4Y2LA

Structure of cfa/i pili major subunit cfab trimer
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
147
structure length
147
Chain Sequence
HEKNITVTASVDPVIDLLQADGNALPSAVKLAYSPASKTFESYRVMTQVHTNDATKKVIVKLADTPQLTDVLNSTVQMPISVSWGGQVLSTTAKEFEAAALGYSASGVNGVSSSQELVISAAPKTAGTAPTAGNYSGVVSLVMTLGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Off-pathway assembly of fimbria subunits is prevented by chaperone CfaA of CFA/I fimbriae from enterotoxigenic E. coli.
pubmed doi rcsb
source organism Escherichia coli o78:h11 (strain h10407 / etec)
molecule tags Structural protein
molecule keywords CFA/I fimbrial subunit B
total genus 17
structure length 147
sequence length 147
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-02-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2040 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4y2lA00
3F83A 4Y2LA 3F84A 2HB0A 4Y2OB 4Y2NA 4HJIA 3VACA 3F85A
chains in the Genus database with same CATH superfamily
5E5LA 3FN0L 2AANA 3DOSB 4XVTL 5E2JA 1FLTX 1I3GH 4P2RE 3B83A 1EHLL 3BUIA 5GZOD 1CR9H 1JYNA 4HV8A 4ERSL 2DWYA 5FHBL 3FTYA 1EV2E 3BW9B 4XWOD 2F53D 3O3AB 2ITCB 3QQ3B 4OIAA 2MEJB 1WA2X 2Y6SC 3D39A 1GPOL 1K6QH 3N41F 3NGBC 1JFQH 4ONGH 1IM3B 2BP3A 4AQ1B 1LE9B 3NSYA 4BWTA 2XFGB 5D2LE 3C5SB 3I6KB 4MA3B 1LP9B 4NM4L 4GUQA 3QUGA 3US0A 3EJCA 3FRUA 2BJML 4OQTL 2WXKA 4GRLB 5FFOA 3ROOB 3NUKA 1E5ZA 3HI5L 1YAIA 4J3WA 1NMBL 3DA0A 1G7IA 1AIZA 1NLBH 4NXSA 3S35X 3HFFA 5BO1L 4FXGC 3L9BA 1WBXA 5AYQA 3CN2A 4ZMAT 4PJDA 2CNZA 2EACA 1H8NA 2A6DA 4H0HB 3QZBA 4OJFH 5D7IB 3PGCB 3T3PF 4HU2A 3WNMA 3GSVB 3DTDA 3DX3A 3PPSA 3L5IA 1TYEB 4UZUA 4NRYB 4ABQA 4D7BA 3Q05A 3X14A 1AGCB 3V0GA 2N3JA 3WUWG 2OZ4H 4FA6A 3EFFB 3WKNA 5F3BB 4XT1C 3SDDD 2W80C 3T0ED 4Q0XL 4Y5YA 3PAVA 2FQDA 3FN0H 4XVTH 1CXFA 3EJZD 1QSEE 1VZHA 1RSYA 1E65A 5T1LB 1EFXB 3EH4B 5AZ2L 5TFSH 2Q6WA 1XB8A 3T0VA 5C0BE 3NFPA 3KPOB 2O5YL 1K3ZA 5PCYA 1PG7W 1GYCA 2IAAC 3B7RL 1JP5A 3OG6B 4G2AA 4B9CA 4FQXA 4MAUH 4Q58C 2DQHH 1A7OH 4FLRA 2AEIT 4X9YA 1T03L 3QXUA 5D8JH 3FULA 5D9SB 5C2BL 2EO1A 2X7LA 1CN4A 1DVXA 1L3WA 2WBJB 2VDNB 3BPLB 3FU0A 1T5XB 3MUY1 1LEKA 4HA1A 4BZ1H 4OLUH 4WU5B 2Y2WA 4L3FA 2BVTA 2CK0L 4QY8B 3VFRA 5BS0A 5I6MA 1NDTA 1TTFA 4JFOB 1WWAX 5EHFA 3BKCH 1JERA 5F0MB 2H45A 4DKEL 5DYFA 2KQMA 3I50H 1UZ8B 3LZNA 5LNDA 5KJRH 2E6QA 3C08L 4P4KB 5H37H 1P4UA 3PUCA 4UQDA 1C1EH 1I1FA 9CGTA 5E9DA 3DRTA 3MV7E 5CN1A 5E6RB 3VXNA 4XH2A 3QDGE 2YA2A 4F7PA 5IROD 5AYUH 1YC7A 2WZ5A 2J57A 3WLBB 3NABL 1FCCA 1G6RA 2AABH 4FNSA 5CGTA 5ALBH 3UG3A 4AJYV 1CD8A 3SOTA 4WI0A 2ZKHL 3RL2B 4UTAL 1GH7A 4FQ1L 3VXRE 1KXQE 4OCSL 5C0BD 1W16A 2OP4L 2Y1VA 4NAQA 3GINA 5FW6A 2IALA 4EZLA 5IEKB 1RZJL 5CF3A 3FQ2A 1CTNA 3S5YA 4ONOA 1RHHA 3ETSA 4ZI8A 4PJFA 1TVBA 5SWZA 1N8ZA 3GTNA 4M29A 3LPPA 1IEBB 2Y1YA 3LKRB 4M3KB 3QDGB 2RACA 4PVMA 5E6YA 5GRZA 4PBDA 1RUAH 1AZRA 4KTEH 5JOPE 4BZ2H 2Q2EB 2J1WA 2RIKA 3E80A 4JN1L 4MX7B 4FNRA 2YPKA 1XQ4A 2Z1KA 3CVHA 3FB5B 3V5HA 5CU5A 1YN7B 8FABB 3M17A 4U1LA 4WO0A 5HI4D 1EDYA 5DGRA 2DN7A 1ZLSL 5TGBB 4PJGF 4NDMB 1OW0A 1SDAB 2WJ5A 4KKLC 4M7LH 4RGMC 3TBTA 5FYJD 5CHNA 5JQ6L 2DICA 4JQVC 4ZO9A 1L9SA 5DRWB 1AGCA 5GGRB 4XVJH 4DEPC 3IU3A 4J3SA 3ARED 4GG8A 3D3VB 4X8GA 1PF3A 4Y89A 1F90L 3T77A 4HUXB 4MAZA 1NUNB 4R0LB 2IANE 3ARGD 5F8RC 4AZ8B 2A6DB 1QPXA 2B4CH 3CE1A 1IC7H 2J1YA 5IT2H 2H3KA 3D6GA 1MHHB 4X2UA 3VSQA 1UWEH 2BSSB 1L4IA 2VH5L 2ZP8A 4I18B 4TLUA 5AKSA 2FX9L 4P5TA 1DUYB 1KTRL 1CL7I 1WH0A 3CFCL 1KPUB 2GKIA 1WZKA 4AT6B 3ZHDA 3NJFA 3WKMH 1ZHKA 4ZTPH 4NRXA 1GXEA 4ZPTA 3T04D 2IVFC 4ZDHB 1KUMA 4IGBA 5DTFA 2Q3AA 3ESNA 4J8QA 2NY5C 1OTUC 1A6ZA 2RMNA 3MROB 1MIMH 5GGRA 4KY2A 4N6RA 2AZUA 5CEZH 4WFED 2VDRL 2CR0A 1HHIB 2FJSA 1TKWA 5C3LD 2YBRA 4B0MB 3FU7B 4YJZL 1CLOL 4L37A 1ZTXE 1IUZA 1ZSDB 3QQDA 3ZR6A 5A6IA 2VXQL 3LQAC 5I0VA 3VFSB 2X2YA 2X44D 3HI6L 4YVNA 1I7RB 1VSCA 3VM7A 5EV7A 1YNKL 3C6LB 5FWRA 2EABA 3W2DL 3OB0H 1IEBA 1S9YA 1Z7JA 4FQCL 1IARB 4PGDB 5E2UL 7FABH 3P02A 2HMIC 1ZLWK 5J9PA 3PABA 3NMEA 1E2WA 1MOEA 1TPXB 3OF6A 3B7YA 3EZ8A 4S0HA 5C7XL 1LVEA 3U9WA 3KNBB 3WFDH 2ZWNA 2Q76A 1RFDH 3QFJE 1KPRB 3WLWC 4ZMQA 4ZFOA 5CCKH 3JV4A 3ZIMA 4LL1A 4I8DA 2VDQL 2V7NA 4X5LA 5MEND 2AJXH 3VFOA 1WIOA 1ZMYA 4AOFA 3WTUA 1E9PB 5T5NG 5E1AA 3RB7A 3FO1A 2MCPH 1U9KA 4JS7A 4RNRA 3EHBC 1HE7A 3R19A 4NN5C 3NJKA 2BHYA 3BI9X 4KI5D 2UZPA 1EJOH 5HYQB 1P0SE 2Y7SA 1DLHA 3FXIC 4LCWE 1U33A 1VEPA 2RA1A 1FZJA 4OB5L 4EDWL 4IBLT 1PKOA 1K9TA 4I13B 2FEDD 4LCCB 5I1AA 3N04A 5F9OL 1SY6L 2QVTA 2VUYA 1FV1A 2VQUA 4POZC 4KWUA 5BV7L 2N7BA 3AQZA 5L6YH 5FKPB 4PJ9B 2X6BA 4NZTL 3AB0C 4JPKL 4FXKA 1V54B 5EBLA 2YD0A 1LD9B 1JGEB 1RERA 3VRLF 4OCXH 4NQCA 4LRIA 4OZFG 1O6SA 4J8RA 3VVVA 3TYGL 3ZSTA 5KBDA 5TF0A 4LDCA 1XHHA 4IHBA 1L5GA 1ZTMA 4IRZL 4G3YL 4B7LA 3CPLA 3TJHD 3H6AA 4LP5A 2QKIA 2QSCH 4S10A 2FX8L 4YHYC 4LPUA 3SDCA 2JJVA 2H2SD 3BGMA 1S7XA 2L8AA 2AK4A 3HFMH 1JFQL 2ZP9A 3IGFA 4QRBA 1TEGA 3L9RA 2N56A 4TLKA 2Z65C 4E5XA 1GMEA 3O3BB 2JLPA 1Q9KA 4NP4L 2H32B 3ENEA 1SZNA 4PJAE 1GIGH 4WUUB 3OC8A 3B5HA 1U8CA 3C09C 3EJSA 3RWEA 1CFQB 5KSBF 4XXWC 5LN4A 3BIAX 5LG1A 1NL0L 4MJ5A 1CG9A 3TBVB 4OCRH 3DVNA 3HHSA 3HMXL 4FFYL 