4Y28J

The structure of plant photosystem i super-complex at 2.8 angstrom resolution.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
41
structure length
41
Chain Sequence
RDLKTYLSVAPVASTLWFAALAGLLIEINRLFPDALTFPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
publication title The structure of plant photosystem I super-complex at 2.8 angstrom resolution.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 12
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 2015-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01701 PSI_PsaJ Photosystem I reaction centre subunit IX / PsaJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4y28J00
2QIWA 2WSEJ 2FYNC 4IL6X 1Q90D 2QJPC 2WSFJ 1VF5B 4H13B 5KKZC 2ZT9B 1ZRTE 4RKUJ 2E74B 3LW5J 4Y28J 4I7ZB 5L8RJ 1JB0J 2E75B 2E76B 4KT0J 1S5LX 2WPVB 4H0LB 2QJKC 2QJYC 3C8VA 4PV1B 4OGQB 2K9YA 2D2CB 2QSIA 2O01J 4H44B 2YIUC 5KLIC 2WSCJ
chains in the Genus database with same CATH superfamily
3CCEP 1U7JA 1ZLLA 4M3LA 3SSUA 3AEAC 3HE5B 2A06G 3AE9C 1PP9G 1GW4A 1VQ7P 2QJKC 5TISE 3GHGC 2YMKA 1YYCA 3CC2P 5CCHA 2MJZA 1YIJP 3JCUE 1NTZE 2BCCE 2B89A 1JO5A 2V7QH 2GM4A 1CI6A 1EDKA 3II6A 1XTCC 2H88C 2QM8A 3KYQA 1BE3E 1OWAA 4H0LD 3V6IA 3S9OA 4PJ0H 1T2KD 1W5CE 1MFZA 2E74B 1KYOE 2J59M 2FYZA 1ZRTD 1IFPA 3MUDC 3BRTB 1S9KE 3HRNA 1J1DB 3RL0g 3NFQA 2CK3H 2O1KA 4JF7A 1M1JA 1QVFO 2OYIA 2ZT9B 2KK7A 1LWUC 2R32A 1ZMEC 4N6JA 1NTZG 3HTKA 2BCCG 3HUSB 4U3FD 1JMMA 4OGQB 5AW9B 1KILE 2B87B 4XE5B 3H1JE 5APTA 3W67A 1L0NE 3AE5C 1N73C 2B88A 1URQA 1BE3G 1T6AA 5KJ7A 1P84E 2Z5IA 5CMZA 4U3FJ 2NZ2A 3UIAA 3VP9A 4AUWA 1NJIQ 2ZYDA 1BCCE 3QH9A 1BSNA 2KUBA 4PV1D 3H1LE 4ZMDA 1IK9A 3CCMP 2BEQD 4KJMA 3O6QA 3L36A 4L75A 3VMAA 3VYIA 1SQPK 2WSSH 4RESB 1FDOA 2YIUC 1YJNP 3CXHH 1DD3A 5KKZB 4AYCA 3RK2C 1FBMA 1PZQA 1KN7A 1HJBA 1SFCB 1NGMB 3C9IA 2A06D 2HODA 3H1JG 3V2NA 1L0NG 3AEBC 2WITA 1AVYA 2WPRA 3G71P 4IFMA 4MN4C 2M3BA 2NPSD 1Y8AA 1LP1B 1BCCG 3CWBD 4JQ0D 4RO0A 2Q1KA 4CPGA 2QJKB 3GHGB 4D6TE 1YTZT 3H1LG 1NH4A 2OYHC 2E75C 1YQ4C 2KLVA 3CWBJ 1KTMA 5B5EE 2KOGA 3TNUB 2H8PD 1VQ5P 1FZBA 2I1KA 1VQ4P 1IO4A 1LNQA 5CJ4A 4BRYA 4DCKA 3V2RA 4H13D 1CSBA 5CCHD 2M8RA 3VP8A 2KZJA 2E76D 3SWYA 1KB9I 4EI2A 1ZXGA 2QA4P 2L5GB 1NTZD 1QGKB 1HGVA 2KSJA 3TDKA 1HBWA 1FU1A 3NMDA 3CX5D 4D6TG 1BSHA 1JM0A 2O01N 4ZKPA 1GDTA 1NTZJ 1LWUB 3MZWB 3KDPB 1LT1A 1JY3O 5GTHH 3WMM0 1LGHB 1GZLA 4GIFA 3IFMA 5KAIE 1KYOD 1VF5D 2W90A 2N1TB 3A0BE 3E7KA 1N73B 1VQNP 1HGZA 2WSCJ 3H6PA 2P1JA 5BVZA 1S9KD 3AE6C 1JTHA 3L71E 1PGQA 2W27A 3HE4A 1R5SA 1JUNA 3L73E 2M0BA 1LTIC 2XNDH 2YO2A 3KXDA 1SQXK 2KI7B 3S4RA 2ZJSE 3MD0A 1FDMA 1VQKP 3H25A 1URQD 1RF1C 3H1JD 4HJGH 1HTLC 2D2CD 3H1KE 1L0ND 2FYUD 2YIUB 1P84D 3RK2B 4WB4A 4GDOA 1BCCD 3H1JJ 1UIXA 4EOTA 1PGOA 1L0NJ 4IFFA 3IN6A 2FYUJ 1YHQP 3GF7A 3H1LD 1HVVA 3L71G 4LGDE 1BCCJ 5CCGA 4OH8B 4C7NA 3U1CA 2WSEH 4IOIH 3L73G 4W7YA 1NO4A 1PGPA 3G9RA 3H1LJ 1HUCA 4K3AA 2PGDA 4ASVA 2HYNA 3SFEC 1W2EA 2WWWA 1JMBA 2OYHB 2E75B 4Y99C 5AVSB 1CW5A 2IDBA 4PD4I 1SQQE 3USSA 3V4WA 2V4HA 1NKNA 3AE7C 5APXA 5H2FE 1KC8Q 2LXBA 1HWTC 2RH0A 4LLHA 2GUSA 4D6TD 1OZHA 2A45I 2Q3IA 5GTIH 1K8AQ 2E5YA 3E1IA 1ZR2A 1XTGB 