4Y2NA

Structure of cfa/i pili major subunit cfab trimer
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
147
structure length
147
Chain Sequence
HEKNITVTASVDPVIDLLQADGNALPSAVKLAYSPASKTFESYRVMTQVHTNDATKKVIVKLADTPQLTDVLNSTVQMPISVSWGGQVLSTTAKEFEAAALGYSASGVNGVSSSQELVISAAPKTAGTAPTAGNYSGVVSLVMTLGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Off-pathway assembly of fimbria subunits is prevented by chaperone CfaA of CFA/I fimbriae from enterotoxigenic E. coli.
pubmed doi rcsb
source organism Escherichia coli o78:h11 (strain h10407 / etec)
molecule tags Structural protein
molecule keywords CFA/I fimbrial subunit B
total genus 17
structure length 147
sequence length 147
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-02-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2040 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4y2nA00
3F85A 4Y2OB 4Y2NA 3F84A 3F83A 4HJIA 3VACA 2HB0A 4Y2LA
chains in the Genus database with same CATH superfamily
1YEIL 4KNSA 1KJVA 1HAUA 3UTTA 1AS8A 2X44D 2ZUYA 3RGVD 4X5PA 3KM2A 2A0LC 3L4YA 5DYFA 3N1GC 3B8YA 15C8H 4JFYA 5E2VH 5M94B 1NMBL 3F58L 3D4YA 3F65A 2H26A 3GXNA 1NAMA 3CZSA 3LKOA 4HV8A 3GSXB 4DW2L 1NTDA 3EZ8A 4S0SD 3UTQB 4CSPA 4HK0A 3EOBA 2FJSA 5JHDE 4LK4A 3VG9B 4ELME 3VXMB 4IGBD 1PEZA 3HZKB 3FT2A 4GG8A 1OCWL 2BIMA 5I17B 3MOBH 3PGFH 4MBOA 1G1KA 1KB5L 4PJIA 4XO8A 4EDXA 1P7KB 3G5WA 1X5ZA 4JNXA 1CF1A 1Y6MR 1X7QA 1TETH 4DGIH 4LSUH 3WY3A 3KH3A 1U41A 2JVUA 4ZFOL 1SFDA 3PV6A 4JFVA 3TTSA 3MRDA 4HG4J 5CR8A 4XPAL 3V4LA 3B3IB 4ATTA 4UTAH 4JQVA 2WBKA 1COBA 1S5IH 3QDMA 4PLKC 5EU6E 3RQ3A 3EFDH 3QFJD 2APSA 2A73A 2FJHB 2DTMH 3BD4A 4ZMOA 2VW7A 4G71B 5MEQA 1QYGH 3MCKA 4DIXA 5I75B 2YLHA 1ES0A 4Q0XL 3HG1E 4AJWA 1RVFL 5FA4B 5AQ0A 2A77L 1NGZA 2ITCB 3TCTA 5I74B 3DARA 5EBWA 1P7BA 3X1FA 3OQ3B 1ZHBB 3H7BA 1M53A 5DMIL 4IEFB 4D7PA 1NCNA 3NH7H 2W59A 1PFOA 1AKJA 2WLHA 4FJYA 5BRZA 2DQUL 5E8EB 4PJEB 4PP2B 5J7CC 3LQAC 4X7FC 5G4NA 5AD0A 1SY6H 3GLDA 1T3FA 5C0DB 2J72A 5JPNC 1GYVA 3EJZD 4HS8L 4ODVH 4PD4J 3BSZA 4F91B 1OAJA 5JW4N 1I9RL 1WAAF 2K6ZA 2NR6C 3IDGA 5T5NF 1UOKA 2ERJB 1MW0A 2C1OA 3TF7C 5E4IA 5CBEA 1UB6B 1GC1H 4EIUA 4L0YA 4LVOC 4AXWB 2EECA 3C5XA 2AQSA 2FEDD 2HJLA 3SBPA 3OG4B 3Q5YA 3ZE0F 2WZAA 5PCYA 3WNIA 2V9UA 1I1AC 1HOCA 3G04B 1OD7A 3K3QA 1ZEAL 5D4QA 4FA6A 3WBDA 2H32H 2FECL 1AGEA 3Q5OA 2Q2EB 1A8JH 4KROB 1NDGA 4MMZA 5JO5B 3MRNA 3V6BR 4TNVF 3D3VD 4L5FL 2DJ4A 4KTEH 1JK9B 2Z8SA 5IVXA 4W9DC 3Q8FA 1JZGA 4OZ4A 4MHHI 3ZTJG 4P4KC 3I02A 1ONQB 3NFPB 3QXDA 2JJWA 1EV2E 2OCJA 3UPRB 3NJIA 4XXDA 3ETBF 5E7BA 5F7NC 5F7YC 4UOJA 1HTYA 5D2LA 4KKBC 5BPPA 4BINA 3LH8A 5C0BD 3U2SA 4HKXB 1EJOL 4V1DB 4CMHB 1OGTB 3TBVB 3ZTNL 3MKKA 2PYEA 1J1XH 5F9DC 3QIWB 2GBAA 3Q8AA 2ZUUA 4N2HA 5F44A 2DQFB 4Y2LA 2APWA 3QAZC 1QO3A 1T1WB 2D4DA 5IMLB 1QNZH 2Z93B 4MCYA 4MKTA 2DMCA 3OKEA 1J0KA 1U91B 5FYLL 2WLMA 3VH8G 1EQWA 4IIQA 3RLSA 3VFSB 5TF1L 3UTTB 3EYQD 3FPXA 3LH9A 1XGRA 2B4CL 2J12B 5AW7B 5TGBB 5I1CH 1GJWA 2VMCA 1JFHA 2EDTA 2VLJA 3QFJA 2R2EA 4TVPL 5F71A 3LKOB 4DN3L 4JKPH 5GQBA 1BMWA 1SEBB 2F1BA 3WKNA 1NAMH 1ZK9A 4UV7L 1U8PA 4LPVA 5CUSH 1L9PA 1R0AH 3OB8A 4HUVA 3Q1SH 4HFWB 1I8IA 1UJ3C 4O2EB 3HFML 3ME0B 4TVPE 4YHYB 2Y6TE 2R51A 4Z78A 1IM9B 4HIJB 2FIKA 2HP4A 3EOAB 1EHLH 4JGMA 4AEHL 2VDPB 2WPGA 1IKNC 3UTPD 2CJUL 3PE9A 1TXKA 3CUPB 1C12B 1F4WH 5F2FA 1KACB 3ZPDA 4BBWA 1IAKA 2WZ6A 3IAPA 3M7FB 1FP5A 3V6ZA 1CFTA 2L0DA 2JQAA 3ALXA 4Z18A 3ET9F 3UYPB 4I18A 1ED3B 5EU7E 2D7OA 2YLKA 1U0QA 4G8GB 4DK3A 4J5VA 1ORSA 5J8OA 3GXFA 4PLJD 3QZWB 5F9OL 4GKNB 5DA0B 1XEDA 3HVNA 3T1FA 5EU4B 3K81A 4G70B 4ODUA 3TC9A 4IOSA 4JMNA 4RBPH 1M2VB 2B9AA 3D50A 2O5XH 3FT9A 4RMWA 4WW2F 4IEFA 1Y0LB 5ALCL 3ZMEA 3P0YH 3X17A 2DWEB 1GYAA 4FQQB 2CKBA 2A6JB 4CKVX 5MENB 4BFIA 3G5YB 3HNVH 2HXAA 2VDKH 2V4LA 2R1WB 5F96L 2CGZA 3NJKA 4MZ2A 4WI0A 4M5TA 3ATAA 4A7VA 4ADJA 4AH2A 1Y6NR 1W6LA 3BPCB 1A6WH 3M1OA 2P42B 3OJMB 1PEWA 1GKOA 4AENA 3MBWA 2ZJSH 3D7PA 1HHIB 2IAND 3JV5A 5AVRB 5IQNA 1CFSA 4A63A 5D70H 3NGBC 2X9YA 2EYSB 3D30A 1IC0A 3MOBL 3LEVL 5F93C 4PMEA 3SE3A 4PRDB 2JIXA 4XT1C 4FMVA 3LZLA 1KIQA 4K7FA 3I3EA 1PX8A 3SDAA 4Y19D 1AGEB 4UOZA 3L1OL 2Y2WA 2ZCKH 3GDCA 1GZQA 2BIQA 3OKKB 3POCA 4NRZA 4Q6YA 4DW2H 2CDGA 3T6QC 4E0RA 2IG2H 3QDGE 4KJPD 4AYBA 4X6DE 3RPKA 1J1OL 4KXAA 2WYHA 5DD0L 1U33A 3QJVB 1RUQH 4Q58C 3RI5F 2UWEB 5FCUH 1RL1A 2JJTC 4A67A 1BLNA 3BUYA 4GEIA 4BFEA 3NAAL 2BY3A 1BV8A 4IHBA 4D0BA 3RWIB 4RRPM 1JHTA 2CLRA 1FNGB 4X99A 5D9SA 4K5MA 1OO2A 3V0VB 3EAKA 3O4OC 4YUEH 3ATBA 3ZW3A 1YJDL 4C4BA 4PW3A 4QT5A 3FTGB 3JSSA 3LB6D 4V1DA 4ORGB 2Y36L 3K72A 3OV6A 4XC1L 4P0DA 5CLTA 1OSPL 2XIDA 2VXSL 3H9ZA 5FC9A 4ONHA 2BNQB 4DHLA 3CX2A 4XNUH 3CU7A 2WAHA 4HLZG 1SOSA 4JDVB 2C26A 2XHNA 3QO1B 2DQJH 2IWGA 4XH2A 4ZPVA 1OV8A 2BHYA 4YFLI 4HK3N 1UATA 4NWTL 1HH9A 3U36A 1YYCA 4M56A 3QIUC 3F12B 4Z0BL 3CLWA 3QEGH 4LFHG 2BDNH 3TEXA 1KXTB 2VABB 3GIVA 4M02A 1CR9H 1V7NL 5C0AE 1EFXB 5IHZB 5IQ9A 5HYEA 3N85L 2MRYA 1F8TH 5AAWC 2AJUH 1IE4A 4G43B 4YBLC 2A9BA 3TA3B 4O51A 3QDHA 3ABZA 1NUGA 2YC1B 2ED7A 4I7ZC 2R2EB 3X11A 3H42H 2GTWB 4DT2A 1HEZB 3D08A 3HZVA 4JE0A 4Y2DD 5DMGD 4A2EA 2CUAA 3NCBB 2PO6B 5BUGA 