 1Y4SA 5J5AA 4FDVA 2NT4A 1WE2A 3D6JA 3B6EA 4XUGB 5DT9A 4NL4H 4OL9A 3PE4A 3WXMA 2WIGA 1XF9A 3MBIA 4XSHA 1W25A 3LBIA 3C3BA 2VZ9A 4HN2A 4CU5A 1E1MA 1W6UA 2ZRAA 2RGNC 4FT4A 3WMGA 4N01A 4NBSA 1GU0A 3GFBA 2ZWOA 4RX1A 4BZQA 4E7PA 3SHVA 3EY4A 1C80A 5ITWA 4LMRA 2IOFA 4TV9A 3L8EA 3SYNA 3MINA 3ISJA 4ZZ1A 1HEUA 4TKZA 4I0WB 2OCLA 1BXRB 3HKEB 4REQB 2WHRA 2BCGY 3EQ8A 3AVQA 5FTKA 3SF8B 4B6FA 3QOWA 2BEJA 2C4TA 4LCJA 4XVHA 1BRTA 2AF3C 4NKRA 3LBNA 4G0UA 1T5BA 2F62A 5DM60 3R6WA 2VPWA 3EVZA 4FEEA 3ENWA 4HNHA 3DVQX 1FDWA 4UNIA 3VX3A 2PUBA 1N2SA 1HI9A 1VKNA 3D0RA 4OBEA 4OMDA 4OMFG 2WWVD 3KB2A 3AIKA 3QHPA 1JI0A 1IEWA 1S6YA 3EVNA 3IAUA 4BMSA 2PRKA 3GHHA 4IGFA 4LRQA 3F1KA 4JLNA 3B2QA 3KQOA 1G41A 3DKPA 2G04A 2LGJA 3NTQA 3W3ZB 1L1QA 1KP2A 1WHSB 3PUZA 4HGYA 3JD1A 2QL6A 2ORVA 2PTHA 3GCXA 2I7XA 3BULA 5ADHA 1UJ4A 3ZZTA 5B3JA 4O2LA 2QVXX 1J2UA 1VSVA 3C87A 2YY6A 3N8DA 3OPYA 2JI8A 4QBIA 2ZZNA 4X95A 3DL2A 2CW5A 3SLRA 3V2UA 4D5GA 1XKQA 4NBVA 1RAAA 3UMJA 4U00A 4IQFA 2R6DA 4KPUB 2OZVA 1NXVA 4P3PA 2QUHA 2YW9A 3MEQA 2QN2A 4L4RA 5CYFA 5J2TF 3U19A 4QYXA 1XNGA 4YRFA 4G1MB 3UAYA 1I7SB 1N5OX 5K4HA 2HB6A 2OBYA 2GYYA 2XUAA 2XOKA 1I9GA 5C32A 1C9KA 1ZC3A 5CJJA 2GEDA 2GSWA 4REOA 4YYEA 3O1JC 4ZOBA 1G8JA 1NBMD 3G1WA 2RHRA 4FCCA 3FTCA 5K3FB 4E0BA 1CY6A 4D42A 2H0AA 1ZIXA 2BBSA 4QVIA 5ES3A 3A6JA 1WKCA 1IM2A 1K0UA 1QFXA 5C7IO 5CAEA 4NQRA 5JAOA 3KU1A 5KKCA 3QSYA 4ZC8A 2ZJ7A 1MA0A 2QAGA 1FRQA 1JEAA 1ODLA 3BOSA 3HVJA 1CY2A 2H06A 3KHSA 4R3NA 1NDHA 4LYDA 2DSTA 2QLNA 3AXTA 1LVGA 5EWLA 1OZFA 3TLGB 3WWZA 3RQIA 3FCCA 5CA1A 3BM5A 4MS1A 1NYLA 1U2SA 1GU1A 5CFPA 2X13A 3VBEA 4LY6A 4PGFA 1OLXA 2NV6A 4G9BA 1PKXA 1Z07A 4OYYA 1S8AA 1SUDA 2XUGA 3BA1A 4TRRA 5BN4B 1ZAKA 2X0JA 1JHAA 2DG2A 4HAXA 3D6NB 2WHYA 1ETUA 1KERA 1A8IA 1S8FA 5F4BA 2P7HA 5BPFA 4EJSA 3UT6A 1C2YA 1YR1A 3AJAA 4H7IA 2B6HA 1G4UR 3O03A 4JP3A 4YP7A 4YAUA 1Q1GA 1JLSA 4C76A 4HS9A 