4Y2FA

Crystal structure of native gaf domain of potassium sensor histidine kinase kdpd from escherichia coli
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
143
structure length
143
Chain Sequence
b'GAMDLYEMSKALAVGRSPQDIAATSEQFIASTFHARSQVLLPDDNGKLQPLTHPQGMTPWDDAIAQWSFDKGLPAGAGTDTLPGVPYQILPLKSGEKTYGLVVVEPGNLRQLMIPEQQRLLETFTLLVANALERLTKLAAALE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor protein KdpD
molecule tags Transferase
source organism Escherichia coli
publication title CRYSTAL STRUCTURE OF NATIVE GAF DOMAIN of POTASSIUM SENSOR HISTIDINE KINASE KDPD FROM ESCHERICHIA COLI
rcsb
total genus 42
structure length 143
sequence length 143
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2015-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13492 GAF_3 GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4y2fA00
2G7UA 3KSFA 4IUHA 3S7NA 1VHMA 5HPIA 3S7OA 3TRCA 3S7QA 2XSSA 2GX5A 2XROA 2W3FA 2M7VA 2LB5A 5TJJA 4ZRRA 4DN0A 2W3EA 3E0YA 3KSIA 3MMHA 4MCWA 2W3GA 1YKDA 2KOIA 2XRNA 3MQ0A 2W3DA 4Q0HA 5LBRA 5HPFA 2W3HA 3R4KA 2VEAA 4ME4A 2IA2A 3RFBA 2QYBA 2Y79A 3O5YA 3NOUC 4PAUA 4QPRA 3G6OA 4YNRA 5K5BA 3C2WA 3NOTC 4MDZA 3OOVA 4IJGA 3E98A 4Q0JA 4Z1WA 2VKSA 3IBRA 3MF0A 4MMNA 4R70A 3BJNA 4G3WA 4O8GA 3EEAA 4ETZA 5DFXA 2O9BA 4RQ9A 2ZMFA 3DBAA 3OBFA 5L8MA 2M7UA 1TF1A 1ZTUA 4FOFA 2HGVA 4R6LA 5C5KA 4GLQA 1MKMA 4IUKA 4G3VA 2W1TB 1F5MA 5AJGA 3NOPC 4O01A 4G3KA 4ETXA 3LFVA 4LRYC 3KO6A 5HSQA 1YSPA 4EU0A 2O0YA 4CQHA 2K2NA 4YOFA 4Y5FA 5I5LA 4Q0IA 1TD5A 3IBJA 3ZQ5A 3S7PA 4LRZE 2B18A 4EUVA 2K31A 1MC0A 5DFYA 3NHQA 2O9CA 4DMZA 2W1RA 3W2ZA 4MN7A 1YSQA 2O9AA 4BWIA 3K2NA 2W1TA 3CI6A 3CITA 5HL6A 1STZA 2VZWA 3VV4A 2LB9A 4O0PA 4GW9A 4Y2FA 2OOLA 3HCYA 3D3OA 4LRXC 4Y3IA 4E04A 2KLIA 2VJWA 2Y8HA 3KSGA 2O99A 3KSHA
chains in the Genus database with same CATH superfamily
1XFNA 1Y4OA 3N8SA 3LIEA 4UA6A 3V50A 4IEDA 1T1AA 1T19A 2W27A 4ZAMA 4S2IA 1NWZA 1PZOA 2OLVA 1CEGA 2PD7A 2XH9A 3HLEA 4HP4A 3UE1A 4BL3A 1GHPA 1K57A 3GTCA 2G2UA 5E43A 5EV0A 3UPOA 2YKHA 3BWLA 1OTDA 3UDXA 4OONA 3PBQA 4CLCB 5GLAA 3SZTA 4MMNA 1OPXA 1W8QA 1YLYA 3EQVA 5I94A 5EFWA 4E3JA 5FAQA 3UE0A 5DJTA 3CHWP 1ZG4A 4XXRA 5FDHA 3W8KA 3LO7A 4Y17A 3S4XA 3S7PA 4E3MA 2DRWA 5CTNA 1MXOA 1JWVA 4R0QA 2V8FA 3KX0X 1YSQA 5TBMA 1WYBA 1F98A 3IH8A 4ZJ1A 1XJ6A 5J4EA 3TW8A 4EEUA 4M4XA 1QMEA 4GJ4A 3RXXA 5FA7A 4LCLA 5DKKA 3IX3A 4NXEA 3VP4A 3H82B 3BY9A 4N1XA 1XA7A 1MWTA 3S7NA 1E3UD 4ZJ2A 5DJUA 1F9IA 2XSSA 4R3AA 4X68A 1E25A 2W3FA 4R23A 1TDGA 2JE5A 2ZC3B 3N4IA 5EECA 4EW7A 1PW8A 3MKEA 4O7DA 2HDQA 3MMHA 1YKDA 1IKIA 2ZM2A 1W8YA 5FSRA 3RXWA 1ZG6A 2W3HA 3BLMA 3LR0A 4IBRA 2DNSA 3VE3A 1FCMA 1SCWA 2HDRA 1S67L 4S2NC 2PR5A 2XK1A 3ITBA 5U47A 2VA0A 3NBLA 3OCLA 2J3TD 4I5SA 3MXQA 5L09A 3ICYA 2PR6A 5J8XA 2V1AA 5HWTA 1E4DA 3SS3A 1XGJA 2W1TB 1F5MA 5CHJA 5KSCA 4QWOA 3OPPA 4K0WA 3QHYA 2JN7A 1OJGA 3A3JA 2PDRA 5EVIB 1DP8A 4KQOA 2JKRM 4HEFA 3CG5A 3HJKA 1TS6A 3W2ZA 3ZVTA 1L0DA 1VETB 3MXRA 3PBSA 2QJ5A 5M19A 2Y2HA 2Y2OA 1LL5A 2Z6DA 3G34A 1DP6A 3K3DA 3NECA 5A93A 5CGSA 5A8BA 4MN5A 1Q2PA 3EGXC 3PBNA 5HPIA 3E4QA 4RX2A 1CI9A 1S4RA 4MBKA 1N9NA 4ARZA 3GECA 2Y2NA 3FKWA 1E3UA 4M3KA 4GCZA 3CPTA 3UE3A 4NG2A 3T4KA 3CZDA 3G31A 4E3NA 3RFBA 1RCJA 3G2YA 3NOUC 3M6HA 3UDIA 4IBXA 1L3LA 3SOIA 4JXVA 5K5BA 3C2WA 1ESUA 3PAEA 3DTEA 1XPBA 1SKOA 1W79A 3PBOA 4R70A 4P0MA 1ONHA 3EEAA 4WMCD 3ZFZA 1SDNA 1CF0A 4B9OA 2Y59A 3BFGA 3UMDA 1K4EA 3DBAA 3OBFA 1TF1A 1CJFA 1ZTUA 3BFFA 4DE2A 3OPRA 3D9YA 3HLFA 1M6KA 4S2JA 5AVFA 4KZ9A 3F1OA 4Y13A 3ZG7B 1FR1A 2QHKA 1KE3A 4II7A 1S6RA 3UPNA 3ZVWA 1YSPA 1OTBA 4YOFA 3FC7A 4HQAA 3SH8A 2HP5A 4MN7A 4MLLA 1LL8A 4CPKA 5CHUA 3NC8A 5FQQA 3UO9A 3MR0A 1SKFA 4UEYA 4Y0TA 3VP1A 2VJWA 2ZC5B 3JVUA 5FEFA 3DW0A 4FH4A 3B42A 4MBHA 5HW3A 2PBYA 1XX2A 4RA7A 2H0YA 3U4LP 2EFXA 2WK0A 3JPUA 4PKYG 2FFFB 4C3QA 1PYYA 3G30A 1YLWA 3DAVA 2EXBA 4FSFA 3Q07A 5FL3A 1IYOA 3BY8A 3L7HA 4BJPA 3BECA 3ZG8B 1NRJA 2UV0E 3MZEA 4OQIA 3ZG0A 4PAUA 4QPRA 4XUXA 4P87A 2Y2IA 1K57C 4R4SA 4RVAA 1I2SA 1VQQA 3DTMA 3FKVA 4S2NA 4X6TA 1CEFA 2IWDA 3ZCZA 4I38A 1FQGA 4ETZA 3MS6A 5L8MA 3UMEA 5EVIC 3BEBA 1HVBA 3GV9A 5EM0A 1BSGA 1MKMA 1G6OA 3LCEA 2X02A 2Y2MA 5CECA 4EEPA 4PMAA 1AXBA 4LFUA 3CUEA 4EESA 1I5QA 4Q0IA 4P6ZM 4OVDA 3LIFA 2ZJ9A 4Y0OA 1YMSA 1P9WA 2NUPC 3T4QA 4DJ3A 3CITA 2CC1A 2LB9A 4WZ5A 3T4LA 5F82A 2PU2A 1MY8A 2KLIA 3IT9A 4DF6A 2VLGA 5MC7A 3KSGA 2P74A 3O88A 3C4PA 2FFYA 3AGDA 5DF8A 3ZNTA 3N8RA 2FH5A 1WA9A 3KYEA 4JXWA 4JF4A 3QNBA 4N92A 2XLNA 2BASA 2L1MA 1KGFA 2P9VA 3VOYA 4JKTA 3PYPA 1W7FA 3O86A 1ACFA 3UE6A 2ZQCA 5F5YA 1NJ4A 3SH7A 3R4KA 1LI0A 2WGVA 3HLWA 1T1BA 5A90A 5L07A 4ZDXA 4YWZA 1FCNA 3IF6C 4GDBA 3SH9A 3M2JA 3NULA 1BZAA 4R38A 2OSUA 4HESA 1L0FA 5HX9A 1FSYA 1LI9A 4U0XA 3HLDA 4JGRA 2JBFA 