4Y1GA

Sav1875-e17n
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
171
structure length
170
Chain Sequence
b'TKKVAIILANEFEDINYSSPKEALENAGFNTVVIGDTANSEVVGKHGEKVTVDVGIAEAKPEDYDALLIPGGFSPDHLRGDTEGRYGTFAKYFTKNDVPTFAIHGPQILIDTDDLKGRTLTAVLNVRKDLSNAGAHVVDESVVVDNNIVTSRVPDDLDDFNREIVKQLQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein SAV1875
publication title Structural and functional insight into the different oxidation states of SAV1875 from Staphylococcus aureus
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus mu50
molecule tags Hydrolase
total genus 59
structure length 170
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4y1gA00
5BV2P 2AB0A 3TQIA 2ZUVA 1P7YA 4L7QA 3UJNA 2YWDA 4GE0A 4AULA 2W7TA 3PQ6A 3PQ8A 4OGGA 3N7TA 2NV2B 5LIRA 3CYFA 1JVNA 2A9VA 3BWEA 3EJ6A 4UOZA 1I7QB 5SY9A 4ENSA 4D1YA 4ZDJA 1KA9H 1C3OB 3CY6A 2H2WA 1FY2A 3NORA 2RK3A 4P35A 4B7AA 4Y0NA 3NOVA 5SY4A 3ER6A 4AJ9A 4QYXA 1VHQA 4ENUA 1Q7RA 2YWCA 4B5KA 4Y1RA 3EFEA 1QWSA 2V4UA 2RK6A 4XLLA 4ENQA 1R9GA 2GK3A 4LRUA 4OQ4A 3BHNA 2R1TB 1WL8A 3VU3A 3WFZA 3CZ9A 3P9PA 3PQ2A 4B31A 4Y1RB 1M6VB 4UNIA 4P5PA 2VDJA 4Y1EA 2IUFA 3TTVA 1S1MA 4E5VA 3NVAA 3SF8A 4ENTA 4P2GA 4ENPA 1I1QB 1J42A 1K9VF 1SY7A 4I46A 5DFAA 2ZUSA 5E9AA 2AD5A 3SOZA 3RHTA 3R75A 2VKTA 4UOQA 4OGFA 1QF7A 4L8FA 4B40A 5K4AA 4HCJA 1IZZA 5JZMA 4L78A 5SY6A 4GE3A 3SF8B 3UMMA 4GUDA 4PXYA 1OX5A 2ZUTA 4RKWA 4RKYA 1I7SB 4OIFA 2ISSD 3EWNA 3TTWA 1KWGA 4ZGGA 1PDWA 3B3AA 1GPMA 3EZGA 1A9XB 1GGEA 1C30B 4AUEA 3UGJA 4L8YA 4MGHA 2VXOA 1GGFA 3ZJ4A 4ENRA 1BXRB 1O1YA 1T3TA 4BTEA 4E08A 1GGHA 3L3BA 4JQSA 3PQ5A 3TTTA 1GG9A 3CZAA 4Y1GA 4R7GA 2NV0A 3M3PA 3TTXA 3UK7A 4S0ZA 1P7ZA 1P81A 3R74A 2R1UA 2RK4A 1T36B 2LXNA 4L95C 2ABWA 4MNTA 1IPHA 3PQ3A 1N57A 4K2HA 5IP5A 1P5FA 3EN0A 3NONA 3NOQA 2XF2A 3TTYA 4UZSA 2D7JA 3R76A 4QYTA 4ZDKA 4MTCA 2WJZB 3F71A 2R1VA 4OFWA 1KWKA 3F5DA 1G2IA 3D54D 1OI4A 5JZOA 4Y1FA 1Q2UA 3MIIA 4L8WB 1CS0B 1PDVA 4AUMA 3B38A 3P9QA 1OX4A 4P36A 5SYAA 4ADSG 2R1VB 4BFLA 3L7NA 3P9SA 2YWJA 2ZUUA 1P80A 1U9CA 1GGJA 2FEXA 1UCFA 2VPIA 1CE8B 4WXYB 4ENWA 4AUNA 1OX6A 1GPWB 4LGYA 1OX4B 3FIJA 3GRAA 2VRNA 1QDLB 3MGKA 2OR3A 4I4NA 3UOWA 4BIMA 1GGKA 3L18A 3CNEA 1VCOA 1PE0A 3L4EA 3FSEA 1PV2A 1ONSA 4ENVA 4P34A 4OJYA 3TTUA 1OY1A 1KXJA 1T0BA 3ZJ5A 4B2YA 1CF9A 3B36A 1QVZA 2YWBA 3PQ4A 1JDBC 1KEEB 1FYEA 4UCFA 2R1TA 3KKLA 1L9XA 4I2NA 1SOAA 1QVWA 4N12A 3ZR4B 3OT1A 1VCMA 3TTSA 4WINA 4ZDIA 1IZYA 4N0MA 2ZUWA 3PQ7A 1QVVA 1VCNA 3NOOA 3P9RA 3OT1B 2GHRA
chains in the Genus database with same CATH superfamily
1F6BA 4FFBA 3ZQ6A 3G8YA 1RS0A 5MN4A 1WW3A 3BRWA 1P7YA 5DM4A 4LJ9A 1N4AA 4EB0A 2Q2VA 5DI3B 4YP0A 1FFSA 5JPCA 5AW7A 3PGVA 1XROA 3AF4A 1HZJA 2ZRBA 1MG0A 1KNQA 1NBMD 1ZMRA 4L0MA 1JAIA 4LWQA 4D1YA 4ZP1A 2PG3A 4EATA 1H6DA 1XZPA 2R2GA 4NMMA 5I7FA 4CEIB 3C43A 5JADA 4QZVA 5A5EA 4J9UE 1GADO 2ZS9A 2BTEA 1JEEA 3WHPA 4B6EA 3FKJA 3PENA 3VHRA 4UHKA 1DMSA 5JSKA 4IQFA 2Q21A 3L9XA 2WUGA 1DOHA 2M6SA 2FP4B 3FPAA 2AR7A 4RETA 4P4TA 3WMXA 3KLNA 4C1BA 4BO1A 2C2ZA 2O7NA 2IS4A 4I7EA 4DLZA 3ZKWA 3IAAA 3Q9LA 4M2LA 1EIWA 2QDXA 3D9QX 1QIIA 3HCNA 3BYZA 3BMNA 3F0TA 3FSGA 4HXFB 4WZBE 5KREA 3SF8A 4EJMA 1OJ7A 2AQHA 4I50F 3ZCVA 1YI8A 2V9PA 1JPNA 4Y6LA 1E92A 4XRRA 3CNQS 3LY9A 3HY4A 3BKWA 4YJ3A 2E21A 3AW8A 4HLQB 4M7OA 1IXKA 3HU2A 3KYCA 4GE3A 1M2WA 3T1HB 1ZD1A 5K03A 4XQCA 2G7MC 5AK0A 1QV6A 3KCQA 3RRMA 1DBPA 1TUIA 1NPYA 2ZJ3A 4BFWA 4JA0A 4FMCB 3LCUA 2Q1YA 3CW2A 2WHXA 1NC3A 4FMDB 1R9MA 5AK4A 3ZJYA 1QHEA 5SYNA 4G0XA 3RC3A 2OV3A 3LDAA 4OMCA 1O1YA 1FF9A 1DG9A 5HVNA 1OBVA 4JL6A 1ZL0A 3M49A 1PLJA 3KQSA 4UQPA 4Z3KA 1NSFA 1Y8CA 3AKDA 3D6MA 1N3BA 2Q4OA 3T3HA 1CUEA 4YRJA 2FZVA 4A10A 5C52B 4HAIA 1C0LA 1G8AA 4Y30A 3R74A 4I1PA 2JD0A 1U7OA 3PGXA 2EEPA 2VT3A 4DJEC 1U5CA 2WTNA 4G0QA 2H00A 5LBIA 3NONA 3A1TA 5K8VA 3NASA 5FUBA 4C20A 4PN3A 3IDFA 4QYTA 3EG9B 3TLYA 1AZTA 1B1AA 2G67A 2JJ2A 3JQCA 3H65A 1UJCA 1X0VA 1K8RA 4RIGA 2V6IA 5AVZA 1Y8AA 1OI4A 1U2RA 3G8AA 3OJXA 5K2OA 2WJYA 3ISTA 1W29A 2B0JA 2N42A 4DF3A 4TVKA 3KYDA 1PRYA 3NXKA 1T0HB 4N3NA 3IEVA 1MO3A 4WQMA 2I6GA 1LQ2A 3H9QA 2I55A 4G0MA 4YA6A 3BXEA 4J75A 3CRQA 4NFHA 1ZW1A 4WE3A 1WJGA 2O0LA 2Q6TA 1PJ3A 4GVLA 3T4PA 1O9BA 2ZAGA 5JIBA 5KNCH 4ZTUB 2ZWVA 1BS2A 1Z34A 3MFYA 2Q1TA 2YV1A 2QQ5A 2C84A 1XTRA 1XXLA 3C0KA 3JQ9C 4GSLA 4KPGA 4RZHA 4JYCA 2UYHA 2O8FA 4C3VA 3ZYCA 4BLTA 1CJMA 1OIVA 1SUFA 3E23A 4UAUA 2GZRA 3DT9A 1XE3A 3AYZB 3RUDA 1GA6A 2C7QA 4FYYA 3EQ8A 4BVFA 5CFRA 4M7WA 4JA2A 3C3PA 3W6ZA 4HPJB 2HIGA 4OAOA 1L3CA 4G56A 3CZ4A 4XUGB 4ZT7A 4URVR 2NMVA 2OPBA 2O23A 3BH6A 3TEJA 3U56A 1Z0UA 4UPVA 3IT0A 5A1TA 1VCMA 1Y3IA 1IUKA 1Q12A 5L3SB 3ZGVA 4IBOA 4X20B 1ZONA 3R3WA 1NL3A 2FKNA 1R16A 1V7CA 1G8MA 3WWCA 3UB4A 2CNKA 4LJ4A 4X41A 1ULSA 1QNLA 4JXXA 3VJMA 1C3OA 1M7BA 2C95A 1BA2A 3CN7A 5KTPA 3DWFA 3KHSA 4D0NA 1NKSA 1C0IA 1ZM9A 4LRQA 1BJRE 3PP8A 4JY7A 2OE2A 1A96A 4O4LA 1CJUC 3WQQA 1VPDA 3IAM6 1GZUA 3LI2A 3I9LA 1M1UA 5K3AA 2IV3A 3VZCA 1X8JA 4B2IA 1U3DA 2QYHA 2RAVA 3HCRA 5JSYA 2A8YA 1SBHA 5U1PA 4WASA 1QE5A 1TCCA 2O3SA 2O3TA 3COVA 1I2AA 3GARA 3GEPA 3CE6A 4J2OA 2R1TB 4LWPA 4WVFA 4XUEA 3OZRA 