2F8XC 4C56D 4M43L 2G0LA 4YDIL 1RZKH 5C86A 3BLKA 5GJSL 2IBBA 4KI5E 4OJCA 1OCRB 5I6MA 3ME0A 2B3IA 2AJSL 4RCAA 3CSYB 3REWB 3SJVB 4UT9L 2IADA 5EZLB 4TUJB 1Q1PA 2WKOF 2AEOA 4BK4A 3MLRH 4Z7AA 5AW9B 3GBNL 5KANI 3JTSB 3D3VB 2FO4A 3GB7A 1HOEA 4QRTA 4PRAA 2CG9X 4ODTH 4Y1AA 3MA7A 1RUPH 4MMYB 5B7MA 4ZT1A 2XYCA 3VXPB 3ARDC 3MRCB 4Q56A 4AJYV 1SEQL 2ICEA 5E00A 3PFUA 4KMLB 3KW8A 4F7EA 2XY2A 4GMSH 1FRGH 3HG1A 5EOCH 2NW3A 5FOBA 3K2KA 4KTDL 1OARH 1YEDA 5IGXH 4P5KB 3UTQA 3APNA 4A68A 3MRIB 3U9WA 4ZMAT 1KGWA 4PJHF 3QRLA 3L3HB 3NZ8A 5JIPA 3AS3A 2Z4TA 4C59B 4F33A 3ZIMA 1DDHB 4X6CF 4PUBH 2V2XA 3ZE2E 1FF5A 1HE7A 1GA2A 4Z7UB 1GAFH 3SPGA 4LKXA 4PTUB 1E4HA 3GKZA 1SHMA 1T7VA 1OW0A 3QWRA 3WLBA 3M86A 3LRMA 3D07A 3TVMC 2GITA 1P1VA 1AO7A 4OGZA 3ARDD 5JIKA 1JMZA 2F54D 2VLRE 3MBWB 2YPKA 5EA0L 4AOFA 1PQZB 2J8OA 4A6YB 5B4MC 3ZHLA 5IHUL 2BMKA 3X12B 5B7FA 3MGAA 4UT6L 3ATFA 4WFEE 1U8HA 5KVEL 2AXGA 4JRXA 1MAKA 2P80A 3EYFB 2R2HA 2JQZA 3KEDA 1MCFA 4JVWA 5C3IA 2YEZA 1I7TA 1ZANH 5HDOA 4KUZH 3FKUS 5TFSH 3GSNL 1ZCRA 3MSPA 3ZL4H 5J13B 5JXAL 4A7QA 3GJFB 1OPOA 2X4SB 4HAFA 4I3GA 2AEIT 1T04A 3VE0B 4KRPD 3S37L 4DK5A 4PLKD 3H9SA 4LAQH 5D7LB 4H2CA 1E4WH 5E5MA 5ELIA 5F1IA 3HR5B 4A7TA 1X7TA 1E2ZA 1SJMA 3RWIA 1CDIA 5EIQA 3IDGB 2I7SA 4WUKL 3UJJH 1XGQB 4YR6A 3W2DH 1NC4D 3HRPA 5DUPH 1U8JB 2WJ5A 5L9DH 2HMID 5DCCA 1FFPA 3OD3A 3IMVA 1S9WB 4N90D 4R96B 4WZ9A 2F19H 1A4JA 1QFHA 5ICXB 2EKSA 2WWNA 4DOHB 4RA3A 2LU7A 4OQ1A 2K9UA 2OL3L 4XVOA 3PL6D 1RZFH 4OCRL 4DQOH 1Q9KA 2ICWJ 4WI7A 2R4SH 2AJXH 4F3FA 4NS0A 2OXHA 4QWWD 1CFMA 4Z76A 3EJSA 4HPHA 3BN3B 4UQ3B 4PJAB 2EJ1A 2HFFA 5FV2A 3Q6FB 3AUVA 1TJHL 4U05A 2J8UB 2WBJC 1GCFA 3GS0A 3IFLL 4MDJA 4JFWA 5HHMB 2F6AA 2MQ3A 4NBYB 4YHPB 4BXSV 5E0FA 1N6QH 3S9DB 4NNPH 4RZCB 4KZEL 3UPRA 2R9HD 5FM8A 1MUJB 2CA4A 2Q8AH 2EZ0C 1BSIA 1OCZB 1T1ZB 1E40A 2CO6B 3BI9X 2P5PA 3IVKA 1QRND 4JFZL 3QG6A 4YHNA 5KJRH 1MJJB 5F3BA 3MCLL 2XFGB 2XNAA 3NK4A 2B4CC 4AC2A 1VSCA 3DX9A 3UX9B 4NO5A 3P11H 5D1XD 3REWA 3ZYJA 2WNKA 2QDWA 4LL9A 4U33A 4PJ7F 1RULH 5GRJL 5EFIA 5ADPH 1FLTX 1D3CA 1HIML 1NCCH 3CAFA 3V4VB 1FFTB 4M7LT 3BCDA 4LHQB 3D2TA 2OKMA 5HGAB 1KYAA 3SGKA 3RA7L 2EXYC 2FQGA 3BQUB 1XCTA 3GB7B 4HK3J 2PTTA 3VXUB 4RWYL 4YGVA 1SJHB 1RERA 4FE9A 3APDA 3ISRA 5I1HL 3Q01A 2MPAH 2PXYD 3LB6C 5TQ0H 4CGTA 1XR8B 1FNFA 1AC0A 4NC2B 4JDTH 1YEKL 3VWKA 5ILTH 5AENA 5D6CA 2NCEA 2BVPA 4PYGA 1JPGB 4GP8B 5CJOL 3EG9B 4L8SB 2DQMA 1I4FA 5AVQB 5H94A 3CQQA 3KWXA 5SX4I 1DDHA 3U2IA 1R5IB 1ID5I 1PZ5A 4M8VA 1JRHI 4BK8A 3QAQA 4NKMB 4X6CB 3CUPA 4NQDA 4LKXB 4NUJB 1O6SB 1H3PH 4YDJA 2J88L 1ZS8B 4OQTA 2ZUQC 2G4EA 4UZUA 4KO6A 2WUBH 1ZT1B 3V6ZB 3KXFB 5D2NC 4ZAKD 3KLHC 2NDGA 5FO8B 5L4MA 5JR1H 1EJ6A 1RLBA 2CXGA 1H3GA 3UOAB 1KGUA 4A38A 4HXBH 1G7JB 4GAFB 1IGFH 4PRNB 4ELKA 4OU3A 1LTXA 2Z31C 4WCYH 4A7SA 2WQXA 1GPOH 2NNRA 3KPQA 4JRXB 5E8PB 2F0CA 5C9KA 2TRHA 1EHAA 5DO8A 3ECBB 4R4BA 1EHNA 1IM3A 3FU6A 4LSVH 2HUHA 2NXYD 5EC1A 3TCXA 3UPAA 3VXRB 1SN5A 3WL9A 3LXUX 5H2BA 5E1IA 4MS6A 4M1DH 1S6NA 1T04B 2CHWA 3BDBA 1Z3GL 4OLXL 1QOKA 1CYGA 1M05B 3AU0A 4PJGF 2X6VA 1N8OE 4Z7UE 4OD1H 3PWVA 2A6JA 4OLEA 3FCSA 2YKLL 3U0WH 1MRDH 4I2XB 4YDMA 2BVQB 2QADD 3LSOA 3WLWC 3BT0A 1LK3L 4HUNB 2Y06H 4WI0B 4DEUA 2ED9A 3BKYL 5HYJA 2CE6A 2OPCA 2VIRB 1D6EB 3BHBB 1CB4A 1OSZB 1WCQA 4V1DE 3DO4A 5CBAA 1MDAA 2W9EL 4ACPA 2FX7L 1PD0A 4DPAX 2NY4B 3K4DA 4QHLA 2D03H 3NCCB 5BUAA 1OL0A 1MKFA 4FEIA 1J8RA 3I9IA 2D2OA 1YC7A 1YECL 2HRLA 3T4AC 5KS9B 2Z92A 1O9WA 1ODAA 1QSFD 4ZQKA 5EUKA 3SPVB 3D3VE 2HFFB 1XH0A 3CSTA 4NAMA 1LHZA 1QFOA 1YA5A 5KG9A 4JRYD 1YEGL 4XCNA 2J8UA 2XKUA 3AVEA 1WDAA 1SNRA 2CO3A 4IRZA 1T20B 5KSUA 1KPRA 1ETB1 1G1YA 2ZP9A 1FL5B 3FYIB 1CDUA 4MB3A 4QAMB 4TNEA 1IGTA 4N6RB 4UTAA 5CIPH 3LKSA 3RY6A 2F8IA 3VFUB 2QVMA 3KXFD 4OQTH 4B53A 4KX8A 1JYVA 3J2PA 4IU2A 5LDSA 3CN2A 2XACC 5FYKU 2VERN 1X5MA 3L5XH 3QPXH 4WFHD 3GUTA 3OJDA 1MHCB 1SMDA 2ZYSA 4LP8A 5T1DL 3TBSB 2KBGA 5ACMA 1UH4A 4KO7A 1TQTA 3SSGA 1KCSL 3P73B 2UZIH 3PWPB 4BZ2H 4EI5C 5J06A 5FUZH 3LN5A 3H2WA 3THMH 4F7PB 5D7IF 1BXUA 4YSDA 3UROR 2ZT9C 1U21A 1C5BL 4NCC2 4NQEE 5GHWL 4N0YL 1QHQA 1HH9B 3BPOB 4YHYC 1H6TA 4EN3B 2WBXA 4PBXA 2ZXGA 3JWNE 4DWHA 1CD9B 4X8XA 4AL8C 3TBTA 1KJ2A 2XTLA 3LXBA 3TNNB 1NEUA 4NJ9L 3VXUA 4F8OA 4XWOD 2ATKA 4L9DA 3VQ1C 5DVLA 3UTSD 3K7UA 1HNFA 3IJEB 3OF6A 3QIBB 1NKGA 5HYSB 3GXTA 5ANHA 3X11B 3FQUA 3QJUB 3Q9QA 5JHLA 1Q94B 1VZGA 3VXQA 3RDTA 2CUMA 2VITA 3LZQA 4B9IA 1JGDB 3FUDA 5EU6B 1EZSA 3MVSA 3QCUL 3MO1A 3ZBMA 2X3CA 3QXAA 1NCDH 1I1AA 1UXWA 2BOLA 1T66C 3K5RA 5DTFA 3FO1A 4M6NL 1NUNB 4OD1L 4YSSA 1N0XL 3KWUA 2WZ0A 1ET8A 5MP6H 4OZGE 1P9MC 1S8DB 3C5SA 1NEZB 2I07A 2VLLA 4FXGA 4DVBB 3SBQA 1IARB 1UCBH 2XTJB 2A4EA 5D1ZD 2PMZA 4WTZA 4L18A 5J6HA 4BFFA 4ELMB 4FFZH 3OPUA 1W72H 4B9KC 2XG4A 3OB0K 1RIVH 3QB7C 4E9SA 2VR9A 3WIHL 4L8SC 2EXWD 4AKQA 4ODWB 4M03A 2ICEB 4L23A 5E00B 4GS7B 1EO8L 2J5LB 3ZY7A 2B0SH 2IMMA 1KIRA 3TJEH 4K5LA 4XPHL 3S0PA 5HVGB 3WL9B 3DV6A 1E9PB 1WTGT 2LGNA 1ZLWK 4F58L 4OV5A 1WSST 2CM6A 2A9AA 1S4IA 3KL0A 3V4VL 2ZYIA 1BPVA 5I8KL 3RNQB 2N7AA 3NSXA 4NOBA 3CJJA 3QHZH 3FCSB 1CURA 5MENE 4APXA 2F5BL 3T8XA 4FQIH 4LEOB 4NJ9H 2NYYD 2R4RH 2BVQA 3ZZQA 2EDDA 2ROXA 4MB4A 