4WY4D 4D6TJ 1VQLP 4IFDK 1LTTC 5DJUB 2K88A 1OIPA 3A5TA 2C0WA 3FX0A 1J1DC 1SQQG 1KMIZ 3FXDA 4W80A 3EWKA 1YQ3C 3CC4P 2FXOA 2NRGA 1AJYA 1ZR4A 2K9YA 1IJDB 5KAFH 2N9YB 3Q5SA 2YXQB 2H89C 1NTZK 1KORA 2QE7H 1JY3N 1FJPA 1PV3A 3LW5J 4DJGA 1S4XA 3A0HE 2JWAA 3B8EB 1IK7A 1KQSO 1Y9BA 2QSIA 1JNMA 1VQMP 2PRRA 3Q5RA 1FJKA 2P7JA 1PP9E 5AW3B 3KZIE 1X0TA 2R3CA 3B4SA 1SQBJ 3L71D 2AEFA 4KT0J 5K5GB 2YMYA 2OTKE 3AE4C 1NU1E 3CD6P 1OFCX 2E74D 4NPFX 1RE3C 1FZCC 4TLFA 2Y0CA 2RN0A 2XKMA 3L71J 4UB6E 3EQ2A 3L4FA 3B5NC 1SQVK 2FFDC 4H44D 3WU2E 1X79B 3M0DC 3T97B 3H1KD 2WVRA 2ZAEB 3IF4A 1LTJC 1GTWA 1AFOA 3ITKA 3GMAA 1KV4A 1EDJA 2WPQA 3GG2A 1L0NK 2OARA 1T2KC 2K37A 3D6ZA 1L0LD 4OGQD 3H1KJ 2FYUK 4JYBA 4Y99B 3AE8C 4QMAA 4HKZH 2WTYA 5CCGD 1JOCA 1NTKE 1FZAA 1H88A 5AW8B 5C39A 1MKMA 3A3YB 4EYYQ 1L0LJ 3MTUE 1NU1G 2ZFCA 3TGUE 1GL2C 3CMEP 3P8MC 2WPSA 3P8CE 4DOJA 3GW6A 4L76A 2OTLP 1LT9A 2AXTE 1H0TB 1SQQD 1L4AA 3Q2YA 5KLVE 3AECC 1QEXA 1KZUB 1RF0C 2XZRA 1ZOYC 1D7MA 3R4YA 3MP7B 1NHLA 1N7SC 2YKOA 1SQQJ 3BCCD 1RE4A 4I2LC 1AQ5A 1NTKG 1GMJA 3D6YA 2HPCA 4GT1A 5CHXA 3L72E 5CJ0A 4XFJA 1BGYE 4GOFA 3BCCJ 1J2JB 3L37A 3TGUG 1N86A 1X9VA 2JJLA 2ZYGA 3BVHA 1GK6A 4OWFA 3G4SP 2N1TC 2JP3A 1PPJE 2HR3A 3BATA 1KILA 2M5AA 1UIIA 1G2CB 1FS0E 5B66H 5KLVG 2FKWB 1JY3P 2NPSC 3D71A 1SS1A 4XA4A 1Q90D 2KSEA 3H32B 2ITAA 4JPZB 1WMKA 4C46A 1EQ7A 2QVAA 4PD4E 1DEEG 1NAFA 3L72G 4I6MC 3Q5PA 3E1RA 1FZCB 4JYCA 1RHZB 2I8DA 1BGYG 1S5LH 1M57D 3B5NB 2FFDB 3H1IG 1KFMA 3JC22 1LTJB 2Q9IA 1SQBK 4RKUJ 3RBZA 1E79H 5TISH 1PP9D 4H13C 2KNCB 2YXRB 1K73Q 5CCHC 1PPJG 3HD7A 2E76C 2WT7B 1NU1D 2XNXA 1PP9J 2ZVNB 1J1EC 1JEKA 1N2DC 3RL0D 3CX5H 1NTMG 1FZFA 1RF1A 1Q81Q 3GF3A 2PAJA 1BDDA 1Q7YQ 1NU1J 2WSCH 1OVVA 2ZXXA 1KQFB 2KS1B 1GK4A 2IYOA 3MIWA 1GL2B 1KB9D 2LR2A 1KYOH 3G6EP 2JDIH 3L35A 5TJHA 5EFWB 4O9BA 1VF5C 3CLQA 5APYA 4WY4A 1YITP 1LTAC 1NOHA 3D70A 1BDCA 1L0LK 1S3JA 1M1JC 3M91A 1HJ0A 2A45G 2OYIC 2SPZA 3RK3E 2Z5HA 1ZN5A 4U7JA 4ZNCA 1OX3A 2BCCD 1N7SB 3TGUD 4DT0A 1YBKA 3P8CD 1URQC 1YJWP 1L4AD 5KJ7C 3HE5A 3MGNA 2YO3A 1P84H 2BCCJ 2QEXP 1BE3D 2I1JA 3TGUJ 5KLVD 3CXHI 2AEJA 4WVZA 1QX8A 3CC7P 2DW3A 1SQQK 2R5DA 1SQPE 3V2QA 1BE3J 5KLIC 3VOPA 2YKQA 2Y0EA 1YI2P 1ZP0C 3U1AA 1FOSE 1ZV8A 2MKVA 3FWNA 1Z56A 1YTZI 2NPSB 2W6JH 3L72D 2P2UA 3PP5A 1OW7A 2C9LY 1IZNB 1BGYD 2K9JB 1G1IA 2CPBA 3VMZA 3SWKA 1VQ8P 3AE2C 3AEEC 2IBZI 1EZVI 1KILD 2FBWC 5APSA 3L72J 3F5HA 2LXCB 2KYVA 1AA0A 4WBAA 3TSIA 1BGYJ 1WT6A 5L8RJ 4EIJA 5AVUB 4AQRD 3L74G 3TF5A 3SWFA 5KAFE 2FY8A 3I5CA 4H13B 3HUSA 5APWA 1SQPG 3MHVA 3Q1MA 2Q6QA 3M06A 2B87A 2E76B 5E79H 5B5EH 2K1AA 1L2PA 2OYOA 2XV5A 1USEA 4PD4D 1CI6B 5AVQB 5DJTB 1J1EB 1MZ9A 2YKPA 1JY2P 2B9BA 2JWDA 3P32A 3HD7D 3M9QA 1S5LX 2IPPA 3BRVB 4BWNA 3RBXA 1M90Q 2ZYAA 5AW1B 4JBZA 1KQLA 1EXIA 1VF5B 3LW5H 1NVOA 5AW2B 1M1JB 1EDLA 2OYIB 1SFCA 3L75E 3HTKB 2PFXA 3AE3C 1U57A 3WUTA 5KAIH 2UWJE 3VMXA 1RQUA 1HH0A 3A0BH 1URQB 2KP8A 1LP1A 3JSVC 3A7OA 1SQXE 1H89A 3GHGA 3C1LA 2CPSA 1FE6A 2QJPC 2WSFJ 1PL5A 3RK3D 3TNUA 3ZDMA 1R5LA 1GD2E 5KLIB 3M9HA 2KLUA 3CCLP 1EDIA 3IAOA 3O6QB 5M1BA 3LIEA 3AEGC 4H44C 3L75G 3V5BA 1KD1Q 4PJ0E 4EDFA 1SLQA 4GKGA 2HODB 2BASA 1SP4A 3L70E 1SQPD 3MUDA 