4Y1GA

Sav1875-e17n
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
171
structure length
170
Chain Sequence
TKKVAIILANEFEDINYSSPKEALENAGFNTVVIGDTANSEVVGKHGEKVTVDVGIAEAKPEDYDALLIPGGFSPDHLRGDTEGRYGTFAKYFTKNDVPTFAIHGPQILIDTDDLKGRTLTAVLNVRKDLSNAGAHVVDESVVVDNNIVTSRVPDDLDDFNREIVKQLQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional insight into the different oxidation states of SAV1875 from Staphylococcus aureus
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus mu50
molecule tags Hydrolase
molecule keywords Uncharacterized protein SAV1875
total genus 59
structure length 170
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4y1gA00
1VCNA 3B3AA 4GUDA 4I2NA 2RK3A 4GE3A 4P36A 3ZJ4A 1J42A 2VRNA 1PDVA 4UNIA 1JVNA 1Q7RA 1K9VF 3ZR4B 4B5KA 4ZDIA 2V4UA 3NORA 3NONA 5K4AA 3UGJA 4AJ9A 3PQ7A 1WL8A 3R76A 1C30B 1P5FA 2NV0A 2ZUUA 3TQIA 3ZJ5A 4ENWA 1G2IA 2W7TA 4XLLA 1QVVA 1T0BA 4ENVA 3R75A 5SY9A 2R1TA 1CF9A 1GG9A 4WINA 5SY4A 1ONSA 2ZUSA 4LRUA 4UOZA 3PQ4A 4B40A 2GK3A 1FYEA 3B38A 4K2HA 1GGHA 3TTXA 2XF2A 3TTYA 1KWGA 1JDBC 4P34A 5BV2P 5JZMA 4ENSA 1PDWA 2OR3A 4PXYA 3MIIA 4RKWA 4JQSA 4MNTA 1KA9H 4P2GA 5DFAA 1KWKA 1CE8B 4Y1EA 1OY1A 1U9CA 2RK4A 4L8YA 3EN0A 3EJ6A 3CZ9A 4QYXA 3TTSA 4ZDJA 4UZSA 1VCOA 3L4EA 1GGKA 3N7TA 5E9AA 2VXOA 3GRAA 4HCJA 3PQ2A 4B31A 5SY6A 4LGYA 1QF7A 3UJNA 4AUNA 4D1YA 3CY6A 1FY2A 4R7GA 1OX4A 5IP5A 3CNEA 4ENQA 4E08A 3BHNA 2YWDA 2ZUVA 2R1VA 2YWBA 2YWCA 4P5PA 4ENUA 3F5DA 1GGEA 2D7JA 3MGKA 2AB0A 1C3OB 2VPIA 1QVZA 1P80A 1R9GA 3EZGA 3F71A 4MTCA 2A9VA 4Y1RA 1T36B 1KEEB 4L95C 1PV2A 4GE0A 1OI4A 2R1TB 4I4NA 3TTUA 3NOOA 1I1QB 1O1YA 1A9XB 4ZDKA 1QDLB 3L3BA 1IPHA 3NOVA 1GPMA 1IZYA 1GPWB 1N57A 4Y1RB 4L78A 4BIMA 1VHQA 3UK7A 4E5VA 3P9SA 3M3PA 1SY7A 4RKYA 4ENPA 3OT1B 3KKLA 2RK6A 4UCFA 4Y1FA 3SF8A 4ENTA 1L9XA 4OFWA 1I7SB 4MGHA 1QWSA 2ISSD 5LIRA 4AUMA 1S1MA 1SOAA 1P7ZA 4Y1GA 4ADSG 3OT1A 3SF8B 1Q2UA 3L7NA 3TTVA 3P9QA 4B2YA 4BTEA 3FIJA 2GHRA 2ZUTA 3SOZA 4I46A 3CYFA 4AUEA 1T3TA 3PQ3A 3NVAA 4N12A 5SYAA 1P7YA 2AD5A 3P9RA 3EWNA 2FEXA 1QVWA 4N0MA 1GGFA 1GGJA 4L7QA 1P81A 2YWJA 4QYTA 4ENRA 5JZOA 3R74A 4AULA 2WJZB 4OQ4A 3RHTA 1BXRB 2H2WA 1OX6A 2ZUWA 3VU3A 2ABWA 4OGGA 3D54D 4S0ZA 4OGFA 1CS0B 2R1VB 4L8WB 3ER6A 4ZGGA 2VDJA 4BFLA 3FSEA 1I7QB 4WXYB 1OX5A 4P35A 3WFZA 2IUFA 2NV2B 3NOQA 1PE0A 4L8FA 4Y0NA 3TTTA 1IZZA 1UCFA 3P9PA 4OIFA 1M6VB 3PQ5A 4B7AA 3UMMA 4UOQA 3EFEA 2R1UA 3UOWA 2VKTA 3B36A 3L18A 3PQ8A 4OJYA 1KXJA 3BWEA 3PQ6A 3TTWA 1OX4B 1VCMA 2LXNA 3CZAA
chains in the Genus database with same CATH superfamily
1FNBA 3EH1A 4W4TA 3CUVA 1U3CA 3W1VA 4WBSA 3WV4A 2RFLA 1EH5A 2GCEA 2Y0EA 1ULHA 3MOIA 1LS1A 2W2LD 2AL7A 3Q2KA 1T9CA 4MQ5A 3QFHA 1P2DA 4QHYA 1TDJA 4L85A 4RDCA 2WHYA 2VEOA 3TQIA 2ARKA 5I5EA 1C0KA 3E7DA 1E8MA 3LHKA 4BC1A 2K7FA 3T12A 2I6FA 1QF9A 4MDFA 4KXQA 1RBZA 3EAQA 1E3QA 1Y80A 4MB0A 2OQ2A 4M9QA 4MA5A 3VDMA 5LQUA 5JIBA 4DM4A 4Z51A 4FOSA 4G5OA 4GLBA 1Q7BA 1U2GA 4IVRA 4REMA 4XIJA 2FSFA 4KXMA 3M7IA 1IOLA 3B53X 4ACAA 5CFRA 4RAQA 1XU4A 2JFVA 2C95A 1EBBA 1YQ9A 3ZWBA 5J2UF 1W0CA 4AU1A 4EMBA 2GCNA 2VTBA 1J0BA 5E7JA 1MRNA 3WNVA 1J20A 3CLKA 1UXHA 4A82A 2DH5A 1XAJA 1XZDA 3Q7PA 1QH8B 1U8TA 2AV6A 2G9UA 2PMBA 3LCUA 1F2UA 2NO1A 2C31A 3NC4A 3HJRA 5LU9A 1T24A 2ZZMA 1EQ2A 1PL8A 2J30A 2ZSFA 3W6PA 4O4HF 2IPLA 2QN9A 4QAJA 4G8DA 1BIFA 1SXJB 5IDYA 5B7QA 2ZSAA 2YFHA 3QVVA 3HCAA 4F7WA 4Z7OB 3TJMA 2UYHA 4GE0A 4LHVA 1DOHA 2AEEA 4LYEA 3ZDXB 3ZJVA 2WI8A 1V9LA 1MCZA 4K1XA 4WA8A 3A4LA 4ZAXA 3VJKA 1A2KC 1MB0A 4U8HA 2Q07A 5L7WA 2ZJZA 2RGEA 1XJWA 1CY2A 1I30A 4PX9A 3ABZA 4INJA 3ZY4A 3FNFA 1W25A 1KIMA 2W6IA 1WA5A 1UPAA 2ZM5A 4JWTA 1QNLA 2L82A 4WCFC 10MHA 3HR4A 3GFFA 3P5SA 5IK2D 5CDHA 1L1FA 2QRUA 3CR7A 2I3AA 3Q8KA 1ZCZA 1S6YA 2LZ0A 1NBMA 1U0LA 4LK3A 4YC7A 2M6KA 5F7JA 3FHTA 4XYMA 4EA9A 1PT8A 1L5HA 1AGXA 3O1JC 3HB9A 4IQGA 1BC5A 1XTQA 1AUQA 3AKZA 2HZBA 3WYGA 3U4QA 1L5GB 2GZMA 1DC5A 1K5GA 2ADMA 4CJXA 1Z2EA 4FYJA 4ZIRB 3RHTA 3UJAA 4QUAA 1RJDA 5EE5B 2H57A 4AP9A 1OMOA 1AC5A 2A88A 2QLBA 5AVVA 5DU2A 3PC2A 4GM0A 3FDIA 1BD4A 3K5IA 3WFIA 2FPOA 3A9UA 3CX7A 3JARA 4EB6B 1ZNYA 1GFIA 3T54A 3VNQA 4GR9A 2RGNC 1RPNA 2ZIXA 1PEAA 4UNSA 5CLJA 1T25A 2L69A 1TCAA 1ZX1A 2I2XB 2JFYA 2ZSHA 5AOBA 1M2EA 4TT3D 3HM2A 4RZ3A 2B83A 2BBWA 4C3OB 2XSZD 1GR0A 5IN4A 2VDRB 1E0JA 2R8OA 2WIAA 4Q02A 3ZHOA 2F1OA 4QWWA 4S1VA 1NQUA 3KSDO 4RZUA 1SHKA 3THXB 3NAZA 4O2LA 3QITA 2J0UB 1Z4NA 2FF7A 5AI5A 2FPXA 4UEQA 3VR6A 3WMXA 1WZCA 2OGUA 1XBTA 1YRWA 1YHZA 3EWIA 2YZ7A 4M9ZA 1E79A 2QTWB 4D92A 1A1SA 1DQZA 2QL6A 4MCJA 1PR5A 5KAPA 4R3WA 2QGZA 2GWHA 3COVA 4AICA 2X77A 2XOXA 4NU5A 4R2JA 1CRQA 2Z5VA 4GFDA 2AFRA 2ZYWX 5AUNB 2QYOA 4O29A 4HFMA 4BVJA 2WUWE 2X76A 4X24A 1G19A 4X92A 1MC5A 1DTSA 1C81A 4PYJA 4QU8A 4AK9A 2NXJA 2WT8A 1UMKA 1AD2A 2JVIA 2ZBRA 3AEUB 3G1UA 3OIYA 4UTZA 1JWBB 3AU8A 2F8TA 1IY1A 1LLDA 5TVGA 3QKSB 1SK8A 4U7HA 4KH0A 4JIMA 4U00A 3WTCA 3B3JA 3A3YA 3L8CA 1QH9A 1JMVA 2JLCA 4PHFA 3WQQA 4CMKA 3GPDG 5U4XA 4JLKA 5AM3A 4ENUA 1TECE 2PT5A 4J3FA 1V16B 2X8LA 4J1NA 4A7PA 1TCVA 2ZYRA 4IX1A 5FWXA 3LIPA 3ZZ0A 1Q21A 2P77A 1X1RA 3LBFA 1QKKA 2NU7B 1CZKA 1PG0A 1PSDA 3EC2A 