4DP5X 3SDXA 3GXPA 5C6WH 4U7SA 5DUMH 2QKIC 4G6FD 1J8HB 1MNUH 4JM2B 3O6FD 3E6FB 4L4VD 5GGQH 3QZMA 1FIGH 3WKQA 4K3JL 2Z64C 1IEAB 3FTSA 3PWNA 2PCXA 4IHOA 1NCOA 3KLDA 1QNIA 4HIXL 3HC2A 5ILTL 3SD5A 3ZMRA 4C56E 5AOLA 4F5CA 5IMKB 4XMKH 2ZX9A 5HI4C 4DUXA 5I1HH 2JKWA 2EDMA 3EXLA 3MRKB 2H5UA 4K2UH 2DH3A 3MLUH 4F2ME 5LNGA 3HNSL 4ZQKB 5FGSA 2FJFA 2WXIA 4C4KO 1WZAA 2EVFA 4PGJA 5KG9B 1P7HL 2CLVA 4OZIF 1NCCL 2BNRD 4Z7VB 2WP3T 4KQ3H 5C92A 1PTZA 4KRPB 4OLUH 4AX3A 5DUBA 1NFDE 4N6RA 1KULA 4JG9A 3AT0A 1NGZB 4ABQA 3OXRA 4Z7QF 4AYID 4QTIH 4GI8A 3GUTB 1N5AB 2DQEL 2WWKT 3D2UA 1YECH 2QLYA 4JFZH 1U8JA 1YNKL 2WLIA 3FHAA 1R19A 4A1RA 3OKOA 5I9QB 4ZW5A 1AD9B 1F3JB 2CJ3A 3NZHL 4JPWH 1CXFA 4PJEA 3HBQA 4PP2A 5IJVB 3FQRB 4HFUL 1UG9A 2JNZA 4NNPL 4U1LB 3E2HB 1WV7T 1EJ8A 3K80A 3W38A 1TJHH 3D18A 3BKYH 1KCRH 3F7VA 2FO1A 1HZKA 4Z76B 3BQVA 1ODUA 2DEWX 4LLDB 2Q8BH 1EXGA 3PP4H 1JWUB 3QZOA 1HNGA 3QR2A 2AJXL 3KDMB 4KVNH 1T0NB 2Y7NA 2BP8A 4KAQL 5JHLH 4E9RA 2DDQL 2FBOJ 1ZPUA 1DVSA 2OL3H 2OMNA 4Y2NA 1T7ZA 4F37K 4Y4HB 4CC4C 2NT1A 1LO3H 5EO1A 1JXJA 2GC4C 5EOQL 1GW6A 3MXWL 4E5XG 4MMZB 5I6XB 3MRNB 2AV1A 4YHKH 5IQLA 4ZX6A 1J5OH 4FFYA 3NTCL 4PHXA 4YFDB 4F2EA 4O4YL 1IVTA 2EDLA 3QC5X 2ZSWA 4LRNL 4HWBL 1E6JL 3VI4F 3WS6A 5TD4A 3L1EA 1DBAL 5D93B 1T0OA 5GS0L 3B9VA 1U8IB 2YD3A 2G2PA 1KY7A 5E8OB 5DFAA 4R3SA 4UM9A 5CCJA 5FWQA 3FB6B 3V5DB 1NKOA 1UWEH 2EYTA 4YDLB 5JXAH 4OZIA 2L7EA 2V9TA 1MWAA 4X8GA 4UV4H 2WCSA 4OB5H 1XCTB 1K85A 3CDGA 1D7CA 4UUJB 2GFBA 3QJHA 3WJMA 2R7EA 2KYIA 2AJYL 4O02H 3EZJB 4TUOA 3DOSA 2HPTA 3GI8H 3BIAX 1W8OA 1JWMB 4EI0A 1RUMH 5CFAA 2BXZA 3ZZLA 3GMRB 1LL1A 4NERA 4LLUB 3D1MC 3OKEB 1HKFA 4X4XA 3SCMC 2DWDB 2XN9A 1GZPA 4R90L 4R97C 5AW6B 4F1ZA 4F7CB 2IDTA 2XVGA 1NFIB 4OD2B 5FHBH 4PS3A 4H8WC 4MRBA 5KYXA 1BX2B 3MLZL 1G6RB 2Z34A 4PJ9B 1L0PA 2ODHA 1CGUA 4HX1A 4RWYH 3TFKC 5AZ2L 1MREH 2EIKB 4FFWC 4AYDC 3QULA 1SMOA 3QUML 1E6JH 4WJ5A 4HD9A 2H2PD 2AZUA 4OZHB 4JM2A 3SGEH 2UX6A 3GXIA 2ZSVA 3MUJA 3F6IA 3UZQB 2PXYB 4A6YH 3DJZA 1WP6A 4TF4A 3CVIH 1I8KB 3S4SB 3EJZC 5IP4A 4FL4C 5IMKA 3ILPA 2G5BB 4BYHA 1CUOA 3L4UA 3C6LA 4A04A 4MWFB 4AUUA 2JK5A 4LPXA 4JDZA 4QGYA 5DR5L 4LAJH 3I9GH 4TMPA 4BA8A 2OZ4L 4HWZB 1PNCA 2UYLB 3W57A 2Y0SA 3Q44A 4JQIH 4ADGA 1RZQA 2Z7WA 4PRPA 3VGDA 4L8CB 4MAZA 4JO1L 2UUDK 1GOHA 1PG7X 4KRMB 5BRPA 3CH1B 4BZ1A 1M05A 4FFWD 2I27N 3KYNA 4MJ5B 4J3SA 1C5CH 4ENEC 3P1VA 1Z3RA 1NGQL 3O6FB 3ARFC 2MKWA 1K8DB 3VXSE 4WWID 3ULVH 4N8UA 4E68A 1JN6B 1HDMA 5DUJA 4PRBA 3WNPA 3VXME 5C0RL 4JHUA 2AK4B 3GMOA 3BHBA 2CKBH 3DOIA 1F3JA 2BHUA 1TJGH 5C0GA 5HGBB 1II4E 5DZVA 2AV7A 2CKBB 2QGBA 3ZU8A 5I2IB 5MEOA 2XN2A 4UNIA 4PJ7E 4AGOA 1E3XA 3BKJH 4HZ1A 5J11C 1O6VA 1TNNA 3LQZA 1NKRA 2NY5C 4JFFD 4FYRA 3WCYA 5CJBA 1S3KL 4FQCL 4O02A 4M8QA 5L2KE 2AJZA 2NY2C 4FQXD 3ARYA 1KLUA 3LVTA 5DVOA 2WLJA 4OF7A 5JIIA 3LD8C 2ZAGA 3ILQC 4M6OL 1YPZA 5FUOH 1SLVA 2ARJQ 3HJ0A 3QEUA 4JRYE 1KTKE 2HKAA 4YPGA 5KSUB 2DQJL 7PCYA 3TN0D 3ZZ1A 3I6LD 2RCSH 3PV7A 4ZOEA 3IXAA 1BQHG 1V5JA 3UC2A 4Y4KD 2I9LB 4Y5YA 5LCVA 4ETYA 4WW2A 3M1BB 2Z31D 4WSGA 2R2CA 3BC9A 1MHCA 2ZUVA 2C9QA 3FHQA 4RX4A 3OMZA 1JNHA 2VN5A 4PJHE 2XN9E 4P5MA 2D9QB 1OP5K 4YUEL 3E8UH 3RGBA 4Z7IA 5K9QG 2BM3A 5T3ZD 2VSDA 1F97A 5CLYA 4MMXB 2BVTA 3QIWC 4LLWA 1TEGA 2ZWLT 3TU6A 1YNTF 2R4RL 1ZDSA 1NFAA 2AEPH 4JM4L 5JHAA 4GAGL 2AEWA 3V5DA 5TPWL 5LXVA 1LP9A 1G9ML 4HUKB 4XNYL 4HCFA 3VQLA 3T1WA 2QPEB 1LMKA 2BS9A 3CDGB 2LABA 1T21A 4LPYA 3U0TB 5E8NB 4XPHH 3FF8A 1NBYA 3SYCA 3TJEL 1CFNB 1D5XB 1U8NB 4TVUA 1UD5A 4N86A 4MKMA 12E8L 3KLAB 5IR1A 1CGWA 4PWIA 5ECGA 1EO8H 3LEXA 1ZHNA 1E9OA 4AKPA 5D2NB 3IPFA 1KELL 3DXAE 1HC1A 3F12A 2CMRH 5IJKC 4NQVA 1AR2A 2GC7C 2YSSB 3D9AL 1UD3A 1GRWA 4JPVH 1USZA 4OIBA 2V5YA 4LMQE 4EI6B 4XTRD 5EU6D 1EFXA 5IHZA 2P4AB 5EF0A 1I1AB 1FORL 1OAXH 3CHPA 3C2SA 4LIQE 2NY0B 3QUZD 5ID1A 4JDEA 2WXQA 4YHZL 3ZDWA 2CDFA 4OJAA 2JTDA 5TE6L 2GEQA 2ICCA 3RUGA 3ZDZF 1J0ZA 3A5VA 3DSNA 4MNQA 1FWXA 1T0MA 3KVPA 2PXYA 3SGEI 3BEWA 3MLRL 1P4LB 1BQHA 2DI9A 1G9NL 1GH7A 4PJBF 3SJVA 3DVFA 1NGPL 1W91A 3MI6A 5FYJE 5T5FL 3GRWH 4ZO9A 1TZOA 1VJSA 1FGNH 4F57L 1ECYA 3SEPA 5IT2H 3QUZC 1VFAA 5JHDA 1MOEA 4X7TA 5HDLA 5ID0B 4LVHB 1V54B 3V0EA 3LRSA 2OL3B 4KX9A 5TDOA 4AMKH 3GSUA 2YRBA 3AS2A 3H54A 3N44F 3QJFB 5DURB 4BSWB 3MCG1 1T1YA 2YXVA 4CU6A 1IQDA 1F11A 3QA3A 5AW4B 2VB5A 3BH4A 3UBXG 2PXYC 4IW4C 3C5ZD 4DN4H 2PWFA 4JMXA 3HHSA 4YZFE 1CFQA 3TIDB 2MSPA 4FAAB 4AI7A 3THML 2W9DL 1EUUA 4BZ2L 4YQXH 1ZV9A 4ODSL 2PW1B 4HIHB 5F7DA 3VD7A 1AMYA 3QPQC 4TTGA 3E6FA 3QS3A 3LHAA 3ZE1B 2QGDA 4JG0H 3WFEL 4JKPL 4F7TA 2Z31A 3PWNB 5EF2A 4TVPH 2AV7B 3MRPA 3T0BA 2P8LB 3HKFA 3DMMB 4PAZA 3ZSTA 4X7SL 1XR9B 2Q3ZA 2VXVH 3ATDA 3SKJL 5I66A 2SEBB 3EFOB 1OP4A 2B4CH 3L9RA 5I1CL 1PW3A 3P4LA 4O02B 2VDRB 3DETC 5D5MB 1LWJA 2XQYG 5DHYB 3TZVC 3WOVA 5I6PA 3ZL1A 1E4XH 2D0HA 1F45A 4R4FL 1KLUB 1NM9A 2VISB 1QP1A 3JVFC 3KGUA 2X10A 4R83A 1JXDA 3CFDB 2ZCLL 5SWZD 1FVEA 1B4LA 3SDXE 3QUYD 2DQIH 4OGYH 3BUTA 4PJDF 4WI3A 4PWGA 3UMTA 1RPKA 4L37B 3Q2LA 4FQXC 4XPFH 3V0FA 2R59A 3BD5A 4TTDC 4ZX5A 1CLOL 5ENWA 4PVBA 3MV7A 4RNRA 4LP5A 4PD4K 1SZNA 3VYPA 3GJFK 1QEXA 1ADQA 2ADFH 1DJXA 1OY3B 4UT7L 2FL5A 3MRHA 5E03A 1DSWA 1IAMA 