4OOYA 1P0ZA 5M1AA 3NCKA 1XJ3A 3HLBA 1W5DA 3V39A 2QPNA 5FAOA 3S22A 3BFCA 4OPQA 3VP2A 3KO6A 4CLCA 4E6XA 1KGEA 2M1CA 4EUVA 5TGFA 1PW1A 2I9VA 1OTAA 4PKYA 1IYQA 1O7EA 4DE0A 3CI6A 1GSVA 2VZWA 4O0PA 3MQQA 3IQAA 1DJBA 1TDLA 5AQ7A 5FASA 1K25A 2DMWA 3T50A 5EPHA 2V1ZA 3C5AA 4N9LA 2WGWB 2WGIA 1IOUA 1BLPA 2J9OA 1JWZA 3NJAA 4ZBEA 1BLSA 2HF6A 5F6AA 3P09A 4IHQA 4OLDA 2PU4A 4EXOA 5AVEA 4S2PA 4FD8A 5DTTA 1J3WA 1DRMA 4PM9A 5DTKA 4E3IA 3H82A 1FCOA 1BLHA 4RX3A 2EX2A 4GHIB 1HTZA 1V9ZA 1TS0A 4E3OA 4F3LA 5E2FA 3G6OA 4UAAA 1K54C 5E2HA 1BUEA 3LICA 3UDFA 4ZJ3A 2V9AA 4KQDA 4NK3A 3HREA 2JKTM 4JXSA 5G4ZA 1YPRA 4XUZA 2WKQA 3R7WA 3FYZA 1ONGA 2RL3A 4N9KA 3QP8A 5A91A 2HDUA 1CI8A 3WS1A 4WYYA 5L10A 1WYCA 3V3RA 1H3QA 4NXGA 2VK3A 3EWKA 3OPLA 3B33A 2B18A 4WMCA 2BG1A 3MJQA 2IWBA 2VV8A 3NHQA 4NKPA 4F94A 2YKFA 4B4ZA 2VGJA 2W1RA 1XJ4A 1K0KA 4WUJA 5GLCA 5HL6A 1STZA 1X0OA 5FQMA 1XP4A 1Z6FA 3HCYA 1SKOB 3G2ZA 3T4TA 4DXCA 1MWSA 5HDDA 2WKPA 2XEPA 1VHMA 5CEDA 2MJ6A 3IXGA 4KQQA 2GNXA 2WAFA 3CAXA 1PFLA 4I3IA 3GRJA 2D01A 4HH2A 4DN0A 5FEGA 1RGYA 4OPRA 1ZKJA 4X69A 1BT5A 3FWLA 5HDCA 5FAPA 2XRNA 1S4SA 5EVEA 5HPFA 2VEAA 3BRMA 4L9FA 2Y79A 2ZM8A 1KDWA 2BLSA 1TS8A 3PTEA 3GDIA 3OOVA 3VP0A 1SZVA 1DY6A 4KZBA 4Z9QA 1UWNX 3IBRA 1MBLA 3SS5A 3QP6A 2X01A 4OPZA 1NZOA 5DFXA 2EX6A 3P7NA 1NLYA 2OAP1 3AGFA 3VOZA 3WRZA 4GS9A 3RJUA 3D4FA 4BLMA 5EVID 2DCFA 2GJ3A 5EOEA 4HP9A 3A0RA 2WADA 3HLCA 4D60A 3IXBA 2ZQAA 3QNCA 5GHYA 3LUQA 1YLZA 3KYZA 4LCMA 3F1PB 5G4YA 4L9GA 5HZHA 2J8YA 4GS9B 2V1BA 3C38A 4HBTA 4FH2A 4R3BA 1KE0A 1ERMA 4HNBA 3TE8A 2ZM0A 5KZHA 2G7UA 1M40A 3W4OA 3TJZC 5TBMB 1ERQA 4NETA 5TJJA 3EQUA 1KVMA 2WZZA 1ZHHB 4JGOA 2WUQA 4GOGA 1EROA 1NZUA 4MCWA 4BL2A 4PM5A 3MQ0A 3PR6A 5LBRA 1FR6A 1XKZA 2IA2A 3IWQA 3E4PA 1TEMA 3SS4A 3OZHA 3NOTC 4MBFA 4C6YA 4IJGA 2Z6CA 3E98A 4EWFA 2ZLYA 1BTLA 3UB8A 3ULFA 3LIBA 4G3WA 1D7EA 3RH8B 1LT0A 2ZQ8A 5IHVA 4QJGA 4R6LA 5C5KA 4BD1A 1TVFA 1HD8A 4GLQA 4JGPA 4MN6A 2H0TA 4OLGA 4OKPA 2WAEA 2ZC7A 3HUMA 2K2NA 3M6BA 2WYXA 3GVBA 3C4OA 1LLBA 4DMZA 5HDSA 2JKGA 3E4OA 3C8CA 4ARZB 4Y0UA 1G6AA 3BM6A 1UWPX 3H7WB 4ZTKA 3WS4A 4LV0A 1K55A 1ES5A 4ESPA 1GHIA 2Y55A 4PM8A 5CTMA 2H28A 4JXGA 2WKHA 4WBGA 4GB7A 4X1LA 3ZG5A 5EM1A 1IEMA 2Q9MA 1K4FA 2EWVA 3VFFA 3RTYA 3S1YA 2ZQDA 3MXSA 2QYBA 3O5YA 2GZAA 3PHYA 3VFHA 4FCFA 4XT2B 3LY4A 4CLCD 5FDSA 3BJNA 4BBVA 3T12B 2O9BA 1K56D 4RQ9A 3BYDA 5FQ9A 4GHIA 1RGZA 3HLGA 4S2KA 3B3XA 3PXPA 4O01A 1ALQA 5HARA 1O07A 4UHUA 4KZ6A 1IYPA 1Z09A 3MBZA 4XT2A 2O0YA 2J80A 3ZQ5A 3F1PA 4P6BA 4HY8A 5CEBA 4BWIA 4KZ3A 1EW0A 2KX6A 3CUEC 2X71A 4EV4A 2JC7A 3G32A 3Q82A 3D3OA 4KG5A 4YINA 2XD1A 4L9EA 4WZ4A 4S2LA 3OC2A 4S2MA 1NXYA 3IH9A 3VSKA 5CX7A 2Y91A 3TRCA 2HPBA 4HH3A 4DKIA 2XROA 2WGWA 4DDYA 2C6WB 2QJ7A 1KVLA 3DTKA 3F1OB 1G28A 3IX8A 3IWIA 4AFIA 4BBUA 2W3EA 3MQOA 2J3WA 1LHYA 5F68A 2PAVP 4JPMA 4KG2A 3A0VA 4OQ0A 1G5UA 2C5WB 5L2FA 5F83A 2A24B 5HD5A 2B02A 3LY3A 4E6WA 3BQ8A 3T1QB 3ZDJA 5JYOA 4YNRA 5KMWA 5D3OA 3E2KA 2FZ0A 3QP4A 4GN2A 4NEED 3UN7A 4BMWA 5J7EA 3A3IA 3O3VA 3IS2B 3N7WA 2Y2GA 2M7UA 1K6SA 3TG9A 2HGVA 5G18A 3JVVA 4JF5A 4UA7A 3IS2A 3HUNA 2XDMA 1WE4A 4EU0A 4DE1A 3T1SA 1YMXA 3C30A 1TD5A 4EBNA 1NYMA 1EWZA 2K31A 5DFYA 1S0WA 3M2KA 4EQIA 4ID4A 3UB7A 4PM6A 1L2SA 3LIDA 3VV4A 4EERA 2ZMAA 1MPLA 3BLSA 4OP8A 4KUOA 1GSXA 2HDSA 3GMWA 3IWOA 3A0SA 1P9RA 2J7VA 4NXBA 3HJIA 1LSWA 2H10A 3FZCA 1VEUB 3Q7VA 1GCEA 2ZL1B 1N9BA 5J3WA 3LI8A 1NYYA 3G4PA 3DWKA 2GDNA 3Q7VB 4WZ5C 1OTIA 3E0YA 2V0UA 3KSIA 1BYWA 2PD8A 1QMFA 2G2WA 1CK3A 2W3DA 4DDSA 3IHBA 4MEZA 3F1NA 2UWXA 5IT5A 3WS2A 1JNUA 4HBUA 1XFQA 1XA1A 5EE8A 3JYIA 4LPZA 4MDZA 4HOIA 1OJ5A 4DJ2A 2EXAA 3C7VA 4FUWA 2INWA 2HJEA 3T4OA 1I2WA 3UB5P 4JGQA 5CHMA 1Y54A 5HAPA 3MZFA 3PAGA 4IUKA 3IX4A 4PPRA 5FQIA 1J9MA 2ZD8A 1BULA 2XR0A 3NI9A 4GZBA 1PI5A 2K7SA 2V8CA 3MSHA 1TS7A 4GNUA 4DRTA 1FILA 4Y7PA 3HL9A 4QB8A 4PM7A 2EX9A 3V5MA 1PI4A 1A0KA 3ITAA 3TOIA 5AQAA 2L0WA 3A3DA 3BW6A 2ZQ7A 4R4RA 4Y15A 2I72A 2ZOHA 1OT9A 3NY4A 4OH0A 2OLUA 1SDEA 4HJ6A 3LYXA 1NRFA 2V0WA 2VGLS 1ODVA 4HHDA 4X55A 1YLTA 2W3GA 1DJCA 3ZG9B 5IS1A 1K38A 1ES3A 4Q0HA 2PHYA 5HAQA 3O87A 4H6JA 3BFEA 3R7WB 4K0XA 1KDSA 4LENA 5GHZA 3QP5A 4C75A 4QY5A 3QP2A 2XF3A 4EUZA 1Y28A 3A3EA 3I7JA 3MF0A 3LEZA 2PYPA 1T18A 5EVIA 4O8GA 5FQKA 1NY0A 2OWHA 5KSHA 1HZOA 2IWCA 3CPTB 3L9KA 4CLCC 3EEHA 1RP5A 4H6JB 4G3VA 2HV1A 3NOPC 4BQMA 4GKUA 4DXBA 4B4XA 3VP3A 4JBFA 4CQHA 4OPYA 1SHVA 3T1RA 3IF6B 5FI7A 2VGLM 5F1FA 2Z2LB 3B47A 1DP9A 2W1TA 4KZAA 4OOMA 4LGWA 2OOLA 4JF6A 4Q8IA 5HWVA 1ES2A 2R78A 3NDGA 2Y2QA 2VV6A 2XQZA 2R9WA 2ZBBA 3LR4A 1MKIA 3V67A 3VMAA 3PBTA 2EWWA 4QHCA 4X1MA 2GX5A 4GD8A 3LI9A 4ZRRA 3GR2A 1JVJA 3UNWA 4JLFA 1Q2QA 2XGNA 4KZ7A 4WF0A 2D02A 3QP1A 3TSGA 2WZXA 2A3UA 5TR7A 2P08A 4P6ZS 4MNRA 5EOOA 3ZGAB 4UA9A 1DJAA 3HVFA 1U60A 4Z1WA 2Q0OA 