4Y2LA

Structure of cfa/i pili major subunit cfab trimer
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
147
structure length
147
Chain Sequence
HEKNITVTASVDPVIDLLQADGNALPSAVKLAYSPASKTFESYRVMTQVHTNDATKKVIVKLADTPQLTDVLNSTVQMPISVSWGGQVLSTTAKEFEAAALGYSASGVNGVSSSQELVISAAPKTAGTAPTAGNYSGVVSLVMTLGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CFA/I fimbrial subunit B
publication title Off-pathway assembly of fimbria subunits is prevented by chaperone CfaA of CFA/I fimbriae from enterotoxigenic E. coli.
pubmed doi rcsb
source organism Escherichia coli o78:h11 (strain h10407 / etec)
molecule tags Structural protein
total genus 17
structure length 147
sequence length 147
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-02-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2040 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4y2lA00
4Y2LA 3F83A 3F85A 4Y2OB 3VACA 3F84A 4HJIA 4Y2NA 2HB0A
chains in the Genus database with same CATH superfamily
3CXFA 2QHLA 2AXGA 5IMMB 4Y8AA 4PG2A 3FN9A 2YUVA 1JNHA 2ZAGA 4AYEC 2Y36H 1N6VA 4AGMA 2B5IC 1E7VA 3ZY7A 3KJ6H 3X14B 3RGBA 1KJMA 2X42A 2G75B 1AYRA 2ZUYA 3FNKA 3BRGC 1TZOA 2B20A 3LTVA 4AV0A 3SJVB 5JOFB 2EILB 5JOPD 2BNQD 4JQIA 3CMOH 5MENE 4QRTA 2EO1A 3SDAB 2AGJH 2ZIDA 1XO8A 3RUGB 3M1BB 3WN5C 4X98B 4L2LA 4XN7A 5FHBL 4YSDA 4ODTL 2ZF8A 3TX4A 3OTTA 3BP5B 4XB3A 4OIAA 5FO8B 4CN4A 1XL6A 3BN9C 5DQDL 2G0KA 3LZQA 2NUTA 5G4OA 3AGWA 4LPWA 3QQNA 3RWIB 2IVFC 4M93B 5K1NA 5IOPA 2D03L 2TRHA 1RJYB 4HPYH 3NK4A 4HMDA 1OGPA 1WISA 4JREB 4DNLA 5EF3A 2ERJC 4NRXA 5DRWA 1FVEB 1M05A 2VXQA 1ZA3B 4NQDA 4E41A 5DQ9A 4ODVH 1N67A 1YEIL 1T1XB 4IKNA 5F89B 2B4CH 4OD3L 5CR1A 2AQ2A 4ZS6C 1TQWA 3LPOA 1BQUA 3D6GA 4PB9L 5D6CB 3BHBB 5CP3H 4JZNA 1VADA 4LRIA 4WTWA 2BIQA 3O41A 3FFDB 4X6DA 3X3FH 2PMZA 4XOBA 4EI5C 4XNQB 5BOPA 3EHBC 5D2LA 4JR9L 1VERA 1FFTB 2FHBA 1EXUB 5JDSA 2WTOA 4LSSL 3B8SA 1RPQA 2Y4SA 4JKMA 4D0BB 4HIJB 5C9JB 5B3JF 1DQIA 4ZMLA 3ARXA 3A4EA 4QOKA 2PABA 3CXDL 4NDMA 3B8YA 4P2OD 3U1SL 1DCLA 4RH4A 1R6VA 5I71C 3Q48A 3LHPL 1L0XA 2NNFA 4OCLC 4LSPL 4G83A 1C8PA 2R2EA 4HJTA 2JIXD 1VFUA 1AY1H 4RESB 3FTYA 1DBML 4WHYH 3MLVH 2VR5A 3MA9H 3GD1C 2CDGA 3F58H 4JJ5B 2Z1KA 1KB5H 3V4UL 3BPOC 1QQDB 1NAMA 3CDZA 4FQHB 5ERWB 4AC2A 1HFUA 3ARFC 3D85A 1UTDA 1LO0H 5FO9A 2DIAA 1QBLL 1YEDA 1F58H 4PJIA 5TE6H 4JZOA 3DX1A 4XT1C 1A6VH 2G5RA 3WLWC 3ZX1A 3OJ2C 4LSVH 3US9A 4XC1L 5KG9B 1CD0A 2P80A 4LLDA 3AMLA 3RVXD 5IVZB 2B39A 2X41A 1L9QA 5ESAA 2EO9A 4PRNA 2Q2LA 3ETTA 2Y6SD 2QLYA 3V0HA 2ORBL 5IVOA 4X5XA 5ICZA 1NFIB 2BK8A 5F1KC 4LLQA 3S96A 5BXFA 4ZW3A 1CFNA 1BOYA 2IWFA 1S7WA 4HUKB 5MI0B 1FFOA 2GY5A 2XV6B 4X6DE 3T1FB 5T5FA 5C1MB 1J1OL 1P6WA 2E7DA 5IKCA 4PJDA 1FHNA 4JQVA 3WFDH 4Y16A 1M71B 4UTBL 4H2AA 5DFWH 5HHVL 1F3JB 1F97A 5ILTL 3D0AA 4PJEA 1OHQA 4M48H 4EN2A 4ATWA 5T1KB 1SJEA 5F93C 3P3YA 2D7TH 5CINL 1LE5B 1T21A 2W0PA 1BAFL 5T3XE 2X0UA 3MBEB 1ZLVH 2PW1A 5DC2A 1X5YA 4X5WA 1QUNB 1LEIB 3NIFE 5F3BA 3VDBA 3CVCA 1BZ9A 1Y1DA 1JZGA 4MXWL 5D4QA 3ELQA 5E8PA 1SFHA 2R2BB 3I75B 1R5WB 4HJ0D 3ARDA 1TZGL 4M1CD 3VWJB 4OF6A 2FECL 4Q6IA 1PX4A 2B3IA 4HD5A 1OW0A 2CU9A 1B0RB 2J44A 4NQXB 1C12B 5GS0D 3VI3E 4PUBL 3NIDF 3FT3A 1RZIA 1NBCA 3X1GA 3D4CA 3RPKA 3BH4A 1UXSB 4OZGE 3WKMH 1V3MA 4RGNB 1R0AL 4HWEH 3OAYK 4LRNL 4B3VA 1I85C 1NCAH 4M7JH 3E8UL 2WZ0A 2XN9B 1FAIH 3AAZB 4UUJA 5K59E 3O6FA 3TT3H 1PZBA 3FHQA 2Q8AH 3G6JA 4MHHG 1INDH 1Z66A 3HFML 5EIVA 1U93B 1F4HA 4GUQA 3TL5A 4XOEA 4P04A 5IMLB 3EGXB 3H7LA 2J56A 3PWVA 4DO6A 4FMFA 5GS1B 1T04A 4OM0L 4OF7A 2JMRA 4RFEB 5CR8A 1LO5A 1IEAB 3B7SA 1U2YA 1ZANL 4WI8A 3ZDYB 2C1OB 4HZLA 4OZHF 2O5NA 3CHRA 3L2NA 5AVXB 4B50A 4DGUA 4ETQA 4ZW5A 1JGEA 3RPBA 2ZSWB 5K9QG 1CS6A 4HC1H 3HUJE 4PBVC 2EDRA 2D3NA 2IANA 5FR3A 1HZKA 2A4CA 2GSGA 2XXFA 4OZFA 2V37A 3RAJL 3QWOA 5DEGA 5E70A 3GK8H 2JCCF 2P8LA 3CAFA 1QW8A 2XOTA 3C87A 4LLWA 3IXAB 1WE5A 3DUUB 2LR4A 4G8GD 5EA0L 4ONFH 4QTHB 1MLCB 5CJBA 5KUMA 3MPCA 4N9GB 4XHQA 2OX5A 4Y4HD 5DQDH 2OMYA 1KLFA 3ALPA 3JSSA 1WVZA 5F6IC 1E7UA 3WEXA 5LCVL 1OM3H 3L54A 3OKNA 4RA3A 3O3AB 2YJLA 2ZP9A 4L4VB 3VXQB 3V0WL 1H6UA 3GEFA 1SMAA 4RAVB 3CX2A 4D9QD 3K46A 1QBAA 1T2QH 3LMJH 3D51A 3OKMB 1DJIA 4KITB 5D2NB 3ZDXE 4H8WC 5J13B 4P5KB 2CA3A 3KYOB 4CMHB 5E6IC 2BIMA 4BQ8A 3EOBB 4H25B 2VDOB 4OCYL 5DVPA 4JFFD 4PAZA 2EYSA 2XETA 3U30B 1DQDL 3NRQA 5H37G 1VFBB 4G6KL 5ANHA 5SWSD 3BMWA 5EU5B 3NCXA 5EPMA 2YD8A 1O9VA 3L3HB 4NNPL 1XSIA 4MCZB 1DN0B 3G5YB 1MI5E 2H6PA 3MCLH 1JZ4A 4JDVA 5KANI 4M5ZL 3LKPA 1P1ZA 2DI8A 2XA3A 3LRSA 4TNGA 1HXYA 1U8LA 3HI6H 3P4OB 4Q9RH 3H9SD 3VWKC 1A2YA 1IVLA 3A3YB 3V9EA 3ULSA 4HLZH 4V1DD 3IB4A 1KIUA 1QWHA 3MAWA 2YOAA 2X4UA 3EJUA 4R5VA 3VE0A 3RGVB 3ZR6A 3KPRD 4LARH 2IAMC 1T4WA 2CH8A 3HR5A 4HJSA 1U8CA 3F04A 5D5MB 4DT2A 4WFHE 1H8SA 5J0BA 4NHCL 5AB9A 3AS1A 1WWAX 2Y5TA 5E8EB 2NY2D 2G3MA 4RNRB 3VVWA 3NOIA 4FFYL 1DBMH 3TFKC 1WHOA 3RVUD 5C7ZA 4G82A 3F7LA 4LCYB 3ESOA 2WKLA 4JB9L 1WA0X 3KLHD 4Q9QH 4XN4A 3UYRH 3V4UH 5ITBL 1T6WA 1OAQH 2VLJD 4O4YH 3JTSB 1ZIBA 2NXYC 3GBLA 2O93L 4UM9A 1IQDA 2OW7A 2X6MA 1SEBA 2F15A 5K9JL 3OG6B 3VXMB 4XC1H 1BSIA 3LKSA 4EUPH 4OAWA 1IB5A 2I32A 4LEOA 2V9RA 3DETC 1I3RA 