4Y2FA

Crystal structure of native gaf domain of potassium sensor histidine kinase kdpd from escherichia coli
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
143
structure length
143
Chain Sequence
GAMDLYEMSKALAVGRSPQDIAATSEQFIASTFHARSQVLLPDDNGKLQPLTHPQGMTPWDDAIAQWSFDKGLPAGAGTDTLPGVPYQILPLKSGEKTYGLVVVEPGNLRQLMIPEQQRLLETFTLLVANALERLTKLAAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor protein KdpD
publication title CRYSTAL STRUCTURE OF NATIVE GAF DOMAIN of POTASSIUM SENSOR HISTIDINE KINASE KDPD FROM ESCHERICHIA COLI
rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 42
structure length 143
sequence length 143
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2015-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13492 GAF_3 GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4y2fA00
2VZWA 2LB9A 3NHQA 1MC0A 4GW9A 3NOUC 5LBRA 2OOLA 4RQ9A 3O5YA 5HPIA 1F5MA 2VEAA 4LRYC 4ETXA 4Y3IA 4YOFA 1YKDA 5C5KA 4ME4A 3OOVA 2K31A 2Y8HA 4DN0A 3NOTC 2W3GA 4ETZA 5DFXA 3E0YA 5K5BA 4R70A 4Q0JA 2VJWA 5TJJA 3RFBA 4DMZA 4MN7A 2KLIA 1MKMA 3KSHA 2IA2A 2VKSA 5HSQA 2K2NA 5AJGA 5HPFA 4FOFA 3NOPC 4Y2FA 1YSPA 4O0PA 1VHMA 2XROA 3S7OA 4IJGA 4G3WA 2XSSA 4QPRA 4Q0HA 3KO6A 4LRXC 3MMHA 4CQHA 4YNRA 4BWIA 4G3KA 2O99A 4R6LA 2KOIA 2Y79A 3BJNA 2M7UA 3R4KA 4MCWA 3DBAA 1YSQA 4Z1WA 5L8MA 4Y5FA 2HGVA 5HL6A 3D3OA 3LFVA 2W1RA 3VV4A 2XRNA 4G3VA 4EUVA 3KSIA 3HCYA 4MMNA 2QYBA 4EU0A 3IBRA 4Q0IA 2M7VA 4E04A 2W3HA 3MQ0A 3E98A 2W3DA 3IBJA 1TF1A 4IUHA 3S7NA 3W2ZA 2O0YA 3EEAA 3S7PA 3KSFA 3K2NA 2W1TA 3TRCA 1ZTUA 5DFYA 1STZA 5I5LA 4IUKA 2B18A 2LB5A 3CITA 4GLQA 3S7QA 4ZRRA 3MF0A 2GX5A 1TD5A 2W3FA 3OBFA 2ZMFA 2W1TB 4PAUA 2O9AA 3KSGA 2W3EA 3G6OA 3CI6A 4O8GA 2O9BA 4LRZE 4MDZA 4O01A 2G7UA 3C2WA 3ZQ5A 2O9CA
chains in the Genus database with same CATH superfamily
3ZG8B 2EWWA 3G2ZA 4S2NC 1CI8A 1NYYA 3BYDA 3A0RA 4RA7A 3QP5A 4KQDA 2D01A 3VOYA 4WELA 4WLAA 1OT6A 4ME4A 3OOVA 5TBMA 4BENA 3IS2A 1I5QA 3T1RA 3G35A 3RFBA 4MN7A 3UPPA 2I72A 1XJ6A 4KZ7A 3CHWP 1UGUA 3OCNA 3HLFA 4KENB 4FOFA 3UB9A 4EW7A 4L9GA 2WADA 3F1PB 3PBNA 4ZBEA 2Y2LA 4FUWA 4N9KA 2JHEA 4PM5A 1GSVA 4MNRA 4OPYA 2WZZA 5FAQA 3VV4A 1K55C 3ULFA 3PBOA 3O87A 4II7A 1H5XA 1L0FA 3IF6B 4WMCD 3NULA 3MQ0A 3E98A 2XK1A 3E4QA 3UB6A 2W3DA 4DE2A 2ZQAA 3ZVTA 3RXXA 5EE8A 4HBUA 4PM7A 1K57A 3G34A 4UAAA 4E6XA 2QMIA 1W79A 2WK0A 1GA9A 2GX5A 4BD1A 5E43A 3LI8A 4U0XA 5G18A 4GS9A 2OWJA 3IXDA 1SKFA 1NRFA 1DP8A 2EA9A 3OZHA 5AQAA 1F5MA 4UA7A 3QP1A 4BBVA 3Q7VB 4OP8A 2PRFA 3ITBA 1MZUA 2WZXA 2P08A 4PM6A 2W3GA 4X1LA 4OPZA 1K56D 4ZTKA 3UE3A 1FR6A 2JKGA 1P0ZA 4NG2A 3UY6A 2PR6A 2RCXA 3T4LA 3MXQA 2XR0A 5HD3A 3S4XA 3C5AA 4Y13A 4ARZA 3C4PA 3AGEA 2ZM8A 1LL9A 5AQ9A 1CEGA 4S2LA 1BTLA 3B3XA 4HJ3A 3HREA 2EFUA 3VMAA 3SZTA 4GNUA 4X25A 3GR2A 5L09A 3WS2A 1S66L 3C38A 4M3KA 3V67A 3IH9A 4OONA 3ICYA 1SDEA 5JYPA 1NWZA 3EQVA 2DNSA 4P6ZS 3KX0X 5GHZA 4LV1A 1O7EA 4PHTA 2OSUA 3OPPA 3DWKA 1KE4A 1VETA 5AQ7A 5J3WA 3LIFA 3ZG9B 3LICA 4O01A 3UB5P 1Q2QA 3EEHA 1LL5A 2JKTI 4BJPA 4KQRA 2VEAA 2Z6CA 4WZ5A 1BYWA 5C5KA 4HOIA 3L9KA 2ZM2A 5MC7A 2K7SA 3LR0A 4E3KA 3CG5A 2KLIA 3UE6A 2V0UA 3N4IA 5E2GA 4WEJA 3Q81A 3WS4A 4QWOA 2OAP1 2YKFA 3RTYA 4G3WA 1QMFA 2KDKA 3T4OA 4OOMA 3VFFA 2XSSA 5J8XA 5CEBA 4HESA 5EM1A 2A3UA 1Q2PA 4ZJ1A 3E4OA 3CJMA 4L0LA 1D06A 4PKYG 2PBDP 1P9RA 1XFNA 4EQIA 1W63Q 5L8MA 5FQ9A 5HL6A 1LSWA 3G31A 4MBHA 2ZM0A 3MS6A 1N9LA 4QY6A 2EX9A 4JF5A 1ES4A 4JXGA 3BWLA 2V2FF 1XGIA 3NC8A 5DF8A 2JKTM 2D02A 2EX8A 3VP1A 2NUPC 1OJGA 1P97A 3QP8A 3CPTA 2VGLS 4CLCE 2HP9A 2QJ5A 2WGVA 3BECA 5I5LA 5KMWA 3SOIA 2Y2NA 4GLQA 1T18A 1H0MA 3QNBA 2CC1A 4R4RA 1TD5A 1TS6A 2W1TB 4O7DA 5F82A 2O9BA 3HLBA 2V20A 2G7UA 3ZQ5A 3TSGA 3NHQA 3BEBA 4X53A 3EGDC 1LLBA 4QHCA 1T1CA 1ZG6A 5FI2A 3PBQA 1LSXA 4I5SA 4R3BA 2PAVP 3HUNA 3F1PA 3Q82A 3VE4A 2VKSA 4DJ3A 4K08A 2GZAA 3PBRA 5U47A 4XXRA 3S7OA 4HQAA 5CEDA 3N7WA 4KG5A 1JTDA 5DTSA 4HIAA 3IF6A 2QJ7A 3MSHA 3D3OA 1FCOA 3DAVA 3LR3A 3OLOA 1VEUB 3P01A 1KDSA 4DE1A 3CAXA 5GLCA 1YMXA 2WKPA 3BY9A 2XQZA 2W3HA 1FQGA 1XKZA 3ZCZA 3S7PA 1ZC2A 5DFYA 1L2SA 1SHVA 1CF0A 2HJEA 3JPUA 2B18A 3IXHA 3HLWA 2W3FA 3MKFA 2VV6A 5IT5A 2ZMFA 4DJ2A 1ESUA 1Y54A 3TE8A 3Q7VA 5JYOA 1TVFA 3LIBA 1FILA 3T50A 1UWPX 2O9CA 1E25A 3MZEA 5TR7A 3IHAA 1KGFA 2ZQDA 4NKPA 3A0VA 1E3UD 2VX8A 4JF4A 1IYOA 4Y3IA 4YOFA 1X0OA 4UQIS 3N6IA 4S2JA 3E2LA 4RX3A 1PZOA 3BY8A 4LCMA 3K3CA 2Q9NA 5F6AA 5HAQA 1YT4A 2QHKA 5HSQA 4M4XA 5L10A 1OJ5A 1NZOA 1XGJA 1AWIA 3UDFA 3LEZA 2VA0A 3A3EA 2VK3A 1ES2A 3VSLA 2PU2A 4KZBA 4YNRA 2ZQ9A 1IKIA 5EFWA 2X01A 1S67L 1SZVA 1DP9A 2J3WA 1IKGA 4Z1WA 3HLCA 3SS4A 3LFVA 1JWZA 1OTIA 5AVFA 1SDNA 3KSIA 2M7VA 1N4OA 4JGQA 4BL2A 2P9VB 2BG1A 4NXFA 4H6JB 4R3JA 1W8QA 3B47A 3MQQA 5HWTA 3ZYTA 1CEFA 5A93A 3ZHHA 3ZDJA 2Y59A 