4K91A 3V3SA 2Z2MB 5HD3A 4BBTA 2ZMFA 3FV7A 1MWRA 4EQ1A 5HWWA 3IXDA 5GLBA 3WS0A 1XXMA 4EBPA 2ZL1A 4X53A 3A3FA 3FPWA 1KOUA 1YLPA 4OQHA 4WEKA 4PHTA 2Y2KA 4BENA 1PRQA 2A49A 3IBJA 3KYQA 3P98A 5DKLA 2W0NA 2O9CA 3WRTA 2PT7A 5E2EA 1GSWA 3F1NB 2E8IA 3EOIA 3K2NA 5F69A 1H8YA 5CGWA 1PNEA 4U3TA 3T1XA 4KUKA 3Q81A 1JTDA 3CMZA 4EBLA 1IELA 2VGKA 2WKRA 1EI5A 2JKRI 4N1HA 4IUHA 5HFOA 1F2KA 4NXFA 3T4SA 4X56A 3IHAA 2VX8A 3UY6A 1V9YA 4EETB 4OP5A 3VOLA 3ZNYA 2LB5A 3W4QA 4HJ4A 5AQ9A 5DF9A 1KE4A 1VB6A 3UB6A 5CGXA 1FSWA 3MFXA 3EGDC 1AWIA 2Y2LA 1L0GA 3GSGA 1IFQA 4DE3A 4ME4A 1BLCA 1K54A 2RCXA 1OTEA 1S1ZA 2A24A 3NDEA 5CERA 4CLCE 4D2OA 3H9WA 1K56A 2OWJA 3OPHA 4LV2A 2XA7M 2P9VB 4KZ8A 2XA7S 3ZYTA 1IKGA 3IXHA 1GA9A 4QU3A 5AQBA 4E3LA 1JTGA 2EFUA 4FOFA 1LSVA 4UQIM 3C7UA 1N9OA 5CRFA 3SW1A 4LRYC 4HI4A 2EA9A 2Y2PA 2P04A 4KQRA 5GLDA 2NUTC 4CJNA 3P01A 4LV1A 4LRZE 1HLUP 2JHEA 1N4OA 1T1CA 3LEQA 1H0MA 2PBDP 4Y3IA 2B5RA 1D06A 2R9XA 3PBRA 4WEJA 4KENB 2O99A 2ZQ9A 5CXWA 1CQAA 4GD6A 2ZC6B 1YLJA 5FI2A 2H5SA 1H5XA 3U2AA 4E3KA 5TFQA 2PYRA 4L0LA 5HAIA 1C3BA 1VEUA 3MZDA 2E8JA 5DTSA 1MZUA 3Q7ZA 2XFSA 2KOIA 1IYSA 3AGEA 1H8MA 3IF6A 5FQJA 3GQZA 1K55C 4BD0A 3D72A 1D1JA 2B95A 3VE4A 2CMNA 3DTIA 2J3TC 1MWUA 3OLOA 4HIAA 2JCHA 3IF5A 2Y4AA 1H8ZA 4LLOB 2Q9NA 1W63Q 4WLAA 3MKFA 1YM1A 4B88A 1VETA 1YQSA 3E2LA 3W4PA 4R3JA 1ZC2A 2V20A 2QZ6A 2HP6A 2JKTI 4F3LB 2ZMVA 3LGOA 4ETXA 1VM1A 5KIZA 5GL9A 3H7WA 5EUAA 2L4RA 2AVXA 4Y5FA 5I5LA 4WM9A 2QWSA 3N6IA 1N9LA 5EVLA 1OT6A 2HZ5A 4OOLA 4QD4A 1FIKA 4UQIS 3CWFA 2XD5A 1NLZA 3UB9A 1YAXA 3T4JA 1PWGA 3ZHHA 3BFDA 4LRXC 5E2GA 1L0EA 4FTXA 3Q1FA 4H8RA 3KSFA 4X25A 5DF7A 4I39A 3S7OA 3S7QA 5M18A 2M7VA 2QMIA 1S1YA 2ZOIA 2Y2JA 1XGIA 3MFDA 2QKPA 3ISGA 1XJ2A 3LR3A 3N8LA 1PIOA 4I3JA 4B93A 3LIAA 3HBRA 3CLOA 2XFTA 1UGUA 4IVKA 1LL9A 1S66L 2WKEA 1ES4A 4KG6A 2KDKA 3FPVA 3LR5A 3DWZA 4I3AA 2J9PA 4WL9A 3WS5A 1GA0A 4WELA 4KZ4A 1KGGA 4Q0JA 2VKSA 1YT4A 3HUOA 1K6RA 1P97A 4GDNA 2HP9A 4KZ5A 3FG8A 3WWXA 3UPPA 5DVAA 4K08A 1PWDA 2ACGA 2BTFP 1OMEA 3OCNA 5FI6A 4A5RA 4IVIA 5AJGA 2ZC4B 4G3KA 3VSLA 2PRFA 2V2FF 3LFVA 2P7JA 4R1GA 5HSQA 1PZPA 5HL1A 2JKFA 4QY6A 4P85A 5BOHA 4HJ3A 4S2OA 1JWPA 4OQGA 1MC0A 1PWCA 1W63M 4YFMA 2OAQ1 5GHXA 4U0TA 1GHMA 4RYEA 2O9AA 3BQAA 2A2LA 2WKIA 2HJ9C 3CJMA 5FATA 3K3CA 4WN5A 2VV7A 4GW9A 4Y2FA 5A92A 5JYPA 4LV3A 1G68A 1FOFA 1ESIA 4E04A 3G35A 3NIAA 2Y8HA 1LSXA 5IU1A 2EX8A 2OV5A 5F1GA 3KSHA
chains in the Genus database with same CATH topology
1XFNA 3LR4A 3LIEA 3V67A 3PBTA 2EWWA 2FH5A 1WA9A 2H28A 2GX5A 1T1AA 1T19A 2W27A 1NWZA 3LI9A 4ZRRA 2BASA 2L1MA 2PD7A 2EWVA 3PYPA 4WF0A 2D02A 3RTYA 4HP4A 3UE6A 5F5YA 3R4KA 2QYBA 2P08A 2YKHA 4P6ZS 3O5YA 1T1BA 2GZAA 3BWLA 3PHYA 4YWZA 1OTDA 4XT2B 3PBQA 4R38A 4CLCB 4Z1WA 4CLCD 4MMNA 3BJNA 4BBVA 4JGRA 1OPXA 5HD3A 4BBTA 2O9BA 1P0ZA 4RQ9A 2ZMFA 3EQVA 5EFWA 4EQ1A 5HWWA 4GHIA 1XJ3A 3PXPA 4O01A 5DJTA 4XT2A 3FPWA 3KO6A 1KOUA 4CLCA 2O0YA 4WEKA 4PHTA 2J80A 2M1CA 3IBJA 3ZQ5A 3S7PA 3KYQA 4EUVA 5DKLA 3F1PA 4HY8A 2W0NA 2O9CA 3KX0X 1YSQA 2PT7A 2I9VA 5TBMA 1F98A 3F1NB 1GSWA 4BWIA 3K2NA 3EOIA 1OTAA 5F69A 4PKYA 1EW0A 3CI6A 1XJ6A 1GSVA 2VZWA 5J4EA 2KX6A 3TW8A 3CUEC 4EEUA 4O0PA 3MQQA 4M4XA 4GJ4A 4KUKA 3D3OA 5DKKA 2DMWA 4L9EA 3T50A 4NXEA 3H82B 3OC2A 3BY9A 2WKRA 2JKRI 1IOUA 4IUHA 3S7NA 4NXFA 5CX7A 3NJAA 3T4SA 2HF6A 3TRCA 4HH3A 1F9IA 2XSSA 4R3AA 5DJUA 5F6AA 2VX8A 2W3FA 2XROA 4IHQA 1V9YA 4EETB 4EXOA 3VOLA 5AVEA 2LB5A 2QJ7A 4HJ4A 3F1OB 1G28A 4EW7A 4AFIA 4BBUA 5DF9A 2W3EA 3MQOA 1VB6A 2J3WA 3UB6A 1DRMA 3MMHA 3MFXA 3EGDC 5F68A 1YKDA 3A0VA 3H82A 1IFQA 2A24B 4GHIB 2W3HA 5HD5A 2B02A 4ME4A 1OTEA 3LR0A 1S1ZA 1V9ZA 1TS0A 3BQ8A 3VE3A 2A24A 4F3LA 4CLCE 3G6OA 3H9WA 4YNRA 3LICA 2V9AA 1S67L 4KQDA 2OWJA 2PR5A 2FZ0A 2VA0A 2XA7M 3OCLA 2J3TD 4I5SA 4NEED 2XA7S 3ZYTA 4BMWA 3MXQA 2JKTM 3ICYA 2PR6A 5J7EA 5G4ZA 3IS2B 2V1AA 2WKQA 2M7UA 5HWTA 4FOFA 2HGVA 3R7WA 3JVVA 1LSVA 3IS2A 2W1TB 1F5MA 4UQIM 1N9OA 3SW1A 4LRYC 4HI4A 2EA9A 4EU0A 2P04A 2JN7A 1H3QA 4NXGA 2NUTC 3C30A 1OJGA 1TD5A 3EWKA 3P01A 2PDRA 4LRZE 3B33A 2B18A 1DP8A 4KQOA 3MJQA 2K31A 2JKRM 5DFYA 2VV8A 3NHQA 4NKPA 2JHEA 2YKFA 3HJKA 1TS6A 2W1RA 3W2ZA 1T1CA 3UB7A 1XJ4A 3PBSA 2QJ5A 4WUJA 5HL6A 1STZA 1X0OA 3LIDA 3VV4A 4EERA 2Z6DA 3HCYA 1DP6A 3T4TA 4Y3IA 3K3DA 1D06A 3PBRA 4WEJA 5HDDA 2O99A 4KUOA 2WKPA 1GSXA 5A8BA 4MN5A 3A0SA 3EGXC 3PBNA 1VHMA 5HPIA 3E4QA 1P9RA 4NXBA 2MJ6A 3HJIA 1LSWA 2GNXA 3U2AA 1S4RA 5J3WA 2PYRA 3LI8A 4L0LA 3CAXA 1N9NA 4I3IA 4ARZA 3GECA 2D01A 4HH2A 4DN0A 1MZUA 1OTIA 3E0YA 2V0UA 3KSIA 1BYWA 2PD8A 4GCZA 5HDCA 2KOIA 3UE3A 2W3DA 2XRNA 1S4SA 1H8MA 3T4KA 5HPFA 2VEAA 3D72A 3F1NA 3RFBA 4L9FA 3VE4A 5IT5A 1JNUA 2CMNA 2Y79A 3NOUC 1XFQA 2J3TC 1TS8A 5K5BA 3OLOA 4HIAA 3C2WA 4LPZA 4MDZA 3GDIA 3OOVA 4HOIA 4LLOB 1OJ5A 1UWNX 3IBRA 3PBOA 4DJ2A 