1GYUA 4H8HA 3OG6B 2VMDA 4GW4A 3VMNA 4Z3FA 4X7DC 4B50A 5HHVL 1NIBA 5FDWA 4OSUL 1ZJAA 2Y06L 1HCZA 3QFDA 3HG5A 3VD0A 4QOKE 4ZTOH 3D25B 4P2OB 3NRPA 3RUGE 2W88A 1PLCA 3LV3A 43C9A 3ALWA 1CLOH 2O6FA 4V2CB 1YEFL 5CCKH 4FEMA 2E59A 3HNVL 5E6IB 2K70A 4XNXH 3O8XB 4LSVL 2FVNA 1VESA 1YJDC 1T0NA 1FCCA 3S4SG 1D5XA 1U8NA 5JW4M 5LCVH 3R7RA 5C6PB 1MCLA 4GI9A 3A23A 2C4FU 3LEXB 1ZHNB 4U1NB 3ZXAC 1MPAL 4JE4B 3MZGB 2OXGB 1F86A 2B77A 4P49A 4NXKA 3QRGL 1QZNA 1MCNA 2C3VB 3E8VA 4YSOA 1YMMA 4GS7C 3BVUA 4GFTB 4R7VA 3OM3B 1EFXD 3IKCA 1S7WB 4NQSB 3MCYA 4FXTA 2VDNB 2E9IA 2QVKA 3CZGA 3QDAA 5EZJB 1U8IA 1WWWX 4O9HH 4WI9A 5KVFL 5C3LD 1A5FL 1MUJA 2G0KA 2K6WA 4JFPA 2F1AA 1J0YA 2D8KA 1RJLB 4W9HC 5DMIH 2BFVL 2XNAB 5LNEA 3RVTD 3FCTA 1F4WL 4N8VB 4NZRL 1PJWA 4NKIL 1ZHKA 3H9HA 3L1FA 4FMKA 1EHLL 3DLQR 1J87A 1FPTH 3ARDB 1A9VA 3TN0B 3GSWA 1SVBA 5PAZA 4B9JA 3LN4A 3EJYD 4U6HA 1DSYA 2V5RA 3A4FA 4N0UB 4W4NA 3K6SA 3K2UH 4X7TB 5HGAA 1TU2B 4Y9BA 3RBSA 4M7KH 2P45B 2NYZA 4DKDC 1BIIB 5EEXA 4OCNC 2EDHA 3MRGA 3PWJA 4XXWC 3T0XA 1NGXB 4KMTH 4BSWA 4NKQB 1T1YB 3GS4A 2RJMA 3RA7H 4TQPA 1IQDB 2IOOA 3HB3C 4JZJA 3NJLA 2C9VA 4XP5H 3UDWC 1I1YA 1VEOA 2PLTA 3IU4H 3UXFA 1K8IB 4IRJC 4P3WA 4JFYB 1PG7W 4XAKE 3MROB 1ET7A 1RU9L 1ZVSB 4WENB 1OCWH 3OR7B 1G9NC 1L9TA 5BV7B 4XCCH 3COOA 2A4CA 2VR5A 5TE6H 1ZXKA 5E9DB 4XNQB 1MFBH 2XJKA 1C5DB 3VXMA 4N68A 3O81A 1X9QA 3HPJB 5JOEA 2WXRA 3AWEA 2BW5A 3DSFH 3MACH 1G7PA 3TA3C 4P8QA 5ECJE 4NQDE 5DEFB 4GINA 1IJNA 1AQ8A 3HE6A 4QHKI 3LZFL 3N50A 3QUMB 4ZDHA 1JNLL 2WVSA 3HE6D 3V52L 2C9AA 3PAUA 1JI2A 2C9SA 1SHWA 2CGYA 5EORL 1MCHA 4BE6A 1ZT1A 3O0RH 2ZX7A 3BN9D 2QVTA 4G7RB 1IKFH 2EEBA 4TKWA 1ZKAA 2BNUB 5BCAA 1XSIA 1JIBA 3GZPA 1A6UH 4V33A 1IBBA 4ZMPA 5TTRA 1NM4A 5FIEA 1TJIL 5J1SC 4LSDA 2APFA 4OCRH 5SWSE 2YPLB 3OKYA 3OTTA 5FA4A 1V3MA 5CINH 1BEYH 1AG0A 4MQXC 2I25N 4G5ZL 3MV7B 2B5IC 4RNRB 5DMJB 4ATWA 2CRIA 5B1AB 1FNSL 5F7HA 4QHUB 3WTVA 5DJCA 1X3DA 2J6EA 5BRZB 1YCSA 2VWEC 4GQRA 5E99H 4IOFD 3S96B 3SDAC 3T4YA 3TBWA 3W2DL 2F8OA 4J1UA 4N2KA 3NIFE 4H1LH 2A9DA 1ASQA 5L88H 1EPFA 1JS4A 5FAAA 3LSOB 1MEXL 2G75B 3B56A 5GRVL 3IK2A 5GGTH 3RAJL 5JYLA 4F80A 1VFUA 4EVNA 2AJZB 2X09A 2VIRA 2Z91A 3O2VH 3QQNA 1EXUB 4X7SH 4FQXB 3ZT6A 4ETQA 5E6IA 3ZDXB 1A9BB 1IGIL 5C0EA 2AMGA 4NQCD 4PCTA 4MASA 1INDH 43CAA 4F2MB 1EAOA 2YXFA 3SO3C 2DQUH 1ZRUA 2EP6A 1WK0A 3A47A 4NKDA 3C9NB 3MFFB 3IPBA 3Q5TA 4P99A 5EEWA 2ESVA 2XBDA 1FC1A 3CMOH 4FNQA 4JZNA 2LLLA 5I1DA 4WW2B 4CJ0A 2F7RA 3J7HA 1E27B 1DVQA 1U2CA 5EA0H 3BDXA 4YSCA 3S37X 1AGFA 2NY5H 3GF8A 4JY6A 4UU9B 5DD3L 1Z9PA 4JFHD 1T20A 2G5RA 3RYMA 1NQBA 4OZ4B 2ZYHA 1VKXB 4XB3A 4Y5XC 4RH4A 1IGTB 4YHOH 3W0WE 3WEXA 3TO2B 4X5WA 4XOEA 4AMKL 4FX5A 5FA3A 3EFDL 3UYRL 1SF3A 2AFNA 3CNKA 4PUBL 4AT6A 4X50A 4KZ0A 1DCLA 5FGCB 3L9YA 3ALPA 2W92A 1N19A 2XN0A 3O9WA 4HKXA 3O2DL 3MBEA 4GUQA 4GKOA 3WN5A 4PJ9C 1YHPA 1WIUA 3OAUH 4P9HH 1J05A 5E8NA 2X87A 1VGEH 3OLGA 2NYKA 2XRAL 3CZFB 2PCYA 1DJWA 3BESR 1OQXA 2QQNH 3ESNA 3SE6A 1AGBA 3ZL2A 4JO1H 3PL6C 4ZS7L 4ZUSB 5C08A 4YXHL 4N0UA 1BFVL 3MJ6A 1AANA 1UKQA 2YD1A 4JQIL 1OTTD 1U91A 2YZ1A 4ZTEA 3V0JA 4JPIB 1DCEA 4KTYA 3TNNA 2J8UE 3FTXA 4JN1H 4JQXA 2WGXA 5A7EA 2J5WA 1TT6A 2BJMH 2GUYA 5I16A 3FUKA 5JUEH 3P4NA 1TZIB 2OMZB 1NLBH 3L8QA 5HYSA 3VI4A 1BEXA 1UWXH 1VEMA 1ZVSA 4QHMA 2QGEA 3O11B 2DLEA 5TH2B 4XMTA 2VAJA 2VITB 3CU1A 3EF7A 3S36X 4HCRA 4LCYA 3NFSH 2A6DA 1AZNA 1A2YA 4MA3B 5GGUA 4ECNA 1YPZE 1XB6A 1NMCB 4O2EA 4BQ6A 1IGCH 3HLAA 4DGUA 1JZIA 1RFDH 4QRBA 2GAZA 2A6IA 4JFDB 1KF9B 4U6VL 3ZT5A 1G9MH 4GYBA 1SY6A 3EOBB 4TULH 5FECA 2IFFL 5DFWH 4AVIA 4JM4H 5TDOB 2H2SC 3WIFA 8CGTA 5F7FA 2ED8A 1P7QA 1Q38A 2A83B 2R1YA 4PJ8C 4RIRA 4WWKB 1FZOA 5IW3A 3QNZA 2CXKA 2XXMB 4KNUA 5CEZL 3L4XA 4JCWA 4BH8A 2QGCA 2RD0A 4GKNA 4FN0A 4XWOC 3PV6B 2CLZB 1WEJL 4GXVH 3CD4A 3EJCA 4ODUB 4XNUL 2AXFB 3UAJA 4HIHA 3MYZA 5F7DB 4A2MA 2AMUA 3U7WL 3DXAD 5D7HA 4R26H 4FLHA 4L29A 3GBMH 3EJYC 2K3TA 1PY0A 1SLUA 3ULUH 3RZCB 4J1UB 1BVZA 2XVBA 3S48A 1XAUA 4C4UA 4P2AA 3PP3K 3G5YA 5D1QE 1HEJC 4Y4FD 2CHXA 3MYJA 4D8OA 4LSPL 5IBTL 5E51A 5EBWB 2AXHA 4JG1L 5I0XA 3T2LA 1MHEA 5D2LF 1Q72H 2BW4A 3QI9C 1JYXA 5EZIL 1KB3A 3D0VA 1JZ7A 3BKJL 1IFRA 1OSEA 4AENB 4CL7A 3WFBH 5C0AB 3V0GA 1OGAE 4NSKA 4BCYA 4P5TC 4RMTA 4Z3GA 4HS3B 3H9SE 3QZWG 4ZX4A 3SGDH 5LVEA 2VTFA 3GFUA 4WHTB 5SWZB 2IQAB 3MLSH 4TSAH 3FK3A 3SDAB 1ZHLB 3WN5C 2OS7A 1YY9D 2L7UA 5HJBA 4BXVA 4WAFA 4GP4B 3EJQA 3GT6A 4NPYB 4NJAH 2CBQA 1MFDL 1U3ZA 1JTOA 2YR3A 3SDYL 1R4XA 4Z7VA 3OMAB 4P48A 4MD0B 3U82B 4EQ3A 5B3JF 5DUBB 1ULVA 1N6VA 2W60B 4PY7B 1UGKA 5IK3B 1NDMB 3QUKA 4KHXL 1JHTB 2CLRB 3SN6N 1WFMA 2OJZH 3FFCB 4TPRL 4LHJB 4AT6B 3WXWH 3L2MA 1ZTXL 1QBLH 5EIIB 1KT2B 1EZVY 3HMWH 3QDJD 3O9WB 3INUL 5I8OH 1HNYA 3K5SA 3DTUB 1AD9A 1O7SA 4TLUA 1JPSL 5KOMC 4WW2C 2VAAB 3O8XA 1UZGA 2OBGA 5BVPL 4YPJA 3PIQA 1TEFA 1IGML 3P9LB 3PF2A 3BZFB 4G6AC 1O5PA 3ILEA 5ITFA 1RH8A 4N0CD 5HYJD 5FM5O 3TPUA 1KXTA 1TQCB 2DB8A 3GM0A 4JJOA 5HYFA 1YMMB 2VLJE 1BVLA 1QABA 4ODBD 3NJXA 3SO5A 5EU3A 4U1IB 1HH6A 3TZVD 1TZIA 2OMZA 4G43A 4PJ9D 2PR4H 3R4DA 5DZ9A 5B39G 3D0LB 1OOAA 4XHQA 2VOTA 2YC1A 2Y5QA 3SE8L 5ADOL 1PSKH 2X4RB 3P2DA 3QEQB 4AQ1C 1JMXA 4QY8B 2JKNA 2D7TH 