4Y1GA

Sav1875-e17n
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
171
structure length
170
Chain Sequence
TKKVAIILANEFEDINYSSPKEALENAGFNTVVIGDTANSEVVGKHGEKVTVDVGIAEAKPEDYDALLIPGGFSPDHLRGDTEGRYGTFAKYFTKNDVPTFAIHGPQILIDTDDLKGRTLTAVLNVRKDLSNAGAHVVDESVVVDNNIVTSRVPDDLDDFNREIVKQLQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional insight into the different oxidation states of SAV1875 from Staphylococcus aureus
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus mu50
molecule tags Hydrolase
molecule keywords Uncharacterized protein SAV1875
total genus 59
structure length 170
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4y1gA00
4P35A 2RK6A 3L7NA 3P9SA 2VPIA 1ONSA 2ZUVA 2ZUSA 1VHQA 4BFLA 1PDWA 1VCNA 4BIMA 3PQ3A 1I7SB 4ADSG 3UJNA 3EFEA 2GHRA 1T3TA 3TTVA 4BTEA 2ZUWA 4I2NA 1GGHA 1GPWB 1SY7A 4UZSA 4N0MA 4MNTA 4B31A 1OX6A 2GK3A 1P7ZA 3SF8A 3TQIA 4AJ9A 1OX4A 4AUNA 1K9VF 1P5FA 1P80A 1QVZA 4JQSA 1KWGA 4E08A 1IZZA 4P2GA 4ENVA 2R1VA 4MGHA 4AULA 1PE0A 1KXJA 3NOQA 2RK3A 3CY6A 3PQ4A 1GG9A 5SY6A 3TTXA 3CZAA 2D7JA 3PQ8A 3UOWA 4I46A 2YWBA 1QF7A 2AB0A 1GGKA 1O1YA 1OX5A 3WFZA 1I1QB 1UCFA 3EJ6A 3BWEA 4OIFA 4UCFA 3PQ2A 3CNEA 2VKTA 2VDJA 3N7TA 4E5VA 3UMMA 2R1UA 2ISSD 1BXRB 4L7QA 5DFAA 3P9QA 3SOZA 4UOZA 4OGFA 1GGEA 1QWSA 1PV2A 3OT1B 4OGGA 3TTTA 4ENUA 4L95C 2OR3A 3TTWA 4Y1GA 4ZGGA 3ER6A 3GRAA 1T0BA 4N12A 2R1VB 4UOQA 1QVVA 3KKLA 4Y1EA 3L3BA 2IUFA 2V4UA 4L8FA 4RKWA 4L8YA 3SF8B 4Y1FA 4R7GA 2RK4A 3MIIA 1U9CA 3P9RA 4UNIA 1R9GA 3R76A 1N57A 4B7AA 3VU3A 1IPHA 1C30B 1CF9A 5JZMA 1VCMA 5BV2P 3ZJ4A 5SYAA 3B38A 3MGKA 1GGJA 1P81A 3CYFA 2R1TA 3NOOA 3NVAA 1PDVA 4HCJA 4OQ4A 3D54D 4Y1RA 1I7QB 4ENRA 4ENQA 1OI4A 5JZOA 4K2HA 2FEXA 4ZDKA 3M3PA 3FSEA 1JVNA 2AD5A 2W7TA 1GPMA 3EN0A 2YWJA 4GUDA 4P5PA 3UK7A 3PQ5A 5SY9A 2H2WA 5E9AA 3F5DA 3PQ7A 3ZJ5A 4S0ZA 1T36B 4ZDJA 3F71A 1M6VB 1OX4B 3L18A 4OJYA 1GGFA 3TTYA 4WXYB 1G2IA 1JDBC 3NORA 4P36A 3ZR4B 2WJZB 4OFWA 3PQ6A 4AUMA 4ENTA 4RKYA 3R74A 3CZ9A 1A9XB 3B36A 5K4AA 3RHTA 3NOVA 1L9XA 3EWNA 2NV0A 2A9VA 4WINA 4AUEA 3P9PA 1KWKA 1QDLB 1WL8A 3FIJA 4Y0NA 1SOAA 4ENPA 4XLLA 1QVWA 1VCOA 4Y1RB 5SY4A 2ZUTA 4ENWA 2R1TB 2YWCA 3EZGA 1CE8B 2XF2A 4I4NA 2VXOA 4L78A 4P34A 4B40A 3BHNA 2ABWA 5IP5A 1Q2UA 3R75A 5LIRA 1CS0B 2YWDA 3NONA 4GE3A 4ZDIA 4QYTA 4LRUA 2NV2B 2VRNA 4PXYA 3TTUA 1OY1A 2ZUUA 3B3AA 3TTSA 1S1MA 1KA9H 4LGYA 3UGJA 4MTCA 1KEEB 1C3OB 2LXNA 1FY2A 1Q7RA 3L4EA 1J42A 3OT1A 4GE0A 4QYXA 4B2YA 4D1YA 1FYEA 1P7YA 4ENSA 4L8WB 4B5KA 1IZYA
chains in the Genus database with same CATH superfamily
1E5VA 3HBFA 4YMSA 2D5LA 1Z2PX 2E9SA 1K7XB 4YRFA 4B09A 2YH2A 4ZCMA 3GZNA 5E0KB 1CK4A 5DN6D 3PNOA 3FAKA 2ZULA 4HQKA 4D97A 3HSSA 3JVUA 4MJ7A 3Q7EA 3O0DA 2ZI3A 2ZRAA 2BZ1A 2CN1A 1JSXA 4PLPA 3T7CA 5BR7A 4YRQA 5I48A 4CLXA 5AW2A 3TNJA 1FS4A 3RWOA 3LNTA 3ZWOA 4EUNA 3GRRA 5C51B 1M6EX 1VE3A 3ZU4A 4BO9A 1MX3A 3A1UA 3GLIB 1XWFA 4OJMX 4ACBA 4ZU3A 4BMVA 4G3XA 2AN5A 2OV6A 3RS3A 3GHYA 5DW3A 2LV8A 3WGVA 5A4JA 1GG2A 3KXKA 1HE4A 2A33A 3H9CA 1JHPA 2R65A 3U9TA 2H85A 3JAWB 4DDHA 2ECFA 2H57A 3F4LA 4C30A 2HJHA 4MV5A 4G56A 4MQMA 4U6QA 4D99A 2F90A 1TAQA 4XIJA 4ZWNA 3ZI0A 1A2OA 3OFJA 3IULA 3ZDQA 1UC8A 4D46A 4CTMA 4WN9B 1WCYA 3IBSA 1T6BY 5CB4B 1J8MF 4KQEA 2VJMA 4D44A 3V9PA 2C9MA 2CNNA 3QFSA 4JEIA 3T9BA 2ONZA 1A4XA 1EK6A 2YHSA 4EGSA 4HDOB 2ZDQA 4QOGA 2V9CA 1VBFA 2OBBA 4ZA2A 3ZBUA 4EPTA 1J06A 1ISRA 5HUHA 3FLEA 3GT7A 3D4PA 4QPNA 3C48A 3DAHA 5EIOA 4EAQA 3AK4A 2PT6A 4LFCB 3JQQA 1N2ZA 3PXXA 3GW8A 1GGVA 4HLNA 2C77A 1Q91A 3CYFA 3TH5A 1MP0A 3A14A 3TIVA 2PO5A 3ACDA 3Q3IA 5B3LA 1GKLA 1X1TA 2GZMA 1HKUA 3Q0IA 4B0PA 3THYA 2QMUA 4PWYA 1KL7A 2F3UA 2C5LA 2Q6LA 4WY5A 4BJ3A 2DFVA 4MAAA 5B4TA 1QOPB 2Y77A 3RLFA 1L5ZA 5K4HA 1JQ3A 4I9NA 2JHGA 3BQNB 2PXXA 3PQ7A 5DHSA 4S0ZA 4ZU1X 1S2OA 2R62A 4UBLA 4YV0A 1N0VC 2G1KA 4RM3A 1R3UA 1XP8A 2LE0A 3N2GA 3ETGA 3OZGA 1GCGA 1PT6A 1J56A 1P2FA 4GI1A 2IXFA 1LD3A 1V95A 3C3AA 3H4IA 2J7PA 3H2IA 4CLDA 1M5TA 1I5OA 2P9HA 1KYVA 3AHEA 2HEIA 4MS4A 1JDPA 1SQSA 5EHIA 2WTNA 2ZSBA 3C3PA 2EFGA 2W83A 4UW9A 3S81A 2ZWVA 3FVRA 1CULC 1C9MA 2ZCUA 3DBIA 4G5SA 1U8FO 1MRNA 3ZWMA 4M6WA 3K9LA 1TC1A 1KR5A 1JECA 3EX7C 2H8GA 5EZ5A 1UDXA 1I01A 5AKZA 1MUUA 1A9ZA 1H6DA 2QM3A 4KLZA 3FKJA 1U8CB 4W9NC 4BNZA 5IT9A 1EGMB 2H0RA 4IGEA 3EVBA 4Z3DA 4K9MA 2R3SA 4LCEA 2IUYA 3NI2A 4J29A 4LC0A 4XUEA 1VSTA 2CMHA 2IPXA 4CV1A 5JADA 5KDOA 1EFPB 1VECA 1ECPA 3C3JA 3EAGA 5IWAB 4C2TA 4LF9B 3OT4A 2FFJA 4QC2A 4YROA 3EGVA 4B4OA 2Q3CA 3RQIA 2V8OA 4UNNA 4D9EA 4RZIA 4TXLA 5D5PA 3U44A 3IVGA 3GCWA 3ZDBA 1XMOB 4GMDA 5T4BA 1CDOA 2V7QA 5AW9A 3HJFA 3MJDA 3TLBA 3WQRA 3AUXA 5FUWA 5JRDS 2PGAA 3OF3A 1U81A 3QOWA 1KEEA 1Y8QB 4KW7A 1Z5ZA 5EMLA 5FL7A 1JWBB 5EHZA 4GGMX 1XX6A 2AW3A 3ETNA 4N65A 4DLVA 4KKVA 4H7DA 1SCIA 2G28A 3DZIA 4N03A 2A57A 3G7NA 1AQJA 2BJVA 4L08A 1K92A 1OZAA 3ER8A 1IZZA 1A3CA 3QUAA 4L6AA 1Z5UA 2FU5C 1VJ0A 3CY6A 3KQSA 1XCPA 4B4DA 4C2UA 3BMQA 1P0CA 1I24A 4J0FA 4AMUA 5F2NA 1IRIA 4Q3NA 4B48A 3AVVA 1Y8AA 3D8HA 1M8PA 2Z30A 4X1IB 1RZUA 1GA4A 4Q5IA 1ZA2A 2EHDA 2CLHB 2DZDA 4RXUA 3TQSA 2VK1A 2JGNA 1PZFA 3BXPA 3GFBA 3WJ7A 2ODAA 4H0FA 1J07A 3D0RA 