4Y2NA

Structure of cfa/i pili major subunit cfab trimer
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
147
structure length
147
Chain Sequence
b'HEKNITVTASVDPVIDLLQADGNALPSAVKLAYSPASKTFESYRVMTQVHTNDATKKVIVKLADTPQLTDVLNSTVQMPISVSWGGQVLSTTAKEFEAAALGYSASGVNGVSSSQELVISAAPKTAGTAPTAGNYSGVVSLVMTLGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CFA/I fimbrial subunit B
publication title Off-pathway assembly of fimbria subunits is prevented by chaperone CfaA of CFA/I fimbriae from enterotoxigenic E. coli.
pubmed doi rcsb
source organism Escherichia coli o78:h11 (strain h10407 / etec)
molecule tags Structural protein
total genus 17
structure length 147
sequence length 147
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-02-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2040 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4y2nA00
4Y2NA 3F85A 4Y2LA 3VACA 3F83A 4Y2OB 4HJIA 2HB0A 3F84A
chains in the Genus database with same CATH superfamily
1CGWA 5DJXB 5E51A 3V0AC 4WQOA 4DF9A 4WFEE 2L04A 1NCOA 4QLWA 1QEXA 4JKKA 3VSVA 1H5BC 2DLEA 4WW1B 3TNMB 3Q5OA 1GGCL 4S11A 5E6IC 2WLZA 1G9NC 4LLYA 4MAYB 5AOKA 1FVEA 5HHNB 5IB1B 1RZKH 1S5HB 1T22A 2N1KA 3GMQB 4JVUA 1BAFH 1XH3B 4ORZC 4LEOA 4X7TA 1G1KA 5DZAA 4TUOA 1GTNA 1VF5C 4KRPB 5GS3A 2CGRL 2AK4B 4K94C 3GGWA 4L23A 4PJIF 3U6XA 4KK6D 5K1NA 2CO6B 5JW5B 5B1KA 4PV9A 4HS6B 2VM9A 4JPIB 4JKMA 3OJDA 2HJFB 2JH2A 4OB5L 1ZTXH 2APWA 5F9DC 4NQVA 3QUZA 3V9EA 4FADA 4G8IB 3VI3F 4LSSL 5AL0A 2EKSB 1MJ7H 4JO1L 3T2NH 1TQCB 1T1ZA 4W6YB 1BPVA 4LOUD 1JRHH 3HI5L 4X99B 2UVFA 3WI9A 1TUPA 3FQNB 3SKUD 2ZSWA 5D1ZD 3DX7A 1AJ7L 3VWJA 2YO3A 4XAKE 1I3GH 4OSUL 3ARYA 4JO3H 4LAQH 1BHGA 1O75A 1BBJA 1ET7A 1RY7B 2VR6A 1AD0B 3KPQB 5BOPA 2XICA 1MW0A 3WS6C 1L6PA 1UHVA 2OJ1A 1T5KA 3C2AL 1GAFL 4FXGC 4L37A 4AYFA 1K8DA 2E27H 4R7DA 4XN1A 3QZWA 4JFFD 4K8RD 3RUGB 5CD5D 2HKHH 3O9WA 4H44C 2XN9E 4DN4L 2ITDA 1XSOA 1Z9MA 4O58H 5KYYA 2F58L 4MCNA 5CN2A 3VFTB 3V6OA 4KJQC 1PZDA 1AY1L 4N3UA 5C0GA 3R4RA 3MV7A 1ZLWK 3RX8A 1NKRA 2FBOJ 4Z5RB 1DQQA 4HKZA 4LDEB 5L8KB 3VXPB 4AEHL 4PLJD 4JUSA 3DYPA 3HS9A 4YXHH 3O3DA 4L8SA 1TLMA 3GMRA 1FVCA 3D06A 4XXDB 2X2HA 3ISRA 3QUZD 4OZHA 2HT2D 4RH4A 4JZJB 2PNDA 2IWFA 5C0JB 4OUUB 4Y2DA 1Q8MA 3ATEA 1ODAA 2CR0A 1PCXA 5L8LB 3H6AA 2P7TA 1XV8A 4IOFD 1RZPA 2CIIB 2W9DL 4Q2ZA 3SE9H 2DI8A 3KL5A 4WI2A 5DEFA 2YK1L 4DERA 2WZPA 3SEPA 5JA8B 4HUNB 3KG5A 1KCVL 4PP1C 3F04A 2PXYC 3LQAL 4DTGL 1L9NA 1HILB 4OW6A 1HYSC 2VDKB 3K8KA 5IF0A 1MXGA 3GBML 2OX5B 3Q5YA 3T1FB 1RZIB 1EANA 1AAJA 3CLEL 3GD1C 2OCFD 4AH2A 4APXA 2EDXA 2WXIA 2JLLA 3JV4B 1NCUA 1V3JA 3O9WD 3PNWB 4MXQD 5HDLA 1A1MA 1A6WL 4KQ4L 2EVFA 3EBGA 3MTRA 5GZNA 4QDGA 3MV7D 1F02I 2D0GA 1QLRA 4GAGH 4ICWA 3MLYH 3PHQB 2MQ0A 1MN4A 4PB9L 1WAEA 5D8JH 2NY7H 3FFCE 3WFCH 2EDLA 4NRYA 2SEBB 3RVUC 4Y2DD 3SE8H 5BOJA 4ZFZB 2BDNH 1UD5A 1F4YH 2H6PB 3I6SA 4IS6B 4GLRH 2IQAB 2IBZY 4OLUH 2NX5B 3O2VL 3ULVL 3R18A 1W72B 2XFGB 4TVSa 5F7DB 3SZKC 4HULB 4FMVA 2I60H 1P5UC 5I1EL 1NJ9B 2PWHA 1L9SA 2UV3A 3O2DH 4JHZA 4NZRH 2AITA 4XP5L 1I4FB 1F3DH 2VDNB 3D25B 3D8MA 1A1NA 3ZKNC 3OMAB 1AIFA 2UXGA 4Y4HC 3EH3B 1OAUH 4WIQA 4BQ8A 4P04A 3QXTA 4DCQA 3MO1B 4WU5A 1ES0A 2YXVA 4N8CL 1WBXB 2HUHA 2QDVA 4UWQB 1UD3A 3QNZB 3TL5A 2DLIA 3A24A 4YDJA 2HH0L 5GRUH 2WK2A 2H9GB 3IFNH 4NCDA 2HFEB 1CXKA 1SHMA 1FBIL 2ESVB 1M9WA 3S8WA 3V6FB 2GJZB 5GZND 3EGDB 5K9QG 2YXMA 3UEZA 2VMDA 1WD8A 4JVWA 4PVNA 1ILSA 5BRZE 5AYUL 5IY5B 4MAYC 3WNOA 1G87A 3IFOA 4G6ML 3DVFA 3IE4A 1JGDB 1DP0A 3D2UA 5BMFH 3ZKMC 4H7VA 1KBPA 4AYBA 2Z65C 1JZ6A 2F19L 5E94A 3QEGH 1B3IA 3V0IA 5C0AB 1ACYH 4KRPC 2UZXA 4JN2B 4HJGB 1OP4A 3IPEA 4MCZA 4ZXBB 2WTRB 5DUBA 1BM7A 5IK3B 3X1NA 4FNTA 3AQZA 5F7NC 1FHNA 3RKDD 1TEFA 1NWPA 5HVGB 4LOVA 1JN6A 3OKLB 4MXWL 4JY4B 3RJOA 5HHMB 4PLNC 5I1KL 4AYGA 2NCMA 3C08L 1BSIA 1KZYA 2G5UA 2GSIA 4H88L 1Y6MR 2BS9A 3V7MA 2ZCLH 4CBZA 3UPRB 5DYOA 5CHNA 4HJEA 4NENA 3S5LG 4XWOC 2DM7A 2VL4A 2BWQA 5I6OA 5GGRA 1MCOH 