4Y2FA

Crystal structure of native gaf domain of potassium sensor histidine kinase kdpd from escherichia coli
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
143
structure length
143
Chain Sequence
GAMDLYEMSKALAVGRSPQDIAATSEQFIASTFHARSQVLLPDDNGKLQPLTHPQGMTPWDDAIAQWSFDKGLPAGAGTDTLPGVPYQILPLKSGEKTYGLVVVEPGNLRQLMIPEQQRLLETFTLLVANALERLTKLAAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title CRYSTAL STRUCTURE OF NATIVE GAF DOMAIN of POTASSIUM SENSOR HISTIDINE KINASE KDPD FROM ESCHERICHIA COLI
rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Sensor protein KdpD
total genus 42
structure length 143
sequence length 143
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2015-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13492 GAF_3 GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4y2fA00
2HGVA 2O9BA 3R4KA 3E98A 5HPFA 4EU0A 3DBAA 4QPRA 2O99A 4LRXC 2K2NA 3O5YA 4Q0JA 4E04A 4O0PA 4BWIA 3CITA 2W3DA 2Y8HA 4Y3IA 2O0YA 5C5KA 3NHQA 3W2ZA 4MCWA 2O9CA 4RQ9A 3OBFA 2KLIA 3E0YA 3S7QA 4R6LA 2W3EA 2W3HA 4IJGA 2Y79A 1MKMA 3S7PA 3NOUC 5TJJA 4DN0A 2VKSA 4G3VA 3VV4A 2W3FA 4MN7A 3D3OA 3IBJA 3MMHA 3NOTC 2VJWA 3NOPC 3CI6A 1STZA 2W1TB 3KSIA 4Y5FA 2KOIA 4PAUA 1YKDA 3KSGA 2ZMFA 5K5BA 5L8MA 4ME4A 4O8GA 5HL6A 1YSQA 3RFBA 2GX5A 2W1TA 2QYBA 4ETXA 4ETZA 1TF1A 2W3GA 4YOFA 3TRCA 1TD5A 2M7UA 4G3KA 2XSSA 4ZRRA 5HSQA 3KSFA 4DMZA 5HPIA 4LRYC 4IUKA 3S7NA 4LRZE 4GW9A 4FOFA 1F5MA 3IBRA 3S7OA 1MC0A 2G7UA 2K31A 3LFVA 4Q0HA 2W1RA 4GLQA 3BJNA 4G3WA 5AJGA 2LB9A 2VZWA 2IA2A 4Z1WA 4Q0IA 3EEAA 3K2NA 4R70A 1YSPA 3MF0A 3ZQ5A 4IUHA 2LB5A 2XRNA 3OOVA 2VEAA 4EUVA 5DFYA 3MQ0A 5I5LA 5LBRA 5DFXA 2O9AA 4MDZA 1ZTUA 4O01A 4CQHA 3C2WA 2XROA 1VHMA 3G6OA 3KO6A 4YNRA 2B18A 4MMNA 2OOLA 2M7VA 3HCYA 4Y2FA 3KSHA
chains in the Genus database with same CATH superfamily
2Z6CA 3SS4A 5FA7A 4R3JA 3UB7A 4KZ8A 4Y13A 3T1RA 1YLZA 4LRXC 3BLSA 4I3IA 1BLHA 4XT2A 2PDRA 5EVLA 4BBTA 5M19A 2ZC4B 5C5KA 1GSXA 2JKTM 1TS0A 2I72A 2ZMAA 2GDNA 4E3JA 1PNEA 4KZ7A 5FQKA 3MZFA 2RCXA 1FILA 3D3OA 2Y2GA 1STZA 2KOIA 3SS5A 2Z2MB 4ME4A 2JE5A 1HTZA 1BULA 2VV6A 3IWIA 4LPZA 4JXVA 3BY8A 2UV0E 1P9RA 1TD5A 2BLSA 2WYXA 1LL9A 4ZRRA 3RXXA 4PMAA 5FAPA 3EGXC 4EUZA 3L7HA 4GW9A 2ZQ9A 4FOFA 1F5MA 1I2SA 3V3SA 1OJGA 1Q2PA 3T4OA 3CAXA 1T1CA 4GZBA 1ESIA 4FUWA 3H9WA 1YSPA 2CMNA 2E8JA 5F83A 4BL3A 4CQHA 2ZLYA 5F1FA 5M18A 4R3AA 5JYPA 4QU3A 4N92A 3HVFA 3OPLA 3LY3A 2PRFA 4DXBA 2FH5A 1L0GA 3ZNYA 1TDGA 2WGWA 3C7VA 4QY6A 4X1LA 5EE8A 2PYRA 3VOYA 1XJ3A 1IYSA 2QHKA 2WAFA 4R23A 1SKOB 1TVFA 5FDSA 2VA0A 3C4OA 5E43A 1MKIA 4Y3IA 2O0YA 1YLJA 2XGNA 2JC7A 2A2LA 2ZL1A 1EROA 4U0TA 2NUPC 3NOUC 3S22A 4G3VA 2WKQA 1Z6FA 4B88A 3OZHA 3E2LA 3B42A 2VGLS 2W1TB 3HJIA 3T12B 4EESA 1YLPA 3W4OA 5HARA 3ZVTA 2XFSA 2QPNA 3PBSA 3SZTA 2EX6A 1ALQA 4GD6A 4HJ6A 4QY5A 2H0TA 4JGPA 3RXWA 3SOIA 2VGJA 2EWVA 2VGKA 4I3JA 3CPTA 4JF5A 2Y2LA 3VE4A 1NLYA 3LIBA 2PBYA 1OTDA 5FI6A 1OTIA 5GLBA 3BJNA 5J4EA 2XLNA 2ZBBA 4B4ZA 1FIKA 2M1CA 1L3LA 1KGFA 1P97A 3FYZA 3G2YA 3BY9A 2Y59A 3BFEA 3GR2A 1KVLA 3A3IA 4P6BA 4PKYG 3FV7A 3KYZA 4HP9A 3F1NB 2O9BA 5CGWA 2A24B 1LHYA 4HHDA 2V0WA 3IHAA 3TSGA 3V67A 2ZQDA 1XJ6A 4LENA 5G4ZA 3Q81A 3N4IA 2WZZA 3A3EA 2QMIA 3LIDA 5TBMA 1PI5A 2Y8HA 5HZHA 3E0YA 5FI2A 4R6LA 3ZYTA 2IWDA 3G31A 3DTEA 4OPQA 4LV2A 1DJCA 2B95A 5AQ7A 4EBNA 4PM7A 3I7JA 1LI0A 3OC2A 4DRTA 1KE0A 2K7SA 1PYYA 4C3QA 4H6JB 2DNSA 2GJ3A 4Y17A 1HZOA 3MXQA 3MBZA 5DF9A 5FSRA 2G2WA 4GDNA 1LL5A 2WKRA 4EBPA 4LCMA 2PAVP 4K0WA 3S4XA 4WLAA 5FI7A 3NI9A 2X02A 4L9FA 2EX2A 3W4QA 4PHTA 2XA7S 4S2IA 3TJZC 1IKIA 4P87A 4WZ5A 3NECA 2VK3A 1PW8A 3N6IA 3LEQA 4ZBEA 3ZVWA 4WUJA 3LCEA 5EFWA 1PZPA 3LFVA 4D2OA 2ZQAA 3UPPA 5HAQA 2VZWA 3MF0A 4C75A 2VX8A 3UDIA 3HLDA 1GHIA 3HUNA 2HP9A 1MPLA 1ZHHB 1BUEA 3NJAA 1FCOA 3HJKA 5CX7A 1OJ5A 3OCLA 2VGLM 3CMZA 1AWIA 5FAQA 2O99A 5FQQA 1YLTA 1MWUA 4FD8A 5A8BA 3LR0A 2NUTC 3OCNA 4KUOA 4X53A 5CEDA 3LGOA 1ZG4A 2W3EA 4OP5A 2HDQA 2XQZA 3C5AA 3VV4A 5CTMA 1ONHA 1K57A 1S1ZA 2FFFB 3V39A 2ZM8A 4Y5FA 2DCFA 5AVFA 1XJ2A 4EQ1A 2JKRM 1FCMA 2A3UA 2PBDP 4M4XA 1ERMA 1YLWA 2E8IA 5HFOA 4DF6A 4ETXA 3FKWA 4YOFA 1V9YA 3QP6A 5DTTA 3PAEA 1JTDA 4ZAMA 4DMZA 5AQBA 2L1MA 1VM1A 5AQAA 4OP8A 4YFMA 3C7UA 4NKPA 3K3DA 3JVUA 3Q82A 4I38A 1L0FA 2HV1A 2OAP1 2XEPA 1YAXA 3QP2A 1NLZA 3LIEA 5A93A 1FR6A 4MN5A 2XRNA 3OOVA 3HLGA 2ACGA 1ACFA 1H3QA 2Q9MA 1VEUA 5CRFA 5DKKA 2WKPA 4S2OA 3QHYA 5GLAA 4E3KA 1JTGA 4R4RA 2EA9A 3AGFA 4OH0A 1BT5A 3R4KA 3LICA 4EU0A 3IQAA 1H8ZA 3P98A 3C30A 3SS3A 4E04A 4O0PA 3K3CA 3LY4A 3ZNTA 4ARZB 3HUMA 5HAPA 3DTMA 4B4XA 4BJPA 1A0KA 1PIOA 3Q1FA 5HL1A 4PPRA 4IJGA 4JBFA 3SH9A 4DN0A 1NZOA 3E2KA 2Y2MA 4MN7A 3UO9A 4BQMA 3BWLA 4L9GA 4X55A 5GLDA 1Y4OA 3KSIA 3NCKA 3FKVA 3WS0A 5KSHA 4IVIA 4O8GA 2PD8A 2ZMVA 4FH4A 4ESPA 