4Y2FA

Crystal structure of native gaf domain of potassium sensor histidine kinase kdpd from escherichia coli
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
143
structure length
143
Chain Sequence
GAMDLYEMSKALAVGRSPQDIAATSEQFIASTFHARSQVLLPDDNGKLQPLTHPQGMTPWDDAIAQWSFDKGLPAGAGTDTLPGVPYQILPLKSGEKTYGLVVVEPGNLRQLMIPEQQRLLETFTLLVANALERLTKLAAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title CRYSTAL STRUCTURE OF NATIVE GAF DOMAIN of POTASSIUM SENSOR HISTIDINE KINASE KDPD FROM ESCHERICHIA COLI
rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Sensor protein KdpD
total genus 42
structure length 143
sequence length 143
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2015-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13492 GAF_3 GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4y2fA00
1MKMA 4MDZA 4YOFA 4GLQA 4ME4A 2LB5A 2O9AA 2M7UA 4R70A 2VKSA 4R6LA 2W1TA 5DFXA 2K31A 2O9BA 1TF1A 5L8MA 4IUHA 2KLIA 2W3DA 2KOIA 3EEAA 4G3KA 4Y3IA 5I5LA 4QPRA 1VHMA 3CITA 3KSIA 4FOFA 2B18A 4O0PA 1YKDA 3OBFA 3G6OA 4Q0IA 3IBJA 4G3WA 2ZMFA 2IA2A 4MN7A 4BWIA 3CI6A 4DN0A 2LB9A 2W1TB 2W3HA 2QYBA 4DMZA 1STZA 4ZRRA 3S7NA 3S7OA 5AJGA 2VZWA 2W1RA 1F5MA 1TD5A 3KSGA 3BJNA 3S7QA 3D3OA 3OOVA 5DFYA 2K2NA 5HSQA 3IBRA 4LRYC 4LRZE 3NOTC 2XROA 1YSQA 2O9CA 3W2ZA 2XRNA 3TRCA 1ZTUA 5LBRA 2XSSA 4LRXC 3O5YA 4G3VA 2W3FA 3E0YA 2Y79A 2VJWA 2GX5A 3MMHA 4O01A 5K5BA 4MCWA 2VEAA 3KSFA 3ZQ5A 2HGVA 4E04A 3DBAA 3MQ0A 4GW9A 2O0YA 4PAUA 2Y8HA 3MF0A 2W3EA 1YSPA 4ETZA 3LFVA 3HCYA 3E98A 4CQHA 4EU0A 3VV4A 3NHQA 4IUKA 1MC0A 4YNRA 3S7PA 5C5KA 4RQ9A 2G7UA 2O99A 3C2WA 4Q0HA 3KSHA 2M7VA 4ETXA 3NOPC 4Y2FA 4Y5FA 4Z1WA 3RFBA 3K2NA 4MMNA 4O8GA 3R4KA 5TJJA 2OOLA 4EUVA 3NOUC 5HPFA 5HL6A 4Q0JA 4IJGA 3KO6A 5HPIA 2W3GA
chains in the Genus database with same CATH superfamily
1K56A 2ACGA 3E4PA 3SS5A 3ZFZA 4R70A 5EUAA 4R3BA 2NUPC 1ALQA 2O9BA 3SW1A 4N1HA 1D06A 4HHDA 1Z09A 2ZQCA 1BUEA 5HZHA 3UB8A 2J80A 5HDCA 3LI9A 3PBOA 3UDIA 2JN7A 3OBFA 4CPKA 3PBRA 2ZMFA 2C5WB 5FAPA 3BY9A 4X53A 3BFGA 4XXRA 4I5SA 4KUOA 3MQOA 1OTBA 4JXVA 4IVKA 1E25A 2QYBA 5F68A 4OP5A 2RL3A 2HV1A 3T4JA 1PYYA 3G32A 4A5RA 4HY8A 1MWUA 1S1YA 4JF6A 3SOIA 2EX6A 1YLJA 4E6XA 1ZG6A 2I9VA 1Y4OA 1E3UD 3VP2A 1NRFA 2ZJ9A 3BWLA 3B47A 4GD6A 2A49A 4JGPA 1LSWA 4LRXC 1ACFA 4G3VA 1T1AA 1MWTA 3BYDA 1K0KA 1G6OA 1YQSA 2FH5A 2P08A 5FAQA 3H7WA 5DF7A 3GVBA 3KSFA 1LHYA 3E4QA 1CQAA 5FATA 4E04A 3H7WB 3V39A 4X68A 3EGXC 4ETZA 4R38A 5CX7A 1LLBA 5EOEA 2X02A 5C5KA 3AGDA 4RQ9A 3IS2B 3IH9A 2HJ9C 3JYIA 1GCEA 4JLFA 4PHTA 2PYPA 3L7HA 2W3GA 1M6KA 4IBRA 5E43A 2HPBA 4QY6A 3VFFA 2V2FF 3VSLA 3FV7A 1H5XA 4C3QA 3K3DA 5TR7A 4WEJA 3IF6C 5I5LA 3QNBA 3H82A 4O0PA 1LI9A 3T50A 4G3WA 3E2KA 4CLCB 3KX0X 4JF4A 1JWPA 4LENA 4DN0A 1CI9A 2WAFA 4XUZA 1YLPA 1NXYA 2JKTM 3GR2A 5EPHA 3V50A 3EGDC 2MJ6A 5GHZA 1MWSA 1DJBA 1PRQA 1GSXA 3P7NA 4LV0A 3C30A 2Y2HA 1ZTUA 2FZ0A 4KZ8A 5DTSA 5IU1A 1ES5A 2GX5A 5GLCA 4E6WA 4JGOA 5EFWA 4E3JA 4UEYA 3LIDA 1YLZA 3LCEA 4M4XA 3OCLA 3OZHA 4X1LA 2P9VB 3UE3A 1FR6A 4Q8IA 4JGRA 2X71A 3U2AA 1MC0A 1P9RA 4X55A 1PI4A 4Y2FA 3MBZA 5G18A 4JXWA 3Q81A 1T19A 4WN5A 5CGXA 3VE4A 3KO6A 4KZ3A 1LL5A 5KSCA 4ME4A 1P0ZA 1PZOA 2VV6A 5CHMA 3LY4A 4G3KA 5A8BA 4KG2A 2Y2KA 5HW3A 3Q82A 3HLWA 4BL3A 3FPWA 1ESIA 1CJFA 5EM1A 4ZAMA 2YKFA 2W0NA 4BWIA 1T18A 5FI2A 2LB9A 3LR3A 3VOZA 4Y17A 1G6AA 2WKHA 1SZVA 1BLSA 5AJGA 4OOLA 1LI0A 3KSGA 5A90A 3CAXA 1XX2A 5FEGA 3IBRA 3TOIA 4IVIA 3LR0A 4PM8A 2Q9MA 3W2ZA 2GDNA 3G2ZA 1XKZA 4BL2A 4CLCA 1NYMA 2Q9NA 4P6BA 3O5YA 2Y2MA 4L9EA 1ONHA 5DTTA 3O88A 1RGZA 5EVID 3N4IA 3IXDA 2BTFP 2K7SA 1H0MA 4M3KA 2ZM0A 2HP6A 4S2KA 3ICYA 2HGVA 3GTCA 3A3IA 3N6IA 2H5SA 4QHCA 3MQ0A 1Y28A 2O0YA 3IF6A 3FG8A 5DTKA 4PAUA 5EE8A 1D1JA 4EQIA 1QMFA 4GN2A 3OC2A 1K4EA 2QHKA 2PD7A 4KZ6A 1EROA 2J9OA 5M1AA 2E8JA 2G7UA 5FL3A 2Y2LA 4PKYG 4UQIM 3UO9A 4XUXA 4N9KA 3RFBA 3VP3A 4QY5A 4HJ6A 1H8YA 1PZPA 2W1TA 3C5AA 3C8CA 4DJ2A 1N9BA 3ZG8B 2M7UA 1CI8A 2PAVP 2NUTC 4HNBA 5L8MA 3BY8A 1M40A 2W3DA 1YAXA 1W63Q 1NY0A 1XP4A 2XA7S 1BTLA 3WS2A 1IKIA 3GDIA 3HL9A 3G6OA 1K54C 3O3VA 3UB6A 1S6RA 2R9XA 3BLMA 4X69A 2XD5A 3S1YA 4K0WA 1HD8A 4DDSA 2H10A 3VMAA 3CJMA 4UAAA 4NXBA 5GLAA 5F1GA 5TGFA 3F1OB 3NOTC 1ONGA 1Y54A 3PAGA 4FSFA 3AGEA 1PNEA 1H3QA 2EFUA 1OT9A 3UNWA 3IXGA 2OWJA 1GHMA 3M2KA 4Z9QA 3UB7A 5EVIC 3ZQ5A 3WS5A 2L0WA 4OKPA 1UGUA 2P04A 2Y55A 2EFXA 2VV7A 2WKQA 4FUWA 4HJ4A 2WGWA 4NETA 3VV4A 3RH8B 3EQUA 5GLDA 3EEHA 2DMWA 3A0SA 4X25A 2DCFA 3NDEA 4DXCA 1W63M 4E3LA 4QJGA 1GA9A 3G30A 3T4SA 1BLPA 1MKMA 4ZTKA 5TFQA 4NEED 1IOUA 3IXBA 2PU2A 4WM9A 1CEGA 3Q7VB 2CC1A 4IUHA 4F94A 1JWZA 4ZDXA 3BLSA 4Y7PA 5FQ9A 3EEAA 1W8QA 1VHMA 3CITA 4H8RA 2WKEA 4F3LA 2IA2A 5F1FA 2HJEA 1KE0A 4OPYA 3O86A 3ISGA 4D60A 4R23A 1GHPA 5EM0A 4EUZA 