1E7QA 3QKRA 4FI3F 3P1JA 2CXNA 1PJCA 3AI2A 1IQRA 1EGMB 2QPTA 4LY0A 3L0ZA 1QU3A 1HDGO 3WLEA 4AX4A 5B6PA 1CNFA 4NZZA 1AMNA 4MP8A 4YUVA 3NJRA 4QYMA 4DDKA 5ELXA 5JT1A 1W73A 2P11A 1LW6E 1X7YA 3V1KA 1BVHA 4INJA 1N2HA 2BFPA 1PNTA 1H8HD 1UWKA 3NC4A 3CNNA 1X1SA 3JQFA 4QOFA 3X2FA 1A7JA 3H1TA 1O5IA 2C84A 2CC2A 1N5JA 1XP5A 5AOBA 1LRKA 1YMVA 3U4DA 1FSFA 3C1OA 2GM3A 1ENYA 1ADGA 3DPUA 3QLUC 4FCWA 2FFBA 3L0PA 4UAJA 2QE7A 3WWEA 4BP3A 1T9GS 2GZRA 1ZVJA 3IO5A 3RQSA 3GPLA 1SIBE 1I0IA 3HZRA 2B99A 3TS1A 2X6TA 3BIFA 3QJ5A 1P80A 2IHBA 2ZYSA 3A6KA 4HVAA 2IUUA 3ZE8A 1M2GA 3OA2A 5ADUS 1D7AA 2VKTA 2DOKA 4KXLA 3NPMA 4N3GA 4U9UA 2DULA 2FCRA 1ADFA 1N8TA 3DOJA 4ZZ0A 3R7WB 3CB4A 4GECA 4ICIA 4QXRA 3G68A 4YRBA 1GKYA 4DWWA 3ENNA 4YJDA 2NYAA 5A9SB 1XZQA 1NI4A 1S2GA 1YBVA 3IT3A 3HGQA 3I5UA 3P4UA 4GD3Q 5I9BA 2C8VA 3ADKA 3FYCA 1XLTA 2YVUA 3EDRA 4PFKA 2HZ7A 4YV2A 1NU6A 4FT2A 1TPYA 5J5VA 2RFLA 1GYQA 1Z2CA 2FQQA 4XKJA 1LLUA 2X4DA 4L27A 3L4JA 3WNVA 4Z4IA 3FLAA 4Q7EA 2HGZA 3BXGA 4RIGA 4EL0A 5CDUA 5L7WA 4EQZA 4K9KA 4QUBA 1M0EA 3BK2A 3A3YA 3D4OA 1SXPA 3C3KA 2QTFA 3CH4B 3DMFA 3D7MA 2WT4A 3LY5A 1PJBA 3WBBA 4H60A 2AC7A 4IIJA 1UK6A 2P62A 1U3TA 4O08A 2YXBA 4JL6A 2B8TA 3CPSA 1TLLA 4F0JA 5M29A 1AJEA 2BFEA 2ZJ5A 5JS7A 4DEYA 4FFMA 4DW8A 3V1TC 4BFUA 5TC4A 5KYWB 1MG0A 2BEKA 1CB7A 2G0TA 3LY9A 4IGIA 1RQRA 1M75A 1IN8A 1QV6A 1KSHA 1V3TA 3NHSA 2XDWA 4R8MA 1EFLA 5B6JA 3O0DA 1Z68A 3GVPA 4E1VA 5DTIA 4KR3A 3BMNB 3QQ5A 4WZAE 2PGDA 1Z2OX 2JFXA 4FN4A 1Z4OA 3NT2A 1GPDG 1GG9A 4EKIA 4FYVA 3DPIA 5FOSA 1WD5A 4E2WA 1VPDA 2JI9A 2PWYA 4QHTA 4RXUA 5FHRA 2Z6VA 1IWPB 3PGJA 3QPDA 4HYTA 3DKIA 4IJUA 1FE8A 1RHJA 4ID9A 4IX9A 4BAZA 2F8SA 1BU5A 1YC5A 3N0VA 3QXGA 1MHPA 4CLXA 1DFIA 1YJAA 2GDZA 1R64A 3OT1A 4TX1A 1BHSA 1K3FA 5LD2C 5A9TA 2PCJA 2CYBA 5IHXA 2P4QA 4HDQB 5LZ2A 5PGMA 4OGGA 4Z8XA 1YRWA 1KBOA 2QJFA 2AC2A 3ZR4B 2J0QA 1Q1AA 3OMXA 1S8NA 1LBHA 1W46A 