3RVWC 3BKYL 1MFBH 2J44A 4W9KC 3NCWA 2VXUH 3KPSD 3K81A 3EBIA 4I9XA 1OAUH 3RBGA 3RILA 4XMKL 1MPAL 5IW1A 3FUJA 4ZT1A 1J18A 4N24A 2FH6A 4OH2A 1XGTA 5HI4C 5CEZD 1GYWA 5A1AA 2NDGA 4JR9H 1F4XH 5CKAA 3UG4A 1BEXA 1FZOA 1NLDL 4L8BA 3BESR 2JFCA 4NQDD 4KOBA 3KR3H 3RURA 1E8ZA 2KMWA 5L88H 2XQYK 3EH2A 4TSCL 4Y2DD 1JI1A 4LNRB 5GS0D 1TJXA 4AQEA 4DAGH 1OK0A 1MAML 4Y1AB 2QFPA 2XG4B 3IS0X 1KBWA 3HN8A 2AF2A 3BJLA 3LB6C 3QQNA 5E56A 4Z7WE 1MCOH 1IBYA 1OD7A 5FGRA 2OX5B 3VD1A 2P5EA 2R0ZH 4ISVA 4YHNA 2AMGA 4MAUL 3GMPA 2Z31A 4TUJB 3O9WA 3C9NB 1HDMB 3BFOA 4G6KH 2R0WL 4UI2A 5EB9A 5K59E 4WLCA 5DGQA 5DJZB 1BM3L 5KYWA 4JMNA 4JY5L 1UQSB 5LCVA 2D03H 1OB0A 3II1A 3FONA 1JGIA 4K4KA 3V6ZB 1HXYA 4MJHA 3OZKA 2YD6A 25C8L 5IROC 3D0AA 4P5MB 2AJVH 1T1ZB 4HP5A 2EXTA 4OZHF 4WI2A 4Y4FC 2R29L 5G55A 5AD0B 5D4HA 2FT6A 2BCKB 5GGVL 2DJSA 1XB3A 2K6WA 4N0FB 2B2XH 1S7RB 1O7DE 2WQVA 1USQA 2BC4B 3U1SH 1Z32X 2EXYC 4X80L 2YIHA 4V1DD 3CVDA 5IBLC 1MCNA 6PAZA 1NEZA 4HUNB 4N68A 2WBJD 5KYXA 1NCIA 3HZVA 1OCWL 2V7HB 3EKCA 5AL8A 3UFIA 3WHE1 1RIHL 3LV3B 4AVKA 2J2ZB 4AM0B 4KKCD 1VERA 2YA0A 4OLXL 1J8HE 1DBBL 2NY6B 4DW2H 3N43B 3EJRA 3D69B 1TJMA 4RZKA 3TNMB 3LEXA 3ZYZA 1FC2D 4LLDB 2R2EA 1PAMA 1QR4A 3M17B 1ORQB 2J73A 3SD5A 4AYMC 4BH8A 1T1YA 4MHHI 4AVHA 1BZ9B 3EADA 1S3KL 1ZJAA 4JPVH 3HOGA 3VE0A 5IF0B 3U0WL 3ZVVA 1S7TA 1QFWI 4P5TC 5L7XL 1DQMH 2NY5H 2ADIA 3EO1B 4LLAA 4Y4KD 4MZ2A 3GJFK 5HHOD 2MFNA 1MY7A 4WSJA 1JDDA 1SYVA 1CL7H 3V0VB 1HHKA 3MRFB 4YPGB 2NUPB 1RU9L 4KHXH 1G7HB 3W0WA 5GS1B 2GCYA 5JA9A 5DYOB 4BFFA 5LXVA 2XCMC 3FOLA 4NX0A 4F7TB 2BFGA 1HESA 3ECWA 1YEHL 5AVTB 1C9SA 1YN6B 3L1GA 3DIDA 4FC3E 3U4EA 4D0CB 3EJYD 4A7TA 1A1OA 2BXZA 3P77A 4YHLH 3NRFA 3RWGA 2PW1B 2CHWA 2AAAA 4N2LA 3KPSE 5GGTH 3B7TA 2OMUB 3SKOB 5KYUB 1MREL 3TLRA 3X1EA 2APFA 3BP5A 4MXVF 3RU8L 2JCCA 1FL5B 1BYNA 4LQ1A 1F11B 1ZWIA 3G6JE 3KAAA 4XO8A 3VJ6A 1IO4C 4U3HA 1KTKE 2FRGP 4JW3A 4P2AA 5HP5A 4LRNL 1JHKH 1SN2A 1T04B 1F3DJ 2HYMA 4K3DH 4S0TD 1B2WL 3QS2A 4PY8I 2CHZA 3FJTA 3JYCA 2VDLL 5FYJH 3OSKA 4P48A 4JFQB 1KNOB 5IVXA 3OXRA 3THMH 1H8OA 3IDXH 2FJHB 5ICYB 2YLKA 1F6LL 2PPCA 1TQBC 4YSUA 2PWHA 4BFJA 1QUNA 2DW5A 2UY6B 4JHBA 1I7UA 1M05A 2JIXD 5E2WH 3VQLA 3L3KB 2YFNA 3L81A 4JZJC 1WBXB 3CC5B 3DPBA 3JWNG 4M8VA 1GS7A 4WV1C 3O4LE 3M86A 3WENA 3FC8A 1PZUB 5FS5A 3VA6A 1CVSC 2GHWB 5F1NA 5FIEA 4Z3FA 3Q13A 2IC2A 4PY7B 2P43B 3UGXA 4ODXB 1SY6H 1VCBC 5TDOA 3P2TA 2VH5H 3E6HA 1BZ7B 1FYHB 4KROC 5ANHA 4BE6A 3RL1A 2WCGA 4OGAD 1SLWA 3FU3A 2VLKA 3QWQB 2MMXA 3CIAA 2VUOA 3ABGA 1FFNB 2GBAA 3BKML 4ZOEA 4FYQA 2NUPA 2ADJB 2VLMD 4Z23A 3CN4A 3CJJA 3DMMC 3NFNB 2V5RA 4UU9A 2VDQB 4MXQC 1MJJA 4NQCD 3ZHFA 4G82A 1IM3A 1A1NA 1JVLA 3HI5H 4NQED 5IJVB 1A65A 1AD9B 3PDGA 1GZHA 4XCYA 3WFEL 1GOGA 5K59F 5J3HD 1EO8H 3MA7A 3C6LC 1FVEB 4POUB 2GI0A 2IEPA 5G4NA 4JCWA 3V5DA 3DO7A 2PYFA 2XACC 3FU6A 4WW2B 2DMKA 2EE0A 4XNMB 3OQRA 4PGCB 2HG5A 3EFDH 1O75A 5FGCE 5DO8A 2YD8A 1C8PA 3JVFC 5EN2A 1IQWH 4ZSOB 1GW6A 5C0FB 3OX8A 4TMPA 4TNVK 2XWCA 2ZAHA 4XP6L 3S9DB 2DB8A 3AGVA 1CFTA 5ISZE 3ULVH 1ZKAA 2A6JA 3KW7A 4WW2F 4F2MA 5HJGA 4QIRA 1B4RA 4RAHA 1WZAA 1HSAB 1P5VB 1X9RA 3VYNA 2YUVA 1U3HC 4FQ1H 1EAQA 1OSPL 3BW9A 3OAUL 4XPGL 4ZS7H 3X13A 3QHFL 4A39A 5IJKA 1DFBH 1LO2L 1XBRA 2YZ1A 4IOFC 5FYKU 4GUPA 4JRXE 1IBZA 3CH1A 3UMTA 1X5MA 4RWHA 1Z9OA 4W6YB 3GRGA 4OI9A 1IGFH 1U8CB 1EHAA 2KZBA 2WB7A 1A6AB 5DLML 3GLDA 4TULH 5IG7B 5JDJA 1FO0H 2N0KA 3L4XA 3T6VA 4OLEA 1M3JA 3MLXL 2XVBA 4WI6A 3Q1SL 2E9BA 1QBMH 2JJUA 3DVFA 3ILQC 2CBOA 3RWCA 3C60C 3DV4B 5HHQB 3T65A 5E6UB 4KO5A 4WWPA 3VM5A 4B97A 2ICEA 2E56A 4Z8FL 3WG7B 3QUKB 3HHRB 1I85C 1E4WL 1R47A 4IOFD 3AM8C 4U1GB 4GKZA 2EIZB 1PLCA 3ROLB 1B2YA 3S96A 3EAKA 3PWJB 3VI3F 3FTWA 2B77A 1WZ1H 1QSFD 4ES9A 3MGTB 3QZWA 3GMLB 4C83A 3HEIB 3IF1B 4R5TA 1ZV9A 3DRQA 3D50A 2GPZA 2NY6C 4G8FB 2FO1A 3QNXA 3AQDA 2DQDH 2D3JA 4NKOA 3B3IA 1KIQB 1IRAY 3CHSA 2GEEA 2WW8A 4ACPA 5IJBC 4UM8A 5JTWA 2VISA 1A6UH 4KNTA 2BNQA 2KZ1B 3ARDA 1Q9WB 2B39A 4BHUI 4MQ7B 3PAYA 1XH3A 2B0SH 5DD6B 1A14L 4JM2F 3QEUA 3DVNB 3HHSB 3CFJA 4XZ4A 1HZHH 5DC4B 5HGHA 2J8UB 4Z9KB 2IOMA 2PW2B 4KV5E 3OB0K 3MUGB 1ZT7B 4PHXA 3GK8H 1WICA 3BIBX 4FCAA 2XG5B 2C3VB 1A4KA 3P9LA 1H15B 1P84J 1WBZB 3A6OA 4ELMB 1KULA 5A40E 3F58L 2VR4A 2YAHA 3P9WB 1FI8C 4AYBA 3RAJH 2B16A 3CCHB 3F7RA 4NI3A 1PYWA 1Z2KA 1QRNB 1QEWA 4HJ1A 2Q7YB 3AY4C 2WCPA 1T6BX 2J8UF 5C0JA 1JRHL 3VGAC 5BW7A 2OTPA 1Z5LA 5TD4A 1CDUA 1RK7A 4LPTA 1CXHA 1SVZA 3O0LA 1D5ZB 1TCMA 2ZP0T 4J3OG 4JY4A 4TL5A 3PCYA 1AO7B 1PD6A 3F85A 1DVUA 1YSOA 5E9DE 4UUJB 3RZCC 3UBXB 3MV7A 4W9LC 1KXVC 5EU3A 3ULUE 4NXKA 2G4EA 5GJSH 5ID1B 4W4OC 4OU3A 4EXPX 2UZYB 3O8XB 2YAMA 3NH7L 1CXIA 1TZAA 3J07A 4ODSH 2Y1AA 1PZDA 1E40A 1T03H 5FYJU 3O6KH 4JDZB 4IW4C 3S7GA 2EVIA 4ZDHA 1N5AB 4WIQA 3WL9A 2HJFA 5GJTL 5TE4H 5TK4A 2NY0C 5KJRL 1F00I 1FNHA 2E7CA 4KOCA 5F7YC 5B21A 1BF2A 3WGVB 2HSIA 3WJLA 3P3SA 3QARA 3B56A 5EZLB 3FTXA 4CL7A 4YHML 4CADA 1BG9A 1HEZB 2YEZA 3KCPA 3HE7A 4RQQA 2GTZB 3D34A 3ZO9A 3TL5A 5ANMA 4XMLL 4JBSA 2R1XA 4YE4H 3STLA 1QSED 4IU3B 5EEWA 2B1AH 3QFJA 1WISA 2H5UA 2IGFH 4LLWA 4BJLA 3ULUC 3ZTJG 2PTUA 1T1WB 1MF2L 3RY4A 4HKBB 1QFWL 1HIML 1XZ0B 1BF5A 3FCSA 5CIPB 2HT2C 1ZV5A 