3IXHA 2Z2MB 5EOOA 3PTEA 4S2MA 3S22A 2VA0A 3C4PA 3S7OA 1N4OA 1C3BA 1K6RA 3IX3A 3S7QA 4U0TA 4EERA 2WGWB 2Y4AA 4EBLA 4JXSA 1TDLA 3ZG5A 1KOUA 3HLCA 2Y2OA 4PM5A 3NBLA 5EVLA 2A2LA 2B5RA 3UMDA 3MMHA 5E2GA 1TEMA 4OQGA 3QP6A 4FTXA 3VSKA 2WKRA 4DDYA 2V9AA 4KQOA 3T4OA 2XA7M 5CERA 2WKIA 3LYXA 1OTAA 2OAP1 1YMXA 2QJ7A 2Y2JA 3MZDA 4Z1WA 4AFIA 4S2JA 3ZNTA 1YPRA 2A24B 2XSSA 5CXWA 1DJAA 4RX2A 2WGIA 4YOFA 3UMEA 1VQQA 4N92A 5FAOA 3TJZC 4EBNA 4F3LB 3MJQA 3GQZA 4BBVA 1NZOA 4GNUA 4WZ5C 1HLUP 3NULA 4QPRA 1MPLA 4OPRA 3K3CA 3DTEA 1YLTA 4OLDA 4X56A 1NYYA 2PU4A 1LT0A 1BT5A 3BM6A 3V3RA 1STZA 2ZC6B 1BYWA 5FSRA 2VZWA 4ZBEA 1F5MA 5DJTA 4QU3A 2WYXA 3GMWA 2K2NA 1TS0A 3UDFA 3LEZA 1D7EA 2JKRI 2XROA 3WS0A 2ZBBA 5HAPA 2HZ5A 3TW8A 3E4OA 4RYEA 3DW0A 4H6JB 2ZL1B 2HDRA 3S4XA 4EW7A 1K56D 4GHIA 5FDSA 2OAQ1 4WMCD 1SHVA 2QPNA 4MEZA 1PWCA 3FYZA 1G5UA 2W3EA 4MN5A 3LFVA 5HD3A 2Q0OA 2QKPA 1XJ2A 3OCNA 4B93A 2VLGA 1W8YA 4OOYA 1XFQA 4OOMA 3NY4A 3KYEA 2GJ3A 3IWOA 3U4LP 2EA9A 1HZOA 5CGSA 3IHAA 2B95A 5HAQA 2O9AA 4HP9A 3KYZA 4UHUA 5KMWA 3PAEA 2V0UA 2KOIA 1VM1A 3D72A 4HP4A 2EX2A 3PXPA 5FQQA 3QP4A 4X1MA 2BG1A 2W27A 1FILA 4H6JA 2OSUA 2ZL1A 4MN7A 4LCLA 3ZVWA 3G2YA 4X6TA 2A24A 3ZHHA 4BJPA 4K0XA 1FSWA 5A92A 1XA7A 4MN6A 4IHQA 4S2LA 5CTNA 1XJ3A 5G4ZA 3SH8A 4BLMA 3E2LA 1PW1A 2EX9A 3WWXA 1YMSA 2Y2GA 3IF5A 3CG5A 1QMEA 1FSYA 4GDBA 1SDNA 1ERQA 2JC7A 1TS8A 5CTMA 2VJWA 4EV4A 4FD8A 4KZ9A 3VOLA 2AVXA 3HBRA 2V0WA 2OWHA 3M6BA 1IFQA 5JYPA 5EECA 2EXBA 1N9NA 1N9OA 3E98A 3D9YA 4R4RA 2O99A 2M7VA 3UPPA 1TVFA 3DWKA 4OH0A 5AVEA 4OQIA 3AGFA 2XQZA 4IJGA 2EWVA 2GZAA 4B9OA 5J7EA 5DF9A 1G28A 1IKGA 3UE1A 3W4OA 2XH9A 5FEFA 3CPTA 2KLIA 1HVBA 4GCZA 5CEDA 4I3AA 3Q7ZA 5FDHA 1OTDA 1K38A 3OLOA 4E3KA 4BBTA 4S2OA 3T12B 1V9YA 4OP8A 2WZXA 1O7EA 4NG2A 4LV1A 3MZEA 1YT4A 2PD8A 1BLHA 4RX3A 4GKUA 3NC8A 5HAIA 2Z6DA 3ZG9B 3QP5A 5FQJA 3ZGAB 2PR5A 3MS6A 2J7VA 2P74A 1UWPX 2HP9A 3QHYA 2EX8A 1MWRA 1BSGA 4WYYA 4WZ4A 3JPUA 4RVAA 3M2JA 5IT5A 3HUNA 4KZ5A 2GNXA 1JVJA 4GS9A 2VGLM 4P6ZS 3N7WA 5AQ7A 1T1BA 4DE2A 3UB9A 3KYQA 2P9VA 2IWCA 3PBNA 4QWOA 2XF3A 3S7PA 3QP2A 2ZC7A 4GDNA 4JXGA 1WYCA 1OPXA 4Y0UA 4BQMA 4KQQA 2OOLA 1U60A 3SH9A 4OPQA 3T1SA 5KSHA 4MDZA 2Y2NA 3GSGA 3DAVA 4UQIS 3CZDA 2KX6A 4LGWA 1TF1A 3P09A 1H8ZA 4KUKA 1W5DA 2FFFB 5L09A 2ZC5B 2WAEA 3A0VA 4ZJ3A 3N8RA 5FQIA 2ZQDA 3BRMA 4MLLA 2W1TB 2ZQ9A 3LY3A 1ESUA 1ZHHB 2G2UA 1LSXA 1O07A 1OTEA 3EOIA 1IYQA 3HLGA 2A3UA 2ZQ7A 4DF6A 4IBXA 2INWA 4MBKA 3LO7A 4HBTA 2XGNA 3BEBA 2WKPA 3VFHA 1PI5A 1NLYA 5HARA 3WS4A 3HLFA 5U47A 2VEAA 1S1ZA 1K25A 3PBTA 1S67L 3W4QA 4FH2A 4OLGA 1EWZA 1K55C 4ZJ2A 4EESA 5HDSA 4WLAA 1LL8A 1MKIA 1JNUA 2JKGA 5GL9A 4CQHA 3WRTA 4GD8A 4NXFA 1VEUA 4NK3A 4ETXA 4EWFA 3HREA 4LLOB 4KZ7A 3G34A 5HPFA 3TE8A 3D4FA 3HJIA 5EVEA 3TG9A 4NXGA 4EXOA 3OPHA 3UDXA 5HD5A 2ZLYA 3IX4A 1CF0A 1NWZA 4LV2A 5DFXA 1V9ZA 1LL9A 2J3TC 3BW6A 1XFNA 1FQGA 3SS4A 1JTDA 4Y3IA 4FOFA 4WBGA 3ITBA 5E2HA 1YKDA 4R4SA 1KVMA 4ID4A 5AQ9A 4B4ZA 4HQAA 4K91A 3MKFA 1FIKA 1JTGA 4I3JA 3HLEA 3NIAA 2PYRA 2XEPA 3LIEA 4NKPA 4S2NC 3BFDA 3T4KA 5TBMB 5GHXA 2Y59A 3PYPA 1L0DA 2O9CA 1HTZA 2ZMVA 4QD4A 2J9PA 4E3NA 3W4PA 2JKFA 3PHYA 3E0YA 3F1PB 4C6YA 1F2KA 2PBYA 4R0QA 5DJUA 1KGGA 2WUQA 4U0XA 1G68A 1K57A 2VV8A 3WS1A 1EI5A 1YSPA 3F1NA 2JKTI 4MNRA 3LIFA 4EU0A 4PM9A 1XJ4A 2M1CA 1DJCA 2XFTA 1ES3A 3NOPC 5FI6A 5DKLA 5L10A 4OPZA 1IYOA 1N9LA 2XR0A 3JVUA 3GV9A 3IX8A 3LIBA 1IYSA 4KG5A 2D01A 3MXQA 4QB8A 2J3TD 2Y2QA 4ARZA 4B4XA 3UE6A 2CMNA 1OT6A 3CPTB 4PPRA 3CI6A 5FA7A 3CWFA 4WZ5A 3SS3A 3BQ8A 3FWLA 2B02A 1MBLA 2G2WA 4IEDA 1S4SA 2ZM8A 3MFDA 4DKIA 4Y0OA 4N1XA 3BJNA 4GZBA 2P7JA 5AVFA 4NXEA 2ZMAA 1FR1A 4JPMA 2Z2LB 3UB5P 4EETB 2V8CA 1J9MA 4PM7A 5HX9A 3MXSA 4DRTA 4HBUA 2JHEA 2VK3A 3RXXA 2W3FA 4GJ4A 2Y79A 1L0FA 1YLWA 5FASA 1E4DA 5HFOA 1TS6A 4S2IA 3GECA 2WADA 1GHIA 3ZCZA 2Y2PA 4R1GA 4LCMA 2HDQA 3MF0A 2OV5A 4UA7A 3ZVTA 4KZ4A 3NHQA 2V1ZA 1E3UA 4YNRA 4ZJ1A 3KSHA 2ZOIA 4Y0TA 2RCXA 3R4KA 5HL6A 1DY6A 1I2SA 3VP1A 3A3DA 1S0WA 4RA7A 1BLCA 2Y2IA 4S2NA 4GOGA 2H0YA 3HLDA 4OQHA 3ITAA 4R6LA 5L07A 3I7JA 1WA9A 4EBPA 4GHIB 1NLZA 1ERMA 2PR6A 1WYBA 3MFXA 4DJ3A 2JKRM 1AXBA 5MC7A 3KSIA 3IHBA 4Q0IA 3F1NB 4KG6A 1KDSA 1ODVA 1TDGA 3CMZA 1K57C 1YLYA 3MQQA 5GLBA 3UPNA 4WMCA 1FCNA 4ZRRA 4FCFA 4DE3A 3G4PA 1X0OA 4DXBA 5EV0A 4UA9A 3OOVA 2I72A 1GSVA 1RGYA 5FI7A 4ARZB 5CRFA 4L9GA 4S2PA 3OPLA 4N9LA 2V8FA 3TRCA 5AQAA 2XD1A 3A3FA 3DWZA 4PMAA 3SZTA 5DVAA 2V1BA 2V1AA 4P6ZM 3NDGA 3H9WA 5CHJA 3UPOA 5L2FA 1BZAA 3LIAA 3MSHA 3T1QB 3HLBA 4L0LA 5F5YA 5HL1A 2VX8A 5M19A 3VP0A 2HP5A 3ZNYA 3VP4A 4EEPA 3BFFA 5E2EA 1EW0A 3B33A 3C2WA 1DRMA 1XA1A 2HDUA 3RTYA 2QZ6A 2YKHA 4MMNA 4I39A 4EUVA 3NOUC 3T1XA 3SH7A 4II7A 4HI4A 5CEBA 3OPPA 2QJ5A 4OQ0A 4HEFA 1NZUA 4GLQA 3MXRA 4HIAA 5CHUA 2VKSA 3F1OA 4E3OA 3NI9A 1OJGA 1RCJA 