4R70A 1W63Q 4WLAA 2INWA 2HJEA 3T4OA 3EEAA 5DFXA 3P7NA 4B9OA 4JGQA 1NLYA 3UMDA 2OAP1 3DBAA 3OBFA 1TF1A 1ZTUA 4IUKA 5AVFA 4GS9A 3F1OA 2JKTI 4F3LB 2ZMVA 2QHKA 2GJ3A 4ETXA 4II7A 5KIZA 3H7WA 4HP9A 3A0RA 1YSPA 2L4RA 1OTBA 4YOFA 4Y5FA 5I5LA 2QWSA 2K7SA 1N9LA 3FC7A 1OT6A 1TS7A 4OOLA 4HQAA 3LUQA 4MN7A 3KYZA 4UQIS 1LL8A 3F1PB 5G4YA 4L9GA 3CWFA 5HZHA 4GS9B 1NLZA 3UB9A 1YAXA 3MR0A 2V1BA 3T4JA 3C38A 4LRXC 4UEYA 2VJWA 3JVUA 4HNBA 3TE8A 3B42A 2L0WA 2G7UA 3BW6A 3KSFA 3TJZC 4I39A 3S7OA 3S7QA 4PKYG 5TBMB 2ZOHA 1OT9A 2M7VA 1S1YA 2ZOIA 4HJ6A 3LYXA 2QKPA 1XJ2A 3LR3A 5TJJA 2V0WA 3EQUA 4FSFA 3LIAA 4I3JA 2VGLS 4B93A 1ZHHB 1ODVA 4JGOA 4HHDA 3CLOA 5FL3A 1UGUA 1S66L 4MCWA 2W3GA 5IS1A 2KDKA 3MQ0A 3FPVA 3BY8A 3LR5A 3PR6A 4Q0HA 5LBRA 2PHYA 4BJPA 4I3AA 4WL9A 4H6JA 1NRJA 2IA2A 3R7WB 3E4PA 4PAUA 4QPRA 4WELA 3NOTC 1Y28A 4IJGA 2Z6CA 3E98A 4Q0JA 2VKSA 3MF0A 3UB8A 3ULFA 3LIBA 1P97A 2PYPA 1T18A 4G3WA 4I38A 3FG8A 1D7EA 4O8GA 3RH8B 4ETZA 1LT0A 2OWHA 5KSHA 4CLCC 3EEHA 5L8MA 3UMEA 4H6JB 4K08A 4R6LA 5C5KA 4GLQA 1MKMA 3OCNA 4JGPA 4MN6A 4G3VA 1G6OA 5AJGA 2HV1A 3NOPC 4G3KA 4EEPA 3LFVA 2P7JA 5HSQA 3CUEA 4EESA 4CQHA 2K2NA 4Q0IA 4P6ZM 4HJ3A 3LIFA 1MC0A 2VGLM 1W63M 2OAQ1 4DMZA 5HDSA 1P9WA 2NUPC 2O9AA 3B47A 3BQAA 2A2LA 3E4OA 3T4QA 4DJ3A 2HJ9C 3C8CA 1DP9A 2W1TA 3CITA 3K3CA 4WN5A 4ARZB 2LB9A 2VV7A 4GW9A 4OOMA 4Y2FA 2OOLA 3T4LA 5HWVA 4E04A 2R78A 2KLIA 2Y8HA 2VLGA 1LSXA 1UWPX 3H7WB 3KSGA 5MC7A 2VV6A 5IU1A 2ZBBA 3KSHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G7U A;  3KSF A;  4IUH A;  3S7N A;  1VHM A;  5HPI A;  3S7O A;  3TRC A;  3S7Q A;  2XSS A;  2GX5 A;  2XRO A;  2W3F A;  2M7V A;  2LB5 A;  5TJJ A;  4ZRR A;  4DN0 A;  2W3E A;  3E0Y A;  3KSI A;  3MMH A;  4MCW A;  2W3G A;  1YKD A;  2KOI A;  2XRN A;  3MQ0 A;  2W3D A;  4Q0H A;  5LBR A;  5HPF A;  2W3H A;  3R4K A;  2VEA A;  4ME4 A;  2IA2 A;  3RFB A;  2QYB A;  2Y79 A;  3O5Y A;  3NOU C;  4PAU A;  4QPR A;  3G6O A;  4YNR A;  5K5B A;  3C2W A;  3NOT C;  4MDZ A;  3OOV A;  4IJG A;  3E98 A;  4Q0J A;  4Z1W A;  2VKS A;  3IBR A;  3MF0 A;  4MMN A;  4R70 A;  3BJN A;  4G3W A;  4O8G A;  3EEA A;  4ETZ A;  5DFX A;  2O9B A;  4RQ9 A;  2ZMF A;  3DBA A;  3OBF A;  5L8M A;  2M7U A;  1TF1 A;  1ZTU A;  4FOF A;  2HGV A;  4R6L A;  5C5K A;  4GLQ A;  1MKM A;  4IUK A;  4G3V A;  2W1T B;  1F5M A;  5AJG A;  3NOP C;  4O01 A;  4G3K A;  4ETX A;  3LFV A;  4LRY C;  3KO6 A;  5HSQ A;  1YSP A;  4EU0 A;  2O0Y A;  4CQH A;  2K2N A;  4YOF A;  4Y5F A;  5I5L A;  4Q0I A;  1TD5 A;  3IBJ A;  3ZQ5 A;  3S7P A;  4LRZ E;  2B18 A;  4EUV A;  2K31 A;  1MC0 A;  5DFY A;  3NHQ A;  2O9C A;  4DMZ A;  2W1R A;  3W2Z A;  4MN7 A;  1YSQ A;  2O9A A;  4BWI A;  3K2N A;  2W1T A;  3CI6 A;  3CIT A;  5HL6 A;  1STZ A;  2VZW A;  3VV4 A;  2LB9 A;  4O0P A;  4GW9 A;  4Y2F A;  2OOL A;  3HCY A;  3D3O A;  4LRX C;  4Y3I A;  4E04 A;  2KLI A;  2VJW A;  2Y8H A;  3KSG A;  2O99 A;  3KSH A; 
#chains in the Genus database with same CATH topology
 1XFN A;  1Y4O A;  3N8S A;  3LIE A;  4UA6 A;  3V50 A;  4IED A;  1T1A A;  1T19 A;  2W27 A;  4ZAM A;  4S2I A;  1NWZ A;  1PZO A;  2OLV A;  1CEG A;  2PD7 A;  2XH9 A;  3HLE A;  4HP4 A;  3UE1 A;  4BL3 A;  1GHP A;  1K57 A;  3GTC A;  2G2U A;  5E43 A;  5EV0 A;  3UPO A;  2YKH A;  3BWL A;  1OTD A;  3UDX A;  4OON A;  3PBQ A;  4CLC B;  5GLA A;  3SZT A;  4MMN A;  1OPX A;  1W8Q A;  1YLY A;  3EQV A;  5I94 A;  5EFW A;  4E3J A;  5FAQ A;  3UE0 A;  5DJT A;  3CHW P;  1ZG4 A;  4XXR A;  5FDH A;  3W8K A;  3LO7 A;  4Y17 A;  3S4X A;  3S7P A;  4E3M A;  2DRW A;  5CTN A;  1MXO A;  1JWV A;  4R0Q A;  2V8F A;  3KX0 X;  1YSQ A;  5TBM A;  1WYB A;  1F98 A;  3IH8 A;  4ZJ1 A;  1XJ6 A;  5J4E A;  3TW8 A;  4EEU A;  4M4X A;  1QME A;  4GJ4 A;  3RXX A;  5FA7 A;  4LCL A;  5DKK A;  3IX3 A;  4NXE A;  3VP4 A;  3H82 B;  3BY9 A;  4N1X A;  1XA7 A;  1MWT A;  3S7N A;  1E3U D;  4ZJ2 A;  5DJU A;  1F9I A;  2XSS A;  4R3A A;  4X68 A;  1E25 A;  2W3F A;  4R23 A;  1TDG A;  2JE5 A;  2ZC3 B;  3N4I A;  5EEC A;  4EW7 A;  1PW8 A;  3MKE A;  4O7D A;  2HDQ A;  3MMH A;  1YKD A;  1IKI A;  2ZM2 A;  1W8Y A;  5FSR A;  3RXW A;  1ZG6 A;  2W3H A;  3BLM A;  3LR0 A;  4IBR A;  2DNS A;  3VE3 A;  1FCM A;  1SCW A;  2HDR A;  1S67 L;  4S2N C;  2PR5 A;  2XK1 A;  3ITB A;  5U47 A;  2VA0 A;  3NBL A;  3OCL A;  2J3T D;  4I5S A;  3MXQ A;  5L09 A;  3ICY A;  2PR6 A;  5J8X A;  2V1A A;  5HWT A;  1E4D A;  3SS3 A;  1XGJ A;  2W1T B;  1F5M A;  5CHJ A;  5KSC A;  4QWO A;  3OPP A;  4K0W A;  3QHY A;  2JN7 A;  1OJG A;  3A3J A;  2PDR A;  5EVI B;  1DP8 A;  4KQO A;  2JKR M;  4HEF A;  3CG5 A;  3HJK A;  1TS6 A;  3W2Z A;  3ZVT A;  1L0D A;  1VET B;  3MXR A;  3PBS A;  2QJ5 A;  5M19 A;  2Y2H A;  2Y2O A;  1LL5 A;  2Z6D A;  3G34 A;  1DP6 A;  3K3D A;  3NEC A;  5A93 A;  5CGS A;  5A8B