4Y2LA

Structure of cfa/i pili major subunit cfab trimer
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
147
structure length
147
Chain Sequence
HEKNITVTASVDPVIDLLQADGNALPSAVKLAYSPASKTFESYRVMTQVHTNDATKKVIVKLADTPQLTDVLNSTVQMPISVSWGGQVLSTTAKEFEAAALGYSASGVNGVSSSQELVISAAPKTAGTAPTAGNYSGVVSLVMTLGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CFA/I fimbrial subunit B
publication title Off-pathway assembly of fimbria subunits is prevented by chaperone CfaA of CFA/I fimbriae from enterotoxigenic E. coli.
pubmed doi rcsb
source organism Escherichia coli o78:h11 (strain h10407 / etec)
molecule tags Structural protein
total genus 17
structure length 147
sequence length 147
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-02-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2040 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4y2lA00
4Y2OB 4Y2NA 2HB0A 4HJIA 3VACA 4Y2LA 3F84A 3F83A 3F85A
chains in the Genus database with same CATH superfamily
4NM8H 1E67A 4KC3B 2I9LB 3TFKC 5A43C 1KEGH 5LB1A 1NKGA 4F7KA 5EDSA 4A63A 1RKRA 2BHZA 5CBAA 3CDYA 3CLWA 5DSCA 5ABAA 2EILB 1F41A 3B43A 1EA9C 3H9ZA 4ECNA 1DDHB 1SMOA 3VXMD 3ARYA 5E9DD 5KVGE 3WTXA 3FSAA 1EXUA 2XWCA 5ANHA 1MWAB 2EDMA 3LKRA 3GZOA 3KYKL 4ZMWA 5I0VA 2B59A 5DO2D 1IQWH 3HB3C 4XP4L 1UWGL 3B34A 1J0ZA 3UGUA 2AV1B 4OZGF 5ESVA 1KF9B 5C0AA 4P5TB 4FXGC 4I4WB 3QDAA 1VGEL 2F8OA 3M7FB 5DQDL 3OXRA 4LCVA 3SDCA 6FABH 1CLOL 3MRRA 5IVXA 2Y7MA 3VD1A 3KPMA 5HY9B 1QNZL 5IG7B 2L7JA 5L9DH 5JPNB 5T5FL 1K3ZA 2GTWA 1EAPA 4HW6A 2UZPA 5DK0B 4KGLA 4Z7UB 5EN3A 2Y23A 3K2UL 1J0YA 3TF7C 3RURA 1N8OE 3MLWH 1JHLL 5EPMA 1QW8A 2V2TB 4C56E 3ARQA 3R8BB 5DHDA 2YKLH 4HD9A 3MJWA 1CD1B 3QFJA 5IMKB 3CE1A 3M86A 4NQSB 2IBZY 3HLAA 1MCIA 4PREA 2OW6A 2UUDK 1FAKT 2KBGA 2NY3B 1HEZB 1GL4B 4AC4A 3HE7A 2Q2LA 3X14B 5E00A 1QR1A 3MA7A 1DYZA 4XP9H 4PRAB 4TXVB 4X98B 2UY6A 3EFFA 3EFOA 1KGCD 2QV4A 5IF0B 3HZMB 3RAJL 4HEPG 3IJSA 1QZ1A 5DVNA 4JY5H 3HPLB 4ZOAA 5F1OB 5LGJA 1PZ5B 3MV8E 2XZQH 3DV6B 1HAWA 1MIML 1B6DA 1ZRUA 3DV4A 4HZ1A 3OSKA 3PRZA 5D7LB 3PIQA 1TZ8A 3OAYK 3S48A 5CLTA 4GT0A 4FEIA 4DO5A 1AHWB 1OGSA 3VFPB 4CADB 1H8OA 5AZ2L 3ULUL 2XV3A 1ZTMA 2FJHA 1NCJA 5D72H 1DANU 1U21A 4QRFA 4JKLA 4Y2DD 4OZIF 1N2RB 3Q44A 5KW9L 2ALAA 3TVMA 3BUYB 4ABVA 2IAMB 3ZR6A 1NANI 3LOWA 1UZ8A 2W9DH 3GMLB 1Z5YD 4L0PB 2G75A 5C0BD 5E4OA 2BC4B 1U8NB 4FADA 3FH8A 2ARJB 1RAMA 4QJ3B 1BSIA 4ZFOL 3NSJA 4UAOC 1BFSA 2HA1A 3O11A 3FRUA 4K3DH 1F3JA 5TE6L 4XB7A 1PZUB 4P9ML 4YDKL 4AQEB 5IQNA 1PEWA 3KGTA 3TA4D 5IV2A 3EJYD 4HC1L 5H2BA 1G9NC 2P5PA 4OZ4A 4EIBA 5PAZA 2D2CC 1B9KA 3PWUB 4OQTA 3BWAB 2WB7A 4XOAA 3VXMA 5E9DA 1MCHA 1E40A 3N43B 4JCLA 3VXRB 2NUTA 1AI1L 3VXQB 4EMZA 2OMYB 4J3TA 5AZUA 1A7RL 1X9RA 1MDAA 5I16A 3JWDL 2WYTA 5GGUB 1OAZH 3MX0B 2N7AA 3FH7A 2YQ3A 5F7NC 3L6FB 2MOVA 1JGEB 3FPXA 1OCWH 1UEYA 3RI5K 1H0DA 1NZRA 4F8OA 2MPAH 3N85L 5FYKE 3UTSD 1EZUA 3KLKA 1CICD 4P9HH 2AV7A 5AAWA 5JW3H 5B7EA 3CMOL 1TETH 4GLRI 2WLLA 1JV5B 1WBXA 4EN3B 5B38A 4DP9X 1CGYA 1P4IL 2F19H 4QO1A 4XR8C 3RY5A 2ZP9A 2X0UA 1E9QB 4FFTA 4YVNA 3WFZA 3KWXA 1IGFH 1HQRB 1ONQA 3T8MA 5JIPA 2X6AA 1U8OA 5DUBB 3PP4L 4GKNA 5DD5H 2VJ0A 3MOAH 4AV5A 1JOIA 5JR1L 4TQEH 3RIFK 4M6MH 3B9DA 4D9RE 1NLBL 5FUZL 2I7OA 1S7SB 2EE2A 3VDAA 3UTTB 5IHBA 1TTBA 3AG3B 4BFNA 1J8SA 3VFOA 3KVQA 3W56A 1WFUA 5IJCC 3ARTA 3LEXB 4LSRH 4AM0B 1FO0B 4QHLB 3QIUD 4WW2A 3OTTA 4HJ0C 4C54A 1IL1B 2XVBA 3BVNA 1R3JB 1W2KT 2X10A 2A6KA 3N04A 4AW7A 4DP2X 1YQVH 1AD0B 5J3HC 4JQVC 4ANKA 1NBZA 4Q2ZA 5I6KA 1R33A 4MNQD 5AWNL 4LDLB 2E0PA 5CSZB 1AXTH 2X4TA 4IBLT 3UBXB 1Z5LB 2B5IC 4B3VA 1S46A 4JHAH 4QDGA 4U2YA 4DOHB 3VXTA 4DTGL 4R26H 5FYLE 3WS6A 4HXBH 5E2JA 2XKSA 1YMHB 2YJQA 4PJDB 3L4UA 4Y2DA 4FQJH 4XNZB 4UQAA 2AJZB 1BOGB 4UAHA 5ICXA 3IKCB 1T03L 1J1XH 1V3LA 5EF3A 1SEBB 3K71A 4AXWB 3VI3E 2VISA 1RZFH 3NCMA 3F04A 4PJIB 4C8XA 5M7QA 1R47A 1FNSL 1MRCH 1MFDH 3AWFA 5C0BA 1N8ZB 4PWHA 4UT7H 3TNMA 5J1AA 4M62L 3IBOA 1NGPH 1O6VA 2ZP8A 3TLRA 5IFHL 4LVOB 3P4MB 2V2XB 1BF2A 3P69A 4KZCA 4R83A 4PLJC 3ATBA 4C56B 3AREB 4LLAA 2VQUA 4JRFA 4U05A 5CZKA 5FDWA 4YUEL 2WNGA 5KAQG 1E4WL 1V7NH 3PAYA 4ZMPA 3GT6A 1PSKL 1OE1A 2W9EL 1MY7A 3O2DA 2WXMA 2ZX7A 4YDLB 3DMMD 3NJHA 1T80A 1A0QH 3LH2H 1SOSA 2F1BA 3P0GB 3RPIA 3Q9QA 5KYYB 2YMTA 5GGRA 2H9GA 2ICEB 3D25B 4BGLA 4OZIA 5E5MB 4ELKA 2IWFA 2ROYA 3ABLB 4L29A 5D96C 5JW4M 4A7GF 3OZKA 2BWQA 2UWEE 2WXIA 3JQOB 4A7SA 5IJKC 3NZSA 3FSZA 4IS6A 4TNWF 5DMYA 3MV8B 1WLHA 5BO1L 1K6QH 5JA8B 4MA8L 3LN9A 4JKNA 3IGLA 1SOXA 2VITA 2D03H 1TSRA 2HKFH 4D9QD 2N1KA 3HFML 5AW3B 3STLA 2EXYC 3FFCB 5DGRA 3T0EC 3UTSA 4RA3A 2YPVH 1OPOA 2KT6A 2ZWKA 4OFPA 1CICA 2KKQA 3BPLB 1C5BH 2MNUA 1A6AB 4MWFB 1ZS8A 2V33A 1R19A 4PJCB 3T2PA 1I9IH 2W94A 3QCTL 1WITA 4NBYB 5IVZB 4B9PA 1IGML 3BGAA 2C8NA 1IAMA 2QBWA 5HTSA 4HJGA 2BH0A 4BIKA 1MCDA 4LASH 3FT3B 1JFHA 2QSCH 4XN2A 3BLPX 1K4CB 3MRPA 2AJXH 4KY1H 4NXKA 4GFTB 1ZSDA 4KKLC 4YXLL 3B1TA 3HMWH 4CW1B 4FNSA 5ID0B 5JTWA 1ZGLB 1TEFA 1KXHA 4C57C 3JWNE 1U8PB 4U1KA 1MCKA 2VIRA 4JPSA 1B90A 2NXZB 5EULV 3RWFA 3V6FA 1X4XA 3W11C 1U8QA 5LLIC 1BLIA 3BP6B 2WCPA 2DBJA 3MRFA 3MRNA 3QIUA 2Q8AL 1O5DT 4LOEA 3I6KA 5LQBH 