4A68A 4XGZB 1TZIB 1MW0A 1NGZA 3FYEB 4IRZH 4NBYB 1U2YA 1EGJL 1KG0B 1BZ8A 1DANU 1JE6A 3QFGA 1UG9A 4BFEA 4HG4K 4FXLA 5BZXA 5KWYC 5DK2A 2DQGL 1N8ZB 4PBXA 4JPVL 4HKBA 4DP4X 1PIGA 4P3WA 5C86A 4Y5XA 2BNRA 4DGYL 1I75A 2C4FT 2JKXA 5CD3B 1QSFB 3K8MA 5HYSG 2CSPA 3C8KA 5C9KA 1WITA 2B20A 3KPMB 4N6RB 1U58A 2BDNH 4XMWA 1J12A 1J1OL 1KEML 5C92A 1XGZA 3QCVL 3UEQA 3LHAA 1L3NA 1ZANH 2EYSA 1P84K 2BVUA 4PY7A 1VCAA 3V8OA 1RP8A 3DSNA 3B8YA 2R8SH 2KS0A 3PXHA 2QSQA 3AS0A 4KK6C 4JRXA 3QDMB 2R23B 1O9ZA 4YXLL 4NT6A 3ZTEA 4ELKA 1J0IA 1G43A 2HPOA 5DF0A 4F2EA 4YBLC 4HS8L 4M5ZL 4Z7AA 5HPMA 4NQCB 1OTTD 3NCBB 2AXWA 3KYMB 4N8CL 3D18A 5CD5D 5AKRA 2VDMH 1KIQA 1QFOA 1T21A 3D9AL 2YUWA 2XRAH 4J5VA 2Z9TA 3F5WA 4QY8A 3FCTB 3VFRB 4LEOB 1MCCA 4KXZI 3VD2A 2O30A 2NXZC 3EDEA 3TJEH 2A1WL 1KXTB 1RK1A 1PLGH 3GXDA 2WMPB 4DFIA 4OV5A 1ML0A 3DJZA 5KVFH 1CD1A 1DBML 3UIZA 5E1HB 3SY0A 2OKMA 4LCWD 3ARWA 3JQOB 2IQAB 3DK0A 1KTBA 4BV1A 3TCTA 5CN2A 4FXTA 5ISZB 3O4LD 2ITDA 5J4MA 3U6XS 4UT7H 2UY7A 1MI5E 2CKBB 4B9PA 4G83A 2TRYA 3K5SA 3OBAA 4RMSA 5BOPA 4HCRL 1S5HB 4WUKH 4N9OB 5C71A 2ARWA 6FABL 4O2CA 3QEQD 3SGEH 2RFXA 2ZOWA 3K4AA 4Z7OB 1BJ8A 4YZFE 5DEFB 5C08A 2EICA 2ZCKH 4FABL 4MJIA 1VFBB 1CGYA 4X7FC 5HYJB 5E2VH 5IQ9A 1MI5D 2V2WA 3LZPA 4PG9B 3NJJA 3RUGB 3I2CL 2QHRH 3QSKB 1LWHA 4M03A 3HVDA 3BLKA 4LSQH 2QQKH 4R4BB 5IF0A 3TV3H 2OJEB 3RX5A 2LLNA 3P0VL 2YA1A 3Q01A 2PCFB 4G6JL 4KQ3H 4X5QA 2BIHA 3WY2A 3P4NA 4S1SH 3S88H 4ATWA 1F90H 4GO8A 3HUJF 2HFFA 4PJ6A 5HHVH 4JDEA 3B1UA 3VD5A 1BWMA 4JKNA 1TMCB 3VXPB 5LUMA 1A3RH 5C0FA 4JFHD 2XN0A 1MCSA 2DKUA 1JPSL 3Q8BA 2NRDA 1O6VA 2X6AA 1UADC 3QZWG 4KU1A 3D0VA 2GTZA 4MA1B 3QR0A 2G2NA 3S96B 3TJEL 3ARBC 1T7ZA 1OGAD 4PGBA 2QPEB 1U3HB 4FQXB 2DD8L 2QKIC 5B1JC 1HHJB 2DJ4A 4XI5C 1JVOA 5INDB 4R96B 1JCVA 4JRFA 5HGBA 1PZBA 1BG1A 4K5LA 1U8HB 2ICWA 4GW5A 5H37G 1WWBX 4FFVD 2JB5L 4BCYA 3GMNB 3RAJL 2ZOUA 3L3DB 3Q48A 1YYMH 4I2XB 1U93B 3LD8B 4URTB 4JFEA 2ATKB 2EZ0C 5F3BA 4TQHA 4P49A 1HL9A 1YEGL 2XC8A 1RZ8A 1WDAA 4OCMC 2AQRA 5IQNA 4Y0GA 4L4VE 4FQHA 2NTSP 1XSJA 4FI8A 5T3ZL 2FH8A 5TE6H 3VX0A 4FYSA 4F3FA 1FFPA 4FMKA 4DP7X 4EI5D 3MLYL 3VXQB 1EAJA 1FZKA 3A23A 1DLFH 5FUZH 5HGAB 2V5MA 2ZG1A 3GSUB 3NPZB 3VDCA 4ZMTA 3AWFA 3MCG1 1ACYL 4K9JA 5E2VL 3HJ0A 4PRPA 2XQBL 3LH2H 1AGBA 3FCUB 3HAEH 4GG6F 1WG3A 4BSVA 4X98A 4CVZB 3DTUB 4P57A 3B9DA 2C9AA 4YDNA 2R2HA 3U6RA 1W6LA 4L8DA 4JNXA 3NIFF 3KBEA 3V0VA 2VAAA 3S34L 1T0NB 4A66A 4KRPD 4F37F 2O6FA 1NGWA 4TUKL 3PNRB 5FK9B 5EDXA 2HVKB 1RZGA 4NKIL 4JZJB 4UF7C 9PCYA 3K7UA 4HJTA 2WLHA 4MCZA 3LKNB 1DBMH 4J27A 2D7PA 1MCPL 4DP6X 3ZW3A 2EILB 3QDJD 2V5YA 1P5UA 4JFUA 4NM8H 2WNKA 2A74B 3LEVH 2BMKB 1I8IB 3OM3B 1SBSH 4L3ED 3VTTA 3VWJC 2R1WB 1IBFA 4FLSA 5MP6H 1N4XH 3U6RB 5ECJE 3NIGB 4HIXH 2AEWA 3HTLX 4S1RH 5I18L 4G9DA 2XOTA 5A6MA 3DDGA 3CLFL 4I0PA 5DO2C 2JI1A 1LMIA 1N10A 3BXNB 3UX9B 4K7PY 5IB3A 3H2WA 2EIEA 1AOHA 1G9MH 1L9TA 1FN4A 1QVOB 4X99B 3WKML 2RGSA 4G5AA 4NC2B 1QBAA 4PRBA 4M7JH 1EDHA 1ZIBA 2JIXA 5E5RB 4ONHB 3VAEA 3VCLA 3JUYA 1VFMA 3G5ZA 1ZPLA 2WLZA 3W82A 4Y2LA 5I76B 1OAJA 2EDRA 2ICWB 1FPTH 3KHQA 3PJLA 3VWKB 5TE6L 4JM0A 1MDAA 4WRLA 5E9AA 3B9EA 4Y5VB 3VB8A 1FNGA 3QUXA 1YEGH 2CBPA 2COQA 1IBGH 1T4KA 2HUHA 1ODUA 4CADB 5B8CB 1V8HA 1YEDB 4QRRD 4ERSH 1S9KC 1T5KA 1HYRC 3UPAA 1XEDA 3BAIA 2ZJSH 3TPUA 1KWGA 5J1AA 3SKUD 3GSNA 1EPFA 4GSDH 1DL7L 4W9EC 4WKXA 1YNLL 4F58H 5FO2A 1KJ2H 4H2AA 3HZYB 1AAJA 2FAUA 2W65A 1QFHA 5DD3H 2O5ZH 1LO4L 3GBEA 4OCLC 4URKA 1BBDH 4ETYA 2ZZUT 1FA4A 1MHCB 3GXPA 2GJPA 2BWDA 4W70A 4HJJL 5D2LF 4LVNB 4GXVH 4IS6A 1VHPA 3UTSD 5FLVA 1P4LA 4GFXA 5FC9A 5IWLA 1WWCA 4MTMA 5HJ3A 3VD0A 1NAML 1TZIA 1QD0A 4JPWL 4X6EB 5A2BA 3QPQD 1V3LA 4Q74A 1BM7A 4YHKL 4FTVA 5FYLH 1BYOA 3WO3B 4RGMB 4MAYD 4DPRA 4Y1TA 35C8L 3NSFA 4WUKL 3JTBA 1WUZA 3RL1B 1H15A 4WK4B 4XX1E 1W0WB 1Z9LA 1FG9C 4Y1SA 5FUCE 3OPUA 4PHZA 3I2CH 3ZYIA 1D7CA 3WJMB 4N0RA 4U1HB 5M95B 3FB6B 5IM7B 1W9XA 5IOKA 3ECQA 2EP6A 2VDRB 1F56A 3QEGL 1ZLDA 4PJ7B 3U2SB 3CPLB 4XNAA 4MD0A 4MB5A 2ORBH 1I7UB 1M05B 3CFEA 5DDHA 2EUVA 2V2TA 3GRWH 3NCCB 2FBJH 2FEJA 2FJHA 2BNQB 1JK9A 4F8NA 5ICYA 2H32H 3IXAA 3JV5A 1QO3A 5I5JA 2BINA 5BRZB 3IU3B 4PRHB 4G7VH 2DM2A 3QJTB 3D85A 3SE4A 2PPFA 4M5ZH 2C1PB 5H35B 1CDGA 1P7QD 2X2UA 4OD3L 2BVOA 4GNKB 3VSVA 4QHNA 4C83B 3KPRB 1GIGL 2ESVE 1TQSA 3L3JB 4UNVA 2WNGA 2YJQA 3HG3A 1M1XA 3L7EB 5ALCH 2GABA 1JL8A 5GGRY 2NDFA 5IBUB 1PLGL 1YEFL 2CK2A 3G6AB 4NQEE 2OSLB 3AITA 3KGTA 2IFFL 3QIUA 5B1JA 5L9DH 2HMID 4P23D 3MRKB 3MRIA 3S2AA 1U92B 4HIEA 4YUEH 3LXCA 4OCWL 4KVCH 4U1MB 4ES8A 4NWUL 5IIEA 2IPUG 3SQRA 5IHHA 1EHNA 4C56E 4WNQA 1DDTA 2HKHH 4P0DA 3FT4B 3T2QA 1QSEB 1GGIH 3L8QA 1DJZA 4JQVA 4UILH 1A6AA 4Y1AE 3KPRE 2XVKA 4F7MA 3E1ZA 1AZCA 4PJIA 5IHUL 4FXGA 1UM6H 3IKCA 5BV7H 5EOTA 4KJWD 4AIEA 4XPHH 3LZLA 1ZLUH 3A24A 5F7MC 1TEFA 3D3VD 4WJKB 5EUOB 3C2AL 1HSAA 2AI0L 4I5BB 2IGFL 2DWEB 5K9OA 4NO3B 4ZFFB 2EYSB 3ZX1A 3L08A 5DZOA 1JPFB 4HMEA 2NY4B 3ESVF 4YDZA 4N8VG 3ZGIA 4RFNC 3B34A 1FGVL 3IDNA 5EA0H 5SV4A 2YS4A 3QBTB 1LTXA 1TJHH 2YXVA 1C5DA 1LDPL 2CDGA 4L9LB 4NQSA 5DC2A 1J0KA 1DCLA 5EDSA 1ASPA 5D6CA 3OZLA 3VFPA 1QFWH 1RZKC 1ZHLB 2WUCL 4LDLB 4AG4L 4AT6A 3OGCA 1BP3B 1J9TA 2F54D 