4I38A 4KZAA 1SDEA 2WZZA 3C7VA 3ZDJA 3ZG7B 3A3EA 2HDSA 2JE5A 4GS9B 3T4TA 3MKEA 1ES2A 3M6HA 1SKOA 4HOIA 4OVDA 5HWVA 3CLOA 3LR5A 4XT2B 2L4RA 1CK3A 3VOYA 3D3OA 4CJNA 5DFYA 5KZHA 4XT2A 4EQ1A 3LR4A 3QP8A 1DP8A 1Q2PA 3IH8A 4LFUA 3EWKA 2PRFA 1RP5A 2EXAA 3HUOA 4JGQA 1W79A 1I5QA 3Q07A 1OTIA 3CUEA 1UWNX 2ZC4B 1DP9A 2WK0A 2VGLS 3DTIA 3H82B 3ZG0A 4Y13A 3ZYTA 4DE1A 1XPBA 3A3JA 2PHYA 3LICA 4ESPA 3IWIA 4BD1A 1SCWA 4KENB 3LEQA 5F69A 1NJ4A 3W8KA 1TS7A 3O87A 4BBUA 3DTKA 5FQKA 2C6WB 2OLUA 4WL9A 4HH2A 1ES4A 3IWQA 1ZKJA 1KVLA 1P97A 4MBHA 3HVFA 4Y5FA 4O8GA 5TJJA 3OPRA 3FPVA 4YINA 2ZQ8A 5HPIA 1H8MA 1WE4A 3V67A 4O7DA 4DE0A 4C75A 5G4YA 3DTMA 3NCKA 2V20A 3TSGA 3VE3A 3FZCA 4LPZA 5F6AA 3ULFA 1I2WA 5JYOA 2FFYA 3P01A 4HESA 3A0RA 5AQBA 3HJKA 2XLNA 2VGJA 4L9FA 2W3HA 4Y15A 1SKFA 4DMZA 1FOFA 5HWWA 5J8XA 3S7NA 5F83A 4CLCC 5TBMA 3LUQA 3BFEA 5HSQA 2E8IA 1AWIA 3G31A 3HUMA 2BASA 4LRZE 1KGEA 3BFCA 4GB7A 2XRNA 1P9WA 3FKWA 1MZUA 1KGFA 2PDRA 4I3IA 2BLSA 2DRWA 3G35A 3WRZA 3LI8A 2ZQAA 2XK1A 5K5BA 4MCWA 1OMEA 1YM1A 4WELA 5HDDA 3QNCA 1MY8A 2WGVA 4EEUA 2EWWA 3N8LA 4BD0A 1KE4A 4E3MA 4YFMA 4K08A 4IUKA 2PT7A 2ZC3B 2R78A 4Q0HA 4U3TA 3V5MA 3MZFA 2J8YA 4KQRA 1K55A 3K2NA 2XDMA 5A91A 3GRJA 4PKYA 1K54A 2J3WA 2LB5A 2Y91A 5M18A 4P0MA 3IS2A 3T4LA 3JVVA 5IHVA 5DF8A 5J4EA 2JBFA 3CUEC 1VEUB 2D02A 1JWVA 2PBDP 3N8SA 5J3WA 5DKKA 2L1MA 3IBJA 4JKTA 4E3IA 4WEKA 1CEFA 3L9KA 3NJAA 2DNSA 2ZOHA 1ZC2A 3PR6A 4JBFA 2VGKA 1XJ6A 5CGWA 5I94A 4D2OA 3RJUA 1FCMA 4HJ3A 2IWDA 1W7FA 3UN7A 4CLCD 1L3LA 5GHYA 1XGIA 4PM6A 4R3AA 1L0GA 5EVIA 3BQAA 1DP6A 2HF6A 1YSQA 1PWDA 1IYPA 1Q2QA 4YWZA 3R7WB 3B3XA 5LBRA 3R7WA 4JF5A 4OONA 1F98A 3Q7VA 3IT9A 4O01A 3MR0A 3T4QA 2H28A 3C4OA 2UV0E 3C7UA 3HCYA 1KE3A 1A0KA 1F9IA 3QP1A 2X01A 2ZM2A 3NECA 1LSVA 4Q0JA 3PBQA 4HH3A 1IEMA 5KIZA 2UWXA 4FH4A 3T1RA 3CHWP 3BECA 3UE0A 3EQVA 1J3WA 1L0EA 2K31A 3F1PA 3LGOA 1VETA 4BMWA 4WF0A 1Z6FA 5E2FA 1XGJA 3FC7A 1OJ5A 1VB6A 2B18A 3IQAA 4CLCE 2IWBA 3Q1FA 1KDWA 4B88A 2QMIA 1S66L 3RXWA 1S4RA 1L2SA 4KZBA 2W1RA 1PW8A 4WUJA 1TD5A 3B42A 3V3SA 1FCOA 1NRJA 5D3OA 1PFLA 1PIOA 3C38A 1SKOB 4LRYC 4R3JA 5A93A 2KDKA 5HWTA 2QWSA 1K6SA 4P87A 2ZD8A 1K4FA 1IELA 5F82A 3FKVA 5BOHA 1BULA 3PBSA 1T1CA 4BENA 1XXMA 2Z6CA 2JCHA 3DBAA 4GW9A 2Y8HA 4P85A 1GA0A 3UY6A 2XFSA 1GSWA 5EVIB 2H0TA 4LV3A 2OLVA 4UA6A 5FQMA 3IF6B 2R9WA 1MXOA 4MBFA 1VETB 5CECA 1ZG4A 3P98A 5IS1A 1PWGA 4KQDA
chains in the Genus database with same CATH topology
2QJ5A 1MKMA 4MDZA 4NEED 4GLQA 1IOUA 3E4PA 4HIAA 4R70A 2VKSA 3F1OA 4UQIS 2NUPC 2KX6A 2O9BA 3SW1A 1D06A 1OJGA 1TF1A 4HHDA 4I38A 4IUHA 5HZHA 3UB8A 4KUKA 2J80A 3EEAA 5HDCA 1VHMA 3CITA 3LI9A 3PBOA 3A0VA 2JN7A 3OBFA 4F3LA 3PBRA 2IA2A 2ZMFA 4GS9B 3BY9A 3T4TA 2HJEA 4I5SA 4KUOA 3MQOA 1OTBA 2W1TB 4HOIA 2QYBA 5HWVA 5F68A 3CLOA 3LR5A 2VA0A 3S7OA 1ZHHB 4XT2B 1LSXA 2HV1A 3T4JA 2L4RA 4HY8A 3S7QA 1S1YA 3D3OA 5DFYA 4XT2A 1OTEA 4EQ1A 3EOIA 3LR4A 4EERA 2I9VA 1DP8A 3BWLA 3B47A 2INWA 3EWKA 4JGQA 4JGPA 1LSWA 1OTIA 3CUEA 1KOUA 4LRXC 1UWNX 4G3VA 1T1AA 2WKPA 1DP9A 1NLYA 2VGLS 1G6OA 2A2LA 2FH5A 3H82B 2P08A 3UMDA 3H7WA 3MMHA 2VEAA 3KSFA 1S1ZA 3ZYTA 3E4QA 2PHYA 3LICA 3PBTA 1S67L 4E04A 3H7WB 2WKRA 4EESA 5F69A 5HDSA 3EGXC 2V9AA 1TS7A 4KQOA 3T4OA 4BBUA 4ETZA 4R38A 2XA7M 4WL9A 1LL8A 4WLAA 1JNUA 5CX7A 4CQHA 4HH2A 3LYXA 4NXFA 1OTAA 5C5KA 2OAP1 4RQ9A 3IS2B 4ETXA 2HJ9C 1P97A 2QJ7A 4LLOB 4PHTA 4Y5FA 4Z1WA 4AFIA 4O8GA 5TJJA 5HPFA 3TE8A 3FPVA 3HJIA 2PYPA 2A24B 2XSSA 5HPIA 2W3GA 1H8MA 3V67A 4NXGA 4YOFA 4EXOA 3UMEA 5HD5A 3TJZC 4F3LB 1NWZA 3MJQA 5G4YA 5DFXA 4BBVA 1V9ZA 2J3TC 3BW6A 1XFNA 3K3DA 4WEJA 4Y3IA 5I5LA 4QPRA 3VE3A 3K3CA 4FOFA 3H82A 4O0PA 1YKDA 3T50A 4G3WA 4LPZA 5F6AA 3ULFA 4CLCB 3KX0X 1LT0A 3P01A 3A0RA 4HQAA 3HJKA 4DN0A 4L9FA 2W3HA 4I3JA 4DMZA 5HWWA 1STZA 2JKTM 3S7NA 4CLCC 1BYWA 2PYRA 2VZWA 1F5MA 5DJTA 3LIEA 4NKPA 3EGDC 2MJ6A 5TBMA 2K2NA 3LUQA 3T4KA 1TS0A 5HSQA 5TBMB 2BASA 4LRZE 1D7EA 2JKRI 2XROA 3PYPA 1GSXA 2ZBBA 3P7NA 2O9CA 3TW8A 3C30A 3E4OA 2XRNA 1ZTUA 2FZ0A 2ZMVA 4H6JB 1P9WA 1MZUA 4EW7A 2PDRA 4I3IA 5IU1A 3PHYA 3E0YA 3F1PB 4GHIA 3LI8A 2GX5A 5K5BA 4MCWA 4JGOA 2OAQ1 5DJUA 5EFWA 4UEYA 4WELA 5HDDA 2VV8A 3LIDA 4EEUA 4M4XA 2EWWA 3OCLA 3UE3A 2W3EA 1YSPA 4MN5A 3F1NA 2JKTI 3LFVA 5HD3A 4JGRA 2QKPA 3LIFA 4K08A 1XJ2A 4EU0A 4IUKA 3U2AA 1MC0A 1P9RA 2PT7A 1XJ4A 2M1CA 3OCNA 2R78A 4B93A 4Q0HA 2VLGA 3NOPC 4Y2FA 5DKLA 3K2NA 1XFQA 4OOMA 1T19A 4WN5A 2GJ3A 3VE4A 3KO6A 1N9LA 3JVUA 2EA9A 4PKYA 3LIBA 4ME4A 2J3WA 2LB5A 2O9AA 4HP9A 3KYZA 1P0ZA 3IS2A 3T4LA 2VV6A 3JVVA 3T4SA 5J4EA 2D01A 2V0UA 3MXQA 2J3TD 2KOIA 4ARZA 3CUEC 4G3KA 3UE6A 5A8BA 2CMNA 3D72A 2D02A 4HP4A 3PXPA 1OT6A 2W27A 5DKKA 5J3WA 2L1MA 3IBJA 3FPWA 4H6JA 4WEKA 4MN7A 3NJAA 2YKFA 2ZOHA 2W0NA 4BWIA 3CI6A 1T18A 3PR6A 2A24A 2LB9A 3CWFA 3LR3A 4BJPA 