3KZOA 4WZBE 3C74A 2O9JA 2V7GA 3HDQA 3LXUX 2JD1A 4FILA 4QEDA 1U65A 4R6WA 2G04A 2GJ9A 4Q48A 4NECA 3SR4A 4DNQA 2X22A 5BSHA 1E7MA 1UDBA 4Y3UA 4D9EA 5CX1A 3RRJA 1RHQA 3DBLB 4ON9A 2ECOA 3LY5A 5ER9A 5AW0A 4LFBB 1BU5A 1Q19A 2BP7B 4M9RA 4Y1FA 3I4LA 2HXGA 4N9WA 1ITZA 4QYIA 1H6DA 2FUNB 2J32A 1P9RA 4JAVC 3COJA 4F4DA 2PZAA 4X6UA 3D4IA 1SZPA 1OHHA 3BIWA 4K87A 4NMXB 1BEUB 2QP4A 3L0DA 4O3MA 4I4TA 3Q4GA 2MYPA 2D13A 2TS1A 2ZGVA 3PQ3A 4MDHA 4OHCA 2ZXUA 4UHCA 1AUXA 1TO6A 2NMVA 1U1IA 1TMOA 4FEYA 2IE8A 4QELA 1U7PA 3D02A 5AKYA 1FP1D 3T5CA 4KO4S 4NF2A 1XD8A 1KFJB 2XKKA 1P2UA 4IIYA 1ZKDA 3B1ZA 1QRSA 3FJYA 3M5WA 3W06A 2IEAA 3HN2A 3U3RA 3UXYA 2FZVA 4PZEA 1QHHB 1O4VA 5EE0A 4HNTA 2BFDA 3LC7O 4NAHA 2Z4RA 3BE8A 4M98A 3JR3A 1BA3A 2GBIA 4I1UA 3QEMA 4DLLA 7AT1A 4ZRNA 1RLMA 4YCDA 2I5PO 1AG9A 1E2MA 1NXWA 3IAAA 3MAAC 1DBWA 1P45A 3WFZA 4F1WA 3IQIX 3EEBA 3EGWA 4G5XA 2JJ2D 2YFKA 3X1ZA 4IF6A 3KT0A 3TRHA 4HRXA 1NP3A 3IMFA 3QEMB 4C4SA 3B51X 4UHEA 3DHNA 4CM6A 3FOEC 2PYZA 3HS3A 13PKA 5DHFA 3T06B 4BRZA 5JHHB 4B3MB 3QVTA 1AH2A 2A6PA 4XVCA 1HTWA 2YVUA 3O3CA 1GRVA 1XKTA 5B55A 4BPRA 1R18A 3AUKA 4MB2A 1VGQA 3B82A 3TSYA 3FUXA 5E7IA 3O9MA 4NK4A 1ECJA 4AN1A 2FRXA 5FL3A 2NV0A 4BO8A 2AOWA 3PQEA 1EB9A 3CLTD 3NEAA 1O6CA 3GLKA 1P1JA 2PSDA 2X0JA 1QYVA 4O1MA 4KWCA 4NMWA 5H8WA 2FVXA 4M36A 2JK0A 1L7AA 1YS9A 4YI5A 3RFUA 2CHVA 3ZLBA 1ESMA 1NLUA 4BLSA 1MHTA 2R6CA 2ZI4A 2ZKLA 3D64A 3T99A 3TTSA 1GA1A 2H1SA 1E32A 2WHEA 5LQMA 4QJBA 1P4HA 1VG1A 5EPOA 2OORA 4X94A 4RVSA 4ER6A 4BKUA 3G7SA 2ILTA 5JEDA 3QA9A 1UPXA 2EWWA 2J9FA 4D4MA 4EGQA 4EK9A 2FY8A 2OECA 1BDHA 4C7JA 4REOA 3AJ9A 1T0HB 4G85A 4XIGS 2IPAB 1UBSB 3KE9A 3QNMA 3DEAA 3GFVA 3VNRA 4YJFB 1QK5A 621PA 1YBFA 1O6ZA 5JNWA 1DFHA 4PYLA 4DUGD 4EPYA 2W98A 2FF5A 1E3EA 2HO5A 1QLJA 5JS6A 5KX5A 2OO7A 1P2GA 1IZ0A 3JQBC 3PGA1 4LYHA 4RACA 2YKGA 3NYIA 3A06A 1TVEA 4N01A 4YCJA 2N3ZA 5J63A 3UTCA 4EG0A 1N78A 2JGNA 4KJZA 4IIVA 3A4YA 2ZQ5A 4JJZA 1A8IA 2XECA 2I8AA 1C5KA 2AW5A 2BHNA 5DW3A 3GBVA 1FP4A 3INNA 3EVTA 5AVJA 4RDIA 1YRYE 3AUFA 2UUBB 3CEAA 4GI2A 3KPWA 3OBIA 1ZCJA 2XVYA 3S3TA 1LJLA 2QVGA 3W4KA 5KHLB 3CZMA 1EX1A 4OYYA 1JFTA 1RCFA 1FTWA 4MGHA 2HIGA 3C16C 1B2RA 1VA4A 2VUTA 3HBJA 3UC5A 5GTDA 2PE5A 1F60A 5TPZD 3OCZA 5B1YA 1HDIA 2Q9CA 2WU3A 1TU4A 2JEYA 3DFUA 3OQ1A 2PX0A 3VPCA 3ZHVA 4D25A 2HC9A 4QA9A 1JWAB 2PS3A 4CV1A 3WI7A 2ZB7A 5C1DA 4JZYA 1E1DA 4HNAA 1FPQA 2H4HA 4RVDA 2SBTA 5I7VA 1ZH6A 4OQMA 1ESNA 1FNDA 2ORWA 2QZJA 2XUPA 4HB3A 4J4BA 1PEKE 1WW2A 2QR5A 4B17A 4OOFA 4AULA 4BVEA 3O7MA 1PEYA 2GHIA 3KXKA 4N3CA 1JJFA 5BWNA 1OC2A 4B33A 5KWEA 2IYNA 4RE5A 3UG6A 4YJ2B 5GOZA 3EH2A 3ZNPA 3JD0A 3L4BC 1CHDA 1MIOA 1TZJA 3PWTA 1T5IA 5EIOA 1HTTA 4IMRA 3BMCB 4EQZA 1ZK0A 1W88B 3L0PA 3OKFA 1U6JA 1VYVA 3WKBA 3SJBA 1AUVA 1DC6A 1K2WA 3CX3A 3SIXA 4CDRA 2B1IA 2YJ3A 4YQZA 1MX9A 4IW3B 2EZUA 4UOQA 2P2CA 3MHTA 1LC3A 2JGDA 3CVVA 4JVMA 2GNAA 1PJ3A 1FZQA 2ZRLA 3CS3A 1Z7WA 2EGUA 1C7QA 1ADYA 2O4UX 5AH0A 3WQRA 4AJ4A 1YOBA 4KWEA 2QUBA 3IA7A 1S5PA 4JBYA 1KRHA 1B16A 3DXFA 3O3MB 4X54A 3PKIA 3BH7A 3F6RA 1RC0A 2VIIA 4XQEA 5P21A 1M74A 3TL3A 3WYFA 1XVTA 4YVFA 1GPJA 5CLQA 2X8JA 1JJBA 4YYZA 4KNVA 2HWWA 2W8ZA 4DLTA 5IM4F 1QCDA 2D1TA 4PTLA 1WLYA 2YNMC 5ALHA 3WS7A 1QANA 2QX7A 1PAUA 1AQUA 2AN3A 3H1GA 5EHNA 5JVDA 2AUMA 2H8GA 1L7XA 4BZXA 3IV9A 3D6UA 3RASA 1X1EA 1QU2A 3TJZA 4MUEA 4BJ3A 4DCMA 1RR6A 1D2CA 3UMGA 2FFJA 2JFNA 3IA2A 4XE5A 2DQYA 2RHTA 5CK4A 4MZDA 1ORHA 2FU5C 2FN4A 2VNKA 3HDVA 4MDYA 3B2EA 1VB3A 5DGIA 3S1AB 3CG4A 4F72A 1LF5A 3STVA 1S8AA 1BA2A 2AWOA 2GKSA 5DJ5A 1MT0A 5DK6A 3ZCSA 4DS3A 4OX9Y 5C35A 3GZNB 4YMIA 4GGMX 1IG3A 4EI2A 5JNSA 2XCRB 2B5VA 1I80A 1NMQA 1W19A 2EYQA 4QXQA 4TYPA 2G9RA 2ECPA 2CUZA 1FDIA 3RJTA 3LUKA 2B1QA 2QQ5A 2OORC 3I52A 2BONA 4XYGA 2O23A 1FTQA 1KZ4A 1KSFX 3GCGA 3Q8LA 2VRCD 4TUYF 1RYYA 1KDZA 2ZYTX 1R5OA 5LLSA 5GONB 3T61A 2XQFA 1N9GB 2C4KA 1C9NA 2Z57A 4BMZA 3PUXA 1E1CB 2EKDA 3ED5A 2O2DA 3X1JA 1CUSA 3NOVA 4DSNA 2D54A 5AKJA 3VOSA 1JN0A 4YUAA 2O0MA 4J7AA 5DBIA 4XM1A 2VTBB 4MS3A 4KSCA 4QUJA 5EFZA 4DVJA 3OT1B 4L07A 1FQWA 4UMFA 5CFZA 1U8ZA 2IS6A 3K6JA 1U0GA 2EJVA 3H2IA 1RAFA 4W5RA 4YJ2F 3K70C 2LCQA 3LW7A 1AKVA 1I9GA 5CDFE 2RGUA 3GJXC 3ZU4A 3S4YA 4H3KB 4O6VA 3R4CA 1HR0B 2R86A 2I29A 4ZFNA 5JW6A 3O1IC 4KC0A 4UU7A 4HEA1 3WADA 1EINA 2CMHA 4IKOA 4S2EA 2O54A 1IRIA 2X1HA 4R2XA 1KH3A 2IA5A 2OE2A 3HNPA 4V1CB 2C5HA 2ZKIA 4EHBA 3OOSA 5TE9A 2QJTA 1J5XA 5HUJA 3OQIB 1XTTA 4D0SA 2IY9A 1QMGA 3G17A 4FGWA 1TZCA 1L5LA 1EX7A 1Y5MA 3DF9A 3PP8A 2Y0PA 3DZBA 3O8RA 1WPGA 2X5XA 2B6NA 4JKYA 3SZLA 4C3VA 2OZEA 1O89A 4IIEA 1XG5A 4WXYB 4AQYB 3T0IA 1D03A 2FPIB 2IZ1A 5KYUB 4I9GA 2QVBA 3TGLA 3FW1A 1II8A 1KIFA 5LZ9A 4JSRA 1N1MA 1OR8A 1R0BA 2YYSA 9LDTA 3R3YA 4BP9A 2C29D 2UZ0A 1IEQA 2ZAOA 2ZROA 4FU0A 5HCUA 4BGIA 5BP7A 1OWOA 5EY5B 1X14A 1UK7A 4YJ3A 5KNBA 2RCNA 1VCNA 3B52X 2IU4A 1E1CA 2RK3A 3LSTA 4UEWA 4X1YB 4WK4B 4XJSA 1DBQA 2VQ6A 2IDZA 3P9KA 3H2BA 2HBRA 1P6UA 1TOAA 1AKYA 1FRZA 2PPVA 2UYGA 3IPRA 1E1MA 1Y8QB 2ZUUA 3OG9A 4JBWA 5FUXA 1UBJS 3RTGA 1GEEA 5CLHA 5KWSA 2H7CA 4MUXA 4N6OA 1VJ5A 3ANYB 1SUAA 5JZVA 4YFYA 3NAQA 2P30A 2GK3A 3PUWA 3OLXA 4LF6B 2FQ1A 4IIBA 