1BW8A 4WUUA 2CO6A 5FKAB 3QDMA 3ZTNL 5MEND 5T33H 1IGIH 4XBPB 3WE1A 1X44A 1YC8A 3KPPB 4NAMA 1PZCA 1TVHB 3UBFA 2VIRA 3NN8A 1DBAL 4Z7VF 5EN3A 3P11L 2VM4A 3FSAA 2P44B 3AB0B 1N8OE 4UT9A 1WH0A 2HUHA 4HIIA 3BZFA 1XCWA 1F6AB 3FQXB 3FPYA 1ED3B 1K6QL 3NFSH 3UIYA 1ZEAL 3KVDD 4LSUL 1JFHA 3GFUA 2QKIB 3VFGH 3N9GH 4X4XA 4W81A 3ZTJG 4UIKL 1BAFH 3WI9A 1XF4B 3V8CA 4E5XA 3MOBH 2E86A 4L1SA 4Y9GA 1JWMA 1UOWA 3QIBB 4QTFA 5EZIH 4K07A 3WUZA 3I6KB 2AI0L 4GRWF 3QWNA 1KXTA 4MXWH 4HYTB 2YAOA 1KC5L 3U6RA 4PJFB 4RZCB 3C8KA 2Q3XA 5JMOC 3VXTA 2DQFB 3ASWA 5JW4M 3WXWL 3TIDA 2HJKB 5INDA 2LLGA 4J4PD 4XWOC 3MOAL 1J10A 2VDOH 4HKJB 1Y0LA 1NBZB 2FJGB 2XY1A 4GUCA 2ARJB 3DMMD 4PRIB 4R7VA 1IGCL 3M8OL 5FV1L 1SHSA 3NCJH 4JHAH 1P7BA 2FJUB 4KKBD 2ZF9A 4AEHL 2UZIH 3GC3A 5JYLA 1GGCL 4PRDB 3V7AG 3WFCL 2RFXA 3WIFB 1AQDA 5IUSA 1PZ2A 3RWDB 3E8UH 4N26A 4KX8A 4P49A 3SYPA 2DIEA 1TCMA 2YLKA 1F2QA 3FTSA 3QC6X 2TSBA 5PAZA 4UDUA 3EADA 4TSAH 3N6YA 4K2UH 1DQLH 2EDYA 4QHMA 5EF1A 1I1YA 1U30A 4XXDA 1YYML 2X0WA 1CFQA 5GGSY 3ZDZF 4I1NB 3VD1A 2EVJA 5CILL 4KAQH 5JXEA 2CLVB 3CMGA 3QZOA 1V3LA 4DTGL 1F4XL 1ZANH 4MNGB 3C09B 1VACA 2WSKA 3H53A 3PP4H 3UGEA 3ARVA 2IO5A 3S5LA 1AS8A 1WD9A 1MVUB 4ZMOA 5SWZB 1BJMA 2DEYX 1T0MA 4UCFA 1KEMH 1BVNP 1TO4A 5BZXA 3QUHA 3UC0L 3BD4A 3RBGA 3SQOH 3EYQD 2VZ3A 4IK6A 2R27A 1SEQL 5DUPH 1MWAB 2A2QT 4KX9A 3WHE1 5C0NC 1IQWL 1U6AL 2V2WA 1OL0A 2DQHL 3TF7C 1Z9PA 2ATPB 4YK4B 1J9QA 2ITFA 3NCMA 2IF7A 2I07B 2HRPH 3B43A 2ADIB 3MRCB 3FUNA 3C6LA 4I0PB 4GAYA 5I0YA 2GK0B 4KI5E 3MLYL 3MACH 3ALXA 5AOIA 2WOYA 1KN4H 3VFTA 3V95A 3D34A 4R8WL 1XGRB 1GL4B 4X6EA 2Q6WB 5MEOA 4WEUD 4G5AA 5EEYA 1OARL 3QHZL 4P46B 2XCMC 5FW8A 3L8QA 4PLOB 3NFPA 2AKRB 5EEWA 4XNUH 4LOFA 1SLWA 1DQDH 4NERA 4G6KH 1ZVSB 2FJHA 1JFQL 2CPCA 43CAB 1PG7W 2B4CC 1INQB 1MHHB 3ALWA 1ZLSL 4AQ1A 4KQ3H 3OLEA 4L37A 3VTAA 4U6XB 1U8PB 2YK1L 1NUGA 2BY1A 2ZOKB 4KKQA 4LLVA 4AL8L 3BP7B 4Z7OF 1JK8A 2YQGA 4UILL 1LE9B 3OLIA 4MNQE 1DFBL 3GXNA 5HGAB 4HUCA 5GRWA 3APCA 5IB4B 1WO2A 4N0UB 4BK4A 2ICES 3CX5J 3FTXA 3P54A 3VU2A 1T66C 3QUZD 4XAWL 1E43A 2IDCA 5EO1B 5FM8A 3VH8B 4R96A 4I3RL 4M8RA 5L2KB 1FL5B 3QI9C 5GGSB 4KXZI 5AL8A 1PQZA 2FR4A 4BFRA 3UPRB 3VD9A 4XBEH 5HI3C 3RJDA 3AU1B 4JB9H 2GW5A 1RKRA 2UWEF 3D3VD 4K0OA 5AKVA 4M1GL 5GZNC 2YGOA 4AVJA 4F7PA 1DLFH 3L1OL 3L4ZA 3CFJA 4HUWB 4OFYA 4YGVB 1XL4A 4IJ3C 5KSAA 2CKBL 5JXAH 3QJSB 4IKLA 3BZ4A 3PGFH 4WHYG 4LCCC 1JYXA 1P5UB 1JZ7A 2NY3C 4ZNCD 3ZTEA 5K9JH 4N22A 1FNLA 1ZE3C 3BT0A 1OAXH 2BP3A 1WGVA 1ACZA 4R7NA 1SNRA 3EOYG 2DQUH 2JB6B 2VDKH 1VZHA 3QPQC 5DWUH 4JFOA 3W3BA 1ONQA 4P23D 5KW9H 4KTEH 4JFDB 4FYQA 2AEIT 2J20A 1DBAH 4Q97A 5D7JB 2CBTA 1BVLA 1ODUA 3P11H 3NCBB 4TOYH 1NGZB 1VPOH 1MWAH 1SDYA 2DMKA 2LAAA 3HMWH 3SIKA 4E42B 4LSQH 4ISVB 3IU4H 4YHPB 5IQNA 4XCYB 3ZL4L 3WKNA 1BPVA 4JL1A 4HBQA 3SDAC 1EFXA 4LPCA 1QOKA 4X7EC 2BIIA 1DJYA 1PYWB 1RIHH 2ICEB 5JQ6H 1JIBA 3K8KA 2EACA 1Z6JT 4NPJA 5F21B 2G9HB 1U8MA 2HVKB 3FQRB 4MB4A 4G6FD 1KXVC 3UOAB 4EVNA 2W65A 4ZD3H 1II4E 1H6EA 1P53A 1B4LA 2SODB 2ZCZA 4OD2B 3WXWH 4HGWA 4JY4A 4R2GB 4FZEH 1YEKL 5KWYC 4KNTA 4K23H 1IGCH 3M8OH 1MI5D 1Z9MA 4GUPA 1ZD6A 4M6NL 4GI8A 5GISH 4NM8H 3O9WD 4CADA 1A9BB 4PIBA 4PLJD 1W0VB 4HUXB 4OLUH 5FW6A 3DRQB 4Y19D 2PTVA 4WFFE 3C5ZB 3TURA 3K6NA 5I75B 4K5LA 1T4KB 1MFEL 1WP6A 3L5HA 3RWJA 3LRLA 2WXPA 4I18C 4QKXB 3AVEA 5D8JL 1VRSA 3WLBB 1U9KA 3QNZA 5IHHA 4P5RA 1U2HA 4GP4B 1O9ZA 3HE6D 1LEKB 2J8UB 1HCZA 4MAYB 4AYGA 3EFFA 2COVD 2GFBB 3H55A 4U1GB 5KYYA 3DX9A 5FO2A 2LTQC 3NIDB 4NWTL 3ZT5A 4PU2A 4BZ1A 3SBRA 1DQKA 4OM1L 3F83A 4HEMA 4I77H 3ROOB 5F9JB 3FOMA 1NGXA 3WN5A 5L8KB 1IC4H 3U7AA 2E47A 3BSZA 2ZX9A 1HCYA 1OV8A 3HZMA 4LK4A 4ZUWA 3B2DC 4C58B 1BZ8A 2ZYHA 4HFUH 3M1CA 1YJDH 2Z91A 5TJWK 4ZAKD 4K94H 3IDYB 2DQHH 2GCYB 1Q38A 1DL7L 2YEZB 3PABB 5E8OA 1OHZA 4HAFA 3VSVA 1A7PL 4QXGL 2QTVA 5D9SA 5EUOB 1GTFA 1KIQA 3A21A 5I1KL 4NKMA 1Q72H 3QULB 5KSBE 1BD2E 3SBPA 5EO9A 4N2GA 2JKWA 1L5GA 3PCYA 3V0JA 2XWEA 4OZHB 5HDQH 4OFDA 3SODB 4OZIA 4LVOB 1F90L 2ZKHL 3QQXA 1MCFA 4IJTA 3ULUH 3HPJB 5LGJA 3VQ1C 3QJFA 3EH4B 5EBGA 1W9XA 5IWLC 1CK0L 1J9RA 1OQXA 2XKSA 2CO7B 3EBAA 3JWNH 3MSPA 5CM1A 1KULA 5I76B 2WUCL 2X38A 4XNZB 3QB7C 5IVXA 2JCCB 3PIQA 3KPSD 2X12A 4JHBA 5HGGS 1JFQH 5ACLA 4OVVA 5IMOB 2ZCLL 4W6YB 3S3BB 2HRGA 3TBTA 3B1TA 3IETA 3MBXH 4OT1H 2VYRE 1HZHL 3IPEA 4RMWA 4NQEB 4P5MB 1PD0A 4AIZB 2EADA 4UILH 3RZCC 5LNGA 1CGUA 3EDEA 4HA1A 1OVZA 4HPHA 2SEBA 4KVNH 2YXWA 2JSFA 2CNZA 4PJAF 4UV7L 5AOKA 2PPEA 4FQCL 1DVFD 4I4WA 1TYRA 4L3EA 4Y88A 5I23A 1GGBL 1BREA 1WFJA 4JDZA 7PCYA 1HHGB 4CGUB 3CFKA 1NC2D 2CO4A 3NQKA 3UTPE 3DTXB 3CFTA 1LDPL 4WAFA 5EBWB 5KS9F 5BUAA 1M56B 1IO4C 5E5LA 4HLZG 1XMEB 1IAKB 3HB3B 3LZNA 1X5LA 2HJFB 1TQSA 1CLYL 2NW2B 3ARFA 1BQKA 3KBPA 1OOWA 4P5SA 2YBRB 2WQVA 4WY7L 3H9HB 3JYCA 5DJ0B 3L1OH 1AP2B 4X8GA 5DZAA 2OYKA 5IJDC 3S4SB 3JVGC 4J6RH 1I8MB 2QLVB 1MRFH 2NUPB 3IDMB 4FQLH 4U1KB 4DCQA 2PTUA 2V7NA 4FLHA 3OAYH 3MLUH 4BFIB 3VMPA 3P0GB 3HW7A 4PJCA 4RMBA 3F3HA 4LF3B 4MXVE 4YVUA 3TVMD 4Y5VB 4IS6B 2YN3A 3GXIA 5DD1L 4PSPA 3ZRFC 3IDJA 1G6VK 4KK8C 1CR9L 4ADJA 3SYOA 5IVXE 3UPCA 1AGFA 2X3AA 5SX5K 3OQ3B 4U49A 4I5BA 2VN3A 3B4NA 4HKXB 4ODUB 3QGVA 1DZBA 