3FYZA 3GQZA 2WYXA 3FZCA 4R38A 3NJAA 1NLZA 2O9AA 3HLDA 1DY6A 4CLCA 5D3OA 4DRTA 2XF3A 3B33A 4N1HA 3UDXA 3ZG0A 1PI4A 4DF6A 3HL9A 2JKFA 2ZL1B 1H3QA 2GJ3A 2Y8HA 4S2NA 3PBTA 1TS8A 2PD8A 3OC2A 5FSRA 2J3TD 2G2WA 3BW6A 3GTCA 4OLDA 1MY8A 4I38A 3HLEA 5GLBA 4JF6A 3NIAA 3FG8A 5FAPA 3IWOA 3PXPA 4WZ4A 4EBNA 2HPBA 5EM0A 2V0WA 4CQHA 3QP6A 3VFHA 2HDUA 2HDSA 4OOYA 4WM9A 4JGPA 3BLMA 2Z6DA 4S2PA 1OMEA 2HP6A 5CECA 3Q07A 4MN6A 4EUVA 2HJ9C 1YLJA 4IVKA 4EBLA 4E04A 1WYCA 1K55A 2Y2MA 3GRJA 2XA7M 4LLOB 4RX2A 3P09A 3S7NA 4R3AA 3C7UA 4PM8A 3FKWA 3LGOA 2W1TA 3LUQA 1YM1A 1FIKA 4B93A 2X71A 4K91A 3OCLA 3E4PA 4KZAA 2ZJ9A 3DTIA 4S2OA 3VSKA 3E2KA 1BULA 4PAUA 1FSYA 5CGSA 2V1BA 4LFUA 2E8JA 2B02A 3BRMA 5A90A 3CZDA 3C2WA 5EUAA 1T1BA 1K54C 4GW9A 5EVIC 3FC7A 3DTMA 3NDEA 1ZHHB 3G4PA 1PZPA 3A3JA 5HL1A 1E4DA 4GD8A 1TEMA 4OQIA 5A8BA 5DFXA 3E0YA 3UO9A 5L2FA 1MWTA 5DKLA 2DCFA 3IF5A 1H8MA 3TW8A 1TDLA 1MKMA 3CMZA 3VP2A 3FWLA 2UV0E 3BQ8A 1HD8A 3NOPC 1F98A 3KYZA 1K6SA 2JN7A 4FSFA 3KO6A 1WYBA 1VEUA 2ZBBA 1CJFA 3FKVA 3WS0A 3ISGA 4HI4A 1NJ4A 3SS5A 2BLSA 3ZVWA 5IS1A 3A0SA 5HZHA 4EV4A 1S4RA 3I7JA 5DTTA 2CMNA 3IH8A 5CTMA 4Z9QA 3VP4A 3UMEA 1W5DA 1XJ3A 1Z09A 4S2MA 2EXAA 4BQMA 1NRJA 4K0WA 4JKTA 4IUHA 3LIEA 3HVFA 1G6OA 3ZFZA 2PYRA 3NBLA 3T4JA 1STZA 5CHJA 2IWCA 5E2FA 4L9FA 3CLOA 3HUMA 3T4TA 4KZ9A 3GMWA 3M2JA 4IBRA 1MBLA 2Y91A 5BOHA 1YLZA 3G2YA 4UEYA 3JVUA 4GB7A 1NLYA 1ALQA 4HBTA 3O5YA 4N92A 3UE0A 3VP0A 5CERA 1DJBA 4GKUA 4KZ6A 5CXWA 4LV0A 4OLGA 3U2AA 3RJUA 1PYYA 4P87A 1YLYA 3UDIA 5DF9A 2EXBA 1H8YA 3KYQA 4A5RA 3DW0A 2INWA 4CLCB 1KE0A 4WYYA 5A91A 4Q0HA 3ITAA 2W27A 4E3LA 2ZQCA 3MZFA 2KOIA 2Y2GA 3W4QA 5FEGA 2P9VA 2J9OA 4LPZA 2RL3A 4H6JA 2C6WB 2QYBA 4EU0A 1K4EA 3LIAA 3V3SA 2WKEA 2Y2OA 2AVXA 3QP4A 3EEAA 2QKPA 2J3TC 3OPHA 4NXEA 4PM9A 3T4SA 3GECA 4JXWA 3CITA 4WBGA 4X68A 2E8IA 2HP5A 3LIDA 2NUTC 1S0WA 1JWVA 2ZC5B 5CX7A 2JC7A 1DP6A 3IWQA 3MBZA 1ODVA 4YWZA 3PYPA 4GOGA 1EWZA 4GCZA 5IU1A 1KVMA 1RCJA 2ZL1A 4BBUA 4DXBA 5DF7A 1IFQA 3MKEA 1S4SA 1PIOA 4JXSA 1LHYA 3RH8B 1PNEA 2I9VA 1YKDA 1SKOB 5L07A 4HHDA 3IX4A 5GHYA 5HAPA 4DN0A 1K25A 2XDMA 3NOTC 4ETZA 1OTBA 3QP2A 4S2IA 5M1AA 1VB6A 3LCEA 3PAEA 4LCLA 4KZ5A 3KSHA 1EROA 4E3NA 3O86A 5EVIB 3W8KA 2PD7A 4N9LA 5AJGA 3BFDA 4WMCA 2QZ6A 2ZC3B 1YMSA 3NCKA 4IEDA 4CPKA 5IHVA 1GA0A 2M1CA 3TG9A 3BFGA 1ZKJA 2PHYA 5FQMA 4EBPA 2A2LA 3W4OA 1PW1A 4FH4A 2OAQ1 4Y5FA 3FPWA 5HW3A 5J4EA 1XJ2A 2Q0OA 1FSWA 3ZNTA 2H0TA 1T19A 1DJAA 4Q0IA 1F2KA 1OT9A 5KSCA 1NY0A 3Q1FA 1C3BA 4LGWA 4FCFA 3W2ZA 1XP4A 1JNUA 4B88A 2HV1A 1KOUA 4LV2A 1GSWA 2GDNA 1YLTA 1PWGA 3JYIA 3P7NA 2JKRM 3UPNA 4MBKA 3M2KA 4X6TA 3VOZA 2J7VA 4EEPA 5F1FA 3MZDA 1XPBA 2Z2MB 1AXBA 3KYEA 3LR4A 4O8GA 4KUOA 3S22A 1LT0A 3V50A 2XEPA 4R1GA 5EOEA 2KX6A 1MC0A 4DDYA 5HX9A 4MN5A 1ONHA 2ZC6B 5HPIA 2XFTA 4WEKA 4LRYC 1YLWA 3D4FA 3WWXA 5CGXA 2PDRA 3T4KA 5K5BA 5EVLA 4F3LB 3F1NB 3OPRA 3EQUA 1J3WA 3A3DA 2ZC4B 5GLDA 4QY5A 1W8YA 4R0QA 2K2NA 3G32A 1FCNA 2WAEA 4WN5A 1HLUP 3LY3A 1TS7A 3O3VA 3LYXA 4NETA 4NEED 4GZBA 3V39A 1K6RA 3N8LA 2FFYA 1WA9A 3H82B 3MJQA 5M19A 3HJIA 2Y55A 3BLSA 1D7EA 1CI9A 3CUEC 5KZHA 3ZG7B 4HY8A 2A49A 2VGKA 2XD1A 5EECA 4HNBA 4EERA 2O0YA 1S6RA 4OVDA 3KSFA 4DDSA 4GDBA 2UWXA 4UQIM 3TRCA 3LEQA 3LY4A 1J9MA 2R78A 4ZRRA 4PKYA 2J80A 4OQHA 2QWSA 4HH3A 2W3EA 3VOLA 3DTKA 2ZC7A 4MDZA 1PI5A 4QJGA 3IXGA 4JPMA 4E3IA 2LB9A 4AFIA 3UE1A 1LI9A 2WKIA 3GDIA 2PBYA 1ZG4A 4OP5A 1V9ZA 2J9PA 3SS3A 4UA6A 1HVBA 2QPNA 2R9WA 3NY4A 2A24B 5HAIA 2EX2A 1ERMA 5GL9A 1XXMA 4HJ6A 2W0NA 2IWBA 1UWNX 3SH7A 1CK3A 3HJKA 3VE3A 1ACFA 4LRXC 4FD8A 1NZUA 4UA9A 1BUEA 5F5YA 4KZ8A 2ZQ8A 1EW0A 1HZOA 3BM6A 5FQKA 1U60A 1YSQA 2FFFB 2GNXA 5EVEA 4XUZA 3BFEA 1MPLA 3PBSA 2OLVA 4B9OA 5FQIA 1RP5A 4E3MA 1W63M 2J8YA 3DTEA 3IBJA 2ZOHA 3HUOA 4BBTA 4Y15A 1ZTUA 1WE4A 4X55A 2B5RA 2XA7S 3G30A 3O88A 1IOUA 4NK3A 1OTAA 3A3IA 1GCEA 1BLCA 2Y2IA 1L0DA 1S1ZA 1KVLA 5KIZA 4RVAA 4JLFA 1IYPA 3MFDA 4LRZE 1I2SA 1Z6FA 5FASA 3BFCA 3OPLA 4DE0A 1SKOA 3FV7A 3BFFA 2Y2HA 2Y2QA 1Y4OA 4I3IA 1RGZA 3IHBA 2OLUA 4U3TA 1KE3A 4GHIB 2P7JA 4KG2A 1K54A 3DWZA 5EPHA 5EVIA 2K31A 2XGNA 2PYPA 4R70A 5KSHA 4OPQA 1PRQA 4DMZA 5DTKA 4H8RA 5FAOA 1GHMA 5DJUA 1W7FA 5EOOA 4PPRA 4Y2FA 4EESA 4GD6A 4KQQA 2Y2KA 1BSGA 3U4LP 5HARA 2VLGA 2MJ6A 4QPRA 4K0XA 3P98A 3Q7ZA 2V1AA 1DRMA 5FI6A 3C7VA 4Y7PA 2VGJA 1VM1A 3JVVA 3MXSA 4KQOA 2ZLYA 4FTXA 1DJCA 5CHUA 1Y28A 3BJNA 3F1OB 1FR1A 2W1RA 1MWUA 4HP4A 1GHPA 5F1GA 1LI0A 4G3VA 4B4XA 1N9BA 3QHYA 2HF6A 1K57C 2L1MA 3QNCA 4GJ4A 4C75A 1IYSA 1G5UA 4X56A 4EXOA 2DMWA 4OH0A 1E3UA 1GHIA 1L3LA 3PAGA 2P04A 2ZQ7A 4KZ3A 3UPOA 5G4YA 1XA7A 2BTFP 4LV3A 2XD5A 4NXBA 2XLNA 5HDCA 3K3DA 2XFSA 3EWKA 5FATA 3KSGA 2P74A 3CI6A 1KDWA 1D1JA 3UN7A 3UB8A 3B42A 1T1AA 3IWIA 1ERQA 2WKRA 3NOUC 1QMEA 4F3LA 3F1NA 1ES3A 4ETXA 2V8FA 4IBXA 3FPVA 