3JVGA 4YIQA 1PL3A 4NOBA 5EUOE 3HI1A 4QR7A 3BMVA 2E0PA 4FQXC 4ZFZA 1KCUH 4APQB 2V0AA 4DSYA 3VFSA 1JZHA 5T3ZD 2BM3A 4M1DH 5CLXA 1JWMB 3BP6A 1OT1A 2APXA 4IIQA 5G4OA 4ZODA 1FFOA 3QFDA 3LS4H 1KJVB 3ECBA 3QH3B 1ETB1 1QHQA 1LEGB 5JHMA 4IBVA 1WTLA 1MFEL 1NICA 4PB0H 1D9KA 2ALAA 4FERA 1NGPL 5EZPA 3ULVD 2AITA 1L7TL 3BWUC 3VG9C 2HX9A 3F7VA 3QDJB 1R9FA 3E6HB 1SYSB 2N4IA 4WEMB 5E2TL 4D9RD 5BCAA 4YSEA 2DKMA 3DX6A 3NIGE 1OP5H 3ZQ9A 4L3EB 4BK5A 2QT6A 3ARXA 3FH7A 1TTBA 1D5ZA 5DI8B 2W91A 1E27B 4MDJB 4UANA 3ZHNA 3UPCA 3VRIA 1GC1H 3OVUB 6FABH 5B8CA 3ZL1A 1SLXA 2WB1A 4IBSA 4IBZA 5C0GA 2WM0A 1NBVH 2A73B 3RPIB 1J5HA 1E8XA 2C5DC 2VDPH 5F1IA 1HSBA 1JWSB 4OIBA 1KPRA 3O8XC 3QG7L 3K4DA 43CAB 2NNRA 4DNLA 3PWNB 1LK3H 3TVMC 2KYIA 4RLDA 2HRLA 5JW4R 3T3MB 3DX9A 5GZNA 4Q6IA 3MOBH 3PWPE 3T8XB 2ID5A 5KW9H 4NWUH 4WEUD 5EEYA 4E0RB 5TGBA 4JY6B 2HG5B 4IOIB 1UXWB 1QKZH 4LRIC 1LM8V 4M3JA 3HHMA 4X4ME 4NQTA 2JCCB 1F3JB 3BPCA 3L1OL 4JDVA 1D6EA 2CMRL 5F0LB 3QA3A 1MCBA 3WS6A 2QSCL 5GGSB 2XZCL 1DBKH 3O9WD 4POZD 5L2JB 4JAMB 3NCMA 1QRNA 1KXVA 2GT9B 4HKXA 4XN8A 3K8KA 3E38A 1H6UA 3DMMB 4X7TA 5SWSE 4XAWH 2GJ6B 3K5RA 5JPMB 5DJXA 4A67A 1F3DH 5I16B 5CLTA 3L9RB 1R75A 2R1WA 2F7PA 4WSGA 3SCMD 1BF8A 1SBBA 3KLHD 5DD5L 5GS2D 4AJ0A 4NQDA 2GK0B 3MRIB 5JHLH 1UACL 4XP9L 3W39B 3LNDA 4GT0A 5KG9A 1M4KA 1HI6A 3DPBB 2UWEA 5E94B 3L4YA 1Q0YL 1A22B 3MV11 4CC4A 2G9HA 4TUUA 2QSVA 12E8L 4QRAA 1JDCA 1VJSA 2ZPKH 4IRJC 2BNUB 2RALA 3HVNA 5AYUL 3BWAA 1FVCA 2X4NA 4P9MH 1O7VA 4OAWA 3GXUB 3VXSA 4MSWA 1ZLVH 1OGTB 4Z95H 1YEJH 3D69A 2D0GA 4LVHC 1UEMA 3RA7H 1FZMA 1S9XA 3ELAT 1KPVB 4N86A 5IB5B 5AVWB 5I82A 1P7KB 3UADA 2E9GA 3SYCA 3WIHL 4YDIL 4UQBA 1T6WA 4G9FA 3OKMB 2WAQA 4LSPL 1WP6A 1VENA 2G9KA 1W72L 3K91A 4G72B 4LB8A 4PJ9D 4XMPH 1YJDC 2ARJQ 3UGEA 2OR9L 2Y3AA 4XAKE 2WXOA 1MLCA 4PWKA 3FUFA 5DS2A 3ZKSD 5C6TH 5E1AB 5HGAA 3S37L 3ZRCC 5ICZA 3P73B 4IJTA 4QRSB 4HC1A 3BVVA 1S7RA 4U1NB 4PB9H 1A7NL 3LH8A 1F58H 3TBYA 4FLQA 5IGXL 4Z0XB 5ISZD 4YHMH 2X41A 4E68A 4RH4A 4Y5XC 1G6VK 5HDBF 3B9KA 2ZE0A 5L2KE 1CICC 1XIWA 3FHEA 4J12A 4I2XA 3BGFB 3IT8D 4MXWL 2IJ0C 1JZ4A 3HPLB 5IEKA 2DBJA 2MTAA 4RFOL 4Z7NE 3TF4A 2WIMA 1Q72L 4HKZB 4AYFA 5HGBB 5FA4A 1XAKA 2VC2L 3W11C 1ASOA 4LPCA 1XH2A 1ONQA 4HIHB 3VFVA 1PS3A 1SJEB 3LMJH 4DUVA 4FZEH 4OJYA 3O6FD 4B9YA 2GTWB 3Q43A 1AHKA 2YPLA 3MRRA 4L4TD 1U8KA 2D9CA 3V55A 3ARDD 2OAAA 3IU4H 3VXUE 3G6DL 4XO5A 3IDIB 1G5AA 3QCVH 1ZA3B 4KKLD 2HJKA 1HCZA 1TQBB 2B15A 2NW3B 3ET9F 5D7JA 4CSZA 4HKZA 5BS0D 5EC2A 4KXCA 3COOA 1UCBH 1I8LA 3CDCA 5DMYA 4MZIA 1IGYB 3VA2C 4OGQC 3SJVB 1JV5A 1IEAB 5HYIA 3H0TB 4L5FE 4X6DA 4A7SA 4JE4B 4R4NC 1JNJA 4IRJB 1G87A 1WVZA 2ZUQC 3A6CL 3K6DA 3LV3A 3Q5OA 4LBAA 2MCMA 2UZIL 2NZ9C 3KL0A 4NUGH 1OP4A 3EDJA 2BJMH 5TE7L 5GRVL 1WAPA 5L8LB 3EOTL 1CDIA 4WJ5B 4MKTA 4OCWH 4XMTA 1MAMH 4ICXA 1EUUA 4OLZL 3RUGE 3WDHA 2R9HD 2Y7QB 1B2WH 4X50A 3RWIA 1IC4H 5I18H 3WNPA 5F70A 3BEWA 3BLPX 4WAFA 3U2JA 3U7AA 3GMMB 3MAWA 3JWOH 3OJDB 2ZCLL 1AJ7L 3D7PA 3MACL 5DJCA 2GBVA 1OL0A 2V9TA 43C9B 2CKNA 1CICB 1I31A 2WP3T 4JO1L 4OZIE 3EUDA 5CO1A 5GGTL 4NRYA 2AK4B 5CCKL 1RZFH 3RFRA 1PQZB 2PP8A 2K7PA 3GBDA 3GMRB 1U8LB 1EK3A 1HHJA 1HTYA 5E1IA 5AOMA 3TC9A 3NABH 4U6HB 1MFDL 3FT9A 2ZUTA 2J8HA 4PGBB 3WAKA 5TDPB 4LPWA 1EVTC 4C58B 4M9OA 2KBGA 3LVTA 4LU5L 4KKRA 2DS4A 2JK5A 3JTTA 5D6DA 3EH1A 7TAAA 3GBLA 1OAZL 1WBYB 5C09E 5EU6B 3MXVH 3ROOA 1XR8A 4ZFGL 5E6IA 5KSAB 4HAGA 5TQ0L 4P2OD 3GSXA 5FR3A 2XFXA 5EBMB 3L13A 3OJVC 2FQFA 3EGXA 4FG0A 1F86A 5I1IH 4GAJL 2FX8H 4MCZB 3DX0A 3RHWK 2IQ9L 3VI3B 1S4IA 5T1DL 3MJ8A 4BFGA 1DCEA 3WJLC 4NNYB 3FQXA 3IBEA 5JORB 4WV1A 1X4ZA 1A7OL 4K8RD 4L4VB 5DUBB 3VFUB 1YY8B 4XMKH 2XY2A 4CJ0A 1SJEA 3S5LG 4HUWB 1NAMH 1WC7A 3QZNA 1PFCA 4KQ4H 1X4YA 3IFNL 5HVFB 5I66B 3KS0H 3NIFB 5DQ9B 3F2LA 4M93B 4JKMA 4N3UA 5AOJA 1KGCD 1PKQA 4Z7UA 4ZYKB 3RWDA 2Z8WC 1NWPA 4N2GA 2GJRA 4BSVB 1XGPB 4PJAF 4L1TA 1NCGA 4BRJA 3GUTB 1SRDA 5DUPL 1J86A 5SWZD 3DSFL 5CD3A 3RNKB 2VZUA 4L23A 3IAGC 4JDTH 5EO0A 2X70A 4RETB 1M2VA 3IXTB 1YCSA 4X7SL 3QWOB 4Y4HD 4GSUA 3C6LA 4FLHA 4OLZH 4JEGB 3MLVL 3ABLB 2B4CC 5IKCB 4HS3B 1T1YB 3V0AC 4K3EH 4Z7VE 1OARL 4FKKA 1HOEA 2C1OA 3VNYA 4X6DE 1H0DA 5I1DB 2XN1A 3MNDA 4ODWB 4W9CC 3TONA 4E0RA 2VKXA 4NO0A 5AOIA 1A6WL 2JQMA 2AJ3B 1G7MB 3JSSA 4NENB 4X80H 5FB8A 2VB5A 2EEAA 2YGPA 2OYMA 4X9IA 4JHWL 1RV6X 2DPKA 4EPSA 1TZGL 2NY4C 3GLAA 2FHBA 4KX8A 1E5BA 1WAAE 3CAFA 4NHUA 4WWID 1BV8A 3E9UA 1OAYL 1AY1H 4BSWA 2X4TB 3EYSH 3FFCA 2QQNL 3BH9B 5DI8A 1GCYA 1YMMD 3CU7A 4HJGB 5HHMB 3IFNH 3TZVD 4HJEA 5B1KA 1ITBB 3HR6A 2O72A 2GI7A 3MBED 1KCRL 3QDHA 4AMWA 1EEYB 3BGFC 3OKOA 3QIBD 3X1GA 1JV5B 1XV8A 2MJWA 5BVJB 2BIOA 4JDEB 5JHDD 2EDKA 3MBWA 3TEYA 2L7QA 1MH5B 3CVIL 2DMGA 3LS5L 2DL2A 3P1VA 4G7QB 1WQVT 3IFOA 2W95A 4ORGB 4PI0A 2NNAA 1ZGLA 3ZDYB 3M45A 3O3AA 3QQ3A 4MX7A 2C9XA 1I85A 1NLDH 4BUHA 2K6YA 2Q8AH 5IOPA 2GFBB 4PJXF 4H25A 1JV2B 1UUNA 3EOBA 3UBXG 2R27A 3I6LD 3NFSL 4KH9A 1YYLL 4I77L 4HJIA 2DDQH 1HINL 2WLIB 3PGDB 4DUXA 2XNAA 1SN5A 5CWSA 1A6WH 1KENL 2NY2B 1SFDA 1ED3A 3UZQB 3BUTA 2H32A 2NY4D 2MRYA 3ULUL 2WUCH 1JF6A 1KMGA 5D1ZI 4NFDA 2DTML 3FB8B 3TYFB 3PAUA 5ESQA 1ETZB 5I71B 5L2KB 4ILDA 4KDTA 4YFDB 1K8IA 