1TDQA 1YNTA 4JO1H 4O02A 5FUCE 4EN3D 3L5JA 3L4CA 4ODXB 4NSKB 1YY9C 6TAAA 4IIZA 3ZK0A 1NJ9A 3EJYC 4XPTH 5I6XB 4RQQA 3VXSE 2P8MA 2AAVA 5I1AA 5EWIL 1A4JA 1S9YB 3BAJA 3GSVB 1MCSA 4Z95H 5I1GL 3HHMA 3CCHB 2G2RB 1IAIM 2DQCL 2RBLA 3CIQA 3P3SA 4RFNB 3RHWF 3UL4A 2JI2A 5L88L 5FYLL 4PJXE 4L3EE 1PDKA 3N40F 4POUB 4YXHL 2MCMA 1QZ1A 1TVDA 4FRWA 4KRMB 2RCSL 3T2QA 3WNOA 5EBLB 3QIWB 4Z77B 1KGXA 5EN2A 1BVKB 2IQAB 5D70L 2ZG3A 4KZEL 4NP9A 3LQAH 5EOQH 2VJXA 3RHWK 5DEJA 1UFGA 1P9MC 3L5WB 4Z5RB 3W11D 3W39A 1MCBA 4U31A 2J71A 3MLRH 2A73A 3A47A 3GRWH 4JMNA 4WTXA 4ZK8A 5LAPA 5J13C 4JPQA 1KSRA 1IM3D 4PS3A 2VCOA 5EZJA 3UO1L 1I85A 4H40A 4N2CA 1UC6A 3INOA 1J12A 3SE8H 5E5MB 2BY0A 3HNSL 3TBWB 5SX4I 3MNMA 4V2CB 4MNQD 1KLGB 2PCXA 3FRUA 3I3EA 2K8MA 3U6XA 3GZPA 4HEPG 4NWUL 1I9IL 4QYOA 3TM6A 4KTGA 5F9AC 2R0LL 3FUDA 1CDUA 1CU4L 1MLBA 3KPNA 3F7QA 4FXKA 4UTAH 3WD5L 2W60B 1H19A 1QFUL 4GRWB 3H56A 4ZNEA 4FCAA 4QHPA 3IS0X 3IU3B 4N90D 4NAJA 3AY4A 5DDHB 1UWGH 4GAJL 5C0CB 3ZHNA 4ZI8A 1G84A 2MOVA 2OMVB 3H7BA 4Y1AD 2FYYB 1Q0XL 5C0JB 3BPCA 1QUPA 4X6CE 2PCYA 1EX0A 1I3GL 3E3QC 3GSOB 1XT5A 5IHZB 1ZVNA 4MQSB 5I6MA 2V33A 5GS3A 3TN0B 4R7XA 4F8QA 1QO3B 4AIXA 1E5CA 1HOCB 2EIJB 4MXQD 2Y9RT 5E2TL 1BBJB 2W9LA 2QADD 1M57B 3LB6C 3L4WA 3K6SB 1IBGL 1JP5A 5GSRB 2KZ1B 1CF8L 1NGPL 3HHSB 1VESA 3QUMA 4TYUA 3E2HC 4QJ4B 5HXMA 5JHDB 1A7PH 4AJYV 4QXGH 3BH8B 1H8LA 1JVKA 3NCYS 1CE1L 3ZDZB 5BRQA 1XSOA 3BWUF 3P77B 3WKYA 5EZOH 3ISRA 2UXFA 5JLZA 3D7PA 5FGSA 1B3IA 2VJ0A 1FC1A 2I25N 5E6IA 1F90H 4TPRL 1GZQB 2W92A 3HKZA 3NABH 2I26N 1S3KH 2GSIA 2OQJB 3B2VL 5KSUA 4URTB 4L3CB 4YHKL 4JRYA 4Z7UA 1QSEB 4OJCA 5D4IA 3LHAA 2J72A 3CSBA 4Q14A 1F2XK 4QY8B 4JE0A 3GDBA 4WO4B 1NUFA 1CDBA 5EUKB 1HAWA 4MZ3A 4ZNEE 5GRJL 3BE1L 4PM1A 4MQ7B 1W91A 3VWKA 2QKIC 1UXMA 2EKSA 2XTJD 4AMXA 3O3EB 2KC0A 1MFAH 3IF1A 5HJBA 5FYKL 1N70A 1RK1B 3DTUB 3II3A 2MJWA 5DJ6B 1AQ8A 1I4FB 2F53B 2IAMA 1S7XA 3MR9B 4EI6B 4X8JB 1BFVL 1TR7A 1KG0A 5CD5D 4WWID 3VD7A 3CLFH 5EU6E 1BHGA 1SYVB 2X40A 1U8JA 4L29B 4L0PB 1T22A 1XFPA 4HCRA 4UOQA 4QJ3B 2BSTA 4MJIA 3UAJC 2NY5L 5C3TA 4KZ0A 1F3DH 3ZTDC 3KLDA 5I66B 4OUUA 1CLOL 1KJ2A 1QG3A 4F5CA 4AQOA 1N12A 3JT2A 4QF1B 2A6IA 5TF1L 3DOIA 3O45A 5ISZA 1CLYH 1QSFB 4BDVB 1DJHA 4PS4H 4RGMB 4APQB 1XGUB 3UYPB 1JG9A 1JPSL 1XF3B 1RFDH 3FUFA 3G6DL 3PG2A 4Z7OB 1DDTA 2B16A 5BO1L 5ADOL 2H5UA 4QRPB 4KK6C 1RUPH 1HHKB 2JELL 4P99A 3RWCA 4MDRA 4NLAA 1G0YR 1H9VA 1UQSA 1ZT1A 2HLEB 3QG6A 5HVHB 4PCYA 1MCEA 4G5ZH 2VUKA 4FOMA 4IRSB 4O2EB 5A2AA 3WDIA 3DV6A 4MD5A 2OXHB 3U25A 1USZA 1SOKA 2NZ9D 3H6JA 4QJ5B 4QHNA 1HYRC 3B5TA 4PCKA 3HHRB 2XPYA 3V0VA 4YZFF 4JVPA 4L18A 3E80A 2NZIA 2CLRA 1UXLA 3H8NA 2JB5H 3IMVA 4U3SB 5FS5A 2HAZA 4TNFA 1I9JL 3TTYA 5LHDA 5KJRH 4CC4C 2UWEB 3LIUA 1SUHA 3H3KA 4U6YB 2WWKO 4GKSB 1RQ5A 4DERA 1TEFA 1DDHB 5DVNA 3CFCL 5I1DA 1BD2D 5EWIH 1JD7A 3RZWA 2FEDC 3DA0A 2GTZA 3REVB 3FQNB 1X7QA 2HKHH 1ID2A 3ILQC 4G9DA 1I1FB 2F54E 4YDIH 3PHOA 1E4XH 5DRZA 5AZEL 5L88H 2QDWA 4PRPE 2JJTC 3NACL 3DXAD 1MPAL 2ITCB 1BX2A 3DX6B 1HQ4A 3N1FC 1W16A 2OCCB 1GGUA 2VWEC 4HIXL 4MJIE 2WN2A 4JM2F 5CKAA 3JTTB 1N0LB 2Z6FA 4ZQKA 1E4HA 4MD4A 2OAAA 1NFDB 1YMHA 4F5CE 4DGVL 2CDEA 1P4BH 5CEZH 3VXUB 2V2XA 4WENB 1RUKL 5AOMA 1OGTB 4BQ6A 3MRLA 4YMPA 2Q0ZX 2R4RL 1NCUA 3BUTA 4B0MB 4CUCA 1TO5A 1B9KA 5CU5A 1QMUA 1HAUA 2Z7YA 3AG1B 3ARPA 3V6FA 2D4FA 4EZKA 3Q44A 1EH9A 4DUVA 2HRLA 4WDIB 4RMSA 3PPSA 2EEBA 4NWUH 3IGAB 3SQRA 1I1RA 1I9IH 4W6XB 3CVIH 4YHIA 3GKZA 3DK2A 4XZUA 3DIDA 3FCSA 5HDBF 2WWMC 1XCTA 1VJSA 2RTTA 1NEUA 2UX6A 5FA4A 3KGRA 2DIBA 4OLVH 3S88L 4S1QH 2IV8A 1A4KB 3GWJA 1NUNB 3GMMA 3UTPD 1DBJH 2X4SA 3OHXB 4A55A 1DVYA 2XG4A 4LO9A 2J88L 1N0XL 4GAJH 1TYJA 3QEGL 1KTCA 5BPPA 4H1LA 4GMTL 1CB4A 1Q0XH 5EOCL 1DVQA 1WBXA 1X6NA 2LW3A 4QRRB 3IDIB 5IROC 4WQOA 4G80A 4IHOB 4IIQC 4JGJA 5CS7A 4R84A 1A22B 3OKLA 1RUAL 4L48A 4GG6F 5IJBC 3G5ZB 1EMTH 3FUEA 4NENA 3VH8G 3ZHKA 1A8JH 1AO7B 3DVFA 4IOSA 1A7NH 3UJJL 5DZLA 2P47B 5BVPL 1OQOA 1SDDB 2VABA 3QDJE 5LLIC 2YPVH 4BKLB 2OCJA 1CF8H 1NGPH 3T77B 1A02N 2EXTA 3SCMB 2HB0A 2OXGB 3DHMA 3H9SA 4HBCL 2P7TA 4MQXD 1ZDQA 2YBGA 2XICA 4FTVA 4L5FE 2XN0A 4V1DA 4PI0A 4XH2A 1YQVH 3QO1B 1T03L 2Y2YA 2JKLA 4EO5A 1KNOA 3R1GH 4MD0A 3KPRA 3A6CH 4XNYH 5I18H 3WUWB 2ZKWA 1S8DA 1JZ5A 4DK5A 4AVKA 3WNPA 1J5CA 5CCKL 4FHBD 4U1HA 4PBWD 2GJ6B 4LLYA 1AGEB 4LIQH 4XPHH 5F0JB 4N3UA 2WLMA 4L8CB 5IF0A 1J48A 5A43C 3QEQA 3KXFA 4XNMB 5C0FA 1IKFH 1FUNA 2ED9A 4PVMA 1G7JB 1BV8A 4XX1G 2AAAA 2YN5A 5D7JC 4L8SB 3CZSA 3CZFB 2BFVH 2XRAH 4H88H 2BO0A 3GPEA 3LXBA 4BFEA 2VSMB 1I1CA 5IR1A 3NJGA 2HLFC 1YZZA 1V7NL 2GJPA 3JWNG 4BRJA 4PJ5D 2NCMA 2ZUUA 3QRLA 3SDXA 1MHCB 3GYRA 3C2SA 4XP1L 5FYKH 4C56D 3O2WH 3WJLC 5CSGA 4AYFA 1BFVH 1N5AA 4MWFB 4KQ0A 3IRPX 4GXFA 2NNCA 5ETUA 1TZHB 3N1GC 4YE0A 3J8F7 4OV6F 3U9WA 4AL8C 3QI9A 1CVRA 4LSDA 1A9EB 3P9LB 3QCVH 4LLMA 3DDGA 5J3HD 2FBJH 2XIBA 3KDPB 4TS6A 4WFED 3VFOA 4MNHB 2NY5H 5CMAB 1JPFA 3TV3L 1T20A 3VNZA 5HGHB 2X89D 2FSEB 4R2GC 1XGYL 2VSDA 1MCPH 1FV1B 2G60L 4YDZA 4NZTH 5GZNA 5B39B 4IRZA 8FABB 5SWQB 2CCWA 2MOGA 2Y7OA 1M7IA 5DZNA 5E8NB 3UZVB 4NM4L 1PKQB 4TKWA 1Q9LB 1NIAA 5D1QB 1JPSH 5DJ2B 4YN3A 1EVTC 4LCCA 1CFTB 5FAAA 3L3GA 5BO1H 