1VESA 1BIIA 5IJKC 3QQ9D 4PJGF 3OKDA 1D5BA 1LP9B 3NJNA 4RRPG 2MMXA 4RGNB 5KBKA 2J44A 3BAWA 1RZKL 1BAFL 5ILTH 1YEGH 5D2NB 4CNIA 3WEMA 4MJHA 1FORH 3BN3B 5I1AA 5F3BB 3ARQA 2XVBA 3B5HA 5IWLC 1H3UA 3QZNA 4N85A 5CCGE 3F12A 4OV5B 5I0ZA 1ZTXL 3VGGA 2GQHA 2IV9A 2WB7A 2VLRE 5TDNB 1G7HA 3QQ4B 4NN6C 1MJ7L 1ZPLA 1CC3A 3GMNB 3LZQA 3T2NL 2DEWX 3H9YA 2WLLB 5D93B 5DJCA 4D3CH 1MFAH 3F7YA 1V3KA 2QT6A 1JRHL 4HW6A 3D0AA 3QRFM 3FT3B 1H8OA 1OAZH 1XGRA 1LL1A 1C08B 5T5FH 4BZ2H 4HAFA 3MNMA 3U7WH 2CDGB 4NLAA 1G7MA 5B39B 1F1AA 4ZPVA 3PPEA 2MQ3A 4I2XA 1I3GL 4JZJC 2DLHA 1RUPH 1JZEA 5EDSA 5JOFB 3C09B 4JO3L 4LAQL 2BZDA 3KPPA 4X0KB 1CD1A 2MOVA 5IMMA 2G3MA 4GT0A 1I9RH 4LPVA 2VUOA 4PRHB 6FABH 2J71A 3PGCB 4NKOA 1ECYA 4QRSB 1HEZA 2ZG1A 3RPIB 3GXUB 2IPUG 2E27L 1FH2A 1T6WA 2GCYB 2BP0B 1FFPB 4LMQE 3FFDA 4Q8BA 4UQCA 4E0RA 1YJDH 3AB0B 2WQAA 4LOEA 5EUOF 2HKHL 5F7YC 1I1AC 3VFVB 2E6JA 2K6WA 1UA7A 3V5KA 2FEEL 5K9JH 2XV2A 3P3RA 4O58L 4QT5A 2BINA 4JJOA 4S0SD 4W70A 4GSXA 5BS0D 2GABA 1S7RB 3KJ6H 2AEPH 1I7TA 4PJIB 4YXHL 3WUWB 4KXDA 5KSBA 3VRJA 1CFTB 4NO0A 5I6PA 3I75B 2DLTA 5D1XE 4XB7A 1PKOA 3VI3B 2DM3A 2WUBH 4JR9H 5DHEA 5EU4A 3KMDA 3K6DA 1GMIA 1RSFA 3CZNA 3HR5A 4FNRA 2YIHA 1WLHA 1A9EB 4PPTA 4WI0A 1L9TA 2EICA 1KIRA 4XR8C 5JTWA 5J1AA 3QARA 2IF7A 3SE9L 3HCVB 2YA1A 1F97A 5C0DA 4K73A 2JFCA 5GXBB 3LOWA 1UKQA 4QAWA 4HK0A 4P2QA 5DDHB 1UJ3C 5HVHC 3QR2A 2CHDA 2G9KA 3ZE0F 5HPMA 4AGPA 4WI6A 4EVNA 4B3VA 2Z93B 3THMH 3CX5J 1AXSA 1T1XA 2NLJA 4TL4A 3TJEH 1JDAA 3G6AB 1CGTA 4FMKA 4MD5B 1C7SA 2ILLA 4X6BB 3EH1A 2RFXB 4Y16B 4NZ8A 2HLAA 4ELME 2A6JA 1MFVA 2ZX5A 1A7BA 3OZKA 1NGQH 1VERA 1ZAGA 3LSOA 4PWFA 3GMMA 1WEJH 1JNJA 3I50H 3QUMB 1SBSH 3HRZA 5AB0A 2PR9A 2TSBA 2WBJB 4WTWA 4XBEH 1CPUA 3G04A 4XO9A 5B1CA 3GZPA 4GAGL 1JK8B 43C9B 1IQDA 3MLYL 4NO0D 1QR1B 2Q0ZX 4TNVF 1KLFA 1RPKA 1BXVA 3EFOA 3B9AA 1CDCA 3L3HA 1ZT1B 2NY7L 4BWTA 3WFCL 3V4PB 3WNJA 3HHSA 3SE8L 2WQ8A 1F4AA 2BDNL 1ZY9A 3T8MA 1F4YL 3SDXF 4MDJB 1KDIA 3C5SB 2H3KA 4OLUL 4PR5A 4XMLH 3LZNA 1S4IA 2ZNWA 4XAWH 2X4UA 5IQLA 4A7GA 1MVUB 5E9DA 2MCG1 5F7WC 4W9LC 2I60L 2PUQT 4GSRA 4MKTA 4WHCA 5FPIA 1Z9SB 1QRKA 3O2DL 2OL3H 4NZRL 4P2QD 3FQTB 4XMVA 5L4FA 1FVDB 2ATKA 3QIBB 2R9HD 3VMPA 1OAUL 2X4OA 3B8SA 5I6XB 4HHAB 4BH8A 3DO3A 3TBVB 3FB5B 3QIUB 1JNNH 3H0TB 1CE6B 3WFDH 3E38A 5KVEE 4ELKB 3FUDA 4AQ1B 1KENH 4GKSA 5GRUL 4PJFE 4AMWA 5F1IA 3IFNL 3GJFK 3QQXA 4PJXE 3H4FA 3L3KB 4AIEA 3T71A 4JANB 4JVPA 2DIBA 4UDUB 4P9HH 1F45A 5LGHH 5CP7A 3DKHA 1PX8A 1GZPB 4HD9A 3WFBH 5I8OH 1JWUB 3MLPA 3NFPB 4I85A 4GUOA 1KJ2B 2PN5A 1H15A 1ZS8B 2VERN 5BMFL 5HTSA 4PGBB 5KYXA 1NMAH 5ID0A 3Q3GA 1BVNT 3QEGL 5D2NC 5SV4A 1ACYL 2WXJA 2AV7B 3G5XA 5GGSA 3L4ZA 5D9SA 1MI5A 1SQMA 1ZHKB 2YMXH 3CVHH 4G9FE 2UY7B 5EV7A 4NWUH 4NDMB 4UU9B 4FQHB 5E9DD 3DUUB 4C55A 1JZ5A 4O2FA 5EF0A 4LLVA 4HP5A 4RFNB 3VJ6B 5MENA 1BZOA 3H7BB 5D93C 1N2RB 3M1BB 4WUUE 1AG0A 5D7EA 3B2DC 2OR9H 4JFED 2ZCLL 2HB0A 1OT1A 3FQUA 1K4DA 2IANA 4A55A 3BJ91 4DP4X 4ANXA 1MFCH 3RWCA 1MCOL 2YC1A 3C09C 4ZMWA 3S9DB 4QRBA 3H9ZA 1A6ZB 3L4XA 3HRPA 1OV8A 2BVOA 4GMSH 5F7HA 4RWYH 4JE0A 1S7UA 1KB5H 3ES6A 3NCFB 3AXIA 3C8HA 4GS7B 1A0QH 2RTTA 1ZGLA 3I6GA 5ILTL 1YEGL 3CXHK 2CDFA 3IDMA 5AG8A 1FORL 4X9HA 4ABWA 3BVXA 1S6NA 5H2BB 3VB8A 5EZLA 4ODXB 2DBLH 4L9DA 5ALCH 2OAAA 4BQBA 5ETUB 3T4AA 4JUTA 3ULVC 1OTUC 4R4FH 2QSTA 3BVNB 3EUUA 3DGGB 4D3CL 1MFAL 4WY7H 3PL6A 5C71A 1R5IA 3V5DB 4QOKB 1ORSB 1OAZL 5HYJE 3MRJA 3CK0H 5T5FL 4BZ2L 3U7WL 2DS4A 2ADJA 1TQVA 1DLHA 1MAJA 3ASNB 4D8PA 4NBXB 4AQEB 1RUPL 4JFOA 4JFDA 4DP0X 1N19A 2BVEA 4NQEA 1CU4H 4GKZB 3EXJA 4UM8A 4JZOB 3OKNB 1I9RL 5AAMA 3TCLB 1TNNA 6FABL 4M02A 2ZX8A 1NGZA 2ZXQA 2VRQA 2F8OA 4PWJA 3QUXD 5F9WC 4PLKC 4Y4FB 3SDCB 4PJGB 4YHKH 1RUAH 1ZHNB 3TYFB 5DXWA 1QZNA 5DJAA 3LTVA 4KFZC 5BV7B 1CFSA 4PGCB 5K9JL 2IH3A 1NIEA 4BFFA 3D07A 2Y5QA 4ZBJA 2PCFA 1F13A 2ZONA 5E1HB 4JFVA 5I8CA 4JDVA 1V3MA 1NM9A 2AEPL 2CXGA 1PBYA 1SY6H 4AK2A 1NEZA 1OGAD 3VTAA 1RD6A 1AZNA 1P4LB 5D1QA 5HDQH 4I87A 2WUBL 4JR9L 