4U7KA 3TBYB 2R83A 3KL5A 4QLWA 1W91A 4QF1B 5E99L 4YSSA 4H25B 4NCC2 2PTTA 4EI5A 1IBDA 4NNPH 3B4NA 4HH9B 2IPTH 2BSBA 4JVPA 3BKJL 4FG6D 1CL7L 4I18A 5CJOH 5I74C 5F9JB 1AP2B 4K9EC 4O51A 3SYPA 3RPKA 1YDPB 2AI0H 2YPLD 3OHMB 3RWJA 3IKCB 2H41A 3D39D 5IB4A 1ZDSA 1VKXA 2J56A 3B3IB 1UWYA 3FSOA 5IB5A 2ZX7A 1NCCH 32C2A 1SJVA 3VI4F 3I3DA 4FTDA 1KCKA 4LVOC 4YHIB 3F5WB 1OGTA 1XR8B 4G3YH 5ILTH 3O41A 4B96A 4F24A 4BUQA 1FZJB 3LMJL 4FG4A 4QHKI 4C4UA 1QBLL 1IC5L 2VC2B 2VABB 1IE5A 1OIOA 5JIIA 3EXJA 2HFGL 4MJ6B 3SJVD 3PWJA 1U92A 4A04A 2VLLB 1JF1A 1XXDC 5EORH 2VM9A 1DZBA 4PJHA 1OQOA 4ZUVA 4YR6B 5TQ2L 4ZXBC 4BM7A 1M57B 4F1ZA 1RHFA 3RTLA 3VSTA 3FUEA 1UM4H 4J8RB 3KCWA 5KVDE 4OB5H 3WTXA 3V4PL 5FO9B 4UQ3B 1EQWA 4NWTL 4FXKB 1JWUA 2Y0SA 3O41B 2EVJA 5KSAC 3DROA 5I73B 3HRPA 2G3MA 1IKFH 2NY2C 1G7PA 3MOBL 1PKQE 2P24B 3NCYS 4Z7UE 3II2A 3FTUA 1E28B 3HNVH 4WW2C 3OKNA 3S8FB 1L9NA 2J8UA 2NQ3A 3C12A 4HKJA 4H0GA 1EO5A 1LDSA 4L05A 2P8MA 2PKDA 3GB7A 4XH2B 2X6CA 4F7PB 1SLVA 4YSAA 2I07B 4ACTA 3VDBA 1CXKA 3BP7B 1YEHH 2NNAB 2EVGA 4OUOA 4QF1A 5CEZL 3ESUF 4Z7NF 5GS0H 4K2UL 3S35L 3SE6A 2EO9A 4LPXA 4U1HA 5C08E 3FO2B 4AQZA 3N9GL 1KOAA 4WU7A 5SV3A 5FPIA 2VLRD 4J39A 3FTGA 1ULVA 3DMMD 2NXZB 1OEZW 5C8JA 2NYYD 4GRLA 1PKQB 1WA1X 4Z7UB 3RWDB 4ZYKA 1VA9A 1N6VA 2D0FA 4HZAA 4Q14A 2CO2A 4M7KH 1HQ4A 2J43A 5GRVK 4YHPA 4L3AA 1BFOA 1V55B 2YKLH 4PWIA 5IT2L 4XTRD 4LHUD 4MNQD 5KVEE 3EOBB 4AUUA 5DJ6B 4L8SB 2X38A 1S7UA 1DJGA 4KVPA 1JRHH 4WCYH 2JJTC 1D3CA 1G0XA 1M7XA 4N2NA 2NW2B 4ZOBA 1B0GA 3PDOB 2WGNB 1I8MB 3OG4B 4IU2A 4M48L 2HP4A 3QQDB 4M7LL 5HHQA 2F74A 1N2RB 4PW4A 3GSXB 4KFZC 1ACCA 2CKBL 3N42B 4DZ8B 5H4ZA 4ZFQA 4C55A 3ARPA 5IQ7H 4WJG3 1NANH 3BQUD 4HWZB 2K3TA 3AUWB 3B5TA 3GJFA 4XVUC 3X12A 1SOKA 2FJFB 1ZHNA 1GPOH 1K6QL 2R15A 4HC1L 4D8PB 5HVWA 5T33L 4LSDA 3VXME 3UTZB 4PWFA 1S7SB 1ZGLM 4LL4A 4AXWA 4J3TA 4I0CC 2DQMA 3V5KB 4YHOH 2XXMB 5CSZB 1U8LA 3GI8L 4HAFA 3S48A 1KIRA 4Z77B 4Z78B 1VFUA 5EU5A 5GGUA 1E6OH 2EE2A 3ME0B 4I89A 4E9RA 4ZFOL 4HX1B 4OZHB 4QHLA 1Q1PA 1UM6L 2XN9D 2XZCH 3VWKC 4R7NB 5KSBB 5IMKA 5BZWB 2BNRE 4OD1L 3FO9B 5E08L 3UYPA 2XTJE 2ED8A 3TYGH 3GM8A 1E9QB 1LK2B 1V7MH 4IRSB 4G8EA 1U41A 4GBXD 1M6OA 2BIQA 2BOCB 1AR1D 4XNYL 3RYMA 3ZE1E 5IEHB 5GISL 2R1YA 5IP4A 1H6TA 4LIQE 2IG2H 2IWKA 3D08A 3PHOA 2Y2TA 2H0PA 5B7FA 5DJAB 3NDYE 4L4VA 5DUBA 1VZIA 2XJLA 3CDYA 4XNXH 1J48A 2K8MA 5FHAH 4RDQF 2X0VA 1NC2D 2QADB 3CZKA 3G5XB 2OMXA 5DJ8B 4M1GH 1ITCA 5EO9A 1BVKA 5KN5A 2R4RH 5J57B 1CIDA 3ZE2E 5KANG 3GBML 4JM4L 3L3OA 1FVDA 1GSMA 5FGBC 4XXWA 2NYKA 4J7RA 4AG4H 2DAVA 1NJ9B 3WKQA 1RUKL 2Y25A 4ZAKD 5C1MB 2PXYC 4NAMA 2OMXB 1NIFA 3EO1A 2HJLB 3AAZB 4K8RH 4XMLH 4QOKD 2FATL 3MCLH 3BSHA 4XVOA 1BFTA 1U8KB 1YEDA 2CK0H 1G7JB 2RCSH 2CO4A 3EHBB 1BOGB 3O0RH 5IFJB 3E2HB 1CLVA 5ID0A 4BZ2A 2AW2A 4JQXA 4XVSH 2J5LB 4X6BB 3RJDA 4FQPA 4YGVB 5GRWA 2ZICA 5C2BH 2UX7A 1BMZA 4MAYC 5DA4A 2FO4A 4GRMB 1CD9B 1QASA 4PRIB 1TQVA 3HBPA 5G5DB 3WNJA 3HJEA 4NN7B 2D3NA 1P1VA 3OJDA 3NP3A 4Q6IC 3RGBA 3AG3B 4TN9A 3SYOA 5DK3A 4EN3A 2ZOOA 1SQ2N 2FSDA 3PWNA 3ZZ1A 5IMKB 1XSKA 1RU9H 2EYRB 4ODTL 4AKQA 4GUPB 4TNEA 4ZXBD 2Q2LA 3VJ6B 2XBDA 1IM9B 1QHPA 1BJ1H 1Z9SA 1G1YA 5F6IB 5I5MA 1AGFB 2ZF9A 1U30A 2HT3C 3C8DA 3ZKXC 4OCYL 5LWYH 1S7SA 4PJ5A 1U8PB 4RESB 5HDWA 3RFZA 3IRPX 5D72L 2E4TA 5I8OL 1FQ9C 5D4QA 4QRQB 2EYRA 1JNHB 1OM3H 1J88A 4N85A 4PJ8B 2VDOL 1UOKA 3CFUA 3M8OH 4RGOL 2JVUA 1KB5A 3B2UD 1I1AA 4XNYH 2VIRA 3FTVA 5DD3L 1B6DA 5BQ7A 2C26A 1U2CA 1KLGB 4QEGA 4KITB 2D4DA 3P4OB 1JNNL 1CGSH 4JLRB 4LKCA 2IPTL 4FG6C 1PFOA 4HLJA 4PJGE 1I8MA 4R4FL 1XL4A 1JZ3A 2A38A 3ASNB 3MUUA 4P5KB 5F97E 4ALAC 1ZLSH 1VRSA 5F96H 3SYQA 1S7UB 1BVZA 4D0DB 4DEPB 3W39A 4D7PA 3TT3L 4OZIF 5E2TH 2OCCB 2AXFA 4NQDB 1NM9A 5GSVB 1INEH 4AKPA 4WGVB 4BXVA 2FBJL 3D09A 4WO4A 3QZPA 5GRJH 2NSXA 3WO4B 4C4BA 3KVDD 4N90D 2ESVB 2FBOJ 2J5LC 5C8JB 1OPOA 1R5VA 4N2CA 1NFKA 2F8XC 5CUSL 5ALCL 2WXPA 4O2CB 2DQUL 4FFZL 3LEYH 1J5CA 1OCZB 1ZIAA 3KJ4B 1H3GA 3KPLA 4FKHA 4NC1E 4OD3H 1A4AA 1NGYB 1IGIL 1AC6A 4N2BA 5AZUA 4Q7DA 2VMEA 3OF6D 4Z3HA 4Z7NB 2G2PA 2XSKA 4ZPVA 2OL3B 3GSRA 1UJ3C 2YPLB 5EOCH 3LKQA 3LJ3A 3PE9A 3HCVA 1BD2D 1PX8A 3V4PB 5GIRB 1P7QA 2JE8A 2CRMA 3F01A 4N2HA 5CJXA 1R19A 3JV6A 2CO7B 2IWGA 4N1CA 3V6OA 3PQYE 1UXLA 4M7KL 1ZA6B 4CN1A 1X5XA 1DE4B 2CLZB 2QVFB 3D8MA 1MJ8L 4HGMA 3CXDL 4K3JH 3VH8A 3X3FH 2WWNA 3EGSA 3OMAB 1KGXA 3SGKC 3RX9A 3T6QC 2NMSA 3N0PB 5IV2A 1XSIA 2HX8A 3FSAA 2GAZB 3K4ZA 3QWRA 2Q86B 3W56A 3U0WH 1FORL 4HXAL 1TZGH 4JZOA 5IVOA 3BAKA 3UTSE 5T3ZH 2YQ2A 1A2YA 2FSEA 2KDGA 2QKIB 2WXJA 3L4UA 1E42A 5EUKB 4I3RH 4JRXB 4QKTA 1R4XA 4PJHB 3EHBD 4MB3A 2CXGA 4QRRA 2NQDA 4D0CA 4UZGA 1IQDB 4O5LL 3C5XA 4AW4A 2IH9A 2PYED 1X9UA 4NQCE 5K39B 4GW1B 1BQHA 1BW8A 4M6AA 1P7KA 4JCLA 4WI5A 1TVDA 2AXGB 1E4XI 2I9TB 4APXB 5AVQB 3C8KB 4QXGH 3R0MA 1IBGL 1UD2A 3C8HA 2D2CC 2GVYA 5E0QA 3BH4A 3ARBA 3HB3C 4QYAA 3D39E 1KB5H 2F68X 4UNUA 3U7WL 5IW6A 5IZ7A 2MOGA 5DHVB 3LKNA 3CFMA 4JANA 2F53A 3UTSB 4BK5C 1KIUA 4MLIA 5I8KH 5F3HB 3OKDB 2AQPA 1S7TB 4UQEA 4M8QB 1JGVL 4MD4B 4YC2C 3CZJA 3KLAA 3V4VB 1U21A 3AB0B 3C6LD 3HMWH 1U6AL 3NK3A 2VERA 3WFBH 3MGAA 4OJCA 1W8NA 3MU3A 2VL5A 2V2XB 1CE6B 5EG6C 1WGVA 4NYLB 