4GO6B 2GI7A 1KLUB 4X5LA 1D7BA 5I0XA 4J3OH 4P59H 5IMMA 1RPUA 3PLYA 2IGTA 4CKQA 1M7DB 1I9EA 3PAYA 4EE2A 1GR7A 3BVNA 4BWWA 3CU1A 3OF6A 5E9DB 2ZICA 4RWYH 1T1WB 3QEQE 2QPDB 1KFAL 3KXFE 2APTA 3OX8B 3V5HA 3VYOA 3VXOA 1RXLA 1I8AA 1E2WA 3V5DA 3VXRD 1D5ZB 5KS9B 5D1XD 4JFSA 3ZTCC 3OSKA 1PG7L 1U58B 4BK8A 2CUMA 2VKXA 3BX7C 4U1GC 3H9ZA 3RL2B 4K7PX 2DIJA 4G3YL 1L6XA 2P5WA 1T5WB 3P4NB 5LVEA 2EEXA 4B5EA 5IFJB 2QR0A 1PLGH 3CFCH 3EOAA 4JFXA 2HG5B 4KQ4L 4LMQI 4ZW8A 5HHOD 1UUNA 2C3HA 4GW1B 5TGBA 4HS3B 2NSQA 3F65A 1NBQA 5FGCE 3VYPA 2UY6B 4UZSA 4YBQD 3KPLA 1KXVA 3FB6A 4YBHA 1CDGA 4MA8H 3DLQR 3QUXB 2DL2A 4XBGB 1N10A 5EU4A 1S78C 4TUKL 3BH9B 4X50A 3KNBA 1XBRA 5D7LB 3ZKSD 4XPAL 3EYVA 3SQBB 3MRRA 2APXA 1J5OH 3GMRA 4UANA 4DGVH 1HJCA 5C2UB 3QUGA 4W9ZA 1L0PA 3PV6A 2BOBB 4WEBL 1T1XA 4EZLA 4QR7A 3RBSA 3FL7A 5BZZA 3RTQC 1BQHA 1EQWA 1TETL 2LT9A 3ARGD 4HQQL 4XNXL 4X6BA 4J1UB 3KBEA 3KWXA 5F96H 2YRBA 2UUDK 2YFNA 4UTCA 4ZDHA 3TIEA 3MROB 3BHBA 2UXGA 1R46A 3B2UC 4S1DC 4WEEA 5IB2B 5FA3B 1KXQA 5IK3A 5JHMA 3GLDA 4I18A 1HHJA 3BDYL 3QH3A 1HEZB 5LBVA 3AS0A 2R4SL 1YMMB 2DQGL 5EU6D 5EB9A 1XCQA 4P5TD 1O7DC 1NEZA 4QRUB 3N1PC 3S88H 2QQNL 1G7MA 3TWYA 3VGGA 3ORJA 1AZBA 3TONA 1BDYA 3QBTB 5DYOB 5JHLH 1IAII 3O2VL 3AXLA 3SJVE 2WBJC 3BXNB 5E1GA 5IFAL 2Z35A 2PUQT 3QEGH 5JTWA 5L6YL 5DI8B 5I1HH 1OE1A 4JO4L 4ZUSA 1LP9F 2H1PL 3NTCL 2Y2WA 3FCUB 2FO4B 3QFJA 4RSVA 4OI9A 3V4PB 3T08A 4EBQL 2F2HA 4YXLL 3BAWA 5E1HB 4LCUB 3DOHA 4BELD 5GQBA 4KUCF 5EU7C 2IPTL 1AIFA 4JJ5A 4CBZA 3Q2NA 1R5IB 5BVPH 1ZA6A 2H3NA 4FQHA 2WQWA 4GNKB 4IOIA 4YR6B 5DT1H 2O72A 4EXPX 5I1CH 4R97B 3DTDA 3NCFB 4HBCH 3K80A 3S3SA 3VRIA 3GSWA 2NXZD 2PWDA 1FL3A 2EIMB 5LKNA 4X5PA 1T03H 4B9IA 5HJDA 2BZDA 4HXAL 3S4SG 2CO2A 3MU3A 3QUZA 5ANMB 1A1NA 4OKDA 2KQMA 3M7FB 4KVPA 1UD5A 4M61B 3UROR 1MELA 5IWLA 2XQBL 2DLGA 4HVBA 5CCKH 2PN5A 1BIIB 4PTUA 4M8UA 2ATKB 4ZTPL 1L9MA 4Y4FC 2IMNA 1BYOA 1VFAA 2CJTA 4HWNA 1KXQE 3CJJA 4CSZA 5JW5B 4WHCA 3SO3C 3OB0K 4NJAH 2VW7A 4MMXB 5T1DL 3VFNB 3RP1A 4YHZH 4P8QA 3VXNB 3MBWA 1CDIA 2F54D 4WUKH 1EEYA 3ZKNC 3SKUD 3DUSB 4HAGA 4TVPH 1M2VB 5SX5H 2Y5QA 1UT2A 1N59A 2VXUL 3RZCA 3DSFL 3MTXA 5AYUL 4PGEA 2DYRB 2KPNA 3O8XB 5FK9B 1A7BA 3TBSB 1JYVA 2E5EA 2R1WB 2DM2A 4CRPA 5HHQA 1CF1A 1UWXK 3SDDD 1CDHA 4K3JL 1BEYL 1X4XA 3BVVA 4RFNC 5DEFB 5IGXL 2FQFA 3QFJE 3HJEA 4X4MA 4GY4A 4F7KA 3MUHL 5DC0A 5FFOA 2A5UA 4N2DA 3C6EA 2QPEB 3NAAH 1FIGL 3GJFK 3ZHLA 4PJHF 2QSTA 4HFWA 4PG9A 4WJ5B 4AQZA 5JPNA 4FZ8H 4KI1A 1MQKL 5ALBH 1TQUA 2DWDB 3INUH 4MMZC 1QLFB 4NLHA 5KJ7E 3IFPB 5T1LD 4G8FA 5E23A 3EO9H 1YECL 3JVGA 5TFSL 1IM9A 1RZGA 3AAZA 5CJOL 4E9RA 5EORL 32C2A 3C6SB 5C0RH 3DROB 4M5TA 1NCGA 3X13B 5A3ID 5I2IA 1QRNB 2K3TA 1OSPH 3DV4B 1G9ML 1FNFA 2UZXA 3PDOA 4A2MA 1SXNA 3MV9A 4JPVH 4NFDA 1ODAA 1UT9A 4IYKA 4WV1C 4NCDA 1URZA 4WO0A 3FTZA 1IEAA 1SXCA 3VQLA 4WJG3 2JCWA 2C1OA 1I3VA 1I1AD 3UPAA 4HWZA 1I7UB 3V4PH 4NKOA 5DGRA 1MAKA 2IH1B 1Z5LA 5DO2D 3TO4B 2ZKYA 1CCZA 2ZSWA 4IU3A 2EXWD 5BV7B 3U46B 2GC4C 2WV3A 2JKXA 1U8OA 5BS0B 3HBQA 1JVOA 1MNUL 1U3JA 2CQVA 3QDJD 4XHJC 2JI1A 2H32B 2WD0A 1AOHA 1E9PA 4XVSH 5CGTA 4MJHA 2VGLM 3SBQA 4UT7L 3U2JA 2JQAA 3CIAA 4U1LA 4UTBA 4JO2H 1OAUH 3DHUA 3MJ7A 1QBBA 4IBVA 4QTHA 1FGNH 3P4LA 3WKPA 3MJ9H 2DQEH 3BZ5A 3AZUA 3L3DB 1ADQA 1MF2H 2AQTA 2OMXB 5FX3A 5INCA 2HPOA 2DYPB 2VITA 3B2XA 5IV2A 4D8PA 2VLRA 4YWGH 2QVMA 1MHPL 3SE9L 3X12A 2GVYA 2ZD0A 3EH2A 1P9MA 1ZV2A 5FKPA 3WL9A 2QPSA 3GSNL 4OQTA 4RGNE 4N8VA 3WTSA 3DRTA 3MREA 1JNLL 1G7HB 1N64H 2BXYA 2QKSA 3CX5K 2XN9E 5JR1H 3MXWH 5FM5O 1MCQA 3BKCL 1KFGA 4A1RA 3BT2H 3CFNA 1X9UA 3L3HA 1XB8A 4YEFA 2Y5EA 3FU3A 1MH5B 3Q1SL 3HZVB 3EOTL 1DJGA 2CHXA 3G5YA 2DMCA 4NUJB 3CN4A 2B1AL 3MV9E 4Y2LA 3TBYA 2A0LC 3FW6A 5D2LF 3FQ4A 3QXDA 1A7RL 3BIBX 3JWOH 6PCYA 3PS6A 2A77H 1E8WA 2A9ML 3ZDYE 3RDTC 3ES6B 1BVNT 3PGDA 1VAHA 4NCC1 4JM2B 1T5XB 3TZVD 1RK0B 3HAEB 3QDGB 1JMZA 3MFFB 3NRPA 4GSXA 2VO5A 2EDXA 1UM5H 4FP8H 1FVDA 5H2BB 5E24E 1QSVA 2FZ3A 2H1PH 2OSYA 3LPFA 4GBXB 4YUEL 1XH1A 4QRSA 3N5AA 1HYSC 5E8EA 2H1LM 5IFHL 3N44B 1Y18A 5DK3A 1IGML 2CE6A 2IPTH 2ZNXA 3IDNB 2N7SA 4S1RL 4XN1A 5JPMB 4NUPA 3WS3B 5DD3L 1ZT7B 3FTVA 3PV7A 5TQ0L 1TPXC 3FFCD 3Q1EA 3N85L 4KJWC 1SUJA 4MB5A 2BMKB 2FJFA 2JLLA 4OU3A 1D9KD 4LEBA 3OR7A 4L4VE 3UC2A 5FUOL 4UQ2B 2IIJA 1YO4A 4APQC 2AK4A 5A7BA 2DEXX 3OR6B 4AZ8B 1FZKA 2WKGA 5F1OB 1AR1D 2W9EH 4G9FD 4M62L 4PJIF 3HEIB 3OKDB 3WFZA 4MJ5A 4B9FA 4CN6A 2R56H 2Q7AA 4F7EA 4I85A 5LJYH 3TA3C 2Y7SA 5LCVA 1KBPA 2BSSB 2NYYD 5GRUL 3UAAA 5HVHC 2I69A 2BZ7A 5BV7H 1QYGH 1E5BA 2GJJA 2FEEI 4IRSC 5I1IH 3HRPA 4QNPE 2H32H 4GG6B 3K1KC 3LEVH 5FFLA 2KLSA 4MJJA 3ZE2F 4JKPL 3FS9A 1P4LA 3BMVA 4AGOA 1XF5A 2PPFA 43C9B 3RB5A 4PJDF 4OTXL 1CQKA 4G42B 4HISA 3V6ZB 4PJEF 1N2RB 3RLSA 1Q94B 3N43F 3O0RL 4HZAA 4Z7QF 1JI2A 5AAMC 5TH2B 2O61A 3CFBB 2ZT9C 1KYDA 1QR4A 2VLLA 4W93A 2Z64C 1F4YL 1V8HA 2XWTA 3OAZK 1AC6A 4NEHB 5HHMD 4WSKA 5D5ME 3RFZB 5I19L 3NYKA 2WSDA 4GOSA 1NOFA 2AERT 3I9GL 4U0RC 4D8OA 3CTTA 4IMLB 4R26H 1L7IH 4HKJA 5E5UB 1IILE 5CFAA 1TJHL 1JAEA 3ILPB 4MJ4A 1FA4A 2Y24A 1MQKH 2XJLA 3HE7C 5EULV 3JV4B 3TYFB 5BJTA 4LVNB 1GZPB 2C4FU 3FULA 3H3BC 5ESQB 5FV2A 2JV6A 5BRZB 2CRYA 3IJEB 1IFHL 3LAFA 