2ASEA 2X8JA 3THYA 3HUFA 4U2BA 2FKAA 2ZCVA 3DM9B 3MCZA 5D1HA 4R31A 2IYXA 5LQSA 3C45A 1JH8A 3QW4B 4KQHA 7ABPA 2NUBA 2ZR9A 1WUHS 5P21A 4D57A 3E8MA 1IPEA 2HZ7A 3C3CA 2XYVA 3E9QA 4F4UA 1GNSA 1ZD8A 3QFFA 4QQNA 3K5WA 2VSOA 4UOQA 3IB3A 4QYSA 4D9HA 3EG5A 3SHVA 2QL5A 5AVWA 4NJEA 3KHTA 5LKAA 2B3TA 3AQ4A 1U1GA 2G1JA 3UY4A 3X1ZA 2NXCA 3NIDB 5I45A 3G3EA 3KWLA 4FFWA 3EFHA 4DA7A 3ZWBA 3N0WA 4BEBA 3CR7A 1V16A 1F3LA 2EXXA 1IG3A 3G0IA 3GFTA 4TL6A 3SLKA 4AUEA 2FUCA 4PC1A 1M8KA 1VG0B 4NEGA 3MAAC 4AZ0B 5AVUA 4MKZA 3WYNA 1E4YA 1F6DA 1A7UA 1K4MA 1IL0A 2XKJE 4KYUA 4QG7A 4R51A 3S27A 1PL8A 2WG1A 4D96A 1PGOA 1UFKA 4MZDA 3UBMA 2WABA 3G8CA 2QORA 2UUCB 4HLUC 3BHIA 1QHYA 3MTAA 2PMCA 4YECA 4DLXA 2YV2A 4JLDA 5EZ6B 3V2UA 2BAGA 2I6SA 3PSHA 3Q7PA 4S2UA 1BAPA 4DQVA 4MQBA 3D54D 4JBWA 5JZOA 1K6MA 4MI9A 2OC4A 3HU3A 2DPHA 3F5QA 4RHXA 3ROPA 4KDCA 4CMIB 1LDMA 1L7NA 1NKVA 2HWWA 1LLUA 3GLRA 2PZJA 3TGPA 1WBBA 4R1PA 2E89A 3S44A 1IOZA 3CNLA 3JRXA 1DKOA 1SOUA 3FCAA 4JNCA 4RAQA 3PXUA 5DLPA 2JCXA 4MGEA 4U02A 2SKEA 3ILXA 2H57A 4JSTA 4JUCA 1EBUA 4G6ZA 3O7MA 3VPSA 5EJIA 4WSOA 2FRVA 4QXRA 5JYDA 1NHGA 3M8KA 4CKZA 4IPTA 4EQZA 4EZEA 5CX1B 1JHRA 2XQKA 1WE2A 3T4XA 2W42A 2EWMA 3F6RA 2W8BB 3JVUA 3PXBA 3R4VA 4WY8A 2O1XA 4BEVA 5KOIA 2D1SA 4ZALA 3RGGA 5C51B 3FAKA 3R7AA 3ZE0B 4YUYA 1KDOA 1XTJA 1FFAA 2KPOA 5AHXA 5F1YA 4DR5B 3LYAA 3WIVA 1RSZA 4XDYA 1L4MA 4OXYA 2EIHA 3UFBA 2E5LB 1QXSA 1VKRA 2AOWA 3THWA 2IPLA 5TGZA 4EG3A 2OUKA 2RHGB 1FUKA 4KO2S 1JU3A 1IY0A 4Z1OA 3RHZA 2V6MA 3NTXA 5F3DA 4CHGA 5F98A 2CC2A 3BE6A 3D0OA 2L82A 4LDAA 2B2XA 1RYYA 5B55A 4WXEA 4YB8A 4YP5A 3LCJA 5I8PA 3VKGA 4ZVNA 3VNRA 2HDHA 1YVUA 3K35A 1SOWA 1YI1A 2OCBA 4P38A 4HAOA 4AZTA 3WGJA 5I7RA 2D6FA 3R3HA 1NUUA 4WPGA 2L2QA 2FFRA 3WZLA 4ENSA 3ANYB 2P7HA 2X41A 3F73A 2HXGA 1GQSA 2H2HA 2OOSA 1DIOB 2XQVA 1QH0A 2PWPA 4BNZA 1ZYUA 2OCIA 4J49A 2V1XA 3IP6A 3UXEA 4K3VA 2B83A 2J6BA 3CC8A 1BMDA 2IC5A 1TM5E 5H4GA 2JLVA 1K4KA 1D0VA 2TMGA 5C5IA 2V4UA 2YY5A 4MJXA 2WKQA 5AM3A 2IU0A 2J9YB 3CPHA 2H6EA 3NEPX 1F60A 1Q1QA 1WEHA 1YMUA 3E7FA 3Q6MA 4ECEA 1HTTA 2GJ9A 3RQIA 1JVSA 1JDNA 1EJ0A 3RLFA 3UJ7A 5KNBA 4WXHA 2HWKA 1UBRS 1KOGA 1TQ6A 1N7HA 5K3SA 2CBXA 2EKQA 4FMCF 2XA9A 2P2YA 1VP9A 3I04M 1LBHA 2ZE8A 2P3OA 2RB5A 4PINA 4XM2A 4DRZA 5GM2A 4JT4A 5LN1A 2P2CA 2QN7A 2K4MA 3HDYA 2AJBA 4Z7OB 2WIKA 1E3LA 5G0UA 1W36B 5EA2A 5ALRA 1ZEJA 3WO0A 2FJPA 1DIRA 2YFHA 5CVJA 3MGCA 3ZVLA 4NJMA 2OT3B 1Z0IA 5B6JA 2QX9A 1T9BA 2JFVA 5B36A 1EBBA 3CKKA 4BTEA 4M83A 3DGEC 2OBXA 3HCFA 3A1WA 3R4CA 5CHEA 2G77B 4OYYA 5ALEA 5C1BA 3BGIA 3RJ5A 4I9UA 4NNPA 5EXPA 1QH9A 4XE5A 2OHHA 1PSZA 5LZ9A 1M2OB 3H5AA 2QTHA 3FOBA 4M9RA 3ODGA 3DVRX 1JILA 1YULA 1Z35A 2QSJA 3FZQA 1NFRA 3AFNA 3L1KA 4KO8A 4DDVA 4Y8VA 2R5FA 5E1OA 4I9GA 5LBUA 3ILVA 3ZY3A 2ZYWX 1JXQA 5LYJA 1W5BA 4QOSA 1DUVG 3AEKB 3L93A 4MLZA 5EE1A 4ES6A 3L0IB 4PY2A 4EPRA 4XQEA 4DABA 4I55B 5ADWA 4X60A 1CLUA 3LYLA 1P6UA 2HT1A 1IY8A 3E4CA 1UWKA 3NHFA 2YX1A 3D8HA 3AY6A 3ROEA 1XU9A 2OYCA 3PTAA 4G0YA 3B8EA 3C48A 4ZT4A 4Q9IA 3L02A 1U3CA 1XNRB 4II3A 3FKSA 4KXLA 3NHUA 1KEEA 1KYXA 1F0YA 4LQLA 4HMOA 1ADBA 3UFXB 8OHMA 4QDJA 3GZNB 4FLEA 1ONBA 4B7UA 2JVKA 4CEHB 3DNPA 4LZOA 3QOYA 3NFYA 3ZIUA 1EWTA 1G1AA 1JT9A 1NR5A 1M9NA 3RGWS 2FPRA 3TSZA 3BS4A 4QBFA 4B4KA 2BISA 1SN7A 2FB9A 2XUZA 1O7JA 3D8SA 3KAJA 5C4IA 4ND8B 4EPVA 1V11A 4FCTA 2FEMA 4HNAB 4IMRA 4OQZA 2VPYA 1XZKA 3PVCA 4NENB 4WZ6A 3ZV5A 3D8TA 1UPAA 2BGTA 2PL1A 3P5BA 1F5NA 4XD7D 1KNXA 3RKSA 2A3NA 2GESA 3UGKA 2AV6A 2QWXA 3FDIA 5JRJA 1Y1LA 721PA 1BHQ1 3T52A 1JLLB 4I36A 4RVSA 2XX3A 3Q41A 4E15A 4RMNA 3QFRA 3LCMA 3WRYC 1NBIA 3OEHD 4PS1A 5SY4A 1U7PA 3SQNA 1UBLS 3ASVA 1P4GA 3CXRA 3ROQA 3V97A 4DQUA 4K9KA 4NCXA 3TCNA 3ETEA 4TVSA 2BTQB 5DW3A 1PGQA 2W70A 4DLNA 4YV2A 2XRMA 1GVHA 2WJ3A 1ODLA 4B3HA 4QGFA 2HHHB 4B6SA 2HWYA 2JJ1D 1EFUA 2RIRA 1M72A 4OHKA 2X2FA 1VC2A 2IYUA 5TPWA 1ZM7A 5B1SA 4QFBA 4TV9B 1J25A 3N07A 1ZZEA 5ITZA 1YQEA 2GF2A 3AHIA 4JI5B 3FD8A 2IKQA 3GZJA 4BZPA 4KHPB 1F8GA 1D5WA 1I51A 2J3EA 2B37A 1GDDA 2P6PA 3H1AA 3OM1A 5AVTA 3UBTA 5BUSA 3WHKA 4E07A 1FDWA 4Q4JB 4AURA 4EBFA 3RC8A 2QU8A 5K8LA 3QVVA 1XZEA 1TMOA 3TKLA 2DHEA 4UZEA 1C7RA 4ETIA 1ZGBA 5EKXA 3VSCA 2IFTA 4HYTA 4R7GA 1HLFA 4QWMA 1G17A 4MUKA 1U0OC 1NQVA 1ZCJA 3AIMA 2G36A 1L7OA 3V5NA 3ZQJA 1BS9A 2AT1A 1I5RA 3QVSA 4PLWA 2VFAA 1GAXA 5GJVC 3RC7A 2GCOA 2EGHA 1CUWA 4DVJA 1IEVA 5KVCA 5FPYA 1H6AA 3C4JA 4LS3A 5GJCA 4P84A 2BFCA 2Q8NA 1JQDA 1E4EB 3HFSA 1AS2A 4HNQA 4GS5A 1OZAA 1GAWA 1E89A 4KGZA 2F8SA 2D1QA 3E3MA 3K0BA 1MIOB 2DJ5A 3I1IA 2FSFA 2GXSA 5E3JA 5KDDA 5B6PA 2YBDA 1I10A 2MR6A 3T9CA 3I9JA 2VYVD 4LGVA 4UDNA 4GECA 3RUPA 4R8SA 1ODFA 1YOBA 3L82B 3QQ5A 4GMGA 4ER5A 3C41J 4OVKA 2FPGA 2RFLA 1JNYA 1KYIA 1G16A 1XTBA 1KK2A 2UZ4A 1F2TB 2MYUA 4BCCA 2BHTA 1IVNA 5JCPA 3W5HA 1VMAA 2CLMB 3AINA 1ZCFA 3O8OB 4DXDA 3GPLA 3ZYZA 1IMOA 1EVEA 3CZMA 4PHCA 1FFWA 3MWDB 5YASA 3DQPA 4OHBA 5L4LA 1O0CA 1XG5A 3TD9A 4YCJA 1Q1ZA 3VDMA 4CQMA 1C3VA 1XCGB 3IKTA 4DJTA 4YBRA 1GXSB 3I6ZA 4ZAYA 4GP6A 5SY9A 1P33A 4PEVA 3OJFA 2OB1A 3CZPA 1A8IA 4JR2A 3G7NA 2IXAA 3DBHB 5HKOA 3MXOA 2FN3A 4OO3A 3PE4A 1KQNA 2FN9A 3G0CA 3LXUX 2OHXA 1PJLA 1R5JA 