1GY1A 2NY7H 3TVMA 3RY5A 2H1PL 1GGBL 2OPCA 3V7MA 4X98B 5D7EA 4PS4H 1K4CB 3K6NA 4JJ5B 2MQ3A 3HZVB 5KSBE 2E7HA 1CI3M 1KDIA 2YD7A 3G08B 3MNVA 4TOYL 3ME0A 2DIAA 4UQCA 1J8HB 4AENB 2ALWA 3N55A 1NC4D 2KL6A 2FZ3A 4XXCC 2X4RA 2Y7NA 3TZVC 5A2AA 4IYKA 5BNXD 3GSNL 3VXOA 2YD2A 4P2YA 5JDSB 1CE1H 1KG0A 4HHAB 4R7DB 1UVQB 5L4FA 4KQ0A 1YG9A 3CXDH 1L9OA 2YKLL 4IS6B 2EEBA 3PFQA 1HH9B 1MH5A 3LS4L 2ZSWA 4XN5A 5KTEH 1T22B 3MRGA 1ZT1A 2WWMD 3BUPA 3QO1A 35C8H 1SF5A 2IADA 1G5GA 4Q6IB 2ZWSA 5E6IC 3N44B 3TBSB 3THML 2JH2A 1LEGA 3JBG7 3MROA 5C3TA 1D5XA 3DDFA 1RJYB 2G0LA 1GS6X 1TTRA 1CDCA 3DGCR 4TLSA 4OF7A 3FRPA 3O4OB 2H2PD 3V7AE 1N7ML 3RTQC 4YE4L 4M56A 3IRCA 5AZEH 4F33B 3NPSC 2X4QB 3TV3L 5CEXA 2YD3A 1MVUB 2BWQA 4CSPA 1CIUA 2RCSL 3W1ZA 2K45A 1HYSD 4QO1B 1A9EB 1P4BL 3LIUA 1XTLA 2DF3A 5FUCC 4R3SB 1T1XB 1QWHA 4LEBA 4BZ1A 4YHIA 1Y0LB 4G8GE 3G5ZB 2AJ3A 3WN5C 4QTHA 2JKJA 5F7AA 5EIVA 3F6IA 5FGSA 4BEIA 1MVFA 2H8PB 2YAEA 5T1KD 2AHIA 2AKRB 3HLAA 3GQFA 4NKMA 4ZS6D 3IJHA 2BPBA 3C75A 2A74C 2QELA 4EI6B 3O11A 5EIIB 3IDJA 1NZRA 4Q2ZB 1KACB 2M83A 3OAYH 3KW8A 2VJ8A 5F3HA 2UWEF 3V10A 1S7VB 5C9JA 3SSGA 4L8CA 5C3IA 2CGZA 3BQUB 4I9WE 2XTSA 3FSZA 4LCYB 2X1PA 5EO0B 4OQTH 3SQOL 4BXSV 4D9QD 3FU7A 1CE1L 4JGUA 1E6JL 5T1JA 3ZDZF 3PV7A 2YQGA 5SWZE 4DERA 4G7YL 1A9BA 5DFTA 5KVFL 1MRDH 4S1DC 1O0VA 2IPUK 2APSA 2ZWYA 3AABA 4DHLA 4LLMB 2A9BA 4M6ML 4ENEC 3B6SA 4MASA 1ZK9A 2K0RA 3PL6C 4Y9BA 5K1NA 4F7EB 2ICES 4HCIA 3U36B 4L8CB 1D6VL 3WLBA 3HR5B 2EIZA 3STBA 4P3CH 1YY8A 1OGPA 2ITFA 3DWTA 3MLVH 3SDAD 1IAIM 4ICWA 5LQBL 2WXLA 3FQYA 3TT1H 4QYOB 4K7PX 4JL2A 3F64A 3P11L 5DJ2A 2JJWA 1CO1A 5CN3A 4ZUWB 4UV7L 4AL8C 2KT6A 1UEYA 1PAZA 2P26A 3BCDA 4PS8A 4CVZA 5BJTB 3DV6B 3NN8B 3N40P 1D5BB 2OR7A 4JREB 4PRPB 5FXCH 4HIEB 1GYVA 4ANWA 4L4JA 5F9JA 1ZS2A 3ILEA 1GGYA 3FQTB 5HGDB 4U1GC 4X4MA 3NJLA 4K7FA 3FT3B 4U0RB 3FB6A 5IM7A 4H8UA 1AXTH 3RWFB 4JO5A 3REWB 2A6JB 2IQ9H 2JI3A 3LQZB 4FQHB 2F18A 3G3LA 4GRWB 3U30B 1ZXKA 3H9SD 3KEHA 3MRCB 3N44F 3UROR 1A5FL 3BKCL 1TQTA 1DSFL 2E27L 3LKSB 3PP4H 3D85B 5AVSB 3LKPA 2JKRM 1NKRA 4A37A 1WGOA 4S1RL 1F8TL 3OJMB 2K1MA 2K9FB 1EBAA 2LE9A 5ELIA 3GSVA 5GGQH 4GXVL 2DQUH 4FFZH 4MDRA 1SNRA 2YXWA 4J3XA 1UC6A 5EN3A 3UERA 3MRLA 1JPTL 2Y36H 3MA7B 4GQ9L 4XAKD 3CQQA 2YD5A 4G42B 1XGRB 4YBLB 2JKWA 3CHRA 2XBZA 3LPWA 3X11B 3ASWA 5DJ0A 4DEWA 3N5AA 4L0PB 4Z3EA 1NCWH 5A7EA 4A2MA 3P69A 4I0PB 1J0HA 4X5WB 3CH8A 4AYDC 5IB1B 2COVD 4N2KA 4UT7L 5IR1B 4JFYB 2PCYA 4XXDA 5LQBH 3KLDA 2AK4E 5KSUA 1ZEAH 4Q8BA 3JWOL 1QYGL 4LIQH 1C5BH 4HWEH 3IPFA 5I8EB 4NP4H 4QRPB 5D9SA 4X4YA 4PLKC 5A6LA 3BWZA 3HE6A 4KTEL 3W38A 1C8QA 3CSYA 3QORD 3BJ91 4KNQA 3K0YA 4ZQKA 4HW6A 4AGPA 3BAEH 2KZWA 1FPTL 4RGNB 2QV2A 5TPWL 3WNLA 5B3NA 4HV8B 2WKLA 2MCG1 4KI1A 5T1MB 4OV6F 4YDLB 4FNPA 2VXTH 4WWKA 4UT9A 2V17L 5E6IB 3BC9A 3BPNC 5JHAA 4P5RA 5ERWA 4LLUB 5C08B 3KPQA 2VMDA 3SDAA 3U25A 4PGEB 1CZ8H 5I1DA 4LGPB 5ID1A 5LNGA 1GGBH 1J8KA 4ONFH 3MX0A 1KYAA 5DMGC 3I6SA 3MNWB 2FEDC 2CAKA 1TTCA 2J1XA 2JB5H 5DZAA 4QCIB 5D1QB 1BSIA 4PY8J 3WE6A 1C7SA 1AQHA 2EE9A 3M7FB 5EUKA 5DU7A 3UJJL 1QVOA 3D2UB 4APQC 1AGFA 2DLTA 3R7QA 3US1A 4HJ0D 2VXSH 1F8TH 4ZOAA 2EDYA 2YD4A 4HEPA 4GFTB 3MX0B 1SDYA 4JJ5A 4OTXL 4YQXL 1T66D 5HBBA 1DSFH 2X1WL 1Q9LB 5CS7A 2YMXH 2YR3A 1EO7A 1TEYA 2NX5B 1VEMA 3J27A 2AJZB 1X9LA 1AQ8A 4PJAA 5GPRA 2BO0A 2D31A 3NOIA 4XPGH 4AGQA 4NQEA 4JM4H 4QYOA 1BAFH 3PNWA 2BCMA 5GZOA 3ZUCA 4WHDA 2HG0A 1NGXB 3LOWA 3O2DL 5F6HI 5LN8A 4Q9RH 4YO0B 1ZVHA 3GZQA 3VRLE 4PJDF 4AVJA 3S37H 2ZUXA 4ZW5A 5DHXB 2BH0A 3VXMB 3OKEB 1TJHL 3T0XA 1B0RA 1BECA 3CV5A 1EEZB 3C60B 3QORA 2VMFA 1W72A 1SOSA 2ZAGA 1CDYA 2ZWKA 4YXKH 4IBQA 2FIKB 3MLTA 4LOFA 4W9DC 4EEEA 3KYNA 4FDWA 2EDTA 4GQZA 3NSJA 5DUMH 4P07A 1D9KC 1XGQA 2VDML 4FOMA 2DQTH 3B1TA 2OMYB 4JFYA 1FNEA 1N59B 2LABA 5CR1A 4G80A 4L1BA 2HFFB 5DZJA 3SCMB 1MIML 2VR8A 2HKFH 2ZYIA 2XY1A 1AFVH 4OD2A 2QPSA 5TDPA 2W9EH 1EMTL 3M07A 2OQJB 2BZDA 3NH7H 2VE6B 5IHWA 3X1BA 4JFPA 4J4PA 5KJ4A 4X4XA 4M61A 5ENWB 2A99A 3UTZA 3P40A 2CJSA 4IEFA 2F5BL 3S2CA 1AKJA 3EO9L 4QMEA 2H8PA 3A6CH 2YQ3A 1DO5A 3I9PA 4R2GB 4V2BA 3UABA 3IDGB 3E1F1 3SOBL 2G3XA 3R4RA 5FO7B 4Z7IA 1PD0A 2BVYA 4HK3N 2F7QA 3II3A 1F5WA 4AK1A 4LP8A 2E59A 3C6EA 4WWKB 1L9MA 2B0SL 5BZWA 3TU6A 1AG0A 1G7QA 1JNHA 4HC1H 4K9EL 4JPQA 4UT9L 1CFSB 1RURH 4GAFB 3FU8A 2IWFA 3VXSE 1F11A 1ZWIB 3L4VA 3TCLA 4P59L 2X89D 5JR1H 3TH4T 3FQTA 5HGDA 2XKSA 3ZN6A 2XWBA 1P9MA 1U8OB 3C5ZD 3ZZQA 4FQXD 4KRMB 2VDLH 3BD5A 1MF2H 2CGRL 5E4AA 2WHVA 1U3NA 2NCEA 1JHTB 1EEUA 5H94A 2NR6D 2JKLA 2B1OA 3UL4A 1K5WA 3KH3A 2PYEB 2Y5TA 2EJ1A 3LKOA 5J0BA 4ABVA 3AUVA 3UO1L 2OSYA 5HDQH 5D93B 3G6JF 1XCXA 3Q1EA 3U1PA 1SEBB 1FYTB 1TNMA 1YPZB 4XB3A 3S36H 4AEHH 1TVHB 1DVZA 1KJ3H 2FX7L 2OJEA 3QRFM 3QUMA 2QR0A 4N0CC 4Q4IA 1SMOA 3AAZA 3ZTJH 2A9NH 1S8DA 4G43A 1T0OA 4MNQE 2BRRL 1A5FH 4JO3L 4QRUA 4MD5B 5JZ7C 3U2IA 5D6CB 1JPGA 5T3XD 4DT2A 3TNMA 5C0AE 5BQ7B 1WD8A 1PY0A 4XCEA 4GAJH 1HIMH 3Q2NA 2BK8A 3UCRA 4FQQB 1XIWB 3N43F 4N5EC 4LLVB 4ZAKA 1X9QA 2HZHA 4P2RB 1NKGA 4XPBL 4JFFD 4M43L 3GXIA 2X2HA 5D4IA 1I3RB 5IESH 2NX5D 2F8VA 3U0TB 3QIUD 1NGQL 1XH1A 1NPUA 3MRPA 3UGUA 1IAKB 4P4RA 4ZUVB 4CSTA 5K9QG 4MD4A 5KBKA 1FDLL 3M1BA 