1HSOA 1RPJA 3KLOA 1F6WA 2YQ5A 4K8OA 1JR3E 3VDQA 1I2CA 4I6EA 1YS4A 2VZ0A 3BGOS 3JQCA 2AMJA 4IIXA 2VYQA 3FTEA 2RB5A 1EUQA 4CGZA 10MHA 1OWPA 4ENPA 1MC8A 1J6UA 4C0QC 1U7TA 3H9EO 3KHUA 3MT0A 2QF7A 4GRIA 1J00A 1JKMA 2HA7A 1ONPA 5EJGA 2ZRLA 2CUTA 3I6ZA 4UQPA 3ZHUA 3S70A 4ZN6A 4ZHQA 1Y4ZA 2CNOA 2QNBA 2RG1A 1SKBA 5K8LA 1JJVA 5I5GA 2H4FA 3EGDB 1CCWA 2FG7C 3IT0A 5EN4A 2REXB 4Z54A 5ICEA 1COWD 2DFLA 1RBZA 1ZXBA 5FP0A 2IU4A 2Q1YA 2Y6VA 4ZVKA 2P2ZA 3CG0A 2FR1A 2JFQA 5CT8A 2ACVA 4LI3X 1EQUA 5A5FA 4MV9A 1H8ED 1Y4DE 2AG5A 1V71A 2CVOA 3L0DA 1Z45A 4LVOA 3SGLA 3WLKX 3ZCXA 1WSWA 3D6FA 4BV8A 5JAPA 3IV9A 3G0DA 5I7WA 2VDKB 2FZKA 4WOBA 3IQGX 4G56A 3KXIA 4C08A 3RLIA 4QLOA 4UU8A 1F8GA 5KHAA 5T3YA 4BB0A 4TV8F 4YQFA 3KPUA 1FJXA 3NBFA 3WJAA 2QW8A 3TF5A 1FEZA 2Q29A 2ZWIA 4L57A 1IHXA 3M5PA 3CZ5A 4L8WB 3ER9A 1DX6A 1PNVA 2IYEA 1EP3B 2GF9A 1L7AA 4CCYA 1ZBDA 1CG6A 3A7EA 2WZQA 4P34A 5B4TA 3FETA 5IVPA 2QT1A 2CEAA 2WDZA 3E03A 3KYJB 1MA3A 1OCEA 1FP4A 4XVRA 4XB2A 1TO1E 2PU5A 3ILSA 1E2HA 4OG2A 2X7XA 2ZS8A 4WAUA 1CF9A 4HZUA 4RMGA 5AM4A 4R98A 3O1IC 4DARA 1A9QA 1HLGA 2OCXA 1XDDA 3OG9A 4K40A 4X71A 3ZIDA 1IWOA 4JWKA 1PK8A 5JWOA 1JQJC 3IJRA 4FSHA 1QAMA 3VKWA 4A9AA 4IQGA 3RODA 4OQ4A 2GXQA 4NBLA 1ZESA 3DBRB 1LLFA 3KL4A 4UVIA 2W90A 3SVZA 2O0LA 4I9UA 5AK3A 4Q7LA 4B82A 4ER0A 2G1KA 3U3ZA 3PCXA 4I4IA 4E22A 2ERYA 5K03A 1T1RA 1EK2A 2AFHE 3ILXA 4HTFA 4POAA 1AZSC 3TRKA 1XDGA 5KYUB 4DZRA 3OBIA 3TNLA 1JHVA 1BE1A 1OXXK 3C0KA 1ZHFA 2W9XA 3A28A 2VUUA 4G23A 2WC1A 2I8CA 2AGVA 1RWVA 1GEGA 2CUZA 3HI4A 1QQBA 5J2TA 3K09A 2ZDGA 1P1JA 3COSA 4MLDA 1MT3A 2DLDA 1OA1A 1PJ8A 1SCNE 4JP1A 3UXYA 4L8YA 2BHNA 2FVYA 2X0EA 1ZGBA 2WG2A 1Y81A 1GGNA 1S9HA 1ZOSA 2QG6A 2E5LB 5ENDA 1ZRMA 1LBQA 2KI5A 2LCFA 5H1YA 1QF7A 1JFFA 2VJKA 3T3EA 3VQTA 5CFMA 1T2CA 1TTPB 2EWWA 3EZ7A 2YKGA 4BNJA 1YU6A 1NP3A 3OM1A 1FX0B 3E84A 1KAEA 5KYYA 3RSSA 1U9ZA 1N8SA 1UIRA 1H0RA 