1XJ6A 3BQ8A 4MN6A 2B02A 4IHQA 1XJ3A 1S4SA 5G4ZA 4HJ3A 5AJGA 4OOLA 3KSGA 4CLCD 3BJNA 3CAXA 2P7JA 5AVFA 4R3AA 4NXEA 3IBRA 3BQAA 1DP6A 2HF6A 1YSQA 3LR0A 4YWZA 3R7WB 3W2ZA 4EETB 1TS8A 4CLCA 5LBRA 3R7WA 2JHEA 3O5YA 4L9EA 2W3FA 2Y79A 2VJWA 4GJ4A 1F98A 2K7SA 4O01A 3MR0A 3T4QA 3VOLA 1TS6A 3ICYA 2HGVA 3GECA 2V0WA 2OWHA 3MQ0A 1Y28A 2O0YA 1IFQA 3FG8A 4PAUA 2H28A 3MF0A 1N9NA 3OC2A 1N9OA 3HCYA 2QHKA 2PD7A 3E98A 3NHQA 4YNRA 2G7UA 1F9IA 2O99A 5FL3A 3KSHA 2M7VA 4PKYG 4UQIM 5AVEA 2ZOIA 3RFBA 3R4KA 4HJ6A 1LSVA 5HL6A 4Q0JA 3PBQA 4HH3A 4IJGA 2W1TA 3C8CA 4DJ2A 5KIZA 2EWVA 2GZAA 4B9OA 2M7UA 5J7EA 5DF9A 1G28A 4R6LA 1WA9A 3EQVA 2K31A 2NUTC 3F1PA 4GHIB 4HNBA 1NLZA 3BY8A 5L8MA 4WF0A 4BMWA 2KLIA 2W3DA 1YAXA 1W63Q 2PR6A 4GCZA 3MFXA 4DJ3A 2XA7S 3FC7A 1OJ5A 2JKRM 4I3AA 5MC7A 3KSIA 1OTDA 1VB6A 3OLOA 2B18A 3GDIA 4Q0IA 3G6OA 3F1NB 3UB6A 4CLCE 4BBTA 1ODVA 1S66L 3MQQA 1V9YA 1S4RA 4ZRRA 2PD8A 1X0OA 2W1RA 4WUJA 1TD5A 2Z6DA 3B42A 3OOVA 1NRJA 4NXBA 1GSVA 2PR5A 3C38A 4ARZB 4LRYC 3F1OB 3NOTC 2KDKA 4L9GA 1UWPX 5HWTA 2QWSA 4FSFA 3TRCA 1H3QA 1OT9A 2OWJA 2V1BA 2V1AA 3PBSA 1T1CA 4P6ZM 3UB7A 5IT5A 2GNXA 3ZQ5A 2Z6CA 4GS9A 2VGLM 3H9WA 4P6ZS 3DBAA 2L0WA 4GW9A 2Y8HA 1T1BA 3LIAA 3UB9A 1UGUA 2P04A 5F5YA 4L0LA 2VV7A 3KYQA 2VX8A 1GSWA 2WKQA 4HJ4A 3VV4A 4EEPA 3PBNA 3RH8B 3EQUA 3S7PA 1EW0A 3B33A 3C2WA 1DRMA 3EEHA 1OPXA 2DMWA 3RTYA 3A0SA 2YKHA 4MMNA 4I39A 2OOLA 5IS1A 4EUVA 3NOUC 1W63M 4II7A 4HI4A 4KQDA 5KSHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MKM A;  4MDZ A;  4YOF A;  4GLQ A;  4ME4 A;  2LB5 A;  2O9A A;  2M7U A;  4R70 A;  2VKS A;  4R6L A;  2W1T A;  5DFX A;  2K31 A;  2O9B A;  1TF1 A;  5L8M A;  4IUH A;  2KLI A;  2W3D A;  2KOI A;  3EEA A;  4G3K A;  4Y3I A;  5I5L A;  4QPR A;  1VHM A;  3CIT A;  3KSI A;  4FOF A;  2B18 A;  4O0P A;  1YKD A;  3OBF A;  3G6O A;  4Q0I A;  3IBJ A;  4G3W A;  2ZMF A;  2IA2 A;  4MN7 A;  4BWI A;  3CI6 A;  4DN0 A;  2LB9 A;  2W1T B;  2W3H A;  2QYB A;  4DMZ A;  1STZ A;  4ZRR A;  3S7N A;  3S7O A;  5AJG A;  2VZW A;  2W1R A;  1F5M A;  1TD5 A;  3KSG A;  3BJN A;  3S7Q A;  3D3O A;  3OOV A;  5DFY A;  2K2N A;  5HSQ A;  3IBR A;  4LRY C;  4LRZ E;  3NOT C;  2XRO A;  1YSQ A;  2O9C A;  3W2Z A;  2XRN A;  3TRC A;  1ZTU A;  5LBR A;  2XSS A;  4LRX C;  3O5Y A;  4G3V A;  2W3F A;  3E0Y A;  2Y79 A;  2VJW A;  2GX5 A;  3MMH A;  4O01 A;  5K5B A;  4MCW A;  2VEA A;  3KSF A;  3ZQ5 A;  2HGV A;  4E04 A;  3DBA A;  3MQ0 A;  4GW9 A;  2O0Y A;  4PAU A;  2Y8H A;  3MF0 A;  2W3E A;  1YSP A;  4ETZ A;  3LFV A;  3HCY A;  3E98 A;  4CQH A;  4EU0 A;  3VV4 A;  3NHQ A;  4IUK A;  1MC0 A;  4YNR A;  3S7P A;  5C5K A;  4RQ9 A;  2G7U A;  2O99 A;  3C2W A;  4Q0H A;  3KSH A;  2M7V A;  4ETX A;  3NOP C;  4Y2F A;  4Y5F A;  4Z1W A;  3RFB A;  3K2N A;  4MMN A;  4O8G A;  3R4K A;  5TJJ A;  2OOL A;  4EUV A;  3NOU C;  5HPF A;  5HL6 A;  4Q0J A;  4IJG A;  3KO6 A;  5HPI A;  2W3G A; 
#chains in the Genus database with same CATH topology
 1K56 A;  2ACG A;  3E4P A;  3SS5 A;  3ZFZ A;  4R70 A;  5EUA A;  4R3B A;  2NUP C;  1ALQ A;  2O9B A;  3SW1 A;  4N1H A;  1D06 A;  4HHD A;  1Z09 A;  2ZQC A;  1BUE A;  5HZH A;  3UB8 A;  2J80 A;  5HDC A;  3LI9 A;  3PBO A;  3UDI A;  2JN7 A;  3OBF A;  4CPK A;  3PBR A;  2ZMF A;  2C5W B;  5FAP A;  3BY9 A;  4X53 A;  3BFG A;  4XXR A;  4I5S A;  4KUO A;  3MQO A;  1OTB A;  4JXV A;  4IVK A;  1E25 A;  2QYB A;  5F68 A;  4OP5 A;  2RL3 A;  2HV1 A;  3T4J A;  1PYY A;  3G32 A;  4A5R A;  4HY8 A;  1MWU A;  1S1Y A;  4JF6 A;  3SOI A;  2EX6 A;  1YLJ A;  4E6X A;  1ZG6 A;  2I9V A;  1Y4O A;  1E3U D;  3VP2 A;  1NRF A;  2ZJ9 A;  3BWL A;  3B47 A;  4GD6 A;  2A49 A;  4JGP A;  1LSW A;  4LRX C;  1ACF A;  4G3V A;  1T1A A;  1MWT A;  3BYD A;  1K0K A;  1G6O A;  1YQS A;  2FH5 A;  2P08 A;  5FAQ A;  3H7W A;  5DF7 A;  3GVB A;  3KSF A;  1LHY A;  3E4Q A;  1CQA A;  5FAT A;  4E04 A;  3H7W B;  3V39 A;  4X68 A;  3EGX C;  4ETZ A;  4R38 A;  5CX7 A;  1LLB A;  5EOE A;  2X02 A;  5C5K A;  3AGD A;  4RQ9 A;  3IS2 B;  3IH9 A;  2HJ9 C;  3JYI A;  1GCE A;  4JLF A;  4PHT A;  2PYP A;  3L7H A;  2W3G A;  1M6K A;  4IBR A;  5E43 A;  2HPB A;  4QY6 A;  3VFF A;  2V2F F;  3VSL A;  3FV7 A;  1H5X A;  4C3Q A;  3K3D A;  5TR7 A;  4WEJ A;  3IF6 C;  5I5L A;  3QNB A;  3H82 A;  4O0P A;  1LI9 A;  3T50 A;  4G3W A;  3E2K A;  4CLC B;  3KX0 X;  4JF4 A;  1JWP A;  4LEN A;  4DN0 A;  1CI9 A;  2WAF A;  4XUZ A;  1YLP A;  1NXY A;  2JKT M;  3GR2 A;  5EPH A;  3V50 A;  3EGD C;  2MJ6 A;  5GHZ A;  1MWS A;  1DJB A;  1PRQ A;  1GSX A;  3P7N A;  4LV0 A;  3C30 A;  2Y2H A;  1ZTU A;  2FZ0 A;  4KZ8 A;  5DTS A;  5IU1 A;  1ES5 A;  2GX5 A;  5GLC A;  4E6W A;  4JGO A;  5EFW A;  4E3J A;  4UEY A;  3LID A;  1YLZ A;  3LCE A;  4M4X A;  3OCL A;  3OZH A;  4X1L A;  2P9V B;  3UE3 A;  1FR6 A;  4Q8I