3ZE0B 4OF6A 1ZA6B 3DC0A 1JDDA 2BNQD 1RK0B 4M3JA 4R6UA 2ITFA 4KK9C 3EYFA 3UYOD 4K5MA 3WJMB 2VR7A 1B0GB 3EJSA 2PO6B 1IBGL 3QPKA 4MNQA 3RVWC 4KUZL 3TX4A 1JNHA 3DRQB 3IGUA 2F8XC 1VIWA 4PJFB 5EU6B 4E9VA 3BIKB 3DWTA 1TLKA 1OCRB 4Z7OE 2PWDA 4OQTH 1PEZA 5BW7C 2KQMA 1BIHA 4MB3A 4XODA 1ZLVK 4ESKA 3TIDB 2HUHA 1INEH 4AV0A 2ZIDA 3JWOH 5FA4A 2P7TB 3CVHA 4JMXA 4H4NA 1F4AA 2XXCB 3MA9H 1A4CA 1D5IH 1OARH 2J71A 1F4HA 1HH6B 2NY3D 3EYQD 1TPXB 3QDME 3H7BA 4UQ3B 1HS6A 4JR9L 3AW5A 1PL3A 1XGQB 5ICUA 3VSVA 4YHZL 1T5XB 3P73B 4DP6X 3H2QA 2D31B 4OKVB 3U9WA 4OFDA 3PGDB 4XN4A 4HHAA 4KVCL 4N9GB 5IB3A 5AEAA 3EGXB 2E9BA 3NZHH 4LBEA 4D0BB 2XIBA 3DMMA 1FDLH 2ADIA 2BDNL 3CN4A 4QY8A 5CUSH 2VWEC 5F21B 4NC0B 2AXGA 3K2KA 2C3WA 1Q72H 4WTWA 2W60A 4HUUB 4GSXA 2VE6A 4PW3A 5I1EL 1IE5A 1SYVB 2GFBA 5D7LD 2OJZH 3AWEA 3PL6A 2EH8L 2P8MA 4HKXA 2ZCHH 5EHFA 3MODH 3H7LA 4X7TB 4HOXA 4C83A 4WY7H 4A39A 4QXTA 4HGWB 5IQ9B 4PJBB 2K6YA 2EIEA 1EO8L 4K8RL 1FE8L 4XNYH 1DFXA 4ERSL 2DLTA 3LDBC 4BCYA 2KHAA 3GMMA 5IROD 5E8EB 4LDOB 5KS9E 3VI3B 2ZXGA 4IBWA 2GSIB 3CHOA 1ZXQA 2FLBT 2I9LA 2FGWH 3OKNB 4JRLA 2BINA 3FBKA 5T3XD 3APNA 4PPTA 2A83B 1DDHA 4P2AA 4MJIE 1YEJH 2KLRA 5DQJB 5IOPB 3VXRD 2IGLA 4TUOA 4JB9L 1MWAA 2R2EB 5E1GA 4J3OD 3PNWA 3QHZL 3BSZA 1CYXA 4IRJC 3SQRA 4B7LA 2B8OT 2YD5A 2AV1A 2MCPH 3CDCA 1LE5B 2BNQA 1OP5K 4P5TA 1IC7L 3GEFA 4I4WA 4DH2A 4OF0A 2BY3A 4LSSH 4WI5A 2J5LB 3DIFB 5DZVA 2G5BA 4J1UB 2ADGA 2FJGB 1ET8A 3EZJB 1NM9A 5HY9A 1ZT4B 3KEHA 3R1GH 4FAAB 5IG7A 4U3CA 4EN3D 5I1CL 4W4OA 4BE5A 3G9VA 1U3JA 4YAQA 5JW4N 4ODVL 5JPNA 5DK0A 1XZ0A 4Z7UA 3CLEL 4TPRL 1TJMA 1ZLUK 1A3QA 2TRYA 4XC1H 5AOMA 1IEBB 4Y9GA 4FYSA 4KMLB 4LMQI 4X0NA 1EO7A 1KYAA 2V2TA 4GP5B 1CDCA 4JZNB 2CKBB 5B7MA 1JXFA 3O2WH 1SJEB 1CD1A 2VSDA 4NQSA 3UTTD 3KLQA 1T1YB 1KJ2L 3HI5L 3HAEB 1I4FB 4PWIA 4H8WL 3X14A 1RUMH 1WCQA 4WI0B 1INQB 4NWUL 5J6HB 1GY2A 2NNAB 1M6UA 2B16A 4PRAA 1MJUL 3Q2CA 1BQHB 2BSRA 2J8UE 4NKOB 3RGHA 2ZF9A 4LGRB 3L3OC 1JN6B 2AGJL 3K2MC 3HPLA 4EO5A 1PZ5A 3QIBC 1A9EA 2YRZA 3DV6A 3UCQA 1IAIM 5B1CA 4AY0A 3GSQB 1TTAA 1IJNA 5D7LA 4NRXB 3KJ4C 4GXVL 4L4VB 3DX7B 4TRPL 1AHWA 1R34A 2D7OA 1N64L 3FB6B 3QDHA 4G3YH 5ITFB 3VFPA 4CADA 4QI3A 4B0MB 1GIGH 3M07A 2WBJB 5FO9B 1QR4A 1N2RA 3AQZA 2WNKA 4GJTB 4I7ZC 4UT9A 3VXSE 4F7PB 3BUYA 3HZKA 1XF1A 1PZDA 3PWJB 4LDEB 2QKSA 3K6SB 3GMLA 2C9UA 3I02A 4Z7OB 1B6UA 1GGUA 2NY1D 2ZOKB 4E42A 4TF4A 1BFTA 2XWXA 5E08L 1I1AC 2ARJA 5GRJL 1G7MB 1S3RA 2CIIB 4KOBA 5IROA 4C56D 3WAKA 2JJVA 3MRJB 4HQQL 1REIA 3EJTA 4AQEA 5AB9A 1FBIL 3HC2A 1J0IA 3QDMB 3VJ6A 5FEBA 3DSNB 4OAWB 3U82B 1AQKL 3V4PB 1TZHA 1L7TL 1ED3B 2G2NA 3TZVB 1CL7H 3PWUA 1T89A 1JZFA 2FRGP 3WS3B 3BWAA 5C6WH 2LAGB 1K2DA 2EH7H 2VN6A 1NDTA 3E2HB 3F85A 3VW3H 3VXRA 4Q4EA 4XOCA 3VXQA 1MJ7L 2OMYA 4QRRE 3IMSA 2JJUA 5C0IA 3UJIL 5GGUA 5ICYB 3MV8D 3C6LB 3L6FA 3D34A 1JGVL 1JGEA 1ZCRA 3KH3A 4HIPA 1FI8C 2ZOTA 5F88A 3RLSA 3T04D 4ETQB 2WKGA 4F7TB 3FH5A 2OTWA 3KS0H 1IV8A 1NMAH 1T0NB 2QZ5A 2BERA 3FFCD 4QXVA 1A7QH 1FJ1B 2FBOJ 3W57A 4ZFFB 2ZCLH 3OMNB 3W5MA 4BSWB 5E1AB 4CKVX 1ILSA 1JV5A 4EN3A 3FUHA 4KUCF 2O93L 4U0RB 2E76C 2FEDC 4UYPA 4DEPB 2FEEL 4XNUL 1E9QA 4F24A 1ZD6A 5JUEH 4Y16B 3UFIA 1HQRA 5EB9A 3SJVE 1BGXL 1G1YA 5MERB 4ZW5A 4X0KA 5F6HJ 4HVBA 5KS9B 4XGZA 1RP8A 3ORJA 1Q9OA 3V2AR 4ZPVB 1YRKA 1F8TH 2I27N 5I0YA 1S7SA 3TWCH 1VRSA 4JHWL 4YGVB 3UTTA 3CDGA 1FG2B 4LVNC 1CU4L 2LQRA 2NXZD 3SQOL 1DBBH 4X5QA 4BK4A 1CBJA 1NPJA 4XAKE 3VFTA 1JPTL 2FNWA 4K7PY 3LEXA 5BRPA 3WEOA 4AM0A 1FO0A 3NVQA 1BPLB 3NYKA 4MJIB 3VM7A 1IL1A 3KYMB 4U3SB 1MQKH 1R3JA 2DYRB 3U0WH 1A6TB 4X80L 3DOHA 3K2IA 4ETYA 1KOAA 2F18A 4X9GA 2V17L 1EFXD 4P2QE 3ISYA 2EC9U 2P49B 3PXJA 2Z8WC 4CDGC 4XVSL 1R0AL 1XEUA 5CSZA 3UBXA 3P0VL 3O9WC 5IZ7A 5EU6D 5FYKD 1EK3A 3FL7A 3RX5A 3LZFH 3X12B 1JDAA 3KHOA 4MS6A 2G4GA 1YMHA 4PJDA 5GRVK 4PRPE 3QFGA 1S7RB 2AJZA 1BOGA 2XIIA 1TG8A 4I13B 1SXZA 4V33A 3CBJB 4AXWA 4CJ1A 4PJIA 3BSZH 1BF5A 3WDIA 4QIRA 1ZT1B 2F1AA 2KZKA 2V2XA 4C56A 1CR9L 4TTDC 4HCRL 3T0BA 3ZX1A 1S3KL 2D7MA 1OL0A 2C9SA 4TTGA 2IO5A 3D5OF 3QUMB 2FQDA 4CNIB 3UYPB 3ULUE 5IFAL 2OTUB 3VU1A 1HHIB 3OWEA 1SZNA 5A2BA 5KYYA 2GK0B 2ICEA 3VI3F 1I8LA 1TEGA 4R4BB 1AZRA 2MEJB 5E5MA 1F13A 2CD0A 2J8UB 4AIOA 4O58L 2WO2B 4LLQB 3NRQA 4W9FC 4Q9QH 3RWHB 3CZGA 1UHVA 3BZ5A 3OV6A 3MV8A 3NZUA 1XCWA 3AJ7A 3N41B 1CZ8H 3NH7H 1HU8A 4X5LA 4NZ8A 3ZE1B 5L4JA 1EBAA 1TVBA 4XPGH 3V7AE 5M95B 4YDVA 3FFCA 1YYMH 4N8VB 4YE4H 3HKFA 3NJMA 5D4IA 3I6LE 4DGYL 3OR6A 4ZNCD 2AHIA 4O5LL 2O6DA 1A6AA 4MWFA 3TV3H 1VPOL 4PJCA 1PY4A 2UWEF 3FZUC 2XWRA 5FHBH 3WNNA 3PXLA 3FFOA 2G4EA 4BK5A 2BHUA 1SGKA 2QEJA 3RY6A 1M9WA 1BZDA 1Q9KA 1ZXKA 2WUBL 3FT3A 1YEHH 3FSVA 3KXFE 4AEEA 2NY5C 1AG0A 4Z1PA 2K8MA 4LZKA 3SE8L 2B4CL 2EDOA 3AMKA 3KDPB 4MD0B 4CW1A 5CEXB 3Q6FB 1I75A 3ECBB 1JD9A 1XQ4A 3UAAA 5ID0A 1ZGLA 5EWIH 5HI4D 3TN0B 5DK2A 1U8PA 4RGOL 1RCYA 2MKLC 3QEUB 3GM0A 2EIJB 1L0XA 2WCSA 3BP6A 3V5KB 5CD3A 2XQYG 3T2OA 4X5PA 1ZJBA 3X1FA 1DCEA 5D5ME 4Z18A 4ZQTA 2ZG3A 3L5XL 2EDKA 1ZVSB 3BAKA 4AYFA 3NOIA 2VM9A 2F7RA 1U8KA 2WWMD 3LKNB 5CJ8A 2IH8A 2JJTA 1MDTA 1DQQA 2AQRA 3NEXA 1EFXA 4BQ8A 4P99A 3WJMA 1B0GA 1AXSB 3UC2A 4EOWL 4ZTOL 1EXHA 5ACZB 1F3DH 4LLVA 1HILB 