4XWAA 4K5QA 4Z0TA 3B7PA 2F8TA 4PAQA 1FPQA 3WK7A 4K8OA 3RODA 1XMJA 3GUUA 3OZWA 4EJSC 4YCDA 2ZJ1A 4FK8A 2MYPA 4RZIA 1XEXA 1CFJA 3TL6A 2RCYA 1DQPA 4ZO7A 4HLDA 1NN3A 4B73A 1HXHA 2YNMD 1UUFA 4LF7B 1Z8NA 4Q3CA 4F85A 5K9ZA 2ZE6A 5A9SB 5IN4A 2PLFA 1D8AA 2VBFA 4JJ6A 2DERA 2IUSA 3T5TA 2WPDA 2PWBA 3SIXA 4GLJA 1WBJB 3V8VA 1ILWA 5DYNA 1M5TA 1SO8A 4K6OA 5AM2A 1Q11A 3EXIB 3CZCA 4AIRA 1GU7A 2OGWA 3N9IA 1Z07A 1NA5A 2O06A 2RHHA 4H7EA 2W9XA 4BGDA 3ANNA 3ZGOA 1DCMA 2IXEA 1IPFA 2I78A 2WT4A 3CG4A 1C7EA 2RHJA 1NV8A 5LKRA 2IS6A 1TW3A 4FZ3A 5FWNA 3VYRB 3CVJA 2XEDA 3M6XA 3PC4A 5COAA 3R40A 3WLHA 2C3OA 1PNRA 2AOUA 3DEAA 2Q8PA 4ZU1X 1GD1O 3VVBA 3SQMA 5ILQA 1CSEE 5DTRA 5GV7A 3Q40A 4AZSA 2QVZX 2CJWA 1G64A 2HBRA 2IDMA 4D5GA 4LJLA 2F1RA 4HVLA 1GUBA 1QGUB 4RPGA 1MOQA 2EFGA 5EE5B 3SXUA 4ZREA 3UW1A 4EHNA 1IBLB 4JUIA 4NK4A 5EFZA 1QLJA 4ZAWA 3VTFA 4W6QA 4G84A 3TJRA 3RBXA 2I1WA 2FX2A 4M1OA 3HE3A 5K8JB 4Z2AA 4ERXA 1R27A 3GUYA 4YN3A 3OWHA 1UPBA 5AKZA 3RC1A 4CMGA 3BBPA 4I55F 5E6RA 1UJ5A 2QJRA 4GR9A 3W6OA 1X1BA 2JCBA 3RYCB 3HS3A 4D9JA 1NJ2A 3PLNA 1UMBA 3KUDA 5AJVB 5IUJC 3ISJA 2QRPA 3OECA 4IGEA 2ZS7A 2GTIA 2ZDQA 2CFSA 5BQPA 2EOAA 1PJ4A 1USWA 4DLYA 2C9OA 2VYND 4MUIA 5CM2Z 4X44A 5EUCA 5K4HA 3MBOA 1FQKA 3EZXA 3K0AB 4RIIA 1LLFA 1NYQA 3TW8B 5JFTA 3KSBC 3B5IA 2GUGA 3KPVA 1XA3A 3TRHA 4LXGA 3ZBPA 1E4VA 2E7ZA 2VPWA 2CHFA 4UUQA 5ENVA 3G1WA 2BKVA 3WWDA 1UFQA 1Y63A 3HYNA 3QV2A 1ZH8A 2WE7A 3TL2A 1TVKA 5EJ6A 4PBTA 4YYEA 5LP6F 2O8BA 2ZITA 3PQ4A 4NEHB 2WUDA 1PNTA 1ZCAA 1JP7A 3OP1A 2BGLA 3UF0A 2QRGA 1RRCA 3EIWA 3C3MA 3UMBA 4EYGA 5KTYA 2IYOA 3U7GA 3IKMB 1UK9A 4LF9B 2H08A 4KMRA 1EJBA 2R47A 1ATZA 4S24A 4KJXA 2OENG 2PYDA 1YRQA 1GPYA 2NT4A 3WYFA 4XSGA 3WMEA 3PQFA 3FTEA 1WRBA 1YCGA 2EJCA 2WKSA 4ZC1A 4O5AA 1XZDA 5D6OA 4V02A 4ZHSA 4B33A 4LSWA 3JZIA 2QAGC 2QMQA 4DDHA 1KVQA 3NNDA 1P4HA 3D8UA 1KI2A 1EVIA 5JNLA 1SUWA 1DRJA 4RJJA 1J2YA 3I09A 3NC4A 1CK4A 3PR1A 4AICA 3FYHA 5FR1A 4BQSA 3CLSD 1E6EA 4QVGA 1Y3AA 2C8KA 4U9UA 3ERCA 5AO9A 1P39A 1RCUA 1BGXT 2J9GA 5DRYA 1ZIOA 3TX6A 5CT5A 4TV9F 1EWVA 1H1LA 2KLBA 3V8NA 5K8IA 3VX4A 4N39A 3TKAA 4FGKA 3V4SA 2ZRQA 1H2FA 1SA0B 5B7PA 4N0QA 3CZ9A 1Y82A 2VVTA 3F7MA 3KSZO 1II8A 3GT7A 2H0RA 2QLMA 2WZQA 3NP9A 4NV1A 4KVGA 1R6UA 1OU4A 4BLQA 4WDQA 3T3IA 1C1HA 3ZW9A 3FUWA 4AMYA 1YDMA 5AD1A 4HAZA 4PAOA 2PUEA 3MMXA 4UUMA 2QRKA 1H3EA 3VUEA 3EQZA 2BELA 2PHZA 2OKCA 4F2GA 2Z1DA 2ODNA 1LNZA 3N76A 4D3ZA 3M2PA 1GAQA 2FE1A 5H3LA 1NJSA 3CVUA 4H3VA 5EYPA 1BSVA 1QFJA 5A4IS 1CWUA 2FQ1A 1P60A 3DDUA 1JRLA 3H42B 1P0QA 1V37A 1OXVA 4K9SA 5I4IA 2HLHA 3PICA 4WZAB 1CEEA 1T3GA 4ZODA 2LDXA 1IMJA 4GEGA 2W6OA 4QDKA 3GLGB 4NH4A 1Z0FA 2GZ1A 2LGJA 1FS6A 3IBSA 4BRWA 2NP7A 2PZFA 1KQOA 1XEAA 5HILA 4AD8A 4F06A 2ZSBA 3OMXA 3W8FA 3Q0EA 1RXUA 2PWYA 4WZBA 4OH7A 1ATIA 2CWDA 5LDHA 1N0HA 1XCOA 4H1HA 5J1TB 1G63A 3B6KA 1JEQA 4QSMA 1WB9A 2HSWA 4RQBA 1LZKA 1Q7TA 3OPNA 4KGVA 4WFQA 5LIPA 3HM9A 5THKA 1IEXA 2NTEA 1JR4A 2C7GA 1CS0B 3KALA 5EFOA 4I4CA 5EY5B 3FLMA 4JIMA 1TTPB 5IAOA 3PUZA 2BEVA 2PZLA 1QX3A 2H4ZA 2VJCA 3K09A 4HC4A 4PSVA 4PVDA 1DAPA 4UW9A 5CURA 1NAIA 2I8CA 4Q4CA 1MORA 1VGVA 1Z0ZA 1VKNA 1ZWLA 2BIFA 2VWGA 4H7KA 1W8IA 4EVRA 1A9ZA 2W2PA 4I4NA 4R3NA 1A71A 4A0FA 4EKNB 4B3BA 1Z7GA 2GN1A 3FPKA 5A0TA 3KG2A 1MQAA 5C53B 1T24A 3KV1A 4DLVA 5GZ1A 3R0JA 4G9BA 3D6VA 3ONVA 1Y5MA 2CMKA 2QJFA 2FPWA 5LWHA 1M67A 2QZZA 4R6WA 4OYRA 3N8IA 3KR9A 1B6GA 1ISIA 3ZVMA 3B8HA 3OQNA 4PXAA 4DCCA 1YZNA 1OFTA 4NXNB 1LX7A 5A4AA 4KACA 3ZBQA 1CRZA 1TI7A 2ZYIA 2QPAA 3B9BA 3LUGA 4OGWA 5DBEX 3H9JA 4OIMA 1OAOA 5C34B 1DP4A 1P7VA 4OH1A 1DQNA 4KFTA 4NTZA 1Z6TA 2FMUA 4K6HA 5DI3A 2W2KB 3RIGA 1ISHA 2YDYA 3WLNA 2FZLA 3T9EA 2AKEA 5A02A 3K0FB 2BM0A 3JWIA 4JLUA 1XO1A 2PMDA 2C4KA 3R3JA 3OEED 3MJEA 4NOMA 5M34A 1YR8A 3UWMA 2EP7A 1WZUA 1O6FA 5T3YA 5LZ7A 2EX4A 3MFQA 5DULA 1NX9A 1C29B 1XMIA 3MOSA 4CEIA 3PHCA 1ZNQO 2ZWAA 2VWQA 1S2LA 3L2OB 2PJZA 3H8JA 4M9ZA 5FPKA 2EBWA 1DOAA 1QLHA 4N6GA 3SIWA 4AUKA 3NAQA 4WZAE 2X0EA 1JBQA 3C6BA 2FP4A 1HE1C 2QUIA 4FW9A 2OXCA 4QYXA 2WY2D 4B09A 1Z62A 2XRZA 3LIIA 1Q7RA 2QN6A 4KQXA 5DX1A 3GLGE 2PS3A 1QU3A 3S8EA 2BHSA 5ICFA 1ZJYA 4LWOA 2XVAA 4R68A 5ELMA 4BMVA 4GGMX 4FU0A 3OMWA 2GK3A 4J0EA 1YAJA 4WACA 4NECA 5DP1A 1N33B 1LRJA 1FXSA 4DEVA 1JKJB 3ZOKA 2I6UA 4XEUA 1FMTA 5FD8A 3D4PA 3NWBA 1U8XX 2C0CA 1NM5A 3QUAA 4K8RB 5B2FA 1UBMS 2HSZA 4F60A 3N8DA 4MRSA 2DWOA 1JTFA 2P4HX 2KBFA 2ATIA 2QV0A 3GMIA 4O4JB 4UBMA 1DC5A 2O3UA 3F3SA 3RH0A 2BEJA 5TY0A 1YTUA 1JECA 5C4GB 3KZVA 3VU8A 1XVUA 2VDQB 3AHJA 1II0A 1KGDA 3DL0A 2JRCA 2W2NA 2CYBA 1CV2A 2XTMA 2H0AA 1L7RA 4HH0A 4L4YA 3WE7A 4GKKB 4JVSB 5EJGA 4K9DA 4Q4LA 4UEOA 2FAXA 3S68A 4DPLA 621PA 5J47A 1TNDA 1CC1S 2G0AA 4E46A 3OO1A 2WNSA 5BMVB 5IAEA 1IBRA 5PNTA 5L6MB 3DNMA 3EG9A 4J94A 2YJ4A 1JE1A 3LUHA 4R1MA 1CP2A 4L3VA 2NIPA 3WQHA 3G13A 1I9CA 5JCJA 1TYCA 1XDUA 2NZ8A 3HV2A 1KI6B 2AK2A 4F4JA 4QBGB 4H59A 4JELA 2EWWA 1IZ7A 2DCMA 3WMGA 1ZJ6A 3HXPA 1KDYA 4Q1BA 4Q1AA 4QXPA 1I6MA 2B25A 1NF8A 3REQB 5EWMB 4P58A 3UTCA 1ZSYA 1P9OA 2PV0A 1X8XA 1UCFA 3A3NA 3GFSA 2A0XA 2P67A 4CIWA 1H2HA 2XOEA 3D7NA 1GU1A 3C8MA 4NYMR 3ZWDA 4AVYA 4C0KA 2P5UA 4CUJA 3REFA 