2PNDA 3L2NA 2A6DB 1JHKH 5I71C 1XGRB 2HKFL 4LF3B 2R27A 2XXCB 2VRKA 4ZW6A 5C0NC 1U95B 1NAML 1G1CA 2AJYH 2ZG2A 3K6OA 4O02L 3WFCH 1JF6A 2BINA 2WAQA 3G6AA 2PP7A 2ZYRA 3PHAA 4TUJA 5CHNA 5MHSD 5B39A 2P46B 1C16B 2AGJL 4UV4L 2WQRA 4YNYA 1HXYB 1Q0XL 1M7IB 2DL9A 1PLGH 2JSFA 4GKZA 3F7QA 5EBGA 4BSVA 3P3SA 1OM3L 1DZBA 3MUGB 4YX2H 4HFWA 3RWCB 5ICZA 3GBDA 1FZMB 4X8CA 2W0PA 1FO0B 3D3VA 5DF0A 2NQ3A 4L3FA 4BDVA 3H85A 4JX0A 4JK0D 4Z78B 2V33A 3GMPA 4FQ1L 5GSRB 4XBEL 1CU4H 1NGWA 5DRNB 1BDYA 3U4EA 1XBDA 4ZXBA 3FQWA 1XGUB 4XR8C 3MRCA 3ULAB 1BQUA 2X2JA 2WIMA 3OKLB 4NNXB 3MUUA 1EDQA 1YEJH 4O5LL 5I1JL 4F7EB 3DUHA 5TDPB 2WLLA 4EN3C 4EE2A 3IB4A 2UZPA 1UCBL 4BV1A 1GW0A 1PZAA 2AI0L 4P5KA 5GGVY 4XC1H 3TYFA 1O7VA 3MJWA 4FKEA 4JM2C 3OXSA 1YY8B 2WXGA 4RETB 3L3HA 3NZ8B 5LBVA 2KQNA 1JI1A 1ZD6A 1DBJL 1IC7L 4KHTH 4MCMA 4OD2A 5CCGE 1B0RA 3SE3C 2NNXA 5DEFA 4X9GA 5CEYA 1QFWL 6PAZA 3DROB 1A7NL 4MNGA 1QR1A 1CFBA 1RJYB 3LQAH 4TVPD 5IFHH 4WWOA 4WGKA 4YDNA 2VXQA 5CKAA 1H8OA 4BEIA 4C57C 1T1XA 4GIAA 1PIGA 1YMME 4LB8A 1AO7B 2VDOH 5T3XH 4JM2D 1KN4L 2DWEA 3JQOB 3HS0C 4LSSH 4NSKB 4FLRA 4ZO7A 4M61A 2GCYA 1EIBA 3FH7A 4IOIB 2FJGA 3BAXA 3X12A 3C6LB 5A6LA 3EGSA 1KCKA 4MNGE 3TTYA 4UZSA 3L54A 3TVMA 2FWOB 3RZCC 3D33A 3VI3B 1AZBA 3DI2B 3DXAB 1AR1D 4Q14A 1WZ1H 5T5NG 1HHGA 3MV7D 4CMHC 5HYJE 2WBJD 1VFBA 3EGDA 4X98B 3JXAA 3MREB 1HQ4B 4RBPK 3HR5A 4OLVH 2ZNXA 4ZOBA 1KIQB 4DP6X 5B7EA 3US1A 1QTPA 1RK0A 4WU5A 5F21B 5I73C 4P5TB 3GDBA 3HZ3A 3BMVA 1NLDH 1GIGH 3NSYA 4JG5A 1MCWM 4TYUA 1XF4A 1J8HE 5CF3A 4G80A 2Z91B 2E6PA 3GMOB 1I3UA 1NSNL 1INEH 3CZJA 4G3YH 5JPNB 2EH8H 4I77L 4JHWL 1A4JB 5ICXA 2WBJA 3B83A 4JREC 3X1BA 3NZSA 2FQDA 1CE1H 4LCIL 4LOFA 5FM4A 1R3IH 3JWDH 2IFGA 2Q7YA 4FFVD 2XPGB 3TA3D 1K4DB 2WINA 2CCLA 4UNTA 1BQLL 3WKMH 4M8QB 5JDJA 5C09E 5KVDH 5I0YA 5C09D 2WQVA 1B0IA 1S7XB 4ORGA 5DGQA 4K9EH 3VFTA 5T33H 3NIDE 3TPUB 3ZYZA 1H3UA 4IGBB 2ZE0A 3FB5B 2BNQA 5DC9B 1L5GB 2MOQA 3N91A 1BVLB 2C9XA 2W07A 3E1F1 2IPTH 4QRSA 1KTDA 1IC1A 3HOGA 4JKLA 3FU5A 1U8LA 3RPIB 1W8EA 5B21A 5D7JC 5ALBL 1PG7H 5I15L 4WUUD 5FA3B 2ZICA 1WAAE 4FNUA 2OJ1A 5IJCC 5IKCA 1CGSH 2XTJE 4WTZG 4AYMC 1CGSL 5GSVA 1QD0A 3ZQ9A 5E4EB 3F7YB 5JMRA 1IL1B 4YO0A 4NO5B 1I8MB 2IAMB 5CN2A 1NCAL 1BVNP 3G08A 4NM8L 3G6JA 5FX3A 4FFZL 2VLKD 1OTSD 4PGCA 3MGOB 8FABA 2C8NA 2C5DC 4M93B 4DKAA 4KQ0A 4AEIL 2RTTA 3NIDB 4MLIA 1FZMA 5HGDB 5IEKB 2L8AA 1P53A 3GMPB 3U0TA 2WLYA 4X9YA 4ZUUA 2IADB 2F74A 3TEUA 2OR8A 1CFNA 3FQWB 3CZLA 4AQOA 4OM0L 1CE1L 4LCIH 4JY4A 4YSQA 1FN4B 2VO5A 5KAQG 1KN2H 3RWJA 4HT1L 4Z7NE 4WFFD 2J1YA 4J23A 4FLSA 1G5AA 1M71A 2BXYA 5IB1B 3HS0A 5KS9E 4C58B 3PXHA 2YSSA 2WLKA 2APVA 3V2AR 2IANB 1T89A 4YFLF 5EBLA 4L8SA 1YY8A 2ENPA 4GW1B 3PPEA 2AAAA 2DQHL 3HBGA 1WBXB 4O2FA 5ISZA 1DQJB 2F54B 4Y4HC 4M1CD 3DX1A 1BG9A 1Q0YH 3CDCA 5TQ2H 2GI0A 1YG9A 4X6CA 5AW0B 4GUOA 1W6WA 2MQ0A 1CDBA 4ODHH 4FDWA 4YDJB 1ZS8A 2R8SH 3MRIA 1G6RH 3F6LA 4ODHL 3EYSL 1T1XB 3APFA 2ZD0A 3KXFA 1YEKH 2IPUK 3B9KA 4Y5VA 1BQHB 3QRBA 1NC4B 1TOXA 3NDZE 2VDQB 2FJGB 1UWYA 4PRNA 2QADB 1XCQB 4Q6KA 1G9EA 3C8KA 4P3DB 2XICA 4EIZC 1VHPA 2UUDH 2BP0A 2JKLA 1HXKA 4HHAA 4ZS6D 1MFEH 3AG4B 3LRSB 1HHGB 3OVUB 3AACA 2ARJB 2DMHA 2YPKB 3EDJA 2DBJA 2DKSA 3EGDB 5DQJA 4HT1H 2Y07H 4DAGH 5JPMA 1QRKA 5LBSA 1NOAA 2QPFA 1F11B 2XKNA 4BWTA 4P46B 5FEBA 5JW5A 1U8HB 4WJKB 3VI3F 2FX8L 3EYFA 3D39E 5I1AA 3FQ1A 1DBJH 2XXGA 2NY6C 1I9IH 4WGWB 5EG6C 2DN7A 2PW1A 3OQRA 3L1GA 3MBED 1N9PA 1D6EA 5BOPA 5D1QC 5JA9A 1FNEB 1JK8A 5DJ8B 2XWEA 3H56A 2EEFA 4XPTL 2LTQC 3VGHA 3WSQL 2I5YH 4NM8H 1NCAH 1BAFL 2RIKA 4F7MB 3BUPA 3FH5A 3FH8A 4BFOA 3HA0A 1BPLB 4PJ5D 2Y1VA 4LCWA 4Y2DB 1U36A 1BJMA 2V7NA 1A4KA 1EEQA 4MZ3A 4MZIA 4HC1A 1W80A 5D55A 4MXVE 3DV4A 4KJPC 3VUAA 4LO9A 1L5GA 4XNDA 3NSJA 1PG7L 5I15H 4Y4FB 1Q0XH 2HTLD 1KTDB 4OGXH 4OLXH 5DZPA 4ABUA 1DLFL 1LO2L 1RXLA 2BNRA 2IGFH 3BKML 3LNGA 4U1SB 4AK1A 4RA0C 1XIWD 3TXAA 4F3FB 2X9XA 3H6AA 4N9GA 3TNMA 5DO2C 1HSBB 3VXRE 2NY3B 3I3DA 4HOWA 3FUIA 1YQVL 2N7SA 2B1OA 3A4EA 2UV3A 4CVXA 5BRZE 5KBNC 3MRHB 3UTSB 4MJID 1RLWA 1X5JA 4BFJA 5IHBA 5E2UL 3WAJA 3P73A 3QIBD 3ZTCC 4G8EA 4HPOL 3SDAD 4DPBX 1T4WA 4GMTL 2V3EA 1F00I 3G08B 5C0IA 5JR1L 3C6LD 4ZTPL 4KFZC 2F18A 5JQHC 2WTPA 4ERSH 1INEL 5D72L 1AJ7L 5GISL 4JFEB 4X4YB 4IBSA 3AT9A 4BZYA 4K8RD 5AB9A 3G7TA 1FYTD 4HA1A 2ITFA 3ZHNA 5IEKA 2MKLC 5GXBB 1JRHL 2CBOA 2F74B 3FQ4A 5DRWA 4LPTA 3FB8A 3NN8B 3V95A 3UZVA 4NN5B 1MRCL 2OK0H 3PYCA 2LQRA 3VSQA 4HWNA 1DE4B 1JUFA 4FI6A 3RDTB 4W9CC 5E6ZA 2HKHH 2PTTB 2Y3AA 2KZKA 1SXZA 3I74A 3MJ8B 2LVEA 3QQDB 2BIOA 5D1QD 3GMQB 1GOFA 3SD2A 4O2FB 2ZF9A 4GAJH 3SOBH 2J3SA 2AQ2A 3N40P 2LE9A 1UD8A 4PCSA 1NBQA 5M7QA 1YDPA 2KH2B 5LWYL 1DJSA 2IEPA 3N0PB 1M7IA 2EO9A 2NY0D 3QUZB 3QJZA 2YD6A 2YMOA 4HK0B 4URKA 4KKPA 2OSWA 1MF2L 3NCYS 5E9DE 1FO0A 4IRJD 4OFIA 2CPUA 2ZWYA 2ERJC 4MMXC 4J3TA 3KJ4B 5F7AA 5D6DA 3ZGHA 3VVVA 4EKXA 4L48A 2BP0B 3K6SB 3EH1A 4QGTA 1PZCA 4K9JA 3SDCC 4M5YL 4PJAE 1S9YB 2NX5A 2GBTA 2DV6A 1QUNB 2HVKB 5CJXC 4BWWA 1UM6L 2WQUA 3B37A 4Z7WE 4IU3A 4LSPH 5IBTH 3QYMA 1TQVA 3RFZB 3VFMA 1T2XA 1J7VR 2J2ZB 2AJSH 3WIIL 1CU4L 1TCRA 1NBCA 4DUWA 2PR9A 5I1AB 4CGUB 4YDLC 4R4BB 3UJIL 3M45A 5AVZB 5H2BB 5A2JH 2YGPA 