1JWVA 1M6KA 4NXGA 3MQQA 3LYXA 4ZJ3A 2VLGA 4CPKA 3LR3A 1F98A 4F94A 4BBVA 1DRMA 1SKFA 4LRZE 4X68A 5KSCA 4U3TA 1QMEA 2B5RA 3MXRA 4X6TA 4QHCA 4UAAA 5HWWA 4QJGA 3Q7VA 2H5SA 1CJFA 3W8KA 5A90A 1XP4A 5GL9A 4EUVA 4WEJA 4HJ4A 5LBRA 1XA7A 1TS8A 1N9LA 1NZUA 4WMCD 1D7EA 4MMNA 1FCNA 1E25A 2KDKA 3HCYA 3P01A 2HJ9C 4ZTKA 2HGVA 1D1JA 1GSVA 4HESA 3E98A 3DBAA 5E2GA 4QPRA 5EPHA 5TFQA 4PKYA 2H10A 2BASA 2X01A 4PM5A 2OWHA 4K0XA 5IS1A 2HP5A 2XF3A 1G68A 2IWBA 3N7WA 3GRJA 3MSHA 2OWJA 4DE2A 3EEHA 3OPRA 1YQSA 3MMHA 3NOPC 3TE8A 4EBLA 3LR5A 5M1AA 2L4RA 2QKPA 1OTEA 3PBTA 3BFGA 1YMSA 2V20A 3ICYA 3VSKA 2GX5A 4DE3A 3U4LP 2Y2JA 1TS6A 2PR5A 4U0XA 1BLPA 4OOYA 2HDSA 1IKGA 3KSFA 3WWXA 4UQIM 3QP8A 1FR1A 3FWLA 4NG2A 2H28A 2EXBA 2J9OA 4X25A 1W7FA 3IXDA 4GS9B 4S2LA 1U60A 3GSGA 2P08A 1XFNA 3SH7A 4E3LA 1BSGA 2HPBA 3ZQ5A 2LB5A 2WGWB 4RVAA 1IYPA 1PFLA 2PT7A 4Z9QA 1WE4A 3IX4A 2DRWA 2M7VA 4HI4A 5IT5A 4Y2FA 1PZOA 1AXBA 2EX8A 2XD1A 5KMWA 3DWKA 3AGEA 5JYOA 4JGQA 5GHXA 3MJQA 2J8YA 3F1PB 2PU4A 3O5YA 3EQUA 3HL9A 5FEFA 1BZAA 3T50A 2Y55A 4KUKA 1SHVA 3MS6A 2PD7A 3TOIA 2O9CA 1VETB 4BLMA 4F3LA 4JXGA 3OBFA 2OLUA 2W3HA 4WEKA 1KGEA 2MJ6A 4IBXA 2JKFA 1QMFA 3G2ZA 4DXCA 2ZD8A 3JPUA 5HD5A 3ZG5A 3GMWA 3QNBA 3MZEA 1LSXA 2ZMFA 5L8MA 4WELA 2V1AA 4EEPA 1YT4A 5FDHA 5A91A 5CHJA 4OONA 4MEZA 1ES2A 4HOIA 3IS2A 1MWSA 3O87A 4WMCA 1CQAA 2WUQA 3TG9A 2QWSA 4NEED 3S7NA 4KENB 4NXBA 4CLCA 4E3MA 3MZDA 2ZM2A 3HBRA 2XFTA 3QNCA 4WM9A 5EM0A 4BENA 2K31A 4KG2A 1K56D 2JCHA 2FFYA 1RGZA 4HH2A 3F1NA 2JN7A 2J3TC 4OPRA 1GHMA 3IXBA 2ZC5B 3EEAA 4CLCD 2WADA 2XH9A 1L2SA 3NIAA 4IUHA 4EEUA 1W8YA 1G6OA 3DAVA 3A0SA 4S2NC 5EECA 2J3WA 2C6WB 3FPWA 3LO7A 4QWOA 1W63M 3ISGA 4JXSA 2OOLA 2Y2KA 4R1GA 3VFHA 2ZC7A 4PM9A 3VP2A 4HEFA 2Y2IA 3KYEA 4Y15A 1YM1A 4PM8A 4YINA 4BWIA 4GN2A 1K56A 2V1ZA 1CI8A 4CLCE 4L9EA 5IHVA 4KG5A 3BLMA 4HP4A 3HLEA 2J7VA 3IWQA 5HWVA 4OPYA 2Y2OA 4GKUA 4DE0A 3D72A 1IYOA 3GECA 4OOMA 4WZ4A 4DKIA 4EERA 2WZXA 4EV4A 2Q0OA 3V50A 3PBRA 1O7EA 4DJ3A 3G32A 1VEUB 3T4TA 3GVBA 3P09A 4JKTA 5E2FA 5HWTA 4K08A 4IUKA 4OVDA 3LR4A 2I9VA 1MC0A 3CJMA 3GQZA 5J7EA 4UA6A 5EOEA 4GLQA 3VFFA 1RP5A 4C6YA 2XA7M 5F5YA 3Q7VB 4XXRA 1J9MA 3NULA 4O01A 2HDRA 2JKTI 3UB8A 1D06A 1K6RA 2Y2PA 4NXEA 4EQIA 4EW7A 3PBQA 4GOGA 3JVVA 4AFIA 1XGIA 5HPFA 2V1BA 4JLFA 3EWKA 2YKFA 1LL8A 2GZAA 3CHWP 3PXPA 1Y54A 3CLOA 2HP6A 4L0LA 4MCWA 3U2AA 3T4JA 2XD5A 2CC1A 2Z2LB 1MKMA 1BYWA 4UQIS 1CEGA 2W3FA 3PYPA 3L9KA 3IF6A 5J8XA 4LCLA 1PWGA 1G6AA 3MQOA 4HBTA 1ES3A 3LI9A 4KQOA 1CI9A 3VSLA 5CEBA 3SW1A 3JYIA 3OPPA 3MXSA 2PHYA 5E2EA 1YMXA 1GA9A 4LV0A 4NXFA 1O07A 1FQGA 5EM1A 1K55C 3E4OA 4S2NA 1GCEA 3CWFA 4RX2A 2WKHA 3B33A 4HBUA 1KE3A 1KDSA 4Q0HA 5DTKA 1SKOA 2XR0A 2Q9NA 5EV0A 1T19A 4Q0IA 3BQAA 4R70A 4WF0A 1HD8A 2ZOIA 5F69A 1NRFA 1T18A 5DFYA 2ZL1B 4EXOA 1CK3A 1FOFA 3UNWA 3ZG8B 4B9OA 1OT6A 3HLFA 4RYEA 3IWOA 2J9PA 4X69A 3DW0A 3B3XA 1OPXA 1W5DA 1XGJA 3O3VA 4MLLA 5TGFA 4DJ2A 1ONGA 4MNRA 2ZOHA 5CGSA 1MZUA 2ZC6B 5CXWA 3T1SA 3PR6A 1MY8A 5BOHA 3W2ZA 5HAIA 3FPVA 1K4FA 4KQRA 4A5RA 1JVJA 1XKZA 3BRMA 4OQGA 4MBHA 1IEMA 3VP0A 3IH8A 4NK3A 3CI6A 3Q07A 2WGIA 3ZG0A 5A92A 1ES4A 5K5BA 3V5MA 2GNXA 4DDYA 3CZDA 4WN5A 3IX8A 3NBLA 3ZFZA 2QYBA 2YKHA 3F1OA 4YWZA 1MXOA 4ZJ1A 3GDIA 3MR0A 4GNUA 3UB6A 4Y0TA 4N1XA 1CF0A 5EUAA 1IELA 1MWRA 2V0UA 3HLWA 4UHUA 4N1HA 2BTFP 5TBMB 1ZKJA 3VOLA 4WBGA 1DJAA 1MBLA 3LIFA 2P9VB 3MQ0A 3ZHHA 2O9AA 2KX6A 3A3JA 1VHMA 3H7WA 1HVBA 5GHYA 3UPOA 4OPZA 5L07A 4WYYA 4GDBA 1DP6A 3A0RA 5GLCA 3SH8A 5F1GA 1P0ZA 5DJTA 3UY6A 1C3BA 1LT0A 3UE0A 2QJ5A 4CJNA 2D01A 1XX2A 3N8SA 4S2JA 3ULFA 3IHBA 3NDEA 2OV5A 1H8YA 4HH3A 3DWZA 3UE3A 1E4DA 4FCFA 1RGYA 3BM6A 2G2UA 5HX9A 3FG8A 1S6RA 3NOTC 3M2JA 5FQMA 2FZ0A 2RL3A 1T1AA 3WS5A 1DY6A 5HL6A 4GCZA 5F82A 4G3KA 3T1QB 3DTKA 3P7NA 5FL3A 5CECA 3PBNA 3IXGA 3VMAA 1GHPA 2X71A 1YLYA 4B93A 4E3NA 1DP9A 5DJUA 4ID4A 4D60A 1S67L 1S4RA 3T4LA 3CPTB 1LI9A 4E3OA 3LI8A 3TW8A 3F1PA 1SDEA 1EW0A 2EFXA 3M6HA 2P04A 3WRTA 1K0KA 2XROA 2B18A 1RCJA 4P6ZS 1OMEA 3NC8A 3VP1A 5HD3A 4BD1A 3EOIA 1IYQA 1GA0A 3MKFA 3VOZA 4S2PA 3RJUA 3A3DA 4HQAA 4DE1A 4OQ0A 5CHUA 2W27A 3BFFA 1VB6A 4ZDXA 4I39A 3BECA 5F68A 1DP8A 1XJ4A 5EVIC 3O88A 1E3UD 4JF4A 3QP4A 2V8CA 1JNUA 5TJJA 1HLUP 4Y7PA 4IEDA 4OOLA 3BFCA 2VJWA 4UA7A 2P9VA 1K54C 1ZG6A 5L10A 4FH2A 3GV9A 4CLCB 1YKDA 1YPRA 3KSGA 1E3UA 5DF7A 3UE6A 3IT9A 3F1OB 4EWFA 2XDMA 1YSQA 2WKEA 5AVEA 1NY0A 1PRQA 3KX0X 3WS2A 1PWDA 5FQJA 4OLDA 5MC7A 4ETZA 3TRCA 1N4OA 3E4QA 3IX3A 4JXWA 3UPNA 5FQ9A 2M7UA 2XSSA 3UMEA 1UGUA 3LEZA 4LV3A 4P85A 5KZHA 4E6XA 1XFQA 4GHIB 4QB8A 4RX3A 3UDFA 3IBRA 5FEGA 2EXAA 2Y2NA 5CHMA 4X56A 4S2KA 4MBKA 4UA9A 3QP5A 5DF8A 1G5UA 3BEBA 5CGXA 1VETA 4G3WA 4II7A 1IFQA 4H6JA 4IBRA 2HF6A 3H82B 1S1YA 5FATA 3CUEC 4BL2A 2J80A 5I5LA 3T1XA 5E2HA 5D3OA 5FAOA 3R7WA 3ZGAB 