2IV3A 3WGTA 1EFAA 3G0DA 3CUYA 5HGXA 3U2QA 4Q5IA 5C8YA 4F9FA 4AJEA 1XPOA 3QELA 1D8AA 1UDAA 1VCHA 3OOEA 3Q1KA 1XYYA 4MVJA 1X7XB 3T1VA 1CWUA 1Y0BA 5LBTA 3SQNA 3WY9A 3NHBA 1Y6FA 1F0NA 3PIIA 4Y98A 5M7EA 2ZIEA 3NXKA 4XPZA 1APBA 1H0RA 3IE0A 1WCXA 1U9IC 1FDVA 1S2IA 4NNOA 3WOVA 4Q3KA 2C1EA 5B1IA 5TV2A 2XPCA 1QF7A 2XB2A 2K5UA 2FFQA 5DHPA 4PGGA 5ULLA 4A2PA 5A4FS 2WINI 3FDJA 1GLGA 3RNLA 4C9BA 5KYYB 3FGNA 5JCXA 1ACLA 2W2NA 4UTPA 4FMBB 2Y1WA 4UBLA 4DBVO 3QFRA 1TU0A 2AR0A 1H2FA 2ZB3A 3H5WA 3FZGA 3MELA 3OIUA 1FUUA 2MDTA 4GI1A 4IHJA 5KBYA 2AF4C 3KJNA 1Z34A 2ZBGA 1I4WA 5CA1A 1NLYA 2CJXA 3RRMA 1SC4A 2QMHA 2R4QA 2G1UA 3MT8A 4GR5A 3VPXA 1G8PA 2ZUEA 3F3SA 2ZIUB 3BGOS 5K7SA 1NI5A 1CG6A 3GLFB 4IHJB 5LIPA 4Y1RB 4M87A 5HQTA 3GRYA 5J2TA 2YXLA 5DI3B 1E58A 2YJZA 3WMWA 3IDQA 1RRKA 2PQMA 5F3WB 1ZK4A 1NQWA 1A8HA 2YZ2A 3GJ5A 1Y8QA 3T9FA 4OXRA 2VTEA 4N4AA 4QSHA 1UINA 3UAYA 5KPJA 5I01A 1E2PA 4BRWA 1TF5A 3GHYA 1RRGA 2A9QA 3CB2A 2H16A 3B1KA 3P9QA 2PUDA 3QPWA 4BO0A 2BFPA 1W4LA 4TKLA 1JIXA 5FTWA 2AOUA 4JYPA 3CW2A 1VL2A 2O3QA 2OK8A 2PEZA 4KJXA 4R1OA 5F51A 2I4OA 3AVWA 1J2JA 1IL0A 2XNHA 4EVQA 3U4GA 1UDCA 4A4DA 4J03A 4D9KA 2HR1A 2VS1A 3LG2A 2Y77A 3DB1A 5HBRA 4F4UA 5BYKA 2QSZA 4JVNA 5DHTA 1QFYA 3SBOA 5K03A 2AZMA 1R6DA 3EZLA 1OZ0A 5EMKA 4QYSA 1P7WA 4YRLA 1XC7A 3RIGA 5HKBA 2YIMA 4YGYA 3S7TA 5CITA 5T67A 1ISJA 1Y7PA 4HL6A 4C4OA 3ES9A 5CJ2A 3H2ZA 3BJIC 1Z25A 3L82B 5ADHA 1NW7A 4XVUA 1G20B 2NZYA 5ESXA 4M86A 3IPLA 2CFOA 4BE4A 1T1EA 3OZVA 3EG5A 1NMYA 4X97A 2F6RA 2VNHA 4ZCSA 4GKJB 2C3PA 2VF5X 3RTDA 1UJBA 5KDLA 4B6PA 3BMOB 3O8DA 4GE3A 1II8B 3ZTTA 1AQNA 1WR8A 2BGLA 3LWZA 1Y1LA 2K2WA 2EKLA 2ZJ8A 4RENA 1UJ5A 4Q4HA 4QXAA 2P79A 5DYIA 3L8EA 1HDZA 2W2OA 1LK0A 5KX5B 2I7TA 3BL8A 1VOTA 3IL2A 3OQJA 3BE4A 2Q2OA 3BFJA 5JDIC 3O4VA 4IINA 3RHSA 2AC7A 3K0FA 3EWAA 1W4ZA 1U1FA 1TYEB 3KLBA 1VL1A 5EZYF 3E22B 5TR9A 1DEHA 3TQSA 4H0CA 2VRCA 2D0IA 3S2ZA 4B82A 1XE3A 4C7BA 3PFFA 4UFPA 4ZA2A 5C1OA 3ZK9A 3CTMA 1JDVA 4RLSA 4Q7KA 3WKCA 3FROA 1NDHA 3EZNA 3ND7A 3Q0TA 1JR3E 3MK31 4L2IA 4RY9A 3GLSA 3QV1A 4AJOA 1G21A 4B0OA 4J8PA 3CH5A 1CUEA 1R88A 1W8DA 3BA1A 3MINA 4O08A 2JFBA 4X1KB 1TQDA 1WM1A 2IGTA 4XASA 5FDFA 4OV6B 3O84A 3ZU6A 1QYXA 4GOLD 3KSMA 1G3QA 2C3MA 3A1FA 3PZRA 1K8ZB 1LC0A 3GJYA 4P5PA 3ZK7A 4GP6A 7REQA 3N39C 4URUR 1ZU5A 4PLTA 4WLUA 4ZD6A 5HS6A 1U5BA 2JVJA 5BUSA 4TSRA 1UBKS 4Q1VA 3DV2A 1KEKA 2HI0A 2NUAA 3KPUA 4XWKA 2YZMA 4GO1A 5J2UB 2AMVA 1FFGA 2Z83A 2C9OA 4M7OA 4QO8A 3HE3A 4WHMA 5CHEA 3PHBE 5AYVA 3U40A 4CV3A 4GPIB 3TOXA 2H31A 3NFYA 1ECCA 1MJGM 4P3XA 1PDOA 1COWA 1SVNA 1KQNA 1JQ5A 1YZHA 4TM8A 1XEAA 2G17A 2ZJ7A 3JZMA 4FFOA 4YI3A 4RKYA 2IEYA 2V4MA 3BZUA 4I2VA 4W8OA 4MV9A 3LMKA 1DKQA 1UWVA 1C2YA 2EEPA 4E4RA 4F5YA 3O4HA 4RIFA 2VBIA 4DEYA 4GMKA 1MAWA 1P9LA 3GXBA 4TMYA 4RJTA 2C42A 4E70A 3EJWA 4DLBA 1MUUA 1TCBA 2WWWA 2PIDA 5HBGA 2GN6A 1WDKA 1NUHA 5JJBA 5BV0A 4A0FA 3VSEA 5DZSA 5I7OA 1GTSA 2YHIB 1K86A 4FZ3A 4N7MA 1E59A 4DM7A 1Q7EA 3VMMA 4ANFA 5C4IA 4Q3DA 1JR2A 2GBLA 2L0XA 3AYXB 1U2DA 2Z5FA 3NDPA 1DAPA 3PLNA 3SZRA 2IODA 2JARA 3TEMA 4DNXA 3CNQS 2OYRA 5I7WA 3AY0A 2CD9A 2QX4A 4Q9AA 1JMKC 2Y71A 1KK3A 2QNIA 4ZVNA 3UOAB 4BRSA 3ELYA 3MN1A 4C0BA 3N2YA 1EWVA 3C5WP 5AUPB 3B8HA 4G0ZA 4HFJA 3BDIA 3KSAC 2WYUA 1EFPA 1ZCAA 3M9LA 1F48A 5IJXA 3FCXA 1QHNA 3GZTB 2ZJ2A 1NXPA 4F6RA 5JANA 4RH1A 3D1JA 3FIUA 2B4KA 5A0VA 1F2TA 4MA4A 2JH9A 3HVHA 4DWOA 1AS2A 1Y8RA 2VPXA 3CGGA 4L0MA 3P2YA 4QJIA 1I7PA 2Y1OA 5F1PA 3R5SA 1VJCA 1NJ2A 3EVBA 4TL8A 3WAJA 4M8LA 1KEPA 1HE8B 1JPJA 3OE7A 1YKSA 3K9HA 1YC5A 3PTLA 3UMMA 1FSGA 2JIDA 3IQHX 1K8QA 1TK3A 3DEFA 1SRQA 1ODCA 1R16A 1SGWA 2A94A 2EL9A 3M1IA 2E0IA 3WYAA 2I2WA 4A0HA 5L7TA 1Y4ZA 3HKCB 1NNI1 2J07A 5ERYA 5TPZA 4BNUA 4LNHA 2X1LA 2EIXA 2A67A 3MMZA 3OIGA 4DG9A 1ZI9A 5FP0A 1S01A 2UVQA 3OC6A 4FYHA 1KI6B 2WD9A 2E4XA 1T9ZA 4UDXX 1YCHA 2ZI3A 1GP2A 3MB8A 2DPHA 3KZCA 3WRWA 3ABRB 3FZQA 2ANBA 1DHTA 2HQRA 1QVVA 4YXWD 3IIMA 2PSEA 4WA7A 1GUBA 4ER3A 5JAUA 5SY4A 3A2KA 3PXAA 1YUMA 4KDRA 4DREA 3VR5D 1ISPA 2GASA 3DCJA 4G1EB 1SQGA 1WD5A 2P9ZA 1MG5A 2I6UA 2Q3HA 2FP3A 5BMOA 4NQZA 1O94C 4EYQA 1EIWA 1V5IA 1OWNA 3MTBA 2WRZA 4N6NA 4QUDA 1CE8B 5FPTA 3IE2A 4J7UA 1M6YA 4AP5A 2AN5A 3PC8A 3LGXA 4HNAB 4J3NA 4GYJA 5AW7A 1YFJA 1E4EA 2RMKA 3TNFA 5L3RA 1U8YA 3HVKA 3TNDA 4TTRA 1GAQA 5L3VA 4RMGA 2H6EA 4DCOA 5IF3A 5ALGA 3K2EA 1JDUA 5DX8A 4XUEA 1XQ9A 3OECA 3HVIA 4QPPA 2HQOA 4MPDA 3O8CA 3DEYX 2ZJAA 1V9SA 3DOEA 2R8PA 3H87A 2H7YA 1V3UA 2P0EA 4GZ3A 1XL1A 2FG6C 3OEED 1I3OA 1LDGA 3RS5A 3WNZA 2CNOA 2OV2A 3NT5A 4OXXA 1MAVA 3GL9A 4UTXA 3RIEA 4V02A 3DEIA 2J33A 3MLAA 2FMKA 3EZGA 1WQ4A 1X19A 1ZOIA 2JCVA 3H3XA 3FLAA 5FBVB 5AD1A 3DFZA 4KACA 3LUHA 2WUVA 5AQ1A 4LMBA 3E84A 1EK2A 5B1DA 4JU9A 1LVHA 1R4MB 5C5DA 2OCIA 3DMGA 3TGWA 1YDHA 3L1JA 4Y2UA 2O2CA 3GLHE 3SXPA 4ZQFA 3G1TA 3WK6A 2C20A 4RLFA 4ZT4A 1QZTA 3NGXA 2XMQA 3M5CA 5DP1A 4AP6A 3EB9A 4D45A 1JHXA 1TAQA 2E1RA 1ZSVA 1KK1A 4W5JA 3OHMA 4IHAA 4B81A 4OB7A 3H4MA 5KTMA 4ECEA 4DV0B 4UVIA 1HLGA 3KTAA 5GJCA 4UFOA 2Y4NA 4G3XA 3U13A 4LKOA 1R64A 1V5GA 1M66A 2J0UA 4V2UA 4WZZA 2JKVA 2BM8A 4WEOA 2XCQA 5J4LA 4BN0A 2OG2A 3INRA 3L0BA 1XMSA 3R09A 3RSOA 