2CD0A 4FFYA 2BJMH 5C3LD 4QCIB 2X70A 2ZUVA 3T2PA 1I8IB 5EORH 1KBGL 2ADYA 3C9NA 3NT0A 2EXSA 2XZCH 3I50H 3VFUB 1XGPA 5B8CB 4WI4A 3G6JF 4QRQA 3HAEH 4ZFQA 1RZ7H 1FNSH 4NI3A 1I8LC 1NBYB 4IBSA 2K78A 3C8HA 3L5IA 2IC2A 1YNKH 4HX1B 5E08L 4WTQA 4DK3A 4BUGA 4F15B 1SMOA 1PZUB 2AQ1A 1GGTA 5LWYL 2EQDA 1DCEA 4M7LL 4S0HA 4PJGA 1VA9A 5EO0A 1WPCA 4J3OG 4UIMB 4W9CC 4C4UA 5SWZA 3WOVA 1D6VL 4FF9A 1P2CA 4HW6A 1OAYL 5I8OL 4ZX6A 2Z92A 1XB6A 2XVBA 4XGZB 2APBA 4X7FC 2A6KB 4G70B 1A9VA 5KSVB 3HRZA 5C7XH 3MFGB 3BFQG 3DBXB 1CQYA 1NKOA 4LEEA 2JJTA 1EANA 3UEQA 3X1EA 4PRAA 2GB2A 4PV9B 2X44D 2A9AA 4PJFE 3GBNH 3N2JA 3RRQA 1FC2D 5DZVA 4APXB 1RI8A 1AKJA 1E9QB 3L81A 3OAWA 1O6VA 5KANG 4ELMA 2BXZA 3SE9H 3GMQB 4PRIE 3A5VA 4TSCH 6FABL 3NPZB 2WXIA 1JRHI 3UTZA 2IH8A 4NQVB 5ADPH 2Q6WA 1SHXA 3FCTB 4DKTA 4M00A 4ODSH 3WUWG 3X3GH 3QIUB 1U8HB 1JNLH 2WLNA 2NCEA 3MRBA 2C5DC 2HVBA 2X9XA 5DFTA 5LGKA 1FO0B 3T3PF 3T3MF 2HRHA 4C8XA 1ZVSA 2H2PC 1HX0A 4YNYA 1MW2A 3S5YA 3Q1SH 3R06A 2DQ6A 4NJ9L 4L8SC 1X5JA 2PO6B 3GS4A 3KPOA 2WIMA 1I8KA 3C5JB 4A7SA 3V4LA 1GC1L 1QVOB 1WBZA 2A9MH 3NSDA 3OKKA 5DUML 4JFTA 4FFWD 4MNGE 4MZIA 4M6AA 4PVLA 1I53A 3MNZA 3P73A 4YH6A 4GW4B 2Y7QB 4FNPA 1A3LL 1RD6A 5SWZE 1H5BA 3ASNB 3TPUA 3BWAA 4UAOB 5I1EL 2O5YL 4R5XA 1EZUA 5JYMA 5LXVA 5CD3B 4IIQA 2KERA 5IHUL 1HN1A 3H0TB 1OCWH 4AQAB 4LHUA 3IS1X 1R3IH 5ECGA 1E40A 2O26U 2N1TE 3JUZA 2VB5A 2J4WH 2J57A 2P42B 1S7UA 3V2AR 4KROB 4U1JA 4FQXC 1F18A 4N0YL 4PP2A 2WLIA 5F7DA 5BZDA 1AOZA 1BZ7A 2TSAA 4IGBC 4TQPA 4BGDA 1NBVH 3FB7A 5G4NA 3KPQA 4HXBL 3KWWA 3MRHA 2IADB 3B5GA 5B39G 3WEBA 1JWSA 3LS4L 4XMLL 1D2OA 4IOFC 1E28A 2GBAA 1OT2A 4HUMB 3UTTA 5K33A 2AJUH 3ARZA 4L9LB 3G9AB 1SXSA 1B6UA 2BSED 2ZUTA 3CSTA 4GQRA 2WLYA 1LD9B 3U9PH 4NZUH 2CMRH 3MBED 3QFDB 1OK0A 4DP9X 3HZYA 1JWUA 5CXPA 5D1ZC 1MRDH 4PRBA 1ZGLA 3JV5A 4DPRA 5F9WB 5MERB 3HI5H 3VI4F 2NT1A 5DMKA 5SX4H 5IJVB 3AWGA 4ES9A 1F86A 2WXMA 2DTSA 2HTKC 5IEHB 4OLZH 4KVCH 4OTXH 1XXFC 2XWBA 2V5SA 1KBWA 4JO3L 3CFEA 1JHLL 1PD6A 1Q0YL 5EBMB 3VWJD 5GGUA 1HSBA 1U3HB 3OXSB 4CMMB 3BKYH 1E27B 3LQZB 3F62A 2ZG2A 2A74A 4N0UE 1F4YH 4OV5A 1OTTC 3PGCA 4P4KB 3SGJC 1T1ZA 5SV4A 1AR2A 5DJ8A 2X4RB 4ALAC 3IT8D 4RGND 4FXLA 3CN3A 3QUXC 4AGQA 2YGPA 5L2KE 1BVOA 4A2EA 5IB1A 2CCVA 1KYFA 2XYCA 2Z3FA 2QZQA 3QJTB 2CRZA 3OMAB 3W37A 2BRQA 3DO7B 3PL6C 1TEGA 1EAJA 3ATFA 2YGQA 3O6LH 1BM3L 4BKTC 2JNZA 1TJHH 1FO0H 3OZ9L 2EIKB 1CJYA 3HPLB 4KXCA 4X5RA 2J5LB 3DJ9A 1OZUA 1VIWA 4HUXA 5B3JE 3OLGA 3ZYOA 3FK3A 2GITB 4GEIA 2X87A 5DJCA 3VA6A 2YD5A 1UCTA 1OZTG 3GJFB 1JCKA 1URLA 3DXAA 4FTDA 1BIHA 2UUDH 4F7TA 3K2UL 1O0VA 3LV3A 3VGAC 2CKBA 4RX4A 3WEMA 3D33A 3NVQA 3T65B 1YQ2A 4XX1E 4DQOL 3ULVF 3KPTA 2A9DA 2WXGA 2XY2A 2X7LA 5JOEA 5DJZA 4K3EL 5KYWB 3CQQA 1T1YA 5LWYH 1YN7A 1EAPA 1JZDC 4PJHB 1H3XA 2G3NA 4ERSH 1JHKL 1SLXA 3DIFA 4D3CL 3IBOA 4A67A 4NXKA 1E65A 4PJ7F 3CFDB 2F5BH 1JS4A 3S8FB 2YHGA 5J6GA 1RPKA 1OAYH 5E4EB 5I8OH 4L4VD 4AK2A 1BPLB 3P2BA 2VW6A 3A0OA 5HGDB 4AYSA 2VDRL 1I7TB 4XVTL 3GMLB 2RB8A 4MVBC 5DHYA 2EEDA 4Z3IA 2F58H 3BZEB 3IGFA 2Y72A 4RA0C 2AJ3A 1LO4H 1E90A 1KV3A 1U3ZA 4AMKL 4ONHB 3CVHB 4HMCA 4KY1L 3HLAA 5JORB 4Z18A 1KPRB 1WV7T 4OJYA 2APVA 2AXGB 2IV9A 2CJSA 3WEAA 2I5YH 4LESA 2HVJA 5KAQF 3EG9A 1JNHB 2HT3C 1FPTL 4NO2A 3VNYA 4OJEH 4GQQA 1KJMB 3S37X 1G7QA 1BEXA 3BP4A 1DANT 1DQVA 2H8PA 5E94A 1UG9A 3RTQA 4PV8A 4CC0A 2V7HB 3HPJA 1AZNA 4CN1A 1JSYA 5EH1A 2FX7L 2YEVB 4WI2A 1DJXA 2MKWA 2JQMA 5I76A 3RVWD 4L4TD 3FUJA 4QHLA 3T2LA 4NNYA 4XO4A 2W59A 3GXUB 4QRTB 3WTXA 1NAML 3RGVD 2D7OA 1AHKA 4H8HA 2ADFH 5JZ7D 3IVKA 1A7OL 2C3GA 4NZ8A 4JN1H 1G1CA 4BFBD 3OB0H 3DGGA 4FQQA 2J8UE 3CZUB 3HC0A 5DVOA 5KYUA 2NY1B 2QMKA 5DUMH 2NUTB 2WBJA 1JI1A 3BWUC 5F0LB 5DD0L 4KTYA 4F92B 3VG0H 5IOPB 2VSCA 3NIDE 2XV0A 1AG6A 1AD9A 1HKLL 1F02I 2C9XA 4LGSB 3PXJA 3TWCH 4NRXB 2KLRA 1GAFL 1M05B 5DRWB 2I85A 4NQDB 2B59A 1JGLL 1RZ8A 1JK9A 1UOKA 3PWPD 1PSKL 3QE5A 5DQ9B 4E41B 2YZ1A 1UWXH 2VQ1A 2XZQL 3QJRB 4W9EC 2M26A 3VVVA 5EZPA 3VXMD 2Q86A 5I16A 2DY2A 4U3HA 2F1AA 4UQ9A 4PYGA 2WGXA 2F18A 2H0FA 2NW2A 1VADB 4KH2A 4ZPTB 5EUOE 2AABH 3O41B 3GJFH 4X6DB 3IWUA 5CBEA 2VC2L 5C70A 5D2LB 5GGVH 3EZ8A 4KFMA 5ID1A 7FABH 2WN3A 5JDSB 1I8MA 4ANWA 4ZXBD 1DSYA 1NOLA 2YQ2A 3C5XA 4OZHE 2ZOLA 3FO1A 3QPXL 4ZO9A 4DGWC 5GRVK 1EDQA 4NQSA 4KRPB 1WA1X 1KACB 4QOKB 3GI8L 1MSPA 2NY6B 4OJAA 4NDMB 5ECJE 4Y4FA 3APMA 3HNVL 3WN6A 3CFUA 2DI7A 4ABQA 2VUYA 1CFVH 1PD1A 3BWSA 1MZYA 2JCCE 4PFEA 2ESVB 4YDKH 5IB3A 4WHTA 3QIBD 5H35A 3BGMA 3BVWA 3L13A 2R2EB 5LG1A 2KLTA 3TO4C 1J5IA 1O7DE 4JFED 4Y4KC 4E36A 1E4JA 5IESL 1BF5A 5TPWL 2OR9H 2CDGB 2RA1A 1KCUH 3CDGA 4WTZA 3QA3A 1F1GA 2QT6A 5I9QB 1U95A 1ZHLA 3CVHH 5CAYB 1JGDA 1K8DA 1NAMB 3CDZB 3FRPA 4MA1B 4DP6X 4KOCA 4LU5H 3D85B 1WUZA 4OLYL 4PRID 3R4RA 4QPEA 3SY0A 5FO9B 1YEDB 4FC3E 4PJIB 1N6UA 2FE0A 4JZOB 5CZXC 2F8XC 3PPEA 1RL1A 2H1XA 2J3SA 2VM9A 2XACC 4KTDL 4A68A 4LLDB 5JIMA 5ESAB 3GS7A 4PRNB 1DUZA 3B7RL 3VACA 5DR5L 3B9DA 4NX0A 1NCOA 3L3IB 4X5XB 5ICZB 1DZ0A 4ES8A 2GSMB 5ALCH 4LLQB 3S96B 5EU3A 4Z7VA 5BXFB 1CFNB 4JQIH 4MMZA 1S7WB 4N85A 4WWNA 4QHUA 3BUIA 3US1A 4NRZB 5IKCB 4PJDB 2WWNA 4Y16B 4HMEA 4H26A 1IBZA 4PJEB 1C9SA 3ZR5A 3N43B 3KG5A 4Z7QB 