3NIDB 4J07A 2JIZD 4MLPA 4Q4DA 3LAWA 1HRDA 1OBHA 4F2PA 2RGYA 1G59A 3RVQA 4OG2A 3C6MA 1LVHA 1UINA 4DCSA 1EIWA 3QKIA 1BTOA 5T4FA 1Q0UA 3AC0A 3UK0A 1B0AA 1CZUA 1R00A 1UK6A 1Y3AA 3HDVA 1T0BA 4N12A 2ZIXA 3RVJA 1DPGA 1GCAA 5FBZA 3MBKA 1BH6A 1C9YA 4FZRA 2J8ZA 3L0ZA 3F98A 3I6YA 1EB9A 3PLNA 4KXVA 1XQYA 1ECLA 1SHTX 3KL2A 3LBAA 2P3OA 5ALLA 4AVYA 2AZXA 2AZDA 3KYCA 4HL6A 4NBWA 2L19A 1J99A 2X9VA 2HT6A 2ATCA 1DCFA 1W9MA 2H9IA 4B1FA 3BERA 3COYA 4FBMA 1T5DX 3RUCA 4WVLA 4G07A 1KMHB 4Y6SA 1PTKA 4NBUA 3W5BA 2CGEA 1E3IA 2QL9A 5CMLA 1E7MA 1G0NA 2EAUA 2RAVA 3FYUC 3TIXB 2R25B 4G9GA 4LQDA 5C34B 3RS2A 4MCAA 3PNKA 1B16A 3GNLA 2XGMA 1C3OA 1Z4IA 1V4VA 3ONDA 1PL6A 1H5QA 3M33A 1LQTA 2OP0A 2X5OA 3BF8A 1SZDA 3WNDA 4AS3A 2Q5CA 1H4SA 4DZZA 4AMZA 2PAFA 1W85A 4ZOLB 1XXHA 3JQ7A 3V4VB 5GVSA 1G63A 4NG5A 4AJOA 1M1NA 1U5BA 3HKDA 5CLLA 1M0EA 5CVUA 4BV9A 2RGAA 1W75A 2CLEB 3L07A 4B33A 4OY3A 4TZKA 4G4SP 2H8KA 1W2WB 2FJ0A 2RAPA 3OZEA 4QGFA 2NMVA 1CRZA 2OCBA 3F3SA 1H2XA 3VO1A 3IEXA 4M0FA 1DELA 2GFIA 1Z0JA 3M5DA 2I34A 4YAKA 4NZNA 1QCDA 1VB5A 3B1YA 4B6SA 5B3KA 4BUCA 5B57C 3RF7A 2H0QA 4MYRA 2ESRA 2GEVA 2R6HA 2HU2A 2W2VA 4RETA 4CZ2A 1DWQA 1U0NA 3D7KA 1MVOA 1U98A 1N6NA 2XNCA 1QK3A 5JJCA 4GO1A 4LYGA 5L45A 5PGMA 5EP1A 4B7CA 5A3JA 4DV4B 5BSTA 2Y4NA 2YV4A 5IFLA 3L0YA 1PWHA 2QTLA 5F5NA 2IS2A 1XWIA 3QLVA 1EHYA 1YZKA 4OXIA 2ZE5A 3ZGZA 3HHEA 1WEHA 4QYSA 4IY1A 5BN3B 2FSGA 5JYCA 3RVRA 1PTJC 1S02A 4LYFA 2H2AA 2XYPA 5M3BA 2YZKA 1W73A 3UY4A 4QM6A 1QKKA 4WLFA 1E3QA 1GSOA 3D0KA 3OKFA 3V3KA 1AUPA 1EM6A 3LCVB 4P4GA 3INNA 3KZNA 3ZIAA 1XKTA 4Q9NA 4BXOB 1V4BA 4DMGA 4EW1A 1Y9EA 2UYGA 1K9VF 4EJMA 3FNGA 3BQ9A 3MMPA 4XWTA 3F73A 2GBCA 4HQ0A 4IO1A 4IHKA 1ILEA 5JAOA 2H63A 5SY6A 3LX4A 3U4IA 5COAA 1JQKA 1XAJA 1JEYA 2WBLC 3IKLA 3ISJA 1SR8A 3PNLA 1VJRA 3PGKA 1QFZA 2E1RA 3IQDB 4A16A 4ZO8A 4K9QA 1TA4A 4CF7A 2XTZA 4MWTA 3WFZA 4JQZA 1DE0A 1RJEA 5TEWA 4HEJA 1AKVA 1ILWA 1PQUA 3V32A 3BULA 4UCWA 2ZB2A 3SY8A 3O95A 1LVGA 3KRTA 5EKUA 4YREA 5BUSA 4IF6A 4O2AA 1YK1A 1NT4A 3RYTC 4F4FA 3WE7A 2RGWA 2OB1A 3OEHA 1FLDA 2ATVA 3CCFA 4DMLA 1C7FA 3KYIB 3GJ0A 3OT5A 3D8UA 2EJVA 1Z74A 4ACAA 4CM9A 3QEMB 1R4NA 1KSFX 2BL4A 1PGJA 1VJGA 2DF8A 3R6WA 3ADOA 1UPAA 4NFHA 4K0KB 3IMGA 1T4CA 4O3FA 1WSAA 3GZTB 3E53A 2A6PA 4HVCA 1AXEA 3A9CA 1CQWA 2B4AA 2IEDA 3KKNA 1ORVA 3SBXA 1MW9X 1SFRA 3UAXA 3HVIA 2XDQB 3TW0A 3QEJA 1LJ8A 3SZRA 4JOBA 2CXQA 2ECQA 3X1MA 1E1NA 5AFSA 4JJZA 1CT9A 4BZQA 2W71A 2PD4A 2NAPA 4MB2A 3FNHA 2QPOA 1GJRA 1NX6A 1D2CA 2A4KA 4PRZA 2V45A 2O5EA 1X80A 2AN3A 4TKVA 3AEUB 1U1FA 3LDHA 1JWAB 1RHJA 5CURA 1G98A 2QR5A 5IDYA 3ZD6A 4I08A 5KJ1A 4NK4A 4MINA 1B73A 2ZYSA 5FLKA 1VSUA 2JKYA 4GEKA 2X0RA 1JDUA 1SUIA 2Q1XA 3GUCA 5HQJA 1OU4A 2CFTA 2I3DA 1WNFA 4ISBA 4UNPA 3COPA 2YCBA 1F17A 1ZD5A 1B93A 2CKDA 2YHUA 3RHFA 2EFHB 2FQWA 3P4XA 3SAJA 3BSWA 3SU8A 3MTGA 4V0RA 4DG9A 2DGDA 3BHNA 3COJA 1MRSA 4A0FA 4KR9A 4BWVA 2BKAA 2C61A 1ZD9A 2BEWB 2CDAA 3FYTA 4C0WA 4O2BB 1SURA 5L3SA 2ZIWB 3O4VA 2Z2KA 5DF1A 3GIWA 3JASA 2BMFA 4ZOEA 5EGNA 3UHJA 2VF7A 1KQOA 5J3JA 4BZXA 4BLWA 1ES9A 4L4XA 5J4HA 1LK7A 4L73A 1PDOA 1IM8A 2B2NA 4FFPA 1BWQA 2PV0A 2OCIA 2YV5A 2A9OA 1QRSA 2P9QA 4DS3A 1KC1A 3NV9A 1MIOB 4HAVA 1T1JA 2WVGA 1NQXA 1ETUA 4OXRA 3OWHA 4H4EA 1Y1TA 4HPXB 6Q21A 4FOPA 1HZZC 3R20A 1KBOA 4I3FA 1V9CA 5CD9A 1M1YA 3GRZA 1T15A 1QO7A 3KEGA 4DM4A 4ZQCB 4PONA 1H0HA 4BB5A 4BEVA 2IH5A 2BUBA 4K28A 2I1LA 3STYA 3TJRA 2IRWA 3CEHA 1HTTA 3TCXB 5ALZA 1KI9A 1Y8RA 2FK7A 5FI0B 3VH3A 4EIWA 1U0JA 5A5VA 1JH9A 2FWRA 5JYBA 1U2PA 2HWUA 4M89A 4OV6B 2VSQA 1JBQA 1OAKA 2F59A 2XHZA 3ADDA 4DB2A 1VE7A 2DWQA 1XNQB 1NNSA 4R2XA 1TCCA 3GPCA 3UICA 2QPAA 2I4LA 4MVCA 3MAAC 4BN4A 4CRWB 4OD0A 5C8YB 3M3HA 5H82A 1Q83A 1G9SA 5JVDB 4MYTA 5KQSA 3L46A 2ZUEA 1AMUA 2DBYA 1S96A 4Y6LA 1P2DA 2DU8A 1G8MA 1WMEA 4HFNA 1E6UA 4R1QA 1HXHA 3X2EA 2NU9A 4YFVA 2G1AA 3Q12A 3ZK8A 1CBUA 5E1BA 3UBMA 2DPLA 1TE2A 4XASA 5IF9A 3KOMA 1MA3A 4GP9A 1E6EA 1RCFA 4GDFA 2FWIA 4B3IA 1QQ6A 3KKEA 3HYRA 1E1CB 1VZ2A 2AE2A 2IIQA 4DKJA 2F43B 2YWFA 3UXEA 1I33A 2LRHA 3ZE8A 2HUPA 1W4ZA 3FTNA 1DU4A 1QDEA 1T29A 2BGIA 1VL6A 3LXMA 3N8HA 2BELA 2EP7A 3DPSA 1JEQA 1HLDA 3MA0A 1CQIB 4MRRA 1TD1A 1SC6A 2GMWA 1VHDA 1GHTA 1DSSG 5DYWA 1NW7A 5JJLA 4KVFA 1UOQA 3OOEA 4RMIA 2XYVA 3LM8A 1CQJA 4HPJB 5C8VA 1DQSA 1IBLB 4DV3B 4QUKA 1E2PA 3LPCA 5JSFA 4DSAA 3DP9A 6PFKA 4FNGA 5LLSA 3ANNA 2VVTA 4AO7A 4E30A 5FORA 1JDBC 1UKAA 5JFGA 2ZUCA 4EUFA 5IJ9B 4BZWA 3O38A 5K6RA 1FXWF 2BMAA 3AUTA 2Z2YA 4ZCLA 5ALXA 4DA9A 1NNI1 1MDBA 1O9GA 2Y6VA 4Z3KA 4YT8A 4US2R 2Z04A 3B3FA 4M1WA 3P52A 3QXSA 3QY9A 5CCBA 2H17A 4ALLA 4RY8A 2IH4A 2ZVDA 4X1IA 4BBJA 1A27A 1DC8A 1TTQB 2XNDD 3K0FA 5AJXA 2O7SA 3CN7A 4DMFA 4TV8B 3BN3A 4FT4A 5IG2A 3A6PC 2B69A 1TYEB 1VRCA 3T95A 1V47A 1BC5A 5DSTA 3STXA 2A9JA 1MIHA 1SQGA 2C5FA 5LZ8A 2QRLA 2P4HX 4B2LA 1N5LA 3FWZA 4BAGA 4DWOA 2PMFA 4ZGBA 5HK9A 3EA0A 5KC9A 2J85A 3Q0EA 1WXEA 3GLFA 2VOJA 5ICCA 1BWSA 5CTAA 3ZV4A 2WVHA 4W4TA 1KEEB 1T36A 3M9WA 3AF2A 2CFOA 1JTFA 2OA0A 5DWVA 3VH2A 3P4YA 4KRXA 1AQIA 3I9NA 3WGZA 4C7MA 5K3AA 1TMOA 3F7NA 2XLCA 4BL5A 1KKMA 1FFYA 4IJQA 4EI9A 1QHHA 1A8HA 1QS0B 3K0EA 4OHPA 4HLCA 1GPLA 