3DPIA 4BCCA 4CU5A 3U4IA 2BW0A 2HK9A 4WWHA 4ZI7F 1OT3A 3U61B 2F2TA 1HX7A 4INPA 3OPYB 2GHTA 1M8GA 1HYBA 1B0UA 3OFKA 1KYXA 4RVUA 1SUPA 5COQA 4KIWA 3FKSA 3QLVC 5FTNA 4ZVPA 4HPXB 1TC2A 2UAGA 1D2RA 5CG2A 1U7UA 1Q12A 4HQRA 5ALLA 1CUYA 2Q7DA 4WBNA 2ZR9A 4WN3A 2FXIA 4GMXA 1B15A 1DCMA 3EYAA 3ZV6A 3N8KA 1G64A 3SIPA 2M9MA 4RQUA 1XCLA 3QM1A 1EHYA 4EUNA 2VSOA 1E79D 4OLJA 1SU4A 2XW6A 5FFNA 5LA6A 2W6MA 2ZT8A 3C45A 4F56A 2FPMA 1E96A 4M99A 4GOMD 1ZSNA 2C58A 3WSTA 1TVMA 2VRNA 4CMJA 1RKVA 2YMLA 2C5EA 5DI3A 4LRTB 3PF9A 1H2AS 3Q3EA 4B5KA 5C8DA 5K3EA 5LQRA 2ZUFA 2ODNA 3TZQA 3NWPA 2HNKA 3U3XA 4YT8A 5MDHA 2GXQA 1A9RA 4GIBA 5ALEA 2W7TA 1XWFA 3GLHA 2XSZA 4ZHQA 3U09A 3ELUA 1CJCA 1XJCA 2O2IA 3PR2B 4G25A 3SQOA 5A9TA 5BRNA 2FVYA 2QPLA 4LECA 4CG1A 3PEYA 1NYTA 1WMFA 5BV2P 1SCKA 1XHLA 4P58A 1SJ9A 4J0EA 4Q6WA 4O59O 4TV8F 3GUVA 1B93A 4Q3OA 2BDTA 2JZCA 3DCNA 4DXDA 1KP2A 2C2OA 1X0XA 4IZIA 4OYRA 5JFTA 2C88A 2OBLA 1J9ZA 2V54A 3QELB 4RWZA 1QE3A 2NZVG 1VMKA 4LBYA 1TMKA 1FP7A 5CBPB 5AWFC 2NXNA 1A9ZA 1OXMA 5TS2A 2WW8A 2CXOA 2NW6A 3RBZA 2X13A 2OCAA 4IY1A 2QR2A 4EUHA 2O3SA 3QFTA 2ZWVA 4ZCMA 2WILA 2DJ5A 4HLNA 2EGGA 4DA0A 4M0UA 4CIWA 1IXRC 3LF1A 2EP8A 5LZ8A 4TWZA 1AURA 5ABPA 1TKCA 4RJLA 5KNLA 2JCSA 1J23A 2PKRA 3U3JA 3QX8A 5BR7A 3D8SA 1SZJG 3G2JA 4WUVA 2PT7A 4B4KA 3G2KA 1DAIA 1ETUA 1QOQB 1S1CA 1BD3A 1XRJA 2BE7A 1Q22A 2NU7A 3ONWA 4OH7A 2C78A 2PLAA 5ALVA 5KQGA 5JOQA 3ER9A 1V41E 5IBRA 5MFPA 2JA1A 4C7VA 2WQ6A 3LPDA 2X3UA 2VT7A 3AZPA 3CVYA 3ELBA 3SP1A 3RRNA 3VI3B 3ONFA 1T5OA 3J7TA 1ZOLA 3BRCA 3FXAA 2AKEA 2P9CA 2PMWB 3GY0A 3R0XA 4GPZA 2W6PA 3TZCA 4D9CA 2OBXA 1YZNA 3S2YA 1JG3A 1SUBA 2CHEA 2LIVA 5TMPA 2I9KA 2C92A 3WGHA 3KO8A 2R7LA 3MCTA 4WJZA 5K8VA 3QKWA 3B5EA 3B2NA 3WYDA 4DW8A 2VBFA 1UM9B 5DMHA 2HXYA 4CLOB 3WRYC 2R6JA 3BJZA 4E21A 1H1DA 4A0SA 1YA4A 2A3RA 1E2DA 4EG5A 1L9KA 4WLEA 1A77A 3DR3A 4M1EA 3DMPA 1KBQA 3AVQA 1Y3AA 2O8FA 3BK2A 4Q9IA 2VEDA 4I3FA 3Q8XB 2HWYA 3T8YA 1COZA 4HWPA 4BMNA 3U19A 1Q3HA 1YK0A 4RDHA 4JEHA 5CDYA 4QVGA 1T5TA 3EPKA 1JAZA 1NF8A 3P9PA 4BQSA 1DLIA 1SIOA 2QYSA 1DQYA 4FFVA 1FSZA 1AHNA 1P7PA 3K16A 1N8TA 2H4ZA 3CZRA 2A1UA 2B4QA 3D0RA 4X90A 2XGSA 5BSWA 2YWHA 2IH4A 1DKRA 3HO8A 2GJ4A 2Z5LA 1SUIA 4QHSA 1W4CA 3HUUA 1P7CA 1VIMA 2IYYA 3BQNB 2CJPA 3PFHA 4TLAA 2H52A 3FKQA 1JVNA 4Y30A 5CRIA 5TARA 3U1VA 3WLEA 3K15A 2QN1A 1CP3A 1VSVA 3D0KA 3V97A 4BASA 4AJ9A 5C34B 2YICA 4IR7A 3UZUA 4WFQA 1SU7A 3GARA 3W8DA 4ARVA 4E6EA 3L8DA 1N6IA 3BM5A 1KDYA 3UB4A 3JAKA 1S4QA 2ZRFA 4G97A 1YOVB 2DCUA 2QPOA 4NATA 4YRDA 4MS4A 2YR0A 5FWXB 5B58T 1NVVR 3IT0A 1QG4A 4OU5A 3K53A 3CF0A 3D6NB 3OKCA 5MGNA 1IY8A 4GMFA 4AS3A 3PRJA 1D6JA 3DAYA 1C14A 3GU3A 3MT9A 1TFRA 2ZWIA 3PD0A 2A7QA 2ATIA 4HQ6A 4QQ8A 4PFQA 2FW6A 5AW1A 1H3FA 3EIFA 3ZU5A 2EBUA 1G8GA 1PL0A 4WDRA 2JAUA 2D5IA 3SYNA 4RTSA 2EC5A 3OSZA 1A5SB 1R6VA 1DRUA 1V4VA 3FGZA 4G0OA 3SAJA 1K5HA 1C0PA 4YY3B 1U2SA 2YFYA 3K20A 5K45A 4CQNA 2HLNA 5ERGB 3RQIA 4LSGA 1CFJA 4CDMA 5BURA 2E4WA 1YKGA 3N1UA 5EHXA 2PCJA 4JDPA 1PFVA 2YRWA 4U39A 3BRWA 1QJCA 1ELOA 1Y9ZA 3DP9A 3PC3A 1TM2A 3HMQA 3BB4A 3W04A 2BSQA 2B34A 4E3ZA 2GAJA 3CUUA 4JOSA 1Z6GA 3KWMA 4JI6B 1HYHA 5AK4A 1LX6A 3CKYA 1EG7A 2A1TS 3DYIA 4U6SA 4FYYA 4M1SA 1N32B 3CLSC 3W78A 3VC2A 2NU6A 5HF6A 4XW2A 3VVMA 4IV5A 1E6WA 3N2GB 1QIEA 3CT4A 1EUCA 2Q3MA 1D0VA 3LHFA 3DDOA 3H6HA 3OM0A 1SCBA 3P2OA 3VHLB 5LQAA 3O1HB 5C7IO 5CGZA 4BE9A 4EAQA 1PGJA 2NU6B 2IYWA 1GZ7A 3I9V1 2LD4A 1YL6A 3LI2A 4F9EA 2JLAA 4H27A 2LBPA 3MXOA 2B69A 2IT1A 4WLOA 1VLMA 1XA3A 1IJFA 3IT3A 3MOGA 4WNAA 1TQ6A 1EP3B 3R8XA 3HU2A 2X2OA 4J3JA 3A6GA 3RF6A 1SB8A 3ANMA 1RXUA 1M2FA 4TTVA 3SJ7A 3P4UA 1WZEA 3TW8B 2B78A 3DUWA 1TAUA 1VI6A 4EO4A 5CFPA 2BSXA 3UGTA 1X7WA 3OZFA 4GL4A 2X0KA 4JK3A 4FXPA 2PZLA 4OJTA 1XJQA 3GN2A 2QRVA 1YAJA 4G1MB 4BV2A 1GZVA 2BD0A 3I4FA 3JQ7A 4A91A 1WG8A 3JYQA 5E1MA 4PO1A 2IYVA 1JYSA 2RC6A 3TZ6A 4Q15A 2JZOA 1CUWA 5TGTA 4LE1A 4ABTA 1SEVA 2BGTA 1PJBA 4IM7A 4TMXA 4GYWA 1PG2A 2BMFA 4X9XA 3TLAA 2FRVA 3JSXA 4EW6A 1QAMA 4L5YA 4INOA 4LNUB 4FDMA 2D8MA 2PV7A 2N1BA 1VHJA 4Q39A 4YRBA 3THWA 1QR2A 2LE0A 3H83A 1VKNA 2FZ4A 4PGMA 3Q2IA 3ZHYA 4COOA 4ZEVA 5JYEA 4NDZA 1U7WA 2HQBA 4BX2A 3KEMA 5IJAA 4XGRA 3T9DA 2YVAA 2QDXA 1OLUB 1SC3A 4UAJA 2H17A 1IK6A 4X8MA 4Z0HO 4WJKB 5A5GA 2OXRA 2ATCA 2QD4A 5JAIA 5GV8A 4P86A 5D84A 3DMRA 4BNHA 4KFUA 1A0OA 4RESA 4KRXA 3VR6H 2GTPA 2DC1A 1Q2XA 3DZFA 4V2IA 5D5QA 4B6SA 1TLFA 1ZINA 1F0PA 2J09A 1HTBA 4IUDS 4ZEOA 3MGCA 4D6PA 3OMLA 3HA7A 1M7BA 4ZOBA 4MKIA 4QLAA 1VKOA 4V3CA 2HGSA 3WGIA 4YP1A 1SUDA 3AKYA 4YUZA 2WUGA 1SCUB 3A4NA 1ZP6A 4MVCA 4XEHA 1WBDA 2X40A 1EP2B 4D3DA 4GL2A 2IXTA 2R8ZA 5KKAA 3TW4A 1CULC 5ALXA 3M82A 3GJ7A 3KQLA 1ZUNB 1XZMA 5B4VA 2QXYA 1T4CA 1T2VA 4TYMA 4C4RA 2E6KA 2WZCA 1YAHA 1W6UA 5FUWA 2M1XA 3DZKA 2E4VA 2V1UA 3HSKA 4KWTA 4DDWA 1AZWA 1NMEA 2W6QA 1PL7A 1JV2B 4LDNA 4RL6A 3ICOA 1CDDA 4K9MA 4PS1A 1X9IA 3MHPA 4P80A 3UF0A 4BNYA 4FSDA 2F43B 4EPRA 1HSOA 1GDTA 1P80A 1EHIA 4AJLA 1SG9A 2V3VA 3CF4G 3C4JA 3GFOA 4O4LF 1RWWA 3ME5A 2E5FA 5EP4A 2QTFA 4NV0A 1HK7A 2O5RA 3ILYA 4KRGA 5DHRA 3K09C 5BQOA 1DIBA 5DXAA 1O94A 4K3UA 1R8SA 1KI7A 3DOFA 3A6HA 4MV8A 1G7CA 1FU8A 