1RV6X 4M7LH 1J8HA 2X6UA 4PJGA 1C5DA 3ZSSA 3FO2A 2DBLH 4QUOA 4HHWA 4YXKH 1WEJH 1FNEA 3KPNB 5DJ8A 2PF6A 2Z7YA 5C0DA 5IROC 2E3VA 5E95B 2PCPB 4QCIA 2LHAA 3IJHB 3LZOA 1M6OB 3IE4A 4DPRA 5FO9B 1NCWH 2PN5A 5IJKA 5TDNB 3K8LA 2E4TA 3VU2A 4WTQA 3UJJL 3IGKA 3DXAA 4Z0BH 2R69H 4RMBA 3MA9L 4IRSB 1BYPA 5KSAD 2WC7A 3TLRA 3L7EA 3KMDA 1UH3A 1AGCA 1KGCE 2MCMA 3SGKC 4AL8H 5IROD 4Q52A 5AW2B 3SJVD 4YSPA 1JZ3A 2PR4L 1AQKH 3LYRA 4U1SA 1JWSA 5I6OA 2XFXB 3MODL 4MA8H 2LTQB 1J48A 3TNMB 5MEND 4I3SH 4XE0A 2Z1PA 3VCLB 1GVIA 1Z5LB 4U4IA 3KBPA 2R23A 2EDRA 1XAKA 4CVXB 3ZDZE 4LOUC 3IU3B 3QSKB 1N59A 4WJG3 3RVWD 5DJCB 3ARGA 4I85A 1KPRB 5IQ7H 2NSXA 2ENYA 3B9EA 1RY7B 1NLBL 1XH1A 1UT2A 2R69A 4MDIA 5B8CA 3IWVA 1CIDA 4P2RB 1CICD 4HJJL 4JBSA 5AAPA 5EO9A 2Y7OA 2DM7A 4APQA 4GXFA 4P2OD 1DQIA 3QARA 1DQML 3NIGE 4XI5C 2E8YA 5KOVC 4HS6A 5J0BA 1LE9A 1CDGA 2FEEL 1U92A 3VFNA 2XJLA 2ED6A 1BFVH 2NNAA 3IBOA 2HFEA 2WXHA 4J3OH 3UGXA 1DVXA 3UTPE 1I3GH 1XB3A 5CS7A 5GGVH 3FCUB 2ZJSL 4YZWA 4D8PB 4JZNB 3H3KA 4FLQA 4RQQA 4YE4L 3RWGB 3JVGC 3LKQA 4AV0A 3CFKA 1RZGA 4PREB 1UEYA 4EIBA 4PV8A 1IIKA 5EDSA 5B3SB 5GSVB 3WHXA 2J8HA 3EYOB 3IJEA 5CMAB 2YJLA 5A1AA 1A6AA 1RI8A 1I8MA 2P49B 3BPLB 2NXZB 4GW5A 3G6JB 2VDMH 5DS8B 2VZUA 4HKBA 2FT7A 4R97B 5CU9A 5BJTB 1XL4A 1IC5H 3KVDD 1U8PB 1A1OA 5D7SL 1TENA 4J3BA 2YMXL 4AUJA 1I8LA 3TYGL 1JSYA 1XF3B 5F9OH 1NMAH 5DTFB 4JFQB 3SYPA 1Z0NA 1FO0H 5KVGL 2WSKA 32C2A 2X88A 3PCYA 4G82A 4X4MA 1NEZA 2I07B 2WWOA 2PO6C 1IAKB 3O8XD 2JKJA 4LLUA 1HAWA 3ORJA 1GGCH 2CZNA 2B1HH 1A7QL 1ZLSL 4X83A 3C6LC 4WI5A 4I18B 4RGNE 1TEYA 2EDNA 1DLHA 2AJUL 3DGGB 5DSCA 4QAWA 4CVZB 1MCEA 4TOYL 1JZ2A 3CN4A 4X5XB 1EGJA 4BE5A 4QYOA 4ZI8A 3U0PA 2YFOA 1S46A 3QO0B 3BPNB 1ZLWH 4JVPA 1ZAGA 3B2UC 4HX1B 1HL8A 4RISL 1XD1A 5I1KH 2FB4L 3DPDA 1UTDA 5E99L 5EU7C 4JRXE 4XC3L 4QTHA 2RH0A 4LHUG 1E9PA 4AUYA 4OV5B 2E56A 5CGYD 3C08H 4GFXA 1F42A 1PBYA 1PYWA 2HJFA 3HG2A 4KKZA 1Y0LA 3MGTA 2ZKMX 3FSWA 2YK1L 3H4HA 4UAOB 1F2XK 5DC2A 5FKAA 3E80A 3BRFA 1J1PL 4NENB 1GS8A 2PCPA 3HBZA 5I26A 1NPNA 2DQTH 2HH0H 3GHBL 3VB9A 3B5TA 5E2TL 1EAQA 2VXSH 5E6YA 1QPKA 3MRQA 4LU5L 2YD5A 1XB8A 5HI4D 4PCYA 4AH2B 3M6DA 1CGXA 4Y8DC 3VWKD 4HHAB 2AK4D 1RURL 1WGOA 5DRZB 3FFDB 2K45A 4IKJA 4FKKA 5SV3A 5FW7A 1UM6H 2V2WA 5FCUL 2HT3D 3PABA 4NKOA 2DWSA 3ARGC 1IT9H 5C6TH 1J1OH 5EO0A 3P30H 1ZT4A 1F41A 1UOVA 1A3LH 4OZFH 1ZDQA 1OPGL 4CVWA 5ESVB 3A4AA 3FULA 1P2CA 2XWTB 1IAOB 3SGDI 1OLZA 4AV5A 3IU3A 1N59B 2R0LL 1LQBC 2EDQA 4KQ4H 5KANG 3VX0A 4S1QH 3RZCA 5HHPA 3HZMA 2XRAH 4MDIB 2OSXA 4LXFA 4B60A 4Y8AA 4BK5A 4LVHC 4HSCX 2DY2A 1N5AA 3D2UB 4L2LA 4MAYB 1MFUA 1A6VH 2FLRT 2OFQA 1BXVA 4QT5B 4W70A 3QEQE 1W0YT 4WGVB 3NFNA 1VCAA 1R5WA 3CQFA 5GRZA 5D4HA 1LE9B 1OE3A 1CZ8L 3OL2A 5IJVA 1VACB 4WHYH 1J11A 2Z7ZA 2IWFA 2Z65C 4IMLB 3C8HA 4JDVA 4Z5RB 3VDCA 2WB7A 4G42B 4P23A 3Q6GL 5ALCH 3EOTL 2IQAA 3T9WA 1WUNT 3U36B 5ESQA 3DC0A 3DVGB 4X8JB 1E4KC 3RG1C 1CJYA 1D6VH 5JZ7C 5FFLA 1FNHA 3MR9A 1HL9A 1JWUA 4NQTA 4WO0A 1F90L 3FL7A 4C55A 4N9OB 5L6YL 4HZLB 1MY5A 3RFRA 9PCYA 3ETBJ 1A6AB 3HNTH 3T3PE 3FONA 1INDL 3FQTA 1MVUA 1WCBA 3PQYA 4M5SA 4Q8BA 4O51B 3HNTL 5C0IB 1NDMA 4G6MH 1QACA 4U1MA 5EO1B 3GPEA 2GTWA 4NQCE 5L6YH 1F90H 1SYVB 3IDYB 3PLYA 4IMKC 4PJXB 5C0CA 1MJ7H 2AV1B 2PO6A 5B38A 2A38A 1EZVX 1WJ3A 1CGVA 1U8MB 2XX0A 2BY0A 4NN7C 4ZTPH 2ZXBA 35C8L 3QUXD 2Q20A 4PVMA 4UQ2A 4WW1A 4BIKA 1MEXH 5JYMA 3BVNA 3MNVB 2VAAA 1OXYA 3Q6GH 1N4XL 2XBTA 5DRWB 3WGVB 1NANI 4JHAL 4GRWF 3E9TA 4GJTB 3PDOA 4R0LC 5EIVA 3FN9A 2A74C 4Z7NB 3CQPA 2M1KA 3O3AA 3FQ2A 1F1GA 1BF2A 4GRLC 2X0WA 1MWAB 1VIWA 4F8NA 1WFOA 1A6TA 1JPFB 4DVRH 3QGVA 1FG2B 4QRTB 2OTWA 5D7LE 3CHOA 4L9LB 1BFOB 3MJ8A 3CXDL 2C3WA 3IJ8A 4EO5A 1M56B 1KB5H 1MCPL 3QHTC 3SDDC 4QHNB 3QO0A 1D5ZA 5KSBB 3GEFA 4JJ5B 5J13C 1KZYA 4QO1A 4DUVA 3HG4A 4JDEB 3LPGA 3B7RL 1YEDB 4FULA 3QUZA 1VADB 5DURD 2D3VA 3RUGB 3RWHA 4UTBA 3IJSA 1IE5A 1BAFH 1AP2A 1JXGA 3N43B 3DYMA 4KUCF 3CPUA 4LF3A 1MI5B 1A65A 4I4WA 5JIQA 4KK6C 4TQEL 4F33B 3P30L 2VLRB 4R7XA 3UG5A 4B9CA 5JOPE 3OHXA 2V2XB 1OM9A 2YWYA 4RDQG 1CDYA 3CBRA 4OGYL 5ANMA 3MRQB 2ZCZA 4JRLA 3FSAA 4Z7OF 1EZLA 3C09C 3P3YA 3RIAK 4DKEH 4QDGA 3DRTA 4QMEA 1U3YA 1FIEA 2BWDA 3FFDA 3GXMA 4GKSA 4RAHA 2WVUA 4LHUA 2OQJB 1QUNA 3H9YA 4AQEA 5GSRA 1P4IL 1OTSC 1A4AA 1MCPH 4UMSA 2H47C 3CHRA 1KFGA 3HFFA 5HSFA 1A22B 1XGUA 2OZ4A 1B0GA 1NIFA 1SYSB 3GHBH 4JDZB 4N22A 5EO0B 4MYWB 4PJCF 1FL3A 4HWZA 3G9AB 3VM5A 1UADC 5DD5L 2EDEA 1JGIA 4K3DH 5D1XB 1A66A 3C08L 1DVUA 4MQTB 1WD8A 5CD5C 4XCFL 1RPQA 4HUCA 4PJGB 1BQKA 2E86A 5CR1A 3ML9A 3SKNB 2ENQA 1TFPA 3H9SB 2EABA 5I1KL 5K9KB 3KPNA 1BFSA 2Z31B 4I13B 4M1GH 3KZ8A 1AG6A 4QCIB 3AJ7A 2H0FA 1P0SE 1J0IA 3DIDA 2WQWA 2WQ8A 1OAYL 1UFGA 1ZA3A 4XMLL 5FO2A 3A22A 1XGQA 3H6JA 4MAYA 5LBGA 3F00A 3OC5A 5TF0A 4JO3H 1R5WB 4PBDA 1J12A 5DD6B 3ZKND 1S9WA 4M4PA 1SDYA 4R96A 1VACA 5DXWA 5AUMA 2VZOA 3GXUB 4AW7A 5I2IA 4POZD 5MEOB 1OTTC 1BGXL 5GRXG 1IKNA 1FGNL 3AQXA 2WN2A 4JFFB 3NH7L 4HJSA 4MSWA 4F57H 1JWSB 2WXJA 4Q4EA 4BQ8A 3TYGH 2OR9L 3VI3A 3H53A 4K73A 1H8SA 3JTBA 3U83A 1R3KB 3K46A 3HS8A 4H1LB 1UXLA 1YEEH 4D3CL 2QZQA 2C3GA 4RFOL 4WF7A 4IBYA 2R23B 3FRPG 5DGRA 2FL5B 1VFBB 4X98A 3NESA 4YDVB 1NAKL 1DUYB 