4N9KA 1VQQA 4KZ5A 2ZM0A 1WYCA 3UB9A 4OQHA 3C38A 4GB7A 1I2WA 5HDSA 5G4YA 1ESUA 5EVID 4Q0JA 4JGRA 1OTAA 3Q7ZA 4E6WA 4P0MA 5J3WA 3T4SA 1K6SA 1CEFA 3VP3A 4ZJ2A 2P7JA 3RH8B 1TDLA 3OLOA 3UN7A 1XPBA 3IS2B 2PU2A 2Y79A 4KZAA 1JWZA 3ITBA 4KZBA 4KZ6A 3IBJA 3DTIA 5TR7A 3BYDA 5DVAA 2EWWA 1S4SA 1H0MA 3G4PA 3PHYA 4N9LA 3ZDJA 5FASA 3RFBA 4JGOA 3HLBA 4KZ9A 3ZG9B 1PI4A 3MFXA 4R38A 3WS1A 4LLOB 1BLSA 1KOUA 4HY8A 3G35A 3FZCA 4KQDA 4IHQA 4GJ4A 5HPIA 4R4SA 4LFUA 1NJ4A 2HZ5A 3IF6C 5GHZA 2W1RA 1LSVA 5AQ9A 4FTXA 3LIAA 3ZG7B 2LB9A 5DKLA 1PW1A 1H5XA 1BTLA 5DFXA 1W63Q 2JHEA 2ZQ8A 3C2WA 3N8LA 3G30A 1TEMA 1KDWA 3PTEA 2VV8A 5CERA 1L0DA 3BW6A 2WGVA 1XXMA 4PM6A 2WAEA 1MWTA 1ES5A 2A49A 1FSWA 1K54A 1N9BA 4RQ9A 4R3BA 2KLIA 2P74A 4ARZA 3UMDA 2VKSA 1M40A 3W4PA 2V8FA 5F6AA 4OQIA 3UB5P 1K55A 1WA9A 1SZVA 4Q8IA 3IXHA 2Z6DA 2PR6A 2Y91A 2ZQ7A 2JKGA 5L2FA 1LSWA 4R0QA 3QP1A 1NYYA 2R78A 4HNBA 1NRJA 1OTBA 2HJEA 1F9IA 5HDDA 2H0YA 2R9XA 1JWPA 4Y0OA 1XA1A 3T4KA 4KZ3A 1ODVA 2B02A 3T4QA 1LLBA 4K91A 2C5WB 5EVIA 5HDCA 5AJGA 2D02A 4Z1WA 3LUQA 3K2NA 2PYPA 2ZC3B 4XUXA 1ERQA 2L0WA 2VEAA 1KE4A 3RTYA 3UE1A 4MDZA 1ZTUA 2VV7A 1T1BA 4I5SA 2OSUA 3M6BA 3MKEA 3IF5A 1N9NA 4NETA 2WK0A 1K38A 3R7WB 4MN6A 2HDUA 3PAGA 4Y0UA 1BLCA 2JBFA 3NY4A 4MBFA 4GS9A 4LV1A 4JF6A 1GSWA 1P9WA 3CITA 2EFUA 3BQ8A 3O86A 4JPMA 4GHIA 3S7PA 4IVKA 4FSFA 1UWNX 1NXYA 1S66L 3V3RA 3HREA 1NWZA 3ITAA 4WL9A 1L0EA 3NDGA 3D4FA 4XUZA 5HW3A 2W3GA 3PBOA 3S1YA 1KGGA 3HUOA 4S2MA 1G28A 5HSQA 3E4PA 2BG1A 4LRYC 3A3FA 1UWPX 3A0VA 1ZC2A 3WS4A 2J3TD 5EOOA 3C8CA 2INWA 5DTSA 2QJ7A 5EVIB 5IU1A 4RA7A 2IA2A 4KQQA 3D9YA 2XK1A 3KYQA 1W79A 3H82A 1X0OA 4QD4A 3C4PA 5CTNA 4BD0A 3G6OA 4YNRA 4CLCC 2V2FF 3ZCZA 1F2KA 1SCWA 3EQVA 1WYBA 3KSHA 3UDXA 4F3LB 1H8MA 3AGDA 5FQIA 3WRZA 1Y28A 2Y4AA 4P6ZM 1NYMA 2R9WA 4H8RA 2K2NA 4HJ3A 3VP4A 1S0WA 1J3WA 4X1MA 1W8QA 1KVMA 5EVEA 2W3DA 4O7DA 1N9OA 3NHQA 5U47A 2W0NA 2JKRI 3S7QA 2Y2HA 1IOUA 1Z09A 4M3KA 2WKIA 1EI5A 2QZ6A 4LGWA 3HLCA 4DDSA 3IF6B 1SDNA 2OLVA 4I3AA 4GD8A 3BFDA 4PAUA 2A24A 4XT2B 4BMWA 2UWXA 3H7WB 3GTCA 4OLGA 1Q2QA 1K57C 3B47A 2AVXA 2W1TA 2ZJ9A 5KIZA 2OAQ1 1TF1A 1K25A 4KZ4A 1PWCA 4EETB 4KG6A 2Y2QA 3MFDA 5G18A 1V9ZA 1FSYA 3N8RA 1OT9A 3S7OA 3CG5A 3IH9A 3OPHA 5I94A 3FC7A 1I5QA 2G7UA 3VE3A 4OKPA 4E3IA 5L09A 1EWZA 4BBUA 1K4EA 1DJBA 2V9AA 1TS7A 2DMWA 4WZ5C 2EX9A 3KO6A 3CUEA 2IWCA 2ZQCA 3EGDC 4UEYA 3M2KA 4HIAA 3G34A
chains in the Genus database with same CATH topology
3PBQA 2Z6CA 3JVVA 3UB9A 4AFIA 3R4KA 3LICA 3C38A 5HPFA 3UB7A 4EU0A 5HDSA 5G4YA 3C30A 4LRXC 2V1BA 4Q0JA 4E04A 4JGRA 4O0PA 1OTAA 4I3IA 3K3CA 3EWKA 2YKFA 4ARZB 1LL8A 2GZAA 4XT2A 5J3WA 2PDRA 3PXPA 3T4SA 4BBTA 3CLOA 5C5KA 1GSXA 2JKTM 2P7JA 4L0LA 4MCWA 1TS0A 3U2AA 3RH8B 3T4JA 4BJPA 3OLOA 3IS2B 4IJGA 2Y79A 1MKMA 1BYWA 4DN0A 4UQIS 2W3FA 3PYPA 4MN7A 3BWLA 3D3OA 3IBJA 4L9GA 1STZA 3KSIA 2KOIA 3MQOA 2EWWA 1S4SA 3LI9A 4KQOA 5KSHA 3PHYA 4ME4A 4O8GA 3SW1A 3RFBA 2PD8A 2ZMVA 4JGOA 2VV6A 4LPZA 3MFXA 3BY8A 4R38A 4NXGA 3MQQA 1P9RA 1TD5A 2PHYA 4LLOB 3LYXA 1KOUA 4HY8A 4ZRRA 4KQDA 4IHQA 2VLGA 4GJ4A 5HPIA 3EGXC 4NXFA 3LR3A 1F98A 4BBVA 1DRMA 4LRZE 4GW9A 4FOFA 1F5MA 3E4OA 3CWFA 1OJGA 3B33A 3CAXA 3T4OA 4Q0HA 2W1RA 1T1CA 1LSVA 5HWWA 3LIAA 2LB9A 5DKLA 1T19A 4Q0IA 3H9WA 3BQAA 4R70A 4WF0A 1YSPA 2ZOIA 5F69A 2CMNA 4EUVA 1T18A 4WEJA 4HJ4A 5DFYA 5LBRA 5DFXA 1W63Q 2JHEA 4EXOA 4CQHA 1TS8A 1N9LA 3C2WA 4R3AA 1D7EA 4MMNA 2KDKA 3HCYA 2VV8A 4B9OA 3P01A 1OT6A 2HJ9C 3BW6A 2HGVA 2FH5A 1GSVA 1OPXA 3E98A 3DBAA 4QPRA 4PKYA 4DJ2A 2PYRA 1XJ3A 2BASA 2QHKA 2ZOHA 2VA0A 2OWHA 1MZUA 5IS1A 4Y3IA 3PR6A 2O0YA 3W2ZA 3FPVA 4RQ9A 2KLIA 2A2LA 2NUPC 4ARZA 3NOUC 3UMDA 2VKSA 4G3VA 2OWJA 2WKQA 3EEHA 5F6AA 3MMHA 1WA9A 3B42A 3CI6A 3NOPC 3TE8A 2VGLS 2W1TB 3HJIA 3LR5A 2L4RA 2QKPA 2Z6DA 4EESA 2PR6A 1OTEA 5K5BA 3PBTA 2GNXA 1LSWA 4WN5A 3ICYA 2GX5A 3PBSA 2R78A 2QYBA 1TS6A 4HNBA 2YKHA 4HJ6A 1NRJA 4JGPA 2PR5A 3F1OA 4YWZA 2EWVA 3KSFA 1OTBA 2HJEA 4I3JA 1F9IA 5HDDA 3GDIA 3MR0A 3VE4A 4UQIM 1NLYA 3UB6A 3LIBA 2H28A 3T4KA 1ODVA 1OTDA 2V0UA 2B02A 3T4QA 1OTIA 4GS9B 3BJNA 5J4EA 2P08A 5HDCA 2ZBBA 5AJGA 1XFNA 2D02A 2M1CA 3LUQA 4Z1WA 3K2NA 5TBMB 2PYPA 3ZQ5A 3VOLA 2LB5A 2L0WA 2VEAA 3LIFA 3MQ0A 1P97A 2PT7A 3RTYA 3BY9A 2O9AA 4MDZA 1ZTUA 2VV7A 1T1BA 2KX6A 4I5SA 1VHMA 3H7WA 2M7VA 4PKYG 4HI4A 5IT5A 1N9NA 3KYZA 4Y2FA 4HP9A 3F1NB 2O9BA 3R7WB 4MN6A 1DP6A 2A24B 3A0RA 1P0ZA 4HHDA 5DJTA 2V0WA 4JGQA 3MJQA 3F1PB 3V67A 1XJ6A 3O5YA 5G4ZA 3EQUA 1LT0A 4GS9A 2QJ5A 2D01A 3T50A 3ULFA 1GSWA 4KUKA 3LIDA 5TBMA 1P9WA 3CITA 2Y8HA 2PD7A 3BQ8A 2O9CA 5HZHA 4HH3A 4F3LA 3UE3A 3OBFA 3E0YA 3ZYTA 4R6LA 2W3HA 4GHIA 3S7PA 4WEKA 4FSFA 1UWNX 2MJ6A 3FG8A 1S66L 5HD5A 3NOTC 3OC2A 2K7SA 1LSXA 1NWZA 2ZMFA 5L8MA 2FZ0A 4WL9A 4H6JB 1T1AA 2GJ3A 4WELA 2V1AA 5HL6A 4EEPA 3MXQA 5DF9A 