3SX2A 1VRWA 2JIMA 4EF4A 5JAMA 5TXGA 2CZQA 2BFWA 1KYVA 4HDQB 4WH0A 5DK6A 4BB9A 2FEPA 1VLHA 2CLEB 2F17A 2GCGA 1DEHA 2QG9A 3EULA 4GOKA 4MUGA 5AKJA 4M22A 3B13B 1V3VA 3EMDA 2PFGA 3BD7A 4YO8A 3GT3A 2Y1WA 5EGSA 2JB9A 4B75A 3G85A 3RS5A 5T7BA 3B36A 4JHLA 3JQ6A 4TVBA 1WOMA 4UFOA 1H3NA 4QL3A 3W7BA 4NI5A 5L3SA 4X20A 1ZM2A 3OQ6A 2YINC 1NVKA 4EA6A 4U5QA 2KLHA 1Z17A 5A4KA 1ODJA 2XCTB 3KQUA 1FSPA 3H2KA 3DDWA 1KU0A 4UUNA 1M8FA 4X5OA 1JMKC 3CLUC 3OCYA 5FTNA 3PUYA 4AN4A 5KQMA 2R0QC 4FFLA 3D31A 3PXGA 2ONKA 2EYUA 4P3OA 4B0OA 4BLUA 3FW1A 1K5DA 2WZBA 4LHSA 2C4NA 4G36A 4QEKA 3QU9A 4EX6A 5CK4A 2V8BA 3W2TA 3NJ8A 3HWX1 4JI0B 4GEKA 4DOMA 1RABA 1Z4QA 5LOVB 3L0BA 1LRKA 5HS6A 3VO1A 1Y3BE 3ILSA 5JJBA 4IZOA 1W93A 5EN4A 1N4DA 4LHEA 4ZOEA 1EP2B 3DTVD 2ZYGA 2RK3A 4Q7EA 1E0SA 4RJIA 1ESEA 4X1OA 4KQIA 3GLFB 3T1YB 5EHGA 1IN5A 1IY1A 2JGFA 2PZBA 4JWTA 4I6EA 2GCPA 4HH4A 5DKFA 1UJMA 3CJTA 2YW9A 3AY7A 2EHJA 3RJTA 2Q5QA 4OMFG 3T4UA 4OQ4A 2Q6LA 1U65A 3C6ZA 3IQEA 4JITA 4KQEA 1EXWA 4LY0A 4DRXB 2GILA 3CISA 3C70A 3SBXA 3GEIA 3PG5A 4PLVA 3ORFA 4Q66C 5L3VA 4EGCB 5A4FS 3A9VA 4BX3A 1S1MA 1T2EA 2BTOA 2LCQA 2W6IA 2ODWA 3TZQA 1QB7A 3GRPA 2VAPA 3DE0X 3HJAA 4UTNA 1BDHA 3M9LA 2PU5A 4Q19A 2VNHA 4BQEA 2QN1A 5AQ1A 1V4VA 5T4BA 2YRXA 4JIGA 1ZD4A 4OLHA 4RZSA 3EYWA 3BSSA 2AKAB 4XVCA 2WSSD 4J16A 5CT6A 3DAOA 5AKLA 3FROA 2LIVA 1FP1D 1GR0A 2XE6A 5ILGA 1OXMA 2RGBA 1O95A 3MT7A 3WQSB 4AZ0A 3ROKA 4Q7LA 4U7JA 4F3CA 5DNDA 2HA6A 1QTIA 1C30B 1L4LA 3K0SA 1NNSA 5H5JA 3ABRB 5FYQA 5GIPE 4BFUA 3BH0A 4KSBA 1CRLA 2BMJA 3QEKA 3ZUPA 2PH1A 4ZCLA 1Z83A 4EHLA 1R4MB 2P2LA 3HBJA 1I3NA 5J2UB 1IPHA 4Y6QA 4RY2A 4DYDA 1TJNA 3IEMA 2XCRB 1ZMBA 1M6WA 2HTFA 5CXSA 1GZ4A 1O6ZA 3E61A 1I3MA 3LPNA 4CMIA 5BY2A 2JDID 3T9AA 1VJRA 4WNYA 4ZI7B 1E5XA 5JZBA 4DNPA 3GIDA 3DM5A 2JLRA 3QYAA 1DX4A 4JEHA 4TTSA 4NCNA 1YGYA 2VK4A 3P9QA 3ESZA 4HRXA 1EB8A 3I8SA 2PTGA 4LTDA 2Z3VA 4P54A 1AU9A 2AG8A 5TVKA 2R7MA 3QE9Y 2FQXA 2JKVA 3L4BC 3LKDA 4B48A 5CX1A 3IVXA 5K0TA 3GCDA 4IXDA 2W8BA 2OWDA 2OXFA 2XWSA 1ZDMA 4GYKA 5JCOA 2OORA 2WWHA 4MKXA 2FUEA 3RRXA 2QR3A 2HY7A 2PKRA 2NADA 3LC2O 4NSNA 1A9YA 5F21A 2IEBA 2SNIE 2DR2A 1MFPA 2WLSA 4UU1A 4XI9A 3A6HA 3S2GA 2H7XA 3GLFE 2E4WA 2NAPA 1NR7A 1NJ8A 2FPIB 4JP1A 4TRJA 4XX1A 4PPFA 4A9AA 1JB9A 5KSZA 3H11B 4AB1A 4Q12A 1FP6A 4J2HA 2J46A 3CTMA 2F62A 1I80A 3TXAA 3GJ5A 3G6KA 4DNFA 2JZNA 1P91A 2XNKA 2LBPA 5KJ1A 5HK9A 2HA0A 1RR6A 2I2AA 2VPXA 1HL3A 3HH8A 2XWQA 1HFWA 4NPAA 2OAQ1 2ONJA 2OA0A 2EX1A 2GB4A 3PPXA 3UMJA 3TFOA 4TS3A 2AF4C 3MOIA 1V4NA 3FAZA 2GHRA 3NGXA 3WADA 1IIBA 5AI4A 3PNYA 3QMVA 5KOHB 2YWXA 3I30X 2NVWA 2Z2XA 3EC7A 3CYFA 1B3BA 3GGSA 2C31A 5HX7A 4LHVA 1F8YA 5EHZA 1BWQA 1RYMA 1XU4A 4FT4A 4Y0NA 2FSIA 2PJRA 1BNCA 4QT4A 1SUPA 1SRRA 1XQ1A 1SBNE 3AR8A 5DSZA 1DHTA 3THOA 2G07A 1RM4A 2B5WA 5HS4A 4TN1A 4D56A 1SCDA 4O4JF 1P5RA 4GMFA 4LRUA 3CE9A 1JIIA 1W1IA 2NXJA 2O5RA 1RWXA 3Q2KA 1NVVR 3BE8A 3H9BA 3K5HA 4OBWA 4WLOA 1SVOA 3ABZA 3OOYA 4MKRA 3FZNA 4AKTA 3FRJA 3KXIA 5AVKA 4NYJR 5DBHX 3WK5A 3JATB 5KB3A 4CR6A 5A1JA 4LRWA 1EJ6A 1FLVA 4HAUA 1E1CB 3B5EA 2X76A 4NG5A 4MIKA 1E7YA 1M5RA 3NVDA 1MXFA 4KNVA 4OBBA 5BMVF 1LBIA 3JQAB 2Z8YA 3G68A 5FI3A 3DD5A 3H2BA 5TQ2B 3U1BA 1DC8A 1KTIA 2P6RA 3EW7A 2XZPA 3NOXA 4V0RA 3T0IA 2M1XA 3T3MB 5FUVA 5MHTA 2P2NA 2PSEA 3DF9A 4JUFA 5BSRA 5JW6A 2CK3A 3T94A 1M2OA 3RM3A 3L05A 1BGVA 5BOVA 4CIDA 1RFGE 4E2XA 4EHDA 3IAHA 3GGPA 3ROTA 1V43A 2IPAB 2VJMB 4LF4B 3QELA 3N6XA 3QH4A 4NOJA 1TM1E 3LOQA 3AC0A 1RWOA 4UZFA 5IC5A 3AEKA 4RZQA 3WV5A 1PJSA 4DGQA 4OLAA 4CTJA 4YAEA 4A2PA 1JXMA 1JIQA 1QFYA 2RBGA 1CNMA 1GNTA 1LU9A 2CJYA 2EW2A 2V7PA 2XGOA 4I55A 4O0MA 4DLLA 4MQUA 8MHTA 3CCCA 1MZVA 1FS4A 4U9IS 3T5AA 5K45A 1R6BX 1WB4A 2C0PA 1NYRA 2XLBA 2Y9MB 3ST7A 1N77A 3SHFA 3MXTA 2AUNA 3I12A 2XTZA 3F46A 5DHPA 2PR7A 3WR5A 3HFJA 1GPWB 5IEBA 3GCXA 3L4JA 3MMNA 2WAYA 1EHIA 3IXLA 3MF4A 2EDCA 2RHRA 4IJ6A 4YCCA 3STWA 4JB3A 2OGUA 3KCNA 4NBSA 4Y6GB 4W1SA 4YR7A 1JS1X 3UFXA 2I2BA 4UBLA 3DG9A 3GZNA 5CEJA 4CEHA 1J99A 5ED0A 2FOLA 2COUA 5JCXA 1KI8A 2ZR0A 5LMUB 3UJAA 5K0JA 1PUJA 4B2YA 4PG8A 3AGPA 1Y6GA 2B36A 1QG6A 2OYRA 2Z6AA 4BE9A 2AR9A 3TMKA 1J09A 2EKLA 4E2WA 5CCEA 4ND8A 4KR2A 1RXYA 2YJ6A 4ZAXA 4HNAA 1DL5A 1HEYA 3GEDA 4NENA 2YZMA 5ALQA 3W8EA 1NVBA 1Z74A 2JEOA 4CMBA 4EUHA 4ZOQI 4K9MA 2AYYA 3OU7A 3ESRA 3V7NA 1DBRA 1U7WA 2BBOA 4DAEA 2GASA 2I54A 1EHCA 1L5QA 2UYCA 4GI7A 3Q7SA 3ZGZA 2C2WA 5E95A 3QUSA 4URZR 1JLLA 1QTRA 5I9MA 3T3EA 3NUZA 1TU4A 3LHFA 3SQWA 1FNDA 4IIGA 1NTRA 2ZQ5A 4WEQA 4BQRA 1RXSA 1U2TA 4P31A 5LU9A 2DEUA 3CQ9A 5FWAA 2IPOA 4U7WA 2O8DB 1JHZA 3TCKA 3UMVA 1WDLA 3FYCA 5C0OE 3U0BA 3LRTA 2BTQA 1CVIA 3OJCA 5D2CA 1VL8A 1D1QA 1PGJA 3EDQA 1QPBA 1CHNA 2AMJA 3FDJA 4M0UA 4TWJA 3U2QA 4NC9A 3WGKA 4QDZA 1FUEA 1QGAA 3CWQA 2RARA 3TZHA 3ADCA 2P2GA 3SYKA 3EPKA 2HNBA 1E6KA 1U2GA 1Y7LA 4A8TA 3IGFA 2EHDA 4LYFA 4TV9A 1KJJA 3OICA 4JJEA 1KZ9A 2Q5JA 4ZWNA 3V2HA 3V8BA 1PZHA 4DLWA 5BORA 3VPGA 4Y1RB 3WBFA 3C5WP 1BMFA 3JQBA 3W4IA 4LFBB 1ZBDA 1JYSA 2PNFA 1M1YE 1JA9A 2WMYA 3C1AA 1GCAA 4NBUA 3EPRA 1H4TA 3D3EA 1WKBA 4OSEA 3L01A 3S6JA 3UVEA 3HPRA 1THGA 4Q4JA 5EQTA 3PXEA 4X93A 3R9KA 2JGMA 3V7FA 5I47A 3HDVA 