A;  4MN5 A;  1Q2P A;  3EGX C;  3PBN A;  5HPI A;  3E4Q A;  4RX2 A;  1CI9 A;  1S4R A;  4MBK A;  1N9N A;  4ARZ A;  3GEC A;  2Y2N A;  3FKW A;  1E3U A;  4M3K A;  4GCZ A;  3CPT A;  3UE3 A;  4NG2 A;  3T4K A;  3CZD A;  3G31 A;  4E3N A;  3RFB A;  1RCJ A;  3G2Y A;  3NOU C;  3M6H A;  3UDI A;  4IBX A;  1L3L A;  3SOI A;  4JXV A;  5K5B A;  3C2W A;  1ESU A;  3PAE A;  3DTE A;  1XPB A;  1SKO A;  1W79 A;  3PBO A;  4R70 A;  4P0M A;  1ONH A;  3EEA A;  4WMC D;  3ZFZ A;  1SDN A;  1CF0 A;  4B9O A;  2Y59 A;  3BFG A;  3UMD A;  1K4E A;  3DBA A;  3OBF A;  1TF1 A;  1CJF A;  1ZTU A;  3BFF A;  4DE2 A;  3OPR A;  3D9Y A;  3HLF A;  1M6K A;  4S2J A;  5AVF A;  4KZ9 A;  3F1O A;  4Y13 A;  3ZG7 B;  1FR1 A;  2QHK A;  1KE3 A;  4II7 A;  1S6R A;  3UPN A;  3ZVW A;  1YSP A;  1OTB A;  4YOF A;  3FC7 A;  4HQA A;  3SH8 A;  2HP5 A;  4MN7 A;  4MLL A;  1LL8 A;  4CPK A;  5CHU A;  3NC8 A;  5FQQ A;  3UO9 A;  3MR0 A;  1SKF A;  4UEY A;  4Y0T A;  3VP1 A;  2VJW A;  2ZC5 B;  3JVU A;  5FEF A;  3DW0 A;  4FH4 A;  3B42 A;  4MBH A;  5HW3 A;  2PBY A;  1XX2 A;  4RA7 A;  2H0Y A;  3U4L P;  2EFX A;  2WK0 A;  3JPU A;  4PKY G;  2FFF B;  4C3Q A;  1PYY A;  3G30 A;  1YLW A;  3DAV A;  2EXB A;  4FSF A;  3Q07 A;  5FL3 A;  1IYO A;  3BY8 A;  3L7H A;  4BJP A;  3BEC A;  3ZG8 B;  1NRJ A;  2UV0 E;  3MZE A;  4OQI A;  3ZG0 A;  4PAU A;  4QPR A;  4XUX A;  4P87 A;  2Y2I A;  1K57 C;  4R4S A;  4RVA A;  1I2S A;  1VQQ A;  3DTM A;  3FKV A;  4S2N A;  4X6T A;  1CEF A;  2IWD A;  3ZCZ A;  4I38 A;  1FQG A;  4ETZ A;  3MS6 A;  5L8M A;  3UME A;  5EVI C;  3BEB A;  1HVB A;  3GV9 A;  5EM0 A;  1BSG A;  1MKM A;  1G6O A;  3LCE A;  2X02 A;  2Y2M A;  5CEC A;  4EEP A;  4PMA A;  1AXB A;  4LFU A;  3CUE A;  4EES A;  1I5Q A;  4Q0I A;  4P6Z M;  4OVD A;  3LIF A;  2ZJ9 A;  4Y0O A;  1YMS A;  1P9W A;  2NUP C;  3T4Q A;  4DJ3 A;  3CIT A;  2CC1 A;  2LB9 A;  4WZ5 A;  3T4L A;  5F82 A;  2PU2 A;  1MY8 A;  2KLI A;  3IT9 A;  4DF6 A;  2VLG A;  5MC7 A;  3KSG A;  2P74 A;  3O88 A;  3C4P A;  2FFY A;  3AGD A;  5DF8 A;  3ZNT A;  3N8R A;  2FH5 A;  1WA9 A;  3KYE A;  4JXW A;  4JF4 A;  3QNB A;  4N92 A;  2XLN A;  2BAS A;  2L1M A;  1KGF A;  2P9V A;  3VOY A;  4JKT A;  3PYP A;  1W7F A;  3O86 A;  1ACF A;  3UE6 A;  2ZQC A;  5F5Y A;  1NJ4 A;  3SH7 A;  3R4K A;  1LI0 A;  2WGV A;  3HLW A;  1T1B A;  5A90 A;  5L07 A;  4ZDX A;  4YWZ A;  1FCN A;  3IF6 C;  4GDB A;  3SH9 A;  3M2J A;  3NUL A;  1BZA A;  4R38 A;  2OSU A;  4HES A;  1L0F A;  5HX9 A;  1FSY A;  1LI9 A;  4U0X A;  3HLD A;  4JGR A;  2JBF A;  4OOY A;  1P0Z A;  5M1A A;  3NCK A;  1XJ3 A;  3HLB A;  1W5D A;  3V39 A;  2QPN A;  5FAO A;  3S22 A;  3BFC A;  4OPQ A;  3VP2 A;  3KO6 A;  4CLC A;  4E6X A;  1KGE A;  2M1C A;  4EUV A;  5TGF A;  1PW1 A;  2I9V A;  1OTA A;  4PKY A;  1IYQ A;  1O7E A;  4DE0 A;  3CI6 A;  1GSV A;  2VZW A;  4O0P A;  3MQQ A;  3IQA A;  1DJB A;  1TDL A;  5AQ7 A;  5FAS A;  1K25 A;  2DMW A;  3T50 A;  5EPH A;  2V1Z A;  3C5A A;  4N9L A;  2WGW B;  2WGI A;  1IOU A;  1BLP A;  2J9O A;  1JWZ A;  3NJA A;  4ZBE A;  1BLS A;  2HF6 A;  5F6A A;  3P09 A;  4IHQ A;  4OLD A;  2PU4 A;  4EXO A;  5AVE A;  4S2P A;  4FD8 A;  5DTT A;  1J3W A;  1DRM A;  4PM9 A;  5DTK A;  4E3I A;  3H82 A;  1FCO A;  1BLH A;  4RX3 A;  2EX2 A;  4GHI B;  1HTZ A;  1V9Z A;  1TS0 A;  4E3O A;  4F3L A;  5E2F A;  3G6O A;  4UAA A;  1K54 C;  5E2H A;  1BUE A;  3LIC A;  3UDF A;  4ZJ3 A;  2V9A A;  4KQD A;  4NK3 A;  3HRE A;  2JKT M;  4JXS A;  5G4Z A;  1YPR A;  4XUZ A;  2WKQ A;  3R7W A;  3FYZ A;  1ONG A;  2RL3 A;  4N9K A;  3QP8 A;  5A91 A;  2HDU A;  1CI8 A;  3WS1 A;  4WYY A;  5L10 A;  1WYC A;  3V3R A;  1H3Q A;  4NXG A;  2VK3 A;  3EWK A;  3OPL A;  3B33 A;  2B18 A;  4WMC A;  2BG1 A;  3MJQ A;  2IWB A;  2VV8 A;  3NHQ A;  4NKP A;  4F94 A;  2YKF A;  4B4Z A;  2VGJ A;  2W1R A;  1XJ4 A;  1K0K A;  4WUJ A;  5GLC A;  5HL6 A;  1STZ A;  1X0O A;  5FQM A;  1XP4 A;  1Z6F A;  3HCY A;  1SKO B;  3G2Z A;  3T4T A;  4DXC A;  1MWS A;  5HDD A;  2WKP A;  2XEP A;  1VHM A;  5CED A;  2MJ6 A;  3IXG A;  4KQQ A;  2GNX A;  2WAF A;  3CAX A;  1PFL A;  4I3I A;  3GRJ A;  2D01 A;  4HH2 A;  4DN0 A;  5FEG A;  1RGY A;  4OPR A;  1ZKJ A;  4X69 A;  1BT5 A;  3FWL A;  5HDC A;  5FAP A;  2XRN A;  1S4S A;  5EVE A;  5HPF A;  2VEA A;  3BRM A;  4L9F A;  2Y79 A;  2ZM8 A;  1KDW A;  2BLS A;  1TS8 A;  3PTE A;  3GDI A;  3OOV A;  3VP0 A;  1SZV A;  1DY6 A;  4KZB A;  4Z9Q A;  1UWN X;  3IBR A;  1MBL A;  3SS5 A;  3QP6 A;  2X01 A;  4OPZ A;  1NZO A;  5DFX A;  2EX6 A;  3P7N A;  1NLY A;  2OAP 1;  3AGF A;  3VOZ A;  3WRZ A;  4GS9 A;  3RJU A;  3D4F A;  4BLM A;  5EVI D;  2DCF A;  2GJ3 A;  5EOE A;  4HP9 A;  3A0R A;  2WAD A;  3HLC A;  4D60 A;  3IXB A;  2ZQA A;  3QNC A;  5GHY A;  3LUQ A;  1YLZ A;  3KYZ A;  4LCM A;  3F1P B;  5G4Y A;  4L9G