1SQXG 2M3EA 5CCGC 2XU6A 1VPCA 2QG4A 5CBOA 1VDFA 2J58A 3L73D 1LWUA 3KPEA 1SQPJ 3OA7A 1JY2O 1MUUA 4YXWH 2FYNC 3FWLA 2IZ0A 3RGUA 2N1TA 2RKLA 3L73J 1N73A 2Z4EA 2ZVOB 4BRYB 3CWBE 2ZT9D 4H0LC 4Z1MH 2OQQA 1IFIA 5BU8B 3NTNA 1OW8A 2O1JA 2E43A 3L70G 3OJAB 4UB8H 1K04A 1EC5A 4I7ZC 5AW0B 1NKZB 2O01J 4N3YB 1LTBC 1LTSC 3IR9A 1S5LE 3CXHE 2BEZF 4WWIA 2R44A 1OXZA 1QL1A 1M56D 1E5WA 2P67A 1JCDA 2N9BA 2QIWA 1FAVA 3N4XA 3CWBG 3B5ND 1NAYA 1JTHB 3CX5E 1AV1A 1SFCD 3HE4B 2IBZE 2Y0DA 2QJPB 1EZVE 1T3JA 4PV1C 1S72P 2JKVA 1DEBA 3L75D 2OYHA 4ZKUA 3CCSP 1FC2C 3A0HH 1GW3A 2FXMA 1M8OB 5AW7B 1AVOA 2RMZA 3H1IE 4GOEA 2YNYA 3L75J 1QL2A 4H44B 1RY3A 2P10A 2JO1A 3KZIH 1HF9A 3H1HE 1SQXD 3K5BA 4HH2A 2WZ7A 2LKMA 4N78E 1SQVE 2KZIA 4IL6H 3I55P 1GL2D 1JB0J 1PGJA 5KTBA 1SQXJ 1QVGO 2OTJP 2IX7C 5AVYB 4UB6H 1IFNA 1NTME 4C7NB 3WU2H 3RL0C 1M7LA 2IBZG 1EZVG 2FYUE 1RH5B 1KFNA 2C0XA 3BASA 5GTHE 1KB9H 2V7QJ 2H7HA 1Q82Q 2FYNB 3WUUA 3SFDC 1N7SD 3L70D 3CCQP 4LC1A 4A7PA 1VQOP 3H1HG 3PJSK 3VN0A 2W83C 4H0LB 1SQVG 2FXPA 3G3ZA 4DZOA 1JY2N 3CI9A 3JCUH 3L70J 3VMYA 2K3RA 2Q3EA 4K35A 1WRGA 2N1TD 3CCJP 2Y9YA 1FOSF 2GUVA 1LT9C 3OAKA 4I7ZB 2AXTH 1DIPA 2Y9ZA 5AW4B 2FYUG 3EFFK 5AVZB 1L4AC 3ABVC 4YPCA 1K9MQ 5APUA 4L74A 1JCCA 4OVNF 1IFMA 1R8EA 1RE4C 1USDA 4B86A 3I56P 5E79E 1DX7A 1NTKD 2IFMA 3T97A 4L73A 3RK2D 3CXHD 5AVWB 4Y28J 1GU4A 2Q5UA 2AEMA 1AQTA 1NTKJ 4PV1B 3S1KA 1Q86Q 1KILC 1QLED 2D2CC 2C9NY 1KQGB 3PH0A 3L74E 1N8RQ 1SVFA 2QJYC 3LIDA 1A02J 5CBNA 1DH3A 2E75D 2IBZD 1EZVD 5GTIE 1VQ9P 5KLVJ 4PD4H 1FDIA 1SQBE 4NPDA 2OGUA 1X8YA 5AW5B 2IYPA 2HLOA 1H0TA 1LJ2A 2W8ZA 3RL0B 1VQPP 3CX5I 3H1ID 1Q2NA 3TK1A 3TYYA 1S2EA 3H1HD 3PLNA 2A45H 3HD7C 4ASWA 1FZEA 1PPJD 1SQVD 4N78D 3M0AA 1IFDA 3H1IJ 1KYOI 1TU3F 3CMAP 3H1HJ 1N7LA 4IL6X 4C7RA 5KJ7D 2KB7P 3VTPC 1NTMD 1SQVJ 1U7MA 3F89A 2IFNA 2WMMA 4YTPC 3R2PA 1OVUA 4BXLA 1SQBG 2QM7A 3V2PA 2R5BA 2POHA 1L0LE 1VQ6P 2WSFH 1NTMJ 1G2CA 4R4LA 1LT9B 3V4QA 4WY4C 1T8ZA 3PHLA 1K05A 1L4AB 1H8AA 2H43A 1P84I 3A2AA 3H32A 5AVTB 4HB1A 3N7NA 1EXJA 3WUVA 3NXSA 3RK3C 2KIKA 1Y47A 1RE3A 1FZCA 3U59A 1T3UA 4I1LA 2HPCB 1CZQA 2J5UA 3H1KG 3B5NA 4W7ZA 1NU1K 2FFDA 2E42A 3M0DA 3CPWO 2PP6A 2R3SA 1LTJA 1VL2A 2KXPB 3KHUA 1S1CX 1OMIA 3AE1C 2KNCA 1L0LG 1GU5A 1ZRTE 5AVVB 2WT7A 3BCCE 2WPVB 3QWOC 1KILB 1IC2A 2M5AB 4UB8E 4RJTA 2D2CB 5BU5A 1G1JA 3Q3DA 3AEFC 2QJYB 1DD4A 3CCUP 4NPEA 4HYTB 2KS1A 5AVRB 3PTZA 4U3FE 1NTKK 1IFJA 1FZGA 1NWQA 1GL2A 3C8VA 2E74C 5AVXB 3EFGA 3W68A 5APQA 2P58A 2WSEJ 2G3AA 3FXEA 3M9BA 2JR8A 1RQVA 2W6BA 1W2BO 3OW2O 2O01H 2ZT9C 2W6AA 1RF0A 3L74D 1X22A 5APVA 1A02F 3HUSC 3BCCG 3HD7B 4OGQC 1PFIA 2XDJA 1N7SA 5KLVK 1M1KQ 1YJ9P 3PRJA 2IZ1A 2E5TA 3L74J 2ZXEB 1SQBD 1NYHA 1RF1B 3CL3D 3B71A 2VRSA 4YXDC 4U3FG 2L91A 2A06E 4GODA 1OW6A 3CCRP 2QRXA 1LTGC 3P7KA 1MV8A 4IL6E 3FGAD 3AEDC 1ZW0A 5B66E 1OVRA 2O3JA 4WY4B 2HG5D 1MFTA 4TT3H 2NPSA 2G8YA 5H2FH 5KKZC 4KHXA 2WQYC 5AW6B 2GA1A 2AXCA 2Q7CA 3GLMA 4R4MA 1SFCC 2JEEA 2K9JA 1PIXA 1KB9E 3O8ZA 3CCVP 3RK3B 1NTMK 2HFED 3KQGA
chains in the Genus database with same CATH topology