4GCZA 4HOIA 3IS2A 2W3GA 3PBOA 2WKRA 4G3KA 1G28A 4WLAA 3E4PA 3P7NA 5HSQA 5FL3A 2QWSA 4LRYC 4NEED 4L9FA 3S7NA 1UWPX 3PBNA 4NXBA 3A0VA 4CLCA 4PHTA 2XA7S 3TJZC 2J3TD 3C8CA 4B93A 1DP9A 5DJUA 4WUJA 2K31A 1S67L 5EFWA 1S4RA 3LFVA 3T4LA 2INWA 4HH2A 3F1NA 2JN7A 2QJ7A 5IU1A 3LI8A 2J3TC 3TW8A 2VZWA 2IA2A 3EEAA 4CLCD 3MF0A 4IUHA 2VX8A 3KYQA 4EEUA 3F1PA 3H82A 1G6OA 1EW0A 3A0SA 1X0OA 2P04A 2J3WA 3FPWA 1W63M 1ZHHB 2XROA 3G6OA 4YNRA 3NJAA 2B18A 4CLCC 2OOLA 4P6ZS 3EQVA 5HD3A 3HJKA 3KSHA 3EOIA 1OJ5A 5CX7A 4F3LB 1H8MA 3OCLA 1Y28A 2VGLM 4P6ZM 4HQAA 2O99A 2K2NA 4HJ3A 2W27A 5A8BA 4BWIA 1VB6A 4I39A 3LR0A 4CLCE 2W3DA 4L9EA 2NUTC 1N9OA 5F68A 3NHQA 3OCNA 1DP8A 4KUOA 1XJ4A 4HP4A 2W0NA 2JKRI 3S7QA 1IOUA 5HWVA 2W3EA 1JNUA 5TJJA 3VV4A 3D72A 4I3AA 1S1ZA 4OOLA 2VJWA 3GECA 4OOMA 4CLCB 4Y5FA 4PAUA 5AVFA 2A24A 1YKDA 4XT2B 3KSGA 1XJ2A 4BMWA 4EERA 4EQ1A 3UE6A 2JKRM 3H7WB 3F1OB 1YSQA 4M4XA 3B47A 5AVEA 3KX0X 3PBRA 2W1TA 5KIZA 4DJ3A 2OAQ1 4ETXA 5MC7A 4ETZA 1TF1A 4YOFA 3TRCA 3T4TA 3E4QA 5HWTA 2M7UA 1V9YA 2XSSA 3UMEA 4EETB 1UGUA 4DMZA 4K08A 2L1MA 4IUKA 1V9ZA 1XFQA 3LR4A 4GHIB 4NKPA 1OT9A 2I9VA 3K3DA 3IBRA 3JVUA 3S7OA 4I38A 3FC7A 1MC0A 5J7EA 2G7UA 3VE3A 2HV1A 4GLQA 2OAP1 2XA7M 5F5YA 1YAXA 4G3WA 1NLZA 3LIEA 4BBUA 4II7A 1IFQA 4H6JA 2HF6A 4MN5A 3OOVA 2XRNA 2V9AA 3H82B 1S1YA 3CUEC 1TS7A 2J80A 5I5LA 2DMWA 1H3QA 4O01A 3R7WA 2JKTI 3UB8A 3KO6A 3CUEA 1D06A 3EGDC 4UEYA 5DKKA 2WKPA 4NXEA 4HIAA 2EA9A 4EW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HGV A;  2O9B A;  3R4K A;  3E98 A;  5HPF A;  4EU0 A;  3DBA A;  4QPR A;  2O99 A;  4LRX C;  2K2N A;  3O5Y A;  4Q0J A;  4E04 A;  4O0P A;  4BWI A;  3CIT A;  2W3D A;  2Y8H A;  4Y3I A;  2O0Y A;  5C5K A;  3NHQ A;  3W2Z A;  4MCW A;  2O9C A;  4RQ9 A;  3OBF A;  2KLI A;  3E0Y A;  3S7Q A;  4R6L A;  2W3E A;  2W3H A;  4IJG A;  2Y79 A;  1MKM A;  3S7P A;  3NOU C;  5TJJ A;  4DN0 A;  2VKS A;  4G3V A;  3VV4 A;  2W3F A;  4MN7 A;  3D3O A;  3IBJ A;  3MMH A;  3NOT C;  2VJW A;  3NOP C;  3CI6 A;  1STZ A;  2W1T B;  3KSI A;  4Y5F A;  2KOI A;  4PAU A;  1YKD A;  3KSG A;  2ZMF A;  5K5B A;  5L8M A;  4ME4 A;  4O8G A;  5HL6 A;  1YSQ A;  3RFB A;  2GX5 A;  2W1T A;  2QYB A;  4ETX A;  4ETZ A;  1TF1 A;  2W3G A;  4YOF A;  3TRC A;  1TD5 A;  2M7U A;  4G3K A;  2XSS A;  4ZRR A;  5HSQ A;  3KSF A;  4DMZ A;  5HPI A;  4LRY C;  4IUK A;  3S7N A;  4LRZ E;  4GW9 A;  4FOF A;  1F5M A;  3IBR A;  3S7O A;  1MC0 A;  2G7U A;  2K31 A;  3LFV A;  4Q0H A;  2W1R A;  4GLQ A;  3BJN A;  4G3W A;  5AJG A;  2LB9 A;  2VZW A;  2IA2 A;  4Z1W A;  4Q0I A;  3EEA A;  3K2N A;  4R70 A;  1YSP A;  3MF0 A;  3ZQ5 A;  4IUH A;  2LB5 A;  2XRN A;  3OOV A;  2VEA A;  4EUV A;  5DFY A;  3MQ0 A;  5I5L A;  5LBR A;  5DFX A;  2O9A A;  4MDZ A;  1ZTU A;  4O01 A;  4CQH A;  3C2W A;  2XRO A;  1VHM A;  3G6O A;  3KO6 A;  4YNR A;  2B18 A;  4MMN A;  2OOL A;  2M7V A;  3HCY A;  4Y2F A;  3KSH A; 
#chains in the Genus database with same CATH topology
 2Z6C A;  3SS4 A;  5FA7 A;  4R3J A;  3UB7 A;  4KZ8 A;  4Y13 A;  3T1R A;  1YLZ A;  4LRX C;  3BLS A;  4I3I A;  1BLH A;  4XT2 A;  2PDR A;  5EVL A;  4BBT A;  5M19 A;  2ZC4 B;  5C5K A;  1GSX A;  2JKT M;  1TS0 A;  2I72 A;  2ZMA A;  2GDN A;  4E3J A;  1PNE A;  4KZ7 A;  5FQK A;  3MZF A;  2RCX A;  1FIL A;  3D3O A;  2Y2G A;  1STZ A;  2KOI A;  3SS5 A;  2Z2M B;  4ME4 A;  2JE5 A;  1HTZ A;  1BUL A;  2VV6 A;  3IWI A;  4LPZ A;  4JXV A;  3BY8 A;  2UV0 E;  1P9R A;  1TD5 A;  2BLS A;  2WYX A;  1LL9 A;  4ZRR A;  3RXX A;  4PMA A;  5FAP A;  3EGX C;  4EUZ A;  3L7H A;  4GW9 A;  2ZQ9 A;  4FOF A;  1F5M A;  1I2S A;  3V3S A;  1OJG A;  1Q2P A;  3T4O A;  3CAX A;  1T1C A;  4GZB A;  1ESI A;  4FUW A;  3H9W A;  1YSP A;  2CMN A;  2E8J A;  5F83 A;  4BL3 A;  4CQH A;  2ZLY A;  5F1F A;  5M18 A;  4R3A A;  5JYP A;  4QU3 A;  4N92 A;  3HVF A;  3OPL A;  3LY3 A;  2PRF A;  4DXB A;  2FH5 A;  1L0G A;  3ZNY A;  1TDG A;  2WGW A;  3C7V A;  4QY6 A;  4X1L A;  5EE8 A;  2PYR A;  3VOY A;  1XJ3 A;  1IYS A;  2QHK A;  2WAF A;  4R23 A;  1SKO B;  1TVF A;  5FDS A;  2VA0 A;  3C4O A;  5E43 A;  1MKI A;  4Y3I A;  2O0Y A;  1YLJ A;  2XGN A;  2JC7 A;  2A2L A;  2ZL1 A;  1ERO A;  4U0T A;  2NUP C;  3NOU C;  3S22 A;  4G3V A;  2WKQ A;  1Z6F A;  4B88 A;  3OZH A;  3E2L A;  3B42 A;  2VGL S;  2W1T B;  3HJI A;  3T12 B;  4EES A;  1YLP A;  3W4O A;  5HAR A;  3ZVT A;  2XFS A;  2QPN A;  3PBS A;  3SZT A;  2EX6 A;  1ALQ A;  4GD6 A;  4HJ6 A;  4QY5 A;  2H0T A;  4JGP A;  3RXW A;  3SOI A;  2VGJ A;  2EWV A;  2VGK A;  4I3J A;  3CPT A;  4JF5 A;  2Y2L A;  3VE4 A;  1NLY A;  3LIB A;  2PBY A;  1OTD A;  5FI6 A;  1OTI A;  5GLB A;  3BJN A;  5J4E A;  2XLN A;  2ZBB A;  4B4Z A;  1FIK A;  2M1C A;  1L3L A;  1KGF A;  1P97 A;  3FYZ A;  3G2Y A;  3BY9 A;  2Y59 A;  3BFE A;  3GR2 A;  1KVL