5AVXB 2VN4A 3ARWA 4PAZA 3DRQA 4YC2C 5JXAL 4PJFA 5EU6A 4DQAA 3IGKA 3OC5A 5HDWA 3MAWA 5KSBB 4JRYB 4PTUB 5DDHB 1ZA3A 4QRQB 5CGTA 4DAGL 3KHQA 4KK8C 2L7QA 5C7XL 1PF3A 1PMYA 2HRLA 4DO4A 1R3IH 2XG4B 4GKLA 2WQXA 3TIDA 3E6FA 2CCLA 3V5DB 4KRLB 2P7TA 3S98A 3RFRA 1MCLA 1FH5H 1HH6A 4UQ3A 4XTRC 5SWSE 1UM5L 3DK0A 5DD3H 3VI4E 3DPBB 3SOBH 5K39B 2QZQA 1XGQA 2H2SD 3P73A 4G7RB 1A3LH 2F58L 5ILTL 2D31A 3TS8A 4IMLB 2K3HA 2NR6D 3PGDA 4WWKB 4N9GA 1LVEA 4H0HB 5C08E 3EGXA 4Z7OF 1U8HB 1A7OL 5C3LD 2DD8H 1WHPA 4AIEA 3R0MA 4UV7H 4OLEA 4JG1L 5FAAA 5HGDB 3QA3A 2L7EA 4G8EB 4XVUC 1J5DA 2VN7A 3DX1A 3PAZA 1CFTB 4HWEL 4QRSA 3T08A 4IOSD 1HJCA 4HUUA 4XO8A 1TZIB 2IF7A 4GMSL 1SYVA 3U9PL 2EVJA 5H94B 4G6ML 4L4VD 1PLGH 3HPJB 1KG0B 4W9KC 3NK3A 4X7TA 3DUUB 2WBJD 5FA3A 4XH2B 1AQ8A 2CJ3A 2WMPB 3FO0L 3PQYB 4HGWA 5CLZA 4PJBA 5IQ9A 2X6VA 1SEQL 2F74B 1OQXA 3F7KA 1FO0H 4NENB 1M05B 3C12A 4OD1H 4JJHA 3UABA 5KVGH 1F4WH 4MVBD 2MH4A 3KLDA 3NCJH 3KMDA 2ORBL 5E8EA 1OTUD 3VI3A 2VDKL 2I60H 3GFUA 2GSIA 3L1EA 5GGSB 1JNLH 2BNRB 4X99A 4CDHA 4QXGH 2R9HC 3D2TA 4TNVF 3OKNA 3QDMD 2N7SA 3OJDB 1PZBA 1JGIA 4ZO9A 4EBQL 1WEJL 4B9KC 2R15A 3QXAA 4XNQB 2WLJA 5FKPB 5IMLA 4ZFGH 4TVPL 4GO9A 1UXSB 2QADB 5DQJA 3G5VB 2ZX6A 2ZAGA 4XB8A 2F5BH 5DJDB 1BQLL 2R2EA 3KM1A 5KS9F 2QVMA 4NO5B 3C6LD 4JPKH 5F96H 3GHBL 4FL4B 1BAFL 1LE5A 4JO4H 4MNGE 4YX2H 5LXGH 1IGTA 4JEGB 3HUJE 4UT6L 5F7EL 3VE0B 2C5DC 2APSA 4J1UA 4JO5A 3PDDA 5CJOL 1U3YA 5G4MA 4GQZA 1AR1D 4OLZL 1ZT4A 3GMPB 4G71B 4WKXA 3IMWA 3N5AA 5HI5D 3PYCA 1JZ2A 3CN2A 1OVZA 1KLFB 5HI3D 3B2VH 4K55A 3L9YA 3FRPA 3I9AA 3QAQA 3DLQR 2A99A 3U1SH 4JO2L 1IEBA 2F5AL 2WN2A 4LT7A 2H0JA 4HOWA 5IQOA 2AAVA 2W92A 2IDQA 2CKBA 2VL5B 2QT6A 1Z0MA 3DO4A 5B3SB 1YEFL 5BVPH 3ZSSA 5C0EB 1SJEA 4OCXL 3VGBA 4ZI8A 1BMWA 3HB3B 3HVDA 1T1YA 2V9TA 3L48A 1RK7A 4FXGB 2HG0A 4Y4HC 5IESH 3TP4A 1INQA 3ZR5A 5B38G 5J6HA 1A4AA 2NR6A 4MJID 5F70A 2WJ5A 5HJDA 4NKOA 1KGUA 3BYYA 3O6FC 2LT9A 1FFRA 3ZRFC 5FECB 4QCIB 1JN6A 4LSUH 5HYEA 2N0KA 2DQUL 2OYMA 1QLFB 3NAAH 1R75A 1ZIAA 4WFFD 4KNQA 3I9GH 4IOSA 2HVKB 3IDXL 3GSQA 3DJSA 3FN0L 1IT9H 3ZU8A 4NRXA 1CTNA 4L4VA 3DX7A 2Z4QA 5CILH 2FECI 2PTVA 3BAEL 5ITFA 1AAJA 1U95B 2YPKB 3GSNH 4IBSA 2WBJA 1V3KA 5FO9A 3ZKXC 4AVJA 1L3WA 1A6VL 2CXKA 5E2VH 3SODB 4F7PA 4G6AC 5L4IA 3FSWA 5HHOE 1KENH 3K6SA 3R06A 5E9NA 4IEFB 4P4KC 2ZOKA 1EHLL 3C6SB 3M7OA 3QCVH 5I71C 2Q86B 1G7MA 5IIEB 1ADWA 3D87B 2NTFB 1U6AH 4UINH 4NQEB 2GHZA 2W88A 2X2YA 3MRJA 4R96B 1FFQA 4UNTA 1M71B 2C9RA 4Y9EA 5F0MB 3QDMA 4FN0A 4EUPG 5SWSB 3DSNA 4OAWA 3VI4B 3QNZB 3V4PA 4XN1A 1E5AA 2PXYC 2V2WA 1AZBA 1C5DB 5HGGS 3LIZA 2EDQA 2XWEA 5I8EB 4G7YL 3WS3A 3DGGB 1YY9D 1SFDA 2BFVL 1QEWB 1CB4A 2D3LA 4JHBA 4KDWA 1OE2A 4MS8D 4UQBA 5ICYA 2E7LA 2ZXEB 3C6LA 4QTIH 3LPGA 4UIMA 4PH8A 4ETQA 4F7TA 1L7IL 1S5HA 1IZJA 1FVEB 5DJ0B 4UAOB 2IFGA 1O9ZA 1PTZA 4TUKL 3KBFA 4ZFFA 1FL3B 4BSWA 2Y1VA 2EUWA 4PP1D 4H40A 4PGZA 2AKRB 3MV7E 1HEHC 3CBKB 2BP3A 3ECQA 3CIQA 3SDXE 3RZCD 4KAQH 2APTA 2DWDB 5BVJB 1VCBC 3PAUA 3ZYJA 1RPUA 3LQAH 2DQTH 2H1PH 1MHPL 1ZE3H 5MERA 4Y4KC 4QRPE 4XPTH 5CIPA 2NY2D 1KCWA 5KS9A 4PTTB 1YEGH 3PJLA 3REVA 4ZPVA 1MI5E 1MLCB 1QSEE 1TQBC 3SPHA 4FI6A 5I18H 1BZ7B 1GJWA 3TN0D 4YGVA 2B39A 1FG2A 5FB8B 4BQBA 3TIEB 4X9YA 3RWIB 1MRFL 1Z5HA 1ESOA 5DMIH 4JG9A 1TJXA 3LJ3A 3SE9L 3C09C 2YMOA 4KMTH 5T1KB 4MJIA 5FYLH 3F83A 3WO3B 3KYMA 3UC0L 2FQFA 1XV8A 2BPBA 1HHGB 3FQ1A 5EC1B 5I30H 3GMNB 3PUUA 4IOFC 4RAHA 1A6TA 2QHRL 1E8ZA 3MLRL 4QRRD 2W8CA 5E99L 4H44C 4RA0C 4P05A 1ETJA 5AB0A 2EKJA 1HESA 1XD0A 2AJ3B 4M1DH 4X6EA 3C75A 4ZQKB 3DXAE 5AVQB 3CZFB 4IK6A 4WHDA 2GSGB 3GMRB 3A6BH 3FJTA 3DECA 3X12A 4GYBA 1YC7A 1P69B 2QPUA 1S7RA 3B1UA 4CVZB 1IEHA 2WAQA 4FJZA 4ILDA 4ABUA 5HHQB 1MAMH 5HDQH 4JO3L 2AEIT 5IVOA 5K1NA 3U0TB 1SUJA 1ZT1A 4CSPA 4ALAH 5EEZA 5GRZA 1B4LA 3S97C 1ZJAA 4JW3A 1KC5H 4QYAA 4G7SB 4GAGL 1F02I 4DT2A 1QLEB 2L4OA 2WIMA 3H8NA 3SZKC 4A2FA 1E8XA 2AEOA 3BJ91 3IMVA 4WWKD 4AYMC 5LG6A 3QUMA 4P2YA 2WSPA 4XAKD 4CNIA 1PZAA 5K69A 3UYPA 2B5IB 5AW6B 1HHIA 3L5IA 3WI9A 5JW5B 3BCDA 1EZSA 3J27A 4R4BA 3L3IB 4DCQB 4OJAA 5I82A 2J8UA 3CHSA 1E2WA 4CBZA 5FUOL 4PRHE 4LO9A 4F2FA 1HDMB 2Y36H 4P2QD 5IWLA 2FO1A 3FUFA 3V9FA 1J9RA 1ID5I 3CUPA 3U4KA 1OCCB 3MLZH 1UT9A 4N8VA 1F90L 2NY7L 3IU3B 1DQDL 3RGVB 3ULUF 4Y5VC 3EO0B 4AGMA 2F68X 5CCKL 4GRMA 3WXVL 4F57H 1O7VA 3MU3A 3F8UB 1G84A 4JLRB 2EDXA 2EDBA 1OANA 2F08A 3L7FB 4BRJA 3RZCA 4C4UA 1M1SA 2KERA 2QGDA 1XBDA 4G72B 2BNRD 4E9RA 4J4PC 1BA9A 2MNJB 1NAMA 1MIEL 3QUXC 3TWYA 1ZANL 3NA9H 3QJHB 5D96B 4NM4L 4H1LH 3V52H 4F27A 1E5CA 3JTSA 2LV4A 2DS4A 4MD0A 3ARXA 3ECBA 3Q6FA 5D1XC 3HNSH 4O2FB 3TN0A 4GY4A 2HFGL 2QADD 1UJ3C 1AFVH 2VQ1B 4RIRB 3HZVB 4PMEA 3QEUA 2R4SL 3T1FB 3T0EB 3QJUB 3V5KA 3JXAA 3QZNA 5FW7A 1YN6B 5AW4B 1J5CA 1OP3K 2CA3A 4HWBA 1PIFA 1TZAA 2VLKE 5C2BH 4QRRA 1ZVSA 1X7SA 2LE9A 1NDGB 3LKNA 4HDIA 4RMBA 1SHXA 4GSDH 3T4AA 3VXUB 3FQYA 1AXSA 2V0AA 3NA4A 1N4XL 2ARWA 5ACZA 1IEAB 3PY9A 1HILA 2OS7A 3SGEI 1GKEA 3L13A 3CC1A 4PTUA 4X9BA 1I7TB 5DDHA 4APXB 4TOYH 4QRQA 3LIZH 1SHMA 5D5MF 4LRNL 4WEEA 1OZUA 3GTNA 4XMLL 3GTVA 4IDLA 3UJJL 5IR1B 2R56H 4YK4C 3SDXB 2CJSA 2D3JA 2XG4A 3UIYA 2TSAA 5F6IC 3V5DA 3RDTC 2EDDA 3K6DA 