A;  4JGR A;  2X71 A;  3U2A A;  1MC0 A;  1P9R A;  4X55 A;  1PI4 A;  4Y2F A;  3MBZ A;  5G18 A;  4JXW A;  3Q81 A;  1T19 A;  4WN5 A;  5CGX A;  3VE4 A;  3KO6 A;  4KZ3 A;  1LL5 A;  5KSC A;  4ME4 A;  1P0Z A;  1PZO A;  2VV6 A;  5CHM A;  3LY4 A;  4G3K A;  5A8B A;  4KG2 A;  2Y2K A;  5HW3 A;  3Q82 A;  3HLW A;  4BL3 A;  3FPW A;  1ESI A;  1CJF A;  5EM1 A;  4ZAM A;  2YKF A;  2W0N A;  4BWI A;  1T18 A;  5FI2 A;  2LB9 A;  3LR3 A;  3VOZ A;  4Y17 A;  1G6A A;  2WKH A;  1SZV A;  1BLS A;  5AJG A;  4OOL A;  1LI0 A;  3KSG A;  5A90 A;  3CAX A;  1XX2 A;  5FEG A;  3IBR A;  3TOI A;  4IVI A;  3LR0 A;  4PM8 A;  2Q9M A;  3W2Z A;  2GDN A;  3G2Z A;  1XKZ A;  4BL2 A;  4CLC A;  1NYM A;  2Q9N A;  4P6B A;  3O5Y A;  2Y2M A;  4L9E A;  1ONH A;  5DTT A;  3O88 A;  1RGZ A;  5EVI D;  3N4I A;  3IXD A;  2BTF P;  2K7S A;  1H0M A;  4M3K A;  2ZM0 A;  2HP6 A;  4S2K A;  3ICY A;  2HGV A;  3GTC A;  3A3I A;  3N6I A;  2H5S A;  4QHC A;  3MQ0 A;  1Y28 A;  2O0Y A;  3IF6 A;  3FG8 A;  5DTK A;  4PAU A;  5EE8 A;  1D1J A;  4EQI A;  1QMF A;  4GN2 A;  3OC2 A;  1K4E A;  2QHK A;  2PD7 A;  4KZ6 A;  1ERO A;  2J9O A;  5M1A A;  2E8J A;  2G7U A;  5FL3 A;  2Y2L A;  4PKY G;  4UQI M;  3UO9 A;  4XUX A;  4N9K A;  3RFB A;  3VP3 A;  4QY5 A;  4HJ6 A;  1H8Y A;  1PZP A;  2W1T A;  3C5A A;  3C8C A;  4DJ2 A;  1N9B A;  3ZG8 B;  2M7U A;  1CI8 A;  2PAV P;  2NUT C;  4HNB A;  5L8M A;  3BY8 A;  1M40 A;  2W3D A;  1YAX A;  1W63 Q;  1NY0 A;  1XP4 A;  2XA7 S;  1BTL A;  3WS2 A;  1IKI A;  3GDI A;  3HL9 A;  3G6O A;  1K54 C;  3O3V A;  3UB6 A;  1S6R A;  2R9X A;  3BLM A;  4X69 A;  2XD5 A;  3S1Y A;  4K0W A;  1HD8 A;  4DDS A;  2H10 A;  3VMA A;  3CJM A;  4UAA A;  4NXB A;  5GLA A;  5F1G A;  5TGF A;  3F1O B;  3NOT C;  1ONG A;  1Y54 A;  3PAG A;  4FSF A;  3AGE A;  1PNE A;  1H3Q A;  2EFU A;  1OT9 A;  3UNW A;  3IXG A;  2OWJ A;  1GHM A;  3M2K A;  4Z9Q A;  3UB7 A;  5EVI C;  3ZQ5 A;  3WS5 A;  2L0W A;  4OKP A;  1UGU A;  2P04 A;  2Y55 A;  2EFX A;  2VV7 A;  2WKQ A;  4FUW A;  4HJ4 A;  2WGW A;  4NET A;  3VV4 A;  3RH8 B;  3EQU A;  5GLD A;  3EEH A;  2DMW A;  3A0S A;  4X25 A;  2DCF A;  3NDE A;  4DXC A;  1W63 M;  4E3L A;  4QJG A;  1GA9 A;  3G30 A;  3T4S A;  1BLP A;  1MKM A;  4ZTK A;  5TFQ A;  4NEE D;  1IOU A;  3IXB A;  2PU2 A;  4WM9 A;  1CEG A;  3Q7V B;  2CC1 A;  4IUH A;  4F94 A;  1JWZ A;  4ZDX A;  3BLS A;  4Y7P A;  5FQ9 A;  3EEA A;  1W8Q A;  1VHM A;  3CIT A;  4H8R A;  2WKE A;  4F3L A;  2IA2 A;  5F1F A;  2HJE A;  1KE0 A;  4OPY A;  3O86 A;  3ISG A;  4D60 A;  4R23 A;  1GHP A;  5EM0 A;  4EUZ A;  3IXH A;  2Z2M B;  5EOO A;  3PTE A;  4S2M A;  3S22 A;  2VA0 A;  3C4P A;  3S7O A;  1N4O A;  1C3B A;  1K6R A;  3IX3 A;  3S7Q A;  4U0T A;  4EER A;  2WGW B;  2Y4A A;  4EBL A;  4JXS A;  1TDL A;  3ZG5 A;  1KOU A;  3HLC A;  2Y2O A;  4PM5 A;  3NBL A;  5EVL A;  2A2L A;  2B5R A;  3UMD A;  3MMH A;  5E2G A;  1TEM A;  4OQG A;  3QP6 A;  4FTX A;  3VSK A;  2WKR A;  4DDY A;  2V9A A;  4KQO A;  3T4O A;  2XA7 M;  5CER A;  2WKI A;  3LYX A;  1OTA A;  2OAP 1;  1YMX A;  2QJ7 A;  2Y2J A;  3MZD A;  4Z1W A;  4AFI A;  4S2J A;  3ZNT A;  1YPR A;  2A24 B;  2XSS A;  5CXW A;  1DJA A;  4RX2 A;  2WGI A;  4YOF A;  3UME A;  1VQQ A;  4N92 A;  5FAO A;  3TJZ C;  4EBN A;  4F3L B;  3MJQ A;  3GQZ A;  4BBV A;  1NZO A;  4GNU A;  4WZ5 C;  1HLU P;  3NUL A;  4QPR A;  1MPL A;  4OPR A;  3K3C A;  3DTE A;  1YLT A;  4OLD A;  4X56 A;  1NYY A;  2PU4 A;  1LT0 A;  1BT5 A;  3BM6 A;  3V3R A;  1STZ A;  2ZC6 B;  1BYW A;  5FSR A;  2VZW A;  4ZBE A;  1F5M A;  5DJT A;  4QU3 A;  2WYX A;  3GMW A;  2K2N A;  1TS0 A;  3UDF A;  3LEZ A;  1D7E A;  2JKR I;  2XRO A;  3WS0 A;  2ZBB A;  5HAP A;  2HZ5 A;  3TW8 A;  3E4O A;  4RYE A;  3DW0 A;  4H6J B;  2ZL1 B;  2HDR A;  3S4X A;  4EW7 A;  1K56 D;  4GHI A;  5FDS A;  2OAQ 1;  4WMC D;  1SHV A;  2QPN A;  4MEZ A;  1PWC A;  3FYZ A;  1G5U A;  2W3E A;  4MN5 A;  3LFV A;  5HD3 A;  2Q0O A;  2QKP A;  1XJ2 A;  3OCN A;  4B93 A;  2VLG A;  1W8Y A;  4OOY A;  1XFQ A;  4OOM A;  3NY4 A;  3KYE A;  2GJ3 A;  3IWO A;  3U4L P;  2EA9 A;  1HZO A;  5CGS A;  3IHA A;  2B95 A;  5HAQ A;  2O9A A;  4HP9 A;  3KYZ A;  4UHU A;  5KMW A;  3PAE A;  2V0U A;  2KOI A;  1VM1 A;  3D72 A;  4HP4 A;  2EX2 A;  3PXP A;  5FQQ A;  3QP4 A;  4X1M A;  2BG1 A;  2W27 A;  1FIL A;  4H6J A;  2OSU A;  2ZL1 A;  4MN7 A;  4LCL A;  3ZVW A;  3G2Y A;  4X6T A;  2A24 A;  3ZHH A;  4BJP A;  4K0X A;  1FSW A;  5A92 A;  1XA7 A;  4MN6 A;  4IHQ A;  4S2L A;  5CTN A;  1XJ3 A;  5G4Z A;  3SH8 A;  4BLM A;  3E2L A;  1PW1 A;  2EX9 A;  3WWX A;  1YMS A;  2Y2G A;  3IF5 A;  3CG5 A;  1QME A;  1FSY A;  4GDB A;  1SDN A;  1ERQ A;  2JC7 A;  1TS8 A;  5CTM A;  2VJW A;  4EV4 A;  4FD8 A;  4KZ9 A;  3VOL A;  2AVX A;  3HBR A;  2V0W A;  2OWH A;  3M6B A;  1IFQ A;  5JYP A;  5EEC