2QIWA 2WSEJ 1GMJA 2G3AA 1EXIA 2D2CC 3AE5C 1ZP0C 4R4LA 3H25A 3D6YA 1VF5B 2D2CD 1KQGB 1RQVA 1K05A 3AEAC 4H44D 2MKVA 3T97B 4XFJA 3AE9C 3GF3A 1OW7A 2NZ2A 4H0LB 2QJKC 2QJYC 2ZT9C 4H13D 2YMKA 2FXPA 3GMAA 1KQFB 4GDOA 1UIXA 3AE3C 1EXJA 2E75D 2E76D 3AE2C 4PV1C 3AEEC 2FYNC 4OGQC 1U57A 4PV1D 2JP3A 3D6ZA 4OGQD 2FBWC 1KMIZ 1FDIA 3AE8C 3IN6A 3EWKA 1YQ3C 3GF7A 4I7ZB 5L8RJ 1VF5C 1RQUA 2J5UA 1DIPA 2BEQD 3O6QA 1NYHA 3D71A 3ABVC 1AJYA 2K9YA 1MKMA 3D70A 2H88C 2ZT9D 3B71A 1FDOA 2YIUC 4H44B 4YXDC 4H0LC 1DD3A 2OQQA 2P10A 4Z1MH 1VL2A 1HJ0A 3Q5SA 2JO1A 1HF9A 2H89C 1KORA 4H0LD 1S1CX 1Q90D 1OW6A 1OMIA 3RK3E 3G9RA 2QJPC 3S9OA 3AE1C 2WSFJ 4H13B 4U7JA 1WMKA 1NGMB 1PL5A 1OW8A 1ZRTE 3SFEC 3Q1MA 1PV3A 2E74B 3AEBC 3LW5J 1R8EA 1JB0J 2E75B 2E76B 1K04A 2WPVB 3FGAD 1VF5D 3AEDC 3Q5PA 1IK7A 1Y9BA 2IDBA 2D2CB 2QSIA 4I7ZC 1TU3F 2O01J 3IAOA 2WSCJ 3Q5RA 3RL0g 5M1BA 4TT3H 4IL6X 3Q2YA 3Q3DA 3AE6C 2G8YA 3AEGC 4H44C 3AE7C 5KKZC 2WQYC 3AEFC 3AECC 2ZT9B 1DD4A 4RKUJ 2BEZF 4YTPC 1ZMEC 3GLMA 4Y28J 4R4MA 4H13C 1ZOYC 4KT0J 1S5LX 2V7QJ 3AE4C 3R4YA 3C8VA 4PV1B 1PIXA 2E74C 4OGQB 2E75C 1YQ4C 2E76C 1KTMA 1KILE 2E74D 3SFDC 5KLIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QIW A;  2WSE J;  2FYN C;  4IL6 X;  1Q90 D;  2QJP C;  2WSF J;  1VF5 B;  4H13 B;  5KKZ C;  2ZT9 B;  1ZRT E;  4RKU J;  2E74 B;  3LW5 J;  4Y28 J;  4I7Z B;  5L8R J;  1JB0 J;  2E75 B;  2E76 B;  4KT0 J;  1S5L X;  2WPV B;  4H0L B;  2QJK C;  2QJY C;  3C8V A;  4PV1 B;  4OGQ B;  2K9Y A;  2D2C B;  2QSI A;  2O01 J;  4H44 B;  2YIU C;  5KLI C;  2WSC J; 
#chains in the Genus database with same CATH topology
 3CCE P;  1U7J A;  1ZLL A;  4M3L A;  3SSU A;  3AEA C;  3HE5 B;  2A06 G;  3AE9 C;  1PP9 G;  1GW4 A;  1VQ7 P;  2QJK C;  5TIS E;  3GHG C;  2YMK A;  1YYC A;  3CC2 P;  5CCH A;  2MJZ A;  1YIJ P;  3JCU E;  1NTZ E;  2BCC E;  2B89 A;  1JO5 A;  2V7Q H;  2GM4 A;  1CI6 A;  1EDK A;  3II6 A;  1XTC C;  2H88 C;  2QM8 A;  3KYQ A;  1BE3 E;  1OWA A;  4H0L D;  3V6I A;  3S9O A;  4PJ0 H;  1T2K D;  1W5C E;  1MFZ A;  2E74 B;  1KYO E;  2J59 M;  2FYZ A;  1ZRT D;  1IFP A;  3MUD C;  3BRT B;  1S9K E;  3HRN A;  1J1D B;  3RL0 g;  3NFQ A;  2CK3 H;  2O1K A;  4JF7 A;  1M1J A;  1QVF O;  2OYI A;  2ZT9 B;  2KK7 A;  1LWU C;  2R32 A;  1ZME C;  4N6J A;  1NTZ G;  3HTK A;  2BCC G;  3HUS B;  4U3F D;  1JMM A;  4OGQ B;  5AW9 B;  1KIL E;  2B87 B;  4XE5 B;  3H1J E;  5APT A;  3W67 A;  1L0N E;  3AE5 C;  1N73 C;  2B88 A;  1URQ A;  1BE3 G;  1T6A A;  5KJ7 A;  1P84 E;  2Z5I A;  5CMZ A;  4U3F J;  2NZ2 A;  3UIA A;  3VP9 A;  4AUW A;  1NJI Q;  2ZYD A;  1BCC E;  3QH9 A;  1BSN A;  2KUB A;  4PV1 D;  3H1L E;  4ZMD A;  1IK9 A;  3CCM P;  2BEQ D;  4KJM A;  3O6Q A;  3L36 A;  4L75 A;  3VMA A;  3VYI A;  1SQP K;  2WSS H;  4RES B;  1FDO A;  2YIU C;  1YJN P;  3CXH H;  1DD3 A;  5KKZ B;  4AYC A;  3RK2 C;  1FBM A;  1PZQ A;  1KN7 A;  1HJB A;  1SFC B;  1NGM B;  3C9I A;  2A06 D;  2HOD A;  3H1J G;  3V2N A;  1L0N G;  3AEB C;  2WIT A;  1AVY A;  2WPR A;  3G71 P;  4IFM A;  4MN4 C;  2M3B A;  2NPS D;  1Y8A A;  1LP1 B;  1BCC G;  3CWB D;  4JQ0 D;  4RO0 A;  2Q1K A;  4CPG A;  2QJK B;  3GHG B;  4D6T E;  1YTZ T;  3H1L G;  1NH4 A;  2OYH C;  2E75 C;  1YQ4 C;  2KLV A;  3CWB J;  1KTM A;  5B5E E;  2KOG A;  3TNU B;  2H8P D;  1VQ5 P;  1FZB