3TH2T 3CHOA 1U2HA 3PL6D 2GJ6A 4KH2A 2X89A 1RQ5A 2R2EB 5DTFB 5GS0H 3BC9A 5DS1A 2I07A 4D0BA 1DVFB 2EDMA 4ODUA 1JCVA 2UX7A 2YAOA 1BQSA 3F8UB 1NH6A 4HPYH 4JREC 4GW5B 4NQED 3APDA 2QZQA 2ZWNA 1HWWA 1MCJA 3D05A 3QFGA 1XMEB 3O6MH 1SPDA 1OE2A 2N0KA 2EIKB 3THML 1JZHA 1G9MH 3TJEL 3B5GA 5TE6H 3TBSB 4WJG3 3TEWA 2CDEB 2ZUUA 3WNLA 2CCWA 1FNAA 2EDJA 1RZJH 3T6ZA 3TFKD 4WFGE 1KGCD 3QIBC 3PWPD 1NGQL 3EGSB 4PBVC 1FL6A 1A4BA 1WEJL 3I50L 4ODBD 5J12B 3HPJB 1L0QA 1SBSL 3VX1A 3UTOA 1R5VA 4WFHE 4FI6A 1OB1B 2G3NA 2LAGB 2ZF9A 2GVYA 3QIUC 3BH8A 1MCLA 3QJTB 2L7JA 4XBEL 3UTPD 3FUHA 4M8UA 1T7WA 3CPLA 4AQ1C 1TYEB 3GJEA 1HDMB 2E7LC 3ZRSA 4EUPH 4HKXB 3BLKA 1N8ZA 2QR0B 4WI9A 4D0DA 4ZMTA 2AEWA 3GUTB 1E65A 4JG1H 1BEXA 3WIIH 1T89C 4YDIH 1BFVH 4PUBH 2ED8A 5F7KC 4FTVB 3RWFB 2KQMA 3APCA 2GJ6D 4F7CB 4R4BA 4BEIA 3MUGB 3DOHA 1S3KH 4XMLL 2YBRB 4XAWL 2ENSA 4Z9KB 1HFUA 1XF2A 2BP8B 4NRZB 1PLCA 5CO1A 5DD6B 2C9UA 2Q86B 1VADA 2OL3L 2WNXA 3CFJB 1HYRC 2EH7H 4E41B 4G2AA 4H0HB 4ZSOB 3OHMB 3DX9B 3FTVA 4U0RC 4X4MA 4YGAB 3CZEA 3C5ZA 1OEZW 5JO5A 5INDB 1LYQA 1UT2A 2NUPA 5KOMC 1CIUA 3L95B 1F6LL 5DJ0A 2VQUA 1JNNL 5IJVA 3WFDL 4DKAA 1AYRA 1KENL 5E56A 5GSRA 1HHIB 3OAZH 4LF3A 4DSYA 5IEHA 3UADA 1GHFH 2R1YA 3MRHB 2EO7A 1BXAA 4FDWA 3MNZB 2DN7A 4G42B 4BRJA 4P9HL 5AW1B 2LTQC 3ZMEA 5LGHL 4L3CA 3C8KA 1E8YA 3EFFB 3V4VH 3WFBL 4Z3GA 5I8OL 3WTVA 1FNHA 4TSAH 1BVLB 1MCDA 3IGFA 2B4CC 4K9JA 3NSXA 2IEPA 1KCWA 4GS7C 5EIIA 2EO1A 3B4NA 1KEMH 3D69B 1NMAL 3EO1B 3KGTA 3EJRA 1F3DJ 3FQ1A 4MA1C 1DDTA 2IPKB 2HCZX 4R5TA 4Y9BA 3VDAA 1LMIA 1LK2B 5L7XL 1OD7A 3SDXB 5HHQB 2Z4TA 2CPCA 3ULUE 2YMXL 1UFUA 3CVHL 2OTWB 4NWUL 1X4YA 3HB3B 4FNPA 4F7MB 4DPBX 1CK0H 1QKZH 1WBZA 3MBXH 3QUHA 3UTSE 3VM7A 3LRLA 3SJVB 3A4AA 5FK9B 3MLRH 2P8PA 4E9XA 5CILH 2OR9L 4QJ4B 4YHIB 1IGJB 4J4PA 3OKKA 2N4IA 2EXSA 4KK5C 2OPCA 3FRPA 4Q6IB 3IT8D 1MFCL 4S0HA 1FV1A 3IETA 5T3XE 4OBSA 1IM9B 2H7WA 4GMSL 3F7QA 4J3SA 4Y4KB 5DO2C 4RWYL 1CL7H 3UOAB 1KB5L 3QDJA 4IKIA 1FNEB 4O51A 2NTFB 5LCVA 4LGSB 1A0QL 3AWEA 4AGQA 1YN7A 5J13B 3QJOA 1K2DB 2ZUWA 2WIIB 3CFCH 3GSWA 4TLTA 4YSCA 4X5WB 2Y7LA 1XQ4A 3MRQA 2BM3A 4QYOA 3AT8A 2DBLL 4MDIB 2GTZB 4LHUG 5ALCL 5DHVH 3NJJA 1A3QA 2VIRA 2C7FA 1NANI 4R4FL 1VEOA 3U4BH 4GG8A 3VFPA 4OJAA 1HOCB 4WY7L 1G5AA 1X5HA 3CK0L 1NSNH 1FFTB 3MNVA 4LCCA 3AREC 4OZ4A 5A1AA 3DURA 2RGSA 3ETBJ 2OJEA 2ORBH 4ODWA 2Q76B 1PIGA 5KG9B 3GSRB 4ONHB 4XNZC 4RAHA 4R7LA 2O6FA 1CU4L 1ZHLA 2C1PB 3E1F1 3MGAA 2AJVH 5F70A 2WV3A 4OVVA 4AVJA 3CLWA 3UH8A 2CO7A 3VA6A 4AVIA 5HYIA 3F83A 2IBGA 1CFVH 3QDGA 4FLQA 4N5UA 1DVFC 3DXAE 5GSVB 3WJLC 1QI5A 4Q9QH 5TH2B 2BNQA 3X14A 1TR7A 4YHKL 1RUAL 4WWNA 3MRLA 1UJ3A 4RGOH 2XBTA 4I4WB 3T3ME 3QDJD 4GJTB 1KXQE 4RSVA 5DK0B 1FG2B 3HBGA 2ICCA 1EZVY 5IZ7A 2EUWA 1MCKA 4LL4A 5CP3H 1YMHB 2AVFA 3QRGH 5A2CA 2ETWA 3AC0A 1MCCA 4PW9A 4LIQE 5LB1A 3NZUA 4JCLA 1F18A 3NG5A 1SY6L 3R0MA 2J55A 1F2XK 4KI5F 3VXUB 5DJ2A 4APQA 4WEUD 4K2UH 1R47A 2MPVA 3WHE0 5HDQL 4BJLA 5ACZB 1NGWA 4Y89A 1IGYB 5EA0H 1J0HA 4FQXD 2CZNA 1BQHG 2CJTA 3CNKA 1EHAA 1ZDQA 2W9EH 3FN3A 5ISZE 1U8OB 4KHTH 5GS0L 3BAJA 3QEQB 3RX9A 5D7JC 3L08A 3EJPA 2ICWJ 3RGVC 3VFGH 3OLEA 1ZWIB 5DVKA 2OMWB 4N6RA 4CSSA 1CD0A 2PO6A 4HPYL 2Z6FA 1KTRL 2WBXA 4LARH 4BA8A 2V3DA 3BWZA 4OF5A 1N6UA 3O6ML 4LCWA 4MB3A 2NR6A 2OMVA 4IRZH 4KKLD 1GYVA 2HA1A 3FQ4A 3OQ3B 2J20A 5EBLA 4FQLH 3DHUA 1G9ML 1RIVH 3ARDB 5DRWA 3QDGD 5TE6L 1A14H 3ZXAC 2R2CA 2VMCA 3PU7A 4KOCA 5T1MB 3T3PB 1HHKB 3DRQB 1SF3A 1RZJL 1BAGA 1I7RB 5GHWH 2Y06H 2UUDH 4OZFA 5IBTH 3HG2A 2L7EA 4L3AA 1JHTB 2IFFH 5E4EB 1N64H 4U6XA 1XZ0B 2W9LA 3G5ZB 3FUMA 3NQIA 2UY6A 5ELIA 4MSWB 3RZCB 4Z18A 5FWRA 1P7HL 3OG4B 2IDUA 5I6LA 4HGMA 4OZIF 1DBJH 2HVJB 3QWOB 4ZMOA 4JG1L 4QRFA 3WIIL 4YDIL 1NDMA 1BFVL 4PUBL 4X6CF 4HCRH 2DOCA 3OD3A 4ODSH 4R6UA 3QNXA 1OGTA 4NEHB 3PAZA 4NX0A 3FRUB 4EDXB 3IFPA 1S3KL 3VXNB 4PJBA 1Q0XH 3UX9B 4YAQA 2Q3AA 1FNGB 5J11C 1W8NA 2PO6D 3IK2A 2NNFA 3WY4A 2A9NH 1NMCC 2XOTA 1NBQA 1ETB1 2J25A 3S0PA 2R7EA 4LCWD 1PFOA 2BWIA 