1QACA 4G43B 1SJEB 1VEMA 4JG9A 5FWQA 2WLJA 3SN6N 5FF6A 1YNLL 3IKCA 1H3WM 3L9RA 3HG5A 1T21B 1ZPLA 4TTDD 2VC2B 2PW1B 2CGRH 3AXIA 4X5WB 4IK7A 4WV1A 4PJ6A 4IDJH 5AZ2L 2ICCA 2FO1A 2IQ9H 3GSQA 1HI6A 2FO8A 5HYSA 3KLQA 4EIUA 5B7FA 1BZ9B 2GPZA 1MVYA 3LKRA 4HG4J 1PEZA 2PW2A 2VXQH 3ILQD 3TBCA 5E8PB 5LQBL 1E5AA 2B1HH 4JM2C 4P9ML 5KZCB 4JJOA 5HYIA 3MVSA 3MXVL 1KGWA 3ARDB 1G9MC 4TQEL 4Q6IB 1F1AA 1QKZH 2EO7A 2YA1A 2H45A 4D3CH 3HAEG 2AXFA 3PWLA 2PPDA 4I0PD 2YLHA 4GBXC 4DW2L 4POZC 3FT3B 5IHLB 1RZIB 2PPCA 3UTSA 4F93B 1OB1B 4RMRA 1AE6L 5FO7A 5HGBA 2F74A 1QFOA 4NPKA 2ICWA 2HFGH 2XA8L 3A6OA 5JPMC 1IKNA 2WINA 2UY7A 4UUJB 4P46D 3O6FB 2GBUA 3QWQB 4AMKH 2A38A 3BH8A 3G6JB 1SYSA 4AIEA 3MV8A 2IDQA 2IDTA 3S37L 4XN8A 5DS2A 4EKJA 1ESOA 1AGBA 1FYTA 4PW3A 3ZZLA 3FUHA 1CZ8L 1HDMA 3PWVB 2ADJA 5KBLA 1R24A 1UZ8A 1T04B 5HPMA 4FDWA 2FIKB 1LO5B 4ECNA 1O6TA 1C5DA 2BNRA 4HZLB 1PZSA 5BMFL 3UAFA 4ETQB 3H4FA 2OKMA 4OZIF 1JGEB 3LPGA 4DETA 4N3TA 2YPLA 3HOGA 4HSQA 5KVMC 1XZ0A 4NO3A 5I74B 2DV6A 2IANB 2CJUL 3BC9A 3WXVL 2VAJA 1D5XA 3BD3A 4GQPH 1NCTA 2GSGB 4OZFB 1NAMH 3QWOB 4QY8A 5DEGB 2P8LB 3G5VA 4LLWB 4GRWE 1FWXA 1YLBB 1QLEL 3K3QA 1SJVA 3RDTA 5T5NF 2P3YA 5C0CE 5E2VL 1WEJH 3F00A 1Z9SA 1MJ8L 2OX5B 4QRAA 2OMYB 1KLFB 2D2OA 3KH4A 4KO6A 3WEXB 1TOXA 3OKNB 1HKLH 2ITDA 3F8UB 4B9ZA 4U1SA 5T5FH 1JGLH 3OAZH 3UTSE 3CV5A 1EHXA 2YD7A 4UT9L 3E6HA 4G6AC 3OWEA 3POHA 2EYSB 1XEDA 1E4KC 1S9WA 3GSXA 3ZKXC 5EPMB 4FG2A 3ZDZE 1TLKA 1ZT4A 1WJ3A 1XGUA 4YE4L 2VC2H 4ZS7L 2BS8A 2H6PB 4JFDD 5FYLE 3LDBB 2FX9L 4JDVB 3ULUD 1PFOA 5D7SL 1L9PA 1P1ZB 4GXVL 4W9FC 3B9KC 3TA3A 1HXYB 1U8LB 4YHML 2BNRE 2VR7A 4FQ2L 1A2YB 2AJYH 4G1EA 3ULSB 1MY5A 5BVJA 3LEYH 1KIUB 2QQKL 2YPLE 5J06A 2X4UB 3FQTA 5EDSA 2BLFA 2IH3A 1GW6A 1TJMA 2Y7MA 5DHEA 3VE0B 1EJ6A 1QSEE 3K4AA 1CYWA 3HR5B 3D39A 1U8CB 5D72H 3KZ8A 4F15C 4JPWH 3MRQA 1U8NA 3L4TA 4UINL 4RRPA 3RPIB 3VRLF 3DWTA 2Y5TB 2D2CC 1DVSA 3W0WA 4F7CA 3CFQA 4GB9A 2EDFA 1EV2E 2IPKA 5DHVA 5AAMA 1T6VN 1UOVA 1UKQA 2EE9A 1SVZA 3EYUH 3V9FA 3WDJA 4X99A 2PWHA 4CVWA 4LP5A 3ULVL 2HH0H 2J1YA 1BP3B 3T71A 1IAIH 1QLEB 3GM8A 4FA8A 4IQHA 3FHAA 4UM9B 1KN2H 1IQDB 1QHOA 1SEBB 3LOWA 1FQ9C 1G9NH 5BQDA 3NBNA 4OAWB 2KPWA 1N0LA 3C5ZD 4LEOB 4JZJC 1EO8L 3GBMH 1I3RB 1OSYA 2YAQA 2CO6B 4WUUB 3QDMB 5AKSA 4PMEA 5G2NA 1P7KA 1UWEL 3HE7A 5DJAA 3L17A 3P30L 1ASOA 4K3DH 5B4MC 1JGUH 4OZFH 2E56A 2VR4A 2VIRB 1NMCB 3NN8B 1ZTXH 4N1CA 4F3FA 5I82A 3K0YA 4P0DA 3QIUC 4Z7OE 4GKNA 2H4EA 4GSQA 4MAYD 4HIIB 3BZFB 5ICUA 2VR3A 4M03A 2HXAA 3MCKA 2GIYA 2NY0B 4X4XB 1MG2C 4E5XB 4JFZL 1JWMB 4L1HA 4GQ9H 5HYJA 2DWTA 1XMWA 3DPDA 4ODBD 3UMTA 5FHAH 2FEEL 2ED7A 1NZRA 4K8RH 1KXTB 2OJZL 4YDMA 4HU8A 4P9MH 3U6RB 3C8KB 3R19A 1ANUA 2COQA 3VXTB 4J12A 1QEXA 3MXVH 2PXYC 3R8QA 4AGPA 2UWEE 2QJDA 3IDIA 3TIDB 4UAOC 4A2GA 5INDB 2F9BT 3MRPA 2CGZA 3L3KA 1Y0LB 1S9XA 4QKTA 2OLDA 4CSSA 5KTEL 4GI6A 1ET7A 1JCVA 2OL3A 1FORH 3M7OA 4XVOA 1YYLH 3QP3A 1AE6H 2LFGA 2NW3A 3BQUD 4A2HA 2RFXB 1AQDB 1EJ8A 2BVEA 4ZTOL 2AJXL 4FABH 4IKJA 3IM1A 5FYKE 2GKIA 1MCOL 3CFMA 4F37K 3FT1A 4KMTL 1F00I 4PCSA 1NFDE 4UDUB 5J6SA 1IBDA 4QHMB 3NZSA 1I1YB 4XXDB 4KDWA 1CFQB 2MCAA 2E27L 4ENED 4OIBA 4N1EA 1OD9A 2WBXA 4GSRA 5C0BA 2YMOA 3GSUA 1VACB 5BMFH 1AGEA 1HOEA 4P2QA 4NQED 1JN6B 5IBTL 3S5LB 1F8TH 4CAGA 2R23A 3ECBA 4ODHL 1T0MB 4NZRH 1HL8A 1KPUA 5CCGE 3GUFA 3EFDL 4KY2A 1U36A 4IRJC 5HYJE 2HT4D 3FQ1A 3BLPX 1QLEH 1SJHA 1XB3A 3BKML 2V2WB 4NQCA 1DUYA 5ICYA 1OTUD 4GIOA 5T1MA 1AXSA 4XMVA 1U3HC 2APFA 2EDMA 2VMCA 4OLXH 3HB3D 3C6LB 3DIVA 4GAYB 4QRRE 4U3XA 4P4KC 1UCBL 3ME0A 4XCFL 4N2IA 3BAIA 3VFTB 2ZWSA 2VZOA 1GC1C 4FG4A 4JE4B 4OIFA 5I5JA 4WW2A 1ZGLM 1E6JH 2NY4B 5MEOB 3QC5X 1AO7E 3QRFM 3AT8A 1EUUA 4OIIH 2ENQA 4LLUA 3CSYA 4Z8FL 3UTQB 3T0EB 3O4LA 2VZSA 4FQXA 2F68X 3NFPB 4OCXH 4IGBA 3HNTL 2FT6A 1IZKA 4TULL 1XXDC 3AQYA 2GIXA 2H41A 3D0LA 4LPYA 1QHPA 2FJHB 3EJQA 4LOUD 2J21A 4D0DA 4ELKA 3NZUA 1CGVA 3W9EA 1UH2A 4U4BA 2R7EA 1MAML 4Y9FA 4AQ1B 2Y6TE 3PQYA 4L37B 1WIOA 1FI8C 1KLUA 2FHCA 4WZ9A 5DK0B 5D7SH 4LLVB 2IXQB 2XLLA 4GXVH 5TE4L 4AX3A 1PNDA 1JK8B 3FXIC 4YHMH 1JRHL 4PJAA 1KY7A 2D7PA 4P2QE 4NHUA 1N3NB 3DI2B 1BZDA 2QQKH 1L6ZA 1T1WA 2AEPH 4N8PA 5D1ZA 4Z3GA 4ZMPA 4FQ1H 5DVMA 4QAMB 1UH3A 2LU7A 2ED8A 4R96B 5JW4Q 5IBUB 2ZX6A 2BDNH 1J9SA 3H42L 5I17A 2AK1H 12E8H 1A1MA 1YC7A 4NQCE 2AHIA 2FR4B 5FUZH 1DQTA 1T5WA 1A64A 2XG5A 3QS2A 3QIWD 4XPGL 1TTBA 5E4EC 3IXTA 2FCBA 4H4NA 2BHFA 3EDFA 4OQ1A 3SGJA 4GMSH 4F7PB 4JPIA 1Q9KA 3CFJB 3BEVA 4WIQA 4WCYH 4Y2DD 5KSAB 2WYZA 3K0WA 2HX9A 3BZ4B 3WIIL 3IGLA 2Q3AA 1EZSA 2DRUA 5AVWB 4YHYC 2FTAA 2OMZA 5HYQA 4HH8A 3VXPA 4KHTL 4Z7AA 3PL6A 2EYTA 4YIQA 4Y7MA 1TQCC 3O4LE 4WWKD 4PG2C 4R7NB 5KVFL 5FEBA 4GS7B 4BD4A 5CGYC 1L9SA 2OR7A 4GINA 4O5LH 4JFOB 2R8SL 1FDLH 1ONQB 2RGSA 4CKVX 3BSZL 5DC4B 2X1OA 1BVLB 1N26A 2OTUA 3U0PA 3MLPA 4JRXD 5C0CD 4JY5H 3LXAA 3PQYE 3RX7A 3VGHA 1ZTMA 5E6RB 3LNEA 2VDPL 3ZDWA 4G6JH 2CDFA 1HIML 3U1PA 4N8UA 1H8OA 4PJAE 2CG9X 5ELIA 1EFXB 2FL5A 2UVEA 5D96C 4JFZH 2G3XA 3TN0D 4AWJC 1GIGH 5JNYA 1NSNH 4DEUA 1CLCA 1U8MB 4NN5B 3VGFA 3Q5TA 5KYXB 5KS9E 1XTMA 2YUXA 3ZQXA 3Q0HA 2H2SD 4WI9A 2IJ0C 3NJMA 1XIWA 4UYPA 2OJZH 3GINA 1KJVA 4EVNB 2W65B 4JGNA 1PCXA 5JHDD 