4NN5C 1V05A 2XXFA 1HCFX 1LNUB 2E7LA 4TQHA 2RGSA 5LCVL 1KYFA 3S36H 5C07D 4NM4L 2NQCA 2K8MA 4M48H 1S5IL 4NQUA 4NO0D 1JHLL 4MB5A 4AEIH 4APQD 1LVEA 5TK2A 2UY7B 3VACA 2XOTA 1CBVL 3FFCD 5B38B 5GS0C 2ESVE 3GWJA 3QG6B 3MZTA 5IQMA 4LGSB 1F3DH 2DPKA 3AM8C 3DX9B 4CC0A 4NBXB 1MFVA 3BUBA 2AVGA 5JPNA 5KBDA 1O0VA 5CJ8A 4PTTA 3F7PC 3W9DB 2HFEB 4I1NB 1I3GL 4KQ4L 4KY2A 1U30A 3O3DA 3VXSD 3WJLC 1K3IA 4D8PA 1P7QD 2WINB 3B9KC 3H2PA 2WTRA 3O3AB 3EBHA 3OKMA 4Y5VC 3RILA 3D5OF 4RQQB 3RWGA 5GJTH 4KJQC 1HCVA 4XNYH 5KZCB 2J4WH 4L4VB 1LD9B 1AI1L 4KXZI 1BFOA 4LLYB 2C7UA 5A16A 4MX7A 4LOEA 3QJQB 1IBGH 3EOYG 1ZV5A 3OJ2C 3WHXB 1Y6KR 3IGLA 1GGUA 4MYPA 4BA0A 3KLAA 5IR1B 2ZCLH 5T33L 1SVCP 4QHNA 4GPVA 2E6JA 3I2CL 1YEIH 3I6KB 1EBPA 1XR8A 4X6EB 2X4UA 1MJUH 2P28B 3RKDD 1REIA 4N2AA 4Q9QH 2OA9A 3GKWH 4R4FH 4JKWA 2J44A 3RDJA 4W9IC 2WSDA 2A74B 1DP0A 4EN3D 1N0LB 4JPKH 1U3HD 3U48A 1XF3A 4MXQD 4I77H 4JHWH 4WO4B 4YO0B 3A6CL 4WU7B 1JOIA 1UD6A 4OCMC 5A2KH 4JZJC 3QNXA 3GSWB 1XGTB 3RJQB 1UFUA 2JKSA 1R17A 2Y7QA 1YEHL 2CDFB 2QQKL 4NUJA 1B3IA 3LPWA 1IBHA 5K59F 4G6JL 4Y2OB 2P8PB 4MNQB 2EKJA 2Y72A 5AYUH 2FGWH 5HPOA 1DQLH 1F5WA 1S9VA 5T5FA 2V2TA 4KFMA 1NGXA 1AGDB 1DLHB 3JWOC 5MERB 4N1CA 1OGPA 4X5XA 4X6DF 3R8QA 1FN4A 1K8IA 1WPCA 3BAEL 5E8PA 3KYMA 1WA1X 3DMMD 2XTJC 4YXKL 4Z8FL 3OC8A 4QTHB 4RZKA 5A2BA 3K0WA 4M7LL 3BP4B 5IUSA 3QUYB 4N20A 3GSUB 3QJFA 1CLVA 5EBLB 2PKDA 3PNWB 3ULVL 3CVHH 4E36A 1WBXA 5I19H 4IRJA 4N2OA 5IB2B 2ICEC 2YPLD 1WH0A 3DX6B 3POHA 2E7LC 2QMKA 1HZLA 1TQUA 1TTRA 1QA9A 3UACA 3NA9L 4U2YA 3ECUA 4W93A 4ZDHB 1V7MH 4K5PA 4M00A 3GUFA 3CIQA 1KIUA 2HX7A 2JKXA 3VH8B 1I7RB 1TF4A 1MQ8A 1MZZA 1QFWH 1RIUH 1AY1H 2VC2H 1V27A 3FT2B 3HZKA 2VDRL 3O4LE 2GBUA 4GG8B 2VDML 4YHZH 4QNPF 4GO9A 2XX1A 1QSFB 3O6LL 2VZTA 4I48B 2QEJA 1RHFA 3DMMA 4OZFA 3KPRA 2PPEA 4NRYA 4B96A 5F8RC 2CNZA 4HC1H 4YGAB 2SEBA 2WCPA 2BZDA 3EFOA 1EEZA 3CFBA 3LKNB 5HDBB 1OTUD 3TV8A 3WNMA 1N26A 4CN1A 5D5MA 3W3BA 1XSOA 1UQSB 4TQ8A 3UTZB 5DJ2B 1A8ZA 3EJJX 4P9MH 5ESVA 4MJ6A 2WOBA 2ZX6A 1XH3A 5EZOL 1MWOA 1WS8A 1LNUA 5AOKA 12E8H 5HYSG 4BFNA 3K71B 5JIMA 3ML8A 1ZA6B 2ZG3A 3ARFD 3ARXA 2JIXD 3PHSA 4FQPA 4KITB 2X4PA 1PZUB 5DT1H 2ZXEB 3LRGA 3C2AL 5HHQB 2G3NA 3DX7A 2VN3A 1X7SA 1MNNA 3ZTDC 2VLKB 3HCVB 4EVNB 1A9EA 1AYOA 1ANUA 2J43A 2H2SD 2EO1A 4GW4B 3RIFF 2EVHA 1J5CA 3GNMH 1JK8B 4ETQB 5AD0B 3PWPA 4OKDA 3Q3GA 3O2WH 1FVCA 1MG2C 5I6NA 1ND0A 1VGKA 1JGEB 43CAB 4F2MA 2FRGP 4IM8A 4QRFA 5EC2A 1QZ1A 5T1LD 2ODIA 2XN1A 5DZOA 1E3ZA 4CBZA 4OD3L 3DVGA 2VDLB 4X8JA 1GMIA 4PI2A 5T3ZL 5CBEB 2UZXB 1CFVL 2XWBB 4Y16C 3WXVL 3CV5A 1V8HA 3FBKA 5I1DB 3GHPA 3TBTB 3BRDA 5F70A 2JJUA 2DWXA 3O3EA 3RBGA 3QK0A 3V9EA 4AIOA 2XWDA 3HUJF 3BUIA 4AE1A 5T8IA 5AVVB 3VGFA 1QSVA 3GJFH 4FNRA 1OP3H 4BUGA 2A1WL 3HC4H 4Y89A 2X4UB 5FUOL 4JFDE 2KKQA 4M6OH 3RVUD 1IGMH 4H26B 1A1NB 3HRZA 3OX8A 4PRHB 5EU6A 3EBAA 3SPJA 3V9CA 5DHVH 1Q1JL 2VDPH 4MA1C 3MXWH 3NEXA 4NQED 4NQSA 2PWGA 3T3PB 3BKMH 3AROA 3FO1B 3HMWL 4GQZA 4OKVA 3QNXB 2EC8A 1UVQB 4FNLH 4J39A 5TE7H 1C8QA 4YSRA 1AXTL 1G7LB 3O45A 4HF5L 4YWGH 4K3EH 1CS6A 1GCYA 1RHHB 5IB5A 1NA8A 2EE0A 4LGRB 5C2UB 5J6HB 3TBVA 4AQAB 3AY4C 5T1KB 1HJBC 4LL4A 1NGQH 5GS3A 3BFOA 4PJFF 3AW5A 2OI9B 1D9KC 3UZVB 5C97A 5I0VA 2VDKB 5AALA 1D5ZB 4UQDA 4JJ5A 5CU5A 3KYMB 5I1IL 5KSBA 4JPSA 3T0EB 4HFUH 2W0FA 5D5ME 2Z93A 4PGEA 1VADA 3FUJA 3NSCA 2Q87A 2UWEF 3IWUA 2G3ZA 4RWHA 3IFNL 5TGBA 4ZMXA 1MI5A 2AITA 4I4WB 1MIEL 1J5DA 3O4LB 1U4FA 4JY5L 4G6KL 3CX5K 1TUPA 3T0VA 1JNNH 3NSFA 4WSKA 1ZLUH 1RQ5A 2E75C 4F15B 4APXB 5EZIH 5I1GH 2QADC 3RX7A 3OR7A 1JVLA 2FJUB 4Y4KB 4IBVA 1UXMA 3I85A 3MRBA 4PR5A 5E9DA 1OAQL 2IALB 5FECB 4HUVB 4EUPG 2GTZA 3QUGA 4JN2B 3WHE1 1IM3D 1T2QH 2DD8H 2OMVA 4IHOB 1FSKC 3A24A 5F7WC 4AQEB 1CYXA 3VWJD 3ZE1E 2K1MA 2JJSA 3MLWL 4NC1E 2GG1A 3RKPA 5H4ZA 4GKLA 3CG8A 3HE6B 5DJAB 1DSFL 2WIIB 3QNZB 3C60D 1OHZA 1KFAH 5E9NA 5IVOA 3STLA 1EEZB 3CFBB 5JXEA 1X5IA 4IQHA 3CLFL 1FYHB 3KPPA 4L8BA 4EBQL 5IW1A 2WXOA 3DOHA 1G7QA 1GZHC 1R6VA 2V7HB 3W56A 1CFTB 5CEZH 3QAZB 2PYEE 5AVSB 5GGQL 3VAEA 5JHMA 4J6RH 1ED3A 5SX4H 1MRCH 3O3BB 1XH3B 1XGYL 1BBDL 3ETSA 4L29B 3T71A 4WO4D 3GRBA 4ESKA 4U49A 3VFMB 2IFFH 2BS8A 2YHGA 3GIZH 5FK9B 5GGSB 1SLXA 2X89D 2X4PB 2Y1AA 1DQDH 4P04A 5IHHA 5GPRA 1A7RH 3T1FB 5E4OA 5FW8A 5HHQA 1PFCA 4MVBC 4NIKB 1CK0L 2VLKA 3HCVA 4XMPL 1X5FA 4NZTL 5IVXF 4QHUA 1P1ZB 4P3CH 2KERA 3IMUA 2N0KA 1QQDA 3TBWB 3EW3B 1HZHL 4M6ML 4MS8C 4NFBA 2DYRB 2E27L 2GJZB 4TRPH 3STBA 4HPOH 4HXAL 4AZUA 5LAPA 3DIFB 5FO9A 1HFUA 3BP5A 1OSYA 1F58H 1GR7A 1UACL 3C60A 4KX7A 5IBUB 4WHTA 5SWZA 4L05A 5TDNA 2NMSA 1BOGB 4YDKH 2NCMA 4HETA 2WY3B 3JV6B 3K2IA 1IX2A 4H1LA 4KXCA 1LO3L 2BJML 2GT9A 3MV8D 4XVJL 2JELL 4N0CC 4KAQH 3LMJL 4G7VL 2I9TB 3QUKB 5C09A 4XZ4A 4RX4D 2ESVB 5FXCH 3TZVA 1LDPL 1Z5LA 4N8CL 4YOKA 4PG2A 3LRKA 3KGTA 2BX5A 1KT2A 3MPCA 4DTGL 4JB9H 4LCCC 3CBKB 3FS9A 5D96B 5SWQA 4AYGA 4YBQD 1XCXA 1WISA 4W6YB 3WUWB 4DEPB 3O2DH 4N5ED 4HJTA 4X5QA 5B8CB 3V0VA 2M26A 3GO1H 3GYRA 1BM7A 2DOCA 1G7LA 3SYQA 2TAAA 4K9EL 3L6FB 4YBHA 1YZZA 4Z7QE 1FBIL 3N6YA 1ORQA 3ZUCA 2FX8H 3NPZB 4QPEA 4LLYA 2NNAB 2EDXA 4J4PC 3T3MF 4KI5D 5AZEL 4Z3JA 4P23D 4RFEA 4UDTA 2YPLE 2DICA 3IRCA 3IDIA 