2JBWA 3P2JA 5EIOA 4CMJA 2DG2A 3BMQB 1CY1A 1GPUA 1ZQ9A 1DV2A 1EVZA 3GXBA 4XUCA 1M10A 1Y6FA 3RHSA 3KTFA 5JG7A 5J2UF 4YRQA 4OXNA 3W5CA 5F51A 4EG1A 2OK7A 3JAKB 4HEQA 3IE0A 4ZI7F 3JWGA 4UCQA 3SEQA 1EFRA 3FRHA 4FHEA 3GWGA 4DXAA 4DMRA 1A27A 4R69A 3AVQA 4NL4H 3N0VA 2R1UA 5JPIA 1X9GA 3INRA 4YMLA 1SVWA 3P9XA 2CCKA 1P5FA 4I5GA 4PQFA 3VYVA 3L6CA 4U2EA 5KHOC 1WCYA 2XI4A 3QI2A 1E4EA 3ORRA 4DXHA 1MB0A 1L5OA 1W9MA 3N74A 3DE2X 3GFRA 3L8EA 2C03A 3FG9A 4J1SA 4RSRA 1RZRD 1JG3A 2A35A 2DX7A 2V0GA 5SYAA 1MIOA 1IWPB 5ICMA 1DJOA 1X13A 2R4QA 3H5OA 2D2IA 5SZHB 4RKQA 1ZMXA 1C2YA 1PW5A 2B3DA 4TTRA 3UT6A 1QPZA 5BNIA 3QTBA 4FEAA 4MI6A 4ZO9A 5HZHA 3WK8A 5TEVA 2YVLA 2Z83A 1UDXA 3BPSA 2AMLA 3E3NA 3K9GA 3OM0A 3WGZA 1CF2O 3T06B 1FZQA 1ZD5A 4HAYA 1F2TA 1NW6A 2GS9A 2EZUA 4NZOA 3SEZA 5LWQA 1LF5A 2RH9B 2O2ZA 3MAJA 1TVEA 2B4KA 3O8OA 4TWIA 1KK1A 3R5JA 4TX1A 4B5LA 4DB2A 1GLNA 4ZOBA 5L3ZA 4LYHA 3BEOA 4R71A 4KJZA 4B79A 1E32A 1CF9A 2HHLA 3AJAA 1IK4A 4QICA 1XTQA 4GGOA 4QTZA 4RZ2A 4A7PA 1PQPA 1LDYA 1MAVA 2EGUA 3CSUA 4UCFA 1I7NA 1GXSA 4X65B 1UPCA 1LPNA 2OFXA 3EPPA 2PUJA 4OL9A 4QUEA 2X2EA 3EDOA 3GG9A 4BLRA 4UXJA 2VHEA 4CQLA 2F6RA 3T5PA 5DTMA 1UFOA 2GF0A 3DBHA 1KGSA 3E22B 3EIOA 4GPIB 4FYMA 1HH4A 4DSTA 3VPHA 1NG9A 4C3OB 3B1WA 1RWBA 2XUFA 1NXXA 4HX9A 2GX6A 4WLEA 5LQJA 1GTSA 4M1EA 1DKRA 3KFVA 4K40A 5C3UA 3WNBA 3ZWAA 3RSFA 1Z6PA 1OXTA 2ZIWB 4B7CA 2Q7OE 5FXMA 1XFAA 1C4XA 4UCWA 2FY8A 2JFQA 3IILA 1AS3A 4GXQA 5A9SA 2DTEA 4HZGA 1ZBQA 2FPXA 4QIHA 1CNEA 4P4GA 4FNGA 1ZM4A 4LVNA 3QPAA 4WK6A 4WK0B 3NXSA 4LDZA 3D8RA 2J33A 1A04A 4AP9A 2HJHA 1EFHA 1V5WA 4AW9A 1NYTA 1P4RA 3EXIA 2OCGA 1VYVA 4B3XA 1G5IA 2GA8A 3EF1A 4I9FA 1R18A 3L9WA 4Y6OA 4PLPA 3TZBA 3P9PA 4HP8A 3QYPA 2QOEA 3QVMA 3EOBI 4H7PA 5LZ5A 3RS0A 3CX8A 1QOQB 2HPHA 2LKCA 1PFWA 1XRQA 3LWNA 3GN2A 1EWKA 1E0KA 3IUMA 2W2LA 2QY6A 3GRYA 2KHZA 4BDTA 3R0QA 4IIEA 3N75A 1GWNA 4C14A 3DZFA 4LISA 4JN6B 1LQUA 2MMGA 4OF4A 2C2HA 2QE7A 4C4TA 3UH0A 1JJVA 5NLLA 1DXHA 5KJFA 1WMSA 2IV2X 2VS1A 4JGBA 1RJ9B 1ABEA 3UN1A 4BMNA 3GP8A 3DPIA 5C80A 3GJXC 1I1OA 2FXIA 3HKBB 3IUPA 3B6JA 5E4FA 1DJLA 1GTZA 3N2NA 4XYLA 1SJ9A 3S2ZA 4YXWD 4NBRA 1E1LA 4L95C 4IDQA 3RYCA 1EQ2A 3AR9A 2KSQA 5A5FA 1AK1A 3FI9A 3GJQA 3VR5A 3AV3A 1ZOOA 2MR5A 4YUVA 2D7JA 4MQ4A 2WWVD 4B87A 3N2KB 2Q2NA 3GW8A 5DPMA 2I2DA 1FRNA 2QA5A 1CY4A 1G2IA 4AYXA 3KRTA 1I7PA 4MO9A 4AY2A 5DE3A 1RRVA 1Y6JA 4YEDA 4O4HB 3SXJA 5JZ9A 4BVBA 4JJ7A 9LDBA 3K0AA 3WA6A 1BE8A 4ZAGA 3TW8A 2J08A 3S1AB 2BEKA 5T57A 3BMXA 4H6XA 4D0GA 5EJ4A 4RTSA 2Y4NA 1GN9A 1OX6A 5AH0A 5HQJA 2WJ4A 4MEBA 4GPZA 4HXEB 5HFAA 4RPHA 3RARA 4Y18A 2P6NA 1RYZA 4BY9E 1NAHA 3DFIA 3C8UA 2D06A 1FTNA 1XHFA 3K09C 4BWYA 5A62A 1JQLB 3ICVA 4FQ8A 1I2MA 1INLA 1MD9A 2PKQP 2XA2A 3OPYI 3URKA 4CLEA 1UXKA 1OASA 3PR2B 4D8TA 4D8XA 1UL1X 3O26A 2R8BA 3RTCA 1OT5A 5JNUA 1DIAA 3DV0B 4QE3A 2R6HA 2IE0A 1FFCA 1T3SA 4DBVO 2FQQA 1DLIA 3KB2A 3VZSA 1WXHA 2WAAA 1X14A 4D9BA 4C03A 4W5OA 4XVQA 3F6CA 2YWEA 2A0KA 3SJ7A 1VZ3A 1K0UA 2WD9A 2HA5A 2X3FA 3E9NA 1K7XB 3RK1A 4BAZA 1VE6A 2P5YA 4IO0A 1WXXA 5ALGA 2LNDA 1MC8A 3AZOA 3ONWA 4JR1A 2IGBA 3KLBA 4CM7A 1U6JA 1OAOC 2G09A 1EFVB 4LXTA 3WK9A 4CKEB 2VHYA 3AUAA 4QDXA 2JASA 4ARAA 3F98A 5HHTA 2X4IA 4FYKA 5A04A 1JE0A 1WXGA 1OC2A 3WO1A 2RCNA 2I7VA 4IY1A 4YRBA 4N48A 2H1RA 3NYIA 4D4JA 5GOZA 1H8ED 5EIXA 3LPMA 2P9ZA 2LZ0A 3UWSA 2XIQA 3TQSA 1GEGA 1SA0A 2R5WA 3D2LA 3EHDA 1T91A 4LV5B 1KP2A 4PSAA 2Y66A 4GC5A 4ZYUA 4QX6A 1J70A 5AVYA 1IXSB 3WIDA 4KE7A 4MSUA 3SM9A 1SBYA 1XMSA 4KQFA 3BCRA 4RESA 5JD6A 1GCOA 1Q16A 5L4NA 4QEDA 3QU7A 5EMKA 4P5PA 1TO6A 3V80A 1B73A 1JQBA 2BR4A 3SG0A 4YMVA 3NDRA 1YR7A 3C87A 2I2WA 4S1VA 2GJKA 1RXWA 1TLLA 1DX9A 4ZEXA 1I4DD 3K6JA 5DWQA 4E33A 4Y2XA 3ZNPA 1I3CA 2ODAA 1ZVMA 4L78A 4MRNA 1MAWA 1NM5C 3G2IA 5BN5B 2GHIA 2VLBA 1T6BY 4M1YA 5BV1A 4WZAA 2A84A 2PWAA 5C7YA 2WSYB 3JQPA 1AG9A 3ZDZB 4PYMA 3JWPA 3V8RA 2GCEA 1OH8A 1ETHA 5JFGA 4TQAA 2FVYA 2ZAYA 2D3TA 3NO4A 2GPTA 1N6OA 1VGRA 3LWDA 3OZSA 4QQFA 4U7TB 3UK7A 1RQRA 2NV0A 1AM4D 4G3XA 4AJJA 4Z9AA 2SBTA 4CT4B 2DUNA 2JIZD 5F23A 4YH1A 1RQ7A 1V8DA 2Y9PB 3LQ1A 1N3IA 3E3OA 1HWYA 2XWBF 4OGLA 5KAMA 1JHVA 4M88A 3IUNA 1CS0A 1L1EA 1Q0RA 4NU6A 1RYNA 3U62A 1E9FA 1D2GA 1Y33E 1CQIB 4UVHA 4O3MA 1E8DA 2XWJI 1QK3A 4PWZA 3A2MA 4IIJB 3P8ZA 4FIZA 1CP3A 5JWOA 3MJRA 3CF4A 3FPCA 4P53A 4ML3A 2P11A 5DNVA 4G1VA 4Y2TA 3MTEA 1KP3A 3H16A 3SZUA 4BNJA 2PZEA 2IHVA 1S2DA 3A4NA 1XRSB 4FSDA 3MGKA 3CLTC 3SZRA 1D4OA 2BGMA 2J6CA 5DP2A 3VMMA 4EG8A 1ZUIA 1NMXA 4IZIA 1GKYA 1RXEA 1VCOA 2WYOA 4ZVUA 1XBTA 3FSEA 3OFKA 2D5LA 1FS5A 2I4RA 3SHTA 4JL8A 1LEHA 5HG0A 1BWRA 2P1RA 3TBFA 4AWXA 1TGVA 3OAAA 2VRBA 5DXJA 2C5BA 4YROA 5BQ5A 1EGHA 4LOAA 3V7YA 5D5QA 4XB2A 4YALA 3TE7A 2OSVA 4GOJA 4CIBA 1X8KA 5TMPA 4OHWA 1Z47A 1FYEA 4C1NA 2XTAA 2AYZA 2W2KA 2EU8A 3JTMA 3K94A 1OCEA 3SICE 5G0TA 3VO2A 2Z8YM 2WYUA 1GN8A 1AMNA 3FE2A 3MPOA 5TB5A 4D5EA 3OD1A 2H4FA 2HUPA 3C16C 5TPZA 4N49A 1KFBB 5T4EA 4L4XA 1JFFB 1OWMA 2NYAA 3GO4A 4LC9A 1S96A 1EUDB 1EI9A 3GJYA 5DYWA 3IPRA 1W44A 1HDXA 4JGGA 4BGIA 3HR8A 2VHQA 5EHXA 2QRQA 2OLKA 3M81A 1SD2A 4Y0AA 3WNDA 4RM2A 2R86A 4FCVA 4G8CA 2EKBA 2A5DA 2G83A 1RACA 4M98A 