4F84A 3H2GA 3QLEA 3F7MA 2BHSA 2X0EA 4B3RB 3LQ4A 1ZISA 4YR9A 1FUIA 3UAZA 2IV3A 2BFEA 1Q3KA 1F48A 4ZXPA 5CEJA 1E9CA 3OICA 3ZHRA 3T0IA 1L7BA 3BREA 2NSJA 2JHCA 1PHPA 3ZWWA 1EFRA 1UMCB 4ZI5A 5BSGA 2A0WA 4TOIA 5M04A 3U6BA 1ZRHA 1IZ9A 3E27A 2X22A 2XNHA 4CMCA 2AG8A 3WGLA 2AFHB 1XDSA 2O07A 2N1MA 1JAYA 4RU1A 4KE6A 2UYOA 5E6SB 3ORQA 4WOKA 3A26A 2JFBA 1PI3A 1SVKA 2DY1A 1X38A 2ZCVA 5C7IO 4AKTA 3N75A 2HMAA 5JY1A 4X97A 2RI1A 2A5JA 4WK0B 3E4CA 3KVRA 3O8OB 4UD6A 3MJFA 3RRXA 4E12A 3MOIA 2OLJA 3FIUA 3U7QA 1CWUA 1QFYA 1MPXA 2C8KA 3UCEA 1E3EA 1KTIA 1IQPA 2FR1A 2OZLA 4QBGB 5DGHA 3LU1A 1FRNA 4Y2YA 3OJCA 2QYSA 1XZAA 1H0RA 4BN5A 1BS1A 3W3ZB 3N05A 2IPNA 1K7FB 1YKSA 1NTRA 1VTKA 2C5HA 1KO1A 3T7KA 2OHVA 5HGJA 3SN6A 4TQGA 5ADHA 4MR7B 2PJUA 4ND1A 2ZIZA 4NZYA 3AL3A 1Q1NA 5K1ZA 3UBTA 2N9UA 1GGJA 2QYHA 2XQGA 2W90A 4FUTA 3H1BA 3ZVNA 3M82A 1VKRA 2QUKA 2QAGB 5I5GA 1IC6A 1WM1A 2B94A 3QE0A 5IKPA 1AMOA 1RE1A 5KVVA 1ENPA 4K2AA 4LSGA 4N3AA 4D6XA 5JO0A 2E21A 4C4AA 1JDSA 1XDWA 5TR9A 1J1ZA 2J3JA 3K8ZA 3OJEA 4QBTA 4YAEA 1SCKA 5GV7A 4F9GA 4M0KA 1R37A 1FBNA 2J7KA 3RU9A 5I7EA 5DB4A 3HFRA 2RBGA 3ZNPA 1PFKA 3QUQA 3MXTA 3SHFA 3ZDYB 3GLIA 5FPYA 1GVNB 3ZDXB 4NF2A 2UVPA 4HKTA 3B48A 2MU1A 4DNQA 5K20A 5T5QA 2BGMA 1AU9A 4BFXA 2WTBA 4OX9B 2PNFA 5KYTA 3HACA 3CKKA 4BFVA 1D09A 2R96A 10MHA 3V7FA 4FDUA 3OZUA 4G67A 3FYSA 1NN3A 3EIUA 1Q0LA 3N70A 1JR3D 3NBMA 4ZMBA 3KUKA 3OM8A 5IN4A 1ZD1A 4IMRA 1M34A 2R87A 3TO5A 3WK8A 2PMDA 5LZ5A 1SIWA 2QP3A 4P34A 4ZQGA 4UUAA 4C6SA 2Z9DA 4Z9YA 3UHAA 1TQ8A 4RIHA 2XDYA 1XZIA 4QHSA 1X0XA 2C9CA 3MXOA 5CDTA 3KTFA 4L57A 3E3NA 4FN5A 4I9UA 4ROTA 4DV2B 4PPFA 2XSZA 5H8WA 3JYQA 4FNAA 2HF2A 3AJEA 4N39A 1I5RA 1ZJ4A 4BFUA 4Q9IA 3TZEA 1H9AA 1FW6A 2AEFA 5EUCA 3TR0A 4OKSA 4JC0A 2F1HA 3IV9A 4HAWA 2ZJAA 4HPWA 2ZREA 1F9AA 3SYKA 4BDSA 5DYGA 3C15C 3HR7A 3K0CC 1PZHA 2CD7A 5KNDH 3GYGA 2RGEA 2XUDA 3N8KA 3ABRB 3ZNOA 1QX4A 1K5GA 2JJ2A 5MN6A 3QLTA 2C7PA 1NZFA 2UUPA 3AM3A 3HH8A 3DE5X 2J9YB 2IUTA 2NLOA 2O0LA 4NOLA 4UZEA 1HK7A 4MH0R 4MPTA 1NF9A 4K0RA 2GK3A 5BXQC 2WZQA 5L7TA 2AFHE 1Z4NA 1E7RA 2B1RA 2GJ9A 2YDYA 2YYZA 4NS1A 4Y2HA 4Z49A 3A4LA 2DQZA 1RYYA 1FOEB 4K88A 2WUDA 2X8BA 1NR1A 4TRNA 3CWCA 1YJ5A 1AKWA 4L6CA 3RBZA 3HVKA 5BW6B 4L3VA 4INOA 4FDMA 3RF6A 5KHLB 3FMOB 3KP1A 4LZAA 1NI4B 2QKYA 3F8TA 4DVGA 1SIOA 4EY8A 4F9TA 1V8BA 3Q5DA 4BJ6A 5L3VA 4ETIA 4BLUA 1MHTA 2YYAA 1CDZA 5H68A 4DNOA 3HEBA 3IB3A 3I2KA 1M5RA 3AJ9A 2DPMA 4KBYA 4A0QA 3BCHA 1Z36A 3FHLA 3TTWA 4K6CA 1BS2A 1SBQA 3F4KA 3MAJA 4L6IA 4Y2UA 1PW5A 4YLYA 4GL2A 3FRJA 3LQKA 3AUFA 3PPVA 5IHPA 3T7RA 4D6PA 2D0DA 3UWDA 1T35A 4ESOA 2TMGA 1EX7A 4G4IA 1Z4LA 1GU0A 4KJXA 4KQIA 4MAMA 2C3OA 4Z9BA 4HFRA 3KB2A 4IZ6A 5CG2A 5JYDA 5JTTA 1JXAA 3CPHA 2IXEA 1EG2A 1YL6A 1Z4JA 2FPLA 3F3MA 2PIAA 2VF5X 5DX8A 4BAUA 4LWZA 1MA0A 3TQRA 3K09A 3EF1A 4EHFA 2GPWA 4NBLA 1V1JA 2HQBA 3IP3A 2H5IA 4JYCA 2HR1A 3C3WA 1XPJA 4GWLA 4RTPA 2XGOA 4FHGA 5JZVA 1L8OA 5DP2A 3ZJ5A 1SO8A 1SVNA 1QIKA 5ALQA 4ZDJA 2ZRNA 1UMKA 2X19A 1L3BA 1T8YA 2ZI6A 4ZRMA 4MI6A 4CFZA 4JT4A 4CQMA 2VXYA 2WA1A 3NIGB 3T7AA 2QE7A 1H8HA 2XGGA 3EQ6A 1XZ8A 1VGVA 1WO8A 4LVCA 1GYRA 3SFZA 3GN1A 1JU9A 1JVBA 4NU5A 1N75A 3ZZ1A 1GTVA 3OJXA 1X1QA 1DOZA 2CB0A 4EHLA 3O4RA 2GCOB 1E4VA 2UYQA 6ADHA 4N7BA 1JNXX 1XKLA 4EB6A 4RTRA 2GYUA 2WSBA 4LZNA 4I50F 3TW8A 2JIZA 2XT0A 4LECA 4QA9A 3OMLA 4R2JA 3KUCA 5ULLA 3WB1A 4ZZ0A 4UQLA 2B8EA 1L5RA 1P44A 2RAUA 2VP9A 2DFPA 3MUFA 5LCXA 2UZIR 5K8VA 3W5AA 1HNWB 2Z3WA 3REFA 3BDIA 3OPNA 4YA6A 2FX2A 3QHQA 5BY2A 2NQTA 1NP7A 3WYAA 2IJGX 3ETJA 4RIGA 3ZZUA 2YRWA 4UEWA 3SIPA 1V1RA 3RRMA 3G9QA 3K6JA 2ZI7A 1A2KC 4CMHA 2R97A 5ICMA 3W2EA 1QQ5A 2IHTA 2EG9A 5CK4A 3UH0A 3UZUA 4Z1MD 1AGNA 3FCCA 2GXQA 4Q47A 3HB5X 1EMDA 1N3IA 4IJUA 1KMHA 2NYRA 2WWGA 2IXGA 4WKNA 3VO9A 3V8PA 1VKNA 2HJGA 4KACA 3E18A 5AJVB 2FW7A 3WDSA 1YR6A 1POXA 4KXWA 5KI6A 1E3SA 4AJ9A 3SF8A 4NNOA 1RC8A 2J6HA 5KJ6A 4IDHA 2NQ8A 5KU1A 1E0AA 1K3TA 3VYRB 2L42A 1KEUA 3I4FA 3UUEA 2ENWA 3CB4A 1J2YA 1W0JD 3O8QA 1BKSB 2GD0A 3ZXUB 3N9IA 1V16B 1LX6A 1A8PA 1G64A 1R12A 2VH2A 4NZPA 1BXRA 2CJYA 2JI4A 3JQ8A 3WB2A 2ZG6A 5ELMA 2V1UA 1U1EA 1I5EA 1O1YA 4DC0A 1L3IA 3BWEA 4FC7A 4F4IA 5JQGA 2BDEA 1V7PC 5FUVA 3QU4A 4HZIA 5HF6A 4YXWA 4B6QA 3AJAA 1Y3DE 1RTTA 5F1YA 2OPBA 3SOZA 3W2HA 2K7FA 2PIDA 3MTEA 5BORA 2WU8A 1N3YA 3PD7A 4I5DA 2BH9A 3V4SA 3QFFA 1CY6A 1XCGB 4D8UA 3FWKA 4RK7A 5HF8A 1LU9A 1ESZA 3DNMA 3WK5A 4B2IA 4JIMA 4XQGA 2GEKA 3I83A 3O75A 4LBYA 1KDRA 1S9DA 3O8OA 5IS2A 2N1BA 3I73A 4MKZA 3T9AA 2BMEA 4DBLC 1GPDG 3HKBA 2AIRA 3ZHVA 1SA0B 3F46A 3PNPA 3A8TA 4GQAA 1CR1A 2E6KA 3LUFA 3S2IA 1LEHA 5LKAA 3GMIA 1OIXA 5E6RB 3IVAA 1Y0BA 4POOA 5TB5A 4D4JA 5LN1A 1SNYA 1LDMA 5D1HA 4BEBA 4CYMA 2YWJA 4P92A 5K09A 4QLBA 2I54A 5E7IA 3C6ZA 4H1VA 3N59A 2ZR7A 4LYAA 2Y1FA 3A3OA 4XM1A 5BSVA 4QOJA 4EA6A 5LZ9A 4AROA 3L18A 1SCBA 4U2KA 4RQAA 3WIDA 4BHTA 4F8EA 1CERA 4PN7A 4DR6B 4ZQFA 1B00A 2ZRJA 4GXRA 3P45A 1HL3A 1MEEA 2P68A 2C3UA 4MTLA 1HC7A 5EJ6A 2H06A 4O08A 2VHUA 2QBYB 3SSAA 1KJNA 1QH9A 1QLJA 4HUQA 1D2HA 3V9AA 4F11A 3P5SA 4K6GA 3QEKA 3IPRA 2O4CA 2XAAA 2YS6A 1P7VA 3A28A 3QXHA 5JS1A 1TK3A 2CNOA 3I2HA 3VSAA 4DV1B 1EA5A 5EP3A 3GJXC 