A;  2I1K A;  1VQ4 P;  1IO4 A;  1LNQ A;  5CJ4 A;  4BRY A;  4DCK A;  3V2R A;  4H13 D;  1CSB A;  5CCH D;  2M8R A;  3VP8 A;  2KZJ A;  2E76 D;  3SWY A;  1KB9 I;  4EI2 A;  1ZXG A;  2QA4 P;  2L5G B;  1NTZ D;  1QGK B;  1HGV A;  2KSJ A;  3TDK A;  1HBW A;  1FU1 A;  3NMD A;  3CX5 D;  4D6T G;  1BSH A;  1JM0 A;  2O01 N;  4ZKP A;  1GDT A;  1NTZ J;  1LWU B;  3MZW B;  3KDP B;  1LT1 A;  1JY3 O;  5GTH H;  3WMM 0;  1LGH B;  1GZL A;  4GIF A;  3IFM A;  5KAI E;  1KYO D;  1VF5 D;  2W90 A;  2N1T B;  3A0B E;  3E7K A;  1N73 B;  1VQN P;  1HGZ A;  2WSC J;  3H6P A;  2P1J A;  5BVZ A;  1S9K D;  3AE6 C;  1JTH A;  3L71 E;  1PGQ A;  2W27 A;  3HE4 A;  1R5S A;  1JUN A;  3L73 E;  2M0B A;  1LTI C;  2XND H;  2YO2 A;  3KXD A;  1SQX K;  2KI7 B;  3S4R A;  2ZJS E;  3MD0 A;  1FDM A;  1VQK P;  3H25 A;  1URQ D;  1RF1 C;  3H1J D;  4HJG H;  1HTL C;  2D2C D;  3H1K E;  1L0N D;  2FYU D;  2YIU B;  1P84 D;  3RK2 B;  4WB4 A;  4GDO A;  1BCC D;  3H1J J;  1UIX A;  4EOT A;  1PGO A;  1L0N J;  4IFF A;  3IN6 A;  2FYU J;  1YHQ P;  3GF7 A;  3H1L D;  1HVV A;  3L71 G;  4LGD E;  1BCC J;  5CCG A;  4OH8 B;  4C7N A;  3U1C A;  2WSE H;  4IOI H;  3L73 G;  4W7Y A;  1NO4 A;  1PGP A;  3G9R A;  3H1L J;  1HUC A;  4K3A A;  2PGD A;  4ASV A;  2HYN A;  3SFE C;  1W2E A;  2WWW A;  1JMB A;  2OYH B;  2E75 B;  4Y99 C;  5AVS B;  1CW5 A;  2IDB A;  4PD4 I;  1SQQ E;  3USS A;  3V4W A;  2V4H A;  1NKN A;  3AE7 C;  5APX A;  5H2F E;  1KC8 Q;  2LXB A;  1HWT C;  2RH0 A;  4LLH A;  2GUS A;  4D6T D;  1OZH A;  2A45 I;  2Q3I A;  5GTI H;  1K8A Q;  2E5Y A;  3E1I A;  1ZR2 A;  1XTG B;  4WY4 D;  4D6T J;  1VQL P;  4IFD K;  1LTT C;  5DJU B;  2K88 A;  1OIP A;  3A5T A;  2C0W A;  3FX0 A;  1J1D C;  1SQQ G;  1KMI Z;  3FXD A;  4W80 A;  3EWK A;  1YQ3 C;  3CC4 P;  2FXO A;  2NRG A;  1AJY A;  1ZR4 A;  2K9Y A;  1IJD B;  5KAF H;  2N9Y B;  3Q5S A;  2YXQ B;  2H89 C;  1NTZ K;  1KOR A;  2QE7 H;  1JY3 N;  1FJP A;  1PV3 A;  3LW5 J;  4DJG A;  1S4X A;  3A0H E;  2JWA A;  3B8E B;  1IK7 A;  1KQS O;  1Y9B A;  2QSI A;  1JNM A;  1VQM P;  2PRR A;  3Q5R A;  1FJK A;  2P7J A;  1PP9 E;  5AW3 B;  3KZI E;  1X0T A;  2R3C A;  3B4S A;  1SQB J;  3L71 D;  2AEF A;  4KT0 J;  5K5G B;  2YMY A;  2OTK E;  3AE4 C;  1NU1 E;  3CD6 P;  1OFC X;  2E74 D;  4NPF X;  1RE3 C;  1FZC C;  4TLF A;  2Y0C A;  2RN0 A;  2XKM A;  3L71 J;  4UB6 E;  3EQ2 A;  3L4F A;  3B5N C;  1SQV K;  2FFD C;  4H44 D;  3WU2 E;  1X79 B;  3M0D C;  3T97 B;  3H1K D;  2WVR A;  2ZAE B;  3IF4 A;  1LTJ C;  1GTW A;  1AFO A;  3ITK A;  3GMA A;  1KV4 A;  1EDJ A;  2WPQ A;  3GG2 A;  1L0N K;  2OAR A;  1T2K C;  2K37 A;  3D6Z A;  1L0L D;  4OGQ D;  3H1K J;  2FYU K;  4JYB A;  4Y99 B;  3AE8 C;  4QMA A;  4HKZ H;  2WTY A;  5CCG D;  1JOC A;  1NTK E;  1FZA A;  1H88 A;  5AW8 B;  5C39 A;  1MKM A;  3A3Y B;  4EYY Q;  1L0L J;  3MTU E;  1NU1 G;  2ZFC A;  3TGU E;  1GL2 C;  3CME P;  3P8M C;  2WPS A;  3P8C E;  4DOJ A;  3GW6 A;  4L76 A;  2OTL P;  1LT9 A;  2AXT E;  1H0T B;  1SQQ D;  1L4A A;  3Q2Y A;  5KLV E;  3AEC C;  1QEX A;  1KZU B;  1RF0 C;  2XZR A;  1ZOY C;  1D7M A;  3R4Y A;  3MP7 B;  1NHL A;  1N7S C;  2YKO A;  1SQQ J;  3BCC D;  1RE4 A;  4I2L C;  1AQ5 A;  1NTK