A;  3A3I A;  4P6B A;  4PKY G;  3FV7 A;  3KYZ A;  4HP9 A;  3F1N B;  2O9B A;  5CGW A;  2A24 B;  1LHY A;  4HHD A;  2V0W A;  3IHA A;  3TSG A;  3V67 A;  2ZQD A;  1XJ6 A;  4LEN A;  5G4Z A;  3Q81 A;  3N4I A;  2WZZ A;  3A3E A;  2QMI A;  3LID A;  5TBM A;  1PI5 A;  2Y8H A;  5HZH A;  3E0Y A;  5FI2 A;  4R6L A;  3ZYT A;  2IWD A;  3G31 A;  3DTE A;  4OPQ A;  4LV2 A;  1DJC A;  2B95 A;  5AQ7 A;  4EBN A;  4PM7 A;  3I7J A;  1LI0 A;  3OC2 A;  4DRT A;  1KE0 A;  2K7S A;  1PYY A;  4C3Q A;  4H6J B;  2DNS A;  2GJ3 A;  4Y17 A;  1HZO A;  3MXQ A;  3MBZ A;  5DF9 A;  5FSR A;  2G2W A;  4GDN A;  1LL5 A;  2WKR A;  4EBP A;  4LCM A;  2PAV P;  4K0W A;  3S4X A;  4WLA A;  5FI7 A;  3NI9 A;  2X02 A;  4L9F A;  2EX2 A;  3W4Q A;  4PHT A;  2XA7 S;  4S2I A;  3TJZ C;  1IKI A;  4P87 A;  4WZ5 A;  3NEC A;  2VK3 A;  1PW8 A;  3N6I A;  3LEQ A;  4ZBE A;  3ZVW A;  4WUJ A;  3LCE A;  5EFW A;  1PZP A;  3LFV A;  4D2O A;  2ZQA A;  3UPP A;  5HAQ A;  2VZW A;  3MF0 A;  4C75 A;  2VX8 A;  3UDI A;  3HLD A;  1GHI A;  3HUN A;  2HP9 A;  1MPL A;  1ZHH B;  1BUE A;  3NJA A;  1FCO A;  3HJK A;  5CX7 A;  1OJ5 A;  3OCL A;  2VGL M;  3CMZ A;  1AWI A;  5FAQ A;  2O99 A;  5FQQ A;  1YLT A;  1MWU A;  4FD8 A;  5A8B A;  3LR0 A;  2NUT C;  3OCN A;  4KUO A;  4X53 A;  5CED A;  3LGO A;  1ZG4 A;  2W3E A;  4OP5 A;  2HDQ A;  2XQZ A;  3C5A A;  3VV4 A;  5CTM A;  1ONH A;  1K57 A;  1S1Z A;  2FFF B;  3V39 A;  2ZM8 A;  4Y5F A;  2DCF A;  5AVF A;  1XJ2 A;  4EQ1 A;  2JKR M;  1FCM A;  2A3U A;  2PBD P;  4M4X A;  1ERM A;  1YLW A;  2E8I A;  5HFO A;  4DF6 A;  4ETX A;  3FKW A;  4YOF A;  1V9Y A;  3QP6 A;  5DTT A;  3PAE A;  1JTD A;  4ZAM A;  4DMZ A;  5AQB A;  2L1M A;  1VM1 A;  5AQA A;  4OP8 A;  4YFM A;  3C7U A;  4NKP A;  3K3D A;  3JVU A;  3Q82 A;  4I38 A;  1L0F A;  2HV1 A;  2OAP 1;  2XEP A;  1YAX A;  3QP2 A;  1NLZ A;  3LIE A;  5A93 A;  1FR6 A;  4MN5 A;  2XRN A;  3OOV A;  3HLG A;  2ACG A;  1ACF A;  1H3Q A;  2Q9M A;  1VEU A;  5CRF A;  5DKK A;  2WKP A;  4S2O A;  3QHY A;  5GLA A;  4E3K A;  1JTG A;  4R4R A;  2EA9 A;  3AGF A;  4OH0 A;  1BT5 A;  3R4K A;  3LIC A;  4EU0 A;  3IQA A;  1H8Z A;  3P98 A;  3C30 A;  3SS3 A;  4E04 A;  4O0P A;  3K3C A;  3LY4 A;  3ZNT A;  4ARZ B;  3HUM A;  5HAP A;  3DTM A;  4B4X A;  4BJP A;  1A0K A;  1PIO A;  3Q1F A;  5HL1 A;  4PPR A;  4IJG A;  4JBF A;  3SH9 A;  4DN0 A;  1NZO A;  3E2K A;  2Y2M A;  4MN7 A;  3UO9 A;  4BQM A;  3BWL A;  4L9G A;  4X55 A;  5GLD A;  1Y4O A;  3KSI A;  3NCK A;  3FKV A;  3WS0 A;  5KSH A;  4IVI A;  4O8G A;  2PD8 A;  2ZMV A;  4FH4 A;  4ESP A;  1JWV A;  1M6K A;  4NXG A;  3MQQ A;  3LYX A;  4ZJ3 A;  2VLG A;  4CPK A;  3LR3 A;  1F98 A;  4F94 A;  4BBV A;  1DRM A;  1SKF A;  4LRZ E;  4X68 A;  5KSC A;  4U3T A;  1QME A;  2B5R A;  3MXR A;  4X6T A;  4QHC A;  4UAA A;  5HWW A;  4QJG A;  3Q7V A;  2H5S A;  1CJF A;  3W8K A;  5A90 A;  1XP4 A;  5GL9 A;  4EUV A;  4WEJ A;  4HJ4 A;  5LBR A;  1XA7 A;  1TS8 A;  1N9L A;  1NZU A;  4WMC D;  1D7E A;  4MMN A;  1FCN A;  1E25 A;  2KDK A;  3HCY A;  3P01 A;  2HJ9 C;  4ZTK A;  2HGV A;  1D1J A;  1GSV A;  4HES A;  3E98 A;  3DBA A;  5E2G A;  4QPR A;  5EPH A;  5TFQ A;  4PKY A;  2H10 A;  2BAS A;  2X01 A;  4PM5 A;  2OWH A;  4K0X A;  5IS1 A;  2HP5 A;  2XF3 A;  1G68 A;  2IWB A;  3N7W A;  3GRJ A;  3MSH A;  2OWJ A;  4DE2 A;  3EEH A;  3OPR A;  1YQS A;  3MMH A;  3NOP C;  3TE8 A;  4EBL A;  3LR5 A;  5M1A A;  2L4R A;  2QKP A;  1OTE A;  3PBT A;  3BFG A;  1YMS A;  2V20 A;  3ICY A;  3VSK A;  2GX5 A;  4DE3 A;  3U4L P;  2Y2J A;  1TS6 A;  2PR5 A;  4U0X A;  1BLP A;  4OOY A;  2HDS A;  1IKG A;  3KSF A;  3WWX A;  4UQI M;  3QP8 A;  1FR1 A;  3FWL A;  4NG2 A;  2H28 A;  2EXB A;  2J9O A;  4X25 A;  1W7F A;  3IXD A;  4GS9 B;  4S2L A;  1U60 A;  3GSG A;  2P08 A;  1XFN A;  3SH7 A;  4E3L A;  1BSG A;  2HPB A;  3ZQ5 A;  2LB5 A;  2WGW B;  4RVA A;  1IYP A;  1PFL A;  2PT7 A;  4Z9Q A;  1WE4 A;  3IX4 A;  2DRW A;  2M7V A;  4HI4 A;  5IT5 A;  4Y2F A;  1PZO A;  1AXB A;  2EX8 A;  2XD1 A;  5KMW A;  3DWK A;  3AGE A;  5JYO A;  4JGQ A;  5GHX A;  3MJQ A;  2J8Y A;  3F1P B;  2PU4 A;  3O5Y A;  3EQU A;  3HL9 A;  5FEF A;  1BZA A;  3T50 A;  2Y55 A;  4KUK A;  1SHV A;  3MS6 A;  2PD7 A;  3TOI A;  2O9C A;  1VET B;  4BLM A;  4F3L A;  4JXG A;  3OBF A;  2OLU A;  2W3H A;  4WEK A;  1KGE A;  2MJ6 A;  4IBX A;  2JKF A;  1QMF A;  3G2Z A;  4DXC A;  2ZD8 A;  3JPU A;  5HD5 A;  3ZG5 A;  3GMW A;  3QNB A;  3MZE A;  1LSX A;  2ZMF A;  5L8M A;  4WEL A;  2V1A A;  4EEP A;  1YT4 A;  5FDH A;  5A91 A;  5CHJ A;  4OON A;  4MEZ A;  1ES2 A;  4HOI A;  3IS2 A;  1MWS A;  3O87 A;  4WMC A;  1CQA A;  2WUQ A;  3TG9 A;  2QWS A;  4NEE D;  3S7N A;  4KEN B;  4NXB A;  4CLC A;  4E3M A;  3MZD A;  2ZM2 A;  3HBR A;  2XFT A;  3QNC A;  4WM9 A;  5EM0 A;  4BEN A;  2K31 A;  4KG2 