2WKWA 1UKBA 3BXHA 4PO8A 3NCTA 3VPAA 2DJIA 1US8A 2Q1YA 1UBMS 3GDHA 5EUMA 2XVAA 1IN1A 3O2JA 1BCSB 4H9GA 4YO8A 1G5HA 3UMBA 3WYBA 1NX9A 2PWBA 3LY9A 4BFUA 4Z99A 1C8VB 2CBZA 4J0JA 1BFDA 5FCDA 3OCYA 1IN4A 4F8EA 3TE6A 4QTXA 5I7AA 1UIMA 2NT4A 3MILA 2H4YA 4HMPA 2AR7A 5JD5A 3RABA 1D2NA 5GIPE 4R2LA 2ZATA 4TV8B 1PQPA 1GN8A 1UZMA 4R7ZA 3TLKA 4CCYA 3M6WA 5KDDA 1JWLA 2CKMA 4QDTA 2KS6A 1E7SA 1T2CA 2EG5A 4B3DA 3TF5A 4JQYA 1KZ6A 1YB5A 4RZSA 4MQEB 1KMCA 5FKJA 2I78A 3NATA 2WZDA 4MS4B 4RHEA 1BXRB 1EHCA 3LQKA 2Z8YA 4OQQA 3FHOA 3EA4A 3C2QA 3IVAA 4MP8A 3PUZA 4ID9A 5IBCA 2WTMA 5F98A 3NHMA 1FTYA 4WXEA 3B70A 3ZVRA 5J40A 3DBVO 3P96A 5A9RA 3BJMA 2IYFA 2QMEA 4YRJA 3H5RA 4DMMA 4CL2A 5CTJA 3HNOA 3Q3JB 1I1OA 3BFPA 4CIVA 5CGQB 5KNDA 5IT4A 1N0UA 3WNQA 1EKXA 4P82A 2QIOA 5E6UA 3ZDBA 4AXXA 2PZ8A 1ZESA 3LC1O 3AL0C 2UXDB 3EHEA 2GBLC 3I6IA 3K0CA 5ED0A 4BO5A 3LLSA 1PR0A 1XALA 3QMVA 2IW1A 2JC3A 2QLLA 5B2EA 1DELA 5ITZB 1PG5A 4J16C 5EWLA 3ZJTA 4M1KA 1CQWA 2OHOA 3RYCB 5CP8A 3E9DA 1KI4A 5CFOA 1N6NA 1VMDA 1DG3A 5HZGA 3KUXA 1XEXB 4ZVKA 3F5QA 1ZG3A 3KPJA 4HOYA 2OB1A 1G6OA 4JVLA 4RMIA 4WOCA 3KHKA 2H9IA 3EEYA 3OO0A 3QUAA 2Y93A 1DHRA 3KHUA 4W6QA 4C7MA 3NV9A 3ZHCA 2W2QA 3UUFA 1R27A 1L5ZA 2J9YB 3M6FA 1IQ0A 2H2IA 2FZGA 4HXYA 4L1KA 1KMIY 1WY5A 2XRYA 3GLUA 4HAZA 4LZLA 5CJPA 3I1IA 3OTGA 5JH7F 4HUQB 3NHKA 1QYRA 1DXHA 1V95A 1YD7A 3A37A 3WDLA 1DJLA 1CF4A 4HYYA 1JMYA 1OGYA 2ZRCA 1JJVA 4C4YA 2QENA 2QOEA 5E95A 1DWPA 3KR9A 3QYFA 3SLRA 3VVCA 2GEKA 4N5LA 3CNLA 1RQLA 3ND6A 5ICSA 4YDQA 1C7JA 2UUPA 6AT1A 2WG1A 1A2BA 3LPCA 3M6IA 3ZGVA 4XD7A 3R9XA 1E9AA 3TIGA 1SAYA 2YXNA 3HYNA 5I3CA 4H18A 4KLNA 1TADA 3TRFA 2O5VA 1HFJA 2YIVX 5NLLA 4JI7B 3P94A 1S2GA 4UXIA 1EJBA 5FEMA 5HF5A 2FSUA 2A0FA 5FORA 1HRKA 2HIMA 2XZLA 3THOA 4IFIA 1SC1A 3R3XA 1SWWA 421PA 4HDRA 2VJLA 4RFVA 3TD2A 3U4HA 4F2PA 1E92A 3V33A 1A9SA 3LSYA 4BO3A 1KAQA 1YS1X 1JDJA 1DBIA 2NYUA 3AU9A 2E4ZA 2ZRPA 3VR5A 4H3HB 1JQLB 4COKA 5B7PA 3JTMA 3IT1A 4US0R 5DHAA 1WW3A 3NCHA 3ZHRA 4OYHA 4Z9AA 4LXUA 4UREA 1DL5A 3H9BA 1OIXA 3M0EA 3OJOA 1QZUA 5DOVA 5CBPA 2CWDA 3JQAD 3WDSA 1HZZC 2E48A 2PBLA 3F5SA 1RQNA 1PZGA 1POWA 2JAPA 2HU2A 3EVAA 3NYWA 4H60A 2ZEJA 2ADFA 2GS9A 1TZMA 3D6TB 3L6BA 4PRZA 2D5AA 4LXXA 2A0KA 4UM8B 3GFGA 2Z5GA 3BERA 4HDKB 4OK3A 2GHRA 4I19A 4DLYA 4RTKA 1N36B 2I1VB 1JZQA 4GSLA 1HFKA 4N12A 4MW1A 4QU9A 2B8TA 2OGTA 4L4YA 1ONBA 3KYDB 1ZGAA 4XA8A 1YRAA 2B2CA 5G02A 4A2QA 2WM2A 3P26A 2GEBA 5JS1A 1R8QA 1U80A 1BTOA 5KYWB 2X2FA 3UMRA 4YV2A 3ACBA 1HUQA 1U0SY 1P2BA 1KH1A 4OP3A 2IOQA 1M10A 1ZJJA 1KO7A 2ACKA 2BGJA 2NU8B 3ZHBA 4B73A 2CNWD 4NENB 1LQ2A 3WV5A 1ST3A 1SMKA 2MMCA 4TN5A 1QHIA 5JPDA 2YV3A 2OHGA 3IBFA 4LOKA 5JWRA 4ZQCB 4LF9B 1WULS 4R0VA 3ACCA 1AMNA 1F6DA 1PQUA 4ND1A 3PV0A 4CEJA 2PGIA 2WE8A 3HR7A 3DE5X 4D9JA 4NX2A 4ARZB 1XKXA 4G63A 2A57A 4X6XA 3IAUA 3T3HA 5CT9A 1JHQA 2R66A 1GL6A 4HQNA 4POAA 2VSNA 4MRMB 4Y9RA 4N5NA 1QR6A 4BMVA 1QUEA 2WTXA 1H2HA 5JV5A 3TMAA 1Q84A 3FMOB 1QH0A 3O95A 4CT4B 4DHEA 4MVJD 1SCDA 5EKDA 3EDRA 1DMSA 4HZUA 1JLLB 1WF3A 1YJ8A 1ZZEA 1G2IA 3AXTA 3DWIA 2Y6VA 4MUIA 3ZX5A 1HT3A 2I2FA 3AFGA 3N2KA 4R83A 3NEPX 5LD2C 1ONSA 3DONA 3X1MA 1UH5A 3GJ4A 5ETJA 4C5AA 1LDMA 2NZ2A 1TQ4A 1NONA 1R00A 3CB4A 4ZK2A 2F4NA 4IDNA 2LVBA 4LHEA 1GNRA 5I9LA 121PA 2KPOA 3P9CA 5E2IA 2Q27A 3QW4B 3TWOA 3RRXA 3N07A 3KKMA 2V7UA 4XGNA 4JITA 3ADBA 2YINC 4E1AA 1U3VA 3D4OA 4EHKA 1DX9A 3G85A 3JVVA 5K1ZA 4DN6A 1WW8A 1M34A 1E4OA 2C2XA 3FNRA 4ISBA 1W8IA 2YVLA 4R8LA 2C61A 2A3NA 4B8YA 4LV6A 4IL5A 3OPYA 3GMIA 2OCGA 1O2DA 2WQZA 3OTQA 3PA8A 2NVWA 4B3CA 4M9UA 5A6VA 3OM1A 4MV7A 5KIAA 1FRVA 3ZEAA 3FVVA 1N92A 3GD7A 1ZC4A 3OLCX 2GPWA 4C2AA 3OHPA 3E3LA 2D8AA 5BQ3A 3C41J 1Z0JA 4BO9A 1HZJA 4H2DA 2VQDA 2C97A 1NVDA 2W2MA 3C3MA 3I92A 5BUQA 3SS9X 2C7PA 3UO8B 2GAIA 3O2NA 1CZNA 3ICCA 3PGVA 1ZBDA 1Q77A 2BEWB 3D6MA 3ICWA 4LMRA 1QCCA 3ZD8A 5DGXA 1E98A 1C3LA 1IEVA 3ET4A 3D43A 2RH8A 2OZLB 2CFSA 1ZHFA 4UM5A 1VG0B 4KBGA 5JS2A 4ALKA 3WQSB 2HPAA 4BWGA 1VG9B 3UMYA 5ER6A 3VU9B 3WJ2A 1CUHA 3R3UA 1MB4A 2QTAA 3T7TA 5E0OA 1KH2A 5CA0B 3HCCA 2J5KA 2P9TA 1RHMA 4LF8B 1Q74A 2BCGY 2CNWA 4JI4B 3IOEA 2J3EA 3AV3A 4GPD1 2BM9A 2VYVD 4ZOLA 4C3ZA 1O54A 5F9MA 3CUEF 4CCSA 1ADCA 4OHRA 1BQ3A 3STYA 1CIJA 3ZKAA 3ANSA 2I66A 3G9UA 4R2WA 4KOEC 1YR2A 4OI1A 1VPTA 1OBOA 1THMA 1NBEA 1D1SA 4PAGA 1UUFA 1TM7E 1CUDA 3ZGLA 4DUYB 4C4ZA 1IHPA 2R6GA 4M54A 1QIGA 1JX6A 1KZ7B 4B8WA 1SUCA 3TZBA 1Y6QA 2OCXA 2OZLA 3U7EB 1C0LA 3VC7A 1JFFB 1GU7A 3FDZB 2V1XA 2WZBA 4OHVA 3GFPA 1UWCA 1I1HA 1KR2A 4GBJA 1CY0A 2W00A 5EJ6A 1UJMA 2VHQA 4MS1A 5CFMA 4XOIA 1XNRB 3C8ZA 1XTVA 3GLRA 4WQMA 4CQJA 1CDEA 3GA7A 3A1EA 3PUYA 3SC6A 4CM9A 3UC9A 4CKWA 3RYIA 2GVNA 3I1FA 5EIWA 4HNUA 5C18A 4IIDA 4BKQA 2BJHA 4DQVA 5JJLA 3EIQA 4KQXA 4ZCPA 1VPWA 4IOLA 3H2KA 3ZIAD 1JL3A 4YR9A 1SUEA 1JHPA 3PCRB 4K28A 3GUHA 4NU6A 5JMOA 5SYMA 3DXXA 5DBHX 3MGBA 4ENVA 2E37A 5FO0A 1NSYA 1KGSA 2BSAA 3AVOA 3HTXA 2F8MA 1CRWG 3ELDA 1LH0A 5AK3A 1QP0A 1XEWY 2WIGA 1PR3A 2WAXA 1J2UA 3TRDA 3MQFA 1C9EA 1ZO8A 1E2HA 2BMAA 3QU4A 5AOCA 4D3YA 3PLAE 1HE2A 1CY6A 2G5TA 3HWWA 3MFYA 3EXHB 5FRDA 4IXDA 1RXYA 2MWMA 4IDOA 4TOIA 3CX6A 3VZRA 3DP7A 3IMKA 4JDUA 