G;  1GMJ A;  3D6Y A;  2HPC A;  4GT1 A;  5CHX A;  3L72 E;  5CJ0 A;  4XFJ A;  1BGY E;  4GOF A;  3BCC J;  1J2J B;  3L37 A;  3TGU G;  1N86 A;  1X9V A;  2JJL A;  2ZYG A;  3BVH A;  1GK6 A;  4OWF A;  3G4S P;  2N1T C;  2JP3 A;  1PPJ E;  2HR3 A;  3BAT A;  1KIL A;  2M5A A;  1UII A;  1G2C B;  1FS0 E;  5B66 H;  5KLV G;  2FKW B;  1JY3 P;  2NPS C;  3D71 A;  1SS1 A;  4XA4 A;  1Q90 D;  2KSE A;  3H32 B;  2ITA A;  4JPZ B;  1WMK A;  4C46 A;  1EQ7 A;  2QVA A;  4PD4 E;  1DEE G;  1NAF A;  3L72 G;  4I6M C;  3Q5P A;  3E1R A;  1FZC B;  4JYC A;  1RHZ B;  2I8D A;  1BGY G;  1S5L H;  1M57 D;  3B5N B;  2FFD B;  3H1I G;  1KFM A;  3JC2 2;  1LTJ B;  2Q9I A;  1SQB K;  4RKU J;  3RBZ A;  1E79 H;  5TIS H;  1PP9 D;  4H13 C;  2KNC B;  2YXR B;  1K73 Q;  5CCH C;  1PPJ G;  3HD7 A;  2E76 C;  2WT7 B;  1NU1 D;  2XNX A;  1PP9 J;  2ZVN B;  1J1E C;  1JEK A;  1N2D C;  3RL0 D;  3CX5 H;  1NTM G;  1FZF A;  1RF1 A;  1Q81 Q;  3GF3 A;  2PAJ A;  1BDD A;  1Q7Y Q;  1NU1 J;  2WSC H;  1OVV A;  2ZXX A;  1KQF B;  2KS1 B;  1GK4 A;  2IYO A;  3MIW A;  1GL2 B;  1KB9 D;  2LR2 A;  1KYO H;  3G6E P;  2JDI H;  3L35 A;  5TJH A;  5EFW B;  4O9B A;  1VF5 C;  3CLQ A;  5APY A;  4WY4 A;  1YIT P;  1LTA C;  1NOH A;  3D70 A;  1BDC A;  1L0L K;  1S3J A;  1M1J C;  3M91 A;  1HJ0 A;  2A45 G;  2OYI C;  2SPZ A;  3RK3 E;  2Z5H A;  1ZN5 A;  4U7J A;  4ZNC A;  1OX3 A;  2BCC D;  1N7S B;  3TGU D;  4DT0 A;  1YBK A;  3P8C D;  1URQ C;  1YJW P;  1L4A D;  5KJ7 C;  3HE5 A;  3MGN A;  2YO3 A;  1P84 H;  2BCC J;  2QEX P;  1BE3 D;  2I1J A;  3TGU J;  5KLV D;  3CXH I;  2AEJ A;  4WVZ A;  1QX8 A;  3CC7 P;  2DW3 A;  1SQQ K;  2R5D A;  1SQP E;  3V2Q A;  1BE3 J;  5KLI C;  3VOP A;  2YKQ A;  2Y0E A;  1YI2 P;  1ZP0 C;  3U1A A;  1FOS E;  1ZV8 A;  2MKV A;  3FWN A;  1Z56 A;  1YTZ I;  2NPS B;  2W6J H;  3L72 D;  2P2U A;  3PP5 A;  1OW7 A;  2C9L Y;  1IZN B;  1BGY D;  2K9J B;  1G1I A;  2CPB A;  3VMZ A;  3SWK A;  1VQ8 P;  3AE2 C;  3AEE C;  2IBZ I;  1EZV I;  1KIL D;  2FBW C;  5APS A;  3L72 J;  3F5H A;  2LXC B;  2KYV A;  1AA0 A;  4WBA A;  3TSI A;  1BGY J;  1WT6 A;  5L8R J;  4EIJ A;  5AVU B;  4AQR D;  3L74 G;  3TF5 A;  3SWF A;  5KAF E;  2FY8 A;  3I5C A;  4H13 B;  3HUS A;  5APW A;  1SQP G;  3MHV A;  3Q1M A;  2Q6Q A;  3M06 A;  2B87 A;  2E76 B;  5E79 H;  5B5E H;  2K1A A;  1L2P A;  2OYO A;  2XV5 A;  1USE A;  4PD4 D;  1CI6 B;  5AVQ B;  5DJT B;  1J1E B;  1MZ9 A;  2YKP A;  1JY2 P;  2B9B A;  2JWD A;  3P32 A;  3HD7 D;  3M9Q A;  1S5L X;  2IPP A;  3BRV B;  4BWN A;  3RBX A;  1M90 Q;  2ZYA A;  5AW1 B;  4JBZ A;  1KQL A;  1EXI A;  1VF5 B;  3LW5 H;  1NVO A;  5AW2 B;  1M1J B;  1EDL A;  2OYI B;  1SFC A;  3L75 E;  3HTK B;  2PFX A;  3AE3 C;  1U57 A;  3WUT A;  5KAI H;  2UWJ E;  3VMX A;  1RQU A;  1HH0 A;  3A0B H;  1URQ B;  2KP8 A;  1LP1 A;  3JSV C;  3A7O A;  1SQX E;  1H89 A;  3GHG A;  3C1L A;  2CPS A;  1FE6 A;  2QJP C;  2WSF J;  1PL5 A;  3RK3 D;  3TNU A;  3ZDM A;  1R5L A;  1GD2 E;  5KLI B;  3M9H A;  2KLU A;  3CCL P;  1EDI A;  3IAO A;  3O6Q B;  5M1B A;  3LIE A;  3AEG C;  4H44 C;  3L75 G;  3V5B A;  1KD1 Q;  4PJ0 E;  4EDF A;  1SLQ A;  4GKG A;  2HOD B;  2BAS A;  1SP4 A;  3L70 E;  1SQP D;  