A;  1K56 D;  2JCH A;  2FFY A;  1RGZ A;  4HH2 A;  3F1N A;  2JN7 A;  2J3T C;  4OPR A;  1GHM A;  3IXB A;  2ZC5 B;  3EEA A;  4CLC D;  2WAD A;  2XH9 A;  1L2S A;  3NIA A;  4IUH A;  4EEU A;  1W8Y A;  1G6O A;  3DAV A;  3A0S A;  4S2N C;  5EEC A;  2J3W A;  2C6W B;  3FPW A;  3LO7 A;  4QWO A;  1W63 M;  3ISG A;  4JXS A;  2OOL A;  2Y2K A;  4R1G A;  3VFH A;  2ZC7 A;  4PM9 A;  3VP2 A;  4HEF A;  2Y2I A;  3KYE A;  4Y15 A;  1YM1 A;  4PM8 A;  4YIN A;  4BWI A;  4GN2 A;  1K56 A;  2V1Z A;  1CI8 A;  4CLC E;  4L9E A;  5IHV A;  4KG5 A;  3BLM A;  4HP4 A;  3HLE A;  2J7V A;  3IWQ A;  5HWV A;  4OPY A;  2Y2O A;  4GKU A;  4DE0 A;  3D72 A;  1IYO A;  3GEC A;  4OOM A;  4WZ4 A;  4DKI A;  4EER A;  2WZX A;  4EV4 A;  2Q0O A;  3V50 A;  3PBR A;  1O7E A;  4DJ3 A;  3G32 A;  1VEU B;  3T4T A;  3GVB A;  3P09 A;  4JKT A;  5E2F A;  5HWT A;  4K08 A;  4IUK A;  4OVD A;  3LR4 A;  2I9V A;  1MC0 A;  3CJM A;  3GQZ A;  5J7E A;  4UA6 A;  5EOE A;  4GLQ A;  3VFF A;  1RP5 A;  4C6Y A;  2XA7 M;  5F5Y A;  3Q7V B;  4XXR A;  1J9M A;  3NUL A;  4O01 A;  2HDR A;  2JKT I;  3UB8 A;  1D06 A;  1K6R A;  2Y2P A;  4NXE A;  4EQI A;  4EW7 A;  3PBQ A;  4GOG A;  3JVV A;  4AFI A;  1XGI A;  5HPF A;  2V1B A;  4JLF A;  3EWK A;  2YKF A;  1LL8 A;  2GZA A;  3CHW P;  3PXP A;  1Y54 A;  3CLO A;  2HP6 A;  4L0L A;  4MCW A;  3U2A A;  3T4J A;  2XD5 A;  2CC1 A;  2Z2L B;  1MKM A;  1BYW A;  4UQI S;  1CEG A;  2W3F A;  3PYP A;  3L9K A;  3IF6 A;  5J8X A;  4LCL A;  1PWG A;  1G6A A;  3MQO A;  4HBT A;  1ES3 A;  3LI9 A;  4KQO A;  1CI9 A;  3VSL A;  5CEB A;  3SW1 A;  3JYI A;  3OPP A;  3MXS A;  2PHY A;  5E2E A;  1YMX A;  1GA9 A;  4LV0 A;  4NXF A;  1O07 A;  1FQG A;  5EM1 A;  1K55 C;  3E4O A;  4S2N A;  1GCE A;  3CWF A;  4RX2 A;  2WKH A;  3B33 A;  4HBU A;  1KE3 A;  1KDS A;  4Q0H A;  5DTK A;  1SKO A;  2XR0 A;  2Q9N A;  5EV0 A;  1T19 A;  4Q0I A;  3BQA A;  4R70 A;  4WF0 A;  1HD8 A;  2ZOI A;  5F69 A;  1NRF A;  1T18 A;  5DFY A;  2ZL1 B;  4EXO A;  1CK3 A;  1FOF A;  3UNW A;  3ZG8 B;  4B9O A;  1OT6 A;  3HLF A;  4RYE A;  3IWO A;  2J9P A;  4X69 A;  3DW0 A;  3B3X A;  1OPX A;  1W5D A;  1XGJ A;  3O3V A;  4MLL A;  5TGF A;  4DJ2 A;  1ONG A;  4MNR A;  2ZOH A;  5CGS A;  1MZU A;  2ZC6 B;  5CXW A;  3T1S A;  3PR6 A;  1MY8 A;  5BOH A;  3W2Z A;  5HAI A;  3FPV A;  1K4F A;  4KQR A;  4A5R A;  1JVJ A;  1XKZ A;  3BRM A;  4OQG A;  4MBH A;  1IEM A;  3VP0 A;  3IH8 A;  4NK3 A;  3CI6 A;  3Q07 A;  2WGI A;  3ZG0 A;  5A92 A;  1ES4 A;  5K5B A;  3V5M A;  2GNX A;  4DDY A;  3CZD A;  4WN5 A;  3IX8 A;  3NBL A;  3ZFZ A;  2QYB A;  2YKH A;  3F1O A;  4YWZ A;  1MXO A;  4ZJ1 A;  3GDI A;  3MR0 A;  4GNU A;  3UB6 A;  4Y0T A;  4N1X A;  1CF0 A;  5EUA A;  1IEL A;  1MWR A;  2V0U A;  3HLW A;  4UHU A;  4N1H A;  2BTF P;  5TBM B;  1ZKJ A;  3VOL A;  4WBG A;  1DJA A;  1MBL A;  3LIF A;  2P9V B;  3MQ0 A;  3ZHH A;  2O9A A;  2KX6 A;  3A3J A;  1VHM A;  3H7W A;  1HVB A;  5GHY A;  3UPO A;  4OPZ A;  5L07 A;  4WYY A;  4GDB A;  1DP6 A;  3A0R A;  5GLC A;  3SH8 A;  5F1G A;  1P0Z A;  5DJT A;  3UY6 A;  1C3B A;  1LT0 A;  3UE0 A;  2QJ5 A;  4CJN A;  2D01 A;  1XX2 A;  3N8S A;  4S2J A;  3ULF A;  3IHB A;  3NDE A;  2OV5 A;  1H8Y A;  4HH3 A;  3DWZ A;  3UE3 A;  1E4D A;  4FCF A;  1RGY A;  3BM6 A;  2G2U A;  5HX9 A;  3FG8 A;  1S6R A;  3NOT C;  3M2J A;  5FQM A;  2FZ0 A;  2RL3 A;  1T1A A;  3WS5 A;  1DY6 A;  5HL6 A;  4GCZ A;  5F82 A;  4G3K A;  3T1Q B;  3DTK A;  3P7N A;  5FL3 A;  5CEC A;  3PBN A;  3IXG A;  3VMA A;  1GHP A;  2X71 A;  1YLY A;  4B93 A;  4E3N A;  1DP9 A;  5DJU A;  4ID4 A;  4D60 A;  1S67 L;  1S4R A;  3T4L A;  3CPT B;  1LI9 A;  4E3O A;  3LI8 A;  3TW8 A;  3F1P A;  1SDE A;  1EW0 A;  2EFX A;  3M6H A;  2P04 A;  3WRT A;  1K0K A;  2XRO A;  2B18 A;  1RCJ A;  4P6Z S;  1OME A;  3NC8 A;  3VP1 A;  5HD3 A;  4BD1 A;  3EOI A;  1IYQ A;  1GA0 A;  3MKF A;  3VOZ A;  4S2P A;  3RJU A;  3A3D A;  4HQA A;  4DE1 A;  4OQ0 A;  5CHU A;  2W27 A;  3BFF A;  1VB6 A;  4ZDX A;  4I39 A;  3BEC A;  5F68 A;  1DP8 A;  1XJ4 A;  5EVI C;  3O88 A;  1E3U D;  4JF4 A;  3QP4 A;  2V8C A;  1JNU A;  5TJJ A;  1HLU P;  4Y7P A;  4IED A;  4OOL A;  3BFC A;  2VJW A;  4UA7 A;  2P9V A;  1K54 C;  1ZG6 A;  5L10 A;  4FH2 A;  3GV9 A;  4CLC B;  1YKD A;  1YPR A;  3KSG A;  1E3U A;  5DF7 A;  3UE6 A;  3IT9 A;  3F1O B;  4EWF A;  2XDM A;  1YSQ A;  2WKE A;  5AVE A;  1NY0 A;  1PRQ A;  3KX0 X;  3WS2 A;  1PWD A;  5FQJ A;  4OLD A;  5MC7 A;  4ETZ A;  3TRC A;  1N4O A;  3E4Q A;  3IX3 A;  4JXW A;  3UPN A;  5FQ9 A;  2M7U A;  2XSS A;  3UME A;  1UGU A;  3LEZ A;  4LV3 A;  4P85 A;  5KZH A;  4E6X A;  1XFQ A;  4GHI B;  4QB8 A;  4RX3 A;  3UDF A;  3IBR A;  5FEG A;  2EXA A;  2Y2N A;  5CHM A;  4X56 A;  4S2K A;  4MBK A;  4UA9 A;  3QP5 A;  5DF8 A;  1G5U A;  3BEB A;  5CGX A;  1VET A;  4G3W