2O26U 4I3RL 4XP6H 3HB3D 2HRPH 4HIEB 4LK4A 4QRPB 5FOBB 3KXFD 1XBRA 4Q9BA 1L3NA 5F2FA 4OLVH 3MCLH 3NACH 1NGZB 3DPBA 3GC3A 4LEXH 5K39A 3OX8B 1MI5B 2FX8L 3MV01 1DQVA 3WFDL 4B41A 4IMLA 3ZOAA 1S9YB 4WWKA 2VZ3A 1WAAE 5ALCL 1U8HA 3IFPB 3OL2A 5D7KE 5HGDA 3IJ8A 2HKHH 2VXQH 2HYMA 3F7PC 4G8EA 1PKOA 4U7KA 3EJCA 1V8HA 3WENA 1CFTA 1G6RH 1HL5A 3SHSA 2DQEL 3LH9A 5FCUH 1TZIA 1W72L 5H94A 5CIPH 1QKZH 1A5FL 4I1NB 5HD8D 5F44A 3VI4F 3HPJA 1KG0A 3NZ8B 2VLME 3VMPA 2ICWI 3DUUA 1AR2A 4JFEE 5D8JH 4EAEA 2VO5A 1FL6A 4XH2A 5BUAA 4NN7C 1F4XH 2WMPA 2BWIA 3ZKSD 3PQYA 1YEDA 4D7PA 4Y7MA 1VB9A 5BMFL 2WLMA 2XT1B 3CXDL 1ACCA 2DIBA 3RKPA 2Z64C 4CA4A 1L6ZA 2IDFA 4NCDA 4KO5A 1LEGA 3B2PA 4GQ9H 3MBXL 3GRWL 1HZHH 3OMAB 4TULH 4X8XA 5GGSA 4CN4A 3S8FB 2BNRA 1S7VB 1XGTA 2VZSA 3S4SB 2YD4A 5SWSD 3UTQB 5DJ8B 1CLYH 1DEEB 2X4SB 1RULH 3HHMA 3QUZC 1KTLB 4P07A 2MOGA 1B4JL 5FKPA 4RGMC 1UXSA 5MP6H 4LARH 1BP3B 4LQFH 5C08D 4OCNC 1TJGL 1WF5A 3OVUB 1JXDA 2J43A 3G5VA 4N2FA 5AOJA 1WSST 2H3NB 5DJDA 1HQ4A 1NL0L 3IJ9A 4QNPE 2BRRL 2XZCL 4NO5A 1V05A 1QX1A 1QASA 3BP5B 3O45B 3ZMRA 4BJLA 1P1ZB 1UM6L 3LDBB 2E46A 4PRHB 1NCCL 1HWWA 1EEUA 3MJ8B 3VTMA 3FOMB 4OF8A 2BSSB 4NQDE 5DZLA 2CSPA 2O6FA 4FLOA 2EECA 1SLUA 4PJ7E 3DJRA 1NUGA 3GMPA 5L7XL 1BXXA 1XB8A 3P3YA 2E7DA 1NC4D 4L0ZA 3QUMH 4PBWD 3LNDA 3L08A 1KLFA 4AMKH 3A4AA 2VDQH 1QFWH 1GKOA 4QHMB 4BFOA 5DXWA 1HYRC 3JV5A 2GEQA 3VGDA 5F7HA 4JZOB 2WQAA 1BLNB 4QTHB 2WTRA 2E74C 3HS0C 2NNXA 1TFPA 1RU9H 3HUJF 3LZQA 4I48B 3P1VA 4MHHG 1F1AA 4IRJB 2EEBA 5CU5A 2NXYC 1VSCA 2PF6A 3KXFA 1QYGH 1PFOA 1DVYA 3VNYA 3ZL4H 1UUNA 1OAUH 4HIXH 1FCGA 4BYHA 2HJFB 2D7QA 5CINH 5FECA 4JDTL 4QCIA 1RP9A 3FO2B 3CPLB 4ORGA 1KZYA 3GI9H 4V1DB 3UGXA 4BD4A 4ZO7A 3T6XA 5D5MA 4KK6C 4K71C 1NAMH 2HVKA 2NYYC 1QUNA 2ZXBA 5DYFA 3Q06A 1GC1C 2AJUH 1E4XH 2YPKA 1JFQH 3HG1E 3TT3L 5GHWL 3Q7JA 5BXFB 3QC5X 4G8AC 3BH9A 1GW6A 1U8LB 2WYZA 2X70B 2YRLA 1VEPA 2G5UA 4IEFA 1IFGA 4KNTA 3V0HA 4HJ0D 3C6SA 3WY2A 2UXVA 3GI8L 2Q86A 3QUKB 3TYGH 2NTFA 5D2LB 2BSED 4TSCL 3IWUA 3L3OB 4B9ZA 1OWWA 2DQCH 1RZGA 1EZLA 1DLHA 4ZNEA 4R96A 4UM9B 3QIBB 5DC4B 1MCCA 5J3HD 1KBPA 1NBYB 3MUGB 4QRBA 2FDBP 4YHOH 4HKJB 1TVDA 5SWSA 4WUUB 3VI4A 3QNZA 1QI4A 3SPVA 2ZKWA 2XVLA 1IGCH 2L3BA 3KJ4B 1C5DA 2MCMA 5I8EA 1W0VB 3AITA 3CFBB 2H8PB 4Q7DA 3DGGA 4YBLC 3VYPA 2ATAA 1MCBA 4TM9A 5C08A 4XPBL 2VL4A 1CD8A 2R0KL 1UASA 1M2VB 2UY7B 3HJ0A 4IDJL 1GS7A 4N3TA 4QEGA 5I8CA 1QEWA 1D5BB 1MHCB 3A4EA 1IE4A 1E5BA 1HSAB 3KYKH 3QUGA 1I1AB 3O6LL 1I1FA 1FVEA 5DJ0A 1AANA 4U6HB 3RGVD 4XPAL 4XP4H 1UWGH 3F7YB 5C0RL 4WSJA 1JK9A 1FL3A 3ATFA 3ZE2E 4K94C 1VGEH 4KO9A 4D7BA 2AKRA 5DQDH 3WHXA 4D3CL 1NC4A 2DQJL 2GI0A 2HT4C 1CLOH 3EGDB 4KDTA 4TVPE 5LBSL 1RH8A 1QNZH 1WTGT 3BP7B 2DWDA 1C5CL 5BVJA 1D6VL 3NJVA 5T5FH 2YLHA 4FFZL 4ELMB 3BUBA 3MI6A 2HFEB 2WGXA 3K2UH 3WCYA 1JYVA 1MLCA 1N10A 2MFNA 1JHLH 5K1VA 3SCMD 1BM3L 5FB8A 3GLAA 5GJTL 3RWIA 3TIEA 4AYSA 1KBGL 1RZKL 3FTSA 2EDEA 2EXYD 4FMFA 1C9SA 3T0ED 3AFLA 5KUKA 3SDXF 2JKTM 2EDFA 4NP9A 5JHLA 2A74A 5D9SB 5HYJE 2DF3A 2WXFA 1ZMYA 4FKHA 5KG9A 1DN0A 1HHGA 1PG7X 3GMNA 5DJCB 1X4YA 1XAKA 2Q1EA 3GBNL 4NC2B 5FWQA 4Y0GA 3EAKA 2RBLA 1OSEA 1XL6A 4N2NA 3UAFA 3VXUD 5D1QC 1N6QL 2QPFA 5KSVA 4MNGA 3RAJH 3FT1A 3CZFA 5IK3B 2GSGA 3HUJA 4Y1AE 4MKTA 1HZKA 3P40A 4AGOA 1MIMH 3IM1A 4Y8DC 4W4NA 2IQAB 4H5SB 2QPSA 4KKLD 4B95C 4HAGA 3HZYB 2QPEB 2V3FA 4UQ2B 1O7SA 4NHUA 2F53B 3ZMEA 5AZEL 3MV7D 1NMCC 4LVNB 5IW1B 3GHEL 1JVKA 1DQTA 4AQAB 2NY6B 3NJGA 4R2GC 5AZ2H 4WUKL 3HNTL 3ULUH 3RB7A 4B9CA 3NJFA 3U4BL 2FLMA 5JIMA 1E4KA 5KW9H 3U0TA 3JUZA 4KRNA 1BWWA 4KKAC 4QRPD 5JQ6L 1DVQA 5J11C 4UOJA 2BSEA 1DBML 2V37A 3IN0A 1MI5D 3W9EB 1QSED 4JFPA 4KK9D 1JPST 3QXTA 3QISA 2ITCA 1AQHA 4R4FL 2IXQA 2ESVE 4JGUA 5F7MC 3RVWD 4TN9A 3RWEA 5TE6H 4ZMOA 5EUOB 4P9MH 4YDKH 1MXDA 3O9WB 1SDDB 1KTKE 1T2QL 5JW5A 1AC6A 2J6EA 4M7ZC 4HC1H 3L3IA 2DN7A 1T0MB 3C6EA 4H8VA 1P4LB 5CFAA 1KCKA 1VAHA 2GW5A 1HDMA 1GCFA 4KHTH 4RGNE 1AI1H 4EZKA 1P5UB 2EVGA 1A7RH 3NCWA 3JWDH 4JVWA 3DETC 4Q97A 1VKXA 3O41B 2QQKH 4XMWA 2BP0A 3RGVA 2ZQKA 3IU3A 3LNEA 4JY6B 4MBOA 3EJZD 1Q1PA 2PYFA 4HK3J 4L3AA 5FW8A 1AQDB 2E7MA 2OKMA 4JLRA 4O51A 1J0HA 2A4CA 4S0SD 3L7FA 4TL5A 1I82A 43C9B 3F05A 3VXNB 3I6SA 4G42B 2HRGA 1P4IH 4PJ9C 3BZEB 2J25A 4TNFA 3QJHA 1LNUA 3V5HB 2X6UA 4KTYA 3QQDB 3PP4H 3FBQA 4FDWA 5EO1B 4O2FA 4YHNB 2CH8A 1WO2A 2VZ1A 4FFWC 4IU3A 3E8UH 5JR1H 2NX5B 3C8HA 1NLBH 2VQ1A 3HZVA 1QZNA 2B08A 3MREB 5FUZH 3T1FA 3T0EA 1NQBA 2IPKB 2IAAC 3F6IA 4JE4B 4L4TB 2WZPD 1KIUB 3KPOB 3T6WA 2DEYX 4KTDL 4PRHD 1RZ8A 1NDGA 1KDIA 4FFYL 4LEOB 2OYKA 3ZUCA 1OKEA 5JORB 3DI2B 1BM7A 4ABWA 4AH2B 1T5WA 2B2XL 3QE5A 3VXUA 2VOTA 2NCMA 2V5MA 1IEAA 2WVTA 3S5ZA 1UZ6E 1GZQB 1U3HC 1TIUA 3NCXA 1TTRA 1AH1A 5C1MB 1I7TA 5AWNH 1J0KA 4HFWB 3DOSB 3MV7A 3QQ9D 3COOA 2E5EA 1XIWC 1BJ1H 4YHLH 4DTGH 4BEIA 1MQ8A 3SDXA 5C92A 4WNJA 5AFAA 3L5WB 1A4KA 1OZTG 3MV11 3UIZA 4IRJD 1XB3A 2YQGA 3DTXB 4OCSL 1T03H 4N2BA 4HIEA 3GSWB 4QRPA 5FOBA 1TTGA 3BQUB 2YKKA 2GSMB 3OJVC 1MI5A 3EXJA 1JGUL 4M62H 4LLWB 4ZMVA 2H32H 1S9YA 5IFHH 4S10A 1O75A 1HJBC 1S78C 2QPDB 3IFPA 3A21A 3POCA 3FRPG 3T3PB 2WKLA 4R7XA 4YC2B 4YUEH 1U8JB 4HBCL 3WY1A 1PSKH 2W9EH 4MA3B 3D2UB 