A;  5HZH A;  2J8Y A;  4GS9 B;  2V1B A;  3C38 A;  4HBT A;  4FH2 A;  4R3B A;  1KE0 A;  1ERM A;  4HNB A;  3TE8 A;  2ZM0 A;  5KZH A;  2G7U A;  1M40 A;  3W4O A;  3TJZ C;  5TBM B;  1ERQ A;  4NET A;  5TJJ A;  3EQU A;  1KVM A;  2WZZ A;  1ZHH B;  4JGO A;  2WUQ A;  4GOG A;  1ERO A;  1NZU A;  4MCW A;  4BL2 A;  4PM5 A;  3MQ0 A;  3PR6 A;  5LBR A;  1FR6 A;  1XKZ A;  2IA2 A;  3IWQ A;  3E4P A;  1TEM A;  3SS4 A;  3OZH A;  3NOT C;  4MBF A;  4C6Y A;  4IJG A;  2Z6C A;  3E98 A;  4EWF A;  2ZLY A;  1BTL A;  3UB8 A;  3ULF A;  3LIB A;  4G3W A;  1D7E A;  3RH8 B;  1LT0 A;  2ZQ8 A;  5IHV A;  4QJG A;  4R6L A;  5C5K A;  4BD1 A;  1TVF A;  1HD8 A;  4GLQ A;  4JGP A;  4MN6 A;  2H0T A;  4OLG A;  4OKP A;  2WAE A;  2ZC7 A;  3HUM A;  2K2N A;  3M6B A;  2WYX A;  3GVB A;  3C4O A;  1LLB A;  4DMZ A;  5HDS A;  2JKG A;  3E4O A;  3C8C A;  4ARZ B;  4Y0U A;  1G6A A;  3BM6 A;  1UWP X;  3H7W B;  4ZTK A;  3WS4 A;  4LV0 A;  1K55 A;  1ES5 A;  4ESP A;  1GHI A;  2Y55 A;  4PM8 A;  5CTM A;  2H28 A;  4JXG A;  2WKH A;  4WBG A;  4GB7 A;  4X1L A;  3ZG5 A;  5EM1 A;  1IEM A;  2Q9M A;  1K4F A;  2EWV A;  3VFF A;  3RTY A;  3S1Y A;  2ZQD A;  3MXS A;  2QYB A;  3O5Y A;  2GZA A;  3PHY A;  3VFH A;  4FCF A;  4XT2 B;  3LY4 A;  4CLC D;  5FDS A;  3BJN A;  4BBV A;  3T12 B;  2O9B A;  1K56 D;  4RQ9 A;  3BYD A;  5FQ9 A;  4GHI A;  1RGZ A;  3HLG A;  4S2K A;  3B3X A;  3PXP A;  4O01 A;  1ALQ A;  5HAR A;  1O07 A;  4UHU A;  4KZ6 A;  1IYP A;  1Z09 A;  3MBZ A;  4XT2 A;  2O0Y A;  2J80 A;  3ZQ5 A;  3F1P A;  4P6B A;  4HY8 A;  5CEB A;  4BWI A;  4KZ3 A;  1EW0 A;  2KX6 A;  3CUE C;  2X71 A;  4EV4 A;  2JC7 A;  3G32 A;  3Q82 A;  3D3O A;  4KG5 A;  4YIN A;  2XD1 A;  4L9E A;  4WZ4 A;  4S2L A;  3OC2 A;  4S2M A;  1NXY A;  3IH9 A;  3VSK A;  5CX7 A;  2Y91 A;  3TRC A;  2HPB A;  4HH3 A;  4DKI A;  2XRO A;  2WGW A;  4DDY A;  2C6W B;  2QJ7 A;  1KVL A;  3DTK A;  3F1O B;  1G28 A;  3IX8 A;  3IWI A;  4AFI A;  4BBU A;  2W3E A;  3MQO A;  2J3W A;  1LHY A;  5F68 A;  2PAV P;  4JPM A;  4KG2 A;  3A0V A;  4OQ0 A;  1G5U A;  2C5W B;  5L2F A;  5F83 A;  2A24 B;  5HD5 A;  2B02 A;  3LY3 A;  4E6W A;  3BQ8 A;  3T1Q B;  3ZDJ A;  5JYO A;  4YNR A;  5KMW A;  5D3O A;  3E2K A;  2FZ0 A;  3QP4 A;  4GN2 A;  4NEE D;  3UN7 A;  4BMW A;  5J7E A;  3A3I A;  3O3V A;  3IS2 B;  3N7W A;  2Y2G A;  2M7U A;  1K6S A;  3TG9 A;  2HGV A;  5G18 A;  3JVV A;  4JF5 A;  4UA7 A;  3IS2 A;  3HUN A;  2XDM A;  1WE4 A;  4EU0 A;  4DE1 A;  3T1S A;  1YMX A;  3C30 A;  1TD5 A;  4EBN A;  1NYM A;  1EWZ A;  2K31 A;  5DFY A;  1S0W A;  3M2K A;  4EQI A;  4ID4 A;  3UB7 A;  4PM6 A;  1L2S A;  3LID A;  3VV4 A;  4EER A;  2ZMA A;  1MPL A;  3BLS A;  4OP8 A;  4KUO A;  1GSX A;  2HDS A;  3GMW A;  3IWO A;  3A0S A;  1P9R A;  2J7V A;  4NXB A;  3HJI A;  1LSW A;  2H10 A;  3FZC A;  1VEU B;  3Q7V A;  1GCE A;  2ZL1 B;  1N9B A;  5J3W A;  3LI8 A;  1NYY A;  3G4P A;  3DWK A;  2GDN A;  3Q7V B;  4WZ5 C;  1OTI A;  3E0Y A;  2V0U A;  3KSI A;  1BYW A;  2PD8 A;  1QMF A;  2G2W A;  1CK3 A;  2W3D A;  4DDS A;  3IHB A;  4MEZ A;  3F1N A;  2UWX A;  5IT5 A;  3WS2 A;  1JNU A;  4HBU A;  1XFQ A;  1XA1 A;  5EE8 A;  3JYI A;  4LPZ A;  4MDZ A;  4HOI A;  1OJ5 A;  4DJ2 A;  2EXA A;  3C7V A;  4FUW A;  2INW A;  2HJE A;  3T4O A;  1I2W A;  3UB5 P;  4JGQ A;  5CHM A;  1Y54 A;  5HAP A;  3MZF A;  3PAG A;  4IUK A;  3IX4 A;  4PPR A;  5FQI A;  1J9M A;  2ZD8 A;  1BUL A;  2XR0 A;  3NI9 A;  4GZB A;  1PI5 A;  2K7S A;  2V8C A;  3MSH A;  1TS7 A;  4GNU A;  4DRT A;  1FIL A;  4Y7P A;  3HL9 A;  4QB8 A;  4PM7 A;  2EX9 A;  3V5M A;  1PI4 A;  1A0K A;  3ITA A;  3TOI A;  5AQA A;  2L0W A;  3A3D A;  3BW6 A;  2ZQ7 A;  4R4R A;  4Y15 A;  2I72 A;  2ZOH A;  1OT9 A;  3NY4 A;  4OH0 A;  2OLU A;  1SDE A;  4HJ6 A;  3LYX A;  1NRF A;  2V0W A;  2VGL S;  1ODV A;  4HHD A;  4X55 A;  1YLT A;  2W3G A;  1DJC A;  3ZG9 B;  5IS1 A;  1K38 A;  1ES3 A;  4Q0H A;  2PHY A;  5HAQ A;  3O87 A;  4H6J A;  3BFE A;  3R7W B;  4K0X A;  1KDS A;  4LEN A;  5GHZ A;  3QP5 A;  4C75 A;  4QY5 A;  3QP2 A;  2XF3 A;  4EUZ A;  1Y28 A;  3A3E A;  3I7J A;  3MF0 A;  3LEZ A;  2PYP A;  1T18 A;  5EVI A;  4O8G A;  5FQK A;  1NY0 A;  2OWH A;  5KSH A;  1HZO A;  2IWC A;  3CPT B;  3L9K A;  4CLC C;  3EEH A;  1RP5 A;  4H6J B;  4G3V A;  2HV1 A;  3NOP C;  4BQM A;  4GKU A;  4DXB A;  4B4X A;  3VP3 A;  4JBF A;  4CQH A;  4OPY A;  1SHV A;  3T1R A;  3IF6 B;  5FI7 A;  2VGL M;  5F1F A;  2Z2L B;  3B47 A;  1DP9 A;  2W1T A;  4KZA A;  4OOM A;  4LGW A;  2OOL A;  4JF6 A;  4Q8I A;  5HWV A;  1ES2 A;  2R78 A;  3NDG A;  2Y2Q A;  2VV6 A;  2XQZ A;  2R9W A;  2ZBB A;  3LR4 A;  1MKI A;  3V67 A;  3VMA A;  3PBT A;  2EWW A;  4QHC A;  4X1M A;  2GX5 A;  4GD8 A;  3LI9 A;  4ZRR A;  3GR2 A;  1JVJ A;  3UNW A;  4JLF A;  1Q2Q A;  2XGN A;  4KZ7 A;  4WF0 A;  2D02 A;  