5KYWB 4Z7QB 2VL7A 2WM8A 4OQNA 4UQOA 1U6IA 4XIIA 3IPAA 4YUWA 1YJAA 4JOCA 2H17A 4FPXA 3PSAA 1JKJA 2F67A 3D6AA 2OC9A 1XHEA 2UV8A 4DMFA 3IE1A 3PHJA 1BW9B 1R4NB 3WL6A 3G2JA 1EDEA 4LYAA 4R1SA 5HE9A 5JRZA 3DZJA 4O4JA 3SIRA 1WPRA 4NONA 3DLAA 3S2IA 4RTMA 4I9NA 1ZNZA 2JIOA 4TXJA 3ZE8A 5JSFA 3DLIA 2WYHA 1WBDA 2R48A 4C4SA 1JLKA 1XQVA 1G66A 4MJ7A 3TSCA 1DBSA 3T6KA 4IFTA 2PXCA 1AF7A 3IHTA 5BO5A 2ZG6A 5DHAA 3R7DA 4I5FA 4BKRA 2BZSA 1WULS 2FFJA 3QY0A 3EZLA 3EVBA 5CD1A 2VEDA 3P9KA 4ID9A 4KDFA 4G4GA 4HGZA 4JFAA 2R7NA 5BMVA 3Q4GA 1TM4E 5AW6A 1DSSG 4FEEA 2ILTA 3SKVA 5ULLA 4EARA 3FM9A 3VC3A 2QZJA 4J16C 4JLWA 2VJLA 4AS2A 3FOFC 4RABA 3H6GA 1O95C 2PKYX 1Z08A 5DBFA 1QQBA 1TAQA 1KI6A 3K6RA 3TD6A 1XHLA 2R85A 4YI5A 2XT0A 1XWIA 1R50A 4ZT2A 5HWSA 1C9KA 1TQDA 1YKSA 2B5OA 3LDFA 4BN0A 5EWMA 1TOAA 4HDKB 2R60A 1E1RD 1D9ZA 3PB3A 4D9NA 3EEBA 4GR4A 5MFPA 1TD1A 5ENZA 3DC7A 2VDPB 821PA 2NYVA 4BFYA 1W4ZA 2Y93A 3VPCA 1V7QA 4D44A 4D4MA 3KYBA 4JX9A 1BE6A 2WR8A 1E1QA 1A95A 3PRHA 3Q8KA 5G4KB 5GY7A 4C0JA 1C4WA 3QV1A 1JDZA 4TM7A 3GLHB 1N2CE 4CFYA 4OFZA 4G0PA 1Z0KA 1YIAA 2LE0A 4OATA 3A9CA 4DJAA 3L4EA 4UUOA 3DMDA 4YT2A 3VR6D 2AFIB 1ZLXA 1KDPA 4G1BA 4CWAA 1VE7A 2CMGA 3AEZA 3URMA 1AUPA 1KXJA 4YPOA 5JCOC 4OX9Y 3QPDA 1PBTA 1BMTA 2OORC 4GLBA 2FJ0A 2VT2A 3GB9A 3TLJA 1NGSA 2Q3JA 3FSRA 1M0WA 2POQX 1ZC3A 2FUG6 3T5DA 5A3VA 1GYRA 1L6IA 1W88B 4IILA 3S29A 2FFQA 1EK0A 2O7QA 4QECA 1I7DA 1NQWA 1SOVA 2MDTA 3C6YA 4U2FA 4XLZA 2PSDA 1MX1A 3HYCA 3I1YA 4LX0A 5ENDA 1G291 4LVUA 5LOVA 3KB6A 1S8NA 1FQJA 3QVGA 4EPWA 4WECA 4G09A 4OCZA 5ADHA 1T9GS 5C32A 1UPUA 2BFPA 3ZWOA 5KHLB 3GJ8A 1SU6A 3N0XA 1KE1A 3T7IA 4LGCA 3R3VA 1JVNA 3EJ6A 4FUQA 4LYGA 3QVXA 2DHCA 3K31A 2C00A 2GEDA 3FGPA 3IBFA 5AVQA 1SWVA 3A05A 4DIEA 4M0CA 2ZI9A 5LNK1 1RAIA 2YYAA 2GNPA 3UXYA 3VNAA 2YWCA 3QOWA 4DRXA 2AG1A 2AW3A 1ZUD1 3EEYA 4ME6A 2CL0X 4RZ3A 5FNVB 4E4YA 3K2EA 4CW7A 1AQUA 4PTZA 3O4GA 2XHZA 5KZMB 1LBTA 1TJYA 1FX0B 1WP9A 2VHZA 3KXDA 5JTUA 1F0KA 4FFNA 1C9DB 1M33A 4FJ2A 1XJQA 4I3GA 4MO2A 4BP3A 3H0CA 1VE1A 5IDQA 3K0EA 3KK0A 1EP3B 2DHQA 1I24A 2D13A 1Z06A 2QX8A 2WSIA 1N92A 4OP2A 3UT5B 4E32A 4G65A 4CNQA 4OUDA 2PM8A 1KMHB 4OJMX 1KZHA 3M6IA 1PEAA 1YD7A 5KNDD 5LMNB 3JS5A 1C30A 2R66A 3L6UA 1B15A 3FCYA 3U3MA 2B92A 2HB6A 4XVHA 3ZC3A 4OIFA 2N75A 1NBWB 1TYZA 4KR7A 1W36C 3EXEB 3GLHE 4COKA 3UJPA 2WJAA 2PLRA 5HJ5A 2PX4A 1R4MA 3F6SA 4U1RA 4R0MA 4CF7A 3S1LA 4BVEA 5IT5A 5J2UA 4LDQA 2O57A 3H9GA 3GJ4A 1ZJ5A 5AI6A 1A9PA 4C5CA 2EP5A 3L8MA 1G8HA 2Y77A 4ZI7A 4MCIA 4CV2A 4LZWA 4K2HA 2HFKA 1ODSA 2UVPB 5E1MA 5H9VA 1OIXA 5B58C 2W8ZA 3TUZC 3Q6NA 5IT9A 3OP4A 4TZ6A 1X9HA 3WISA 4J7AA 3IQXA 2JPDA 1CYEA 1OYVA 3J81A 3L8ZA 3BWVA 3R0IA 1FX1A 2FCAA 2FLVA 2RHLA 3KSRA 3OJOA 7MDHA 5EL0A 4CKCB 1UZUA 5EMJA 3UC9A 1RQGA 1MPTA 4ALNA 2ENWA 4HQOA 1DC3A 3TEMA 2BFFB 3P9SA 2AE2A 3U9TA 1QM5A 2WMDA 3UQZA 2DPGA 1UP7A 2W6MA 3AG6A 4IIFA 4FD2A 4IAOA 1SEVA 1FSZA 4DV7B 5KKCA 4EMBA 5C31A 3FMIA 5A71A 2YJGA 5AJXA 2ZWIA 4P81A 2FPIA 2YDXA 3QIVA 1Z6AA 4JQCA 3O2NA 1X15A 4CCWA 3CXUA 3HJFA 5JJKA 2YH2A 4G4SP 2YBEA 3H11A 1TT5B 5BPFA 3CM0A 3IQGX 4PGMA 3QTLA 4M89A 1IN8A 4RE6A 3V4FA 3G5LA 1VSQA 5KTNA 3SZGA 2XZDA 4JJ8A 4C7OB 1CBUA 5H8WA 1T8WA 3RUEA 1YRYE 3VGPA 1FRVA 1PZMA 2GPBA 3ANMA 3UWDA 1EGVB 1BU8A 4DTCA 1G2QA 1Q22A 4KI7A 3RCBA 1KTVA 3T7AA 4ZHQB 4C2UA 3NH9A 4QLAA 4A8HA 4RDHA 1YZHA 4WINA 4MCHA 3EWAA 3G1UA 3VNUA 5KOHA 3ULKA 9ATCA 2JGAA 4L9WA 3SD7A 2P5TB 3QXCA 3W0LB 2HV8A 2ZWPA 2ZB2A 3TLXA 1Z0AA 3BL5A 2AB0A 1N5KA 1HNNA 5GIOE 2PVCA 5H3HA 3NVMB 1XC7A 2IE8A 3PC6A 1Q0UA 2HBYA 3O3NB 3V7UA 5JXIA 2W6JD 2Q9CA 3WLJA 4BCDA 2VDMB 2VSQA 3FYSA 4IINA 4P2BA 1T34A 10MHA 4WFKA 2R7AA 3KJQA 3IP5A 5ECYA 1TO2E 4EDFA 3BIOA 3H2HA 3VISA 2AFVA 5T3UA 3KR2A 4OEHA 5HUQA 4KK4A 3DF7A 1E66A 4K3UA 5ER6A 2IOHA 4LXUA 2NO0A 1GGVA 2Q4RA 2HN9A 3IHLA 3CLHA 3GXOA 1A69A 1DZ3A 4W7HA 5CDHA 3IHWA 3UH1A 5D00A 1FQOA 1Z73A 4D81A 4F5WA 3KHKA 1BKYA 3DMTA 3JATA 5K6AC 1RHUA 1K0FA 2BR3A 2Z3WA 5JLAA 3TVTA 1DKUA 1OIWA 2FG7C 1E1CA 3MNFA 1RRFA 5K7SA 1U2GC 3AEUB 5C7OO 1IJEA 3AR6A 5DEIA 3JQAA 2GLTA 2O6HA 4YLEA 4NV3A 2BJVA 521PA 5TQ2A 2GJ4A 2ZQZA 2HLPA 5EKUA 1XR3A 3JQBC 2P27A 3I64A 3HA3A 1L7XA 3ES9A 4D9FA 4GHWA 5KYXB 5D8DA 2L19A 3UQYS 4JDPA 3W8RA 2JLSA 4ZIRB 1N36B 4MGHA 3AL3A 2UVQA 3LUAA 2BBSA 2F59A 3QEOA 2XB6A 2F9LA 2VJMA 3BRWD 3FMGA 1YASA 1W49A 3OQBA 1HO3A 1NLFA 3M70A 3LZ6A 5IC6A 3Q98A 4YMUA 1YVDA 1ZD2P 2QAIA 1TA9A 1P81A 1XTVA 2ACEA 3I45A 4IP0A 1XZBA 4RD6A 4HT3B 1IBKB 3GUCA 2WMOB 3ANXA 1YZUA 2B9VA 1N57A 3JVIA 3LLSA 1NXSA 3GT4A 3YASA 4B7XA 3EUEA 2XE8A 2XF2A 4WN3A 2CMDA 4YRRA 5GMOA 3I5XA 5A5DA 5IVHA 1F9EA 1ODTC 3DMYA 4CQJA 1P7CA 3EX7C 1X2EA 3TO5A 1PFGA 5EHNA 3FETA 1PWHA 2J4CA 4EJ0A 2XGGA 4NF2A 4WBSA 2J0SA 2FZKA 4J0DA 1FYDA 4O33A 1CJTC 2G8NA 3PGJA 1QZUA 2IXGA 4KH1A 3RVPA 2HEGA 2IEDA 3ABQB 3C5EA 5FAKA 4DBLE 2EW1A 3PFHA 1AKQA 3ICCA 5IJWA 3FSGD 4MGKR 4U6NA 1IAVA 4ARVA 1L9KA 5AOAA 3RAPR 1RYDA 2PBRA 3P45A 4LOIA 4HNSA 1XZJA 5IS2A 4DIKA 2J0UB 1L8LA 4RK6A 4TROA 4KFSA 3ZU3A 1HLGA 2VF5X 4QHYA 2F2TA 2W71A 2WP0A 4BHTA 1NJ5A 3PHHA 5BSEA 4NYIR 1EK1A 4Y7DA 1BVRA 2EFEB 3A6DA 1G6HA 3W3AA 4XH9B 4E22A 5WRFA 