1US8B 2ZSEA 4XEHA 4LY9A 5BSHA 5CW1A 1I5OA 1NW7A 4CM9D 2Z5GA 3MUNA 4I1RA 2IU6A 3MOGA 4LHEA 1IEXA 4QVKA 1Z8DA 4RETA 2E4ZA 2YMMA 3ST7A 2QTHA 3JQDA 1Q3HA 2EJBA 2QRVA 3N8HA 3O8BA 4MDHA 4NZPA 4TLAA 3EC7A 4UBMA 3A1WA 4ZVRA 5C8YF 2O8EB 1GPKA 3PBKA 3SXJA 5TPWA 5FOXA 3V7WA 1IBRA 4HX9A 1U31A 1XVUA 3STVA 1R9GA 2ZBGA 3QE4A 5ULLA 4JENA 2PSSA 4Q1BA 5D85A 3WRYC 2DBVO 5LJIA 2E18A 4FPXA 5F23A 1KY2A 1XJ5A 1SCUB 1H22A 4QKQA 6REQB 4JI0B 4K0KB 2C07A 3A3OA 2ZXFA 3PQ6A 1BCRA 1P5FA 5A7HA 2DHRA 4AJ4A 2UZ1A 3HBFA 3C8DA 2DUUA 3ZKAA 2O6HA 5EE9A 5IAJA 4Q9IA 1REQA 1WLYA 2AKYA 2CD7A 2QHXA 3ANNA 4TSFD 4MGHA 3L5KA 4ZQEA 4B79A 4WA7A 2LBPA 4FTWA 4UZEA 1CUXA 5EIBD 1J06A 4FYMA 3KYDA 4GVXA 5M7EA 1F2VA 5F3DA 3Q7TA 4ENQA 4WNCA 5JI2E 4OTZA 5TQ2A 1LI5A 1S3FA 1OB5A 2OM6A 4PG6A 3KKLA 3EIEA 3LWDA 5BN3B 1NTOA 4UFNA 4V0MA 3LKZA 4EAAA 2IYFA 1NF2A 1T13A 3NBQA 4RVSA 2B35A 3SC3A 1A3CA 3GLRA 3JVDA 3MNFA 2QGZA 4NI5A 7REQA 1DKRA 1KYQA 4BJHB 4G0VA 3AU8A 2XMDA 1JG1A 4DR3B 1U7ZA 3F8TA 1MDFA 3EG9A 1MH1A 1A5TA 1E5VA 4JUAA 4BE4A 5K2OA 5BWNA 3GZNB 4CCAA 3CJQA 3NBUA 3O6VA 6Q21A 2VUHB 3CEHA 1SBYA 1J97A 5D5PA 5BORA 2C5SA 3S1SA 4BY9E 3LECA 2MU1A 2BM9A 2ZQYA 1RTTA 1Z6ZA 3DLTA 4QVGA 3QPCA 3HH8A 1K75A 2VDVE 3DW1X 3MPOA 2FX2A 2YJZA 3LLUA 4B6OA 2AEJA 3HP4A 2PD3A 3A32A 4R7TA 5AXBA 5KYVA 3FGNA 1T9HA 3U39A 4BQPA 3B6ZA 3FYTA 3Q0EA 4ODIA 1U7DA 1KBZA 3K4QA 1VLJA 1MB3A 1NKSA 2IL1A 2ODAA 3CZPA 1TE2A 5HKKA 1R16A 3T5BA 5JAMA 4CQNA 4CHTA 4EFLA 1XRNA 1C50A 4AIIA 1NT4A 4RM2A 1WQ4A 1R7RA 1SD1A 3DA8A 3T52A 1DEOA 3X1JA 2ZBEA 3BMOA 3JZMA 1GL9B 1RKQA 1X6VA 2EFHB 3L7YA 3Q7QA 1J5XA 2PTGA 1JDBB 4TXHA 3PGMA 1U28C 3L1JA 5DBGA 5IANA 2BBTA 2JNWA 3CSDA 3PRKE 5FRDA 1NF8A 5CFNA 3FMIA 3NWPA 3HPQA 1F20A 1ND6A 4EHDA 3C97A 4MR7A 5FUMA 1GPAA 1MCZA 5EJMA 2VJQA 1ZLYA 4EO7A 2VPZA 3PD7A 4KJXA 1YKFA 2HCTA 3O91A 1WMBA 2VIIA 4GVPA 4YWHA 4NS1A 2PMKA 4P93A 3VGJA 4KSYA 1U63A</