3MUD A;  1SQX G;  2M3E A;  5CCG C;  2XU6 A;  1VPC A;  2QG4 A;  5CBO A;  1VDF A;  2J58 A;  3L73 D;  1LWU A;  3KPE A;  1SQP J;  3OA7 A;  1JY2 O;  1MUU A;  4YXW H;  2FYN C;  3FWL A;  2IZ0 A;  3RGU A;  2N1T A;  2RKL A;  3L73 J;  1N73 A;  2Z4E A;  2ZVO B;  4BRY B;  3CWB E;  2ZT9 D;  4H0L C;  4Z1M H;  2OQQ A;  1IFI A;  5BU8 B;  3NTN A;  1OW8 A;  2O1J A;  2E43 A;  3L70 G;  3OJA B;  4UB8 H;  1K04 A;  1EC5 A;  4I7Z C;  5AW0 B;  1NKZ B;  2O01 J;  4N3Y B;  1LTB C;  1LTS C;  3IR9 A;  1S5L E;  3CXH E;  2BEZ F;  4WWI A;  2R44 A;  1OXZ A;  1QL1 A;  1M56 D;  1E5W A;  2P67 A;  1JCD A;  2N9B A;  2QIW A;  1FAV A;  3N4X A;  3CWB G;  3B5N D;  1NAY A;  1JTH B;  3CX5 E;  1AV1 A;  1SFC D;  3HE4 B;  2IBZ E;  2Y0D A;  2QJP B;  1EZV E;  1T3J A;  4PV1 C;  1S72 P;  2JKV A;  1DEB A;  3L75 D;  2OYH A;  4ZKU A;  3CCS P;  1FC2 C;  3A0H H;  1GW3 A;  2FXM A;  1M8O B;  5AW7 B;  1AVO A;  2RMZ A;  3H1I E;  4GOE A;  2YNY A;  3L75 J;  1QL2 A;  4H44 B;  1RY3 A;  2P10 A;  2JO1 A;  3KZI H;  1HF9 A;  3H1H E;  1SQX D;  3K5B A;  4HH2 A;  2WZ7 A;  2LKM A;  4N78 E;  1SQV E;  2KZI A;  4IL6 H;  3I55 P;  1GL2 D;  1JB0 J;  1PGJ A;  5KTB A;  1SQX J;  1QVG O;  2OTJ P;  2IX7 C;  5AVY B;  4UB6 H;  1IFN A;  1NTM E;  4C7N B;  3WU2 H;  3RL0 C;  1M7L A;  2IBZ G;  1EZV G;  2FYU E;  1RH5 B;  1KFN A;  2C0X A;  3BAS A;  5GTH E;  1KB9 H;  2V7Q J;  2H7H A;  1Q82 Q;  2FYN B;  3WUU A;  3SFD C;  1N7S D;  3L70 D;  3CCQ P;  4LC1 A;  4A7P A;  1VQO P;  3H1H G;  3PJS K;  3VN0 A;  2W83 C;  4H0L B;  1SQV G;  2FXP A;  3G3Z A;  4DZO A;  1JY2 N;  3CI9 A;  3JCU H;  3L70 J;  3VMY A;  2K3R A;  2Q3E A;  4K35 A;  1WRG A;  2N1T D;  3CCJ P;  2Y9Y A;  1FOS F;  2GUV A;  1LT9 C;  3OAK A;  4I7Z B;  2AXT H;  1DIP A;  2Y9Z A;  5AW4 B;  2FYU G;  3EFF K;  5AVZ B;  1L4A C;  3ABV C;  4YPC A;  1K9M Q;  5APU A;  4L74 A;  1JCC A;  4OVN F;  1IFM A;  1R8E A;  1RE4 C;  1USD A;  4B86 A;  3I56 P;  5E79 E;  1DX7 A;  1NTK D;  2IFM A;  3T97 A;  4L73 A;  3RK2 D;  3CXH D;  5AVW B;  4Y28 J;  1GU4 A;  2Q5U A;  2AEM A;  1AQT A;  1NTK J;  4PV1 B;  3S1K A;  1Q86 Q;  1KIL C;  1QLE D;  2D2C C;  2C9N Y;  1KQG B;  3PH0 A;  3L74 E;  1N8R Q;  1SVF A;  2QJY C;  3LID A;  1A02 J;  5CBN A;  1DH3 A;  2E75 D;  2IBZ D;  1EZV D;  5GTI E;  1VQ9 P;  5KLV J;  4PD4 H;  1FDI A;  1SQB E;  4NPD A;  2OGU A;  1X8Y A;  5AW5 B;  2IYP A;  2HLO A;  1H0T A;  1LJ2 A;  2W8Z A;  3RL0 B;  1VQP P;  3CX5 I;  3H1I D;  1Q2N A;  3TK1 A;  3TYY A;  1S2E A;  3H1H D;  3PLN A;  2A45 H;  3HD7 C;  4ASW A;  1FZE A;  1PPJ D;  1SQV D;  4N78 D;  3M0A A;  1IFD A;  3H1I J;  1KYO I;  1TU3 F;  3CMA P;  3H1H J;  1N7L A;  4IL6 X;  4C7R A;  5KJ7 D;  2KB7 P;  3VTP C;  1NTM D;  1SQV J;  1U7M A;  3F89 A;  2IFN A;  2WMM A;  4YTP C;  3R2P A;  1OVU A;  4BXL A;  1SQB G;  2QM7 A;  3V2P A;  2R5B A;  2POH A;  1L0L E;  1VQ6 P;  2WSF H;  1NTM J;  1G2C A;  4R4L A;  1LT9 B;  3V4Q A;  4WY4 C;  1T8Z A;  3PHL A;  1K05 A;  1L4A B;  1H8A A;  2H43 A;  1P84 I;  3A2A A;  3H32 A;  5AVT B;  4HB1 A;  3N7N A;  1EXJ A;  3WUV A;  3NXS A;  3RK3 C;  2KIK A;  1Y47 A;  1RE3 A;  1FZC A;  3U59 A;  1T3U A;  4I1L A;  2HPC B;  1CZQ A;  2J5U A;  