5I7UA 4JB2A 3L4KA 1YDHA 2YJ5A 1A1VA 2HCTA 4WOCA 3SX4A 3DVSX 3MERA 1Y89A 1W87A 2GEBA 5KEIA 2O50A 3GDWA 3H7AA 3G2LA 1R6VA 3FB1A 4R9RA 3MAGA 1MJNA 3U4IA 1JEJA 1ID8A 1TVCA 5K0CA 1TK2A 5KTSA 4UJ5A 1BEZA 5CUQA 2IH4A 2VP6A 2ZRIA 4AO8A 2FLWA 2ZEJA 4EA9A 1ZN9A 4FM9A 1DRUA 3JWEA 3FZYA 1W2WB 3F6BX 4A23A 5LZ4A 4JC0A 2JJ2D 4LJAA 5H02A 4DJJA 5FNVF 2GZSA 4E5UA 4KNYA 4PR3A 4HWPA 4C01A 2AQIA 1Z7YA 1YCFA 5IANA 3P32A 2C94A 1FUUA 2W0MA 3AETB 3UJ3X 4EJ2A 4ZQIA 1A0OA 2CFTA 3UMFA 2HW8A 3BREA 2DGDA 3N8KA 1QFZA 4OU5A 3EIXA 5DMXA 4YQEA 5BR4A 3AHDA 3BEDA 3II6X 4OUKX 5FOQA 4M9CA 1LTHR 3RYIA 1IB0A 1NPTO 2ZRKA 3CEJA 3HA5A 3R3SA 4F2WA 1FB5A 4Y1RA 4MYSA 3KB8A 1HQKA 2OV1A 4PSUA 2X9LA 4C43A 2IIQA 3RK0A 1QLWA 2OZEA 5FDFA 1P5ZB 2ZR7A 1XAHA 3FPSA 1TMGE 2VC2B 3AIOA 2JFGA 2HQBA 4FDLA 4KOAA 4TZKA 2PD4A 5K51A 2O8NA 2VQ6A 1C41A 4PZCA 3KZXA 5CLHA 3GI1A 3PA8A 4URWR 2P4SA 5DISB 2F1HA 4L5JA 4IS2A 4FGZA 3BMQA 4Z53A 1K8QA 4UOEA 3S3TA 3Q1KA 4MYUA 3IX7A 2WF6A 2ENUA 3A28A 1OFHA 2Q4EA 4L15A 3FCEA 3TINA 1I7SB 1G5HA 3DE7X 1V48A 3CFYA 3JAKA 3M4YA 3V00A 4EW2A 8ADHA 3O8DA 5JI2E 4Q1EA 2QN8A 1XQ6A 3RUCA 5IAJA 3I62A 3A4IA 3EGWA 4O1MA 3B1KA 3OPVA 3SS8A 3O2QB 1CY0A 1R5BA 1PDOA 2YUTA 1LSJA 1MJ5A 4TN5A 2WYVA 2Q9AA 1EXDA 1P6XA 4G41A 4FHZA 3DAHA 1P7ZA 1RQ2A 4X9XA 4XWWA 3HA2A 3K92A 1URPA 2ZSJA 5AW5A 3RG8A 2O2GA 1Z0DA 2NG1A 3D43A 2JZCA 2WU0A 3ND5A 1TCBA 4I8DA 4P83A 4U8HA 2H5JA 5B4VA 1W581 2QMZA 3NAZA 4JI2B 1CB0A 1SVSA 3DPUA 2A5JA 3HYTA 4XUDA 4DDMA 3MGBA 2W2XA 2WLTA 1T1JA 4LHWA 1OZ0A 4B1FA 3U16A 1MC5A 3TECE 3NTUA 5IXYA 1DC7A 3FF1A 3DLBA 3DXXA 1YB7A 3ZUGA 1HE3A 2V97A 3R6WA 2QVXX 4B34A 3ZIDA 5JEEA 2OCDA 3DW1X 4KE9A 3SY8A 2AX3A 5C3MA 1Y9JA 1YRLA 5JDCA 4MUNA 2CDCA 2ZIZA 5G1OA 1P6QA 1A7AA 3LY8A 3FXAA 3V4VB 3WYBA 4ZHQF 2GBLA 5KWVA 3KT8A 1MB2A 3O9ZA 4GG1A 1G0NA 5EIWA 3WYAA 2H2GA 3ROFA 3VU0A 3OLQA 2C77A 4LSMA 1SQ5A 3WBBA 4BC1A 4ZVPA 3FN4A 1R8XA 1MU0A 3KZKA 1E3EA 2Y8EA 1ZRMA 3I01M 1KEKA 3UA4A 1O2DA 3DS8A 4M0DA 3EF0A 4ILEA 1P2SA 2FMIA 3U37A 5AK6A 3AFIA 3BN3A 4RGVA 1L0BA 4KQMA 3TSYA 1P2FA 2B4YA 4EA7A 3OMLA 5AUNB 2OD9A 4OSPA 1D9XA 1ISFA 1EX6A 1UT6A 2A9OA 2DSTA 1E1YA 2IYWA 4KQCA 1U0TA 1X1AA 2BGJA 3HYSA 4QELA 1BX1A 5BXQC 4BN4A 2ADFA 4YP9A 1EFPB 2Q1UA 3QXXA 1ZOPA 2G9VA 3BERA 1BE1A 2CE7A 3DDHA 3IKLA 4FGLA 4CM8A 3MELA 5FQNA 2II6A 3ZW8A 1VBMA 2J7KA 3INGA 5TRTA 2G6BA 4H4CA 5DSTA 3ZU2A 1EXNA 1MT0A 2INGX 2Y1OA 2BGRA 1HFKA 3CUKA 1Q3KA 2A14A 1EFCA 2F7SA 4KYTA 1Z5ZA 4EG7A 4YIHA 5I9NA 1U04A 4UJ3A 4ZC8A 3IJPA 2VJDA 3R8CA 5ABPA 1WPQA 4BMXA 1SCUB 4LOLA 3ZWWA 1HOTA 5JI3E 4DLAA 1JSCA 1ECGA 1S9HA 2WIDA 3B20A 3CLUD 3BZWA 3IJEB 4LE0A 4OHVA 3ZW7A 4LRTB 3I0MA 4PYNA 1XPOA 5IYZB 1J06A 5E9AA 5A05A 4KKXB 1HSZA 3O4JA 1CRPA 4G89A 2BZ0A 3O83A 4L8FA 4HF7A 1ZFNA 1RJ9A 4BU1A 1UK8A 5FO0A 3OQIB 4M0FA 4FZ5A 3IAUA 2C98A 2BZGA 3WGHA 5DM0A 3HKBA 4OYLA 1W19A 2AK3A 3CEHA 2ST1A 1ECBA 1EIZA 1IU9A 5LPNA 1VPTA 1GAEO 4MAAA 5EJMA 2VXYA 3DE6X 2GN9A 4QDUA 1X19A 3NH6A 4WCFB 4EY8A 3ZEIA 3O93A 2FPPB 1VPEA 4Y2GA 3LP6A 5IKOA 2O8EB 3HHPA 1CUAA 2JK0A 1Y9EA 2XODA 3N2KA 3ZLVA 4WA8A 5DM1A 4EF5A 1LWOA 4GYYA 4OREX 5C81A 2UZ1B 3QWIA 4TYPA 2HTEA 4BUZA 4GLLA 3N53A 4O4HA 4GMXA 4NV0A 2X22A 3N7UA 2HKIA 5JH7B 4H4DA 5IBCA 4XCVA 1UOQA 3S1AA 1VI6A 1ZXXA 3N3BC 2GFQA 2JFBA 4B4UA 2WWYA 1SG0A 3JQ8B 4ZARA 3U7EB 2JGEA 4HB4A 5C18A 1SKMA 1MPXA 2FUKA 2ZJYA 1XN1A 4PYKA 1JHOA 3TVDA 1D4AA 3QI7A 2J7PA 4RJLA 1SHJA 5ALPA 3FJ1A 3PWZA 2NUTB 3BMOB 3QKWA 4P5EA 3TQOA 5KNBD 4GWKA 3DR3A 3V2IA 3F4KA 3IELA 3WLFA 5JPDA 3C6MA 3TEFA 1COWD 3QHAA 1XZHA 3L8CA 3DZIA 1G3MA 2QD2A 5CH8A 3QZUA 1O0SA 1E64A 3ANLA 2NXWA 3DV0A 5LDDC 1Z63A 1MNQA 1TLTA 2FLKA 1J9ZA 4YRDA 3RYFB 4JJFA 4K7JA 3H5NA 5DHFA 3TVYA 3R0VA 1JQEA 3QG1A 2QQ0A 3C1OA 3M4ZA 2IX3A 1RPZA 2E82A 4AI6A 3JZMA 3FSJX 5FUQA 1OBHA 2BGWA 2Q5OA 1MEJA 5GINE 1KKMA 1EFLA 2IEAA 4DPKA 3NVKI 3NYWA 2R8OA 1J33A 5DI9A 2GOYA 3MIZA 5FBQB 5KI6A 1OGYA 3ESAA 3JQFA 3RUHA 2QVYX 4LOHA 2H63A 1CCWA 2J0EA 3OZBA 4NBLA 1B4DA 3KZNA 4R1NA 3GOQA 3M4JA 2HRZA 1EFVA 4BNYA 4CKEA 4DCUA 3EGIA 2O3RA 4YFYA 2GWRA 1BFUA 1WPGA 2YHBA 4FOPA 1IIRA 2EZTA 4CL8A 3E03A 1C0PA 1G8KA 3RUFA 3OM8A 4BVJA 2H16A 5T8KA 1I7QB 2BEWB 2J3HA 1D04A 1O6BA 3LSYA 4WGGA 1F8FA 4LY9A 4X90A 2W43A 5CHYA 1HYBA 4D25A 13PKA 3CINA 1AH2A 2PR2A 1G98A 1X77A 4TMZA 1PJAA 5DIZA 4KXWA 3AV0B 4TRNA 4B17A 1NU6A 5EIFA 3O47A 3RU2A 2JFOA 2VF7A 2QMEA 4AXBA 5CH3A 4P0PB 3I23A 2QTVA 1QG2A 1A2KC 3O6VA 2XH8A 3R3XA 2A1TS 4KXUA 2CLHB 1KMMA 2QGNA 4U7HA 1ST2A 3FKSD 4OJQA 4LRYA 2RI0A 3TUJC 2RKBA 1GTL1 2IHTA 3C4VA 1G9SA 2G0TA 4ISBA 1U1EA 2O2HA 5BN5A 5DFAA 2H1LA 1UDBA 3IIIA 2TECE 1ZHOA 1TYAE 1K6EA 3FNEA 2IYQA 2OWEA 1G5FA 2DPYA 1E9SA 2REXB 3BXZA 3C39A 4C04A 4AMGA 4UNSA 3DYBA 5GVRA 4JLMA 5LR6A 1SVUA 1EZZA 1VSUA 1NVEA 3M6AA 5TT0A 1P8JA 2BD0A 1A9XB 1X1QA 3AY3A 4BNWA 3LT0A 1NOJA 4RENA 2QR5A 3UTDA 3WGIA 2EFCB 3K5IA 2WTBA 1IDOA 1NF3A 3HB1A 4GBJA 1AX9A 5LP1A 2HHJA 3BH7A 5ELLA 5TF0A 1XEWY 2N46A 5M5BA 3RKRA 1FJ2A 3V4LA 3NX4A 3FTFA 3ACDA 1I30A 1YR3A 1VJ0A 1WKCA 3GD7A 3Q8WA 4FCWA 1RC8A 1CQIA 1QSGA 4G0WA 3TNLA 3HVIA 2IU3A 2IF0A 3EN0A 3O03A 2GM9A 2O7SA 4M1MA 4IIJA 1CVLA 1MO2A 3R76A 