A;  2EXB A;  1N9N A;  1N9O A;  3E98 A;  3D9Y A;  4R4R A;  2O99 A;  2M7V A;  3UPP A;  1TVF A;  3DWK A;  4OH0 A;  5AVE A;  4OQI A;  3AGF A;  2XQZ A;  4IJG A;  2EWV A;  2GZA A;  4B9O A;  5J7E A;  5DF9 A;  1G28 A;  1IKG A;  3UE1 A;  3W4O A;  2XH9 A;  5FEF A;  3CPT A;  2KLI A;  1HVB A;  4GCZ A;  5CED A;  4I3A A;  3Q7Z A;  5FDH A;  1OTD A;  1K38 A;  3OLO A;  4E3K A;  4BBT A;  4S2O A;  3T12 B;  1V9Y A;  4OP8 A;  2WZX A;  1O7E A;  4NG2 A;  4LV1 A;  3MZE A;  1YT4 A;  2PD8 A;  1BLH A;  4RX3 A;  4GKU A;  3NC8 A;  5HAI A;  2Z6D A;  3ZG9 B;  3QP5 A;  5FQJ A;  3ZGA B;  2PR5 A;  3MS6 A;  2J7V A;  2P74 A;  1UWP X;  2HP9 A;  3QHY A;  2EX8 A;  1MWR A;  1BSG A;  4WYY A;  4WZ4 A;  3JPU A;  4RVA A;  3M2J A;  5IT5 A;  3HUN A;  4KZ5 A;  2GNX A;  1JVJ A;  4GS9 A;  2VGL M;  4P6Z S;  3N7W A;  5AQ7 A;  1T1B A;  4DE2 A;  3UB9 A;  3KYQ A;  2P9V A;  2IWC A;  3PBN A;  4QWO A;  2XF3 A;  3S7P A;  3QP2 A;  2ZC7 A;  4GDN A;  4JXG A;  1WYC A;  1OPX A;  4Y0U A;  4BQM A;  4KQQ A;  2OOL A;  1U60 A;  3SH9 A;  4OPQ A;  3T1S A;  5KSH A;  4MDZ A;  2Y2N A;  3GSG A;  3DAV A;  4UQI S;  3CZD A;  2KX6 A;  4LGW A;  1TF1 A;  3P09 A;  1H8Z A;  4KUK A;  1W5D A;  2FFF B;  5L09 A;  2ZC5 B;  2WAE A;  3A0V A;  4ZJ3 A;  3N8R A;  5FQI A;  2ZQD A;  3BRM A;  4MLL A;  2W1T B;  2ZQ9 A;  3LY3 A;  1ESU A;  1ZHH B;  2G2U A;  1LSX A;  1O07 A;  1OTE A;  3EOI A;  1IYQ A;  3HLG A;  2A3U A;  2ZQ7 A;  4DF6 A;  4IBX A;  2INW A;  4MBK A;  3LO7 A;  4HBT A;  2XGN A;  3BEB A;  2WKP A;  3VFH A;  1PI5 A;  1NLY A;  5HAR A;  3WS4 A;  3HLF A;  5U47 A;  2VEA A;  1S1Z A;  1K25 A;  3PBT A;  1S67 L;  3W4Q A;  4FH2 A;  4OLG A;  1EWZ A;  1K55 C;  4ZJ2 A;  4EES A;  5HDS A;  4WLA A;  1LL8 A;  1MKI A;  1JNU A;  2JKG A;  5GL9 A;  4CQH A;  3WRT A;  4GD8 A;  4NXF A;  1VEU A;  4NK3 A;  4ETX A;  4EWF A;  3HRE A;  4LLO B;  4KZ7 A;  3G34 A;  5HPF A;  3TE8 A;  3D4F A;  3HJI A;  5EVE A;  3TG9 A;  4NXG A;  4EXO A;  3OPH A;  3UDX A;  5HD5 A;  2ZLY A;  3IX4 A;  1CF0 A;  1NWZ A;  4LV2 A;  5DFX A;  1V9Z A;  1LL9 A;  2J3T C;  3BW6 A;  1XFN A;  1FQG A;  3SS4 A;  1JTD A;  4Y3I A;  4FOF A;  4WBG A;  3ITB A;  5E2H A;  1YKD A;  4R4S A;  1KVM A;  4ID4 A;  5AQ9 A;  4B4Z A;  4HQA A;  4K91 A;  3MKF A;  1FIK A;  1JTG A;  4I3J A;  3HLE A;  3NIA A;  2PYR A;  2XEP A;  3LIE A;  4NKP A;  4S2N C;  3BFD A;  3T4K A;  5TBM B;  5GHX A;  2Y59 A;  3PYP A;  1L0D A;  2O9C A;  1HTZ A;  2ZMV A;  4QD4 A;  2J9P A;  4E3N A;  3W4P A;  2JKF A;  3PHY A;  3E0Y A;  3F1P B;  4C6Y A;  1F2K A;  2PBY A;  4R0Q A;  5DJU A;  1KGG A;  2WUQ A;  4U0X A;  1G68 A;  1K57 A;  2VV8 A;  3WS1 A;  1EI5 A;  1YSP A;  3F1N A;  2JKT I;  4MNR A;  3LIF A;  4EU0 A;  4PM9 A;  1XJ4 A;  2M1C A;  1DJC A;  2XFT A;  1ES3 A;  3NOP C;  5FI6 A;  5DKL A;  5L10 A;  4OPZ A;  1IYO A;  1N9L A;  2XR0 A;  3JVU A;  3GV9 A;  3IX8 A;  3LIB A;  1IYS A;  4KG5 A;  2D01 A;  3MXQ A;  4QB8 A;  2J3T D;  2Y2Q A;  4ARZ A;  4B4X A;  3UE6 A;  2CMN A;  1OT6 A;  3CPT B;  4PPR A;  3CI6 A;  5FA7 A;  3CWF A;  4WZ5 A;  3SS3 A;  3BQ8 A;  3FWL A;  2B02 A;  1MBL A;  2G2W A;  4IED A;  1S4S A;  2ZM8 A;  3MFD A;  4DKI A;  4Y0O A;  4N1X A;  3BJN A;  4GZB A;  2P7J A;  5AVF A;  4NXE A;  2ZMA A;  1FR1 A;  4JPM A;  2Z2L B;  3UB5 P;  4EET B;  2V8C A;  1J9M A;  4PM7 A;  5HX9 A;  3MXS A;  4DRT A;  4HBU A;  2JHE A;  2VK3 A;  3RXX A;  2W3F A;  4GJ4 A;  2Y79 A;  1L0F A;  1YLW A;  5FAS A;  1E4D A;  5HFO A;  1TS6 A;  4S2I A;  3GEC A;  2WAD A;  1GHI A;  3ZCZ A;  2Y2P A;  4R1G A;  4LCM A;  2HDQ A;  3MF0 A;  2OV5 A;  4UA7 A;  3ZVT A;  4KZ4 A;  3NHQ A;  2V1Z A;  1E3U A;  4YNR A;  4ZJ1 A;  3KSH A;  2ZOI A;  4Y0T A;  2RCX A;  3R4K A;  5HL6 A;  1DY6 A;  1I2S A;  3VP1 A;  3A3D A;  1S0W A;  4RA7 A;  1BLC A;  2Y2I A;  4S2N A;  4GOG A;  2H0Y A;  3HLD A;  4OQH A;  3ITA A;  4R6L A;  5L07 A;  3I7J A;  1WA9 A;  4EBP A;  4GHI B;  1NLZ A;  1ERM A;  2PR6 A;  1WYB A;  3MFX A;  4DJ3 A;  2JKR M;  1AXB A;  5MC7 A;  3KSI A;  3IHB A;  4Q0I A;  3F1N B;  4KG6 A;  1KDS A;  1ODV A;  1TDG A;  3CMZ A;  1K57 C;  1YLY A;  3MQQ A;  5GLB A;  3UPN A;  4WMC A;  1FCN A;  4ZRR A;  4FCF A;  4DE3 A;  3G4P A;  1X0O A;  4DXB A;  5EV0 A;  4UA9 A;  3OOV A;  2I72 A;  1GSV A;  1RGY A;  5FI7 A;  4ARZ B;  5CRF A;  4L9G A;  4S2P A;  3OPL A;  4N9L A;  2V8F A;  3TRC A;  5AQA A;  2XD1 A;  3A3F A;  3DWZ A;  4PMA A;  3SZT A;  5DVA A;  2V1B A;  2V1A A;  4P6Z M;  3NDG A;  3H9W A;  5CHJ A;  3UPO A;  5L2F A;  1BZA A;  3LIA A;  3MSH A;  3T1Q B;  3HLB A;  4L0L A;  5F5Y A;  5HL1 A;  2VX8 A;  5M19 A;  3VP0 A;  2HP5 A;  3ZNY A;  3VP4 A;  4EEP A;  3BFF A;  5E2E A;  1EW0 A;  3B33 A;  3C2W A;  1DRM A;  1XA1 A;  2HDU A;  3RTY A;  2QZ6 A;  2YKH A;  4MMN A;  4I39 A;  4EUV A;  3NOU C;  3T1X A;  3SH7 