2EH7L 2NR6D 4UBDD 4WEBH 3BXNA 3PDGA 3HB3C 1WIOA 5BZZA 3REVB 1WBYA 3QI9D 3FUEA 5FHBH 1KYDA 3BD3A 4OIFA 3N42F 3KNBB 1BOGB 2Z1PA 2B1HH 5EFIB 2WWOA 4RWHA 3PWVB 1A65A 5ID1A 1ODUA 1E4HA 4TQ8A 1Y0LB 1GHFL 2OMXA 4XHJD 5I9QB 2BS71 3HFMH 4Q6IC 3V6OE 4DK6A 4J8QA 1UUNA 4OGQC 2NXYC 3D1MC 3V4VL 3BVWA 4TSAL 1QAWA 1TT6A 1R3HA 4Y4KC 1NAKH 4P5TC 1BLNA 1YPZB 4J3XA 1HN1A 1WA1X 5GIRA 4IOIB 4HPOH 1KEML 5J13C 1QUNB 4OZHE 3REWA 2V5SA 3B7SA 3VCLA 3TZVB 1GSMA 5KVDH 3HG1B 2APSA 1UXLA 4HGKC 3U4EA 1EXUB 1YEEH 5J8OA 2CBMA 3WDHA 2NDGA 2V37A 5DFAA 3RNQB 1NBYB 3IMUA 1TETH 4EO5A 4OZGA 1CK0L 1HI6B 1QKZL 4PV8B 3LB6C 4X8JA 4UTCA 3B37A 2Y7OA 2IO5A 2VDNH 3MBXL 1IBDA 1PD1A 2XZZA 4IHBA 5HGGS 4L9LA 2TRYA 3MLRL 3GXPA 5CILL 1NFIB 3O4LD 5FCSH 1WHPA 1U3YA 3HG0A 3SCMA 2BERA 1ZE3C 2EUXA 4HIEA 2QTEA 2BVQA 5KOVC 3QYNA 1IARB 4Y8DC 4GRMA 1J9SA 1Q9LB 4I13B 5FO9A 4N2HA 7FABH 4F7EA 3D85D 3LIZH 2AKRB 3LD8C 1CL7L 4NCC1 2IIJA 3QRLA 2MH4A 3DROB 1JPST 1RIHH 3MXWH 3JXAA 3OVUB 4HUVB 3QXDA 1Z5LB 4EN3C 1GSKA 3CFCL 2HG0A 5EC1B 4RAUB 2XXGA 4F8PA 2NTSP 2ERJB 2XG4A 3ROLA 5GJTH 3ZE1E 4XO8A 1N5AB 3LNIA 3ZTDC 3ILPB 1RK0A 2C9PA 1MOEA 2NQ3A 3RWDA 5K9QI 3PWNB 1HHJB 4FJYA 1CGSH 2Q20A 1NSNL 5E8NB 1XGPA 3BIKB 1TF4A 2E4FA 4FXKB 1MFEH 3TEZA 3SY0B 2DB8A 2CGZA 2ORBL 4G72B 1PVHA 2PF6A 3G9AB 3WN5B 3IYLW 5HJ3B 2AJVL 4N2GA 2EC9T 5FDWB 4IJ3B 3SCMD 1QQDB 3SKNA 4B27A 4BIKA 4UANA 5SWZD 1JZ4A 3KLDA 1CFVL 2CUHA 1SJXA 3HAEH 4Q9QL 4I0PA 3ZTNH 5AUMA 3U1QA 4ESKA 4TUJA 1XR8A 5KN5A 4RGOL 4P9HC 2GITB 5IGXH 3MCYA 5DD0H 2ZXAA 3S35X 2EXYD 3DK0A 3ARDC 3OZLA 3OHXA 3QRGL 4WCYH 4YDZA 2CKBH 4PJ8A 1AC0A 3IDIA 4JM4L 4KKAC 2R15A 1NKOA 1WTGT 5HHVH 3NFSH 3CE1A 1UASA 4A7UA 4ONGH 4K2UL 5LVEA 4U1GB 3N43F 3MJ8B 3WHXA 5EA0L 1AKJB 4OI8A 3P3TA 5E99H 4AIXA 2IGTA 5HYSG 1DZBA 2W9EL 1XXFC 2JIXA 3DV4A 3FOMA 4L48A 3T0EB 3VFRB 3WDJA 4KHTL 1YMMB 4WWID 1I3RA 3UAAA 1BQKA 2B59A 3I2CH 4XPGH 3OSKA 3VFGL 2K6YA 2TSAA 1F2QA 1H0DA 1MAKA 2EYTB 3I02B 4LCYA 1MIMH 4HEPG 2FJHB 4LARL 4LLMA 4HUXB 4R3SB 3RURA 2QDWA 4PRNA 4IRZL 3WJJA 3RWGB 1AD9B 4FQLL 1PG7H 4G8FB 1RIVL 1F56A 3RU8H 1IC7H 5FGSA 3BO8A 3L3OB 5FX3A 1A14L 1JD7A 2C4FU 4I0PD 5A2LH 4F8QA 3TH4T 1QRND 3PV7A 4H2CA 2X6BA 3SGDH 3RB5A 2A9CA 3RVVC 5F7EH 4I48A 2Y06L 5GHWL 4JQIH 3Q05A 5IBTL 2QV2A 2ZKYA 3UO8B 1CN4A 3L4WA 1A7OH 2IFFL 4F7TB 1N64L 3ABZA 4LNRB 3RDTB 2H3XC 1IAIH 1UM6H 2HT3D 4K5OA 2WXRA 4PJ8D 3TO4B 1KXTB 3Q8EA 1F3RB 2O5NA 2QGCA 4NT6A 1F86A 3ZKXB 4ADIA 5KSAC 3X2QB 4IBSA 4PRAA 4IIZA 4ZX6A 3MLXH 5DLMH 4UCFA 1DBJL 2EADA 4PTUA 2IH9A 35C8H 3KYOA 5I9QC 3PXJA 4JRXD 4HCRL 4N5ED 4LEXH 4ODSL 4QRRA 2WINA 2FCBA 2VO8A 2BJMH 4XPFH 4BCYA 2YJQA 1MCQA 3LPGA 1I7UB 3CXDH 4PV1C 2JIXD 1LD9B 4P23B 5HY9A 4NPYB 1RFDH 1Q0XL 3IDNA 4LXFA 3PJSB 4UUJB 3ZR6A 1OANA 1O9VA 4BK5C 1H9DA 3EH2A 4G1MA 4EIZC 3TZVC 1WIPA 4I2XE 2Z0UA 2Q3XA 1CD8A 5D2LA 2A9NL 2ED9A 3DMMB 5FOBB 2GAZB 4WEBL 1J5DA 1LEGA 3IRCA 5B4MC 4MWFA 2QQKH 1OARH 1XDTT 3DYOA 3MREA 5FHBL 2VITA 5E4AA 2BLFA 2WAHA 5J6GB 5C07D 2D03H 2NY0C 4PS8A 2B1HL 3VFSB 3DVGB 3NJIA 1ACCA 2OULB 2VGLM 3G5VA 1DVTA 2ITCA 1PDKB 1VFAA 2NY3D 3VE0A 2AJ3A 4P2YA 7PCYA 1AGDB 4ZW6A 4IMLA 2VAAB 4WW2B 1QSFB 2ROYA 3HFML 1FSKB 1ZCRA 2BCMA 1F1GA 4AYEC 4FD0A 1JAEA 3QNYB 4OAWA 2VXSH 2UWEF 4QXTA 1A6AB 1BFOA 1SJHA 4WJ5A 1NAKL 1T0OA 2AZUA 5KSBE 4DETA 5LAXB 4OZIB 1UWEH 3STBA 1QASA 3Q48A 1YVLA 4HPOL 3V4PH 3WOVA 3BUBA 4PVBA 4X6CB 4QRRD 5KVDL 2KZKA 4YZWA 4X5QA 2ARJA 4N2AA 2X9ZA 9CGTA 4LKCB 4MMZA 1YEEL 1TQSA 1MFBH 1WFUA 2BSRA 4Z7NE 4HALA 5B3SB 5EEXA 5GPRA 4RQQA 4H8QA 2ERJC 5H37G 1DJIA 1CE1H 2F2HA 1TETL 4YFDB 3W0WA 1HL8A 2CO4A 4R0LA 4J3TA 1LO5B 3FHAA 4R7NA 2VDNL 4Z7QF 4G70B 4MVBD 2WXGA 3VI4F 3B34A 3EOAB 3CUPA 3U0TB 3HA0A 5AOZA 3O45B 3O2DA 1CGVA 3FO9B 3AJ7A 4P2RB 2JK5B 4MCMA 4FXKC 4EZMA 3L3IB 4E9YA 3N42B 4GO8A 1Q90A 4O00A 2EDDA 4N9GB 5HHOA 3ZK0A 4EE2A 7FABL 1T20A 3LIZL 4G8GA 3GFUA 2APBA 2CALA 3BWAB 4O9HH 3FK3A 2F61A 2IG2H 4HHWA 4AL8C 2VLMD 5JUEH 4W9IC 3HZVA 1RIHL 3CDGA 2O6PA 3MXWL 4Z7OB 