5J7EA 3T12B 4C3QA 4ZDXA 4JGRA 4MEZA 2B95A 4P6BA 5HDDA 2G2UA 4HH2A 4OPRA 5TJJA 5FQQA 4E3OA 2IA2A 3LI9A 5TGFA 4OQ0A 5FI7A 4P85A 1YSPA 4O0PA 3UNWA 2H10A 1LSVA 5EV0A 3H7WB 3H82A 3H9WA 5A92A 1JTGA 4QB8A 1S1YA 4MCWA 3DBAA 4Y0OA 5G4ZA 2V1ZA 3NI9A 4ESPA 4OKPA 1F9IA 2PU4A 3PHYA 4EQ1A 2WGWB 3C8CA 3WS5A 3S1YA 1LL8A 2PR5A 3R7WB 2H0YA 1FCMA 2JBFA 1XFQA 1JWPA 5FQJA 3EOIA 2BASA 3T1QB 4P6ZM 4XT2B 3RXWA 4L9EA 1M6KA 4N1XA 3EGXC 3HBRA 4E6WA 5HD5A 1MWSA 4HJ4A 1NXYA 1EI5A 1BZAA 5DJTA 3G6OA 3V5MA 3M6HA 2XH9A 4EEUA 1MKIA 4WZ5C 1RGYA 2VZWA 3PR6A 4GDNA 3VP3A 5AQBA 1KGEA 2A24A 4ZJ3A 2L0WA 1PWCA 1BLPA 1KGGA 1PWDA 4I39A 1PFLA 1O07A 3IX3A 4WL9A 5F69A 3V3RA 3AGDA 2Y4AA 1XJ4A 1OPXA 3T1XA 3L7HA 5TFQA 4CLCD 5TBMB 3IS2B 3MFXA 4ZJ2A 1ES5A 5E2EA 1XX2A 4F94A 4EETB 3MMHA 4MBFA 2FZ0A 4JGOA 4BWIA 4G3KA 2O99A 2JKRI 2ACGA 3GVBA 5CHMA 2JCHA 1JVJA 3BQAA 1BT5A 5FDHA 2HZ5A 1G28A 2Y2PA 4LENA 4X1MA 2R9XA 3IBRA 4S2KA 3TJZC 2VGLM 2DRWA 1MWRA 2V8CA 4JBFA 1TF1A 2HDQA 3MR0A 1MXOA 3SH9A 5FEFA 3MXRA 3WRTA 2LB5A 3MF0A 5F83A 4HP9A 5I94A 1XA1A 4RYEA 4IHQA 2WKQA 1SCWA 4BLMA 4D60A 4GHIA 3GV9A 1PW8A 1YQSA 4D2OA 5LBRA 4RQ9A 3IXBA 1K0KA 2FH5A 4KZ4A 3WS1A 3IX8A 2EFXA 4R23A 4GS9B 3W4PA 2OV5A 1L0GA 1K56A 5F68A 1L0EA 2WKHA 3N8SA 4ZAMA 1CQAA 1OTEA 5EVID 3AGFA 2HDRA 2ZMVA 3WRZA 5FDSA 1I2WA 1IYQA 2PT7A 4R4SA 1VHMA 2VV7A 3F1OA 4IJGA 3IF6C 5CTNA 5GHXA 2JE5A 2WGIA 3GSGA 4XUXA 5HDSA 5M18A 2C5WB 4KUKA 4R6LA 3ZGAB 1ESIA 5E2HA 4KG6A 4EWFA 2M7UA 4IVIA 1OTDA 3LO7A 3N8RA 4Y0TA 1ONGA 2HGVA 3C4OA 4DXCA 3TOIA 4I3JA 2Y2JA 4CJNA 2ZOIA 1M40A 2XRNA 4ARZB 4C6YA 4DKIA 1TDGA 3LR5A 1YPRA 2YKHA 4B4ZA 1TS0A 4P0MA 3A3FA 4OQGA 5DKKA 4GN2A 4I3AA 4JXVA 4WUJA 3K2NA 2H28A 3CUEA 5FL3A 1FOFA 4BMWA 3T1SA 2OWHA 3D72A 1N9OA 1V9YA 4YFMA 3S7QA 4EUZA 3OBFA 3HLGA 3SH8A 3ZG5A 1G6AA 1G68A 3D9YA 3M6BA 4U0TA 1HTZA 3UMDA 2ZD8A 1N9NA 1K38A 2OOLA 1VETB 5DVAA 4HEFA 4X69A 1IEMA 2EX6A 1YLPA 3CWFA 3IT9A 2X02A 2Z2LB 5HWVA 4Q0JA 2VJWA 3NDGA 4QD4A 3H7WA 1A0KA 4MLLA 5HPFA 5CRFA 3PTEA 4BL3A 2XROA 5CGWA 1BLHA 3C30A 4UHUA 1VQQA 2WGWA 1K4FA 4DE3A 3SW1A 1NYMA 2Y79A 4Y0UA 2ZMAA 3R4KA 3R7WA 2IWDA 1P9WA 2Q9MA 4Q8IA 4OOLA 4XT2A 2V9AA 1H8ZA 1YAXA 3HCYA 4MMNA 3IQAA 2H5SA 4YINA 4Y17A 1IELA 4E3JA 4PMAA 5HWWA 2L4RA 3ZNYA 2WAFA 4BD0A 3NECA 4IUKA 1GSXA 4CLCC 4QU3A 2VV8A 1BLSA 5FA7A 4NXGA 3CPTB 5GLAA 3T4QA 4WF0A 3UB7A 4ID4A 3MQOA 4FH2A 2EWVA 5AVEA 5HFOA 2WUQA
chains in the Genus database with same CATH topology
2EWWA 4BBUA 2WKRA 3NOUC 4F3LA 1IFQA 3F1NA 4NKPA 3A0RA 1S4SA 3A0VA 4KQDA 2VX8A 2D01A 4ETXA 4Y3IA 3RH8B 4YOFA 4WELA 4WLAA 3FPVA 1OT6A 1X0OA 2I9VA 1YKDA 5J7EA 4ME4A 4HHDA 4JGRA 4UQIS 3OOVA 4DN0A 5TBMA 3NOTC 3IS2A 4ETZA 5HDDA 3BY8A 4HH2A 1OTBA 5TJJA 3RFBA 3K3CA 1VB6A 4MN7A 1XJ6A 3KSHA 5F6AA 2IA2A 2QHKA 5HSQA 2PD7A 1UGUA 3LI9A 3OCNA 4M4XA 5AJGA 1OJ5A 4FOFA 3UB9A 1YSPA 4EW7A 4O0PA 2VA0A 1LSVA 2M1CA 4L9GA 3F1PB 3H7WB 3H82A 3PBNA 3H9WA 2PHYA 4YNRA 5EFWA 1S67L 2JHEA 2A2LA 1GSVA 1S1YA 1DP9A 2J3WA 2OAQ1 4MCWA 3DBAA 4Z1WA 5G4ZA 4Y5FA 3FPWA 3LFVA 3VV4A 1F9IA 3PHYA 3ULFA 1OTIA 4EQ1A 5J4EA 1XJ2A 5AVFA 3C8CA 3PBOA 3KSIA 1T19A 4II7A 1LL8A 4Q0IA 2PR5A 2M7VA 3R7WB 1OT9A 1XFQA 3MQ0A 3EOIA 4JGQA 2BASA 3E98A 4P6ZM 3E4QA 4XT2B 2W3DA 4NXFA 3UB6A 4H6JB 4L9EA 3W2ZA 1JNUA 3B47A 5HWTA 3MQQA 3EGXC 2HV1A 1KOUA 3ZYTA 1GSWA 5HD5A 3P7NA 2JKRM 4HJ4A 4R38A 2GX5A 3NJAA 4EEPA 1IOUA 1NLZA 2O9AA 3LI8A 3LR4A 3G6OA 4O8GA 5DJTA 4KUOA 4CLCA 1LT0A 4EEUA 4GS9A 2OWJA 2KX6A 3B33A 2VZWA 1MC0A 3PR6A 1DP8A 4MN5A 5HPIA 2EA9A 2A24A 1F5MA 4WEKA 2L0WA 4LRYC 4BBVA 4I39A 1MZUA 1H3QA 2GJ3A 2Y8HA 4WL9A 2P08A 5F69A 2W3GA 3PBTA 2PDRA 3T4KA 5K5BA 1TS8A 4F3LB 3F1NB 2PD8A 3OC2A 3EQUA 2J3TD 3BW6A 3UE3A 4I38A 1XJ4A 1OPXA 2K2NA 1P0ZA 4CLCD 3FG8A 5TBMB 3IS2B 3MFXA 3PXPA 2PR6A 3T4LA 3MXQA 4WN5A 5HD3A 4EETB 2V0WA 1TS7A 3MMHA 4CQHA 4ARZA 2FZ0A 4JGOA 4BWIA 4G3KA 2O99A 2JKRI 3LYXA 4NEED 4HJ3A 4JGPA 3BQAA 1WA9A 3H82B 2Z6DA 3MJQA 3HJIA 4MN6A 1G28A 4EUVA 2HJ9C 1D7EA 3IBRA 3TJZC 2VGLM 4E04A 3CUEC 1S66L 3C38A 3V67A 4HY8A 2XA7M 4LLOB 1TF1A 4HNBA 3S7NA 4R3AA 3ICYA 3MR0A 1NWZA 4EERA 2O0YA 3KSFA 2W1TA 4UQIM 3TRCA 3EQVA 3LUQA 4B93A 4P6ZS 3OCLA 3E4PA 2LB5A 3KX0X 2R78A 4ZRRA 3MF0A 4PKYA 2J80A 4PHTA 4HP9A 2QWSA 4PAUA 4HH3A 2W3EA 5J3WA 2V1BA 3VOLA 4IHQA 3LIFA 2B02A 4MDZA 3LICA 2WKQA 4O01A 4GHIA 3C2WA 1T1BA 2LB9A 3EEHA 4GW9A 5LBRA 3FC7A 4RQ9A 4AFIA 2JKTI 4BJPA 1ZHHB 2FH5A 2VEAA 3GDIA 2Z6CA 1V9ZA 4GS9B 1BYWA 5C5KA 4HOIA 5F68A 5A8BA 5DFXA 5MC7A 3E0YA 2K7SA 3LR0A 2A24B 1OTEA 5DKLA 1H8MA 2KLIA 3TW8A 1MKMA 3UE6A 2V0UA 2ZMVA 4WEJA 4HJ6A 2W0NA 1UWNX 3BQ8A 2OAP1 3NOPC 1F98A 2PT7A 3KYZA 1VHMA 2VV7A 3F1OA 2YKFA 3HJKA 3RTYA 4IJGA 4G3WA 2KDKA 3T4OA 4OOMA 2JN7A 2XSSA 4FSFA 3VE3A 3KO6A 4LRXC 5HDSA 3E4OA 5F5YA 2ZBBA 4KUKA 4R6LA 4L0LA 1EW0A 1D06A 