2RHRA 3ZWKA 1IYZA 1ONPA 2MJLA 3L7LA 3FOFC 4ZGWA 1NN5A 5CEJA 4OA5A 4GVLA 1B8PA 4TL9A 5EI5A 4BNLA 4GW3A 3NHAA 3J81A 3WDMA 2ID9A 2O0HA 2QTVA 3LXRA 3PPVA 5I9SA 5FI1B 1CLEA 2E2WA 1HYEA 2ZAMA 3FTPA 4LTNA 5EPUA 3KYBA 3USZA 3WA6A 5JUWA 4QTYA 3UPUA 1X42A 4JJ6A 1PSWA 3DKRA 1C7FA 3V8RA 2HH9A 5TMBA 1Z12A 3ID6C 4JLUA 3BMQA 4PLWA 5WRFA 2BWJA 1KYTA 5K0SA 1BG6A 1CS0A 3OIFA 1MA0A 5LDGA 4P83A 2NQTA 4DV3B 3LUDA 3VDXA 2XJ4A 3ABOB 3WWDA 5DIZA 4S04A 2QD2A 3HZRA 2FW8A 4IV0A 1ODLA 2PCLA 3HB1A 1HDEA 2BF7A 3AI7A 4HLUA 3HI4A 1YS2X 4RJIA 4XKJA 1O8CA 5EZ6B 1TCUA 4G01B 2GJAA 3KRTA 2Q45A 4JC0A 5JCZA 2I3GA 1ZD9A 2GZ1A 3N0XA 1LDYA 2CLEB 2FI1A 3M9XA 2NWQA 1H42A 1T5DX 1YDWA 4E5UA 1FXUA 1CRZA 3G02A 2CE7A 4MUYA 3EIXA 5SICE 2YN0A 4TRRA 4BNFA 4E22A 3ZKWB 5KUTA 1SOWA 2JHAA 3IS3A 4DRYA 5J2UA 4B3IA 5ADUS 4XVHA 1NC1A 2F1RA 2IQIA 2PWYA 3ADPA 3AUTA 3E7WA 1K7EB 3LYAA 3CPJB 4KQ6A 2M6RA 2QK4A 3DUFA 3D2AA 2DETA 3GNQA 3UYLA 2BELA 3NBQA 3ONEA 5B36A 4B6RA 3L4BA 5L6MB 5ITSA 4CDGA 2AVDA 3FSEA 1SHZA 2QTLA 3IAM1 4HEHA 4M89A 4OXKA 1JW9B 1P9NA 2G28A 3A9RA 3QXCA 1K6MA 4QUHA 4E5YA 1QTRA 5CYGA 2WUEA 2DLNA 2C99A 4FLEA 1UMDB 2W43A 1Q0RA 3I3SR 3TLCA 4REQA 4OQLA 2B7BA 1ZM2A 1KJJA 1U2EA 2E3JA 2NG1A 4WY8A 3PZBA 3THRA 2Q0SA 3WL8A 4DJTA 5ITWA 2FN8A 5JPIA 3TBFA 3ESDA 4J0IA 3ANTA 3QVLA 4M8NE 4JC8A 1M76A 3PTZA 4ZAZA 2PX6A 3AF4A 2PX8A 3E9ZA 5CVJA 1XDGA 3CVJA 3P0RA 1TTPB 4NYJR 4EFDA 4ZV4A 3V00A 5DWQA 3O83A 3ZV5A 4G0QA 4OBXA 4D9GA 1XRSB 2BGGA 3NR2A 5JMWA 2FEMA 4GWKA 3CMMA 4ZI5A 3ZWNA 1UEIA 1HQKA 1M8JA 3KC2A 1ZH4A 1G2PA 4UD6A 5KKNB 2KLHA 1NVVQ 4B6GA 1QX4A 3F7NA 4FNMA 4UARA 2R7AA 4JUAA 1P72A 2ID7A 2Q8NA 3IUJA 3FNEA 4KAJA 4RHCA 5DM1A 3RIYA 3O8LA 3PGKA 1RXWA 4PG7A 3RS0A 1BEEA 1YDFA 2G9QA 2REOA 3WL6A 3CLUD 2Z8YM 3GGCA 1I2CA 1IG0A 4KIFA 2F3QA 4XEUA 1VJTA 2BP7A 5AVYA 1WY7A 3VZQA 5K8JB 4XPIA 4Y2PA 3RU9A 2D3WA 1OJLA 1WUIS 3FB1A 3D9QX 4TGLA 4X7BA 5DHUA 2CSXA 1ENPA 1HE3A 2HMUA 2ZS8A 4MI1A 4QPJC 3UICA 4CMBA 4UHJA 4DABA 3THYA 1C3XA 2DE0X 4HZIA 1NJ1A 2CJWB 3Q3GE 4AURA 5B64A 5M5BA 4DANA 1E9RA 1KDPA 1JHMA 4Y2GA 4G0VA 3DE3X 5FBLB 4P81A 4FD2A 3U5TA 1L8LA 2AB0A 1ECGA 5DI9A 4QRHA 3ZLJA 2GF0A 2BPOA 3KALA 1NV8A 4JOQA 4YT5A 5IXSA 3F96A 3K2IA 3X2SA 1ZIDA 3AWDA 5LP6F 1SKAA 1XWIA 3R3SA 4YRQA 5HJ7A 4TUYB 5EC8A 4FE7A 4R2IA 5H3CA 4K9LA 1Y63A 3A31A 1TK9A 3OZCA 1O03A 2H4FA 4KCGA 5DLQC 4ZO8A 3SSAA 4JLDA 3HJBA 2XWPA 4V38A 1J56A 3U9TA 1SVMA 2P5YA 3HV2A 1DKPA 1VGVA 1RYHA 5DOZA 3WGNA 4L6IA 4EG7A 5CFNA 2W4IA 5FTLA 3OY2A 1CQIA 4CKCB 3ZDAA 2OFXA 1P44A 2CV1A 1Z45A 3OQVA 4GYKA 3K8QA 4LZPA 1YZGA 3QXSA 3H9EO 1JFVA 5K3BA 5BWLA 1IJKA 2I67A 2P9HA 1RC8A 3KAKA 4D26A 4BN4A 4B3JA 4AL4A 2F00A 2NO0A 2NYAA 3PRHA 1KMHB 3VO9A 3CH7A 5BPHA 4D56A 221PA 3T5GA 2O1SA 2FR1A 3TINA 2J59A 2OXFA 4AMGA 5J23A 4YR7A 4WK0B 3SIRA 2B61A 5FV4A 4NHOA 1GPDG 3GLQA 2TRSB 2EJCA 2JFQA 3JAKB 3V2UA 4AN0A 3BB3A 1NRXA 5J4YA 1E18A 3ICQB 5AUOB 2R6HA 1LJUA 1N0VC 1J90A 3VKVA 4XYLA 3O26A 4IQFA 3QFSA 4MYSA 4ESEA 2C5AA 4FYPA 4AJ1A 3KVOA 1E66A 4MP6A 3ZDQA 1PI3A 1N33B 3DL4A 4QASA 4C3UA 2W11A 4P84A 3NUQA 4WNYA 3EG9A 3BWCA 2WIBA 2Z9CA 2ZYHA 4M83A 4EKEA 1DQPA 4TRMA 3A1UA 3WTBA 3SDSA 3WNDA 1U3UA 3GA5A 3HB0A 1UXOA 4W8GA 3NDBB 5ICCA 1W6RA 4F92B 4JA2A 3JARB 1ZWKA 1W2WB 3K9FC 3TNJA 1GCAA 2J08A 1U31A 2EV9A 3A0RB 2DR2A 1MENA 5I8ZA 3GH3A 4G0XA 1AZSC 5KYUA 1BNCA 3SFZA 2VHTA 2VOEA 3AH8A 3SIWA 1HGXA 1XA0A 3EC7A 2QGNA 5A4KA 3NONA 3PWZA 3WB1A 1PWHA 3FYUA 3G6WA 5EP2A 4DIKA 2QUHA 2DBZA 3ITEA 4YS6A 4PU0A 1XVLA 5GGXA 721PA 4MXDA 2Q62A 1R0KA 2R87A 3CKLA 3L1HA 2QV0A 4MPPA 1ECLA 3STTA 3UUWA 1MO6A 5JYDA 3SSOA 1Y3IA 2Y99A 1M0WA 4ZANA 1D7AA 1TPYA 4LXQA 5A02A 5C5IA 5K8TA 3O7WA 2BHLA 1JG1A 1Q0PA 4E5MA 3FUWA 3P1JA 2O6HA 1P1HA 3D4PA 5BV8A 1YR7A 4C5CA 1G8AA 2CVOA 3LKDA 3WLMA 3BZWA 3CRNA 1L8XA 4EZBA 1YB2A 1L7QA 2AW3A 4FGSA 3UUEA 1J8DA 3EZYA 4HX5A 4RGBA 2QVYX 4DMLA 5TY0A 5MN5A 1G63A 3ROEA 4JY7A 3OA0A 4JSYA 5B7GA 2HMTA 5AJZA 2DBRA 4MAFA 4QYMA 2H18A 4RTOA 3SPXA 1EP9A 1GADO 2G83A 2F3SA 3BFXA 1G8JA 2DOKA 1E9FA 3H3JA 3NUGA 3OZXA 4RBNA 5JWHA 4M0KA 2RAVA 4BL5A 1P18A 2B1GA 4DA4A 2D1YA 3WGUA 2O57A 1C8BA 1OT5A 1E94E 2OEPA 5CAEA 1Z5VA 3ORSA 2BVNA 5D6NA 5GJVC 1G4AE 1OC4A 3VPDA 3LPNA 3TE7A 1UOOA 3A1VA 3W3AH 2J0EA 4YUYA 4MR9A 4RK4A 3T9BA 3ZV4A 4DNPA 4C21A 2OM6A 2IH5A 3GJQA 4ZVUA 2RB5A 3ZE8A 3RWOA 3C98A 3GOQA 4BTLA 3KWFA 1PRYA 3HA2A 2FWJA 2HA6A 3CW9A 3BXFA 3M4XA 5EXPA 4ADSG 3M1YA 5AUQA 3LPAA 2RGGA 4IHKA 1WDWB 1GTMA 4FI3F 2Z08A 4EP1A 4J0QA 3DVRX 4XJVA 4KYUA 4DFDA 4PXSA 5BMVA 2CFIA 3KQQA 1YR1A 4L7QA 4EYGA 1YZYA 1XO1A 1RYNA 1JHRA 5CLLA 4NCXA 3BA6A 5AQEA 5JXJA 4J0HA 3RSLA 3KUKA 1X1DA 1QIMA 3AR6A 2I33A 3GRVA 3TXAA 4C2BA 1N3BA 3OU2A 2ISCA 4X0EA 1L8OA 1KYVA 1IB6A 5D85A 5C1IA 4OPMA 4D81A 3IKTA 1TUIA 1WCYA 2XMSA 1EBFA 3GJ6A 3PXXA 5HEKA 4DDHA 1R0WA 3FSJX 4LY9A 4KX3A 3L92A 2WAMA 2FZCA 4JI1B 2W6JA 2W6NA 5D1HA 2LPMA 3A1TA 3GQBB 3PNQA 2XYPA 5ERXA 3SZGA 1WB4A 3C7AA 5IKMA 1FJ2A 3EGIA 1M6WA 4LTMA 3WISA 5BN4A 5BQPA 3DM9B 1ZN8A 4F11A 2XWJI 2NXWA 5M3BA 4NXNB 1B6RA 4X95A 4YPOA 1DAOA 1Q0ZA 1U7XA 4I4CA 4HVLA 2PGJA 2RB4A 2OXCA 2XBMA 3H5LA 1J70A 1SIUA 1HDCA 5L53A 2ENUA 1HLPA 