A;  4II7 A;  4HI4 A;  5CEB A;  3OPP A;  2QJ5 A;  4OQ0 A;  4HEF A;  1NZU A;  4GLQ A;  3MXR A;  4HIA A;  5CHU A;  2VKS A;  3F1O A;  4E3O A;  3NI9 A;  1OJG A;  1RCJ A;  4I38 A;  4KZA A;  1SDE A;  2WZZ A;  3C7V A;  3ZDJ A;  3ZG7 B;  3A3E A;  2HDS A;  2JE5 A;  4GS9 B;  3T4T A;  3MKE A;  1ES2 A;  3M6H A;  1SKO A;  4HOI A;  4OVD A;  5HWV A;  3CLO A;  3LR5 A;  4XT2 B;  2L4R A;  1CK3 A;  3VOY A;  3D3O A;  4CJN A;  5DFY A;  5KZH A;  4XT2 A;  4EQ1 A;  3LR4 A;  3QP8 A;  1DP8 A;  1Q2P A;  3IH8 A;  4LFU A;  3EWK A;  2PRF A;  1RP5 A;  2EXA A;  3HUO A;  4JGQ A;  1W79 A;  1I5Q A;  3Q07 A;  1OTI A;  3CUE A;  1UWN X;  2ZC4 B;  1DP9 A;  2WK0 A;  2VGL S;  3DTI A;  3H82 B;  3ZG0 A;  4Y13 A;  3ZYT A;  4DE1 A;  1XPB A;  3A3J A;  2PHY A;  3LIC A;  4ESP A;  3IWI A;  4BD1 A;  1SCW A;  4KEN B;  3LEQ A;  5F69 A;  1NJ4 A;  3W8K A;  1TS7 A;  3O87 A;  4BBU A;  3DTK A;  5FQK A;  2C6W B;  2OLU A;  4WL9 A;  4HH2 A;  1ES4 A;  3IWQ A;  1ZKJ A;  1KVL A;  1P97 A;  4MBH A;  3HVF A;  4Y5F A;  4O8G A;  5TJJ A;  3OPR A;  3FPV A;  4YIN A;  2ZQ8 A;  5HPI A;  1H8M A;  1WE4 A;  3V67 A;  4O7D A;  4DE0 A;  4C75 A;  5G4Y A;  3DTM A;  3NCK A;  2V20 A;  3TSG A;  3VE3 A;  3FZC A;  4LPZ A;  5F6A A;  3ULF A;  1I2W A;  5JYO A;  2FFY A;  3P01 A;  4HES A;  3A0R A;  5AQB A;  3HJK A;  2XLN A;  2VGJ A;  4L9F A;  2W3H A;  4Y15 A;  1SKF A;  4DMZ A;  1FOF A;  5HWW A;  5J8X A;  3S7N A;  5F83 A;  4CLC C;  5TBM A;  3LUQ A;  3BFE A;  5HSQ A;  2E8I A;  1AWI A;  3G31 A;  3HUM A;  2BAS A;  4LRZ E;  1KGE A;  3BFC A;  4GB7 A;  2XRN A;  1P9W A;  3FKW A;  1MZU A;  1KGF A;  2PDR A;  4I3I A;  2BLS A;  2DRW A;  3G35 A;  3WRZ A;  3LI8 A;  2ZQA A;  2XK1 A;  5K5B A;  4MCW A;  1OME A;  1YM1 A;  4WEL A;  5HDD A;  3QNC A;  1MY8 A;  2WGV A;  4EEU A;  2EWW A;  3N8L A;  4BD0 A;  1KE4 A;  4E3M A;  4YFM A;  4K08 A;  4IUK A;  2PT7 A;  2ZC3 B;  2R78 A;  4Q0H A;  4U3T A;  3V5M A;  3MZF A;  2J8Y A;  4KQR A;  1K55 A;  3K2N A;  2XDM A;  5A91 A;  3GRJ A;  4PKY A;  1K54 A;  2J3W A;  2LB5 A;  2Y91 A;  5M18 A;  4P0M A;  3IS2 A;  3T4L A;  3JVV A;  5IHV A;  5DF8 A;  5J4E A;  2JBF A;  3CUE C;  1VEU B;  2D02 A;  1JWV A;  2PBD P;  3N8S A;  5J3W A;  5DKK A;  2L1M A;  3IBJ A;  4JKT A;  4E3I A;  4WEK A;  1CEF A;  3L9K A;  3NJA A;  2DNS A;  2ZOH A;  1ZC2 A;  3PR6 A;  4JBF A;  2VGK A;  1XJ6 A;  5CGW A;  5I94 A;  4D2O A;  3RJU A;  1FCM A;  4HJ3 A;  2IWD A;  1W7F A;  3UN7 A;  4CLC D;  1L3L A;  5GHY A;  1XGI A;  4PM6 A;  4R3A A;  1L0G A;  5EVI A;  3BQA A;  1DP6 A;  2HF6 A;  1YSQ A;  1PWD A;  1IYP A;  1Q2Q A;  4YWZ A;  3R7W B;  3B3X A;  5LBR A;  3R7W A;  4JF5 A;  4OON A;  1F98 A;  3Q7V A;  3IT9 A;  4O01 A;  3MR0 A;  3T4Q A;  2H28 A;  3C4O A;  2UV0 E;  3C7U A;  3HCY A;  1KE3 A;  1A0K A;  1F9I A;  3QP1 A;  2X01 A;  2ZM2 A;  3NEC A;  1LSV A;  4Q0J A;  3PBQ A;  4HH3 A;  1IEM A;  5KIZ A;  2UWX A;  4FH4 A;  3T1R A;  3CHW P;  3BEC A;  3UE0 A;  3EQV A;  1J3W A;  1L0E A;  2K31 A;  3F1P A;  3LGO A;  1VET A;  4BMW A;  4WF0 A;  1Z6F A;  5E2F A;  1XGJ A;  3FC7 A;  1OJ5 A;  1VB6 A;  2B18 A;  3IQA A;  4CLC E;  2IWB A;  3Q1F A;  1KDW A;  4B88 A;  2QMI A;  1S66 L;  3RXW A;  1S4R A;  1L2S A;  4KZB A;  2W1R A;  1PW8 A;  4WUJ A;  1TD5 A;  3B42 A;  3V3S A;  1FCO A;  1NRJ A;  5D3O A;  1PFL A;  1PIO A;  3C38 A;  1SKO B;  4LRY C;  4R3J A;  5A93 A;  2KDK A;  5HWT A;  2QWS A;  1K6S A;  4P87 A;  2ZD8 A;  1K4F A;  1IEL A;  5F82 A;  3FKV A;  5BOH A;  1BUL A;  3PBS A;  1T1C A;  4BEN A;  1XXM A;  2Z6C A;  2JCH A;  3DBA A;  4GW9 A;  2Y8H A;  4P85 A;  1GA0 A;  3UY6 A;  2XFS A;  1GSW A;  5EVI B;  2H0T A;  4LV3 A;  2OLV A;  4UA6 A;  5FQM A;  3IF6 B;  2R9W A;  1MXO A;  4MBF A;  1VET B;  5CEC A;  1ZG4 A;  3P98 A;  5IS1 A;  1PWG A;  4KQD A; 
#chains in the Genus database with same CATH homology
 2QJ5 A;  1MKM A;  4MDZ A;  4NEE D;  4GLQ A;  1IOU A;  3E4P A;  4HIA A;  4R70 A;  2VKS A;  3F1O A;  4UQI S;  2NUP C;  2KX6 A;  2O9B A;  3SW1 A;  1D06 A;  1OJG A;  1TF1 A;  4HHD A;  4I38 A;  4IUH A;  5HZH A;  3UB8 A;  4KUK A;  2J80 A;  3EEA A;  5HDC A;  1VHM A;  3CIT A;  3LI9 A;  3PBO A;  3A0V A;  2JN7 A;  3OBF A;  4F3L A;  3PBR A;  2IA2 A;  2ZMF A;  4GS9 B;  3BY9 A;  3T4T A;  2HJE A;  4I5S A;  4KUO A;  3MQO A;  1OTB A;  2W1T B;  4HOI A;  2QYB A;  5HWV A;  5F68 A;  3CLO A;  3LR5 A;  2VA0 A;  3S7O A;  1ZHH B;  4XT2 B;  1LSX A;  2HV1 A;  3T4J A;  2L4R A;  4HY8 A;  3S7Q A;  1S1Y A;  3D3O A;  5DFY A;  4XT2 A;  1OTE A;  4EQ1 A;  3EOI A;  3LR4 A;  4EER A;  2I9V A;  1DP8 A;  3BWL A;  3B47 A;  2INW A;  3EWK A;  4JGQ A;  4JGP A;  1LSW A;  1OTI A;  3CUE A;  1KOU A;  4LRX C;  1UWN X;  4G3V A;  1T1A A;  2WKP A;  1DP9 A;  1NLY A;  2VGL S;  1G6O A;  2A2L A;  2FH5 A;  3H82 B;  2P08 A;  3UMD