5EF0A 3KPRB 2MPVA 1OEZW 1GYWA 2R8SL 1BCIA 1ZLVH 4PJ8D 3RVTC 3UG4A 1UB6B 1SBSL 1VFBB 3NZ8A 5DD6B 4BFRA 4E2OA 5I1HL 3BGFB 4CUCA 5F9JA 1OAKL 1QFOA 4MMZA 1WAAF 5F7WC 3TJEL 3WMQA 4MA8H 4BZ2L 4KI5C 1KJ2A 2YUVA 2K7QA 2WJ7A 2DI8A 1RHHB 3HFMH 3VM5A 4XMKL 3IRPX 1OGAB 5DJXB 3LHAA 4FKEA 3ZKMC 2DAVA 1PY9A 3GRGA 1SXNA 2AMGA 1NCTA 4DQOL 3AAZA 1L0QA 3HHSB 2WNXA 3LMJH 4UM9D 4H1LG 3QIBD 4PV8A 4PSPA 3Q9PA 4L2YA 2QGCA 3QCTH 2JB6B 4WGKA 1FFOB 1IGMH 3BWSA 3VD0A 1DEEA 2X4SA 5L6YL 4E9QA 4BCZA 1KTLA 3LXCA 1HHHB 4KKZA 3EJRA 2PPFA 4GW4B 1C1EL 2WWNA 4YXLH 5I6XC 1UCTA 3CV5A 2H3NA 2WXLA 5EO9B 1IQWL 4R7VA 5D7KD 5CZXD 1U91B 2J21A 5DVKA 2WZPA 1GTNA 4L05A 3BP5A 4GG8A 3O45A 1MEXH 5IT2L 1IAOA 1P1ZA 4LP4A 5E8PB 4ZJ9A 4PRHA 1NDMA 2Q8AH 3MJ8A 3FOMA 1CI3M 2BSSA 3BKML 4NZDA 4P9HC 1J9TA 2NYZA 1R24B 1CDJA 3CHPA 4P04A 5M94B 4X6CE 3QWQB 1G9ML 5LGKA 2PETA 4FNTA 1IVLA 2R2BA 3MRDB 2WQVA 3KAAA 2HH0L 3MLWL 4X4YB 2CDFA 1IBGH 1HWHB 2ICES 3OD3A 1P84J 3PPSA 1KPVB 4KUZH 2KZBA 4QNPF 2Z3FA 5HDBB 2OR8A 3D4YA 4HETA 1BLNA 3S3JA 4QTHA 3K74B 4DGVL 3QDJE 4L3EE 2FYYB 4E9YA 4RAVB 2VZOA 4I48A 4G8IB 4AV4A 4BK8A 1G7JB 4M7KL 2UZYA 1E30A 4IRJA 4NKDB 2CMRL 1KV3A 4PJ7F 2Q6WB 3GMQB 4DGIL 2R0LL 3QZLA 4M29A 4ZMZA 3IDNB 3V0WL 2JTDA 2NLJB 5K9JL 2VDOH 2A6JB 1BEYL 1FYHB 4KROC 4JN1L 2ICWJ 4JR9H 1RMFL 3D06A 1RHFA 2HJFA 3LRLA 4UMSA 4IIQC 2FEDD 4KVCH 2J6WA 3FO2A 3CPLA 3LKQA 4WHYH 5DVOA 1ICTA 5AVYB 1GZHC 4P2RB 1USZA 2AK1L 4P3WA 1TQTA 2LLLA 4PJ8A 2Z7ZA 3ASWA 5MENB 5F7DB 2N3JA 4NQDD 2K3TA 5EOTB 4KWUA 3T65A 1BMZA 2FZ3B 5KVFL 2F53D 4OI7A 1NAKL 3L95B 2EH8H 3P0YL 3AG1B 1BZ9B 2H5UA 4NNYB 2NY6D 3U2IA 4FXLA 4FG6C 1A14L 1QA9B 5A7BA 2VC2H 4NI3A 2X38A 1EO8H 3U4EA 5D7SL 4K8RH 1FE8H 3QUKA 3O6FB 1XR9B 5D2LA 3L3OA 1L5GB 4BFGA 4ERSH 1EQWA 3GIVB 4WI2A 4UM9A 1YJDL 3QIBA 4RWHA 1XH3B 3O3AB 3ZT5A 4AENB 1NBYA 2VR3A 1J9CT 4K7PL 1JRHL 4HKJA 4J2XA 1ND0B 3TXAA 4Q56A 2F8VA 2IPTL 3HN5A 3O9WD 5FM5O 4A2HA 5E2TL 4E9SA 2H8PA 3LIUA 3S7GA 1GTFA 3EYOB 4LLDB 4F8QA 1WAAA 3WEMA 3ZKXB 3MOQA 2ZNWA 2UY7A 3N55A 3GLZA 1MCJA 1D5BA 2AERT 1U2YA 2VDMH 3V0AC 1MHCA 3I9PA 2ZF8A 4B9FA 3LEYL 4DO6A 4JB9H 2I69A 4PJGE 3S3DB 2MPAL 1HSAA 2ZPKL 3IFNL 4LIQL 4P4KB 3QHZH 5I71B 1FC2D 5CGBA 1G1OA 3ZW3A 4X7SL 1MW0A 3AVEA 1S2EA 4U6HA 3F7YA 4TTDD 1NCOA 3RQ3A 2NZIA 2ZG1A 5FYJL 1IC7H 3MRKA 3WFCL 3H0TB 4HCRA 4TNEA 4XNXL 1SY6L 3RTQC 1FWXA 3WMSA 3H2PA 3NDZE 3EHBC 3E80A 5J7CC 3H6AA 4BINA 3EGDA 5DC2A 5I76A 1IKOP 3BP7A 2PXYB 5I1CH 1LEKA 4ODVH 3QYNA 4ELMA 4TQEL 3CLEH 4TPRH 2YUXA 2Y9RT 2XBZA 1DQML 4J8RB 1XSOA 1Y6NR 1LE9B 3VGGA 1TO5A 4IBTA 1IM3B 1YNTB 2B77A 3CZLA 4ODHL 3SKOA 3ZE2F 4A7TA 2GJJA 3KDMB 3K91A 1P6FA 3AZUA 1A22B 2EEXA 4H0IA 3S37L 5E95B 3TVMC 3WKQA 3RBGA 4WDIA 1KJ2H 1VDGA 3HI5H 4L4TD 5D9SA 2J12B 4H8WH 3KCPB 4WJG3 5DJCA 3AS3A 5KVDL 4KKBC 4NWUH 1YQVL 3QXDB 4ANUA 4NQXA 1OSZB 3OHXC 3WN6A 2M1KA 1MJUH 2HVJB 5IEHB 4W70A 2ODHA 4XMZA 4GRWE 4MGXA 1Z9LA 3AADB 2AK4E 2LFEA 2UX7A 2AGJH 5IK3A 4WVRA 4Y4KB 4N4YB 1DJGA 2IQAA 4H5SA 4NQDA 3VSTA 5J13C 2OK0L 5C0JB 2LTQC 1TQBB 3HZYA 2EE3A 2OMWB 4TMPA 4UQ2A 2F53A 1S9WB 3WO4C 4GXVH 4TRPH 5IW1A 2ZCZA 1KEML 2JI1A 3DO3A 4TVPD 4AQAA 4U49A 2B3RA 1UACL 3FCSA 4X4ZA 1ADQL 3C09B 3JWOC 4P46C 1QI5A 2J57A 5TFSL 5FFOA 3WJLA 4AVIA 3HVNA 1YEIL 1QAWA 5E56A 2E9GA 4FQ1L 1ZLDA 1AOHA 3AABA 3BQUD 4JDVA 3QS3A 1I53A 3W9EA 2P52A 3GJEB 4L9DA 2RR3A 5E08H 1A9BB 2PLTA 5GRJH 3WKPA 5AAPA 5AAWC 4OIAA 2CHZA 3TT1L 3P9WB 5EUOA 4PD4J 3O9WA 1UD8A 1SDDA 2VMDA 1FBIH 3K8MA 3MHZA 2UVEA 2OFQA 4PB9L 5HYJD 4ZMLA 1AQKH 3KPRD 1I1CA 1C7SA 1L7TH 2W1NA 4L8BB 4M02A 1P4LA 5E1QA 1BFVL 3P30H 1K6QL 5FLVA 2BMKB 2XRAL 1L9RA 2FH8A 2QTEA 4RZCA 4WK4B 4R9HA 3UPAA 3FQNB 5A6IA 2N0MA 5LBVA 1MJ7H 1P5UA 4HAFA 3V7MA 2FHBA 3UJIH 1O7DE 5J5EA 1RLBA 3O41A 1F56A 4YFLI 1HXMB 4XTRD 1UKTA 3LPWA 2AW2A 4TLUA 3S0PA 1JGVH 4JY6A 3ROOA 3KJ6L 1AIFB 3EDDA 3HC0B 4UDTB 3RJDA 5E8DL 4Z3GA 2DIEA 1P2CB 1OGAD 2ED8A 3JBG7 1QFHA 3TBVB 1KLUB 1PZ2A 2K6ZA 1AE6H 4NP4L 2HZHA 5BUPA 2XQYK 43C9A 4NAQA 4G42A 2HUEA 1OAYL 3BZEA 5LDSA 3V5HA 2Z7WA 4XNUH 1A25A 4AQOA 3QQDA 2NNCA 4KMQA 1LP9B 1CURA 1ZY9A 2V8LA 1CFBA 4YHNA 1IU1A 3O2VL 2NX5A 3FUJA 4OLUH 2ESVD 2DI7A 2ZE0A 1DO5A 5E4AA 4JHWH 1KB9K 1ZSHA 4PWJA 1CU4H 5AW8B 5GPRA 4Y5VB 4Q89A 3SQOH 3UG3A 2B0SL 2R23B 1MFEL 4L4TA 2B1OA 4IBZA 3KPOA 3PP3H 1JPTH 3E3QC 5AD0B 1Q0YL 1NFIB 1OTSD 4QR7A 1EHNA 5C8JB 4LEOA 3VXOB 4X7DC 4AH2A 1JZHA 2SEBB 3CXHJ 3SBRA 1GXEA 1A64A 1E43A 1BWMA 3G08B 2OMBA 3QUXB 4X80H 4N2AA 4PLNC 5L2KB 5E24E 2V17H 3EJYC 1QFPA 2EEDA 3NCEB 4B9JA 3DJZA 4RSVA 4JFDB 1R0AH 5D1XB 3P0VH 5I1KL 4HFWA 4XMXA 3DOSA 3AT8A 1H6TA 4PS8A 4YLBA 1KT2B 1UJ3B 4QOKE 5FO8B 3BKYL 2B14A 3N1MC 1UENA 3GBMH 1YUHB 4HAKA 2TSBA 4OD3H 3L5WA 4FI8A 3MV9B 1J1PL 1YYLL 3DTXA 1EEQA 3GSWA 3CG8A 1LWJA 3BQUA 1L0PA 3EH3B 1K72A 5I66A 1LHZA 1BIIB 4PP2B 1UZ6F 2QTVA 5DEJA 3FAWA 3Q2VA 3EDJA 1CICC 4IJTA 3NZHL 1HXYB 4LLWA 4NUGL 4UT6A 5DJAB 3V7AG 3Q43A 1CDYA 3TC9A 5I17B 2FX9L 1CR9H 3FO1B 4HCRH 1E5YA 1SYSB 2P8PA 3ZK0A 1S3KH 3FQXB 3WMPA 1H3XA 3EFDL 1GH7A 3NPSC 4MA3A 1KLGA 1OM3L 5HYJA 4P2RD 5GSRB 3KPRA 4G82A 2EVHA 3OBAA 1AKJB 5IFAH 2DTML 3NTCL 1WWBX 1IC5L 1WA2X 2XETA 3F7RA 4OCWL 2AP2A 4YK4B 5EOQL 