4CLRA 3JWPA 2GN2A 5LDDC 1H2ZA 2Y6UA 1CR2A 1G8YA 1K5PA 3A9WA 3DSRA 1VLJA 2RFLA 4EG0A 5CA1B 3KVVA 4D4MA 1ZIYA 3DWFA 4LJRA 2J6IA 4PLZA 4W7SA 3AYXB 4JR2A 4WASA 5IZ4A 2BLNA 3NYQA 1Y3HA 4BE4A 4KZKA 4TV8A 5FFNA 1S8NA 3ZU5A 1MIOA 2HM7A 1NG9A 1KJ8A 1QIDA 2HMVA 3K5PA 1M6HA 4TYMA 4EYEA 3C41J 1JQBA 2VPIA 2CYAA 3MFQA 4DREA 3PA6A 1E3TA 2P4QA 3LUGA 4HDNA 5KWVA 4P4SA 1MO6A 3HXMA 1FQJA 3WWOA 3C24A 4C0SA 2Z8YM 3IVXA 3CF6R 1RYDA 3BMQB 4BBZA 3A37A 3OZVA 4AD8A 1GL6A 1T2DA 2BVNA 3KHUA 3MWDA 3VMMA 4EF4A 1Q5PA 4EGCB 1W30A 3D6FA 5IZCA 2J3LA 5JOQA 3IXLA 4ND6A 1BQ4A 3HY3A 5A7HA 2DR0A 1ZH4A 5HFAA 3GFRA 3EDRA 5LA6B 4B4WA 3R24A 4U5XA 1X3SA 3QU2A 4WDRA 3FJYA 5E6RA 2PK3A 4F5ZA 1XZFA 1EWYA 2GNOA 1DJNA 1NMXA 1Z18A 2NSYA 3FZQA 4URZR 3A6DA 2ZBEA 2PDAA 4DDWA 2EFEB 4MUEA 2W2KB 2WV7A 4HFJA 2H07A 4MGIR 1JHVA 3OFKA 1NU6A 4AZWA 4F93B 4LRTB 3TPCA 4BVAA 1TKCA 4DYVA 4HRAA 1L7MA 4TLCA 5FKJA 1DCTA 1RAGA 4BKUA 3IQIX 4YCAA 5KX5B 1UKYA 2LBPA 5DM60 1XRSB 4N76A 4YGXB 4TMZA 1E1RA 1VL2A 5IZCC 5DMHA 1MO4A 1NTOA 2H1HA 3L06A 5KZMB 1S2LA 5L95A 3NMUF 4PQGA 5LR6A 3MF4A 1HQDA 3PGA1 4M8SA 1ZBDA 3NJ8A 3ZHXA 1LLFA 1Q0RA 3KDAA 3KWMA 3TLYA 4R3WA 3CGWA 2DTXA 3ASVA 3U3JA 1QZUA 1RC0A 3OUUA 3MQ4A 3Q8KA 1OVGA 3PYLA 1J8YF 4A6XA 3OJFA 1VCMA 5EN4A 4DMCA 1DUIA 1NQAO 1GAXA 3IMKA 4FLMA 3F6SA 4WSOA 4WY2A 5DWQA 1UAYA 1PK9A 2XUKA 2ZTVA 5CGQB 4Y8VA 5BQPA 5KYWB 1ZQ1A 1AA9A 3FN4A 3S0JA 4ENQA 4INZA 1D6NA 2YYSA 4HRVA 3SYTA 4WJLA 4MV4A 4PFSA 3EBPA 4I9FA 4WTOA 4H7JA 1NI5A 2FPWA 4JOSA 5KSOA 4MVWA 1J49A 2IH2A 4ZT4A 2QLBA 2FRXA 3GI1A 4J4TA 1GAJA 3PC3A 3N2KB 4HN4B 3IAS6 4OSPA 2WR8A 1D6JA 1SCUA 3LLSA 1WUKS 1FJGB 3Q4GA 2X4DA 1J9EA 1A77A 2IODA 3E8MA 1EX6A 3NWEA 4P7GA 4UHFA 3L7DA 5KVQA 1RLTA 1IXYA 1JALA 3GRPA 5DZSA 4O4IB 4EPWA 4N3CA 5HIKA 5IUNC 3NAGA 2X8AA 5BWLA 3ADPA 3GJ8A 3U0BA 3W1WA 5IF3A 3PDCA 1FLAA 3SM9A 4WD3A 1KJ9A 1Q19A 3TUJC 2OHGA 3N8GA 1BVRA 1LLQA 2YWCA 2OECA 1G9TA 1SZPA 2NN3C 2ZRKA 1RZRD 3LCUA 2XITA 1E2EA 4TKMA 4ZO6A 4M76B 3U7EB 1B8OA 1QE0A 4KLCA 1I7PA 4RQTA 4WCVA 3BMXA 3TSZA 1Q1ZA 4BFTA 2HSJA 4CLOA 3NRBA 1USVA 1NNUA 4NMMA 2ZM5A 2JGIA 2WI8A 4UBNA 2ZTUA 5F4ZA 1RYMA 2FN7A 1JSZA 2P4UA 3B6ZA 3O3CA 4WCDA 3L4EA 2ZJBA 1KSJA 3AHDA 2J3KA 4RPLA 3DM9B 1F2TA 1W0JA 4QYMA 4ZMSA 3V7NA 3IXMA 1JIQA 5IM4F 2ZIFA 4UNSA 4EFKA 4BX9A 2XPCA 1XRJA 2F3TA 2FKAA 5F9FA 1II8B 2RI0A 5EKSA 2J4CA 3T99A 4DDVA 4MR8A 4O5OA 3OAAA 4ZRNA 5EMJA 1HQCA 3DL7A 4NONA 2JJQA 4YQFA 2UXBB 2FPUA 1PG5A 1P77A 1GKKA 1YAHA 1EUDB 4IIUA 4N0QA 4F86A 5KNBD 5EMNA 4LVNA 3TBHA 1G3MA 1J2EA 3PGLA 1E9RA 1N8SA 3DXFA 4LOLA 5KNBH 2A59A 2Q49A 4V02A 1OMOA 1R5OA 4EQ6B 3TNLA 1D3AA 1E3DA 4JB2A 2IYSA 2MSWA 3H8SA 1JI3A 2J5RA 3N39C 1YFZA 3WP0A 2PUBA 3TLEA 2VYVD 3SHTA 2QMQA 3BRQA 4ASUD 3T5BA 3JARB 1AY0A 3OJOA 3GDHA 5LMZA 2ATIA 2W42A 1EJBA 1IN5A 2B4RO 3OOSA 4OJTA 4D0SA 1JTVA 3CBGA 1IU9A 3WTBA 1SGWA 5SICE 4CVNA 3EXIA 4CW7A 1RI4A 3BIXA 1TLTA 4BP1A 1IN8A 4DY4A 3RTEA 3KHTA 4LOJA 5G02A 4ND3A 4TRRA 4TVKA 3HEAA 2NVOA 3HYCA 1WMDA 5CK5A 3T1YB 4EA9A 4A0RA 3OQVA 3OZDA 3C3EA 1TUIA 2JDID 4HDQB 4C7BA 3WHPA 1BJRE 1AHIA 5IH3A 5DEIA 4CUZA 1OV6A 1LZLA 4R8VA 1GUFA 3VC1A 2C42A 1N33B 4Y1FA 1U9CA 2P11A 4R2KA 4OHYA 2I66A 4Z4EA 1YB1A 3Q5EA 4CDGA 4YDQA 3KLBA 2X0JA 4NAUA 1WABA 4AJJA 4O4JA 1FFHA 3QTTA 4JP3A 2HEGA 2I80A 2W11A 2PMCA 1H3FA 1XCLA 2YBEA 4LMBA 4E11A 1ISJA 3QUBA 5CVJA 2AD5A 1U7DA 4C03A 2RGNC 4UVDA 3PRYA 5FWDA 4CM1A 1N9ZA 2Q5FA 1EM8A 3ET4A 4P3PA 3VO2A 3P0RA 4DIOA 5KWSA 2FDXA 3ZVLA 2PMBA 1UBKS 3Q6NA 4NXMB 3CMMA 3ZGXA 1L5SA 4O2BF 4RF3A 5F9MA 2J59A 1DC5A 3AVQA 1J6UA 1WDKA 4GI7A 5JNUA 2I3ZA 1E62A 3BL8A 4NJOA 3NHRA 4MW7A 2OHFA 5YASA 1O5IA 3UT6A 5CPBA 2WWFA 4EY6A 3TDNA 3ED1A 4X85A 1XJ0A 2X2FA 1WQ3A 5CP8A 3PJEA 2CNWA 1R5JA 3CR8A 4GZ6A 1C14A 4TS9A 4JC8A 4Z9AA 5D3MB 1DXHA 4MEBA 3ZZNA 5KUTA 4FDVA 5K8UA 2ASEA 4FONA 4RD6A 1YTLA 1J8DA 2OGUA 1JA0A 3GPLA 1QTIA 3I1IA 4JVLA 5BVHB 4ZZ2A 4CIXA 5E7JA 1WP4A 1Y9DA 3AQ4A 1LDEA 3KIPA 1E1DA 3KLOA 1EA7A 3AP2A 3KO8A 1W4AA 4QG3A 5JANA 4DL9A 1G2OA 1RJWA 2E4ZA 3SYMA 1XVVA 2I29A 4GDMA 4GLBA 3O9ZA 4REOA 1GNQA 4XB6B 2AX3A 2DR2A 5JAZA 1CUIA 3BGOS 4OP2A 5KKAA 4CM9D 4D2IA 4CTOA 4YCBA 3ROXA 4KPYA 3DKVA 2BFFB 2C29D 3EBLA 4CEJA 4JUCA 4LF5B 1MAUA 2B5VA 2JFQA 2DR3A 3ND9A 4CEJB 1H9CA 3FGPA 3ZKWA 4YALA 1F9EA 1X8XA 3GEIA 4P1ZA 2XXBA 4AQDA 4ALIA 4I2NA 5KYXA 1MKYA 3A4MA 521PA 4DRZA 1OFUX 3D3WB 5KYKA 3R3WA 5JD3A 3A4VA 5BSFA 2XMCA 2AR0A 1U0SY 4MUMA 1Z22A 2JFHA 1LK0A 1S2NA 1WY5A 4ENVA 5H59A 5JJIA 2N47A 1ZHFA 2VWQA 2TRSB 2BEUB 1OD6A 4FKMA 2E4YA 3LRPA 3VQTA 3U4HA 5FO0A 2ZJ7A 2OFFA 3UWKA 4RSRA 1L7OA 3ASUA 2PWPA 2W6NA 3AVYA 2O52A 4TKUA 2CK3D 5T3UA 3RRJA 3HWSA 1PLKA 1C0PA 9MHTA 4D82A 1GNVA 2FSFA 2PO7A 4GQBA 4KLAA 1C3LA 1FNMA 4P5EA 5EESA 5FJIA 3PEUA 2EL9A 4PF1A 1KHHA 4AS2A 1A96A 1FXWA 1T0UA 3GGJA 5CM2Z 4UOEA 1YZGA 4R8MA 2O19A 2RHDA 3M5PA 1F4VA 1GY8A 3IKMB 2D1TA 4GVPA 4XGNA 4MIYA 5EQDA 4FM9A 5KTMA 1YDGA 3EA4A 3BG5A 1KI1A 1M2KA 2B37A 2DWOA 4DKXA 2WWWA 4DCNA 1IYZA 5K2MA 1Z07A 4OFBA 3JCZA 2XSZD 3FRIA 4Q21A 5EE0A 1CQIA 1XLUA 2Q3LA 4NZ9A 4OKIA 2MDTA 4C6TA 4E5MA 1SD1A 3FOZA 1UT8A 2BM1A 2CDCA 4FQ7A 3UMSA 2GCGA 4DLWA 1XDZA 4YJ2F 