4Y2OA 3UMTA 1Z6JT 4JY6B 1JUFA 2UZIH 1KJ2H 2FWSA 5C1MB 1WITA 3UC2A 3CH1B 5L6YH 1CDGA 1MG3C 1V5JA 5GJTL 4RESB 1G6RH 3NCMA 4DW2H 3MUUA 5LGJB 3DK2A 1OT2A 4K4KA 4N9OB 1UWXK 3QYCA 2WANA 3MRMB 1XTMA 3LXUX 3VXRB 2SODB 4Q7DA 1QMUA 1CGSL 1TO4A 3W39A 1K5WA 4IRJC 1MFEL 2Y5TA 3SBWC 5IEKB 3MR9B 5C9JB 3BGMA 1PKQA 3HE6B 4PGZA 1R3KA 4HIHB 4NZFA 1NCBH 4JPSA 1WAPA 2V3FA 3ARFC 3KW8A 4JL1A 1OTTC 4GUCA 3T0EC 3M8OH 4IBLT 1AR2A 2WCPA 5D7JA 3W9EB 3MRFB 2YD9A 3BHBB 5SX5H 3RGVA 1DLFH 3UYPB 4GAFB 4ZI8A 3RIFK 4KH9A 3ZTNL 1DBKH 1KDJA 1OWWA 2HKAA 2ZYHA 5T1KA 5IVXA 3F5WB 2NY2B 4E9LA 1TEGA 4XC1H 2UYLA 1ZMYA 2NY1C 4L5FE 4DP8X 4YNYA 5DD0L 4U6TA 3DHJA 4OGAC 3KEHA 5DS8A 4WCYL 3L3OC 4M03A 2CGYA 2CKBL 3D3VB 2NY6D 2OV0A 2P8LA 4Q89A 2BC4A 2HP4A 2W0FA 4HAGA 5DA0B 3FUFA 4OLVH 4WGVB 1QSVA 5HHVL 3NFSL 2E59A 2EYRB 2F18A 4KOBA 4ONGL 3TPUA 4WI7A 3VD4A 2YLKA 3HLAB 3P4MB 2WVVA 5L2JB 1PZ5A 3TO4C 1CFMA 4XOAA 5I17B 1UENA 5E99L 5E9AA 1UT1A 3HNTH 3QEHA 4R8WH 4TMPA 4DOHB 1MI5E 4PJCA 3N1PC 1KYOJ 5DGRA 5ERWA 3ARGA 3O6FA 4GW1A 5FYJH 2W91A 3I2CL 4XPGL 1LEIB 5TF1H 3NSFA 2Z7YA 1B4LA 2JKWA 3Q9PA 6PAZA 4K15A 4R5VA 4UTAH 3T1WA 2A9AA 1MIML 3P9LA 1NINA 5T5FA 2OTPA 1EWHA 4BZ2A 3OX8A 3X1EA 4NAJA 5MENE 1CUOA 1MLBB 2IBZX 4H4NA 4O2EB 1FCGA 5K1JA 4P23C 1FNFA 2XDHA 4PRDB 4R97B 5DMKA 4KBPA 2B08A 3QXUA 5AOMA 4QRUB 4RCAA 1NIDA 2GUOA 2IANE 1PG7L 4R2GB 1QSEA 5JIDA 2LGNA 1IC7L 2YA0A 5FGCE 1FYTE 4ODHH 3BZFB 1YNTF 3RU8L 4WRLA 2YARA 3O3UN 2VQ1B 3BT2H 1IEAB 2MHAA 4FFVD 4PJ6A 3RFZC 1AOHA 4PY8I 3DMMC 5EH1A 5BV7H 2FNBA 2R2BB 4N28A 5F7EL 1J0ZA 4JQIL 3ILQD 4X7SH 1YAZA 5JHDA 4NAQA 4Z6AT 2ICWA 2X70B 1UCBH 4P4KD 4J3OG 3DPBB 2W80C 3KPSB 2F54D 1IAIL 1UM6L 2A73B 3LKOB 2WXNA 4PCYA 1JL8A 4S10A 2D0FA 4OF3A 5ESVB 3GO1H 3SDAC 2BW4A 3MLXL 4FYRA 4LFHG 5IB2B 1E5ZA 1IFRA 4UOW0 3N43B 4NKDA 3SPJA 35C8L 3CG8A 4NFCA 4LEXL 2BJML 4XPFL 5FF6B 2WLJA 5ECGA 4EKXA 4CGTA 1AMXA 3CXDL 5EWIH 2CRMA 1I1FB 3L2NA 1H6UA 2PW1A 4UF7C 5D5ME 4LLWB 3ARGD 1RFDL 3D0VB 3O6FD 4GUPB 4P5TA 4U1SA 5CINH 5KVGE 5FM4A 5FM5M 2DD8H 1F5WA 3K7UA 2PCPB 3P3UA 3O8XB 4HJ0C 2ZOLB 4JFDE 2APTA 3NRPA 2Y7QB 3S5LB 3DX1A 2EIZB 3TU6A 3U4KA 2FEJA 2GG1A 4U1IA 4L05A 4Q14A 4QTHA 2V5MA 3VXMA 2OXGB 2QQKL 1OARL 2CKNA 2XG5B 4K5LA 1XFPA 1T7ZA 2D03L 3EDKA 1UZ8A 3OLIA 5D7IA 2H26A 3D39D 3VQLA 4GY4A 3QIWC 3ZDXE 3NJXA 1QUPA 3G6JE 4WO4A 1E5AA 2J3SA 5JHDD 4L4VB 1KGCE 2VDRB 2ADYA 5EU6A 4C56B 1G7QA 1JZFA 2H2SD 4KDWA 4XBPA 3BRFA 4CN4A 1CG9A 2VLJD 3WTSA 1INEH 5KJ7E 6CGTA 3LMJH 2VXSL 3T8XB 4RMWA 4ZQKB 5DZ9A 1Z9OA 4JFWA 1OAJA 4X4XB 3SN6N 1UWEL 5JLZB 4IGBB 1A4AA 5D1QE 3V4PL 5B22A 4ZUVB 2IAMC 3TVMB 4GW4A 1FIEA 1U92A 3TBBA 4HMDA 3J07A 3UGEA 4XVTH 3NJFA 4EN3A 5FB8A 5FO8A 1JTPA 1MFBL 3RY5A 2PPAA 5GISH 2Y2YA 3SE4C 2G0LA 2Z7ZA 1CE1L 5T3ZH 2V2XA 5FA4B 2WHVA 5FLVA 2WLYA 2GHWB 3F64A 1AS6A 4A63A 5IV2A 3T0WA 2VZVA 3L4TA 2N01B 2BK8A 2Z31B 3GC3A 3INOA 1E9PB 3ELQA 1XR9B 2Q1EA 3OR7B 4XI5C 2BMKB 5LO7A 4BSWB 4XT1C 4L8CA 1S78C 4PJEA 4PRIE 2B77A 3HFFA 3VXMD 3TPKA 1VDGA 2OL3A 2VO5A 2FR4B 5CEZH 2CIKB 4KXCA 5E2VH 1A64A 4PGJA 4BXVA 1K4CA 1PY0A 2FQGA 2ZAIA 3C6LB 4IK6A 4WO4D 4A38A 3RWJB 3AQXA 3UAFA 1KCRH 2AAVA 4LGRB 5GS2D 2G2PA 2K45A 4O9HL 5HBBA 1GOGA 3MOQA 2IG2L 1NIFA 2X87A 2A6IA 5JUEL 4BSVB 1TMCB 3F58H 4U1JA 2BSCA 1P84J 1GGBH 5C0NC 5GGTH 4MMYB 5GZOC 5B3NA 4EQ3A 1I8KA 4GQZA 4P99A 2DLGA 2UZIL 2FWOA 2UWEB 1X5GA 3DARA 5JW4R 5L6YL 3QJXA 5TDOA 5BXFB 4Z78A 4YE0A 1G6RL 3BPLC 3FQWA 3NYKA 5C09B 4KGLA 4DW2L 1E40A 5EN3A 1JCKA 3UBXG 3X12B 4ZYKA 3TBTA 4N2NA 5IVOA 4X7DC 2BXYA 3LKNB 3NA4A 2A74B 4PY7A 4XE5B 5TDPB 4DAGH 2BHZA 2VDPB 3NK4A 4I89A 4MMXC 4PWIA 1E28A 3CVHA 1R24A 1NCBL 1GR7A 1MHEA 2QVKA 1PS3A 2X53A 3OPZH 4Z7QB 4HLJA 1CF1A 1DDHB 2QEJA 2X3CA 3M8OL 3OKOB 1C5DB 1I85A 1J8HB 4OCWH 4FQQB 4BFOA 1TSRA 5CGMA 1UWGH 1DLFL 1F1DA 1QBBA 1DBKL 3KHQA 2UX6A 4BFBD 1TEYA 3EHBD 4P4RB 4XC1L 4LVNB 5ENWB 1ZPUA 3I6LD 3IDGA 1AQHA 3OB0H 1YEKH 2E46A 4R2GC 4QD2E 1P7QA 1MJJB 1TQTA 5E4OA 1KB5A 5E70A 1C12A 2FWUA 4Y19A 