1YUHA 3A67H 4OB5L 5CLYA 2ZWLT 4HGWB 5I0DA 2X6AA 4JY4B 2DKMA 5H8DA 2XV2A 1PU0A 1AJ7L 4TLSA 4IBLT 1LDSA 1NL0H 3QUYD 3TJHC 3EJJX 3U4BL 1CDYA 4FQJH 4GUPB 2IH9A 5FM5M 2Q8BH 3MLZH 4HWUA 1ZMYA 4CADB 1YY8B 3V0EA 3IFNH 2D3JA 2W5PA 3ZGHA 5B1BB 4GAGL 5HJ3A 1F3DJ 2ZYRA 2CUIA 2PETA 4XNBA 4DKAA 5H94A 3IWVA 4HC1A 3RWJB 5D7LE 4LPTA 2RR3A 5CN3A 4YBLB 4UMGA 5CEZD 2B5IB 4Y2NA 5E56A 3RVVD 3QNZB 1Q1JL 2E27H 5KVDL 4WU5A 4WO4D 2WZAA 2DD8L 1RIVH 2H0JA 2C7UA 1SOXA 3V0IA 4AUUA 3G6AA 2NY6C 1DSFL 2ILLA 3EFFB 2Q2EB 1BIIA 2UX7A 3UJTL 3DX9B 5KYYB 3RIAF 2AW2A 5F0MB 5JW5A 3BAEH 1G6RL 1G43A 2VERN 2WGNB 4ODHH 4U2YA 4DOHB 2F53D 3KD4A 5E6ZA 3FOMB 4YSAA 1NGXB 1CL7L 3TEYA 4I9WD 3A4DA 1YMME 3HZMB 3X17A 2QZ5A 2FX8L 4ZUWB 3WJMB 4NPYA 3SD5A 2A1WH 3RIAK 1X7SA 1PGRB 4GKZA 4FXGA 3LRHA 5I9QC 4H8VA 1L7TH 5E8OB 3S97C 4MA1C 2P48B 4FCHA 4TSBH 5D9SB 2QV2A 4DP5X 5FCUL 1KIQB 1J18A 4NKMB 5C6TH 5CUSL 3WIHL 3QZPA 3MNDA 3D2UD 3QQ4A 1L5GB 4XCFH 1QSFD 5B3NA 2K3HA 3Q8EA 4FMKA 2YKLH 4OZIB 4S11A 4O02L 3T8VA 1JDAA 2ALAA 1NGWA 1PX3A 1H3PH 1X5FA 2HTLD 2LLNA 4QRPD 5F7BA 3QJFB 5B7MA 5LGJB 4Z8FH 5AFAA 3BKJH 1K2DA 3DUHA 2EDBA 4RLDA 4HK3N 4DZBB 2PP8A 4AG4L 5IVXB 4YVNA 1TQTA 3PIQB 4IRSD 4TULH 3FQ2A 3EHBB 4M3HA 4E9WA 3AXHA 3MQIA 1LO2H 1TQVA 5I5MA 4Y16C 1SOQA 3K6FA 4ABUA 2WC7A 3IETB 1V3KA 2YMXH 5L2JA 1G9EA 4RGOH 5CJXC 5TQ2L 5GHWL 5TE4H 2WCGA 4OCSL 4G8IA 5EZLA 5JW4R 1JRHH 4DKEH 3FMGH 3NK3A 5MEQA 2R0KH 3KCPA 4LCVA 4P07A 2SEBB 5I71B 1NMBL 4OI8A 4EEEA 2Z31C 1JNNL 2J1XA 2XN2A 4MQTB 3QWRA 3CQPA 3MUGA 3KBFA 4L3EB 4LFHG 4JDZB 3VGBA 3TO4A 5JO5A 1BA9A 1RY7B 2WTPA 3ESUF 4QGTA 4Y4KA 3ARDC 4PW4A 5DURD 3CVDA 4Q6IC 2PWFA 2R9HD 4Z1PA 5KEZA 3DPBB 1JF6A 1NEPA 4EUPA 3QCTL 5FYKD 1JUFB 2BIPA 2VSKB 4LNRA 3ARFB 4WI5A 1EBAA 3EKCA 2GTWA 3HS8A 3PWUA 1NUDA 3M86A 3VXUD 3STLA 1DBBH 1JV2A 3OAUH 1D7CA 4ANVA 4P2RD 1PPIA 2WLKA 5ABAA 4DCQB 5AALA 1ZIAA 3ZN6A 4LDEB 3DBSA 3U6XS 2XUWA 3HTLX 5DUBA 4KHTH 5C0AA 1AD0A 2XZAL 4PJCB 5JUEH 3BI9X 3NQIA 4M8QA 4PWHA 4HSAC 3LZPA 2CK0L 1UA6L 3IDJB 2VZ1A 4BZ1H 3ARBC 3ARWA 4BIKA 1BF2A 5I6NA 4MCMA 2OMUA 1C08A 2QPUA 1KCWA 4I5BB 4U6TA 3BSZH 4O02B 2XI9A 3NRFA 4J3OD 2F5AH 1U3NA 3FCBA 1NJ9B 4FFTA 1UJTA 5TE7L 1QRNE 1MCKA 2AQ3A 5A16A 1EGJL 3QUML 4J39A 5A2KH 3J27A 2P8MB 3TH3T 5I1AB 3BUBA 1A4JB 4WK0B 2N01B 2WQSA 3V0AC 4OZFG 4JDTL 2Y1AA 4WSJA 4NKIL 5F6HJ 1A0QH 5AZUA 1AS7A 5EIQA 1R9FA 4BH7A 1UD4A 3EO0A 1C5BH 4HUVA 1J87A 4JM2A 1LO3L 1NWOA 1H3UA 3AWFA 5I0VA 4O58L 3P0YH 4TL5A 1SBSH 1QEWA 4N2MA 1FIEA 3TBBA 1DFXA 2W9DH 5EN2B 3SCMD 1HH9A 5HI5D 4GBXA 3QK0A 5AAWC 3BUYA 4L4TA 2EC8A 1DE4A 3W39B 5C8JA 4JUTA 2A73B 2MMXA 5GJTL 2BFGA 1UZ6F 1CIDA 5EZJB 1VFOA 3IGUA 4P57A 4XWGL 5JPMA 3WFHA 3NIFF 4XP9L 3S35X 2P5EA 1SY6A 4GAGH 4LCWA 3TPKA 2GJ6D 4WNJA 1UT1A 1NCDL 1UACH 4KJQD 3FRUB 2PR4H 5CZKA 1RZFH 5C0AE 3Q8CA 4FFVD 4QYOB 1GGIH 2R83A 1RMFH 1MLBB 2VDNL 3KPNB 4FXKB 3WKQA 3RYMA 1N19A 1S5HA 2YJQA 4PRHA 4YZFE 1K5NB 2J43A 4FYSA 2IWKA 2NR6C 2EP6A 2F7IA 3HFFA 4G6ML 3SGEI 2BSSA 4F57H 3H7BB 4DP0X 2K70A 3PWPA 4JKWA 3BPCB 3UG3A 3GHBH 4DGIL 2HKAA 3AY2A 5LBSL 1FRGH 1OE3A 1QBML 1X9QA 5AVYB 1AFVH 1YDPA 3GSNA 5AEAA 1DR9A 5E2UL 1RP9A 3UABA 1KT2A 1SBBA 3K2IA 4FL4B 1OSZA 4GSDL 1AQKL 43C9A 3QG7H 1MCJA 1KCSL 1MRCL 4NT6B 4G42A 5F7EL 3MRMB 4HJJH 1WAEA 3FH8A 4FX5A 3FO2A 1R5VA 4ZRGA 4H0IA 4ZXBA 4M1DL 1LL1A 2EUXA 3QUMB 5A6LA 3ZIYA 3PAZA 3QDGE 3CLWA 4YSPA 1H6FA 3GO1L 1TG8A 4X7DC 4B96A 2Z8RA 5DVLA 1SXAA 3T8XA 5CEYB 5CUSH 5CIPA 1Z3GL 2DQDL 2GC7C 3M46A 3U2SA 3VFMA 3S5ZA 4A63A 4FHJA 5J1TC 5JLZB 2YAPA 5D1QD 3GSRB 4AENA 2VM3A 3IJ8A 5E6IB 3GB7A 1CVSC 5CJQL 4RRPM 3L4UA 2JTYA 2AJZA 4O02H 3A23A 1OGAD 2FB4L 4DN4L 4O2FB 3DJTA 4JFEA 1E4KA 3SGDI 1FLTX 3ABKB 4LCWE 2J6EL 1TYEB 3BFOA 2VN5A 4JRYB 4Z7UB 3FCGA 2BSBA 5E9DD 5HDBE 1S7TA 2PPAA 3B3BA 3MODL 5CCJA 2YD1A 3LN5A 1MFDL 4L0ZA 4KUZH 4LSRL 4HOZA 3HVDA 35C8L 4MA3A 3S36H 4PRHE 3NSFA 3B9KA 3EDDA 4XTRD 2I60H 2CM6A 4XVUD 3VWKB 2NYKA 4EQ2A 2EKSB 2ZWNA 4F33A 3CK0H 1JYWA 1MCHA 4JHZA 3IF1B 4NXSA 4ZFFA 2Q76A 1E0OB 4YFEA 3JWDL 2WM0A 4E5XG 2IAMB 1S7XB 4HX1A 4JG1H 15C8H 1NMBH 2BP8A 1WTLA 2XYBA 4QXTA 4ZSOA 4GG6E 1L0YA 2L7JA 1JDDA 4NC1E 1JNNH 1B2WL 3I2CL 4YSSA 4A7VA 2BVPA 5GRXG 1RU9L 4TVPD 1U8JB 1T22B 3HN8A 1GSKA 5D7IF 4DPBX 3WTYA 2BSTB 4MJIB 2BS71 4HWBH 4PLKC 1UM4H 3B9AA 1OF0A 8PAZA 1FBIH 1PJWA 4OUUB 1KJ2B 4NZFA 1WCBA 5KBPA 2B0SL 5EOCJ 5D7LD 2A6IB 4UQEA 1X9RA 2W0LA 3QXUA 1J0KA 3O45B 5ISZB 1IGJA 4JLRA 4TUOA 4CC1A 2IGLA 4HS8L 4Y9EA 4LEXL 4YHOL 2XJKA 2ZOTA 3WSQL 5FYJD 4E9SA 4BH8A 2WLLA 2FWUA 4WGWB 1JOIA 2DQTL 2Z9TA 3RWCB 1V27A 2HKFL 4JZJA 1UQSB 3QG6B 1ZT1B 2LAGB 1CI5A 3P0VL 4LDLB 2XZAH 3HZ3A 2IOMA 3ULVC 4FG6D 4QO1B 4RDQG 4KKAC 2WPGA 3DV6B 2CK0H 4MD5B 1XF1A 5JXEC 3D4ZA 1HXKA 4QHNB 4G1MB 3V0VB 5CKGA 3AABA 1J88A 4TNVF 1E3XA 3MLTA 4WI0A 2CLRB 3SKJL 3OWRA 2L7UA 3VGEA 2AEQH 1B0WA 3TT1H 4X0KA 2DM7A 1KIPA 5DMGD 3S5LG 2NLJA 2BIHA 2IG2H 3QUMH 3THML 4UB0H 2EZ0C 5I1DB 1WZKA 3VM7A 2V6HA 2KH2B 4XR8C 1WFTA 2H7WA 2GTZB 1X7QB 2BC4A 3C5JA 1M1SA 5LXGL 4YX2L 4G9DB 1R17A 2EE6A 2DL9A 2GJZA 2F0CA 4NKIH 3NDZE 3PHOB 4OSUH 5IQOA 3MLWL 4BCXA 3VQ2C 5DRXA 4YQXH 1CGTA 3E8VA 4H8WH 3D05A 1UASA 1BX2B 1BBDL 1HQ4B 2AF2A 