2WINI 4EA8A 5JZOA 3M89A 3DAYA 4RVHA 2PUTA 1ODIA 3EZYA 2IWHA 5E7MA 2OBLA 1TU3A 1JZQA 3IMFA 5ER9A 3RTCA 1KY5A 1SXJC 3ORSA 4PYJA 9ABPA 1PV4A 3FYHA 1AVTA 3SBDA 2KHZA 3TQFA 2NXEA 4YV1A 2O8EA 4PRLA 5IDXA 2HU7A 4PAQA 1T8TA 2VUUA 3EIEA 4UU0A 4XQ9A 2JG3A 4EJ2A 1ONPA 5EWMA 4A1OA 4QGBA 4CIDA 3PQ6A 5AHXA 3GAAA 3Q6MA 1N0WA 4I36A 4BIIA 1JHYA 3P5BA 2QQ5A 3DZGA 3R0IA 2X42A 3QWBA 4LF6B 2UV8A 4WINA 3Q7IA 3BQMB 5FCDA 2HJ9A 1B7GO 3EWIA 1YASA 3SJAA 3G0CA 3G13A 8ADHA 5KTPA 4CV0A 1OXBB 2WC1A 2XVAA 2PQ2A 3RM3A 4RPCA 3ELUA 3MB5A 1DWPA 4FGZA 4DA7A 4RK1A 1NMYA 5KSYA 1HTWA 4QJ4A 3AFIA 5FP0A 3VC2A 2PE5A 2CLDX 3KSRA 1V8FA 3AIOA 3BKXA 4GX5A 3GWZA 5IVKA 1JIIA 1EYZA 1NKTA 2NXNA 1DS6A 3QPBA 4QEZA 4Z4HA 3MVEA 1W36D 3RSLA 3TW4A 4Q4HA 3NVDA 3NT5A 1DFGA 4ZD6A 5TARA 2ODTX 3UJ6A 2QQFA 4A2CA 1TJPB 1CEXA 3P2OA 3SXUB 4DAEA 1QYIA 2DM6A 3QVXA 1BMTA 1T5LA 1U2DC 3DMYA 3O1IC 1EB8A 2CL6X 1U7PA 1TT5A 1RM4A 4XCQA 3WRXA 4UEQA 4EJSC 2ZRMA 4N8EA 1X1EA 3QG5A 1M33A 3WGJA 4DRXA 4CIBA 3M3DA 3DMRA 2GF0A 3LCRA 3TRHA 4P08A 2HO5A 1GPH1 1PZMA 2I2BA 1DAGA 2ODBA 2Q1SA 1EUCA 5AVJA 1XG5A 3O3OB 4BVJA 2WUVA 4CKCA 2VSOA 3QKTA 1JFSA 1H2AS 2YN0A 5HIAA 2XQVA 1NPTO 1NURA 2R44A 2X76A 2XF8A 3HLTA 2FZVA 1F6BA 3TTXA 4B3GA 2B1GA 1L4EA 1B41A 1QRRA 2O2GA 3IQFA 4GKVA 4P3NA 2HU8A 3CX6A 4X93A 3WL8A 2O8FA 3OHMA 1J2JA 1DIBA 1FUKA 1JT9A 1WW2A 1WAMA 2PZBA 4LOHA 1IUKA 2EC5A 3AFMA 3FTCA 5H7XA 5B64A 4U2BA 3RWBA 1GO2A 4BP8A 2HSZA 1J90A 1WBBA 2QTBA 2XYHA 4PLHA 4UEJA 3UMMA 1S4MA 2R2AA 5C37A 1W0KD 1WTCA 2WMOB 2B3DA 4HRYA 2FE4A 3U3KA 1O6BA 4QUEA 3V7UA 4IG9A 3MYYA 2VDQB 4TMVA 3ZX5A 3H5AA 1ZM7A 2Q5JA 4RK4A 4ENUA 4P32A 3BWDD 1DL5A 3DZDA 3HYNA 4UOQA 4R16A 2IYFA 3AR3A 3C74A 1L7VC 4Y9DA 1BHSA 4MW4A 1F06A 4WNYA 2FOXA 2IEGA 3SSNA 2D62A 5D01A 2GF2A 2WTXA 1GN9A 3EEIA 4MVJA 3MD0A 1RD4A 2X40A 1OAAA 1R6UA 1KIFA 1XZLA 3LY9A 4LW8A 1NYRA 3V6MA 4CI0B 1YDWA 3RIHA 3S70A 1QXSA 2JIDA 2R5WA 1DBQA 2YXEA 4MVJG 3BEDA 2QXYA 1VSBA 3CX7A 3NBXX 4M1SA 4LYYA 4UXHA 4WOBA 3I9FA 4YEDA 3GLIE 3SMVA 2HWYA 3D64A 3EDOA 4PX3A 4HAXA 2WSSD 3RT1A 2PD3A 4D0NA 2XGJA 1DG9A 2NUBA 2Q3DA 5KTKA 2ALJA 3UKDA 2GEJA 2P8SA 4G5QA 3C4QA 4HEHA 1VMIA 3I1YA 2WK1A 4I8DA 3AEQA 3QEOA 4YUXA 2NW6A 1VE9A 4J0EA 2V7VA 4ZJZA 1M6WA 4YAIA 3ROFA 3DFKA 1Y42X 2J09A 3QELA 5K4AA 2J7PD 2Z57A 5K8JB 3VPDA 1TQHA 3L7YA 3OUZA 2YCLA 1QK5A 4QRIA 3AEZA 1AHNA 5G2OA 3FIJA 4D02A 3P0FA 3R44A 5CDFA 2H7VA 5FBHA 1Y4AE 3P0EA 5ABPA 3U5TA 4GT1A 3DWGA 1L3CA 2WJHA 4YCNA 1K5DA 2AMYA 3IKTA 1ST3A 2C2BA 2WOJA 3JYPA 3GFPA 2GX6A 3KJGA 2GYYA 5CT6A 5JTUA 4DLTA 5FBRB 1CUFA 3DGFC 4MP8A 1MC4A 4M83A 1UBNA 4LF7B 2X7JA 4RVFA 1E99A 1WXXA 2RHCA 3JQFA 3QHAA 3W5HA 4IHAA 5KJFA 2JLZA 3HSYA 3E9QA 4L4YA 4XIIA 1Q84A 1JJFA 1LF5A 1RJDA 1SMKA 4KTVE 4CTNA 3PC2A 4J0CA 5K0BA 2J3DA 3OTOB 5LBUA 1BA3A 5MN5A 4HDNB 1P9OA 3FTPA 3VSDA 2P27A 2YQ5A 4Y30A 2FZ4A 3TWOA 3T3OA 4W6QA 1WUJS 4J0GA 5FO1A 2IPAB 2NTYC 5U9CA 2BJHA 3GJQA 2KLHA 5EFZA 5JASA 4XQCA 1W6UA 1Y81A 3WGHA 4P93A 3QI7A 1N3BA 1JBEA 1I80A 1SKAA 2PGOA 3R6DA 4NU0A 1OTHA 1I4TD 3AZOA 3JARA 3LW8A 4E1AA 4LZWA 1ID1A 3RK4A 1FLVA 3VM6A 4MQEB 1AHHA 4QTUB 2OENG 2XCTB 3AKYA 3G5MA 4KIWA 4X1YA 1M0SA 1V35A 3I76A 5F2OA 3ZCTA 3RG2A 1K9SA 3RV4A 2ID7A 2R4UA 1L4NA 4ZYWA 4TYPA 2BJWA 3ZY2A 1E1MA 3F6PA 3PQ8A 2RH8A 5HJ7A 3C87A 4N9QA 1SPXA 4NG4A 5H4GA 2VP4A 1S01A 1ZJ6A 4ARAA 2NU8B 3KSBC 1YVUA 3GEHA 4FUQA 5BO5A 3DF9A 1ZWLA 4ZVTA 1J2UA 1YC5A 3L49A 3HE3A 1RXWA 4MUKA 3ZCUA 3QGMA 1G6Q1 4A82A 2WHYA 3RADC 3IURA 3SS9X 5DKFA 1KZHA 3BRWA 1W87A 3LS2A 1QWSA 3QOYA 2QRJA 3KELA 1T3SA 2PV7A 4TXNA 4UQPA 3ZCRA 3I2JA 4M1TA 1REQB 1TIBA 2VL7A 3EODA 2GYWA 3KR2A 3LSYA 2FN9A 1A98A 4HNTA 1D2MA 2AFIE 1L4UA 5CFQA 4B9EA 2IU0A 1MB9A 1Z7GA 2BGUA 2GM9A 5FFMA 3X1KA 1F0YA 1NHGA 3CLRD 1PWXA 1OGJA 4R54A 1G5TA 2P9JA 3HKEB 3N28A 5B1DA 4GXNA 1G8SA 4P80A 1Y3BE 2VH1A 2KYRA 3CEJA 3A05A 3LA6A 4ZAVA 2W6ID 4CG2A 3H83A 4RJ2A 2FWPA 3IBCA 1V11A 4GPZA 3IDAA 4XKJA 1D1TA 1PSDA 1TQ6A 3U4CA 1OZGA 4BCBA 5HS4A 3HK2A 3KLNA 1KDVA 2P0AA 4P86A 2EW8A 3QMMA 3BCRA 1LPOA 3MWDB 4KWIA 4ZHQF 1FP1D 4I1PA 2WYIA 3QG1A 1UFOA 4NYJQ 1YJBA 2EFJA 3KZKA 1NPYA 1CUAA 4KNVA 1FYXA 4L4ZA 1LRKA 1OOEA 4E03A 3DCJA 3WMRA 4F45A 1CY1A 1EDBA 2HDHA 2PR2A 2NO5A 3P2KA 4LXIA 4MZXA 1P1CA 4PBTA 4DSUA 1UANA 2WU1A 2ZJ0A 2ORIA 3L6CA 4IH9A 4BNUA 2JIPA 3S1LA 3MNFA 1APBA 3IQGX 3IEVA 4B17A 1JLSA 1Q0QA 3AOGA 4LA4A 5EJGA 2J6CA 3O8DA 1P0MA 5HM8A 3BE4A 1JLRA 1Z29A 3BK7A 1GL7A 3DV9A 1JB9A 4ND8A 2ECPA 2O3TA 2E2WA 4N5DA 3UWOA 1U7OA 4GLFA 4C5AA 4I55F 1Q1BA 1E96A 1FVXA 2C4TA 5CA1A 2E5LB 3GH3A 4MTCA 1ZD2P 2MHCA 2P5TB 2WIBA 2GYVA 3VR5H 2FEKA 4PPNA 1H05A 1SRRA 4F6LA 3HYSA 1RACA 1MJGM 3A1FA 1E4YA 4OMCA 2QBYA 1D2AA 1JEQB 4J6EA 4KO1S 5IDWA 3BEOA 5CNIA 1J5PA 1ZGJA 4PCAA 1VPLA 3V48A 1RAAA 2A9QA 3W77A 5L4LA 1AE1A 1LDGA 2F62A 3WDLA 1USGA 4OREX 2MYNA 2RGRA 1W2HA 4CHGA 3WFIA 3CH6A 1XTJA 3M9XA 3OC0A 3RFVA 5EHQA 4CM7A 3JALA 1XN1A 3I6BA 3WAJA 1XMQB 1REQA 4I2VA 1NONA 2J31A 5F4BA 4B6PA 1I14A 3ZY6A 1IIRA 4DLRA 4PSUA 3AEXA 3C3BA 4GL4A 1ULBA 5TNXA 4HJRA 3V8VA 4NR0A 4WE3A 2CDRA 3IDZA 4YV2A 1W5SA 3B3GA 1UPTA 5BN1A 3TFWA 5IHXA 3HB0A 4FHZA 1M2VB 1USUA 5A7FA 4QELA 3DKPA 