1Z33A 4XCQA 5C46F 3C43A 2A0XA 2DHDA 1B2LA 4HGZA 5SY9A 1DCTA 3CRMA 3N3BC 4QYIB 3ZG6A 1MJFA 1JNYA 1OTHA 2XEXA 3AP3A 4O02B 3EASA 1LI4A 1NUQA 5CHYA 3AEQB 3R7AA 1QQBA 3P0HA 2C8LA 3OO1A 4MQ4A 3QOXA 4ZO6A 4QJ3A 1O5OA 1K1EA 4TLDA 4B7ZA 3VO1A 1S3FA 2GERA 5AFSA 4OXYA 1XRPA 3BBLA 4RD4A 2I6SA 2P9YA 4WIAA 3W5AA 1UP4A 3SR3A 3TX6A 4C1BA 4D02A 2V5UA 4D6XA 5I47A 4LJAA 1EFLA 3L4EA 3TSWA 1FYVA 3DDCA 4TTQA 4LNAA 2RJOA 2NUPA 3WGZA 1U3FA 3TQCA 2XDQB 1IPEA 3V3TA 3M1LA 4Y9DA 4EATA 1FY2A 2WZQA 1DTWA 4IZHA 3I12A 2B1JA 1QO0A 1JR4A 1LRKA 3FHJA 3TOVA 5DN6D 4UEOA 2IXEA 1DC7A 1K92A 4Q03A 1HE5A 4G6ZA 3H19A 4IJKA 4Q21A 1NLFA 2FX2A 4W63A 5CYFA 3BCSA 1KK2A 1SN7A 3WJ1A 4FYVA 4HF7A 4OEHA 5EKSA 4MR8A 1U2QA 1V8PA 3SM9A 5BW4A 1ID1A 2Z9BA 3SYKA 1WBBA 3EXIB 2A9KA 3C8HA 2HHHB 2GKGA 2I34A 1E3JA 1E99A 3KV3O 1GPMA 1A5TA 1I2DA 4JS0A 4NBLA 1CYDA 3KJZA 5GVRA 2XQGA 1SXJC 2ZI9A 3KKQA 3P9SA 1C30A 5CB8A 1DUSA 5GM1A 2PRZA 2WNSA 1CR4A 3LZDA 4ZTUB 3EFOA 3MZ0A 4FEAA 1F17A 2O3UA 3H84A 4D4KA 2WLSA 3K9NA 3EQ9A 3GFBA 5EZQA 2HSGA 2RI0A 3SFVA 3UG7A 3VHXA 5LIRA 3ENNA 2XQJA 4KXLA 1YT5A 3E27A 4H3SA 4MEAA 1ZJ5A 3AUYA 2LGJA 3QUCA 1XLTA 1I2MA 3ZZ1A 2IF0A 5AVQA 4B34A 3P52A 5AW3A 3A6DA 1IHOA 1A5ZA 3ND8A 4X3PA 3TLYA 3R2JA 2P91A 1OXSC 2DCMA 3CLRD 4ZAVA 3RHZA 4EG4A 4EW3A 4JMLA 4BN5A 1TT5A 3C5EA 1WVIA 4FHEA 2Y1CA 2G1PA 1K2VN 4M8KA 1XROA 2GOYA 3EF0A 4F46A 3R5KA 3GXOA 4URVR 2PX5A 3EISA 4GQBA 4OKNA 2VH5R 2HRRA 4K46A 1WB9A 3TR6A 2GPBA 1P2VA 1V6AA 2ATEA 3LUBA 3PWSA 3L7MA 1VZ2A 1KU6A 1MW8X 5A9SA 4UBJA 5DGTA 2O8CB 3KT3A 1NR7A 3RSQA 4H7PA 4Y2HA 3G89A 3B9RA 3A1CA 1I9CA 1RYEA 1JF8A 2IHBA 2PSHA 1X7ZA 3K4HA 3ONDA 1M9NA 3QUBA 4FFBA 4UTRA 1TGYA 2OHFA 4PC2A 3RG2A 3THXA 1U04A 1GZSA 3HR8A 1V43A 3B6IA 4C14A 1VXOA 2Z0MA 3VUFA 2XTNA 2YBEA 1TJ5A 5HF9A 3RUHA 8LDHA 3BPSA 4ZC8A 5F9FA 4YCAA 5EYPA 1U4NA 2NU9A 1QRRA 1LV8A 4WUTA 1Y6ZA 4MW4A 3MTAA 3ZR4B 2Q1XA 4PAQA 2FE4A 4UXHA 4ZCLA 3WL4A 3ZGNA 2X4IA 4RADA 1MGOA 4FDTA 1AF4A 3SICE 1ZCBA 2RAPA 1YH3A 1Z6XA 3ZHUA 3REFA 4M0LA 5DM0A 1E6KA 4KGVA 1IH8A 5M2QA 2AZDA 4AZ0A 4P2BA 2O2HA 1J8MF 3ICPA 4Y7CA 3C6QA 2Q5JA 3ZCUA 1AKUA 1UBCA 4PBSA 1XZNA 2IYRA 3HFRA 3OU7A 4JQSA 2ONCA 1HOXA 4S3MA 5CIQA 4XZ3A 4IPTA 1H9BA 1UDXA 1X3SA 2IBMA 4ZOQI 3MJEA 4NARA 3UXEA 4C0XA 4NYIR 2VYCA 4WN9A 5IKPA 1CUAA 4M0MA 4TMZA 4EA8A 2PUCA 3LX6A 1GZ6A 3SX0A 5BT9A 3TZHA 1T9DA 2QMOA 2PTGA 4NNPA 1Y1PA 4P3KA 3ZWWA 2BAGA 2JLXA 3ASYA 3L6RA 1V3QE 3DVAA 1ZVMA 2PFKA 2YWBA 3K8OE 9GPBA 1NI4A 3M2PA 3NHYA 4MQFB 4DADA 2C2KA 4OXQA 1K6IA 2UVPA 1CJBA 1JKFA 1YJXA 5AM1A 4GX1A 4LGVA 3SJZA 1P5HA 1J00A 2MT9A 4X44A 4Z54A 1DKOA 1H23A 3PTAA 1OI4A 1Z0ZA 4I4NA 2FSSA 3KXIA 1JDPA 1BCRA 3QVKA 3EXAA 3OWHA 3QVJA 1FDWA 2JLRA 1BMTA 3IDZA 2I7VA 1PJ8A 2FX5A 4DRZA 4EYSA 4KN8A 3HP1A 4KQIA 5EJAA 4EMSA 2VYNA 5JXGA 5KMGA 2YXPX 3LX4A 2GYYA 4I55F 4K6MA 4KHPB 1UT5A 1E9CA 2JJYA 1ZH8A 3AWIA 2P4HX 4N3NA 1EE1A 5FJIA 2OSVA 3K7EA 3I5MA 3ZXYA 4BLVA 5L3QB 1B6GA 1EE9A 3M70A 4L2IB 5EMNA 2HO4A 2XUHA 4ZMBA 2YS6A 2ISSD 4YO7A 4LTDA 5FWYB 4ZVRA 4HQKA 3UT5B 2YJTD 4LJ5A 1UXIA 4LA4A 4C1NA 3U6KA 3H1BA 2ZJ6A 1XQVA 2FKNA 1GILA 2YY6A 3L6EA 5MGBA 4EG3A 3NHPA 3KXDA 1KTVA 4XFDA 4B09A 5KOYA 4BRUA 3QLUA 1SKUA 4QJ5A 3AUUA 5TPWB 1IY2A 1IB0A 1QGUA 4B9EA 1QQ5A 4CM4B 3DVLA 2RHBA 1XDZA 4O0LA 4DL9A 3WMGA 1GAJA 4PFKA 4KLRA 4BCDA 3CNBA 3HUDA 5K8CA 2VAPA 3RVSA 3ZGOA 1GNPA 1MXHA 4F45A 1LPSA 1EEHA 3JQGA 2PLFA 4L8WB 1Q44A 4ZGGA 3UWPA 4YJGA 5IKXA 4PYKA 5BNIA 2BMEA 5FTJA 4BBAA 1FQOA 3Q9NA 1C4WA 1MB2A 1OX5A 2R11A 2Z6VA 4GI7A 2H2HA 4Q12A 3LAWA 1AHIA 1A8SA 1FUYB 4W5TA 1TKAA 1KRWA 3UJ7A 3E0XA 1AOXA 3AJEA 4GZLA 2PL5A 3NC1C 3L18A 1NKVA 1P73A 5BYJA 2G4CA 2FWAA 2WJ6A 3M6AA 4LRXA 1R5BA 2IIVA 1E20A 1OI7A 2DX7A 3F6BX 5DCWA 3S27A 1RPTA 2NTJA 1I2ZA 2FP4A 2GBPA 2YDXA 2ZVJA 3DT6A 3IP9A 3IPAA 4P5DA 4PYMA 1H66A 3NBUA 1OHHD 1EFKA 2DTXA 1QO9A 2PK3A 3GJ0A 4GI3A 4IEEA 4JI8B 1MNQA 5B30A 1IOZA 1JKIA 4FYIA 2OFOA 3IILA 3MUFA 2VJQA 2QMQA 1L4KA 3PHJA 5ARDA 2O1WA 2WWGA 2WF7A 2Y05A 4KTVE 3TRIA 2HJVA 3RSSA 5LVAA 1BXGB 4JR2A 5J9FA 1O96B 5E9WA 5E6UB 2NZXA 2E82A 1IAQA 1L5HB 3HUEA 4P4GA 3FDFA 1ZI8A 1ND6A 2DWOA 3A28A 4H6VA 1Q1ZA 1RYBA 4L74A 1AU9A 3N58A 5B1HA 1EGAA 1GG2A 2ZRHA 3SR0A 2JNWA 2OOKA 2R2AA 2QLNA 3CWCA 3G0OA 4HNSA 3GRKA 4X64B 5KYGA 2I6GA 4K03A 5CDTA 2POQX 5G3YA 1Z0UA 3O82A 3H7IA 1B1CA 1TVCA 1U28A 4IXNA 1DKLA 3QG5A 4E08A 2R96A 2AMFA 5CU7A 5C8ZA 5F12A 1L4UA 5JNLA 4R1QA 4GVPA 2KJQA 3K73O 2JDIA 5DLPA 1K3FA 1AX9A 3OPXA 4NMHA 5LZ5A 4MWOA 4OLHA 1D04A 1KI6A 1NHGA 4H59A 4KIGA 4PPQA 2AHOA 5HW0A 4J6EA 3ZY3A 1P0IA 2QTZA 2ZCJA 1MH9A 4H77A 2NGRA 2YY7A 3LBYA 3QEJA 1Q14A 1S2DA 2FA9A 5KTTA 2Q29A 2H0QA 5JQGF 1AKRA 1R3UA 2R47A 1A9XB 1I1QB 3ZXUB 4UMVA 1XDWA 4WZAA 5DHSA 4IGIA 4LJLA 4GH5A 4NJOA 2C3OA 2ZB8A 4U9HS 1EVJA 3FOZA 4ECAA 3ZW7A 4D8WA 1PR6A 3DBRB 1M0TA 1Y8RB 3RV4A 3C8MA 3ROKA 1UPCA 2IPMA 3BHMA 4OLFA 1GNTA 2YRFA 1IUPA 3JZAA 3NFRA 5I9IA 3CR3C 2B7CA 3TLBA 3Q9SA 4DIBA 1JHUA 2AN9A 2EATA 2HNBA 4XGQA 5E7QA 3NTOA 4WGGA 4M1MA 4R2MA 4PGAA 3TIVA 4HJRA 1XN1A 4RKQA 3NIDB 4YROA 4DDTA 2Y3IA 5DDIP 2HMAA 5J59A 2CHFA 2A7XA 5FAXA 3OX1A 3VU9A 2GYUA 2QQ0A 2Q0QA 4PRKA 1CVIA 5SYAA 