A;  4II7 A;  1IFQ A;  4H6J A;  4IBR A;  2HF6 A;  3H82 B;  1S1Y A;  5FAT A;  3CUE C;  4BL2 A;  2J80 A;  5I5L A;  3T1X A;  5E2H A;  5D3O A;  5FAO A;  3R7W A;  3ZGA B;  4N9K A;  1VQQ A;  4KZ5 A;  2ZM0 A;  1WYC A;  3UB9 A;  4OQH A;  3C38 A;  4GB7 A;  1I2W A;  5HDS A;  5G4Y A;  1ESU A;  5EVI D;  4Q0J A;  4JGR A;  1OTA A;  3Q7Z A;  4E6W A;  4P0M A;  5J3W A;  3T4S A;  1K6S A;  1CEF A;  3VP3 A;  4ZJ2 A;  2P7J A;  3RH8 B;  1TDL A;  3OLO A;  3UN7 A;  1XPB A;  3IS2 B;  2PU2 A;  2Y79 A;  4KZA A;  1JWZ A;  3ITB A;  4KZB A;  4KZ6 A;  3IBJ A;  3DTI A;  5TR7 A;  3BYD A;  5DVA A;  2EWW A;  1S4S A;  1H0M A;  3G4P A;  3PHY A;  4N9L A;  3ZDJ A;  5FAS A;  3RFB A;  4JGO A;  3HLB A;  4KZ9 A;  3ZG9 B;  1PI4 A;  3MFX A;  4R38 A;  3WS1 A;  4LLO B;  1BLS A;  1KOU A;  4HY8 A;  3G35 A;  3FZC A;  4KQD A;  4IHQ A;  4GJ4 A;  5HPI A;  4R4S A;  4LFU A;  1NJ4 A;  2HZ5 A;  3IF6 C;  5GHZ A;  2W1R A;  1LSV A;  5AQ9 A;  4FTX A;  3LIA A;  3ZG7 B;  2LB9 A;  5DKL A;  1PW1 A;  1H5X A;  1BTL A;  5DFX A;  1W63 Q;  2JHE A;  2ZQ8 A;  3C2W A;  3N8L A;  3G30 A;  1TEM A;  1KDW A;  3PTE A;  2VV8 A;  5CER A;  1L0D A;  3BW6 A;  2WGV A;  1XXM A;  4PM6 A;  2WAE A;  1MWT A;  1ES5 A;  2A49 A;  1FSW A;  1K54 A;  1N9B A;  4RQ9 A;  4R3B A;  2KLI A;  2P74 A;  4ARZ A;  3UMD A;  2VKS A;  1M40 A;  3W4P A;  2V8F A;  5F6A A;  4OQI A;  3UB5 P;  1K55 A;  1WA9 A;  1SZV A;  4Q8I A;  3IXH A;  2Z6D A;  2PR6 A;  2Y91 A;  2ZQ7 A;  2JKG A;  5L2F A;  1LSW A;  4R0Q A;  3QP1 A;  1NYY A;  2R78 A;  4HNB A;  1NRJ A;  1OTB A;  2HJE A;  1F9I A;  5HDD A;  2H0Y A;  2R9X A;  1JWP A;  4Y0O A;  1XA1 A;  3T4K A;  4KZ3 A;  1ODV A;  2B02 A;  3T4Q A;  1LLB A;  4K91 A;  2C5W B;  5EVI A;  5HDC A;  5AJG A;  2D02 A;  4Z1W A;  3LUQ A;  3K2N A;  2PYP A;  2ZC3 B;  4XUX A;  1ERQ A;  2L0W A;  2VEA A;  1KE4 A;  3RTY A;  3UE1 A;  4MDZ A;  1ZTU A;  2VV7 A;  1T1B A;  4I5S A;  2OSU A;  3M6B A;  3MKE A;  3IF5 A;  1N9N A;  4NET A;  2WK0 A;  1K38 A;  3R7W B;  4MN6 A;  2HDU A;  3PAG A;  4Y0U A;  1BLC A;  2JBF A;  3NY4 A;  4MBF A;  4GS9 A;  4LV1 A;  4JF6 A;  1GSW A;  1P9W A;  3CIT A;  2EFU A;  3BQ8 A;  3O86 A;  4JPM A;  4GHI A;  3S7P A;  4IVK A;  4FSF A;  1UWN X;  1NXY A;  1S66 L;  3V3R A;  3HRE A;  1NWZ A;  3ITA A;  4WL9 A;  1L0E A;  3NDG A;  3D4F A;  4XUZ A;  5HW3 A;  2W3G A;  3PBO A;  3S1Y A;  1KGG A;  3HUO A;  4S2M A;  1G28 A;  5HSQ A;  3E4P A;  2BG1 A;  4LRY C;  3A3F A;  1UWP X;  3A0V A;  1ZC2 A;  3WS4 A;  2J3T D;  5EOO A;  3C8C A;  2INW A;  5DTS A;  2QJ7 A;  5EVI B;  5IU1 A;  4RA7 A;  2IA2 A;  4KQQ A;  3D9Y A;  2XK1 A;  3KYQ A;  1W79 A;  3H82 A;  1X0O A;  4QD4 A;  3C4P A;  5CTN A;  4BD0 A;  3G6O A;  4YNR A;  4CLC C;  2V2F F;  3ZCZ A;  1F2K A;  1SCW A;  3EQV A;  1WYB A;  3KSH A;  3UDX A;  4F3L B;  1H8M A;  3AGD A;  5FQI A;  3WRZ A;  1Y28 A;  2Y4A A;  4P6Z M;  1NYM A;  2R9W A;  4H8R A;  2K2N A;  4HJ3 A;  3VP4 A;  1S0W A;  1J3W A;  4X1M A;  1W8Q A;  1KVM A;  5EVE A;  2W3D A;  4O7D A;  1N9O A;  3NHQ A;  5U47 A;  2W0N A;  2JKR I;  3S7Q A;  2Y2H A;  1IOU A;  1Z09 A;  4M3K A;  2WKI A;  1EI5 A;  2QZ6 A;  4LGW A;  3HLC A;  4DDS A;  3IF6 B;  1SDN A;  2OLV A;  4I3A A;  4GD8 A;  3BFD A;  4PAU A;  2A24 A;  4XT2 B;  4BMW A;  2UWX A;  3H7W B;  3GTC A;  4OLG A;  1Q2Q A;  1K57 C;  3B47 A;  2AVX A;  2W1T A;  2ZJ9 A;  5KIZ A;  2OAQ 1;  1TF1 A;  1K25 A;  4KZ4 A;  1PWC A;  4EET B;  4KG6 A;  2Y2Q A;  3MFD A;  5G18 A;  1V9Z A;  1FSY A;  3N8R A;  1OT9 A;  3S7O A;  3CG5 A;  3IH9 A;  3OPH A;  5I94 A;  3FC7 A;  1I5Q A;  2G7U A;  3VE3 A;  4OKP A;  4E3I A;  5L09 A;  1EWZ A;  4BBU A;  1K4E A;  1DJB A;  2V9A A;  1TS7 A;  2DMW A;  4WZ5 C;  2EX9 A;  3KO6 A;  3CUE A;  2IWC A;  2ZQC A;  3EGD C;  4UEY A;  3M2K A;  4HIA A;  3G34 A; 
#chains in the Genus database with same CATH homology
 3PBQ A;  2Z6C A;  3JVV A;  3UB9 A;  4AFI A;  3R4K A;  3LIC A;  3C38 A;  5HPF A;  3UB7 A;  4EU0 A;  5HDS A;  5G4Y A;  3C30 A;  4LRX C;  2V1B A;  4Q0J A;  4E04 A;  4JGR A;  4O0P A;  1OTA A;  4I3I A;  3K3C A;  3EWK A;  2YKF A;  4ARZ B;  1LL8 A;  2GZA A;  4XT2 A;  5J3W A;  2PDR A;  3PXP A;  3T4S A;  4BBT A;  3CLO A;  5C5K A;  1GSX A;  2JKT M;  2P7J A;  4L0L A;  4MCW A;  1TS0 A;  3U2A A;  3RH8 B;  3T4J A;  4BJP A;  3OLO A;  3IS2 B;  4IJG A;  2Y79 A;  1MKM A;  1BYW A;  4DN0 A;  4UQI S;  2W3F A;  3PYP A;  4MN7 A;  3BWL A;  3D3O A;  3IBJ A;  4L9G A;  1STZ A;  3KSI A;  2KOI A;  3MQO A;  2EWW A;  1S4S A;  3LI9 A;  4KQO A;  5KSH A;  3PHY A;  4ME4 A;  4O8G A;  3SW1 A;  3RFB A;  2PD8 A;  2ZMV A;  4JGO A;  2VV6 A;  4LPZ A;  3MFX A;  3BY8 A;  4R38 A;  4NXG A;  3MQQ A;  1P9R A;  1TD5 A;  2PHY A;  4LLO B;  3LYX A;  1KOU A;  4HY8 A;  4ZRR A;  4KQD A;  4IHQ A;  2VLG A;  4GJ4 A;  5HPI A;  3EGX