3QP1 A;  3TSG A;  2WZX A;  2A3U A;  5TR7 A;  2P08 A;  4P6Z S;  4MNR A;  5EOO A;  3ZGA B;  4UA9 A;  1DJA A;  3HVF A;  1U60 A;  4Z1W A;  2Q0O A;  4K91 A;  3V3S A;  2Z2M B;  5HD3 A;  4BBT A;  2ZMF A;  3FV7 A;  1MWR A;  4EQ1 A;  5HWW A;  3IXD A;  5GLB A;  3WS0 A;  1XXM A;  4EBP A;  2ZL1 A;  4X53 A;  3A3F A;  3FPW A;  1KOU A;  1YLP A;  4OQH A;  4WEK A;  4PHT A;  2Y2K A;  4BEN A;  1PRQ A;  2A49 A;  3IBJ A;  3KYQ A;  3P98 A;  5DKL A;  2W0N A;  2O9C A;  3WRT A;  2PT7 A;  5E2E A;  1GSW A;  3F1N B;  2E8I A;  3EOI A;  3K2N A;  5F69 A;  1H8Y A;  5CGW A;  1PNE A;  4U3T A;  3T1X A;  4KUK A;  3Q81 A;  1JTD A;  3CMZ A;  4EBL A;  1IEL A;  2VGK A;  2WKR A;  1EI5 A;  2JKR I;  4N1H A;  4IUH A;  5HFO A;  1F2K A;  4NXF A;  3T4S A;  4X56 A;  3IHA A;  2VX8 A;  3UY6 A;  1V9Y A;  4EET B;  4OP5 A;  3VOL A;  3ZNY A;  2LB5 A;  3W4Q A;  4HJ4 A;  5AQ9 A;  5DF9 A;  1KE4 A;  1VB6 A;  3UB6 A;  5CGX A;  1FSW A;  3MFX A;  3EGD C;  1AWI A;  2Y2L A;  1L0G A;  3GSG A;  1IFQ A;  4DE3 A;  4ME4 A;  1BLC A;  1K54 A;  2RCX A;  1OTE A;  1S1Z A;  2A24 A;  3NDE A;  5CER A;  4CLC E;  4D2O A;  3H9W A;  1K56 A;  2OWJ A;  3OPH A;  4LV2 A;  2XA7 M;  2P9V B;  4KZ8 A;  2XA7 S;  3ZYT A;  1IKG A;  3IXH A;  1GA9 A;  4QU3 A;  5AQB A;  4E3L A;  1JTG A;  2EFU A;  4FOF A;  1LSV A;  4UQI M;  3C7U A;  1N9O A;  5CRF A;  3SW1 A;  4LRY C;  4HI4 A;  2EA9 A;  2Y2P A;  2P04 A;  4KQR A;  5GLD A;  2NUT C;  4CJN A;  3P01 A;  4LV1 A;  4LRZ E;  1HLU P;  2JHE A;  1N4O A;  1T1C A;  3LEQ A;  1H0M A;  2PBD P;  4Y3I A;  2B5R A;  1D06 A;  2R9X A;  3PBR A;  4WEJ A;  4KEN B;  2O99 A;  2ZQ9 A;  5CXW A;  1CQA A;  4GD6 A;  2ZC6 B;  1YLJ A;  5FI2 A;  2H5S A;  1H5X A;  3U2A A;  4E3K A;  5TFQ A;  2PYR A;  4L0L A;  5HAI A;  1C3B A;  1VEU A;  3MZD A;  2E8J A;  5DTS A;  1MZU A;  3Q7Z A;  2XFS A;  2KOI A;  1IYS A;  3AGE A;  1H8M A;  3IF6 A;  5FQJ A;  3GQZ A;  1K55 C;  4BD0 A;  3D72 A;  1D1J A;  2B95 A;  3VE4 A;  2CMN A;  3DTI A;  2J3T C;  1MWU A;  3OLO A;  4HIA A;  2JCH A;  3IF5 A;  2Y4A A;  1H8Z A;  4LLO B;  2Q9N A;  1W63 Q;  4WLA A;  3MKF A;  1YM1 A;  4B88 A;  1VET A;  1YQS A;  3E2L A;  3W4P A;  4R3J A;  1ZC2 A;  2V20 A;  2QZ6 A;  2HP6 A;  2JKT I;  4F3L B;  2ZMV A;  3LGO A;  4ETX A;  1VM1 A;  5KIZ A;  5GL9 A;  3H7W A;  5EUA A;  2L4R A;  2AVX A;  4Y5F A;  5I5L A;  4WM9 A;  2QWS A;  3N6I A;  1N9L A;  5EVL A;  1OT6 A;  2HZ5 A;  4OOL A;  4QD4 A;  1FIK A;  4UQI S;  3CWF A;  2XD5 A;  1NLZ A;  3UB9 A;  1YAX A;  3T4J A;  1PWG A;  3ZHH A;  3BFD A;  4LRX C;  5E2G A;  1L0E A;  4FTX A;  3Q1F A;  4H8R A;  3KSF A;  4X25 A;  5DF7 A;  4I39 A;  3S7O A;  3S7Q A;  5M18 A;  2M7V A;  2QMI A;  1S1Y A;  2ZOI A;  2Y2J A;  1XGI A;  3MFD A;  2QKP A;  3ISG A;  1XJ2 A;  3LR3 A;  3N8L A;  1PIO A;  4I3J A;  4B93 A;  3LIA A;  3HBR A;  3CLO A;  2XFT A;  1UGU A;  4IVK A;  1LL9 A;  1S66 L;  2WKE A;  1ES4 A;  4KG6 A;  2KDK A;  3FPV A;  3LR5 A;  3DWZ A;  4I3A A;  2J9P A;  4WL9 A;  3WS5 A;  1GA0 A;  4WEL A;  4KZ4 A;  1KGG A;  4Q0J A;  2VKS A;  1YT4 A;  3HUO A;  1K6R A;  1P97 A;  4GDN A;  2HP9 A;  4KZ5 A;  3FG8 A;  3WWX A;  3UPP A;  5DVA A;  4K08 A;  1PWD A;  2ACG A;  2BTF P;  1OME A;  3OCN A;  5FI6 A;  4A5R A;  4IVI A;  5AJG A;  2ZC4 B;  4G3K A;  3VSL A;  2PRF A;  2V2F F;  3LFV A;  2P7J A;  4R1G A;  5HSQ A;  1PZP A;  5HL1 A;  2JKF A;  4QY6 A;  4P85 A;  5BOH A;  4HJ3 A;  4S2O A;  1JWP A;  4OQG A;  1MC0 A;  1PWC A;  1W63 M;  4YFM A;  2OAQ 1;  5GHX A;  4U0T A;  1GHM A;  4RYE A;  2O9A A;  3BQA A;  2A2L A;  2WKI A;  2HJ9 C;  3CJM A;  5FAT A;  3K3C A;  4WN5 A;  2VV7 A;  4GW9 A;  4Y2F A;  5A92 A;  5JYP A;  4LV3 A;  1G68 A;  1FOF A;  1ESI A;  4E04 A;  3G35 A;  3NIA A;  2Y8H A;  1LSX A;  5IU1 A;  2EX8 A;  2OV5 A;  5F1G A;  3KSH A; 
#chains in the Genus database with same CATH homology
 1XFN A;  3LR4 A;  3LIE A;  3V67 A;  3PBT A;  2EWW A;  2FH5 A;  1WA9 A;  2H28 A;  2GX5 A;  1T1A A;  1T19 A;  2W27 A;  1NWZ A;  3LI9 A;  4ZRR A;  2BAS A;  2L1M A;  2PD7 A;  2EWV A;  3PYP A;  4WF0 A;  2D02 A;  3RTY A;  4HP4 A;  3UE6 A;  5F5Y A;  3R4K A;  2QYB A;  2P08 A;  2YKH A;  4P6Z S;  3O5Y A;  1T1B A;  2GZA A;  3BWL A;  3PHY A;  4YWZ A;  1OTD A;  4XT2 B;  3PBQ A;  4R38 A;  4CLC B;  4Z1W A;  4CLC D;  4MMN A;  3BJN A;  4BBV A;  4JGR A;  1OPX A;  5HD3 A;  4BBT A;  2O9B A;  1P0Z A;  4RQ9 A;  2ZMF A;  3EQV A;  5EFW A;  4EQ1 A;  5HWW A;  4GHI A;  1XJ3 A;  3PXP A;  4O01 A;  5DJT A;  4XT2 A;  3FPW A;  3KO6 A;  1KOU A;  4CLC A;  2O0Y A;  4WEK A;  4PHT A;  2J80 A;  2M1C A;  3IBJ A;  3ZQ5 A;  3S7P A;  3KYQ A;  4EUV A;  5DKL A;  3F1P A;  4HY8 A;  2W0N A;  2O9C A;  3KX0 X;  1YSQ A;  2PT7 A;  2I9V A;  5TBM A;  1F98 A;  3F1N B;  1GSW A;  4BWI A;  3K2N A;  3EOI A;  1OTA A;  5F69 A;  4PKY