4OLVL 2YZ1A 4G3YH 4KJYA 1I1YA 2V0AA 1NLDH 1E43A 3PDOA 5DCCA 1I8IA 2A0LD 1KPVA 4I9WE 3V5HB 3NFNB 3FONA 4ZS6D 5CKAA 3II2A 1XIWA 3LHAA 2PPDA 1HHGB 2WQVA 1CQKA 3HNTL 2XWJA 2ZP0T 1E2WA 2XV0A 3VXSA 5J9PB 4R8WL 3NDYE 4QF1B 1INQA 3NDZE 4N22A 4FFZH 2FHCA 5ANMA 1TVHA 5FYJL 3IJYA 1SMOA 2XTJC 5TF1L 1YC8A 1RK1B 5BJTB 1FZOB 4UTAL 2GI7A 5JOEA 1JZ2A 5TGBB 1U2YA 3H56A 3KBPA 5B38A 1TZIA 1P6AB 3GTVA 3KPMB 4N0UA 4U6HA 5CZXC 3QXAA 1Z1WA 4HWEH 5D72H 3FS9A 1F58H 1U91A 4PYGA 4W81A 1QFPA 3EG9B 4A7TA 2K1MA 4BK5A 3Q06A 3O8XC 1U8CA 4ODHL 3II3A 4J5VA 1XGUB 3BT2L 2G75A 1IGFH 4TULH 5LNGA 3MRKB 5BV7L 4WWKA 3O11A 5DQ9A 2F74B 3QW9A 4X7SL 2MRYA 4PD4K 3HUJA 2I5YH 5TQ0H 4ELMF 4HS3A 2D2CC 1UCBL 1PY9A 4YIQB 3B2VH 3C60B 1N67A 2XN9B 4KXZH 1V7NH 4TVPD 4PIRF 5CD3B 4F1SA 1WZKA 3S98A 4Y5YB 5E24E 3GO1L 1F4XH 2Y22A 1XIWD 3CBJB 3CFKB 4BFIA 3QZPA 1SY6A 3O6LH 3DTXA 1R6VA 1L9MA 1XTLA 2HYMA 1P7KA 2XFXA 3VXSD 5EWIL 2WMPA 4X4KA 3RA7H 3ASWA 1E4WH 1JPSH 1Q9WA 4K0OA 4JPQA 2XYBA 5CINL 5D96B 1P1ZB 1E4JA 3EGXB 3IJEB 4AVKA 5DK2B 2FBRA 3AGVA 2DD8L 5FYLE 3OJVC 1QO3B 3ZQ9A 2EABA 4JKLA 4G6KH 1E27B 3C6EA 3IMVA 1DL7H 4HZLA 4JAMB 1UD8A 4OF7A 3BIAX 1ETZA 3T5WA 1ZGLM 1H8LA 1T1YA 5FA3B 2EDKA 5F6HI 5HGAA 2YR3A 2GBAA 3TIEA 3FB7B 4JRYA 2Z64C 2YEVB 1T7XA 4HD5A 4KHXH 2LU7A 3DVNA 4MA3B 1KC5H 2BNQE 1NCJA 4LK4A 5JOPE 4WWKD 1TLKA 3CSPA 3HMXH 4YXKH 2VLLA 1DCEA 4M4PA 4A39A 2FIKA 2PMZA 3MLWH 4D0CB 2Y9RT 1G9HA 5CGBA 3C6LC 4LKXB 1INEL 5I6KA 3K6SB 5CMAB 3LMJL 4IU3B 1XCXA 4HGWB 12E8H 1AGCB 1G7IB 4N2CA 5IW6B 3DPDA 1ID5I 2WOYA 3AU1B 4I77H 5H94B 5KJ4A 2CHNA 2R59A 3X3FH 3F7PC 4YHNB 1CFBA 4QHLA 1RL1A 2V2TB 1Q9KA 3AG2B 3LV3A 4JFYA 5JA9A 2DV6A 1ZA3B 4B0MB 4RZCA 3FB8A 4RMBA 3ARXA 1DN0A 4EUPA 4ABUA 4OIIH 3VWKC 4AZ8B 4XVTL 3QR1A 4EMZA 3FFCB 1JYNA 4Q52A 5K9KA 1KULA 1ZDSA 1GVIA 2V9TA 5GISL 3GJFB 4FKKA 5EU3A 5TFSH 4FG6D 5T3ZL 2C7UB 1S7VB 4JM2F 5GS0D 2VC2H 4ORGB 4AQZA 1P5VA 1ERNA 4TNEA 1KJVA 2H0FA 3NRQA 3ZHKA 3LRGA 4D94A 4LCWE 2A74C 3BSZH 3J7HA 3OC5A 4MAZA 3L9BA 1MCWW 5CEZL 5FWQA 4JRYD 3P9MB 5E2VL 1X5ZA 1VKXB 1M53A 2B39A 1A6UH 3FB6A 1ORQA 5C0BD 1KCRL 1E90A 2F0CA 1W16A 2EDEA 3TN0C 3FTGA 4LVHB 4X5PA 5KUKA 1SDYA 4GRWE 2LU3A 3F58L 1PGRB 3MNWB 1GGBL 3BGFC 3T4YA 1XF4A 5GGTL 4B97A 3K3QA 2QJDA 5KBDA 3A4DA 2JELH 2Z92A 3VH8A 1ITCA 3MRRA 4LVNC 3GIVA 5D6CB 3BW9A 4HH9A 1CDBA 1FPTH 3MA9H 4FNQA 3V4VA 2FD6H 5BRZB 3ILEA 4K55A 3AG4B 5T5NG 2MFNA 3RVTC 4PJ5D 5D7SH 4Y5VC 5D6DA 1DQJB 1FO0H 1ZIAA 2RACA 4AY0A 4A68A 3B7YA 3O0RH 2G3ZA 4NJAH 3VA2C 4DAGL 4EF3A 4PI2A 1TCMA 2G5BB 5SWSD 1WG3A 3KPNB 3S36H 4DP5X 3FH5A 3QBTB 8FABB 4LPWA 2PYFB 1J10A 1W6WA 3JZYA 5EZPA 5IFJB 1SZNA 5IB3B 3OPZL 1SYSB 5D71H 3UACA 4ETQA 3HC0A 3QQ3B 3EIFA 2X40A 5DUJA 1RKRA 4TSCH 1AHWA 1J1OH 1WWCA 2XIDA 2ZKWA 3CZUB 4OCWL 3B3IB 3GYRA 2ZT9C 4MNGA 1EZSA 3U0WH 4YJZL 1UWGL 2ROXA 1QEWA 3WEXB 1FJ1B 2X41A 3FCSB 5CIPB 2XN0A 5IW1B 3WGUB 3SGKC 2ZWZA 3QORB 4ERSH 1WFOA 5L88H 5MEQB 2OJZH 3TNNA 3QDMD 1YEKL 3GMLA 4UZUA 3KYKH 2WIMA 3CVCA 1O6TA 2OSLB 3ZUNC 5C8JA 1PNCA 1M7XA 3QQDB 1U8MA 4K7PH 1QBAA 1SLXA 4G3YL 4KMTH 3RFZA 4KVPA 2YSSA 1NLDL 3KH3A 2FSEB 3EYVA 1MRDH 2XCMC 5F1NB 2NSXA 4G82A 2JB5H 4X98B 4BQ9A 3PV6A 3MOBH 3C60C 4GT7A 4FZEH 3GM8A 1F6AB 1HQRB 3PGDB 4MJ6B 1WCBB 1JV5A 1ZS2A 2BVPB 1MCBA 2VLRB 5DHVA 3FT9A 4YFLI 3PIQA 4M62H 4JE4B 1NEZG 1XCTA 2APVA 3I9IA 4QHNA 2BZCA 5DFWH 2Q8BH 5ITBH 4FFZL 3DBXA 3SDAA 1BIHA 2IJ0C 5DT1H 2FX7H 1NCDH 1OTSC 2X7LA 4H0LC 4OZGE 3IMTA 2LW3A 1KWKA 2XKNB 3ULVE 1UM4H 2ZYSA 1G7JA 3W9DB 1O9ZA 4DKEH 5F88A 5CSBA 1TCRB 1YN6B 2V7HB 4HWEL 1I7ZB 5D72L 2KPNA 2MCPH 5LNEA 1F58L 3FL7A 1Z0NA 3K0YA 1FFQA 5DJXA 4K71C 2CK2A 3QZMA 4GI8A 3DO7A 5HDRA 1IGFL 4TULL 3QUKA 5DZOA 2YAQA 3T04D 4NO2B 4YFLF 4WW1A 2H4EA 2WSPA 3TNMA 1LLAA 5BW7C 2I5YL 5TQ0L 3RKPA 1PSKH 1QA9B 3B2VL 3LS5H 4RAVB 5HHNA 1V7NL 2VE6A 1S5HA 3GPSA 1R34A 1A1OB 3GMQA 1XH3A 2DKUA 1EFXD 3JWNC 3RWIB 3FOLB 4BH7B 5CP3A 2AK4A 4WWPA 1DQMH 4YGVB 1F4XL 2KL6A 2F53A 3CMOH 4AKOA 1CDJA 5JW5A 3QCTH 