4PKYG 4HI4A 2M7UA 1P9RA 1XFNA 1YSQA 1W63Q 1OTDA 5L8MA 2HGVA 5HL6A 5IS1A 1LSWA 3A0SA 2GNXA 5HZHA 4I3JA 1S4RA 2CMNA 2ZOIA 4ARZB 2XRNA 1N9LA 3UMEA 3LR5A 3PBSA 2YKHA 1XJ3A 1TS0A 3BWLA 4B9OA 1NRJA 1W63M 2JKTM 2D02A 5DKKA 4I3AA 4IUHA 3IBJA 3LIEA 2ZOHA 1OJGA 2NUPC 1P97A 4BBTA 4WUJA 1G6OA 3K2NA 1ZTUA 2VGLS 4CLCE 2PYRA 2H28A 2QJ5A 3T4JA 3CUEA 1STZA 5FL3A 2XA7S 5I5LA 4L9FA 3CLOA 4GLQA 2OWHA 3D72A 3T4TA 1T18A 4BMWA 1N9OA 1V9YA 1OTAA 3S7QA 1TD5A 3OBFA 1TS6A 1S1ZA 2W1TB 5KIZA 2O9BA 4LRZE 3UMDA 2G7UA 3ZQ5A 1N9NA 4UEYA 3JVUA 3NHQA 2OOLA 1NLYA 4I3IA 3O5YA 3EGDC 1T1CA 3CWFA 4GHIB 2P7JA 2K31A 2PYPA 3U2AA 5HWVA 4R70A 4Q0JA 2VJWA 3PBQA 5KSHA 1LSXA 4I5SA 4DMZA 3F1PA 3H7WA 3VE4A 2VKSA 5DJUA 5DF9A 5HPFA 4DJ3A 3KYQA 4K08A 4Y2FA 4EESA 2GZAA 3PBRA 2XROA 3S7OA 2INWA 4CLCB 2VLGA 4HQAA 2MJ6A 4QPRA 3C30A 4Q0HA 2V1AA 1DRMA 2W27A 3SW1A 3JVVA 2KOIA 4KQOA 2Y79A 1Y28A 3BJNA 4HIAA 3F1OB 3R4KA 3R7WA 1P9WA 2QJ7A 3D3OA 2W1RA 3LR3A 3OLOA 4LPZA 4OOLA 3P01A 4HP4A 4XT2A 2V9AA 4G3VA 4H6JA 1YAXA 3CAXA 3HCYA 4MMNA 2QYBA 4EU0A 2WKPA 3BY9A 2HF6A 3LIAA 2L1MA 2W3HA 4GJ4A 4EXOA 2DMWA 5HWWA 2P04A 3EEAA 3S7PA 2QKPA 2J3TC 5DFYA 2L4RA 4NXEA 5G4YA 2HJEA 3T4SA 3GECA 4IUKA 2B18A 3CITA 1GSXA 4CLCC 4NXBA 3LIDA 2VV8A 2NUTC 3K3DA 5HDCA 3EWKA 4NXGA 2W3FA 5IT5A 2VV6A 5CX7A 2ZMFA 4DJ2A 1DP6A 3KSGA 3TE8A 1ODVA 3CI6A 4YWZA 3T4QA 3PYPA 4WF0A 3UB8A 3UB7A 3LIBA 3MQOA 2EWVA 5AVEA 4GCZA 3B42A 5IU1A 3T50A 1T1AA 1UWPX 2O9CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VZW A;  2LB9 A;  3NHQ A;  1MC0 A;  4GW9 A;  3NOU C;  5LBR A;  2OOL A;  4RQ9 A;  3O5Y A;  5HPI A;  1F5M A;  2VEA A;  4LRY C;  4ETX A;  4Y3I A;  4YOF A;  1YKD A;  5C5K A;  4ME4 A;  3OOV A;  2K31 A;  2Y8H A;  4DN0 A;  3NOT C;  2W3G A;  4ETZ A;  5DFX A;  3E0Y A;  5K5B A;  4R70 A;  4Q0J A;  2VJW A;  5TJJ A;  3RFB A;  4DMZ A;  4MN7 A;  2KLI A;  1MKM A;  3KSH A;  2IA2 A;  2VKS A;  5HSQ A;  2K2N A;  5AJG A;  5HPF A;  4FOF A;  3NOP C;  4Y2F A;  1YSP A;  4O0P A;  1VHM A;  2XRO A;  3S7O A;  4IJG A;  4G3W A;  2XSS A;  4QPR A;  4Q0H A;  3KO6 A;  4LRX C;  3MMH A;  4CQH A;  4YNR A;  4BWI A;  4G3K A;  2O99 A;  4R6L A;  2KOI A;  2Y79 A;  3BJN A;  2M7U A;  3R4K A;  4MCW A;  3DBA A;  1YSQ A;  4Z1W A;  5L8M A;  4Y5F A;  2HGV A;  5HL6 A;  3D3O A;  3LFV A;  2W1R A;  3VV4 A;  2XRN A;  4G3V A;  4EUV A;  3KSI A;  3HCY A;  4MMN A;  2QYB A;  4EU0 A;  3IBR A;  4Q0I A;  2M7V A;  4E04 A;  2W3H A;  3MQ0 A;  3E98 A;  2W3D A;  3IBJ A;  1TF1 A;  4IUH A;  3S7N A;  3W2Z A;  2O0Y A;  3EEA A;  3S7P A;  3KSF A;  3K2N A;  2W1T A;  3TRC A;  1ZTU A;  5DFY A;  1STZ A;  5I5L A;  4IUK A;  2B18 A;  2LB5 A;  3CIT A;  4GLQ A;  3S7Q A;  4ZRR A;  3MF0 A;  2GX5 A;  1TD5 A;  2W3F A;  3OBF A;  2ZMF A;  2W1T B;  4PAU A;  2O9A A;  3KSG A;  2W3E A;  3G6O A;  3CI6 A;  4O8G A;  2O9B A;  4LRZ E;  4MDZ A;  4O01 A;  2G7U A;  3C2W A;  3ZQ5 A;  2O9C A; 
#chains in the Genus database with same CATH topology
 3ZG8 B;  2EWW A;  3G2Z A;  4S2N C;  1CI8 A;  1NYY A;  3BYD A;  3A0R A;  4RA7 A;  3QP5 A;  4KQD A;  2D01 A;  3VOY A;  4WEL A;  4WLA A;  1OT6 A;  4ME4 A;  3OOV A;  5TBM A;  4BEN A;  3IS2 A;  1I5Q A;  3T1R A;  3G35 A;  3RFB A;  4MN7 A;  3UPP A;  2I72 A;  1XJ6 A;  4KZ7 A;  3CHW P;  1UGU A;  3OCN A;  3HLF A;  4KEN B;  4FOF A;  3UB9 A;  4EW7 A;  4L9G A;  2WAD A;  3F1P B;  3PBN A;  4ZBE A;  2Y2L A;  4FUW A;  4N9K A;  2JHE A;  4PM5 A;  1GSV A;  4MNR A;  4OPY A;  2WZZ A;  5FAQ A;  3VV4 A;  1K55 C;  3ULF A;  3PBO A;  3O87 A;  4II7 A;  1H5X A;  1L0F A;  3IF6 B;  4WMC D;  3NUL A;  3MQ0 A;  3E98 A;  2XK1 A;  3E4Q A;  3UB6 A;  2W3D A;  4DE2 A;  2ZQA A;  3ZVT A;  3RXX A;  5EE8 A;  4HBU A;  4PM7 A;  1K57 A;  3G34 A;  4UAA A;  4E6X A;  2QMI A;  1W79 A;  2WK0 A;  1GA9 A;  2GX5 A;  4BD1 A;  5E43 A;  3LI8 A;  4U0X A;  5G18 A;  4GS9 A;  2OWJ A;  3IXD A;  1SKF A;  1NRF A;  1DP8 A;  2EA9 A;  3OZH A;  5AQA A;  1F5M A;  4UA7 A;  3QP1 A;  4BBV A;  3Q7V B;  4OP8 A;  2PRF A;  3ITB A;  1MZU A;  2WZX A;  2P08 A;  4PM6 A;  2W3G A;  4X1L A;  4OPZ A;  1K56 D;  4ZTK A;  3UE3 A;  1FR6 A;  2JKG A;  1P0Z A;  4NG2 A;  3UY6 A;  2PR6 A;  2RCX A;  3T4L A;  3MXQ A;  2XR0 A;  5HD3 A;  3S4X A;  3C5A A;  4Y13 A;  4ARZ A;  3C4P A;  3AGE A;  2ZM8 A;  1LL9 A;  5AQ9 A;  1CEG A;  4S2L A;  1BTL A;  3B3X A;  4HJ3 A;  3HRE A;  2EFU A;  3VMA A;  3SZT A;  4GNU A;  4X25 A;  3GR2 A;  5L09 A;  3WS2 A;  1S66 L;  3C38 A;  4M3K A;  3V67 A;  3IH9 A;  4OON A;  3ICY A;  1SDE A;  5JYP A;  1NWZ A;  3EQV A;  2DNS A;  4P6Z S;  3KX0 X;  5GHZ A;  4LV1 A;  1O7E A;  4PHT A;  2OSU A;  3OPP A;  3DWK A;  1KE4 A;  1VET A;  5AQ7 A;  5J3W A;  3LIF A;  3ZG9 B;  3LIC A;  4O01 A;  3UB5 P;  1Q2Q A;  3EEH A;  1LL5 A;  2JKT I;  4BJP A;  4KQR A;  2VEA A;  2Z6C A;  