A;  1EW0 A;  3CI6 A;  1XJ6 A;  1GSV A;  2VZW A;  5J4E A;  2KX6 A;  3TW8 A;  3CUE C;  4EEU A;  4O0P A;  3MQQ A;  4M4X A;  4GJ4 A;  4KUK A;  3D3O A;  5DKK A;  2DMW A;  4L9E A;  3T50 A;  4NXE A;  3H82 B;  3OC2 A;  3BY9 A;  2WKR A;  2JKR I;  1IOU A;  4IUH A;  3S7N A;  4NXF A;  5CX7 A;  3NJA A;  3T4S A;  2HF6 A;  3TRC A;  4HH3 A;  1F9I A;  2XSS A;  4R3A A;  5DJU A;  5F6A A;  2VX8 A;  2W3F A;  2XRO A;  4IHQ A;  1V9Y A;  4EET B;  4EXO A;  3VOL A;  5AVE A;  2LB5 A;  2QJ7 A;  4HJ4 A;  3F1O B;  1G28 A;  4EW7 A;  4AFI A;  4BBU A;  5DF9 A;  2W3E A;  3MQO A;  1VB6 A;  2J3W A;  3UB6 A;  1DRM A;  3MMH A;  3MFX A;  3EGD C;  5F68 A;  1YKD A;  3A0V A;  3H82 A;  1IFQ A;  2A24 B;  4GHI B;  2W3H A;  5HD5 A;  2B02 A;  4ME4 A;  1OTE A;  3LR0 A;  1S1Z A;  1V9Z A;  1TS0 A;  3BQ8 A;  3VE3 A;  2A24 A;  4F3L A;  4CLC E;  3G6O A;  3H9W A;  4YNR A;  3LIC A;  2V9A A;  1S67 L;  4KQD A;  2OWJ A;  2PR5 A;  2FZ0 A;  2VA0 A;  2XA7 M;  3OCL A;  2J3T D;  4I5S A;  4NEE D;  2XA7 S;  3ZYT A;  4BMW A;  3MXQ A;  2JKT M;  3ICY A;  2PR6 A;  5J7E A;  5G4Z A;  3IS2 B;  2V1A A;  2WKQ A;  2M7U A;  5HWT A;  4FOF A;  2HGV A;  3R7W A;  3JVV A;  1LSV A;  3IS2 A;  2W1T B;  1F5M A;  4UQI M;  1N9O A;  3SW1 A;  4LRY C;  4HI4 A;  2EA9 A;  4EU0 A;  2P04 A;  2JN7 A;  1H3Q A;  4NXG A;  2NUT C;  3C30 A;  1OJG A;  1TD5 A;  3EWK A;  3P01 A;  2PDR A;  4LRZ E;  3B33 A;  2B18 A;  1DP8 A;  4KQO A;  3MJQ A;  2K31 A;  2JKR M;  5DFY A;  2VV8 A;  3NHQ A;  4NKP A;  2JHE A;  2YKF A;  3HJK A;  1TS6 A;  2W1R A;  3W2Z A;  1T1C A;  3UB7 A;  1XJ4 A;  3PBS A;  2QJ5 A;  4WUJ A;  5HL6 A;  1STZ A;  1X0O A;  3LID A;  3VV4 A;  4EER A;  2Z6D A;  3HCY A;  1DP6 A;  3T4T A;  4Y3I A;  3K3D A;  1D06 A;  3PBR A;  4WEJ A;  5HDD A;  2O99 A;  4KUO A;  2WKP A;  1GSX A;  5A8B A;  4MN5 A;  3A0S A;  3EGX C;  3PBN A;  1VHM A;  5HPI A;  3E4Q A;  1P9R A;  4NXB A;  2MJ6 A;  3HJI A;  1LSW A;  2GNX A;  3U2A A;  1S4R A;  5J3W A;  2PYR A;  3LI8 A;  4L0L A;  3CAX A;  1N9N A;  4I3I A;  4ARZ A;  3GEC A;  2D01 A;  4HH2 A;  4DN0 A;  1MZU A;  1OTI A;  3E0Y A;  2V0U A;  3KSI A;  1BYW A;  2PD8 A;  4GCZ A;  5HDC A;  2KOI A;  3UE3 A;  2W3D A;  2XRN A;  1S4S A;  1H8M A;  3T4K A;  5HPF A;  2VEA A;  3D72 A;  3F1N A;  3RFB A;  4L9F A;  3VE4 A;  5IT5 A;  1JNU A;  2CMN A;  2Y79 A;  3NOU C;  1XFQ A;  2J3T C;  1TS8 A;  5K5B A;  3OLO A;  4HIA A;  3C2W A;  4LPZ A;  4MDZ A;  3GDI A;  3OOV A;  4HOI A;  4LLO B;  1OJ5 A;  1UWN X;  3IBR A;  3PBO A;  4DJ2 A;  4R70 A;  1W63 Q;  4WLA A;  2INW A;  2HJE A;  3T4O A;  3EEA A;  5DFX A;  3P7N A;  4B9O A;  4JGQ A;  1NLY A;  3UMD A;  2OAP 1;  3DBA A;  3OBF A;  1TF1 A;  1ZTU A;  4IUK A;  5AVF A;  4GS9 A;  3F1O A;  2JKT I;  4F3L B;  2ZMV A;  2QHK A;  2GJ3 A;  4ETX A;  4II7 A;  5KIZ A;  3H7W A;  4HP9 A;  3A0R A;  1YSP A;  2L4R A;  1OTB A;  4YOF A;  4Y5F A;  5I5L A;  2QWS A;  2K7S A;  1N9L A;  3FC7 A;  1OT6 A;  1TS7 A;  4OOL A;  4HQA A;  3LUQ A;  4MN7 A;  3KYZ A;  4UQI S;  1LL8 A;  3F1P B;  5G4Y A;  4L9G A;  3CWF A;  5HZH A;  4GS9 B;  1NLZ A;  3UB9 A;  1YAX A;  3MR0 A;  2V1B A;  3T4J A;  3C38 A;  4LRX C;  4UEY A;  2VJW A;  3JVU A;  4HNB A;  3TE8 A;  3B42 A;  2L0W A;  2G7U A;  3BW6 A;  3KSF A;  3TJZ C;  4I39 A;  3S7O A;  3S7Q A;  4PKY G;  5TBM B;  2ZOH A;  1OT9 A;  2M7V A;  1S1Y A;  2ZOI A;  4HJ6 A;  3LYX A;  2QKP A;  1XJ2 A;  3LR3 A;  5TJJ A;  2V0W A;  3EQU A;  4FSF A;  3LIA A;  4I3J A;  2VGL S;  4B93 A;  1ZHH B;  1ODV A;  4JGO A;  4HHD A;  3CLO A;  5FL3 A;  1UGU A;  1S66 L;  4MCW A;  2W3G A;  5IS1 A;  2KDK A;  3MQ0 A;  3FPV A;  3BY8 A;  3LR5 A;  3PR6 A;  4Q0H A;  5LBR A;  2PHY A;  4BJP A;  4I3A A;  4WL9 A;  4H6J A;  1NRJ A;  2IA2 A;  3R7W B;  3E4P A;  4PAU A;  4QPR A;  4WEL A;  3NOT C;  1Y28 A;  4IJG A;  2Z6C A;  3E98 A;  4Q0J A;  2VKS A;  3MF0 A;  3UB8 A;  3ULF A;  3LIB A;  1P97 A;  2PYP A;  1T18 A;  4G3W A;  4I38 A;  3FG8 A;  1D7E A;  4O8G A;  3RH8 B;  4ETZ A;  1LT0 A;  2OWH A;  5KSH A;  4CLC C;  3EEH A;  5L8M A;  3UME A;  4H6J B;  4K08 A;  4R6L A;  5C5K A;  4GLQ A;  1MKM A;  3OCN A;  4JGP A;  4MN6 A;  4G3V A;  1G6O A;  5AJG A;  2HV1 A;  3NOP C;  4G3K A;  4EEP A;  3LFV A;  2P7J A;  5HSQ A;  3CUE A;  4EES A;  4CQH A;  2K2N A;  4Q0I A;  4P6Z M;  4HJ3 A;  3LIF A;  1MC0 A;  2VGL M;  1W63 M;  2OAQ 1;  4DMZ A;  5HDS A;  1P9W A;  2NUP C;  2O9A A;  3B47 A;  3BQA A;  2A2L A;  3E4O A;  3T4Q A;  4DJ3 A;  2HJ9 C;  3C8C A;  1DP9 A;  2W1T A;  3CIT A;  3K3C A;  4WN5 A;  4ARZ B;  2LB9 A;  2VV7 A;  4GW9 A;  4OOM A;  4Y2F A;  2OOL A;  3T4L A;  5HWV A;  4E04 A;  2R78 A;  2KLI A;  2Y8H A;  2VLG A;  1LSX A;  1UWP X;  3H7W B;  3KSG A;  5MC7 A;  2VV6 A;  5IU1 A;  2ZBB A;  3KSH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...