5C0DB 4XGZA 3BPCB 2BC4A 3W11D 5D5MB 5CBAA 2A1WH 2CM5A 1X7QB 4JX0A 4PCKA 1TYJA 4D9LH 1K5NB 1W80A 4BQ8A 2FATH 1UD6A 4JANB 3UTSA 1P5UC 5I6XB 4U6XB 3ZE1F 5D1XA 1U91A 3OKMA 3LY6A 3OAUH 1SM3H 4BA0A 1W0VB 2Z31D 1L7IL 4MJJA 4EIZC 1ZVYA 3EJJX 4GRLC 3TT1L 1Q9LA 3HZMB 2NTFB 5CJQH 4WHCA 3ZDXE 2LW3A 4R83A 2OR8A 1WCBB 2ZUVA 1TCRB 1BVNT 3MTXA 4BDVB 5ILTL 4HFWA 5BXFA 4KVNL 2NY5L 4X6CB 3QDMA 2KH2B 2XPZA 4OJFL 3FH5A 2WINA 5C6PB 3JUZA 3HAEB 3MZTA 1TG8A 4JUTA 3QCUH 4KKCC 4HUVA 4WUUD 2OCFD 1ZLVK 1S78D 4HHGA 1T83A 1KELL 4PJEA 1C12A 1NAMB 1NCDH 3P3UA 3W81A 4FZ8H 1LMKA 1QR1B 2VJ0A 5CBEA 5IK3A 1L9PA 5I71C 1Y18A 3EGDB 3MOAL 3AU0A 1RIUH 2CRYA 1H9VA 2XWTA 3EJTA 5I1GH 5E03A 1OWRM 3PQYB 4JG1L 4XOEA 4ZMVA 3CHPA 4I2XE 3ASOB 3A0OA 1PGRB 4OZFB 2OZNA 5LCVH 1WFMA 3ARQA 1JV2A 4LDEB 3KJ6L 5T1KB 4F2FA 3L7FA 5DHVH 1DVFD 3IDJB 3MRMB 2XYCA 5FV2A 5I15L 4WHYG 1BVNP 1WZMA 1UXSA 4HT1L 3ZT6A 3FO0H 2AQQA 1SOXA 2G5RA 3LX9A 2DM4A 5EU6E 1SXNA 4FP8H 3KVPA 4F7EA 1NFDA 3CHQA 1A7BA 1N70A 3NACH 3Q0HA 5ESQB 4ODHH 3WTVA 2E9JA 4XN1A 1MXGA 4H88H 1VESA 4EVNA 4Y19B 4BWUA 4GEIA 3PG2A 2BHUA 3O4LA 3L3IA 3QYCA 2I69A 1FRGH 1BIHA 2J6EA 3DI3B 1SXSA 3MBEB 4N8VA 1BZQK 1S7XB 5KS9F 2PYFB 5EU7C 1UXSB 1FYTD 4HEME 5AB9A 2VM3A 4LSSL 3VRIB 1J5OL 2CA3A 4MMXC 5JHDB 3V6FA 3SGJA 2V9UA 3BUBA 3GMOB 1BFVL 3H9HB 1MFCL 4HOMA 3BZ5A 4R8WH 2Y3NA 3UOAB 3GBNH 5A7BA 3TEWA 5DMKA 2R56H 3K1DA 5ABAA 1PZ5A 5BOJA 5I73C 4XNQB 2PXYB 5EWIL 5BMFH 5C0CD 3ZR5A 2P80D 4DZ8A 1UQSA 2VR7A 4TKWA 1NOAA 2UUDH 2WLMA 1C12B 1NAMA 1X7TA 1YC8A 3IF1A 4KH2A 3TNNB 3VMNA 1JNLH 3PAZA 4K5PA 5EU4A 2HTLD 3RWFA 3SBWA 4W93A 1DJXA 4YFLF 3EYUL 3V9CA 4AEFA 1ZD6A 1OP5K 2P8PB 3IFLH 4QHUB 1T3FA 3TXAA 2DL9A 3B7UX 3ETBJ 1EA9C 2VO8A 5C0IB 4N2AA 5SX5K 3VFNA 3HG2A 4JHZA 1DJSA 2VXUL 1A7PH 4A6YH 4XR8C 5JXAH 3WCYA 1M2VB 1OT4A 5CILL 1HWHB 1TENA 3DV4A 3L3JA 4I3SH 2QQNH 5K93A 3VYOA 1MFUA 1E4HA 4M6OH 4M00A 4F2ME 4U1IA 3FPXA 1VGKB 2B4CL 1LO4H 1Y1DA 2C3VA 2D73A 2X09A 4G70B 1G7MA 2IADB 4P8QA 5IW3A 5HD8C 3P3TA 2YD9A 4JZNB 3RDTC 1I7TB 1IGJB 4AIOA 4TPRH 5BZDB 2XZAH 5I66A 2QSTA 1JGUH 2M26A 1MW2A 3VWJD 4U4BA 4Y88A 3Q2VA 4P06A 1I3UA 4IEFB 5HHOB 4ZZKA 4LSUH 1ET5A 2ZSVB 3IWVA 5AOZA 3ARFD 1E4KA 1T2JA 4PLKD 1OHZA 4O58L 5HHME 2Y07L 4P2QA 4ZMPA 2B3RA 1WS7A 1CBJA 4DO5A 4KJYA 5TDNB 1HCFX 4U3XA 1Q38A 4NZJA 4DEUA 3DUSA 1WFOA 2R0WH 3AQXA 4K5NA 3EYOB 1MY5A 3QULA 3MLSL 4TNGA 3RJOA 3S37X 3UIYA 3CVCA 4IMKA 1XX9C 4I77H 3GD1C 3GIVB 4Q6KA 4G6AD 1DJIA 2VT0A 5CZKA 3TJPA 4IKNA 1PIFA 4FAAB 2UZXB 3JWDH 1QMUA 4KZDL 5LXGL 2WC7A 4Z8FH 4WW2A 1YEKL 1DJHA 3ZLQC 3MOQA 3L3HB 3AG2B 3KWWA 4OQTA 1ICTA 3EDFA 4QXUL 3LRGA 4QNPF 4UQ9A 2IGLA 4MHHG 1RZGB 4UWQB 4PSPA 4MYWB 4ORGA 2WBXA 4BH8B 2W60B 2WYTA 1RUML 1DQVA 1Z0MA 2DLHA 1HC1A 2GITB 2VN6A 4HUXA 3ARFA 5DJYA 4NKOB 5H35A 1M6OB 1JUFB 3C6SB 4M7ZC 12E8H 1RY7B 2ZUWA 2OTUB 2A77H 2CM6A 4GKSA 1K85A 5BZZA 4YEFA 3GO1L 4NQUA 5MERB 4KXAA 2YSTA 4XPAH 4OSUL 2XZZA 4BKTC 4HS6B 4XP9H 4OM1H 1N6UA 1FGNL 2DI8A 3PHAA 5ITFB 5CP3A 2E7MA 5IREA 1NCOA 4PJDB 2BSTB 3CC5A 5DD5H 5C97A 2KLRA 3BE1L 3EO0B 4U3CA 3ZL2A 4CC0A 2XICA 1KBKA 1IIKA 2FECI 1KCWA 2H1XA 5IY5B 3TIEB 1TETH 4EO5A 1FJ1B 3E8UL 2HT4C 2NXYB 4IIQC 4YX2L 3S3PA 3U0TA 5GSRA 2Z0BA 2ITEA 1IAOA 4NQVA 3O6MH 5IQLA 4PI2A 2BVQA 3CVIH 3LS5H 4IK7A 4WTXA 1UM4L 3KBPA 2EE3A 4QXTB 2WQSA 1GSKA 3T3MF 4X6DB 5ERWB 5DJCB 1NFDE 3DHMA 2D7TH 5IROA 5GS3A 4X6DF 4PAZA 5J9PB 3MUHL 4AITA 3UTQB 3CZFB 5BRZD 1UYWL 1YZZA 3GI8H 5D55A 2JJSA 3DBSA 1UOVA 4G1EA 4GMTL 4CGUB 3HCVB 5KBNC 1OE3A 3ZDXB 1UVQA 4OGXL 1CDHA 1VPOH 3D06A 1B9KA 4QOKA 3ZKND 3CVHH 3WEMA 2X3AA 5C0ND 4PTTA 1EJ6A 4HCFA 1G0DA 1XF5B 4AQEB 2O1AA 1FNLA 2I26N 1X6LA 3UDWA 3GKWH 2ZQKA 3LRHA 4KNSA 3QJQB 4L8BB 5TE7H 1OP3H 2F1AA 2JXMA 5I1GL 3IJSB 1GRWA 1LP9A 1SHXA 5J6HB 1CE6A 1G6RL 1T0MB 2UZIH 4NUGL 2V17H 4ODXA 4R90H 3TPUB 1CF8L 4Y9CA 2PWGA 4KK5D 4E42B 5F1NB 1NCJA 2ZUUA 3MYZA 3HUJB 4X0NA 2HX7A 1UASA 2GSMB 2WN3A 3CQFA 4OFPA 1MRFH 3GIZL 4YOKA 3AS2A 3H2PA 6CGTA 3ZDYE 4EI0A 2OJZH 5DUML 1RUAL 1KENH 2XTJC 2R9HC 2VDKB 5ECGA 4F93B 5L88L 5F93C 1QLFA 2Y2YA 4ZFGH 4PRID 4GXUM 2Q8BL 2AQ3A 2M1KA 4JR9L 2QPUA 1D7FA 2AXGA 1DVQA 4IDLA 4MS8C 2ZNXA 2FYYB 1UD5A 3EFFA 1R0AL 3O0RL 1DN0B 4TQIA 5I5IA 5TF1L 1U8NA 2OP4H 4M3HA 1RL1A 4PLOB 4Z77A 4RRPG 3VFMB 1VADB 1F4YL 1BIIA 1FRGL 1GKOA 1OF2A 5I6LA 1KCBA 1TTGA 2VE6A 4OCRL 3TFKC 5MENA 1PX4A 4FE9A 4XCCL 1MNUL 5T3XL 3WXWL 1WYJA 2BSTA 2J20A 2Q0ZX 4PEEA 3RVUC 4G7SB 4HWBA 4TYUA 5A43C 4JFFE 3DXAE 4AC4A 1M9SA 3GMQA 4AH2A 3SN6N 3MRNA 2FLBT 3BCFA 1RJCA 3H6JA 3O6FC 5DZNA 4OF8A 4PBWD 1QA9B 1JK8B 4AEHL 2EXSA 1REIA 3QIWB 1RKRA 2BMKA 3RQ3A 1SMDA 3NSCA 4PRIA 1CFMA 4X7DC 2J6WA 4RBPH 1S5IH 4XB8A 4JG9A 2OJZL 1PEZA 3CZLA 2EH7H 1AQDB 5KZCB 2A0LC 3L48A 3WYRA 5I6XC 2Z93A 3OD3A 3FB7B 1UUSA 4FQLH 5HPMB 4L9DA 1ZT4A 2I5YL 5CXPA 3DO3A 4DQAA 1A02N 2A7BA 4XVJL 2BRRH 3INOA 4JO3H 1XD0A 3P30H 5D1XD 2GJ6D 2ZSVA 2FDBP 3H3BC 2WVTA 2Z8SA 3I02A 4KTYA 1UA6H 4Y1AA 4YSTA 5JYLA 4M9PA 2H2SC 3DXAB 1LNUA 3RFZC 2H3NB 2XFXB 1K8IB 3B9VA 1UB6A 4F7CA 2NXYD 2QVMA 4QGTA 2JF1A 1A3QA 5HY9B 5CSGA 3BVWA 4WI3A 4W9GC 4L9LC 1IFHL 3MO1A 3BAEL 4NSKB 3KM2A 4PJ9C 4U31A 4HF5L 5FYJE 3DMMA 2FWSA 3PABB 