3TTYA 4AF6A 5JV5A 3W5BA 1IXYA 3OD5A 4II7A 4RUKA 1B8UA 3R5KA 4Q3AA 1AN9A 1GY8A 3HUEA 4Q9JA 4KXQA 5JUWA 5L95A 2YJNA 1RFLA 4JS0A 1AKRA 3R6DA 2EBUA 5KVVA 3I52A 3BQNB 4W9NC 2HXYA 1AA9A 2QX7A 2NX2A 4CPDA 2C2KA 4RFLA 5KAPA 1J0DA 3U13A 1XTTA 1BC5A 2CE2X 2NQ8A 1LLDA 2XXJA 2I4OA 3NKLA 5JAZA 2QVCA 2HGSA 3PDUA 4ZKEA 3SBOA 1WCXA 5AP9A 4OHYA 1ZVVA 3OLYA 3PNMA 2EBFX 5DYGA 4TTVA 3LYHA 1SIOA 2VTKA 2NZXA 2YIJA 3BXOA 2NU9B 1GYPA 1YR2A 2E5FA 1YRBA 2QY9A 3ASYA 3PNVA 1V7PC 2IP2A 2BT4A 2WW8A 4RV9A 1J90A 4BZWA 5J5AA 4IGKA 1P0MA 2VZ0A 2XYPA 2EERA 4WLFA 1L6RA 2OOKA 4JI6B 2CVQA 2XIJA 3IVAA 4L9SA 2PT6A 2BBTA 4LK2A 3ZZNA 2FTKE 1HT3A 4LMBA 2O2EA 1N9ZA 3EDRA 4A82A 2DQYA 1CIPA 2ZUWA 3HY6A 4IJMA 1UR5A 1J9GA 3GAFA 4PCVA 4RDIA 4X00A 5G02A 4DMCA 1J21A 1EE2A 3CSSA 4U6QA 3EODA 1BGWA 4DUYB 1Q14A 4BP1A 1TQ4A 5KYWA 2QRZA 3HV0A 3B1VA 4AULA 1HDEA 1H2XA 1RWWA 3QVUA 5KJ6A 2ID4A 2PRJA 2N0SA 5BXYA 2GGSA 4N5HX 4OI2A 1DDOA 4RPLA 4IH9A 5AKHA 4GOXA 1NUHA 2GPAA 1EZ4A 2I76A 3KR0A 4G0ZA 1BW9A 1R4NA 1HEUA 3X1KA 2YQ5A 1WSDA 2XNCA 1VRCA 3CUYA 4LJ7A 3HCWA 4MV1A 4OXKA 5TC4A 1GRVA 1MIHA 2QD1A 3K1TA 4FYIA 3GMDA 4WOKA 4H1WA 2GSDA 2QXYA 3LCCA 4EY7A 1HM5A 4K46A 5HF8A 4FR5A 3PLAE 4TS1A 2M32A 2OY0A 1EDZA 2QNBA 1Y3FE 1PF7E 2ODPA 4JU8A 4NY1A 2XCLA 2BC9A 4HDSB 3L0YA 4BB6A 2CB9A 2HF8A 4JZKA 1UKEA 4HZUB 1ZOIA 4DCSA 3EH1A 3M6MD 3EA0A 3PFBA 3RDPA 4RKEA 4ALLA 4GM1A 2IZ1A 1ST3A 3HJNA 3MTIA 1FDTA 4G97A 4GW3A 5GZ3A 3JSAA 1G6Q1 1YB1A 3EEIA 4PC6A 4QQRA 4CQMD 4FOTA 3ZHRA 2NVOA 3EPHA 2I03A 5SV2A 4EHHA 4PS0A 3M6LA 4AMVA 1YIDA 2EYQA 2QXUA 5I4CA 3TIFA 2XCSB 4B8WA 2F3QA 4IHKA 4ICIA 4R2XA 3U4GA 1I4WA 1S3GA 5JH7F 5IASA 2CXQA 3I1FA 4JI1B 5H3CA 5LU8A 1RI1A 4XVRA 1O9HA 3N0TA 1S3FA 4HDAA 4HDKA 2X9QA 5AQEA 2VJAA 3FFWA 4HUJA 2O05A 1SNYA 5B30A 5KO2A 4UZSA 2BYTA 5BR1A 3IR6A 1L5RA 1V6CA 5BYAA 4KBYA 3WTCA 1YDGA 1UQTA 3QNWA 3RS2A 3MJDA 4AXXA 1A5ZA 2I2XB 3V8PA 4ACAA 2RGWA 4H4EA 1HZZA 4LYJA 3AVOA 5G4KA 4L5BA 1CEYA 2VT7A 3GBVA 3SI7A 3MUNA 2P91A 2DYKA 3GLHA 2CJPA 5LXTA 3QF7A 4YS6A 4Z8YA 3WLIA 3EW9A 3I6YA 4RWZA 3NHSA 4O2AB 3DV9A 3J7AC 1QUFA 4G5OA 2AFIA 1QYRA 4CNBA 4XIGS 3L07A 2XMRA 4GM0A 3GJZA 1H3FA 3DEFA 3MWEB 1PJBA 2WIFA 4HEA6 4QTUB 5AXCA 5BUZA 2H1FA 2ZRPA 3UK0A 4G8DA 1QS0B 3G0HA 1AB5A 1BHJA 1DT5A 2NO1A 3ESYA 1ULTA 2YOGA 2ZXUA 1EG2A 1LVHA 2P9HA 2TRSB 3BJZA 5AI8A 1W88A 3HKEB 4MIOA 2QZPA 1CJVC 3A9TA 4KXVA 4OKIA 5ALZA 3D8NA 5TJ9A 5FHRA 4HH1A 5CVVA 4QOFA 1P9NA 3ZK8A 1QVWA 1I94B 4YCLA 4EHFA 2B9EA 2A4KA 1EDDA 3UHJA 3W06A 3DZDA 1KO4A 1XZAA 3NJRA 4KN9S 4NCBA 1NW8A 5FADA 1PP4A 1V1MB 2H18A 4BLOA 1Z7EA 3UJBA 3UG6A 3O4IA 4ID3A 5A2QA 4KWIA 2O3QA 3VH4A 1ENOA 3H1FA 5BW6B 5A7GA 2QI9F 1P7WA 3B9PA 1MO4A 3A4YA 5D6NA 1Y0BA 1U81A 2UAGA 2BSAA 3CB2A 1JG7A 3H83A 3N8NA 3O74A 3CPSA 4QPNA 3ZGXA 3B60A 5FNVA 4ZQHA 3WGMA 3F6PA 3M1YA 3WL5A 2C5FA 2G0NA 4KMMA 4UCXA 3NOVA 3TOXA 1FX0A 1YE3A 4C2AA 1F06A 4W1QA 4HTFB 2IYYA 1MRZA 4CM6A 1BQ4A 1V6AA 1HKHA 4N5NA 3LW8A 5EESA 1KSHA 4NE7A 4NOKA 3HL0A 2RGNA 5F35A 1E2PA 1QWSA 4PLCA 4RM3A 1IHDA 1IM5A 3HGQA 1W5AA 3LPDA 3NPAA 5GVSA 4GXRA 3PUJA 2FEWB 1VBFA 2QP4A 1YS2X 1C4KA 1ZQ1A 5LB4A 3UT5A 5JJLA 2MSWA 1R6DA 1KMHA 1V8PA 4QBKA 5JATA 1WIWA 2A0YA 1X1SA 2VNAA 3OFNA 3A14A 1SIWA 3DOIA 3DMTC 3I53A 2FUG1 4YJKA 3S40A 3WYGA 3L0CA 4PPYA 4QG3A 3A1EA 4S05A 1Q0SA 3EXEA 2RONA 4QOEA 4F9GA 4NESA 3AF2A 3UMRA 1O54A 4J1TC 2PSHA 4EQ6B 1E7MA 4JC5A 4ZMBA 1NMYA 4FDTA 5JBNA 1MC4A 4FXPA 4IYJA 3HDJA 2Q5LA 3EDYA 3CUVA 1EFDN 4B81A 1KAHA 4C5AA 5IF9A 5KSWB 2ZYVX 2XR1A 5AYVA 3WXBA 4N3CA 1FRFS 1R12A 2WUVA 3I5MA 5KOYA 2UVPA 1N6RA 2VATA 5DB4A 3LDHA 2QLLA 4N65A 4BO2A 1S4MA 4IL5A 2XUQA 3P71T 2P7IA 3PL5A 4JR0A 3K9NA 1FVFA 4N6OA 2I9KA 2R6CA 3VC7A 421PA 4CZ2A 1JT2A 2R1ZA 4DC0A 3LNTA 3CJQA 5TJHA 1N5MA 5J4HA 4Z4EA 1E5DA 2BFFA 4LCJA 5IM5A 3SS7X 3OLXA 2F4NA 2VNIA 4RE5A 2UXDB 4F45A 1PVOA 3V48A 1DZIA 2RI6A 3A7DA 2AUMA 2IXDA 2F1IA 2AJTA 4GWGA 4MPRA 5AKKA 5IWAB 4PZ9A 4EGJA 4LGYA 1NW7A 1TT5A 4COOA 3IAS1 3UC5A 5GZ6A 2H4HA 1JQKA 3ZX5A 1HG1A 1L5YA 1TQHA 1PR2A 2D1FA 2I7CA 1G38A 2W0SA 2ZPTX 4D8WA 4L72A 3LA8A 4BO3A 4C7OA 4LN1A 2M9MA 4PFSA 4RMJA 4E5NA 2D1TA 5IK2A 3LA6A 3PTZA 4L27A 3OZTA 3F49S 1PX0A 5H83A 4RTLA 4ZHQA 3OZ7A 4KH0A 4B84A 4ILKA 2VA8A 5LUAA 4GNKA 1QCDA 3E53A 2QQFA 4IDPA 4RSMA 3H5LA 4TT8A 3T0FA 4CQNA 1KARA 4EGSA 2A9PA 4GO1A 2HA7A 1B2RA 4CN9A 3WLEA 2ZVDA 1G7TA 3HACA 2UYGA 2RC6A 4MVJG 1APBA 3RU9A 1OWPA 1L5HB 3UAXA 3SC2B 3ZY4A 2X9NA 5JD4A 4FX5A 3LY5A 4FKZA 5E1BA 2PYIA 4G5HA 4Z3DA 3DOJA 3DAPA 2HQ1A 2Q3LA 1XK7A 4URUR 2WM9B 2BR5A 1GARA 2Z5LA 3LKVA 4QOIA 1NC1A 4WY5A 2X58A 3CKLA 2ZATA 1HT1E 3MMPA 3KKNA 4R9SA 4W5NA 3CY6A 2A9QA 2HIHA 3S2SA 1GLVA 1K66A 4QKQA 1DOZA 4HXYA 4QD3A 3WOVA 3DHEA 1F20A 3KKKA 4K6MA 3MILA 2GPSA 3BK2A 3RLIA 2WT9A 1U6KA 3LBNA 1X94A 2CVHA 1ANKA 4HNRA 3RAJA 1P0FA 3EFEA 4Q1CA 2BMWA 1TCVA 3R7BA 4Y2RA 3ZLJA 2J45A 4AO6A 3MTGA 4O2RA 4KW7A 5AFSA 2BGUA 5A5GA 2C3UA 3AEUA 4Y2SA 1CFZA 2Y4OA 3I5UA 4IIVA 1HDOA 4H2DA 3OF2A 4BJ6A 1V2HE 1M6VB 1XJCA 2DECA 1WV1A 2DTDA 3DEIA 3L0DA 4Q1DA 5HW0A 5FFNA 1O5OA 3VU9B 4UVIA 1PR0A 3J80A 1TC1A 2ZPUA 1D7OA 3RVSA 3A06A 3VGJA 3SP1A 4F96A 1MA3A 2AA3A 4KZKA 1N25