4WZ5 A;  1BYW A;  5C5K A;  4HOI A;  3L9K A;  2ZM2 A;  5MC7 A;  2K7S A;  3LR0 A;  4E3K A;  3CG5 A;  2KLI A;  3UE6 A;  2V0U A;  3N4I A;  5E2G A;  4WEJ A;  3Q81 A;  3WS4 A;  4QWO A;  2OAP 1;  2YKF A;  3RTY A;  4G3W A;  1QMF A;  2KDK A;  3T4O A;  4OOM A;  3VFF A;  2XSS A;  5J8X A;  5CEB A;  4HES A;  5EM1 A;  2A3U A;  1Q2P A;  4ZJ1 A;  3E4O A;  3CJM A;  4L0L A;  1D06 A;  4PKY G;  2PBD P;  1P9R A;  1XFN A;  4EQI A;  1W63 Q;  5L8M A;  5FQ9 A;  5HL6 A;  1LSW A;  3G31 A;  4MBH A;  2ZM0 A;  3MS6 A;  1N9L A;  4QY6 A;  2EX9 A;  4JF5 A;  1ES4 A;  4JXG A;  3BWL A;  2V2F F;  1XGI A;  3NC8 A;  5DF8 A;  2JKT M;  2D02 A;  2EX8 A;  3VP1 A;  2NUP C;  1OJG A;  1P97 A;  3QP8 A;  3CPT A;  2VGL S;  4CLC E;  2HP9 A;  2QJ5 A;  2WGV A;  3BEC A;  5I5L A;  5KMW A;  3SOI A;  2Y2N A;  4GLQ A;  1T18 A;  1H0M A;  3QNB A;  2CC1 A;  4R4R A;  1TD5 A;  1TS6 A;  2W1T B;  4O7D A;  5F82 A;  2O9B A;  3HLB A;  2V20 A;  2G7U A;  3ZQ5 A;  3TSG A;  3NHQ A;  3BEB A;  4X53 A;  3EGD C;  1LLB A;  4QHC A;  1T1C A;  1ZG6 A;  5FI2 A;  3PBQ A;  1LSX A;  4I5S A;  4R3B A;  2PAV P;  3HUN A;  3F1P A;  3Q82 A;  3VE4 A;  2VKS A;  4DJ3 A;  4K08 A;  2GZA A;  3PBR A;  5U47 A;  4XXR A;  3S7O A;  4HQA A;  5CED A;  3N7W A;  4KG5 A;  1JTD A;  5DTS A;  4HIA A;  3IF6 A;  2QJ7 A;  3MSH A;  3D3O A;  1FCO A;  3DAV A;  3LR3 A;  3OLO A;  1VEU B;  3P01 A;  1KDS A;  4DE1 A;  3CAX A;  5GLC A;  1YMX A;  2WKP A;  3BY9 A;  2XQZ A;  2W3H A;  1FQG A;  1XKZ A;  3ZCZ A;  3S7P A;  1ZC2 A;  5DFY A;  1L2S A;  1SHV A;  1CF0 A;  2HJE A;  3JPU A;  2B18 A;  3IXH A;  3HLW A;  2W3F A;  3MKF A;  2VV6 A;  5IT5 A;  2ZMF A;  4DJ2 A;  1ESU A;  1Y54 A;  3TE8 A;  3Q7V A;  5JYO A;  1TVF A;  3LIB A;  1FIL A;  3T50 A;  1UWP X;  2O9C A;  1E25 A;  3MZE A;  5TR7 A;  3IHA A;  1KGF A;  2ZQD A;  4NKP A;  3A0V A;  1E3U D;  2VX8 A;  4JF4 A;  1IYO A;  4Y3I A;  4YOF A;  1X0O A;  4UQI S;  3N6I A;  4S2J A;  3E2L A;  4RX3 A;  1PZO A;  3BY8 A;  4LCM A;  3K3C A;  2Q9N A;  5F6A A;  5HAQ A;  1YT4 A;  2QHK A;  5HSQ A;  4M4X A;  5L10 A;  1OJ5 A;  1NZO A;  1XGJ A;  1AWI A;  3UDF A;  3LEZ A;  2VA0 A;  3A3E A;  2VK3 A;  1ES2 A;  3VSL A;  2PU2 A;  4KZB A;  4YNR A;  2ZQ9 A;  1IKI A;  5EFW A;  2X01 A;  1S67 L;  1SZV A;  1DP9 A;  2J3W A;  1IKG A;  4Z1W A;  3HLC A;  3SS4 A;  3LFV A;  1JWZ A;  1OTI A;  5AVF A;  1SDN A;  3KSI A;  2M7V A;  1N4O A;  4JGQ A;  4BL2 A;  2P9V B;  2BG1 A;  4NXF A;  4H6J B;  4R3J A;  1W8Q A;  3B47 A;  3MQQ A;  5HWT A;  3ZYT A;  1CEF A;  5A93 A;  3ZHH A;  3ZDJ A;  2Y59 A;  3FYZ A;  3GQZ A;  2WYX A;  3FZC A;  4R38 A;  3NJA A;  1NLZ A;  2O9A A;  3HLD A;  1DY6 A;  4CLC A;  5D3O A;  4DRT A;  2XF3 A;  3B33 A;  4N1H A;  3UDX A;  3ZG0 A;  1PI4 A;  4DF6 A;  3HL9 A;  2JKF A;  2ZL1 B;  1H3Q A;  2GJ3 A;  2Y8H A;  4S2N A;  3PBT A;  1TS8 A;  2PD8 A;  3OC2 A;  5FSR A;  2J3T D;  2G2W A;  3BW6 A;  3GTC A;  4OLD A;  1MY8 A;  4I38 A;  3HLE A;  5GLB A;  4JF6 A;  3NIA A;  3FG8 A;  5FAP A;  3IWO A;  3PXP A;  4WZ4 A;  4EBN A;  2HPB A;  5EM0 A;  2V0W A;  4CQH A;  3QP6 A;  3VFH A;  2HDU A;  2HDS A;  4OOY A;  4WM9 A;  4JGP A;  3BLM A;  2Z6D A;  4S2P A;  1OME A;  2HP6 A;  5CEC A;  3Q07 A;  4MN6 A;  4EUV A;  2HJ9 C;  1YLJ A;  4IVK A;  4EBL A;  4E04 A;  1WYC A;  1K55 A;  2Y2M A;  3GRJ A;  2XA7 M;  4LLO B;  4RX2 A;  3P09 A;  3S7N A;  4R3A A;  3C7U A;  4PM8 A;  3FKW A;  3LGO A;  2W1T A;  3LUQ A;  1YM1 A;  1FIK A;  4B93 A;  2X71 A;  4K91 A;  3OCL A;  3E4P A;  4KZA A;  2ZJ9 A;  3DTI A;  4S2O A;  3VSK A;  3E2K A;  1BUL A;  4PAU A;  1FSY A;  5CGS A;  2V1B A;  4LFU A;  2E8J A;  2B02 A;  3BRM A;  5A90 A;  3CZD A;  3C2W A;  5EUA A;  1T1B A;  1K54 C;  4GW9 A;  5EVI C;  3FC7 A;  3DTM A;  3NDE A;  1ZHH B;  3G4P A;  1PZP A;  3A3J A;  5HL1 A;  1E4D A;  4GD8 A;  1TEM A;  4OQI A;  5A8B A;  5DFX A;  3E0Y A;  3UO9 A;  5L2F A;  1MWT A;  5DKL A;  2DCF A;  3IF5 A;  1H8M A;  3TW8 A;  1TDL A;  1MKM A;  3CMZ A;  3VP2 A;  3FWL A;  2UV0 E;  3BQ8 A;  1HD8 A;  3NOP C;  1F98 A;  3KYZ A;  1K6S A;  2JN7 A;  4FSF A;  3KO6 A;  1WYB A;  1VEU A;  2ZBB A;  1CJF A;  3FKV A;  3WS0 A;  3ISG A;  4HI4 A;  1NJ4 A;  3SS5 A;  2BLS A;  3ZVW A;  5IS1 A;  3A0S A;  5HZH A;  4EV4 A;  1S4R A;  3I7J A;  5DTT A;  2CMN A;  3IH8 A;  5CTM A;  4Z9Q A;  3VP4 A;  3UME A;  1W5D A;  1XJ3 A;  1Z09 A;  4S2M A;  2EXA A;  4BQM A;  1NRJ A;  4K0W A;  4JKT A;  4IUH A;  3LIE A;  3HVF A;  1G6O A;  3ZFZ A;  2PYR A;  3NBL A;  3T4J A;  1STZ A;  5CHJ A;  2IWC A;  5E2F A;  4L9F A;  3CLO A;  3HUM A;  3T4T A;  4KZ9 A;  3GMW A;  3M2J A;  4IBR A;  1MBL A;  2Y91 A;  5BOH A;  1YLZ A;  3G2Y A;  4UEY A;  3JVU A;  4GB7 A;  1NLY A;  1ALQ A;  4HBT A;  3O5Y A;  4N92 A;  3UE0 A;  3VP0 A;  5CER A;  1DJB A;  4GKU A;  4KZ6 A;  5CXW A;  