5FCSH 3QYNA 2D7MA 3D48R 4N0CD 1LK3H 1GYCA 1IGFL 2PXYA 4J8RA 5AW4B 5MHSD 3VW3L 4XN5A 4B9YA 1Y6MR 4ZQKB 1SM3H 5H37H 2EH7H 4MD4B 4JQXA 2K45A 1YMHB 3AT0A 3T4AB 4PLNC 1FZOA 2E9IA 5G5DA 3BYTA 4EDWL 2J12B 2CDEB 5IP4A 3GNMH 2N3JA 1WQVT 2AQNA 2V2XB 2NY4C 2WVSA 3H3PH 1R34A 1T7YA 3LXCA 3V4VL 5AVQB 3MRLB 2UXTA 1F41A 3T0EC 1HSAA 4A6YL 4FULA 4A7GF 1XHHA 3V6FB 3QHFL 5E99H 3DOSA 1EERB 2H6OA 4HJIA 2IADA 4FD0A 1FSKB 4GIAA 3CPUA 4LAQL 4PS7A 4AQ8C 1RURH 4YHIB 4XZUB 4N5EC 3FCSB 3ZHDA 3R0MA 1XCTB 5FA4B 4ZFGL 4GRLD 3GMMB 1D5IL 1K3ZA 2X4SB 3EJZD 3M1OA 2XG4B 3E6FA 4UBDD 1IBHA 4XN2A 1LP9A 4HCRH 4H1LB 2JK5A 4BCZA 3QFDA 3D4YA 3QT2A 4QI3A 1WBXB 4HDIA 3O8XD 5CBAA 1XGTA 4GXUM 5CO1A 1KJ2H 1OLZA 1Y1UA 2IFFH 3ZPDA 3OKLB 3U4AA 4TNWK 4IRJA 1MUJB 3MKKA 4GSDH 4NENB 1OSEA 4BYHA 4D7PA 3ABLB 5IBUG 3M17A 2QSCL 4Y5YC 1G7IA 4EOWH 4DGYL 2MPAL 2VABB 4JRLA 4JFWA 4K5PA 1CGSL 2WHVA 2WXJA 3PNWA 1GGYA 4X6FA 4XP5L 3H9SB 3RFRA 1GYWA 2P7TB 1TMQA 1CFMA 4V1DB 4FTVB 4XH2B 5KSAC 1AMXA 1Z3GH 1NCBH 2IAAC 3VG9C 5A1AA 1KNOB 4MD0B 3KPRB 4XC3H 3SD2A 1UB5A 3BN3B 1DLHA 3VFPA 1IEHA 1RUMH 1S8DB 1G7LA 1SZNA 4U1HB 5I73C 1GY2A 1T0PB 3ET9F 1J1PL 1QRND 1RJLA 2FB4H 2NY2B 3IJSA 4FJYA 4LLYB 3ZTJH 3TESA 4XPBH 4HG4K 5IF0B 1E8ZA 2Z4QA 3CVBA 3GXFA 3QEQB 3KXFB 5B38A 5C0FB 1EHLL 3FT9A 3N50A 3QCUH 5C0IA 1SVCP 4KNSA 2G4GA 2ZJSL 4YPGA 3NJFA 2DDQH 4A6YB 3ETBF 5IR1B 1ZHKA 3RIKA 2PP9A 3S2CA 5BS0D 3L48A 3SDXB 3UG5A 1P7QD 4CDHA 1LP9E 1KEGL 1QTSA 3BCFA 3GRGA 3EJTA 2NY7H 3MV11 4XVJH 1YHPA 5E7BA 4AYFB 4B7IA 1N5AB 4XX5A 4NN5C 3NSXA 5ETUB 4IBUA 2WXOA 1B2WH 3BIKA 4NBXB 5BOJA 2A9NL 3A6BH 4LLMB 1M7XA 1OPGL 1PZ5A 4ZUUA 4K9JA 4YSEA 1A21A 3VFOB 5DCCA 2JXMA 1JPFB 3RKPA 2JKJA 1THCA 2B0SH 1NPJA 3KCWA 2YKKA 1H6TA 3FN0L 1TCRA 4JFQA 5I8KL 4IJ3B 3VFSA 2C7FA 2E7HA 3F5WA 2E4TA 2YD6A 1UZGA 4GH7B 4LCCB 4PJ8D 5F1NA 3L3GB 2NY3B 2A83B 3LKQA 2JE8A 3QJUB 1NLBL 2VR9A 2Y69B 4KMQA 2R29L 4CVZA 4H1LH 4HF5L 4YBLC 3P0VH 3BVNB 4I0CC 3T6QC 1X5AA 3MLSL 4ELMF 1YUKB 1LNUA 1WF5A 2C9AA 3O2DL 3JYBA 3DX8A 3V5HB 3ZYZA 3VXOB 2IFGA 2V7HA 3V5DB 4BXVA 4G7RB 3C60D 2EC9T 4HH9A 2YRPA 1AGCA 4GJTB 3TU6A 2V8LA 3F7YA 3BQUA 3QDGD 3EGDA 2P5WB 4U7SA 1YEJL 2BNUA 3II1A 4M4PA 1QW9A 2QR0B 3D30A 5JA8B 5C09D 5LO7A 2IDSA 3EOAB 3AQDA 4JFXB 1A5FL 5KVGL 3IE4A 1PMYA 3BIAX 5TGBB 4LSTL 1GOHA 1U8QA 1WFUA 1ACYL 3NPSB 4G72B 1HEJC 1T3FA 1MY7A 5DZJA 3S3CB 4B9KC 2YD4A 1K4CA 2JKRM 4N2OA 3KPLB 1U91A 4XMUA 3FB6B 5GXBB 2EIDA 4PJHE 5EU4B 3IGKA 4KDVA 5D6DC 1MCRA 3KNBB 1I8UA 1NKGA 2VTFA 1IGYA 4OGZA 4TUJA 3EYVB 3MRRB 3FU7A 3HS9A 4Q6KA 5AVVB 2YA2A 2N59A 3GMRB 4LQFH 5E51A 3LEXA 5K93A 2ZYSA 5F7HA 1INEH 4ZOEA 3PV6B 2VXSL 1WS7A 4R6UA 3KGTA 5J11C 2YQ3A 2BVTA 1A14L 2C4XA 2G3ZA 1BQHB 3W9DA 4X6BB 5HJGA 3T2OA 4LKXB 3SEPA 2HT2D 5AVUB 4ZDHB 4OGXH 3RY6C 2XIDA 3TIEB 4XMXA 4EMZA 2NQDA 2QFPA 4MYPA 4ZPTA 1F45A 5EC2A 3AREA 3NZHH 1FG2A 4TLTA 2QVTA 5IK3B 4F2MA 3QQ9D 4I18B 1OCOB 5E4AA 3S34L 2QQLL 1HHJB 2FATL 2ICWI 3QH3B 3MHZA 5HTSA 1K5WA 1X7TA 5HD8C 1XCQB 1XF2A 1CICA 1NEZB 2NQCA 2HWZL 1G7MB 1A8ZA 3O11A 1FH5L 2CJ3A 4GT0A 2E59A 2LU3A 3T0BA 4Y8DC 1ZAGA 2EH8L 3AXLB 4AYBA 3NJXA 2Z35B 4IW4C 2LTQB 1I9RH 5J8OA 3CZEA 4ZUSB 3ZT7A 3Q2VA 2ESVA 1P0SE 5MP6H 3QFJB 1K8IA 4QWWC 1ZOXA 1F5WA 1SLUA 3HLKA 4NNXA 2QQQA 1SN0A 4IRZH 4R7DB 4Y1TA 5C2BL 4AEIL 1DJZA 4GIPD 3VFRB 1J86A 1U92A 1AIFB 2BM3A 4JG0H 4Z7NF 4KGLA 1NCWH 2MPVA 5L7XH 5L8LB 4GKLA 1MJUL 3EXJA 1ZA6B 2H3NB 1LK2A 4IOIB 1EEZA 2FT7A 3NCYP 1ZE3H 4KK5C 1O75A 2DJ4A 5DWPA 4XP5H 1HWHB 2YAHA 4U3CA 1OCRB 3CZGA 4TLKA 3VRIB 3GSWB 2MCPH 2PYEA 3HG1A 2XZZA 1FL3B 3DURA 2GEQA 1PBYA 4NQDE 3ZU8A 4E41E 5BRZD 1AACA 2V17H 4KX7A 3KHOA 3QUZB 2B1OA 1A1NB 3PJSA 2FD6H 3UADA 1CLVA 5CFHA 3DNKA 3L3IA 5DXWA 4PJ9C 2Y1YA 5IIEA 4ANXA 3C2AL 1KB9K 2GK2A 4PTUB 2ZXBA 5GGTH 4ADGA 1VFAB 1MIML 4NRZA 4QXUH 4AUYA 3AWEA 2FQEA 5D2LE 2YAEA 2DB8A 2FSDA 1EHLH 2OTWA 3MBWB 2BOCA 3FT0A 1EEYB 3KW8A 4JHWH 1OXYA 2ZJSH 3GHPA 3MV7D 5CJXA 4G43A 2WB7A 3Q6FA 1CXIA 4QOKE 5ENWA 3U36A 1ADQL 1JGVL 1N59B 3RZCB 4ZMZA 2NPLX 4MGXA 3G04A 4PGEB 4J3SA 1H15A 4XMPH 2NZ1A 3IYLW 5HHQB 1EO7A 2Z31A 3U0WL 1J8HA 1WC7A 4WWKA 4WF7A 3UP6A 2ESVE 2OFQA 4OR1A 4RISL 4O51A 4Q6YA 4ODWA 3O3DA 4OQTL 3GXTA 3RA7L 2D73A 4FFZL 1JXFA 4MA7L 2ZPKL 1OPGH 2HMID 1V5JA 5TDPA 4WW1A 2WQRA 4HFWB 1WFMA 4PG9B 4Z0XB 1UA3A 4JRXA 5JPNB 1ZS8A 3FZUD 1YEFH 4KHXL 4M43H 3NG5A 1OB1A 1HESA 4G8FB 3ECVA 4PJIE 3EJPA 3MRKA 2CXGA 2H9GA 3LVTA 1IM9B 2B2XL 5IT2L 1MQ8A 4FHKA 1RZGB 2PYEE 3TO2A 5F6HI 2I9LA 32C2B 1C16A 4QTIH 1KENH 4FNLL 5L9DH 2OTPA 1LM8V 4YDVA 1NH6A 5FOBA 3R0NA 4J3XA 5I2IB 4YOKA 1NLBH 1G7PA 1RVFL 1LEGA 3PDOB 3EUDA 1GZHA 2UZXB 1BQ5A 4FXKC 3MV9B 4HF5H 3CGTA 3ZE2E 5C07D 2FIKA 5AKTA 3ARBA 1F56A 2PO6D 1L9TA 2EXYD 3AY4C 3POCA 4HWZB 4NKOB 3CHXA 3QRGL 4PJDE 5D7IB 4I8DA 3VDCA 1Z5LB 4LMQE 4N0FA 4IU3B 4PJEE 2BCKA 2P45B 1QAWA 1U8OB 1GH7A 2CIKA 5DC9B 4Z7QE 1ZLDA 4EF3A 1K3IA 5HYFA 1CFBA 3STZA 1E9PB 2WJ5A 4X80L 3EF4A 4Y19B 4HULB 5KN5A 2WXFA 5EV7A 3RY4A 4FL4C 4U1LB 5KVGH 1A5FH 4FI6A 1FLRL 5A40E 1J8HE 5FHBH 3MJ7B 4ODTH 2NDGA 1A6AA 2J8OA 4Z7WA 4C83A 4FYTA 5INCB 1NQBA 5BW7C 2VITB 5IV2B 4KROD 4Y89A 4HV8A 4I13B 2D03H 2CA4A 2OP4L 2W1NA 4UQBA 1B2YA 2VLRB