4WY7L 5DD6A 5F6IB 4O58H 4EEEA 3RDTB 1JNJA 3CFDB 4F2MB 5E6YA 5DRWA 4OW6A 5TK2A 5J6GB 2AC0A 4PLKC 1U8IB 3II2A 2GJ6E 1SN2A 1IC0A 1RHHA 1TYEB 4BKSC 3FPYA 5AQ0A 4PJAE 2CZNA 1OGAA 5DJXA 2P28B 4O02L 4W9DC 3P3TA 1BQ5A 4DGYH 2C1OA 4DESA 2DQGL 3W9DA 1T20B 5A7EA 1JPEA 4O5LH 1WC7B 3K1KC 4GO6B 3HHSA 1XH1A 2X4UA 3F12B 4V2BA 5F7LB 1VPOH 3SN6N 4FQLL 3DNKA 1WHOA 3MCKA 4LOUC 3F01A 4DKEL 2H7WA 4XC3L 4XXDB 1FFOA 5LN8A 2CLZB 3KPPB 1JJUA 4ZS7L 1KIRB 1JBJA 2EIZA 2JQAA 3HR6A 1YEJL 2XYCA 5DMKB 2FJUB 2WUBH 4QD2E 4TQ8A 2VXTL 1I1YA 1WWAX 4B3EA 4F5CA 4JDEA 2J5WA 4GW4A 4MQ7B 4AL8L 2A6IB 2UZIL 2ESVA 3LNFA 1M4KA 2B4CH 3SE8H 2W91A 5HPOA 5EO9A 3GXFA 1UGNA 1CL7I 4G6AD 2N4IA 5MEOA 4RGOH 3A6OA 1CLCA 4LSSL 3HG2A 2WLKA 2C9AA 5E8PA 1OHQA 3GXMA 2DWXA 3S3BB 1IBDA 3MLYL 4MCYB 3ROLB 4N86A 5DRZB 1VEOA 5I0ZA 3ZVVA 3L5XH 2J8OA 2VLJE 3D30A 4HCGA 4AVKA 4HS6B 4JHVA 1S6NA 3S88H 1PZ3A 2X4NB 1N59B 4XC1L 3D0VB 1WZKA 4ZTOH 2FL5B 3OQRA 1KNOA 4EOWH 2PXYD 3QUZB 3Q2LA 5JXAH 4RGMB 2FCBA 2FYYA 1N0XL 4G8IA 4B5ZA 3WKML 3SKMA 4DAGH 1G7JA 1IM3D 5GGRY 2J73A 1DVFC 4NKDA 4X6CF 4LCYA 5D1QE 1RUML 2HVBA 3GMQA 3KVPA 4NDMB 4NKMB 2NLJA 3CHRA 3OAZK 3CMGA 4KJPD 2A6JA 1VJSA 3N06B 5BQ7A 1AZCA 4DVBB 5JMOC 2DM7A 3I75B 4M5YH 1WCBB 3X13B 3Q1SL 3V8CA 2F58H 5FX3A 5ILTH 4HX1B 2RHEA 5SX5K 4MXQD 3IS1X 2VH5L 3O4OC 5JIKA 3D50A 1HSBB 1A7OH 1R3LB 4P2RA 5EIIG 2WPGA 4HH8A 4JG1H 4Y4KD 4G3YL 2BVEA 2Y25A 3HMXL 3HS0B 2IBGA 1IBHA 3K4AA 2L7UA 1KTBA 5EOTA 4HWEH 2ZONA 3IGAB 2FZ3A 3CU1A 4GMSH 4K5PA 4OH2A 5CXPA 3U9PH 2RB8A 3L95A 2NXYB 4G6MH 3D6GA 3WIHL 1BZ9A 4HCFA 4NNYA 1ETZB 1KGXA 1BX2B 2JJSC 3VFSB 1TF4A 1FN4B 1G6VK 3STBA 4AOFA 3GSXB 3LKPB 2H41A 3FO0H 3G6AB 5I19L 2CM5A 2X05A 4AK1A 1ZS2A 4IOFD 3ISWA 1ET5A 1MWOA 1XR9A 5LJYH 2I7SA 1F4YL 1L5GA 4NQCE 3ZN6A 5DFAA 3GIVA 2AJVL 2FWLB 4CC1A 2HTKC 3O3AA 2I07B 5D55A 2XACC 2ORBH 1FV1B 4NJAL 5ALBL 4ABQA 1WZ1L 1XAUA 8FABB 3EO9L 3IPEA 2XFGB 4K71B 1ND0A 2VDKH 1TSHA 4PJEE 4W4OC 3ML9A 2YEZB 2EH7L 4HLZH 3SY0A 4KRPC 2QQQA 3D08A 4YPGB 1JXGA 2UX6A 4G6JL 2G0KA 2ZYHA 4TVPH 1LK2B 2VAJA 1NUDA 1S7QB 3EYSL 2WLIB 5CCHE 1IQDA 2J7LA 3OB8A 4HD5A 2FSDA 1BQLH 1A7QL 1BFOA 1TMCB 3QEHB 4HK0A 3IEAA 3C5ZC 3EYQC 3QPQD 4Q6IC 3OB0H 5FGBA 5KYWB 3GDCA 3GHBH 4RQQB 1BAFH 2CLVB 5TJWK 3QC6X 3E8VA 5GQBA 4UT6H 3H0TA 5F7EH 3O3BB 3QZBA 1E9PA 2LU3A 2VJ8A 1UA7A 2NSXA 5CJOH 1T04B 1W8EA 4GPVA 1RERA 4H8PA 4OLZH 4K3HA 1F3RB 2GJ6B 3RL2A 2PXYA 2G60L 5JDSB 4YBLB 5ENWB 3MTRA 4PJGF 4B9GA 3LZRA 1RUPL 5CWSA 4LPXA 1LE9A 5KEZA 1IM3A 1YNTA 4Q6KA 2XN9E 2WIIB 4UB0L 2G2RB 1DBBL 3O0LA 5LHDA 3ETBF 4LVEA 2ATPA 3BH8B 3CVBA 3KDMA 2Y7LA 2ZYIA 5H8DA 1YEFH 4OCXH 4LLMA 1NIBA 1AD9B 3TONA 4KPHL 3MLVL 5GIRB 2CDGB 1KCSL 1HCZA 1ET7A 1V3MA 4WHYG 2FGZA 1AIZA 1SOQA 3ES6A 2P5EE 3ETSA 4Y88A 1YVLA 1OSZA 1KJVB 5AYQA 5IROC 3VFNB 1XCXA 3IYLW 2HVJA 1UXMA 2YPLE 4M8QA 3VRLE 2OSXA 3X11B 2CHWA 4ZMAT 5IEHA 2IVFC 3NEEA 2R69A 5C0NC 3IMUA 3SDAD 3Q3GB 4Y4KA 5L2KD 3BW9A 3LNIA 3NFNB 3CN1A 3NUKA 1QHPA 1KCVL 2WQWA 5C0JA 4X6CA 3IDXH 3HG3A 4JX0A 2OMWA 1T89C 3EG9B 4ZTPL 1WUZA 2NZ9C 3DVFA 4HJTA 2WBXA 3BAEH 3NP4A 4BSVB 2A9NL 2QLYA 4M61B 5L4MA 3MV9D 3ESPA 1KN4L 4Z77B 1A6VH 2WZ0A 4LHUB 1LMKA 2VRKA 4GRWF 4I1RA 4OR1A 2BOLA 4XHQA 4YEEA 1T7WA 4HCIA 5I8KL 4QYOB 3K80A 1EHLH 5IB5B 3EOTL 3ZY7A 1A9BA 1AGFB 1I7ZB 3CH1B 3G5ZB 3UTPD 5D1QB 4GH7B 5E6RB 5F1IB 4QXUL 2VW6A 2ZKXA 5ACMA 5K9KB 5F3FA 4LSQL 5KVFE 1WFMA 5ANME 3RNKB 4UTBA 2X3BA 4XHJC 3MRCB 1A4JA 5BRQA 3IS0X 2F7OA 3RY4A 3ZDXE 3WE6A 1AKJD 4LMQE 4L8BA 2J4WL 1NMCB 2D3VA 3BRDA 4YO0B 2BMKA 4G7YH 2P45B 4R2GB 3VD9A 5CHNB 5B39A 2VKXA 4FF9A 2BFVH 2XOTA 3FQNA 4F15C 3RDTD 5A2JH 2AK4D 2OMUB 3EBAA 2JVUA 1IRAY 2DWTA 5ABZA 1LO2L 3HCVB 3MCYA 5EFIB 1HXMA 4WU5A 3WNLA 4PSRA 4QJ4B 5J11B 1WFNA 1IGIL 2EE6A 4FTVB 1AIFA 3HC0A 3MGTB 1L7IH 4UDTA 1P2CA 4AEHL 3TBVA 1KLUA 4TUKH 3ARBC 4G9FB 1CE6A 1W91A 1NA8A 5TF1L 3O8XC 2ZWNA 1KB3A 5E5UB 3E9TA 1YY8A 3SO5A 1M9SA 4ES9A 4N90E 3QHFL 4M7ZB 4QHUB 2A9ML 2A6DB 4TNGA 4HEPA 1R5WB 2ZUTA 3CFMA 4NQCB 4LIQE 1JV2B 2H2PC 1LP9A 4X6BB 4QRTB 3MLUL 4S2SA 3F3HA 4Z0BL 5JHDE 3NQIA 4MFHA 3UBXI 4PJEB 3IJYB 5FYJE 2CUHA 1M1XB 1MRFH 3TPUB 3LZOA 2R23A 4OZFA 4Z9KB 3FCUB 3SE9H 2NY1C 3KPLB 4LCUB 1NFIA 1WQVT 4HULB 2DPKA 2VNCA 5C8JA 2XZZA 2ZG2A 1JWSB 1S7UB 2WUCL 3UC0H 3UX9B 2DH3A 3NN8A 1N70A 3P9MB 4P59L 3VD3A 3IDJA 2QHRH 2EVIA 3GRWA 4PJ9B 5E99H 4ODTL 2H3XC 3SDAA 1SFHA 5L2KA 2CRMA 3HG4A 5EEXA 2JE8A 2OPCA 4Q58C 1C12A 4UNUA 4JFDA 3ILQC 4L8CB 3QH3A 4KX7A 1CIDA 3PHOB 3NCFB 3FTYA 4FXKC 1KT2A 4N0CD 5FO8A 3BRGC 1H19A 3D07A 2E3VA 1YUHA 3N6YA 3HC4L 5DD0H 5IW6B 5KVDE 3L1FA 3MV9A 1Q9WA 3N1PC 3WEAA 5F1SA 3GSUB 3VG0L 1VA9A 3IPFA 5GZOC 2JJWA 2ZYSA 4PP2A 2V9RA 3GPEA 3WFBL 1FORL 1HXYA 4P2OC 2DD8L 1XCTB 5I17A 1R46A 2ZTBA 4BA8A 3OZ9H 1OT4A 5F0PB 4KZ0A 2GABA 5IBLC 1PKQE 1SYSA 1WS7A 1U3HB 1CF8L 3KWWB 2R59A 1WWCA 2LGNA 1A3RL 2C3GA 5AOZA 5GSRA 2BVPB 1RJLB 3QGVA 4KI1A 5AW1B 1AKJA 4NWTL 4WV1C 1PLGL 1LDSA 3ULVL 3G5XA 3HHRB 2KPNA 4NKIL 2BIPA 4NN5B 5FUOH 3RDTA 2AK4A 3CFDA 5BS0E 2NXYD 4F2MA 3DJTA 4BHUA 1NUNB 5I24A 1EUTA 3QRGL 4AZ8B 5J6GA 4NNPL 3SPIA 4PWFA 4CGUB 1U8IA 5DUJA 2R0ZL 4NBZB 3FFDB 1GMIA 1WBZB 2DLFL 3WNPA 1F90H 2NY7H 3K1DA 3MBED 