4LV0 A;  4OLG A;  3U2A A;  3RJU A;  1PYY A;  4P87 A;  1YLY A;  3UDI A;  5DF9 A;  2EXB A;  1H8Y A;  3KYQ A;  4A5R A;  3DW0 A;  2INW A;  4CLC B;  1KE0 A;  4WYY A;  5A91 A;  4Q0H A;  3ITA A;  2W27 A;  4E3L A;  2ZQC A;  3MZF A;  2KOI A;  2Y2G A;  3W4Q A;  5FEG A;  2P9V A;  2J9O A;  4LPZ A;  2RL3 A;  4H6J A;  2C6W B;  2QYB A;  4EU0 A;  1K4E A;  3LIA A;  3V3S A;  2WKE A;  2Y2O A;  2AVX A;  3QP4 A;  3EEA A;  2QKP A;  2J3T C;  3OPH A;  4NXE A;  4PM9 A;  3T4S A;  3GEC A;  4JXW A;  3CIT A;  4WBG A;  4X68 A;  2E8I A;  2HP5 A;  3LID A;  2NUT C;  1S0W A;  1JWV A;  2ZC5 B;  5CX7 A;  2JC7 A;  1DP6 A;  3IWQ A;  3MBZ A;  1ODV A;  4YWZ A;  3PYP A;  4GOG A;  1EWZ A;  4GCZ A;  5IU1 A;  1KVM A;  1RCJ A;  2ZL1 A;  4BBU A;  4DXB A;  5DF7 A;  1IFQ A;  3MKE A;  1S4S A;  1PIO A;  4JXS A;  1LHY A;  3RH8 B;  1PNE A;  2I9V A;  1YKD A;  1SKO B;  5L07 A;  4HHD A;  3IX4 A;  5GHY A;  5HAP A;  4DN0 A;  1K25 A;  2XDM A;  3NOT C;  4ETZ A;  1OTB A;  3QP2 A;  4S2I A;  5M1A A;  1VB6 A;  3LCE A;  3PAE A;  4LCL A;  4KZ5 A;  3KSH A;  1ERO A;  4E3N A;  3O86 A;  5EVI B;  3W8K A;  2PD7 A;  4N9L A;  5AJG A;  3BFD A;  4WMC A;  2QZ6 A;  2ZC3 B;  1YMS A;  3NCK A;  4IED A;  4CPK A;  5IHV A;  1GA0 A;  2M1C A;  3TG9 A;  3BFG A;  1ZKJ A;  2PHY A;  5FQM A;  4EBP A;  2A2L A;  3W4O A;  1PW1 A;  4FH4 A;  2OAQ 1;  4Y5F A;  3FPW A;  5HW3 A;  5J4E A;  1XJ2 A;  2Q0O A;  1FSW A;  3ZNT A;  2H0T A;  1T19 A;  1DJA A;  4Q0I A;  1F2K A;  1OT9 A;  5KSC A;  1NY0 A;  3Q1F A;  1C3B A;  4LGW A;  4FCF A;  3W2Z A;  1XP4 A;  1JNU A;  4B88 A;  2HV1 A;  1KOU A;  4LV2 A;  1GSW A;  2GDN A;  1YLT A;  1PWG A;  3JYI A;  3P7N A;  2JKR M;  3UPN A;  4MBK A;  3M2K A;  4X6T A;  3VOZ A;  2J7V A;  4EEP A;  5F1F A;  3MZD A;  1XPB A;  2Z2M B;  1AXB A;  3KYE A;  3LR4 A;  4O8G A;  4KUO A;  3S22 A;  1LT0 A;  3V50 A;  2XEP A;  4R1G A;  5EOE A;  2KX6 A;  1MC0 A;  4DDY A;  5HX9 A;  4MN5 A;  1ONH A;  2ZC6 B;  5HPI A;  2XFT A;  4WEK A;  4LRY C;  1YLW A;  3D4F A;  3WWX A;  5CGX A;  2PDR A;  3T4K A;  5K5B A;  5EVL A;  4F3L B;  3F1N B;  3OPR A;  3EQU A;  1J3W A;  3A3D A;  2ZC4 B;  5GLD A;  4QY5 A;  1W8Y A;  4R0Q A;  2K2N A;  3G32 A;  1FCN A;  2WAE A;  4WN5 A;  1HLU P;  3LY3 A;  1TS7 A;  3O3V A;  3LYX A;  4NET A;  4NEE D;  4GZB A;  3V39 A;  1K6R A;  3N8L A;  2FFY A;  1WA9 A;  3H82 B;  3MJQ A;  5M19 A;  3HJI A;  2Y55 A;  3BLS A;  1D7E A;  1CI9 A;  3CUE C;  5KZH A;  3ZG7 B;  4HY8 A;  2A49 A;  2VGK A;  2XD1 A;  5EEC A;  4HNB A;  4EER A;  2O0Y A;  1S6R A;  4OVD A;  3KSF A;  4DDS A;  4GDB A;  2UWX A;  4UQI M;  3TRC A;  3LEQ A;  3LY4 A;  1J9M A;  2R78 A;  4ZRR A;  4PKY A;  2J80 A;  4OQH A;  2QWS A;  4HH3 A;  2W3E A;  3VOL A;  3DTK A;  2ZC7 A;  4MDZ A;  1PI5 A;  4QJG A;  3IXG A;  4JPM A;  4E3I A;  2LB9 A;  4AFI A;  3UE1 A;  1LI9 A;  2WKI A;  3GDI A;  2PBY A;  1ZG4 A;  4OP5 A;  1V9Z A;  2J9P A;  3SS3 A;  4UA6 A;  1HVB A;  2QPN A;  2R9W A;  3NY4 A;  2A24 B;  5HAI A;  2EX2 A;  1ERM A;  5GL9 A;  1XXM A;  4HJ6 A;  2W0N A;  2IWB A;  1UWN X;  3SH7 A;  1CK3 A;  3HJK A;  3VE3 A;  1ACF A;  4LRX C;  4FD8 A;  1NZU A;  4UA9 A;  1BUE A;  5F5Y A;  4KZ8 A;  2ZQ8 A;  1EW0 A;  1HZO A;  3BM6 A;  5FQK A;  1U60 A;  1YSQ A;  2FFF B;  2GNX A;  5EVE A;  4XUZ A;  3BFE A;  1MPL A;  3PBS A;  2OLV A;  4B9O A;  5FQI A;  1RP5 A;  4E3M A;  1W63 M;  2J8Y A;  3DTE A;  3IBJ A;  2ZOH A;  3HUO A;  4BBT A;  4Y15 A;  1ZTU A;  1WE4 A;  4X55 A;  2B5R A;  2XA7 S;  3G30 A;  3O88 A;  1IOU A;  4NK3 A;  1OTA A;  3A3I A;  1GCE A;  1BLC A;  2Y2I A;  1L0D A;  1S1Z A;  1KVL A;  5KIZ A;  4RVA A;  4JLF A;  1IYP A;  3MFD A;  4LRZ E;  1I2S A;  1Z6F A;  5FAS A;  3BFC A;  3OPL A;  4DE0 A;  1SKO A;  3FV7 A;  3BFF A;  2Y2H A;  2Y2Q A;  1Y4O A;  4I3I A;  1RGZ A;  3IHB A;  2OLU A;  4U3T A;  1KE3 A;  4GHI B;  2P7J A;  4KG2 A;  1K54 A;  3DWZ A;  5EPH A;  5EVI A;  2K31 A;  2XGN A;  2PYP A;  4R70 A;  5KSH A;  4OPQ A;  1PRQ A;  4DMZ A;  5DTK A;  4H8R A;  5FAO A;  1GHM A;  5DJU A;  1W7F A;  5EOO A;  4PPR A;  4Y2F A;  4EES A;  4GD6 A;  4KQQ A;  2Y2K A;  1BSG A;  3U4L P;  5HAR A;  2VLG A;  2MJ6 A;  4QPR A;  4K0X A;  3P98 A;  3Q7Z A;  2V1A A;  1DRM A;  5FI6 A;  3C7V A;  4Y7P A;  2VGJ A;  1VM1 A;  3JVV A;  3MXS A;  4KQO A;  2ZLY A;  4FTX A;  1DJC A;  5CHU A;  1Y28 A;  3BJN A;  3F1O B;  1FR1 A;  2W1R A;  1MWU A;  4HP4 A;  1GHP A;  5F1G A;  1LI0 A;  4G3V A;  4B4X A;  1N9B A;  3QHY A;  2HF6 A;  1K57 C;  2L1M A;  3QNC A;  4GJ4 A;  4C75 A;  1IYS A;  1G5U A;  4X56 A;  4EXO A;  2DMW A;  4OH0 A;  1E3U A;  1GHI A;  1L3L A;  3PAG A;  2P04 A;  2ZQ7 A;  4KZ3 A;  3UPO A;  5G4Y A;  1XA7 A;  2BTF P;  4LV3 A;  2XD5 A;  4NXB A;  2XLN A;  5HDC A;  3K3D A;  2XFS A;  3EWK A;  5FAT A;  3KSG A;  2P74 A;  3CI6 A;  