1GZQB 3IU4L 1U0QA 4X5XB 2G3NA 1R17A 3D0LB 3ZK0A 2IGTA 3RIFF 1KXQA 1QYGH 4HS8H 5DUPH 2V5SA 4PJ7F 2P5WB 3UTTA 1KB5L 5CEYB 5ACMA 2YC1A 4N0FA 4ZZFA 3FQRB 3EOAA 4DGVL 2CKBH 5HYJA 3MJWA 4J4PD 4JZNA 4FD0A 5FOJA 1QATA 3T4AA 1D9KB 4E41B 1KBBA 2VZVA 3MV9E 5DFWH 5KVFE 1SEQH 3GTVA 4UOQA 1A6ZB 3PIQA 3NGBB 5INDA 2JKSA 3Q2LA 4I3RL 2CD0A 4P23A 3TO2A 1SGKA 2H47C 2Q8AL 2EKJA 1YEWA 1RH8A 5H4YA 5KSVB 2A73A 1KIRB 3FUHA 1ETA1 4CRPA 1G7LA 2GB2A 3QAQA 4GIPD 1I9EA 2VZTA 4LHUA 4M43H 1D5IL 3M6DA 1ID2A 4MNQA 4QHUA 2X6VA 2E7DA 2IDCA 4NPYB 1KGIA 5CZXD 4F8TA 4OLUL 3FRPB 2EINB 3T8MA 4M1DL 4PJ8C 3NJHA 2HKFL 2BOLA 3RVUD 3KLLA 1GOFA 1HXYB 2WXMA 3W9EA 5E4EB 3VFGL 4Z76A 4M6NL 2JWYA 3JTSA 5A16A 4GRMA 3I50L 1DVFA 4HCRA 5IB1A 2B59B 4TQ8A 4CBPA 4WFGD 2QADC 2YAFA 2E6PA 3MV01 4I4WB 1T2XA 1YN7A 3UBXA 3QIBC 3SQBB 2ZG2A 3DIVA 4NUMA 5FKAB 2G0KA 4QRTA 4HPOH 3RG1C 3HS8A 2CBMA 3FW6A 3QWOA 1S6NA 1GL4B 1OLLA 4CSSA 1BDYA 3NACL 1OTSD 5LGYA 2J25A 4ODVL 1CFNB 3TWYA 3U9UB 4F80A 4HU8A 5KYNA 1EZVY 3O2WH 1E28A 2NYZA 4YHPB 5EBGA 2CDFB 4DVRH 4GP5B 4WKZA 5JHLA 4MNGE 5BOZG 2XTJD 5I16A 1C16A 1E5CA 2XN9E 1QSFA 1CLZL 3WY3A 4PJGB 5F3FA 3O3DB 4KNUA 4BD4A 2X9YA 5IFAH 2AP2A 5TK2A 1INDL 3AWGA 5IVZB 3O2VL 1A6VL 3Q7JA 5L4IA 4CKQA 3SPVB 3H3PL 2EEXA 2L3BA 2YHGA 3EBGA 1BXUA 1UZGA 1XZ0A 4Y7OC 3W9DA 2BVPA 4LP4A 5FUZL 5KW9L 4KJPD 3TEUA 1I9JH 4W81A 4GSQA 4MNGB 3U7YH 2YBRB 1ADQL 1J1OH 1HL4A 1KEMH 1RZQA 4TOYH 4B0MM 5B1BB 1HHIA 1HNGA 3IJEB 1BEYL 1S9XB 1Y6KR 3I6GB 3PJSB 3QQ9D 2PCXA 1R33A 3MBXH 1QA9A 1NBCA 3KGSA 3PUUA 4YDKL 3KWXA 4N1EA 5C0AB 2MCPL 4AX3A 2MNJB 3GMLA 2V9RA 1RZ7H 1IAIL 3WS3A 5E99H 3E8VA 1NMAH 1FNAA 1I3GL 1NBQA 4NFCA 1EHLH 2HWZL 3WGUB 2KPNA 5DK0A 3ZQWA 5AKVA 4OF3A 2EDEA 2BSSA 5AW4B 3S3SA 5JMRA 1HKFA 2FNBA 5KG9B 1HOCB 2DQ6A 4A55A 5AAWA 1B4TA 2CO1A 5KSAD 4AL8H 4L4TE 1I8KB 5C7XH 4MJ6A 1JN6B 3ALWA 4CVUA 1SBSL 1EZUA 5BUGA 4N1HB 4HGKC 1JJUA 1EERB 3T0AA 4DVRL 3PIQB 2XWRA 2AJUH 4J3BA 5JXED 5F7DA 1GKEA 5EF2A 2Y5EA 1SHSA 1ZA6A 3L17A 1HILA 1MWAB 2ARJA 1PY4A 1FE8L 5CZVH 1Y6NR 3JV6B 2G2RA 1KJ2A 1J1PH 3Q3GB 4BFKA 5AENA 5EU3B 5JW4M 3MMEA 4KX7A 1P7HL 3HI6H 1BD2B 3O6FB 3T08A 2CR3A 4FRWA 2BIMA 3G9AB 3PP4L 4J6IA 2VN7A 1Q94A 3QAZC 4LQFH 5GGSA 1DN2A 4L0YA 3WTTA 3TV8A 2W07A 4PREB 1HEJC 5FM8A 1NGZB 1IM3D 2J6EH 2CH8A 3GNML 3POCA 1UHVA 2A4EA 4NKMB 2DZEA 5DEGA 5H2BA 3RA7L 1GGUA 3SQBA 1QEWB 2EDFA 2RQEA 5IBTL 3VMOA 1JPTH 5F1SA 1R3HB 1DVFB 4DP2X 2OMTB 3KPNA 3MSPA 1ILUA 1TLMA 1J1XH 3HPJA 1WBZA 3FTZA 3R8QA 3IJSA 2DQEL 2X9ZA 1DQLH 4OGYH 1FLRH 4JCMA 1NA8A 2IALB 2R4SH 4R3SA 4TULL 2A2QT 2J1ZA 2YUZA 1P2CA 2R2BA 1QNZH 1KBGL 4UYQA 3A6BL 2X4PB 3LHPH 3QJHA 2FT8A 1X5JA 4XMVA 2WY3B 3AXHA 1S3KH 5B1CA 1ESOA 4LSRH 1RSFA 4GXFA 4NC1C 2ITCA 4YSQA 2IO5A 5DC9B 4NZDA 3R18A 2GTWA 3MREB 4N9GB 3VI3A 2X4SB 2VW6A 5J6SA 3MPCA 4J3VA 1AQDA 3T1FB 3K6SA 1EXHA 3CZFA 4KY1L 1AR2A 1NCDL 2ZONA 4HUUA 1E9OA 2XV3A 3V2AR 4AQOA 3K72A 4L5FH 1R3LA 2BRQA 3G5VB 2NNCA 4FNUA 4J3OD 5GS2H 2A4CA 5ESVA 1GJIA 3PJNA 2O26U 2J5WA 1AMXA 4LNVA 2E6JA 4PV1C 5LVEA 3HIZA 2WBJC 2ED7A 5TDOB 5K69A 1NOLA 4AMKH 1WIPA 2EUZA 2Y6TE 1KC5H 2CIIA 2OMZB 3BAJA 5CMAA 5LBSL 2F08A 5D2LA 3TZVB 5JLZB 3UAJC 3K6IA 3N41B 3UYRL 4FZEL 3GSQA 4UZSA 5MENB 1NDMA 1AI1H 1P53A 3F7PC 5E95B 5IB2B 1MHHA 5F96L 5BRZE 2HN7A 2ENJA 4X4KA 2Q20A 5D2NB 5DD1H 1MCRA 2E76C 3DYPA 4TS6A 4MJIE 4FA7B 2Q10A 4R4FH 3F3HA 1QRND 4OZ4B 4UTAH 1QSVA 2XUWA 3BHBB 1ODAA 1JPST 4O2EA 4KDVA 4RDQG 1P1ZA 1U95B 3TBTB 4WFFE 5JHBA 3BFWA 3D5OF 2B08A 4XN4A 4ODWA 5IVXF 4RMVA 3NESA 2J4WH 4ONHA 1E67A 2DMHA 4Y16D 5DHYA 4M62H 3L2LA 5C0AD 3V4VA 4JKWA 2R4SL 4TTDD 4K3GA 2Q87A 2HN7B 2BERA 2YN5A 4GW4A 3EYFB 3RZCA 1BOGA 1MJ8H 4JFPB 3OR7A 5IFJA 5GS0C 2D4FA 2N7SA 3R1GH 1AH1A 1JMZA 1I9RH 1OP3K 1G7IB 3NZ8A 3ML9A 2DWDB 4XBGB 5E2WL 3QJVB 1NDGA 1H3PL 1BBJA 1N18A 1QWUA 3PL6B 4FKEA 3FQUA 2UZXA 4K73A 3GNMH 1ZVNA 5D93C 1E3ZA 5F9DC 4DK5A 1CGXA 1CR9L 5IFHL 3L2MA 4MB1A 1HJBC 1PD1A 4G8FA 2HTKD 2JXMB 1KCUL 3R8BB 2G3ZA 3V52L 1X7SA 2PNDA 1MFNA 2WKOA 3FBKA 4LRNH 5EO9B 2X5PA 1U8MA 3MRKA 4JAMA 1OF0A 4WDIB 3SKNB 3ABZA 1JXGA 1JYVA 2L4OA 4LHJB 1HL8A 3GRWL 3P0YL 3BDYL 2SEBA 3T5WA 4L2LA 4NM8L 5JXEC 5FA3B 3Q6GH 4HIHA 3C87A 4IGBC 3VFVB 1ZGLB 3WKYA 4HSQA 1IE4A 1NINA 1T7WA 3NFPB 2X0UA 1GGCH 1NGWB 4N2IA 3QHZH 4C4KO 2D7MA 3T09A 5DT1H 3RB5A 3D12B 2ADFL 4FP8L 3AS3A 4E41D 2F5AH 2R2BB 4XMUA 3K80A 1I1AD 4M62L 2AJZA 4UIMA 3MRJB 4PV8A 4Y4HA 2RR3A 4GIAA 2H1LM 4I87A 4NWTH 4TSBH 4TUKH 3WIAA 4ABUA 3ATDA 4PRHA 4AW7A 3HRZB 3WN5A 1SUJA 3PDDA 5D1XB 4U1IB 1YNTA 4XPHL 1ZRUA 5CNHA 5A2JH 4JFXA 4OLVH 1PTZA 5F72S 5A3ID 2XU9A 4FHJA 4BH7B 4HWBL 5BVPL 2H1PH 4OY9A 3QXDB 4LHUB 4MNQB 3NVQA 2HFGH 4YN3A 1PJ9A 4JQIL 1K3IA 4R90L 2WO2B 4HLEA 3L3KA 4BE5A 3LQAH 3K2MC 4NZTH 4UDTA 3O9WC 4E42A 1CD0A 2AERT 4GG6A 2HRGA 4N4YB 4P4KC 3AW5A 1CPUA 4GKSB 2DQCL 1SJXA 2VDKH 3MLUL 4OCYH 4XMXA 5LWYL 1GYUA 1AACA 3L3DA 4XC1L 4Z7QB 4W4NA 5CFAA 2BXYA 4PS4L 5ACZB 2P7TB 2ZXGA 1N2RA 1R34A 1CFBA 3EZJB 2NY7L 3SIKA 2CHNA 2OS7A 4BQ6A 4YHNB 3NJMA 1E6OL 4F91B 3PGFL 3SKOA 1MI5B 1KCSH 3GMOA 4F9PC 3CLFH 4XX1G 2FO8A 1JD9A 2WVSA 3FMGL 4YXHL 1RFDL 1LO5A 4N20A 5FYKD 3UP6A 4TVSa 1DQDL 4RSVA 1L0XA 1GJWA 1NUFA