C;  4NXF A;  3LR3 A;  1F98 A;  4BBV A;  1DRM A;  4LRZ E;  4GW9 A;  4FOF A;  1F5M A;  3E4O A;  3CWF A;  1OJG A;  3B33 A;  3CAX A;  3T4O A;  4Q0H A;  2W1R A;  1T1C A;  1LSV A;  5HWW A;  3LIA A;  2LB9 A;  5DKL A;  1T19 A;  4Q0I A;  3H9W A;  3BQA A;  4R70 A;  4WF0 A;  1YSP A;  2ZOI A;  5F69 A;  2CMN A;  4EUV A;  1T18 A;  4WEJ A;  4HJ4 A;  5DFY A;  5LBR A;  5DFX A;  1W63 Q;  2JHE A;  4EXO A;  4CQH A;  1TS8 A;  1N9L A;  3C2W A;  4R3A A;  1D7E A;  4MMN A;  2KDK A;  3HCY A;  2VV8 A;  4B9O A;  3P01 A;  1OT6 A;  2HJ9 C;  3BW6 A;  2HGV A;  2FH5 A;  1GSV A;  1OPX A;  3E98 A;  3DBA A;  4QPR A;  4PKY A;  4DJ2 A;  2PYR A;  1XJ3 A;  2BAS A;  2QHK A;  2ZOH A;  2VA0 A;  2OWH A;  1MZU A;  5IS1 A;  4Y3I A;  3PR6 A;  2O0Y A;  3W2Z A;  3FPV A;  4RQ9 A;  2KLI A;  2A2L A;  2NUP C;  4ARZ A;  3NOU C;  3UMD A;  2VKS A;  4G3V A;  2OWJ A;  2WKQ A;  3EEH A;  5F6A A;  3MMH A;  1WA9 A;  3B42 A;  3CI6 A;  3NOP C;  3TE8 A;  2VGL S;  2W1T B;  3HJI A;  3LR5 A;  2L4R A;  2QKP A;  2Z6D A;  4EES A;  2PR6 A;  1OTE A;  5K5B A;  3PBT A;  2GNX A;  1LSW A;  4WN5 A;  3ICY A;  2GX5 A;  3PBS A;  2R78 A;  2QYB A;  1TS6 A;  4HNB A;  2YKH A;  4HJ6 A;  1NRJ A;  4JGP A;  2PR5 A;  3F1O A;  4YWZ A;  2EWV A;  3KSF A;  1OTB A;  2HJE A;  4I3J A;  1F9I A;  5HDD A;  3GDI A;  3MR0 A;  3VE4 A;  4UQI M;  1NLY A;  3UB6 A;  3LIB A;  2H28 A;  3T4K A;  1ODV A;  1OTD A;  2V0U A;  2B02 A;  3T4Q A;  1OTI A;  4GS9 B;  3BJN A;  5J4E A;  2P08 A;  5HDC A;  2ZBB A;  5AJG A;  1XFN A;  2D02 A;  2M1C A;  3LUQ A;  4Z1W A;  3K2N A;  5TBM B;  2PYP A;  3ZQ5 A;  3VOL A;  2LB5 A;  2L0W A;  2VEA A;  3LIF A;  3MQ0 A;  1P97 A;  2PT7 A;  3RTY A;  3BY9 A;  2O9A A;  4MDZ A;  1ZTU A;  2VV7 A;  1T1B A;  2KX6 A;  4I5S A;  1VHM A;  3H7W A;  2M7V A;  4PKY G;  4HI4 A;  5IT5 A;  1N9N A;  3KYZ A;  4Y2F A;  4HP9 A;  3F1N B;  2O9B A;  3R7W B;  4MN6 A;  1DP6 A;  2A24 B;  3A0R A;  1P0Z A;  4HHD A;  5DJT A;  2V0W A;  4JGQ A;  3MJQ A;  3F1P B;  3V67 A;  1XJ6 A;  3O5Y A;  5G4Z A;  3EQU A;  1LT0 A;  4GS9 A;  2QJ5 A;  2D01 A;  3T50 A;  3ULF A;  1GSW A;  4KUK A;  3LID A;  5TBM A;  1P9W A;  3CIT A;  2Y8H A;  2PD7 A;  3BQ8 A;  2O9C A;  5HZH A;  4HH3 A;  4F3L A;  3UE3 A;  3OBF A;  3E0Y A;  3ZYT A;  4R6L A;  2W3H A;  4GHI A;  3S7P A;  4WEK A;  4FSF A;  1UWN X;  2MJ6 A;  3FG8 A;  1S66 L;  5HD5 A;  3NOT C;  3OC2 A;  2K7S A;  1LSX A;  1NWZ A;  2ZMF A;  5L8M A;  2FZ0 A;  4WL9 A;  4H6J B;  1T1A A;  2GJ3 A;  4WEL A;  2V1A A;  5HL6 A;  4EEP A;  3MXQ A;  5DF9 A;  4GCZ A;  4HOI A;  3IS2 A;  2W3G A;  3PBO A;  2WKR A;  4G3K A;  1G28 A;  4WLA A;  3E4P A;  3P7N A;  5HSQ A;  5FL3 A;  2QWS A;  4LRY C;  4NEE D;  4L9F A;  3S7N A;  1UWP X;  3PBN A;  4NXB A;  3A0V A;  4CLC A;  4PHT A;  2XA7 S;  3TJZ C;  2J3T D;  3C8C A;  4B93 A;  1DP9 A;  5DJU A;  4WUJ A;  2K31 A;  1S67 L;  5EFW A;  1S4R A;  3LFV A;  3T4L A;  2INW A;  4HH2 A;  3F1N A;  2JN7 A;  2QJ7 A;  5IU1 A;  3LI8 A;  2J3T C;  3TW8 A;  2VZW A;  2IA2 A;  3EEA A;  4CLC D;  3MF0 A;  4IUH A;  2VX8 A;  3KYQ A;  4EEU A;  3F1P A;  3H82 A;  1G6O A;  1EW0 A;  3A0S A;  1X0O A;  2P04 A;  2J3W A;  3FPW A;  1W63 M;  1ZHH B;  2XRO A;  3G6O A;  4YNR A;  3NJA A;  2B18 A;  4CLC C;  2OOL A;  4P6Z S;  3EQV A;  5HD3 A;  3HJK A;  3KSH A;  3EOI A;  1OJ5 A;  5CX7 A;  4F3L B;  1H8M A;  3OCL A;  1Y28 A;  2VGL M;  4P6Z M;  4HQA A;  2O99 A;  2K2N A;  4HJ3 A;  2W27 A;  5A8B A;  4BWI A;  1VB6 A;  4I39 A;  3LR0 A;  4CLC E;  2W3D A;  4L9E A;  2NUT C;  1N9O A;  5F68 A;  3NHQ A;  3OCN A;  1DP8 A;  4KUO A;  1XJ4 A;  4HP4 A;  2W0N A;  2JKR I;  3S7Q A;  1IOU A;  5HWV A;  2W3E A;  1JNU A;  5TJJ A;  3VV4 A;  3D72 A;  4I3A A;  1S1Z A;  4OOL A;  2VJW A;  3GEC A;  4OOM A;  4CLC B;  4Y5F A;  4PAU A;  5AVF A;  2A24 A;  1YKD A;  4XT2 B;  3KSG A;  1XJ2 A;  4BMW A;  4EER A;  4EQ1 A;  3UE6 A;  2JKR M;  3H7W B;  3F1O B;  1YSQ A;  4M4X A;  3B47 A;  5AVE A;  3KX0 X;  3PBR A;  2W1T A;  5KIZ A;  4DJ3 A;  2OAQ 1;  4ETX A;  5MC7 A;  4ETZ A;  1TF1 A;  4YOF A;  3TRC A;  3T4T A;  3E4Q A;  5HWT A;  2M7U A;  1V9Y A;  2XSS A;  3UME A;  4EET B;  1UGU A;  4DMZ A;  4K08 A;  2L1M A;  4IUK A;  1V9Z A;  1XFQ A;  3LR4 A;  4GHI B;  4NKP A;  1OT9 A;  2I9V A;  3K3D A;  3IBR A;  3JVU A;  3S7O A;  4I38 A;  3FC7 A;  1MC0 A;  5J7E A;  2G7U A;  3VE3 A;  2HV1 A;  4GLQ A;  2OAP 1;  2XA7 M;  5F5Y A;  1YAX A;  4G3W A;  1NLZ A;  3LIE A;  4BBU A;  4II7 A;  1IFQ A;  4H6J A;  2HF6 A;  4MN5 A;  3OOV A;  2XRN A;  2V9A A;  3H82 B;  1S1Y A;  3CUE C;  1TS7 A;  2J80 A;  5I5L A;  2DMW A;  1H3Q A;  4O01 A;  3R7W A;  2JKT I;  3UB8 A;  3KO6 A;  3CUE A;  1D06 A;  3EGD C;  4UEY A;  5DKK A;  2WKP A;  4NXE A;  4HIA A;  2EA9 A;  4EW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...