3GUHA 3H3JA 3V55A 2W2NA 4YT5A 4PHFA 4HGRA 2EZTA 1OAOA 3G89A 3RPEA 4ZCIA 1DLIA 2VTVA 3HHPA 4QPPA 3LGXA 3ECSA 3MM4A 5FNVF 3F5MA 3MRXA 2JBHA 3IPLA 5B2EA 1LQ2A 4FPXA 4AY2A 1A9YA 3ER6A 4KSYA 3UUFA 3VNQA 3UANA 3OTQA 3AVTA 4BWYA 2ZYDA 1YH3A 4QHTA 3ZE1B 1EM8B 2BD0A 1NDHA 4V03A 4Z0TA 4DWJA 1YU6A 1U8ZA 1ZVJA 2C59A 3LK6A 1IUPA 1JHRA 3LG2A 1QHGA 3P2YA 4QWMA 1KE1A 3VR5D 3WLKX 1GVHA 3O2NA 3R5KA 3ZJ4A 4EGJA 2QU8A 1WZUA 3R3JA 4YQYA 4YJ3F 5JECA 3D54D 3N0TA 5KNDD 2APJA 2BRUC 4R71A 1XTZA 5B2ZA 1CZRA 1T24A 3CR3C 1XT6A 1NFQA 3ET5A 5DJ5A 4D9NA 2YXBA 3BTOA 5CX1A 1OI3A 4RFSB 5AW7A 3PHHA 4TV9A 4B6JA 5U4XA 1JIKA 1C5KA 3BDVA 5BN4A 1SCAA 1KXZA 4U0JA 1EQUA 1OX4B 2P6OA 4G1UC 1IEVA 4HWOA 3STWA 1EPUA 1KAQA 1R10A 1TTHA 2PS1A 3VOSA 5F7JA 4BB6A 5HRUA 1NRWA 3K8QA 4ZT3A 3WL4A 2ORED 2GTPA 2EFYA 3JW8A 4DBVO 1HPLA 1PNQA 1F2VA 1PAUA 3D8BA 4X64B 1QTQA 1CUSA 3T5AA 2Q3JA 3U16A 1DC3A 3OIGA 1EX1A 1NQWA 5KQGA 2E82A 5T64A 3I9MA 4PTYA 1A9TA 2NPIA 1FMJA 2VNHA 2ZKIA 5ITWA 2JLAA 5EKDA 2W6CX 2FPRA 2GB4A 4QYWA 5KDLA 4EI8A 4ZPJA 3NFRA 1XTUA 4UATA 1VDZA 4TL7A 2D1FA 2H92A 3OPYI 1E2KA 3EDMA 1FZQA 4M36A 2QU7A 3E3MA 3K9BA 4IIXA 1ZGZA 4DQUA 2AOVA 5G4KA 2FZCA 1GZ5A 4RTOA 2A3RA 3BXEA 1COWD 5I9NA 3ZHYA 1H2WA 1KJYA 4R2MA 2Q29A 1TKBA 2JCYA 3IBFA 2Y1XA 1Z6AA 2BCEA 1IEQA 4N3NA 4DWWA 4RMNA 4QYXA 3DZFA 4JD5A 5LOVF 3NW9A 2E49A 3GFVA 3NH6A 5FWNA 1YBAA 2W6QA 1H8ED 1ORWA 3UWMA 1QUEA 4HBGA 4WA8A 2VPWA 2IUUA 1PDWA 4U7JA 4YDRA 4YMGA 3EIXA 3S2ZA 3F1KA 4MV1A 3PWZA 1ZWKA 2RSLA 2I4IA 1NVTA 1FJXA 2BTOA 2DQSA 3CUYA 4LDPA 1A5SB 5AK6A 1VOTA 5D5QA 1XMXA 2ZPUA 4KSBA 2Z1NA 4IP0A 1KO4A 3SX2A 4CLHA 5B6JA 1NP6A 1GKUB 3FJOA 5DN9A 1DLJA 1E8DA 2J33A 4IUDS 1LSJA 2DQYA 2ZXEA 3HA5A 4OGWA 1ZPDA 2C3PA 3JSAA 4RV9A 3WQBA 3HZOA 2IXTA 2WIDA 4BQNA 1NYLA 2VJBA 4BKQA 3D4BA 3GRVA 4MI1A 4E09A 1R6TA 1ZK3A 2WF5A 5A02A 5EKXA 8OHMA 1FVHA 3ZEIA 5CCXA 1GCIA 3TZQA 2D0PB 4LS3A 1V41E 2VJQA 3C16C 2NZ8A 4TQ9A 4DM3A 2GZRA 3MCTA 1OC4A 2C1ZA 2BR3A 2QD1A 4MV9A 1N6IA 2ZJ5A 3OCUA 5CW2A 4UAGA 3O93A 2H1CA 3O4FA 3H2SA 5A1TA 5CB6A 1K08A 5I51A 2VQEB 4F3TA 4K6KA 4AJKA 1BRTA 5CFPA 5L3SB 4XGKA 3K71B 2JCGA 4LJ6A 3TMYA 4E88A 1R0SA 2RGCA 2XKKA 2RK4A 4L76A 4UNIA 1IDN1 1FNNA 1QP0A 3TS1A 3JD0A 1W59A 3KZOA 1ZR4A 2CHUA 2R8OA 1JLMA 3OC6A 1L8XA 2Q21A 2X86A 3UHPA 4FOLA 2Q0XA 4ZAGA 3A6LA 5TY0A 3RJ9A 3X2SA 4BE9A 1UFRA 2HDNB 2IZ5A 1DRUA 1ENOA 1GAWA 1X9GA 3BMCB 4A9AA 3LYLA 2FG7C 1DIGA 1JSLA 3VZRA 3ON5A 4AKHA 1J70A 3L4SO 3K6KA 2PUAA 1UKEA 4ZN6A 3ZWQA 5BVGA 3ZUPA 1B1AA 3SG0A 3QPUA 3W8RA 2I2XB 2GAIA 1Z6ZA 2B25A 2IFTA 2W0MA 4HUJA 3E7PA 1WUHS 3DMNA 3L92A 1MQAA 3LDUA 4O1MA 3D02A 1KWKA 3R8XA 4GKJB 3SEAA 4LQ4A 1E2HA 1N0IA 2XTAA 3GJRA 2B4YA 1C29B 2YVKA 1SU7A 4UVEA 4BMOB 4MWSA 2NXJA 4OFXA 2CLOB 5E2AA 2CLLB 4QFCA 2VP3A 3U37A 3D4OA 3TXYA 3HDJA 2IW1A 1OUMA 3TLJA 3OOJA 2BT4A 4IIFA 5DGTA 1L7QA 2IU4A 1Q0HA 1GFSA 1QFXA 1YS7A 3EZGA 2H52A 5FLEX 1U9YA 4X7BA 2F9MA 4BASA 2WKQA 3L82B 1MV5A 2B78A 2L0XA 3AP1A 5COBA 5JCZA 2BEJA 3PITA 2VNJA 1UKCA 4S1VA 1IY1A 4UTOA 3UJHA 1XTKA 1WZ2A 4C08A 2V3WA 4IEEA 5LXTB 5ILQA 1LBEA 2QVXX 2IY9A 4PU0A 2YDXA 5GOTA 3A6ZA 2FSPA 3EVAA 1M34B 3UGJA 2Q50A 3DFIA 1C3OB 4D9MA 2WMDA 3PVSA 1SOMA 1L7AA 4DEVA 1QS0A 1PNVA 2QZ9A 5JVDF 3A3KA 4AKSA 5CVEA 2O7VA 6CHYA 2YUTA 4IV8A 4S12A 2FSVC 2KJQA 3G8YA 3NBAA 4ZQEA 5CIQA 4A73A 2H7XA 1KK0A 4ESHA 3ROEA 4IXMA 2GKGA 1QFMA 3QNWA 3VNBA 4GXQA 4ZVLA 3TFQA 3MS7A 3ETDA 5C3MA 1L8QA 4U63A 1P1IA 5AI4A 3JQCA 1NVAA 4V0QA 3LX8A 3PB3A 1TFUA 1Q2XA 3BDAA 1DAOA 4MWDA 2YS7A 3WB0A 1NBEA 3QLJA 4OQMA 1G5FA 3E7XA 3NC0C 4DA8A 4K86A 1WCIA 1TRHA 1XAHA 1ADGA 2YASA 4FW9A 4HAOA 4JSYA 4FB5A 2FQYA 2ZT5A 3TD6A 1NBOA 4DJDC 2ZB4A 2CJXA 1Q1QA 2FPGB 5KCMA 1EEHA 1TECE 2LGJA 2QSYA 1KI8A 3BRSA 4L8VA 2ZZKA 3GXOA 4MPJA 3UTCA 4E4TA 2YV1A 3D4LA 5BSMA 3KLMX 1BCSA 1BHJA 1D6SA 1OYOA 1OX5A 3I4CA 3PR2B 4B2PA 4IIJB 2PGDA 2VG8A 3C0KA 3O83A 3QFRA 4JJKA 5IM5A 4BRUA 4QBHA 4IBOA 4BVEA 2ZYHA 4MV0A 3UAGA 3UGKA 2PL3A 2QORA 4H27A 3RGGA 1U1CA 2NYAA 1Z2EA 1QOQB 4BMPB 3USZA 3TNFA 1LC0A 1VLVA 3UJCA 3EIHA 3TOZA 1QONA 1WMAA 1XRNA 2A7QA 2JHAA 2VHXA 1KOJA 4LNUA 3LSTA 4PLYA 4MW6A 3GL9A 1XBTA 2D4HA 1SOVA 3EMBA 2F8MA 2Z0MA 3I5MA 2XUFA 3KUUA 5F7XA 2QZZA 3W9SA 1SBHA 3DS8A 3FXAA 3T15A 4RZ2A 5ERXA 5J5AA 4UTRA 1ZM2A 1C9JA 4HAYA 4O0LA 3RFCA 5GZ1A 2EERA 3W5UA 5FTLA 3MGKA 4J4BA 4FYVA 4G5GA 4TSRA 1SUSA 1WPXA 2WG2A 3UKJA 3VOAA 5LIPA 1F4PA 3L43A 1E1CA 3FOFC 3L8EA 4IHJA 2EX1A 1QGUA 3RI3A 3B53X 2CDBA 5KREA 1WG8A 4KPGA 2HRBA 2ATXA 2VH5R 3AIMA 3DO8A 1WWKA 4P4TA 4PZDA 4DOMA 3FTFA 2UXDB 2WZBA 1A9OA 4L16A 4ZTUB 1HDGO 5AMXA 5H80A 1MORA 1Z6PA 3KHKA 5GPBA 4X6LA 3IOYA 1JFRA 5BSKA 4F1KA 1N2JA 2WFLA 4GOOD 3BGWA 5EUMA 3IT2A 5HS6A 1VI5A 4B7UA 3F74A 5AKHA 5B7NA 5A2QA 5I7HA 1SH7A 1NATA 1U90A 3EWNA 3OLVA 1J0DA 5J4YA 4RFSA 4NCHA 2JJMA 1KVRA 3H3XA 1GA1A 2EBWA 1J7JA 4FEGA 3JQ8B 1JJ7A 1ZIXA 2A0UA 1KZ1A 3OTIA 2HMYB 4JLOA 4OQNA 5KNBA 1VE6A 3KS9A 4FYWA 2ZRIA 2BKEA 1C1DB 1P72A 3P9NA 5ALPA 2H4FA 3UHOA 4CQLB 4Q9DA 4D57A 1ESMA 3B2QA 1P1RA 4GC9A 2PZEA 1NN5A 3PU6A 2REQB 1KPIA 3OWXA 3Q11A 3I4LA 3ZDRA 4MVJI 4NV1A 4YJ3A 3X0DA 5ITSA 4TS4A 2OTCA 3DO6A 2GK7A 2I4NA 