1KDW A;  1D1J A;  3UN7 A;  3UB8 A;  3B42 A;  1T1A A;  3IWI A;  1ERQ A;  2WKR A;  3NOU C;  1QME A;  4F3L A;  3F1N A;  1ES3 A;  4ETX A;  2V8F A;  4IBX A;  3FPV A;  5J7E A;  3T12 B;  4C3Q A;  4ZDX A;  4JGR A;  4MEZ A;  2B95 A;  4P6B A;  5HDD A;  2G2U A;  4HH2 A;  4OPR A;  5TJJ A;  5FQQ A;  4E3O A;  2IA2 A;  3LI9 A;  5TGF A;  4OQ0 A;  5FI7 A;  4P85 A;  1YSP A;  4O0P A;  3UNW A;  2H10 A;  1LSV A;  5EV0 A;  3H7W B;  3H82 A;  3H9W A;  5A92 A;  1JTG A;  4QB8 A;  1S1Y A;  4MCW A;  3DBA A;  4Y0O A;  5G4Z A;  2V1Z A;  3NI9 A;  4ESP A;  4OKP A;  1F9I A;  2PU4 A;  3PHY A;  4EQ1 A;  2WGW B;  3C8C A;  3WS5 A;  3S1Y A;  1LL8 A;  2PR5 A;  3R7W B;  2H0Y A;  1FCM A;  2JBF A;  1XFQ A;  1JWP A;  5FQJ A;  3EOI A;  2BAS A;  3T1Q B;  4P6Z M;  4XT2 B;  3RXW A;  4L9E A;  1M6K A;  4N1X A;  3EGX C;  3HBR A;  4E6W A;  5HD5 A;  1MWS A;  4HJ4 A;  1NXY A;  1EI5 A;  1BZA A;  5DJT A;  3G6O A;  3V5M A;  3M6H A;  2XH9 A;  4EEU A;  1MKI A;  4WZ5 C;  1RGY A;  2VZW A;  3PR6 A;  4GDN A;  3VP3 A;  5AQB A;  1KGE A;  2A24 A;  4ZJ3 A;  2L0W A;  1PWC A;  1BLP A;  1KGG A;  1PWD A;  4I39 A;  1PFL A;  1O07 A;  3IX3 A;  4WL9 A;  5F69 A;  3V3R A;  3AGD A;  2Y4A A;  1XJ4 A;  1OPX A;  3T1X A;  3L7H A;  5TFQ A;  4CLC D;  5TBM B;  3IS2 B;  3MFX A;  4ZJ2 A;  1ES5 A;  5E2E A;  1XX2 A;  4F94 A;  4EET B;  3MMH A;  4MBF A;  2FZ0 A;  4JGO A;  4BWI A;  4G3K A;  2O99 A;  2JKR I;  2ACG A;  3GVB A;  5CHM A;  2JCH A;  1JVJ A;  3BQA A;  1BT5 A;  5FDH A;  2HZ5 A;  1G28 A;  2Y2P A;  4LEN A;  4X1M A;  2R9X A;  3IBR A;  4S2K A;  3TJZ C;  2VGL M;  2DRW A;  1MWR A;  2V8C A;  4JBF A;  1TF1 A;  2HDQ A;  3MR0 A;  1MXO A;  3SH9 A;  5FEF A;  3MXR A;  3WRT A;  2LB5 A;  3MF0 A;  5F83 A;  4HP9 A;  5I94 A;  1XA1 A;  4RYE A;  4IHQ A;  2WKQ A;  1SCW A;  4BLM A;  4D60 A;  4GHI A;  3GV9 A;  1PW8 A;  1YQS A;  4D2O A;  5LBR A;  4RQ9 A;  3IXB A;  1K0K A;  2FH5 A;  4KZ4 A;  3WS1 A;  3IX8 A;  2EFX A;  4R23 A;  4GS9 B;  3W4P A;  2OV5 A;  1L0G A;  1K56 A;  5F68 A;  1L0E A;  2WKH A;  3N8S A;  4ZAM A;  1CQA A;  1OTE A;  5EVI D;  3AGF A;  2HDR A;  2ZMV A;  3WRZ A;  5FDS A;  1I2W A;  1IYQ A;  2PT7 A;  4R4S A;  1VHM A;  2VV7 A;  3F1O A;  4IJG A;  3IF6 C;  5CTN A;  5GHX A;  2JE5 A;  2WGI A;  3GSG A;  4XUX A;  5HDS A;  5M18 A;  2C5W B;  4KUK A;  4R6L A;  3ZGA B;  1ESI A;  5E2H A;  4KG6 A;  4EWF A;  2M7U A;  4IVI A;  1OTD A;  3LO7 A;  3N8R A;  4Y0T A;  1ONG A;  2HGV A;  3C4O A;  4DXC A;  3TOI A;  4I3J A;  2Y2J A;  4CJN A;  2ZOI A;  1M40 A;  2XRN A;  4ARZ B;  4C6Y A;  4DKI A;  1TDG A;  3LR5 A;  1YPR A;  2YKH A;  4B4Z A;  1TS0 A;  4P0M A;  3A3F A;  4OQG A;  5DKK A;  4GN2 A;  4I3A A;  4JXV A;  4WUJ A;  3K2N A;  2H28 A;  3CUE A;  5FL3 A;  1FOF A;  4BMW A;  3T1S A;  2OWH A;  3D72 A;  1N9O A;  1V9Y A;  4YFM A;  3S7Q A;  4EUZ A;  3OBF A;  3HLG A;  3SH8 A;  3ZG5 A;  1G6A A;  1G68 A;  3D9Y A;  3M6B A;  4U0T A;  1HTZ A;  3UMD A;  2ZD8 A;  1N9N A;  1K38 A;  2OOL A;  1VET B;  5DVA A;  4HEF A;  4X69 A;  1IEM A;  2EX6 A;  1YLP A;  3CWF A;  3IT9 A;  2X02 A;  2Z2L B;  5HWV A;  4Q0J A;  2VJW A;  3NDG A;  4QD4 A;  3H7W A;  1A0K A;  4MLL A;  5HPF A;  5CRF A;  3PTE A;  4BL3 A;  2XRO A;  5CGW A;  1BLH A;  3C30 A;  4UHU A;  1VQQ A;  2WGW A;  1K4F A;  4DE3 A;  3SW1 A;  1NYM A;  2Y79 A;  4Y0U A;  2ZMA A;  3R4K A;  3R7W A;  2IWD A;  1P9W A;  2Q9M A;  4Q8I A;  4OOL A;  4XT2 A;  2V9A A;  1H8Z A;  1YAX A;  3HCY A;  4MMN A;  3IQA A;  2H5S A;  4YIN A;  4Y17 A;  1IEL A;  4E3J A;  4PMA A;  5HWW A;  2L4R A;  3ZNY A;  2WAF A;  4BD0 A;  3NEC A;  4IUK A;  1GSX A;  4CLC C;  4QU3 A;  2VV8 A;  1BLS A;  5FA7 A;  4NXG A;  3CPT B;  5GLA A;  3T4Q A;  4WF0 A;  3UB7 A;  4ID4 A;  3MQO A;  4FH2 A;  2EWV A;  5AVE A;  5HFO A;  2WUQ A; 
#chains in the Genus database with same CATH homology
 2EWW A;  4BBU A;  2WKR A;  3NOU C;  4F3L A;  1IFQ A;  3F1N A;  4NKP A;  3A0R A;  1S4S A;  3A0V A;  4KQD A;  2VX8 A;  2D01 A;  4ETX A;  4Y3I A;  3RH8 B;  4YOF A;  4WEL A;  4WLA A;  3FPV A;  1OT6 A;  1X0O A;  2I9V A;  1YKD A;  5J7E A;  4ME4 A;  4HHD A;  4JGR A;  4UQI S;  3OOV A;  4DN0 A;  5TBM A;  3NOT C;  3IS2 A;  4ETZ A;  5HDD A;  3BY8 A;  4HH2 A;  1OTB A;  5TJJ A;  3RFB A;  3K3C A;  1VB6 A;  4MN7 A;  1XJ6 A;  3KSH A;  5F6A A;  2IA2 A;  2QHK A;  5HSQ A;  2PD7 A;  1UGU A;  3LI9 A;  3OCN A;  4M4X A;  5AJG A;  1OJ5 A;  4FOF A;  3UB9 A;  1YSP A;  4EW7 A;  4O0P A;  2VA0 A;  1LSV A;  2M1C A;  4L9G A;  3F1P B;  3H7W B;  3H82 A;  3PBN A;  3H9W A;  2PHY A;  4YNR A;  5EFW A;  1S67 L;  2JHE A;  2A2L A;  1GSV A;  1S1Y A;  1DP9 A;  2J3W A;  2OAQ 1;  4MCW A;  3DBA A;  4Z1W A;  5G4Z A;  4Y5F A;  3FPW A;  3LFV A;  3VV4 A;  1F9I A;  3PHY A;  3ULF A;  1OTI A;  4EQ1 A;  5J4E A;  1XJ2 A;  5AVF