4KZEH 5C0RH 3O6LL 2HJFA 2DYPB 3SYQA 4D9QD 4G8IA 5DA4A 3BZ4A 5J56B 5D1XB 3IKKA 3JV5A 3RA7L 4GO6B 1E4WL 1JPSL 4TPRH 3CAFA 4S1DC 4QXWA 4X99A 5EOTA 5FGBA 3ZKND 2EIEA 1Y07A 5E8DH 3FQNA 4GG6A 1HNFA 2BNRD 1WT5C 2IAMA 4G6KL 4F9PA 1DL7L 1CGUA 1MJUH 1OF2B 3GZKA 1KGYE 5JHLH 1AOZA 5IHWA 1KBWA 3T0DA 3UAJC 2F5AH 5ES4B 1AIZA 5IQ7H 3VGHA 2EVJA 1QD0A 2X1XR 5JHMA 1SOSA 1NANH 1XGTB 4IRZA 4KHXL 1MW3A 3HPLB 4M7JH 1KC5L 4N26A 4QTIH 1KIQA 4L29B 4G83A 4AJWA 1U33A 3CVDA 4YMPA 2VDMB 2R4RH 1HNGA 3HMXL 4W9HC 4YXKL 3T6VA 4BYHA 1ZT7B 3S88H 2AQ2A 3MLSH 1T6VN 3VD7A 4MAYD 1KTLB 3D0LA 4ELMB 3GTTA 3STZA 1HS6A 3MLWL 4FKEA 3BFQG 3QUYC 2KYIA 2CE6A 2D9CA 2XZQH 2WO2B 2ED7A 1AZBA 3BSGA 1U0QA 3BYTA 4MQTB 5G5DA 2CSPA 5ACMA 5A2IH 4LHUB 2W81C 3U7AA 2EYSB 2AK4D 12E8L 2ZOKB 2HRLA 4I77L 2F53D 3X3FL 2A5UA 4HUUB 4AIZB 1FQ9C 3WKYA 4XXDA 5A3IC 4I1NB 3PQYE 1BPLB 4OIIL 2AS5M 3TIDB 4IRSC 4OUUA 3VTTA 1AXIB 3EYOB 4HCRA 4LCIH 3BPNC 4KVCH 5TFSL 5EIIG 4DVBB 4JS7A 3I3DA 2Y1VA 2ZWYA 3ULUF 2VC2L 4XWOD 1JGIA 2DWSA 2AAAA 3RTQA 5LWYH 1H3GA 2YD5A 2PYEA 3U82B 1X4ZA 1JPGA 4GUQA 3APNA 3BSZL 4A6YB 1X7TA 2WW8A 3FCUB 3QJZA 2KDGA 1HILA 1FNSH 1KY6A 1HU8A 4G8EB 4HCGA 3DOSA 1RZIA 1A6UL 3VVVA 1R46A 1RLWA 5CEYB 2DTSA 2ZOUA 5DI8A 1PFCA 5CZVH 3PNWA 3GMPB 5AD0B 4JDZB 3V0FA 1QFWI 1TJXA 4PJFB 3FRPG 1U95B 3FHQA 1TKWA 5A6IA 2CBPA 3V8OA 4BDVB 3TF7C 4PJXB 4PS4H 1TO5A 4G7QB 3IVKA 2CLVA 1BV8A 2ICEC 2JELL 3CSGA 4I3SH 4WFFE 5BVJA 2A6DB 5I8KH 1GYUA 1HIMH 2W65A 1ZEAH 2NZIA 3TESA 1EZVX 2EUZA 1FPTL 1BQHB 3MA9L 3AQYA 1E3FA 2FD6L 2P24A 1QTPA 3L6FB 3K6FA 5IM7B 3N0PB 4QRRE 3O3AB 4GIOA 1IFGA 4U6YB 1UD6A 2EC8A 4FX5A 4OF8A 4KROC 2CJ3A 1EVUA 5D7SL 3MSPA 4K8RH 1H6FA 3LXAA 1FO0L 4IS6A 1KTDB 1LWHA 3AFLA 3O0RL 3AW5A 4CVUA 2NX5A 2VSCA 2OBGA 4NJAL 1JZ3A 3QEUA 3KPRE 3VSTA 4AUUA 4AW4A 4JM2B 3S36L 3LVTA 3SQBB 1DUYA 1ECZA 1NJ9A 5D2LE 5M95B 2PYED 5IG7B 1S7SA 1T04B 5D71L 2YD0A 3D25A 4TSCL 1J1OL 3MRCA 4WUUB 5GGVY 3U0WL 4FI8A 4YEFA 3C6SB 4OJFH 3VQ1C 1NOAA 1M7IB 3UTQA 1YRKA 3J2PA 3MO1A 1AR1B 3VNZA 5I75C 1YUHB 4ERSL 3Q8BA 3CX5K 3WSQH 3C5XA 1WBXA 1M1SA 2AQQA 4JJ5B 4RBPH 2PETA 1KF9B 3RVXC 5L88L 5DFVC 2OJZL 1OK0A 1WO2A 4KX9A 4A2LA 2H9GA 3KYKL 4FQ1H 2HFEA 1RUMH 2C1OB 4POYA 4E9SA 3LIZA 4KKRA 1RP9A 1VB9A 4JHBA 2ZXCA 4QRPE 3T3MF 3ETSA 5EF2A 3BP5A 2M83A 3ZIMA 1EZLA 1QLEB 4K7PL 3QAZC 3EH5B 4KMTL 4PJHE 4MB1A 3VSQA 1MRDL 4ZMPA 2JB5L 3L5IA 1WTLA 4JY5L 3MOBL 4UNUA 2H1LM 4FZEL 1SJVA 1T7YA 1JGDA 1UOVA 4PRBB 2FO1A 5KSVB 5FS5A 3VFNA 4FHBD 4S2SB 3QJQB 4J3UA 5C0AA 4M62L 2VKWA 5A40E 5JXEC 2DMCA 4JN2A 4TTDC 4HJGA 2Q8BL 3L5WA 4PHZA 5DZPA 2BIIA 5ITBL 3O41B 2NX5D 3QPQC 4ZXBA 5LXGH 5DHDA 5DT1L 2NNCA 3W0WE 4S1RH 2FX7L 1NCDL 3DJSA 3CMGA 4L0ZA 1XF5B 3N1GC 1UM4L 3BP4B 4DKEL 2O6CA 2WLMA 4JY4A 3DGDA 1BM3H 2X2IA 5F3HB 4ILDA 4H5SA 3VACA 4B95C 5C97A 5MHSD 4MJJA 3FH7A 1MRCH 3OR6B 2MCPL 3ESVF 3QR0A 3HZKA 5C0FB 4HIJB 4OM0H 3V7AG 3LDBC 2DMBA 3CSYA 4R7XA 5HHOE 2YWYA 4EIGB 1MREH 1Q0YH 3QH3B 4FG2A 3HAEA 4GKNB 4OFYA 2YEZB 4G8GE 2B16A 5F97E 3IMSA 2V4LA 5MEPB 3CHSA 3U2IA 2PP7A 1UQSA 1BECA 4NYLB 4CW1A 1PSKL 2B14A 2ESVD 3C75A 3WS3A 2F15A 3LS5L 3KM1A 1YY8B 3HHRB 5F89A 3WKNA 5IHZB 2GIMA 1HT6A 2XWBB 4G7VH 4ZFQA 2XX0A 1ZIBA 4I5BB 2HG5B 4ODVH 3ULAB 4BKLB 1DQML 2NNXA 5F3BA 4MJIE 5IIEB 3VD2A 3CMOL 2W1NA 3LHPH 3P9WB 3DETC 3QCTL 4KZEL 5C0RL 3ZTJG 1UWYA 4NRXB 2P42B 2WYHA 1K5NA 2CNZA 4LLQB 5C0AD 2RIKA 5LGYA 4HFWA 4Y8AA 1R3IH 3RFRA 4OH2A 1NBZA 1OSEA 3BOVA 4TPRL 4ZXBD 2X4RA 3ECBB 5AW2B 4CN6A 2P5WB 3H9SE 1D6EA 1P53A 1C08A 5E8DL 5A7BA 2CDGA 4E42A 3O3EB 3FPXA 5C2UB 3T65A 4K3EH 3VDCA 5B39A 3QT2A 5JDSB 1MJUL 5HHMD 4H25B 2BNUB 2WNWA 3LXCA 5JHLL 3SODB 5G4OA 5C0IB 4FCHA 1OSZA 2F5AL 4PG9B 1T83A 5IBUG 4AXWB 2J21A 3I9AA 5IQ7L 3GB7B 2QGEA 1IAOA 3VFOB 1FZKA 3GTNA 4QXUH 1A7PH 4QTIL 3MX0B 4M7JL 3G5YB 4BELD 3RPIA 4X6EA 1X6LA 5DJYA 4WTZA 5IVXE 4OFYD 2BP0A 3VRIA 2R4RL 4WK2B 4ICXA 3S88L 3MLSL 4MB4A 3VFVA 2W8CA 3PABA 1QWHA 2OMBA 4RGND 1U2CA 1QWNA 2QFRA 4JQIA 1VAHA 2XZQL 2VDQH 