5BOVA 2HSWA 4D96A 1OXKB 2YV3A 4Y6OA 2NV2B 4RIEA 3PKIA 5DTQA 3WWCA 2AKAB 1L5HA 4LGYA 1V71A 1XZQA 3OO0A 4IIVA 5M7EA 1A8SA 5A1JA 2FW9A 2YJNA 4ABYA 3WKCA 3ZE2B 1L8LA 4QQRA 1GGNA 1U2SA 4P35A 4KQ2A 5KTOA 2JJ8A 3RROA 1GFWA 3K73O 4TWRA 3GDOA 4D3YA 1UC9A 1OI2A 4BTEA 3PUYA 4GI3A 1BOFA 3ACBA 2JA2A 5FPQA 3DFFA 4WESB 1FU7A 2PUVA 2PTGA 3EE6A 1EXVA 1IB0A 3VKFA 1ZU5A 1A9PA 1HORA 4PYQA 4BZPA 3PG5A 3SR3A 2VYCA 3W2IA 4OF4A 3C70A 4BVKA 1WRBA 1NP3A 4TGLA 3RC7A 3WK9A 5K0JA 1EX9A 1OFGA 2BHTA 1DP4A 2CLFB 4XDGA 4MQ6A 3VGPA 2IYRA 1U8UA 1NXPA 2Y0PA 3CE6A 4MLDA 1KIMA 2XQJA 3W6OA 3DB1A 4OYLA 5JI2E 3PXEA 5I7RA 2QRVA 3P0HA 2EJCA 1NM5A 2QY9A 2WWHA 4KDRA 2M6KA 3UT5A 4G25A 3ZNNA 4J1QA 1M7BA 4WX2B 2Q1TA 3B5JA 4JUAA 3U7IA 4ZAXA 1AF7A 3Q9NA 1I32A 4YRAA 3WDMA 1ST2A 1JR6A 1EQAA 2PZFA 3GG9A 5EIBD 1PJTA 2PWYA 4KTTE 4A8HA 1EFVB 1KI3A 4Y9SA 2X9GA 1PWZA 2BC9A 3DXZA 1R8QA 1ZO8A 1XEAA 3G02A 3H4VA 3HJNA 1Z6QA 5CNKA 2Y9PB 2P2CA 1Z0AA 3ZWCA 1SHKA 1NDQA 2C1EA 4YLGA 5DNVA 3MAGA 3ZQ6A 3LT0A 5EE1A 5EI5A 5JO9A 2GSDA 5DEOA 1KSHA 3ER9A 1FTWA 4WA7A 4M2LA 1P81A 2AOUA 3P9CA 3SC4A 3OLXA 5JMWA 2X77A 4QXOA 1SUDA 1LLCA 2WTEA 2ZE8A 3DTVB 1FPQA 4NENB 4H6WA 3RBXA 3PD0A 1N5OX 1Y8RB 1VI6A 2EGGA 1RAHA 2DECA 2JIQA 2Z56A 1O57A 4IFIA 1W5EA 3I05A 4J0JA 2EWWA 1VYUA 4M7PA 2YVQA 3T4UA 5DK6A 1HNNA 5E38A 2FOIA 1EVLA 3VBEA 5AH0A 2FJUA 1GKYA 1A4RA 2DCMA 3LA8A 1CQZA 4UM7A 4GG1A 4MQLA 1HOXA 1OKKD 1ZK0A 2K6GA 1AKEA 1CUDA 2WVAA 4MPRA 1G5RA 1CU1A 2Y0CA 2JZCA 4O2BA 1XAIA 4RKQA 4IV5A 3DTVD 3PVCA 3OQBA 4RHTA 4RKYA 3CZ9A 2C54A 2MINB 4DLNA 3WGUA 4HK4A 4XPIA 1EIZA 4CKWA 4LWPA 4ODIA 4KXYA 1OV4A 5SV2A 4LY0A 3H8JA 1SJ9A 2B8JA 4Y98A 4Z7OB 2RCYA 7REQA 4YIHA 5KBYA 1WCXA 5AKIA 1K6JA 1XEWX 4MS3A 1O58A 1XTBA 1YVRA 2BFBB 4IS3A 4KO2S 1CB7A 4INJA 2ZDHA 2AEMA 4M21A 1GR1A 1DUVG 1IUNA 2P6MA 1GXSB 3AB8A 1YI0A 3AERB 3H99A 5LP6B 2BFDB 3R3ZA 4PHTA 4TTSA 5COQA 5DGCA 5JBIA 2YZ2A 4Z1OA 5JLAA 5A71A 4DR5B 3VR4A 2PGJA 5IP5A 3UA4A 4BQSA 3BK2A 2Z8XA 3RHZA 3U13A 2YJTD 4W1PA 1I7DA 4OLFA 2EATA 3LZ6A 3AV0B 3VC3A 3IKJA 4G26A 8ATCA 1U3UA 3RVLA 3DFMA 3VAAA 2HV9A 1Q95A 4IIBA 4BQPA 3CE9A 4JJFA 3OCVA 4R1UA 2CYCA 2ANBA 2WLSA 1NVFA 2XB4A 4M1ZA 4A4DA 1E2MA 2ZT8A 4JASB 1T5TA 4X7PA 3F4BA 2PT9A 2ZBPA 2D00A 4PVDA 4XI9A 4BOYA 4WL0A 2DJIA 1M0WA 4JGIA 4DDTA 3ZU6A 3CX8A 5MF6A 3C45A 2C4UA 3KPUA 3HCNA 3IHKA 1FSFA 3WLSA 1M2JA 2C57A 4ESEA 2H2DA 4OXNA 4DA6A 1P0QA 1GDDA 4D5GA 1PR9A 4WXPA 3HKCA 4Q4JB 2QTNA 5B2FA 1I1HA 3B6JA 4PPYA 1GPAA 3BXXA 1QLWA 3CWQA 3HADA 3DCNA 3NEAA 5IAJA 2WD7B 3HMKA 1N5MA 3KYJB 1XZJA 4HX9A 3AGQA 4UVIA 1L5KA 3ZHTA 4EI7A 5IXYA 1NVGA 1O8BA 4M46A 1IAVA 1E3LA 1ID8A 1O6CA 3DEZA 1P4AA 5F51A 3ADKA 5J9FA 3EQ9A 4Q4JA 5GMOA 1YZQA 1Z0KA 3EXHA 4EVQA 2YWBA 3DMFA 1UXIA 2YOFA 1QPGA 2RH9B 3GFSA 1Y4ZA 4ZPXA 2GOYA 4MRPA 1JW9B 1YB4A 5AVOA 5A4DA 3PUIA 4M9QA 4UCFA 4QJ5A 2VHZA 1MG0A 3AINA 3TEFA 1M75A 4A0GA 4HFMA 3GJZA 3WRYA 2IE8A 3KBBA 8LDHA 3MG9A 2NU7A 2QJFA 3L8DA 1IJEA 2DT8A 1P0PA 2WPDA 5BPFA 5LQJA 1TU0A 3KTAA 3QEAZ 3H17A 4GWGA 1WV1A 1V3TA 2WM3A 4YYEA 3LBHA 3EEQA 1GDHA 2Z9CA 3NGMA 3WY9A 1NIPA 1X7ZB 2HXGA 2Q2OA 3PYXA 3GV0A 3KR9A 2EQ5A 5FADA 1AA6A 5JD6A 1U04A 2GO7A 3OEYA 4NOKA 3ANMA 5HKOA 3NM5A 4HXGA 4ZI7A 1PZGA 4JLPA 2WYWA 3SR0A 5JUWA 3OQHA 2IUSA 3JQEA 4AJ4A 5KINB 3NVAA 5K3OA 2EEZA 3HUDA 4FP9A 4OQ4A 5TXGA 5IJAA 5H1YA 5LJIA 5LU8A 3DBRB 2AH5A 5LQSA 5I6DA 2PEZA 4PX2A 1KMMA 2I33A 3PXUA 4CM8B 1R27A 3VZSA 4RABA 4EH1A 1S2GA 3Q3CA 3SNKA 5EZYF 1X39A 2WHXA 1GGFA 1RRPA 2AOXA 3AIIA 3GDWA 4HX5A 1NXSA 1YBFA 3K92A 3V1MA 3OVMA 4P36A 3SXJA 2JAWA 3KSMA 2V98A 4QDZA 4QUAA 4PEVA 2OPHA 1SBTA 2FR0A 3TZLA 1TAHA 1I2ZA 3HGQA 4BNLA 4CTKA 5EUBA 1XD8A 1J1IA 1TT5B 1KOFA 2EBFX 3EIWA 2RBEA 2JD1A 3HXPA 5E8JA 1JAXA 1NBIA 3MCVA 2UYYA 1MOPA 3M6VA 3QPDA 4Q9AA 5K6TA 4O3MA 2Z5FA 1E92A 4ZICA 1Z7YA 1XL1A 1DXOA 3N7UA 2P1ZA 1RDFA 2VPXA 3LLVA 1T4CB 4NNPA 2XV1A 1XFDA 3PDJA 3TECE 1Z9BA 3IMEA 3DLTA 3INTA 2DY0A 2F48A 1KH3A 4KXFB 1CD5A 2KLBA 4ZO4A 1DQPA 5E1MA 3Q72A 3GYBA 3VU9A 2W4IA 1LBSA 4KAXA 1R8XA 1VDMA 3DVAA 1NFRA 2WIGA 1E9SA 4HG2A 4IZIA 4JEUA 4LPSA 4M55A 4QOEA 4TLDA 1RRKA 4I5IA 4RK6A 1ISPA 2W2LA 2IYUA 4ID3A 4Q3EA 1OFHA 5EL0A 2BZ0A 4U1RA 1PQWA 3UM9A 4F2DA 3KYDA 4Z7JA 2Y2VA 1ND5A 1EXDA 2JFVA 5J2TA 2PPLA 2ECKA 4QQNA 1JTEA 3U31A 1A76A 3RVBA 3H9EO 3Q2IA 3W5SA 1MDFA 4M1EA 4WK2B 3MGAA 4KIFA 1XZKA 5DRTA 1WD7A 3CLHA 3FAZA 2Z5VA 3VDNB 3RCBA 2GD1O 3DE1X 3EFHA 3WL5A 3WSVA 5FBQB 1TO1E 3LOUA 3CTMA 2GHRA 3BILA 3NHKA 1S0UA 5B30A 2WA2A 1ZD3A 1ACJA 2ON6A 4ZEOA 3FM9A 5MN4A 3R5TA 4CF6A 2JIBA 3KKQA 1G19A 2C1XA 2G88A 5C7LO 3A2KA 1J7KA 2PFSA 2E87A 4LN1A 5IARA 1VQ1A 3FTEA 1CUBA 1OX4A 1ORTA 2VQ3A 5E8RA 3SHVA 4R2HA 5KNCD 1ADCA 2I55A 3NS7A 3UW3A 4EF5A 1U3FA 4ZJUA 2PJRA 4U9UA 2ZIXB 5D85A 1V8OA 4YP1A 1VBNA 5LFAA 2MTBA 3QLVC 1WXDA 4B85A 5JCOC 5KOHB 1QYRA 3DOFA 5LYYA 3RTDA 1QB8A 1JFTA 1N7HA 5IAOA 3L7IA 5FT9A 5TQVA 2J32A 3ILYA 4JC4A 2PKXA 2Z1MA 1RC1A 1RLIA 2G5PA 4FMCB 1MNAA 4MLZA 4MIOA 4BFCA 4DIKA 2YV2A 4MS4B 4Q00A 5FJJA 5HKKA 4GPAA 1WOMA 2HU5A 4NPHA 3ONFA 4E5VA 2R751 5FAXA 4RFVA 3D81A 1RBQA 2QROA 1GG5A 2FPGA 4RPJA 4CDNA 1ZM3A 3FMFA 4FGSA 1PFQA 4Z54A 3GXBA 