5I5RA 4QOKD 2I60L 3KPQB 4HJSA 1T20A 5CCKH 2AVFA 4MLIA 1WC7A 5AW5B 2YIHA 3SYQA 3WXVH 2ZAHA 1RFDL 3F12A 1H3GA 1LGVA 3UGEA 2JJTC 2EABA 3GQFA 1SUHA 4N2LA 4FABH 1SN5A 1L9NA 1N5AB 2CLZA 3FN3A 3KPPA 5C86A 1KIRA 1YUKB 4I0KA 3D69A 2WP3O 4PR5B 3BUDA 1MIEH 2FQEA 1NBCA 2D8KA 2WQRA 2WXHA 1YN7B 2BNUB 2HPOA 1A7PL 4NM4H 4F1ZA 3F62A 2A6IA 4PJAF 2HJLB 1CO1A 3F7QA 2CCVA 5C3TA 2GCYB 3DX9B 2HFGH 1PLAA 4IIZA 7TAAA 1D5ZB 3ZL1A 4YX2L 1WK0A 1DUYB 2R4SH 3HBPA 1LEIA 3SKNB 1IARB 1JZIA 2VLLB 4W9IC 5E4IA 3WIIL 2F61A 4LL4A 4MCYA 3OLDA 3Q8CA 1UJTA 2ZUYA 5DRZA 4YSRA 3GJFH 3QBTB 3S35X 4WCYL 1UADC 3N40P 1UTDA 3FB8B 4APQC 1OTTC 4HS6A 3KD4A 5AUMA 2X4NA 1N59A 3D0VA 3AG4B 2J55A 1N4XH 2FL5A 3ZT7A 2GJ6D 3KL0A 1E2ZA 4YR6B 3KW7A 3LQAC 4OI8A 3ARVA 2VR8A 3GXPA 3WTVA 1ZLEA 2BSCA 5FF6B 1ZE3C 3WTUA 1T0OA 4H7VA 3WEBA 2XV0A 4U3HA 1T2JA 2APBA 3LB6D 5I6XB 1NCGA 4NLHA 2P46B 4NFCA 2OSWA 4YQXL 4LRNH 2OBGA 4XMLH 3DTUB 3UJJH 1XO8A 2ZCKL 2PPCA 5F93C 4EDXB 4NDMA 4I3RH 3LRSB 5C9JB 2XUWA 3AS2A 2GUOA 4DVBA 5FM8A 3I75A 5JHDB 3B5TA 3OKMA 3X13A 5ERWB 2FX8H 3QG6B 3WFDH 4HX1A 2LW3A 2HT4D 4W93A 1CFSB 4EDWL 4KXCA 1E9OB 1KPRB 4DKAA 1HSBA 5ALCH 4NKQB 1R3LA 5LBSA 1OD7A 4IGBD 1ZT7B 1CBVL 4JM2F 5ESAB 4FFZA 4QRAA 4PV1C 2XA8L 4M3HA 2I85A 3QI9C 3STZA 3HN8A 3ZDWA 2DQEH 4N2OA 2ZKHL 1TO4A 2FLRT 1W72H 3IGAA 5E2VL 1DQIA 2VLJD 4DEUA 1A5FH 3QVAA 4UBDC 4XO9A 1YECL 1ETZA 3VFSA 1BX2A 3PGCB 3ECVA 4OD2B 1FN4A 3V0FA 3RNQA 1OSYA 3VGEA 4GW1B 3GSXA 3LKPA 4JO8A 1NCIA 4LHUD 4JFZL 3W0WB 4OZFH 3MBEA 4OJCA 2E59A 4KROB 4QOKA 5E5LA 5BMFH 4ALAC 3CXDH 3DIDA 3KYOB 2KDYA 1J86A 4IIQB 4IU2A 1ZHKB 4KXZI 2WWMC 4BGDA 2AMUA 1ITBB 2I07A 2VN5A 3K4DA 2DL2A 3Q8AA 4JM2D 5F1NB 3TM6A 5AW7B 5D1QD 4M3KB 8FABA 3MBXH 3GRWH 1WFJA 3PHAA 4OZGE 4ZMXA 3LRKA 1BAWA 4FP8L 2YR3A 4GRLD 3F84A 1J8RA 3T6ZA 3PWPB 4U1LA 3WUWG 4CN1A 1ASPA 2CK2A 4YPGA 2NUPB 3ZDZB 1LQSR 4YXHL 2YC1B 3KS0J 5DS2A 1B4JH 1D7CA 4ELDA 1CMOA 1EXUB 1LK2A 2XSKA 1TJGH 2Y72A 5GGTA 3WD5L 2WLIA 3LTVA 3ZMNA 4AMWA 5FGRA 2OXHB 2QLVB 2YSTA 3QEHA 1NL0H 2BZDA 3BISA 2BRRH 2XZCH 3GSOB 3VTAA 2Z35B 4J6RL 2O6EA 4PJEF 5KYWA 1KELL 2WXJA 2CALA 4FTVD 5AVSB 1FLTX 1MFBL 1UM6H 2B1HL 4FHBD 3BDXA 4AKPA 1NCCH 4XMPL 1BYPA 3DIVA 3O3BA 5IVXB 3ALWA 4LCWB 4QF1A 1T04A 5DUPL 2IPUG 3LQAL 2GJ6A 5L7XH 4RX4D 3V6OE 2IDTA 4YVUA 5CZVH 4K15A 3ZDYB 1ERNA 3ZRCC 1IUZA 2MSPA 5D7IE 4CVWA 5G2NA 4DP1X 5I18L 4RH4A 5EPMB 3RILA 4NQCD 1JVOA 4G8GE 3SGDH 4OIBA 1WICA 2G2RA 3TEZA 1YAZA 2CHDA 4KVNL 4GRWH 4YZWA 3C5SB 1M2OA 3HE6C 3BH8A 5IGXL 1KXVC 1CTOA 4PREB 3DETD 4CSZA 1AD9A 2EDRA 2E6JA 3UPRB 5I30L 3ESMA 1J87A 1F2QA 2XV2A 5GIRA 2CDGA 5AB1A 1JWMB 3ARGC 1F00I 3N1FC 5CGYC 2O1AA 1YPZE 3RTQB 4MVBC 3EHBB 1RSFA 4YHKL 2ADJB 4G6FB 4M1DL 2WW8A 5IBUG 3VFNA 3QHTC 2JIXD 3WL9A 3O4LE 3X11A 5CN1A 2MNWA 8CGTA 2WVSA 5LGJB 32C2B 4IGBA 4PJ9D 3DK2A 2PYEB 3CSFA 3CC5B 3VX1A 1M57B 3JVGC 4Z3EA 5I28A 3PJSB 4FNUA 5K5YA 2FWOB 4HS3B 4CBPA 2QELA 1PNDA 4DVRL 3L4ZA 1CDBA 4HMDA 4TV3A 2VLJA 1RIHL 3SDYL 2Y5TA 4AI7A 2OCFD 3IU4H 2CM6A 2GJZA 2FJHB 2Y1ZA 3K6OA 3ZKQD 1JI1A 1MAML 2XC8A 3D3VE 1CT8B 3TT3H 5GHWH 3TVMB 4BSVA 5BV7L 4M61A 4A7UA 4PY8I 4Z77A 1I3VA 2E7LC 3VRLF 4LHUA 4RFEB 3QIWD 2CO6A 4DWHA 2G75B 3DSFL 3AUWB 4WENB 4YIQB 3ZKNC 5DT1L 4DP0X 3OHXB 4N1HB 5IB5A 4IBYA 2Y2YA 5EU5B 2XN9D 3O11B 1AGFA 3GI8H 1C16B 1B0WA 1F3JB 1I7ZA 1AACA 4FFYA 4JM2A 3CH1A 1AR1C 3BN9C 3G5ZA 3QQ4A 5D1QA 4TSCH 2R29L 4HLZG 3EDFA 2EXTA 2KMWA 4B27A 5K9KA 4GRLA 1UB5B 3NJLA 4X8JB 3RNKA 1U3HD 1KTDA 2N59A 2R4RL 4FQCL 3WKYA 5HI3C 5J13B 2JCCE 3MRCA 3D8MA 4D0DB 1X7QB 1MLBA 1NICA 2DDQL 2LTQB 4MNHB 2EUVA 3AU0A 3M8OL 3WO4B 5HVGB 2EIBA 4G7QB 1D2PA 1HOCA 4YO0A 3OG4B 4B9YA 1X5HA 2IWEA 4OJFL 3GBDA 2NTSP 4ATTA 4YHML 1JZ3A 1NCWL 4NJ9L 2GIMA 5FW6A 4UUJA 4XPBH 4ANWA 5I16B 2R0KH 1G4RA 2GT9B 4P46B 1PX3A 3PS6A 4IDJH 3MLXL 5HHXL 1JP5A 3HCVA 1UT2A 3LS4L 5EFIA 4OGYL 4BWWA 1PCXA 5EF1A 1EERB 1LTXA 3A4FA 4FTVA 4XZUB 1JF5A 3MGTA 3O6LH 4A6YL 1BBJB 4NQUA 2UZXB 5AW0B 2M8XA 3ZDXF 4XPAH 4AG4L 1S78D 3INOA 2BX5A 4JRXE 5B38B 4FLQA 4QLWA 4RX4A 1NANH 4EVNB 4HKZB 4D3CH 4QHUA 3SY6A 1NCNA 2DQJH 2A6DA 3V0GA 3QEQE 1C5CH 1D6VH 4NQCA 3RVTD 4FFZH 5KYXB 5E5RB 3UP6A 1JV2A 4X6BA 1BYOA 3QDGE 3L3HB 4OZGB 4PJEA 5L88L 3P77A 3IJYA 3V6ZB 1DQLL 2VDRL 5E0FA 1M1XA 2EUXA 1BM3H 3QZOA 3D51A 5GJTH 3TPUA 1RZKH 4XWGH 5IB1A 2M2DA 4BZ2A 1F3DJ 1NEZG 3ATAA 1VADB 3QJTB 4JPWL 3ZKMD 1IKNC 2DQHH 5I6PA 1S7UA 2JIXA 3P02A 4UIMB 2BIMA 4YMPA 1L9OA 3P9MA 1NBVL 2VUYA 5D6DC 3VDCA 2YGPA 4ZRGA 4PJ9A 3GBNH 3S36L 1EPFA 4ZMNA 3GGWB 1D7DA 1NBZB 2HAZA 4Q2ZB 1JVLA 1N6QH 5I23A 2X4TB 4MQXC 4F37K 3FU0A 4EUPB 4L8CA 3PHOA 1D3CA 2LFGA 2R56L 4GLRH 1PYWA 2DWYA 4BUQA 4DGWC 2APXA 1X9UA 5IW6A 3VFMA 5AZEH 4IRZL 3P9LB 4N90D 3GHEH 3GSUA 1TNMA 2VISB 3MTXA 3QIWA 3K71B 2A5UA 4PFEA 5FV2A 4NQQA 3HNTH 4PRIE 3TNMB 3U4BH 5J1AB 5SV4A 2XN9A 3WEXB 2J88L 5JQ6H 4HT1L 1XCTA 4FZ8L 3B3BA 3L3DB 4TKWA 5JHDD 3Q1EA 1DBMH 5FDWB 1GZPB 2O5XL 5KUMA 5FYJD 4H8UA 2Q20A 1U3HA 2AXWA 3ZHDA 3KWWA 5IHLB 3MNWA 3RZCC 15C8L 4IMKC 4R7LA 2BVPA 5DZNA 2A7BA 4YOKA 3VD5A 1J5HA 1QKZL 3SKJL 4N0UB 4HBQA 3GZPA 1T2QH 4PGDB 2ZWYA 1MPAL 2NY2C 3KPSE 2OV0A 1NGXA 2DRUA 3UROR 2X40A 1TMQA 1FPTL 2LLGA 3FQUA 