A;  3C8C A;  3PBO A;  3KSI A;  1T19 A;  4II7 A;  1LL8 A;  4Q0I A;  2PR5 A;  2M7V A;  3R7W B;  1OT9 A;  1XFQ A;  3MQ0 A;  3EOI A;  4JGQ A;  2BAS A;  3E98 A;  4P6Z M;  3E4Q A;  4XT2 B;  2W3D A;  4NXF A;  3UB6 A;  4H6J B;  4L9E A;  3W2Z A;  1JNU A;  3B47 A;  5HWT A;  3MQQ A;  3EGX C;  2HV1 A;  1KOU A;  3ZYT A;  1GSW A;  5HD5 A;  3P7N A;  2JKR M;  4HJ4 A;  4R38 A;  2GX5 A;  3NJA A;  4EEP A;  1IOU A;  1NLZ A;  2O9A A;  3LI8 A;  3LR4 A;  3G6O A;  4O8G A;  5DJT A;  4KUO A;  4CLC A;  1LT0 A;  4EEU A;  4GS9 A;  2OWJ A;  2KX6 A;  3B33 A;  2VZW A;  1MC0 A;  3PR6 A;  1DP8 A;  4MN5 A;  5HPI A;  2EA9 A;  2A24 A;  1F5M A;  4WEK A;  2L0W A;  4LRY C;  4BBV A;  4I39 A;  1MZU A;  1H3Q A;  2GJ3 A;  2Y8H A;  4WL9 A;  2P08 A;  5F69 A;  2W3G A;  3PBT A;  2PDR A;  3T4K A;  5K5B A;  1TS8 A;  4F3L B;  3F1N B;  2PD8 A;  3OC2 A;  3EQU A;  2J3T D;  3BW6 A;  3UE3 A;  4I38 A;  1XJ4 A;  1OPX A;  2K2N A;  1P0Z A;  4CLC D;  3FG8 A;  5TBM B;  3IS2 B;  3MFX A;  3PXP A;  2PR6 A;  3T4L A;  3MXQ A;  4WN5 A;  5HD3 A;  4EET B;  2V0W A;  1TS7 A;  3MMH A;  4CQH A;  4ARZ A;  2FZ0 A;  4JGO A;  4BWI A;  4G3K A;  2O99 A;  2JKR I;  3LYX A;  4NEE D;  4HJ3 A;  4JGP A;  3BQA A;  1WA9 A;  3H82 B;  2Z6D A;  3MJQ A;  3HJI A;  4MN6 A;  1G28 A;  4EUV A;  2HJ9 C;  1D7E A;  3IBR A;  3TJZ C;  2VGL M;  4E04 A;  3CUE C;  1S66 L;  3C38 A;  3V67 A;  4HY8 A;  2XA7 M;  4LLO B;  1TF1 A;  4HNB A;  3S7N A;  4R3A A;  3ICY A;  3MR0 A;  1NWZ A;  4EER A;  2O0Y A;  3KSF A;  2W1T A;  4UQI M;  3TRC A;  3EQV A;  3LUQ A;  4B93 A;  4P6Z S;  3OCL A;  3E4P A;  2LB5 A;  3KX0 X;  2R78 A;  4ZRR A;  3MF0 A;  4PKY A;  2J80 A;  4PHT A;  4HP9 A;  2QWS A;  4PAU A;  4HH3 A;  2W3E A;  5J3W A;  2V1B A;  3VOL A;  4IHQ A;  3LIF A;  2B02 A;  4MDZ A;  3LIC A;  2WKQ A;  4O01 A;  4GHI A;  3C2W A;  1T1B A;  2LB9 A;  3EEH A;  4GW9 A;  5LBR A;  3FC7 A;  4RQ9 A;  4AFI A;  2JKT I;  4BJP A;  1ZHH B;  2FH5 A;  2VEA A;  3GDI A;  2Z6C A;  1V9Z A;  4GS9 B;  1BYW A;  5C5K A;  4HOI A;  5F68 A;  5A8B A;  5DFX A;  5MC7 A;  3E0Y A;  2K7S A;  3LR0 A;  2A24 B;  1OTE A;  5DKL A;  1H8M A;  2KLI A;  3TW8 A;  1MKM A;  3UE6 A;  2V0U A;  2ZMV A;  4WEJ A;  4HJ6 A;  2W0N A;  1UWN X;  3BQ8 A;  2OAP 1;  3NOP C;  1F98 A;  2PT7 A;  3KYZ A;  1VHM A;  2VV7 A;  3F1O A;  2YKF A;  3HJK A;  3RTY A;  4IJG A;  4G3W A;  2KDK A;  3T4O A;  4OOM A;  2JN7 A;  2XSS A;  4FSF A;  3VE3 A;  3KO6 A;  4LRX C;  5HDS A;  3E4O A;  5F5Y A;  2ZBB A;  4KUK A;  4R6L A;  4L0L A;  1EW0 A;  1D06 A;  4PKY G;  4HI4 A;  2M7U A;  1P9R A;  1XFN A;  1YSQ A;  1W63 Q;  1OTD A;  5L8M A;  2HGV A;  5HL6 A;  5IS1 A;  1LSW A;  3A0S A;  2GNX A;  5HZH A;  4I3J A;  1S4R A;  2CMN A;  2ZOI A;  4ARZ B;  2XRN A;  1N9L A;  3UME A;  3LR5 A;  3PBS A;  2YKH A;  1XJ3 A;  1TS0 A;  3BWL A;  4B9O A;  1NRJ A;  1W63 M;  2JKT M;  2D02 A;  5DKK A;  4I3A A;  4IUH A;  3IBJ A;  3LIE A;  2ZOH A;  1OJG A;  2NUP C;  1P97 A;  4BBT A;  4WUJ A;  1G6O A;  3K2N A;  1ZTU A;  2VGL S;  4CLC E;  2PYR A;  2H28 A;  2QJ5 A;  3T4J A;  3CUE A;  1STZ A;  5FL3 A;  2XA7 S;  5I5L A;  4L9F A;  3CLO A;  4GLQ A;  2OWH A;  3D72 A;  3T4T A;  1T18 A;  4BMW A;  1N9O A;  1V9Y A;  1OTA A;  3S7Q A;  1TD5 A;  3OBF A;  1TS6 A;  1S1Z A;  2W1T B;  5KIZ A;  2O9B A;  4LRZ E;  3UMD A;  2G7U A;  3ZQ5 A;  1N9N A;  4UEY A;  3JVU A;  3NHQ A;  2OOL A;  1NLY A;  4I3I A;  3O5Y A;  3EGD C;  1T1C A;  3CWF A;  4GHI B;  2P7J A;  2K31 A;  2PYP A;  3U2A A;  5HWV A;  4R70 A;  4Q0J A;  2VJW A;  3PBQ A;  5KSH A;  1LSX A;  4I5S A;  4DMZ A;  3F1P A;  3H7W A;  3VE4 A;  2VKS A;  5DJU A;  5DF9 A;  5HPF A;  4DJ3 A;  3KYQ A;  4K08 A;  4Y2F A;  4EES A;  2GZA A;  3PBR A;  2XRO A;  3S7O A;  2INW A;  4CLC B;  2VLG A;  4HQA A;  2MJ6 A;  4QPR A;  3C30 A;  4Q0H A;  2V1A A;  1DRM A;  2W27 A;  3SW1 A;  3JVV A;  2KOI A;  4KQO A;  2Y79 A;  1Y28 A;  3BJN A;  4HIA A;  3F1O B;  3R4K A;  3R7W A;  1P9W A;  2QJ7 A;  3D3O A;  2W1R A;  3LR3 A;  3OLO A;  4LPZ A;  4OOL A;  3P01 A;  4HP4 A;  4XT2 A;  2V9A A;  4G3V A;  4H6J A;  1YAX A;  3CAX A;  3HCY A;  4MMN A;  2QYB A;  4EU0 A;  2WKP A;  3BY9 A;  2HF6 A;  3LIA A;  2L1M A;  2W3H A;  4GJ4 A;  4EXO A;  2DMW A;  5HWW A;  2P04 A;  3EEA A;  3S7P A;  2QKP A;  2J3T C;  5DFY A;  2L4R A;  4NXE A;  5G4Y A;  2HJE A;  3T4S A;  3GEC A;  4IUK A;  2B18 A;  3CIT A;  1GSX A;  4CLC C;  4NXB A;  3LID A;  2VV8 A;  2NUT C;  3K3D A;  5HDC A;  3EWK A;  4NXG A;  2W3F A;  5IT5 A;  2VV6 A;  5CX7 A;  2ZMF A;  4DJ2 A;  1DP6 A;  3KSG A;  3TE8 A;  1ODV A;  3CI6 A;  4YWZ A;  3T4Q A;  3PYP A;  4WF0 A;  3UB8 A;  3UB7 A;  3LIB A;  3MQO A;  2EWV A;  5AVE A;  4GCZ A;  3B42 A;  5IU1 A;  3T50 A;  1T1A A;  1UWP X;  2O9C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...