A;  3H7W A;  3MMH A;  2VEA A;  3KSF A;  1S1Z A;  3ZYT A;  3E4Q A;  2PHY A;  3LIC A;  3PBT A;  1S67 L;  4E04 A;  3H7W B;  2WKR A;  4EES A;  5F69 A;  5HDS A;  3EGX C;  2V9A A;  1TS7 A;  4KQO A;  3T4O A;  4BBU A;  4ETZ A;  4R38 A;  2XA7 M;  4WL9 A;  1LL8 A;  4WLA A;  1JNU A;  5CX7 A;  4CQH A;  4HH2 A;  3LYX A;  4NXF A;  1OTA A;  5C5K A;  2OAP 1;  4RQ9 A;  3IS2 B;  4ETX A;  2HJ9 C;  1P97 A;  2QJ7 A;  4LLO B;  4PHT A;  4Y5F A;  4Z1W A;  4AFI A;  4O8G A;  5TJJ A;  5HPF A;  3TE8 A;  3FPV A;  3HJI A;  2PYP A;  2A24 B;  2XSS A;  5HPI A;  2W3G A;  1H8M A;  3V67 A;  4NXG A;  4YOF A;  4EXO A;  3UME A;  5HD5 A;  3TJZ C;  4F3L B;  1NWZ A;  3MJQ A;  5G4Y A;  5DFX A;  4BBV A;  1V9Z A;  2J3T C;  3BW6 A;  1XFN A;  3K3D A;  4WEJ A;  4Y3I A;  5I5L A;  4QPR A;  3VE3 A;  3K3C A;  4FOF A;  3H82 A;  4O0P A;  1YKD A;  3T50 A;  4G3W A;  4LPZ A;  5F6A A;  3ULF A;  4CLC B;  3KX0 X;  1LT0 A;  3P01 A;  3A0R A;  4HQA A;  3HJK A;  4DN0 A;  4L9F A;  2W3H A;  4I3J A;  4DMZ A;  5HWW A;  1STZ A;  2JKT M;  3S7N A;  4CLC C;  1BYW A;  2PYR A;  2VZW A;  1F5M A;  5DJT A;  3LIE A;  4NKP A;  3EGD C;  2MJ6 A;  5TBM A;  2K2N A;  3LUQ A;  3T4K A;  1TS0 A;  5HSQ A;  5TBM B;  2BAS A;  4LRZ E;  1D7E A;  2JKR I;  2XRO A;  3PYP A;  1GSX A;  2ZBB A;  3P7N A;  2O9C A;  3TW8 A;  3C30 A;  3E4O A;  2XRN A;  1ZTU A;  2FZ0 A;  2ZMV A;  4H6J B;  1P9W A;  1MZU A;  4EW7 A;  2PDR A;  4I3I A;  5IU1 A;  3PHY A;  3E0Y A;  3F1P B;  4GHI A;  3LI8 A;  2GX5 A;  5K5B A;  4MCW A;  4JGO A;  2OAQ 1;  5DJU A;  5EFW A;  4UEY A;  4WEL A;  5HDD A;  2VV8 A;  3LID A;  4EEU A;  4M4X A;  2EWW A;  3OCL A;  3UE3 A;  2W3E A;  1YSP A;  4MN5 A;  3F1N A;  2JKT I;  3LFV A;  5HD3 A;  4JGR A;  2QKP A;  3LIF A;  4K08 A;  1XJ2 A;  4EU0 A;  4IUK A;  3U2A A;  1MC0 A;  1P9R A;  2PT7 A;  1XJ4 A;  2M1C A;  3OCN A;  2R78 A;  4B93 A;  4Q0H A;  2VLG A;  3NOP C;  4Y2F A;  5DKL A;  3K2N A;  1XFQ A;  4OOM A;  1T19 A;  4WN5 A;  2GJ3 A;  3VE4 A;  3KO6 A;  1N9L A;  3JVU A;  2EA9 A;  4PKY A;  3LIB A;  4ME4 A;  2J3W A;  2LB5 A;  2O9A A;  4HP9 A;  3KYZ A;  1P0Z A;  3IS2 A;  3T4L A;  2VV6 A;  3JVV A;  3T4S A;  5J4E A;  2D01 A;  2V0U A;  3MXQ A;  2J3T D;  2KOI A;  4ARZ A;  3CUE C;  4G3K A;  3UE6 A;  5A8B A;  2CMN A;  3D72 A;  2D02 A;  4HP4 A;  3PXP A;  1OT6 A;  2W27 A;  5DKK A;  5J3W A;  2L1M A;  3IBJ A;  3FPW A;  4H6J A;  4WEK A;  4MN7 A;  3NJA A;  2YKF A;  2ZOH A;  2W0N A;  4BWI A;  3CI6 A;  1T18 A;  3PR6 A;  2A24 A;  2LB9 A;  3CWF A;  3LR3 A;  4BJP A;  1XJ6 A;  3BQ8 A;  4MN6 A;  2B02 A;  4IHQ A;  1XJ3 A;  1S4S A;  5G4Z A;  4HJ3 A;  5AJG A;  4OOL A;  3KSG A;  4CLC D;  3BJN A;  3CAX A;  2P7J A;  5AVF A;  4R3A A;  4NXE A;  3IBR A;  3BQA A;  1DP6 A;  2HF6 A;  1YSQ A;  3LR0 A;  4YWZ A;  3R7W B;  3W2Z A;  4EET B;  1TS8 A;  4CLC A;  5LBR A;  3R7W A;  2JHE A;  3O5Y A;  4L9E A;  2W3F A;  2Y79 A;  2VJW A;  4GJ4 A;  1F98 A;  2K7S A;  4O01 A;  3MR0 A;  3T4Q A;  3VOL A;  1TS6 A;  3ICY A;  2HGV A;  3GEC A;  2V0W A;  2OWH A;  3MQ0 A;  1Y28 A;  2O0Y A;  1IFQ A;  3FG8 A;  4PAU A;  2H28 A;  3MF0 A;  1N9N A;  3OC2 A;  1N9O A;  3HCY A;  2QHK A;  2PD7 A;  3E98 A;  3NHQ A;  4YNR A;  2G7U A;  1F9I A;  2O99 A;  5FL3 A;  3KSH A;  2M7V A;  4PKY G;  4UQI M;  5AVE A;  2ZOI A;  3RFB A;  3R4K A;  4HJ6 A;  1LSV A;  5HL6 A;  4Q0J A;  3PBQ A;  4HH3 A;  4IJG A;  2W1T A;  3C8C A;  4DJ2 A;  5KIZ A;  2EWV A;  2GZA A;  4B9O A;  2M7U A;  5J7E A;  5DF9 A;  1G28 A;  4R6L A;  1WA9 A;  3EQV A;  2K31 A;  2NUT C;  3F1P A;  4GHI B;  4HNB A;  1NLZ A;  3BY8 A;  5L8M A;  4WF0 A;  4BMW A;  2KLI A;  2W3D A;  1YAX A;  1W63 Q;  2PR6 A;  4GCZ A;  3MFX A;  4DJ3 A;  2XA7 S;  3FC7 A;  1OJ5 A;  2JKR M;  4I3A A;  5MC7 A;  3KSI A;  1OTD A;  1VB6 A;  3OLO A;  2B18 A;  3GDI A;  4Q0I A;  3G6O A;  3F1N B;  3UB6 A;  4CLC E;  4BBT A;  1ODV A;  1S66 L;  3MQQ A;  1V9Y A;  1S4R A;  4ZRR A;  2PD8 A;  1X0O A;  2W1R A;  4WUJ A;  1TD5 A;  2Z6D A;  3B42 A;  3OOV A;  1NRJ A;  4NXB A;  1GSV A;  2PR5 A;  3C38 A;  4ARZ B;  4LRY C;  3F1O B;  3NOT C;  2KDK A;  4L9G A;  1UWP X;  5HWT A;  2QWS A;  4FSF A;  3TRC A;  1H3Q A;  1OT9 A;  2OWJ A;  2V1B A;  2V1A A;  3PBS A;  1T1C A;  4P6Z M;  3UB7 A;  5IT5 A;  2GNX A;  3ZQ5 A;  2Z6C A;  4GS9 A;  2VGL M;  3H9W A;  4P6Z S;  3DBA A;  2L0W A;  4GW9 A;  2Y8H A;  1T1B A;  3LIA A;  3UB9 A;  1UGU A;  2P04 A;  5F5Y A;  4L0L A;  2VV7 A;  3KYQ A;  2VX8 A;  1GSW A;  2WKQ A;  4HJ4 A;  3VV4 A;  4EEP A;  3PBN A;  3RH8 B;  3EQU A;  3S7P A;  1EW0 A;  3B33 A;  3C2W A;  1DRM A;  3EEH A;  1OPX A;  2DMW A;  3RTY A;  3A0S A;  2YKH A;  4MMN A;  4I39 A;  2OOL A;  5IS1 A;  4EUV A;  3NOU C;  1W63 M;  4II7 A;  4HI4 A;  4KQD A;  5KSH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...