4NLAA 2A1WL 4JPQA 5DZAA 3M1BB 3G5WA 4MX7B 5AVUB 4AZ8A 2IADB 1E4XI 5E51A 3STLB 1PU0A 2XG5B 2WXKA 3FFDA 3DRTB 1CICB 1WBZA 1OAXL 3W0WD 1QFWM 1TOXA 4KROD 1X6LA 2V6HA 2YD9A 2OA9A 2LVEA 4TULL 3B9EA 1Z9PA 4RETB 3QG7L 3FU3A 2N56A 2AQ2A 5DURB 1AZUA 3NPSB 4FJ6A 2XN2A 1HN1A 3CZUB 2GJPA 1WTLA 3T4AC 3ZT6A 1G9HA 3T0VA 1MFMA 2D7PA 5HHVL 4AE1A 1N5AA 3QP3A 2B1AL 5JA9A 5C0DB 2BSDA 5IVNA 2XWTB 4X6DE 3PJNA 4PR5A 4XCFL 4HU8A 2FJSA 2JV6A 4LQFL 3MRPB 1YN7A 2BNUA 1ZSDB 3PWPD 3ZZSA 4GB9A 2HJLA 7FABL 3QPXL 2VIRB 1I85C 4OV5A 3HRZA 1ROWA 3DX9A 1DBAL 4ICXA 4M8RA 5FLUA 2PR9A 4R0LA 3S34L 4EI0A 4JK0D 1D5ZA 4FG6D 3MRNB 2IV8A 1DUYA 4KO7A 3B83A 4N2IA 4Z76B 3A6CL 5E1HB 3SPCA 3IE4A 2VLLA 3SKNA 3UBHA 1IO4C 2O61B 2E4FA 3EH2A 1GGCL 2Z6FA 2WO4A 3M46A 4U4IA 4E0RA 3U7YL 4KTDH 3WXWL 3PHQB 4MDIA 3U6XA 5BS0D 4NIKB 4TUUA 2A4EA 3B7YA 2B2XH 4TNVK 1F45A 3FNKA 2W07B 3SYPA 2PP7A 3L2MA 5DS8B 2RCSL 4YR6A 3ZIMA 2NYKA 4K3EL 1HVXA 2XPZA 5J1SC 3IT8D 1I9RH 5CO1A 1J5OL 1X5YA 1LQBC 2IG2L 4E41E 2GB2A 1RZIB 4J5VA 1YO4A 4FHKA 1JCKA 4H0LC 2CCWA 4G70B 2OSYA 1IBBA 4F20A 3QEQB 4O2CB 4PJXE 1X5ZA 4TQPA 3OLGA 1UM4L 4OF5A 4EDXA 4ZFQA 4M9PA 3LRSA 4OCSH 3MSPA 5H4ZA 4JAMA 5J06A 4R7DB 3WV0A 5HPMB 1X9LA 5JHDA 1TYRA 4GSQA 5ERWA 3WBDA 3RTQD 3MJ6A 1JGUH 4R4NC 4G6FD 3GIZH 1MFAL 1CFSA 1SY6A 1E9OA 1DTUA 1KPRA 2ADIB 4QY8B 1UH3A 3KLHC 1GOFA 1OCOB 5ESAA 2PYED 4HBCH 5EA0L 3SBWA 1SNRA 1ZV9A 3MZTA 1H6UA 4KKNA 5HHME 5GISL 3FUIA 3MNDA 2GQHA 2P8MB 2R8SH 5EV7A 2YQBA 3HEIB 1DVFB 1VEMA 1SBSH 3BQVA 2IV9A 1PX4A 4EIZC 5I1HH 4GS7C 3PGCA 3ULUC 1OAKH 1JF6A 4HUCA 3KPNA 3UO1H 1KB5L 1RJCA 3CN0A 5CP7A 3C5XA 5A2IH 5J89A 3W0WA 4MDRA 4ACTA 4WI7A 4BZ2H 3HBQA 2X6MA 2XQYA 4WJ5B 3KYOA 1UATA 4IIQA 4XMKH 4H0GA 2VSCA 4WHCA 3O4OB 5F1NA 3ULVE 1BHGA 3EH1A 4P0DA 1AGBB 3BAIA 5IQMA 4GAJL 4DQOH 4MJ5B 3CSBA 3X3GL 3PWPA 1DSFL 2NUPA 5L6YH 4WNQA 4IBQA 2YC1A 2WBKA 5IJVA 2BWDA 3DVIA 4MKMA 1PKQA 2Y4SA 3W37A 1FYTE 3NPZB 3E38A 1TJIL 4HIHB 4KFZC 1J8HE 4TUOB 2VR4A 4DF9A 2PWEA 1QTSA 1C1EH 3PNWB 4JQIL 2OXHA 4P46D 1QTPA 1ADQA 2YAEA 3MUHL 3JWDC 1I3RB 2E8YA 3GSOA 5EEVA 2Z35A 1FGNL 4XBGB 2BNQB 5IT2H 2CG9X 2HLEB 2G5BB 2ADGB 4OCLC 5BS0A 4RCAA 3LN4A 4LCWA 4TQHA 3BKMH 1L9MA 4HISA 3NT0A 1G9MH 4R7NA 4YAQB 1FG9C 2G30A 2AJYH 1EJFA 1HKFA 1ITCA 1XZ0B 1RUAL 4KRPB 1AGEA 1G7HB 2O5NA 2YJLA 3JUYA 4NEHB 1Q0XL 3VG9C 2HH0H 3CSGA 4Q9CA 5B39G 5JIQA 2RTTA 4FULA 3CSPA 2AXJA 1BW8A 4LSPL 4PBXA 3R7RA 5HD8C 4PYHA 2ZUVA 4DGVH 3BIAX 4JPIB 3C5SA 5SWZE 1T1XA 3NJKA 1G94A 4WEUD 3CQFA 4M7KH 2O5YL 1NMBL 1KBVA 2PW2B 3C5ZB 4Q6IB 4LXFA 2CMRH 2YPVA 5GS2H 3UPRA 3T8XB 2HWZL 3APMA 4DGIH 2VRQA 2C9QA 2R0LH 4NFBA 1CLZL 1JWMA 2V7HB 2EIDA 4BFBD 1OT1A 2AAAA 4JJ5B 3V0WH 5K9JH 1WWWX 3RTQA 2ADJA 2BSRB 5D7IF 4HH9B 1BEYH 1NFDE 2XWJA 1EGJH 1AGDB 3CX5K 4JN1H 4ZBJA 1RMFH 2VABB 3L4YA 32C2A 4JKWA 1A9EB 3QQ3B 2PYEA 4J7RA 5AW2B 3CC5A 1JYNA 2WANA 3PJSA 3SOTA 3UTZB 2FWOA 4HS3A 2AK1H 3NBNA 4KQ0A 3ZHLA 1DHKA 4ZK8A 3VVWA 2L8AA 5CZRA 3BXNB 4NQVB 1YPZF 3OGOE 1CT8A 4OZFG 4JO1H 5KVFH 2AEQL 2EEAA 3HZKB 1G87A 1NAKH 4PUBL 3P0YH 1MHEB 1JPGA 4RFEA 1Q0EA 2GBVA 1UD4A 3S9DB 1G4MA 3I02B 2BS8A 4NAJA 4E42B 4YIQA 1YNKL 2FHCA 3UAJD 5D7EA 1A14H 1Q9LB 3OHXA 4G8GD 2DYPB 5EU5A 5I74B 2PP9A 1QBLL 3Q2WA 1C16A 5D7SH 4I2XB 4EQ3A 4I85A 4HSAC 2NMSA 1AKPA 3IKKA 1WIUA 1YJDH 3M1OA 1UB5A 4X8JA 3VJ6B 2EADA 4KDTC 2NY4D 4K7PH 1TZHB 2BOCB 3BFWA 4D0DA 1JRHH 1X7QA 4MNHA 2PPDA 5L0QB 4HS8L 5I5MA 3WNOA 2IPTH 5C0CE 2HXAA 4IKIA 1K2DB 5E2TH 4KHTL 3HBZA 2CJUL 4BSJA 2WKOF 2AQTA 5C09E 3WTWA 5SWQB 3QUYC 2IH9A 3MRLB 3O4LD 3QORB 4FQHA 5C0IB 1YDPB 2X1WL 2GT9A 3BUPA 4PWGA 5IHWA 4P46A 3U7WL 2QQKL 1XX9C 5F88B 3Q0HA 2E9IA 3UJTL 2P5WE 6TAAA 3LEYH 3RUGE 1LM8V 2OTWB 4XZUA 5DZJA 2JKIS 1A8ZA 2ZPKH 3X2QB 3IFNH 4LIQH 1MHHB 3CFJB 4LSVL 2JCCF 2EC8A 1BBJA 3DARA 4X7SH 2A74C 2UZXA 1GOHA 2FIKB 5CGMA 3ZTDC 3NJNA 5ECGA 5FYJH 4WFGD 3WFCH 5HHNB 4XNXH 1SY6H 1GMEA 4UANA 2X6BA 5DURD 3BD3A 4HKZA 4EVNA 4WEBL 1SJHA 5ITBL 4W6WB 3EF7A 4P23D 4X0KB 5KYXA 4XVJL 3E8UL 4XGZB 2AZUA 1Q9OB 1FNFA 1DJYA 4L4JA 4F15B 1DQMH 2K45A 3L3HA 4OZGA 3QO1B 5FGCE 3CDGB 4WFED 1U4EA 2DQDL 1QI3A 4ODHH 1JTOA 3V6ZA 3LVTA 4BWUA 2E6PA 1MFCL 3VFTB 4PLKD 4N0RA 1WH0A 3RPBA 2AQSA 1E4KC 1OAQL 2F54E 2QKIB 4ZSOE 3S37H 1VADA 1BXAA 3QNFA 3ARBB 3GLDA 4TS6A 4H26A 1J8HB 3LQMA 3O8XB 9PCYA 5DEFB 5KVDH 4JY4B 5KBNC 1TFHA 5D1ZC 1YMME 4LOUD 4Y4FC 5EBWB 1HC1A 3GGWA 4KOCA 1HINL 1Y7VA 3X1GA 1MFVA 1MCEA 4YLCA 4EUPA 1BBDH 3VNZA 3SBPA 3CFQA 4YHLL 4QUOA 2KLTA 4QHKI 2OK0H 3SGJC 3DURB 2W65B 1W15A 5HHPB 3P9LA 2UV3A 1KEMH 3FSOA 1UACH 5E23A 1XGYL 3QEQD 2NY1B 1ADQH 5E94B 5MHSE 1R6VA 3UAJA 3B7SA 5TFSH 4D94A 1JG9A 4G8GA 1YEIH 3RGVC 2WSKA 1I9EA 2K8QA 3WEXA 3FQ4A 4FQ1H 3FCTA 2B15A 3L3DA 4HJ1A 4JM4L 2B7DT 1GZPA 1KZQA 4MD4B 3TEXA 4A55A 5HDRA 1M3JA 4HUNB 3T3ME 4B7IA 1HXKA 2DWEA 3DBXA 3TT1H 3ZHNA 1YLBB 1CQKA 1MCPL 3GRBA 3VAEA 3EO1A 4N0UA 1FQ9C 1WDAA 4FXKB 1YPZA 4PGDA 1DVSA 3MRQB 1H9VA 2MQCA 4GFXA 1MFNA 1HTYA 3J07A 3N42B 4PB9H 3O4LA 3FF8A 5JOPE 4F8NA 4D0CB 4FQQB 1P4UA 1BFVH 3SCMC 5JQIB 5EF2A 1DVFD 1MH5B 2XRAH 3H85A 3M1BA 5JQHC 3TEWA 4MX7A 1TVBB 4HJJH 4Q74A 2IADA 2A9CA 4YDVB 2XG5A 3DRTA 1QRNE 2DJMA 4P2OB 3OR6B 4PS3A