3H1K G;  3B5N A;  4W7Z A;  1NU1 K;  2FFD A;  2E42 A;  3M0D A;  3CPW O;  2PP6 A;  2R3S A;  1LTJ A;  1VL2 A;  2KXP B;  3KHU A;  1S1C X;  1OMI A;  3AE1 C;  2KNC A;  1L0L G;  1GU5 A;  1ZRT E;  5AVV B;  2WT7 A;  3BCC E;  2WPV B;  3QWO C;  1KIL B;  1IC2 A;  2M5A B;  4UB8 E;  4RJT A;  2D2C B;  5BU5 A;  1G1J A;  3Q3D A;  3AEF C;  2QJY B;  1DD4 A;  3CCU P;  4NPE A;  4HYT B;  2KS1 A;  5AVR B;  3PTZ A;  4U3F E;  1NTK K;  1IFJ A;  1FZG A;  1NWQ A;  1GL2 A;  3C8V A;  2E74 C;  5AVX B;  3EFG A;  3W68 A;  5APQ A;  2P58 A;  2WSE J;  2G3A A;  3FXE A;  3M9B A;  2JR8 A;  1RQV A;  2W6B A;  1W2B O;  3OW2 O;  2O01 H;  2ZT9 C;  2W6A A;  1RF0 A;  3L74 D;  1X22 A;  5APV A;  1A02 F;  3HUS C;  3BCC G;  3HD7 B;  4OGQ C;  1PFI A;  2XDJ A;  1N7S A;  5KLV K;  1M1K Q;  1YJ9 P;  3PRJ A;  2IZ1 A;  2E5T A;  3L74 J;  2ZXE B;  1SQB D;  1NYH A;  1RF1 B;  3CL3 D;  3B71 A;  2VRS A;  4YXD C;  4U3F G;  2L91 A;  2A06 E;  4GOD A;  1OW6 A;  3CCR P;  2QRX A;  1LTG C;  3P7K A;  1MV8 A;  4IL6 E;  3FGA D;  3AED C;  1ZW0 A;  5B66 E;  1OVR A;  2O3J A;  4WY4 B;  2HG5 D;  1MFT A;  4TT3 H;  2NPS A;  2G8Y A;  5H2F H;  5KKZ C;  4KHX A;  2WQY C;  5AW6 B;  2GA1 A;  2AXC A;  2Q7C A;  3GLM A;  4R4M A;  1SFC C;  2JEE A;  2K9J A;  1PIX A;  1KB9 E;  3O8Z A;  3CCV P;  3RK3 B;  1NTM K;  2HFE D;  3KQG A; 
#chains in the Genus database with same CATH homology
 2QIW A;  2WSE J;  1GMJ A;  2G3A A;  1EXI A;  2D2C C;  3AE5 C;  1ZP0 C;  4R4L A;  3H25 A;  3D6Y A;  1VF5 B;  2D2C D;  1KQG B;  1RQV A;  1K05 A;  3AEA C;  4H44 D;  2MKV A;  3T97 B;  4XFJ A;  3AE9 C;  3GF3 A;  1OW7 A;  2NZ2 A;  4H0L B;  2QJK C;  2QJY C;  2ZT9 C;  4H13 D;  2YMK A;  2FXP A;  3GMA A;  1KQF B;  4GDO A;  1UIX A;  3AE3 C;  1EXJ A;  2E75 D;  2E76 D;  3AE2 C;  4PV1 C;  3AEE C;  2FYN C;  4OGQ C;  1U57 A;  4PV1 D;  2JP3 A;  3D6Z A;  4OGQ D;  2FBW C;  1KMI Z;  1FDI A;  3AE8 C;  3IN6 A;  3EWK A;  1YQ3 C;  3GF7 A;  4I7Z B;  5L8R J;  1VF5 C;  1RQU A;  2J5U A;  1DIP A;  2BEQ D;  3O6Q A;  1NYH A;  3D71 A;  3ABV C;  1AJY A;  2K9Y A;  1MKM A;  3D70 A;  2H88 C;  2ZT9 D;  3B71 A;  1FDO A;  2YIU C;  4H44 B;  4YXD C;  4H0L C;  1DD3 A;  2OQQ A;  2P10 A;  4Z1M H;  1VL2 A;  1HJ0 A;  3Q5S A;  2JO1 A;  1HF9 A;  2H89 C;  1KOR A;  4H0L D;  1S1C X;  1Q90 D;  1OW6 A;  1OMI A;  3RK3 E;  3G9R A;  2QJP C;  3S9O A;  3AE1 C;  2WSF J;  4H13 B;  4U7J A;  1WMK A;  1NGM B;  1PL5 A;  1OW8 A;  1ZRT E;  3SFE C;  3Q1M A;  1PV3 A;  2E74 B;  3AEB C;  3LW5 J;  1R8E A;  1JB0 J;  2E75 B;  2E76 B;  1K04 A;  2WPV B;  3FGA D;  1VF5 D;  3AED C;  3Q5P A;  1IK7 A;  1Y9B A;  2IDB A;  2D2C B;  2QSI A;  4I7Z C;  1TU3 F;  2O01 J;  3IAO A;  2WSC J;  3Q5R A;  3RL0 g;  5M1B A;  4TT3 H;  4IL6 X;  3Q2Y A;  3Q3D A;  3AE6 C;  2G8Y A;  3AEG C;  4H44 C;  3AE7 C;  5KKZ C;  2WQY C;  3AEF C;  3AEC C;  2ZT9 B;  1DD4 A;  4RKU J;  2BEZ F;  4YTP C;  1ZME C;  3GLM A;  4Y28 J;  4R4M A;  4H13 C;  1ZOY C;  4KT0 J;  1S5L X;  2V7Q J;  3AE4 C;  3R4Y A;  3C8V A;  4PV1 B;  1PIX A;  2E74 C;  4OGQ B;  2E75 C;  1YQ4 C;  2E76 C;  1KTM A;  1KIL E;  2E74 D;  3SFD C;  5KLI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...