1OLXA 3GEHA 2AWNA 4TV9F 1H5NA 4G65A 2PZFA 4PN7A 1ZNXA 2WPDA 2DQZA 4I50A 3WK7A 5AT1A 1RWBA 1SXJD 2Q1SA 4DB4A 3N0RA 1CCWA 1B8OA 4W7SA 1LU9A 3KELA 3TR0A 2QRKA 4OQYA 1ZAKA 3H6GA 4PG6A 2NP6A 2JJQA 3KD3A 2JAWA 3E9YA 1VL5A 4MWBA 4KMSA 3UKOA 5JRDS 2QMYA 2OQIA 4BO6A 5C37A 2UZ1A 1KO8A 4BFXA 2QUZA 1Y37A 4CKEA 4F2GA 2ZCUA 4G4GA 3ROPA 5JNTA 1EMDA 4W9NC 3E3NA 1PJZA 3KQVA 1FU7A 3DZ8A 1A95A 4KOAA 1RP7A 3H9JA 4MVJH 5DF1A 2EFHB 4XGKA 1OXKB 4BU1A 1AS0A 4Z4GA 2ORYA 1D2MA 1JUDA 1J2TA 1UR5A 4OUDB 4PHTA 1G3MA 1K98A 1UPUA 1XMXA 2YYYA 3T38A 1SKYB 3OKAA 1OYYA 1E5LA 1WHSB 5KQMA 4DLRA 3WKDA 4YACA 1FLDA 4EX7A 4MHOA 2Z3ZA 2X19A 4LXHA 3U4AA 1QRUA 4YH1A 1LZKA 2PY6A 1OV4A 4FW8A 4PSUA 5LU8A 2D0OB 3GVIA 3C6YA 2PT9A 3FAKA 5D5PA 4YAKA 3OBBA 1DADA 3CE9A 4ZJUA 3HJHA 4OI2A 4BLUA 5LKRA 2V8OA 3F3MA 1XZPA 3LY7A 3MCUA 1KE1A 2D2EA 4KUEA 4JLMA 3N2KB 2AH5A 3UAVA 3I61A 3FAZA 2WMYA 4IGEA 4PLZA 4BMSA 3RS7A 5A1TA 3G2QA 3UHAA 5CCXA 4JQCA 5AKEA 4LOJA 1PYOA 1MPXA 3L4KA 4KAFA 2C2YA 1U1DA 4IG4A 4UBKA 2DUJA 2Q4TA 2XYHA 4NRDA 4BCBA 4EO9A 2GEJA 1WHSA 1CTQA 5FUMA 2FW0A 5T6MA 4K0RA 5D87A 4A9AA 4YJHB 1IONA 2B99A 4TWBA 2E4AA 5T8KC 3IX7A 1N9GA 3EZFA 4U3JA 3EW7A 1EYZA 1NPDA 1NX6A 4KXXA 4WOBA 5IM5A 2BFFA 3A4VA 3F71A 4QT4A 3CJRA 3HB4X 4BFYA 5L95A 1HQCA 1SXIA 3G8DA 4MIOA 1PN3A 4FCTA 3OLYA 1CEXA 4HH4A 5JSKA 3TUJC 4F38A 4ZV9A 2IZ0A 4UEJA 4NENA 3RTCA 1ZHOA 1GU0A 4FEGA 2COUA 2VJPA 2QZPA 4JYCA 1K75A 5HE8A 2NUTB 3AR4A 4E5VA 5IAEA 5EN4A 1UEXC 4QBIA 1PHRA 2ZDHA 5IJZA 3MT0A 5FNVF 5HKOA 1OZAA 3KB6A 4JOCA 4NBWA 2CZCA 4LK2A 1EJ0A 3NM4A 4L3OA 1CIPA 4HNRA 5L4LA 3P2EA 1GFZA 1P4GA 1P0PA 3QYPA 1QQ7A 2R4TA 1U2RA 4GBMA 3RARA 5KDOA 4KGZA 4DIOA 4U63A 1J0DA 3GLIB 4ERNA 3CLRC 5LUBA 1HURA 4HEA6 2BFBB 2EF1A 3JYNA 1VKRA 1DJPA 3IBCA 1CUFA 1P7YA 4LV8B 5DP2A 3IDSA 2OAGA 4DXHA 2EKPA 2G82A 1U5CA 4Z9BA 5IABA 3JQPA 1QTNA 5ALFA 3MJTA 3MBOA 2PM8A 2CXQA 2CZQA 2J9GA 2YQ4A 3NXSA 3QTBA 3VU3A 1HNWB 3T5AA 3ORQA 3IC5A 5L9AA 1ISIA 2X41A 2XHEA 4H7EA 3E7PA 1KJWA 2NNLD 1IZ9A 3DULA 4CM3A 4E51A 1JIQA 2C5SA 3UGKA 3STWA 5F64A 2PU5A 1E0AA 3A3OA 3PGMA 3K94A 3N0WA 3L40A 4JL5A 2IUFA 1UKYA 2FW9A 4UQOA 5HQJA 3ZZMA 4E2FA 4WEQA 4KXFB 3BGIA 1GTG1 2J3JA 2WJ4A 3FZNA 4V39A 4LJRA 2E9SA 1USIA 1XTSA 4AG3A 2C4NA 1D0SA 5I48A 3ELWA 3JRWA 1QHYA 1W88A 3LHDA 3B3QA 3UWKA 3CC8A 5M04A 1OX4B 5CA1B 5GJWC 4AY3A 1EB8A 5BT8A 3QY0A 3AR3A 2REBA 1D2HA 4RVGA 2R25B 4PBRA 3KVVA 4AZ0B 4H7IA 3UGJA 3GLTA 3DLBA 2CCJA 2D00A 1NPYA 2QZZA 3QG1A 2FLVA 2VYQA 3N75A 4QUIA 5I7RA 1KBOA 4QARA 1TLTA 2LRHA 4OQEA 1GXSA 4D9BA 1YZUA 5KWVA 1WUJS 2R1TA 4B3FX 3ZI4A 3AOEC 3TAUA 1KDRA 1YVDA 3JQ9A 3KP1A 4R7TA 2A9JA 3QVSA 4NEGA 1KEUA 3WBBA 3KB1A 3S5JA 4DC9A 1VBNA 3OMXA 3MIIA 4XRRA 3MNFA 3U3MA 2GNOA 3HKBB 4JNKA 4AIIA 1PW7A 3O4IA 4R0MA 5FB3A 3OAAD 4Q7JB 3RJ9A 4FI3C 4GZ5A 2B4YA 5EOVA 4UHFA 3TLGA 1TF7A 2NSLA 2XUQA 2ZBQA 5EE1A 3RK1A 4D79A 5KPDA 1HBJA 3TD6A 4EFNA 1XWWA 4I8XA 4CQMA 1V11A 2J31A 4QICA 2ZE8A 5KINB 1KHTA 1KPGA 2XXAB 2P2ZA 1MVLA 2AOUB 2MR6A 1H93A 4QU5A 3ZQ4A 1BROA 4P3NA 5KTYA 2GPJA 1FFCA 3AK4A 3ZHTA 3GB9A 1OBHA 4CLOA 1D4ZA 3ZE9A 2JW5A 4PONA 4HGPA 3SG0A 4GR4A 2Z1MA 2YS7A 4ZAGA 4FMCF 1DRWA 5FR1A 5H80A 3NB0A 1CQPA 3BDAA 3P0FA 1YQGA 1Q11A 4ZREA 3G13A 2V6FA 5K0LA 2YHSA 3PVZA 1IBKB 4IIJA 1UPBA 1NXTA 1MEEA 2ZPAA 4ZZ0A 3JZFA 5FXMA 4ZDKA 1GNQA 5B2FA 1EFVB 2RHJA 3GVXA 3KZKA 3LBAA 1JPUA 1UT8A 3SE0A 3SNHA 3OX3A 4Y9TA 1V0JA 2GH1A 5DISB 5F2OA 2WD8A 1RRVA 4BLRA 5EKUA 1ZD1A 4CR6A 4MS1B 1H1LA 2D0DA 5LQDA 4NXMB 2DM6A 1J25A 5D3MB 1AV7A 1I24A 2O50A 4XVRA 1XCMA 4FQ8A 5CDSA 1T6NA 5JRZA 1VHTA 1Z47A 2YASA 5FF9A 1M5RA 2W2KB 4NVRA 2CJFA 2MSCB 2XQVA 4EBFA 1G41A 1Y82A 3BTVA 3D8TA 3GJSA 4HAXA 1E1NA 4HQLA 4G4JA 5F77A 5CMLA 3I2GA 3UV3A 1ORIA 1DG1G 3DWGA 3FPHA 1ZFNA 1Y5NA 4KG7A 3O92A 2O7QA 5D3ZA 1OB2A 3K70B 3EVGA 4LWZA 4MCIA 4EVSA 2IY7A 2QP3A 5BVHA 3WLSA 1Z2OX 1UJ4A 3D7KA 2FLKA 2QVLA 1QK4A 2VNAA 4KNWA 4Q6BA 4AF6A 3SX2A 3ISTA 2WWHA 5KOHA 1WOMA 3RW9A 3T3EA 3HC7A 1FLAA 1NW4A 2R6R1 1EFTA 5HYVA 1QVRA 4G9GA 1PNOA 1I4DD 1XTPA 2RIPA 1PWZA 3MJDA 4IXWA 3ABIA 5EJ8A 4NDNE 2BGRA 4EH1A 2HWKA 1FFXA 1M1YA 1MN6A 1PJRA 3ZV3A 4HWOA 2Y67A 2A4MA 3UIEA 1UFVA 3RRZA 1EK1A 2XE7A 2DPXA 2HLDA 2QRJA 1T3HA 1Z22A 1PE0A 3IPCA 3TTTA 1DI0A 2P6PA 1CY1A 1XCOA 3DZGA 4RH0A 2O8EB 4R0NA 1NQTA 5HK8A 9ATCA 1AHHA 1KKUA 2ZSJA 3E2MA 3WLAA 1KEEA 2FPSA 3ZKWA 2H3HA 1XXHA 6YASA 4CIAA 4HZUB 2VP5A 5TC4A 2RONA 1QE5A 4I2NA 2GKOA 1ZM4A 2V65A 4DGQA 1WXXA 3QP9A 1UQUA 4R2HA 3N0VA 1QX3A 3F7MA 1HA3A 3BL5A 4RXMA 4IBOA 3HA3A 2O8VA 4BXOB 5EL0A 3LNTA 1KC3A 3MC1A 1NT4A 4ZVLA 1EK6A 1KR5A 2DPLA 2Q3DA 1BZYA 2EJBA 2QBYA 1JFRA 1M6HA 4OHYA 3ONNA 1IUNA 1WCIA 4MRNA 5K9ZA 2FE1A 9MHTA 2UZ4A 1B8UA 5DX0A 3TTYA 4MWGA 4EA7A 4II3A 1YZFA 4CTJA 2ZAIA 4GEGA 2HLDD 3C3JA 4FZRA 1XP5A 5HX7A 4WBNB 1L8QA 3WLKX 1H6CA 1V39A 3WLHA 5BVGA 1T4MA 1PQWA 1OU0A 2B82A 1QFJA 3CO5A 3TGPA 2J4CA 2I2AA 3L6OO 1KOGA 1FDRA 4M1ZA 4B31A 4BNGA 1IHXA 3Q7QA 2X1MA 5AK6A 3MT7A 4PZ9A 2KYRA 3B78A 2B37A 2CUTA 3EULA 4WLNA 3TEFA 5K8UA 5KVAA 4YA6A 4R84A 3RUIA 3F90A 1TEVA 2QIPA 3BHNA 3MJSA 1WHTA 1VI2A 1U28C 4Q47A 2IHUA 2RHCA 2WJGA 4WKNA 3V7NA 2IU6A 3DJYA 1KOJA 2P2DA