4I4IA 2GLXA 2H5LA 5LQCA 4D6YA 4MCIA 4ONEA 2V6FA 1ULHA 3LYHA 3UG7A 1JMKC 2JD2A 3FCSB 2XXAA 3A4YA 1XUOA 3A1NA 1UBSB 3HL0A 3IP8A 3WMWA 4RD4A 4FEAA 1QE5A 2PH1A 1FDWA 1G18A 3EEYA 4U2DA 4ZQBA 1P3JA 2L2QA 3PXBA 1FTNA 4JP8A 2H16A 4K2HA 1GQQA 1JVNA 3UAYA 1DTWB 1WZCA 2CMFA 1DQRA 2H2WA 5E9AA 1M2WA 4Z51A 4CL2A 2H6EA 3STTA 2H5EA 1J25A 2YINC 1O3YA 3TTYA 3MT8A 1ODKA 1WF3A 1QH0A 2VJYA 3ZD7A 1U2TA 2EKBA 1QFJA 1SG9A 4F2HA 1EP1B 2OO5C 1QV7A 4NH4A 4NV3A 1EVIA 2O2JA 1VB3A 1LF0A 3BZBA 3QVTA 1JJVA 2A9VA 2QM8A 5HPYB 4NFSA 5WRFA 3GDGA 1PT8A 5J4KA 1O0SA 3NATA 3D8TA 5G3YA 4ENPA 4GZLA 1BW9B 4QO7A 1TGYA 3ZXXA 2C2HA 1ZJWA 4PE5B 4PZAA 3T9EA 5K8CA 5KSZA 2EQBA 3J7AC 3UJ3X 1LDNA 4PAOA 1HLFA 1E2JA 1JKFA 2VSYA 3U3ZA 5J47A 3OHSX 3EPKA 1L5MA 4J1TC 2OMEA 3IS3A 4YMHA 5EXTA 1U6JA 4KMRA 4LK3A 3CG4A 4I50A 1DAIA 4JFRA 3VKWA 1JHQA 1HT3A 1LPNA 1TJ3A 2J3QA 3ZDDA 2BFAA 2A7XA 3FSGA 4GYJA 1XB2A 1K75A 1HTBA 4D9JA 4E4YA 1UFKA 1ZNQO 5KYUB 5EZYB 5JXHA 1KH1A 3VSCA 2I3AA 1EAYA 1XROA 1PBNA 2C8JA 2X15A 3E22B 3GZNB 1QHYA 3HCCA 2ZVPX 1E6MA 3KC2A 5EIEA 2NUPB 1NYQA 3CLVA 1I13A 3HYTA 3A3NA 2IW3A 2WB4A 1HG1A 3EXFA 4DY6A 5BV8A 2FLVA 1N8TA 1XTSA 3F6EX 1M8FA 2PU5A 2VK4A 3SLRA 4UC0A 2VCHA 4HWPA 4J0QA 3LTEA 3INRA 1A7JA 3CUVA 1UWVA 4GOMD 5CLGA 5ADVA 5L53A 4EZEA 3F5FA 3H4MA 3RBVA 2R6ZA 1EE1A 1GRRA 2ZJ1A 4D79A 2AC4A 3KPJA 4U9HS 1R4MA 4XVCA 2Y0DA 2Q5OA 3ETEA 3QE9Y 5FUBA 3LCMA 3H9QA 1E1YA 1YD7A 4V0OA 2X6RA 4RLSA 4O33A 2AB0A 1J9GA 2OBXA 3GJTA 1U2ZA 2YFQA 2ZJOA 4NHEA 4OHMA 4EDFA 2WU3A 1GZ6A 3R23A 4N5HX 2IBSA 1A5TA 4OIFA 1MLDA 4ZCSA 2QXUA 3NAZA 4H7FA 4RZQA 4UU1A 2IBMA 1E0DA 1V37A 2BE7A 5IVPA 3FWPA 3HNRA 1XAGA 2ZS8A 3U62A 4MIEA 4GP6A 2OESA 4E5UA 1V2GA 1G8JA 1QDUA 5NLLA 1LW7A 4IIYA 3OEEA 4QECA 1MBZA 4CG3A 5GONB 4WOCA 3EF0A 3DXXA 4LTNA 3F8WA 1N1EA 3O0TA 4C20A 4EI2A 3TMAA 5LXTA 2HA2A 2SCUA 2N0SA 3CW9A 5EYPB 1KOLA 2O6HA 3IUMA 4F7DA 1SXHA 4GC5A 2FW6A 4Q6WA 1DFIA 5FB3A 5CBKA 1LK5A 2HLDA 3NOOA 1H6AA 1B74A 5FOSA 5JALA 3PP8A 4L1KA 3UAVA 4PG4A 5KYNA 3VX3A 3CPEA 5HE9A 3RGWS 2UUAB 1VGRA 2XE4A 3FUUA 1KFEB 3D0OA 3SLGA 4LZJA 1CHNA 3SFTA 4IQFA 1E4OA 4GYWA 3ZWAA 3H0EA 3AI1A 4V3CA 1YGYA 1LFDB 3W4KA 4L75A 3FPJA 4RLHA 2XOKA 3HBAA 4TMYA 5A0VA 2AF3C 4PPGA 4H35A 4JVNA 4FDAA 2HFJA 4KMSA 3M4XA 9ATCA 4L07A 1X86B 4D26A 3R7AA 3S44A 4A91A 4Q24A 2BR4A 3GFGA 5C18A 1C0IA 1K3FA 2VNIA 1MU0A 3GVXA 4A10A 2ZM6B 1S1CA 1GEEA 3C7AA 1WL8A 2NSHA 1RR6A 1ZA1A 4RPHA 5CYPA 2WFMA 2XE6A 3VNSA 1XLVA 1D9XA 4BJ5A 3PFWO 2FRDC 2DFKB 3M2PA 4NVRA 4P4UA 3R3HA 1NF2A 1T6ZA 3DZ8A 1RHUA 3EGDA 3ZS9A 4YAFA 2HZBA 4IS2A 1QP8A 4OHZA 3PICA 4I5GA 4NDNE 3EXG2 4MQFB 5FUMA 4DFDA 2PZJA 3VZBA 3KT8A 1I9CA 2FUNB 1X87A 1LQUA 3HRIA 3KXPA 3PFBA 4C89A 4MK4A 4EARA 3ERCA 1H2EA 1OE0A 1VP9A 2OCKA 3O1HB 4LDQA 1EFAA 3WK7A 3GLFE 4DUGA 3V00A 4XR9A 1M74A 3WL3A 3GFTA 1IBRA 2X41A 4FE7A 4AZVA 4YPVA 1HNXB 2Q28A 2QDKA 4I4CA 5IYZF 3VTFA 3UXYA 4UBOA 5HNKA 3ANTA 4J7AA 3K1AB 4U39A 4CG0A 1Z6YA 5C4IA 4JBNA 3STUA 4IDOA 2CUTA 2A30A 3G9ZA 3K0SA 4LWOA 3OBIA 3QHPA 1PEYA 1D8AA 1D8TA 1ZNZA 1XJWA 3CLSC 3FFXA 5KOJB 1YB2A 3KL4A 4BS9A 4CODB 2HNKA 4ZOAA 3PXGA 3E0XA 1RM3A 3NBQA 2RKBA 4MP3A 4PSVA 5DTEA 2O50A 2VUIB 3R40A 4G81A 4JR1A 4BQFA 2HCTA 3E84A 3BWBA 1QHSA 1UPFA 3QXGA 1R0ZA 4LXUA 3QFCA 5CVVA 4ER5A 1YSCA 3M4JA 4JAVC 1JQJC 2NAFA 5B4VA 3LI2A 2Q2WA 3F5QA 3KFVA 4HGOA 4MVJH 1UQTA 4MWEA 1T4MA 3I64A 4F3RA 3U7GA 2P1DA 5KOYA 4HQRA 3DQPA 4IZOA 3NWJA 5TMPA 4TM8A 3N0XA 2CD9A 1JZTA 2GRAA 3HB1A 4YO8A 5HA5A 3U09A 1AJEA 1EWKA 3ZLVA 4X1OA 3L05A 4TS1A 5E6SA 1CUVA 3PRKE 1VFNA 4PNZA 1ZC3A 1UP7A 2OK7A 3BSFA 4FGKA 1GPJA 4KR7A 1FB5A 1ZMOA 1NXXA 4DSOA 3NCTA 2NTJA 1QIIA 4OM8A 3W2FA 3M5WA 3OX4A 4ZVQA 2NTEA 3PWKA 3WGKA 1IMJA 5A3QA 4YRCA 3L5KA 3DOJA 2H1IA 2I22A 2GFQA 3R09A 4QGHA 1KI2A 2R84A 4I99A 4JLJA 3FCAA 3X1DA 5DT9A 4YRMA 1I1NA 1WSBA 4KC0A 1KQFA 3SP1A 4WZAA 2FQ1A 4DV6B 2YIMA 3FHTA 3RYHA 4EW6A 3IJEB 1I3OA 1Z4OA 5T67A 2PUFA 2IHZA 1AX9A 2XRFA 1FMTA 1CHDA 2FWJA 2BFPA 3FUXA 4LZLA 4EYGA 2QTTA 5DSXA 2QTVA 2R2GA 5T7BA 1CVIA 4TROA 3QF4B 4GX2A 2Y93A 5L4SA 1UEIA 1GLGA 3PEYA 4YNBA 2PKCA 2JVKA 4F7WA 3ZTTA 1NW6A 2OSBA 3L0IB 1DEOA 1MXHA 1NXWA 3EMKA 3HU5A 3K9CA 1MR3F 1RQGA 5CG1A 2DC1A 3KJQA 2HA5A 3BCSA 2P0YA 3X2FA 3GX1A 2AI3A 4NC9A 5ALGA 2VJLA 4UTNA 3I42A 2WD8A 3WISA 3QWAA 4AG6A 4Y9UA 1D2NA 4RF4A 2MOKA 2XUPA 3MMZA 4S1NA 4TKUB 4NCJA 3HA3A 2XZLA 2Y99A 1SVSA 4IKEA 4L5JA 4KYTA 4CT4B 4JJIA 3BB4A 3BSSA 1HEYA 4DGQA 3F9IA 3K2BA 3KR1A 3NEPX 1QGZA 4LDRA 4LHEA 4LQCA 4NTZA 4HH1A 4W1SA 3EJWA 5JJ5A 2X8JB 4G24A 2HREA 2PVCA 3QW4B 1OW3B 3NTLA 1DTSA 4FR5A 1D2GA 1K63A 3HJGA 3ROMA 3DLAA 3K2IA 4XLZA 3A58B 2F9LA 2K2WA 3DULA 5J2UB 1ZJYA 3V97A 3G68A 4Z7NB 4CIWA 3O2SB 2IS6A 2ORVA 4D4IA 3OD5A 2IEBA 4OHXA 4JI6B 4MMZB 2E6UX 4TMWA 3NNNA 1I2CA 1XF9A 1JDNA 2PUDA 3KZ1E 1U3CA 3ZGYA 2QS9A 1AGPA 3H05A 1J8VA 1M72A 2NM0A 1YHYA 3QKSA 2IU3A 3R7WB 4L3WA 3ZC3A 4RSMA 1H6BA 4B87A 3DNFA 2P8JA 4WN3A 4BECA 4F04A 3VH4A 2B2XA 3KT3A 1W44A 1SB8A 3K1YA 3OFND 4HAUA 2HA3A 2Q1WA 3KOYA 2B83A 2FNAA 2FX3A 5JV5A 4HNAB 2MSLA 3GAZA 3F3YA 3PBKA 4C9BA 3PQCA 2CSUA 1KK1A 5DGIA 5C31A 1U3WA 4L22A 4PR3A 1YR9A 4HXFB 3VPHA 1GTG1 4JI1B