2F5AL 4OT1H 1BZDA 3SKOA 1JBJA 3BFQG 3P3UA 3L3OC 4K7PH 4DGVL 3HIZA 3HE7C 2A74A 4JVUA 4I9WD 2X6BA 4R0LA 4K2UL 3JWOL 4WO4A 2F5AH 2VUYA 1RSYA 4N3UA 2DLGA 2J71A 4LSTH 4GW5B 3MDJA 2JCCF 5CHNB 5AOZA 5I8EB 5LKNA 4LRIA 4QHMB 2W94A 4P57B 1XGTA 1RK1B 1QW8A 2OI9C 1N68A 3ESPA 1HXYA 1GS7A 2H3XC 4GKZB 4HKBB 3WS3B 4OIAA 3MV9D 1A1OB 1DO5A 5D4IA 2P5WE 2X53A 2VN7A 3O4OB 5TQ2L 4ZMVA 2QV2A 1J86A 5DWUL 4OCXH 4JFQA 2HFGL 2NW2B 3WFDL 1T7XA 4Y5XA 2O6PA 1G7HA 3TN0C 2WIIA 2D03L 1FNSH 5C07A 4CW1B 1MQKH 2JK5B 2A6IB 3RTQC 5CLZA 3SY0B 4LSSL 3STLB 4G5ZH 5EHFA 3W39B 3P9MA 1QLFB 3QR0A 5TK4A 4FLOA 3WIHA 5L7XL 2X4QA 1CT8B 4PRID 1TJIH 2FR4A 2AK1L 3AU1B 4L8CA 4U0RC 3WIFB 1CDHA 3MX0A 3QIUB 4NYLB 2B0SL 3OXSB 2B59B 1MAJA 4HEPG 4K3HA 1LK3H 2R1YB 2IAAC 4RIRB 3UFIA 4NN6B 3ECQA 2DYPD 3WIHH 1NC2B 5CEYB 4YDZA 1KXQA 3LMJH 4G7VH 4ALAC 2NW3B 3SIKA 5FOBB 2F68X 1Y07A 1QR1B 4PJXE 4RGNC 4U1GC 3V6FB 1JN6A 1KIUB 4HZAA 5C9JA 4W6XB 3KH4A 1N18A 1P1ZA 1AQDA 2J1WA 4B5EA 1CD8A 2HWZH 1KJ2H 3N9GL 4M6NH 2LLGA 3L3IA 3BAKA 2ZNWA 1GPOL 3DIFA 5GZND 5A40E 2VL5B 2AW2A 3EKCA 4PVNA 1RSFA 2GJ6E 4UOQA 1J0JA 2FX9H 4EEEA 1MHEB 2JKTM 1AQMA 4H88L 1ZVHA 3D0VB 1GOGA 3UTZA 4JZOB 3SCMD 1YC8A 5ALBH 3KL3A 1QLRB 6TAAA 2UXGA 3KJ4C 3KPOA 4G8IA 2QVIA 4HS3A 3L5HA 1HQ4A 5IB4A 1C1EH 1H9VA 1ITCA 3IDMB 4U6XA 1JNJA 2GJ6A 2C4XA 3F2LA 1FA4A 4F5CE 3US9A 2I9TA 4KKCD 4EXKA 2ADGA 2QTVA 3IXAB 2X5PA 3OR6A 3P77A 3TZVB 3M1BA 2YEZB 4LBEB 3VXTA 3DX7B 1OP5H 3IDNA 1XF4B 2R39A 2PTVA 5IF0A 2E6QA 3DO3A 4P5SA 3MLTA 5DMKB 3N1MC 4F9PC 5D7LA 4PJCB 2NY0C 5GHWH 4L4TE 4NZRH 4PEEA 3W37A 1I7UA 3Q48A 2CR3A 3PWLB 1FVCB 4P4KB 1YYML 4PV1C 3LVEA 4JR9L 4HOXA 3APMA 3O2DA 2YBGA 5HGGS 3K6NA 5EEUA 1UASA 1SN0A 1U2HA 1BJ1H 4H8QA 2UZXA 4N24A 4LCVA 3VFTB 5HJDA 1NC2D 2WO2B 4WFHE 1ZGLM 4YHML 3PHOB 3UCQA 5ICYA 2GHZA 1ASPA 3U4AA 4KVCL 1E5AA 2TSAA 2ZXWB 4OLVL 4QRSB 1HVXA 5E2WL 1RULL 5GRJH 4IRSD 4P4RB 1H8NA 5D2NA 4KI1A 2WXFA 4XXWA 2QELA 4G6KH 2ATPB 4UWQB 3BZFA 2XV6B 4GQPH 5GZOD 3MRMA 4XOAA 3SBWA 1GYCA 1TSHA 1OGAD 4MDJB 2MCPL 1E43A 3TO4A 1IL1A 1KG0A 1BLIA 5D1ZI 3O41B 2QFPA 3WY4A 1GS6X 4GSQA 3D0LA 1GC1C 4Z23A 5B1BB 3FRPA 3REVB 1BYNA 3GBLA 2FX7H 2YKKA 2VDOL 4OKVB 3IAGC 3F7KA 3KLSA 3I9AA 2DKMA 1SYVA 2DEXX 3G5ZA 4PGCB 4PJXA 5C0CB 3IFLH 4Q6IB 1KCVL 2Y2TA 4YHNB 4YE0A 4OFVA 5I18L 2ZONA 3F01A 5GRWA 4OGQC 3ULUD 5CEZE 1NOLA 3FTUA 4XMVA 2ADFL 3F5WA 4UT7H 3WD5H 2EUZA 3PDOB 1B6DA 1NCTA 4OZIE 2X1WL 2G3MA 4XPFL 1XXDC 2X4QB 3VD5A 3MUGA 4YXLL 4GNKB 2GIXA 2P5EB 4ES8A 2DQIL 4IIQC 4K5NA 1XBRA 1JPFA 1A6TB 2FR4B 2BWIA 1Q1JH 2VDPL 5F89B 4BDVB 2GIMA 1ZSHA 4FXLA 3MX0B 2YPVL 4KKLD 4L9LA 4GRWH 4O5LH 4UCFA 5DK0A 3S5YA 1SJHA 5L2JA 5DRNA 3QYCA 4K8RL 3LIZA 5E08L 5DA4A 1YEWA 4TUUA 2LFGA 4KO5A 5BRQA 1JGLL 4M5ZL 4CC4A 1NC2A 3FQNA 3Q13A 4PHZA 2VWEE 2ZX8A 3GBML 4R26L 2AJVH 2FQFA 1SOQA 2BVPB 2N0MA 5AW3B 4AM0A 4Y4KA 2VDNL 4DZ8A 2IDFA 3RTLA 3TYFB 2IALA 5IVNA 5TFSL 3EBGA 1EGJL 3G6DL 5FLUA 2QBWA 1TVBB 2LV4A 2A6KA 3NCFB 1UOLA 4OD3H 5T3ZH 1B0RB 3WFEH 2YO3A 4QLWA 4P2OC 3L3IB 1S5HB 3G9VA 1LO4L 4QXTB 4N6QA 4ZQTA 1UKSA 1PF3A 3C8KB 4P3DA 2X70B 1OAZH 5IHUH 3EFFA 3UBHA 2YD2A 3OKDA 4Q89A 5IW1B 1JGVL 4NDMB 5EUOF 2DLFL 1JV2A 3QDJA 1PSKL 4MQSB 4AEFA 1FFQA 3SE8H 5ADOH 2BERA 5L8JB 7FABL 1UT9A 4AK2A 3S88H 2A73B 2GCYB 2ITDB 1JDDA 1ADQH 1S78D 3EJTA 3ZMNA 3MCKB 3ARUA 3LEYH 5DT1L 2LFEA 3ZE2B 3UBGA 3CSBA 4OTXL 3SE9H 5DQ9A 3OR6B 3K2MC 3GSQB 1IM3B 1OE2A 1IAIM 3ZRFC 3QDJE 5FYJU 4OBRA 1U8QA 3NFSL 4TS6A 2DZEA 5BVJB 2Z8WC 4P9ML 1TZHB 3EYVB 5E56A 4BZ2A 1PZDA 2V9RA 5KBMA 1JG9A 1ZOXA 3C6EA 5FW6A 1MHPL 2F54E 2VLRD 3CFNA 1T3FB 5I1LB 1QI4A 1KTJA 4P4KA 3KLQA 5E6ID 2V8LA 1IVLA 4XPGL 2QPUA 1DL7L 2RR3A 3GTVA 5FLVA 4PRPD 3PAZA 4PY8J 3D25A 1RUPL 4JN1L 4MA1B 1HWWA 5DC4B 4HGWA 3JV6A 1V3LA 2YAMA 3LQMA 5LG1A 4FA8A 4XGZB 2HCZX 4W68A 4OFDA 4ORZC 1H5BB 5GIRA 1E4JA 1L7TH 4QHPA 4Y4FA 2B1AL 4HISA 4LVNC 3BDYL 3C5JA 4PJBB 2ZWKA 1AE6H 5E2JA 2VNCA 2Q7YB 3CDFA 3LS5L 4XBMA 5C09B 1H3VA 4G1MA 1C7TA 2FEDC 2OMUA 4EI5D 5A2IH 4TSCH 1SXSA 1SXNA 4OTXH 3FB7B 3TO4B 2GY7B 3VD4A 2Y25A 3HC0A 1A7OL 1J8HD 3WTUA 3VFUA 1BIHA 7FABH 3HAEH 1I85C 1F8TL 2XETA 2JJTA 5JOFB 3JVGA 1JTTA 3G6JF 4G8GD 4AJ0A 1RJLA 1ESOA 2KC0A 3LHPH 4P2CG 1U8CB 1FLRH 2AEPL 5KW9H 1FFOA 5CKGA 1MDTA 1OAZL 1E5YA 1L6PA 4F15C 5D7IB 1DJZA 2M83A 4KDWA 4QRPB 4HOZA 5AYTA 1ML0A 3MLPA 2IAMA 1MCRA 1PZBA 4FXGC 4Z9KB 4HEMA 3ZUNC 1KGCD 3KR3H 2E5EA 1JYWA 4K07A 5I76A 3MGOA 8FABB 3A3YB 2X38A 3S37H 2WO4A 5IMLA 1TU2A 1ZTMA 1MFCL 3IDIB 1CTNA 2Q86B 2P5EA 2MHAB 3EO9H 5HHNB 1KJ3L 1MW2A 4JPKL 5F9AC 5LG6A 4RRPG 5F89A 2GVYA 5DFTA 5DVKA 3KAAA 4XRCB 4KDVA 4Q6IC 2ATKB 3NQIA 4KK9C 3ZYOA 4N2CA 5EEVA 1MJUL 1KGXA 4UT6H 3FU7A 3AREC 3QFJB 2YPVH 1I3RA 2HSIA 4LL1A 3MOQA 3JTTB 4AIZB 1PL3A 3DUUA 1IBGL 4DZ8B 3D09A 1E6OH 1J8KA 1QPXA 4Y19B 2BC4A 3U1QA 1BM3L 2HJKA 3E3QC 3KYKH 4LT7A 4YC2B 3UCRA 2ZCKL 4JRFA 3B6SB 1KC5H 2VR4A 4H25B 2BVOA 1X5YA 2BP3A 4U31A 3QT2A 3K6IA 2F15A 3C5SB 1C12A 5I18H 1T03H 1IKFL 2VZ1A 5D70L 1LO5B 2NXYC 3BZ4A 3LNHA 5I24A 1CT8A 1RZ8B 3NJVA 1EO7A 1FFNB 2BO0A 5IGXL 3PNRB 4Z7WB 4PRIB 3QCVL 3SO3B 2XG4B 1NC4A 3WJJC 2CHZA 2ITDA 4N2MA 5CP7A 2X1QA 5JUEL 2VR8A 4BGDA 4BRJA 3ASWA 3NIFB