2HMIC 1P2CB 2WQWA 4GI6A 2EIMB 1YEJH 1S7RA 3MYJA 3ARVA 1GXEA 5LG1A 1J0YA 4M9OA 1AQKH 4GNKB 4WDIB 4Z7UA 4YHYB 3ATAA 3WUWA 3IDYC 3ZE0E 1CFTA 1S5IH 1M2VB 2R0WH 1Y6KR 1A4KB 3KD4A 3VI3A 4OZHF 4U1HB 5FW6A 5C08A 4ZFOB 2JXMB 2JE8A 4LCIL 1A9EA 1JXGA 3L3GB 1MSPA 1FLTX 4KVCL 4PJCE 4YHLH 5H4ZA 4J6RH 3QCUH 4XNXH 5KYWB 3HCVA 3K0WA 1D7BA 2QGBA 3ARBB 4YR6B 3U4AA 4M1DH 1F0LA 2HAZA 2DWYA 2XLLA 5LWYL 4AK1A 4WV1A 2XWXA 3PWUA 4QWWD 4Y5VA 1T0MB 5JZ7D 4PGEB 4HOZA 4Z7WE 2PPEA 2I27N 2OS7A 3CC5B 4PRHD 4V2BA 3U25A 1QSEE 2WWMC 1FNSL 4JM2C 4XNMA 3SE3C 4HKJB 2VWEC 1TTUA 3OKEB 3KR3H 3ZT7A 1K9TA 4HCIA 2VR4A 3WAJA 2X0VA 1KLGA 5F7FA 4G71B 3GK8H 1EA9C 3FCTA 3BD4A 2NY4D 2HT4D 3OXRB 4GH7B 1B0IA 1N12A 4YEEA 4POUB 2V33A 5CZVL 1KJMA 5FUCC 2Z91B 1YY9C 3OTTA 5D7HA 4XNYH 2CRYA 2DI9A 4DIXA 3F7VA 1AS8A 2WBJA 3CHPA 3OWRA 2JSFA 4PS4L 1DYZA 4I3SL 5GRVL 5I8KL 2CU9A 1HIML 3BZ5A 3JUYA 3QJHB 1ZEAL 3OB8A 3DNKA 3KAAA 4XVJH 1FFOB 3NBNA 4E2OA 1QR1A 4XTRD 5HYSB 1XSKA 4WHTB 1X7QA 1U8PB 3RIFF 1WA2X 3ZE1F 3EJUA 4YLCA 3V4PA 5K39B 4K8RL 2JVUA 3B56A 5IROC 5F1SA 1GMEA 4XCEB 4MDJA 4KKBD 4V11A 2D4DA 3NIFE 2W92A 3UZVB 1KJ3H 5E5UB 1MVUA 3V6BR 4ZX5A 1AQDB 1MKFA 2CD0A 1J05A 3GBNH 4HDIA 1IRAY 5I6NA 4N68A 4Y0GA 1V27A 3RL2B 2W0LA 5I15H 3UTSB 1FVDA 2HTKD 1NGXB 5C3IA 4CU7A 1UURA 3SPGA 3X13A 1PD0A 4OJFL 2ZNXA 2MKWA 1W6LA 4JFQB 1JV2A 4HHAA 5JNYA 2DKSA 2X1PA 3FB5A 3B9KC 5AB2A 2JQZA 1B4JH 3WSQL 4Y16D 4ELKA 1YEFH 9PCYA 4OQTH 3L7FB 2FBJH 4QHPA 5I82A 4FQ1L 3RAJH 1RUML 5EU6E 1QATA 3TURA 1WIUA 2WBJD 1V55B 3V95A 3PPSA 4J2XA 4I8DA 4ZUWA 5IQOA 1BZQK 4MNQA 1GZPA 2AXFB 4PH8A 1IGTB 5D55A 3BVTA 3NFPA 3MV01 5I5MA 1KJ2A 2GJRA 2Q2EB 2AXWA 5HGDB 3U2SA 1BF5A 2QQNH 4BUQA 1MG2C 5EEYA 1JWSB 2VR8A 5G4NA 3VTMA 1G6RA 3TA3C 1I1RA 4FYQA 4I18B 3TO2B 1E8WA 3ZSSA 4EI5B 2YRLA 3IDJB 1YEDA 5LXGL 1J88A 1AHKA 3U36B 1ZHKA 4S1RL 1ZT4B 2AXGB 2E86A 3EFDH 3WXVH 2ZCZA 3HZYB 2ODHA 3H42H 5AVYB 3DUUA 5F6IB 1WRFA 5LNDA 1BM3L 2PW2B 3HHMA 1MFMA 1T5XB 3N50A 3UBXI 3VJ6A 2C3HA 4XP4H 5CLWA 1KXHA 1KTCA 1MRCL 3QIBD 3CFTA 2KZ1B 3P77B 5AVQB 1LEKA 4PVMA 4L18A 4OM0L 3FUIA 3LH8A 3MBEB 1WT5A 2HN7B 2ZUVA 2QLYA 3QIUD 4FN0A 5ICXB 2R0KH 1CS6A 1EO7A 1MREL 1Q0YL 1A6ZA 1HL9A 3DXAB 2ZX9A 3GEFA 1WH0A 4FFYH 3NABH 4Y9CA 4QRQB 1J9CT 3UPAA 3T3MB 1ZOXA 2R1WB 1FF5A 2FE0A 1QNZH 4HOMA 4G7VL 5CKGA 4ODVL 4NSKB 4JJHA 4FE9A 3BQUB 1QWUA 4GQPH 3KL3A 5CJQH 2UZYB 5H2BA 3LHPL 4ODXA 4ZUTB 5HSFA 4N2MA 3FT0A 4TOYH 2XV6B 3RZWA 3L45A 1IEBB 4ZMQA 2DYRB 1E30A 3BVNA 3UC0H 1R3IL 3WO3B 3FT2A 3DGGA 2QVMA 4NCC2 1CICC 6PCYA 5ABAA 4OJDH 4MD4B 3A23A 4QOKA 5CWSA 5IREA 5ISZB 1D9KB 2CUIA 2FO4A 5L4MA 4JCWA 4PREB 3B9DA 4K3EL 1CIDA 1BDYA 1G1YA 3BMVA 1ZHBB 4QY8B 4C4BA 3HVNA 3KYNA 2AFNA 4M7ZB 4UTAA 1VFBB 3T77A 4DEPB 3JSSA 3V6ZB 4AWJC 5KVMC 5EUKB 2BIPA 4JZOA 2J12B 3D9AL 3OKNA 1UB5B 2Z3FA 3TCLA 3II1A 4YSQA 3ARBC 4QXUL 1MHHA 1A7PL 3RGHA 4P3DA 3P54A 4ENEC 4Y4FA 1NCGA 2P28B 4UB0H 2FB4H 4M1CC 5CS7A 4ACTA 4JZNA 3TYFA 3VQ2C 4PGCA 3K5RA 1EXHA 4LLYB 4WLCA 2VDQL 1FVEB 3MLZH 4KKNA 1U3HB 4TVUA 4UQ9A 4Y19E 1EZUA 1YEJL 4LEOB 2EIJB 2XIIA 1Q9OA 4TUOB 2Y6SD 1V7MH 3B2UD 2ZF8A 3QXVA 2YGNA 4N24A 1AZRA 1S5IL 2NXZB 3OG6B 3AAZA 3GGWB 3JV0A 5CAYB 1CBJA 1AZVA 1FAIH 1P4LA 2R0WL 2RHEA 5KSBF 1VACB 1H3VA 3CIQA 4NQVB 1YO4A 1ROCA 1YEHH 4YHLL 3IKCB 2I24N 2FYVA 1JGEB 4QOKD 2R2EA 4J6RL 3QCUL 4Z7NF 1U3NA 4F9LA 4XNXL 7TAAA 3GSOA 4NQDA 3ZO0A 5FYJD 2X6VA 4M1DL 2ZSWB 3DX7B 3AWFA 3VWJB 2QTVA 3IBOA 4F57H 3ESNA 1TYJA 3KYMA 1AS7A 3DX0A 3I3EA 2B1OA 3CQQA 4XC3L 1XSJA 2XJKA 4GPVA 3LNEA 2WWNA 3ULUC 2EILB 4YXLH 3KR3L 5K69A 2VB5A 3TBSA 1GW6A 1U8NA 2EEBA 2VH5H 4JG0H 4Z95H 2FO8A 3BAYA 4Y4FD 3SDCD 3WJMA 4HJUA 3GK8L 3E6FA 3LN5A 4L37B 4AYFB 3C87A 1K8DB 5D7LA 1GCFA 4R7DB 3EGSA 1EBAA 4NN7B 3WUZA 1A02N 1U8IA 3O9WB 3Q9QA 3HPJA 4XNYL 2P1YA 3KPLA 4N20A 5BQDA 1AYOA 1FG9C 3MTXA 4PW4A 3MDJA 3V0DA 5I18H 5KYYB 5F0MB 4FCAA 3DJZA 2A38A 4XVJL 1OAKH 1DQQB 2WTOA 4HKZB 1HDMA 4Q6KA 3ZIYA 3CJJA 4HKXA 4Z3JA 3O3DB 1RCYA 3F3HA 5LN4A 2AXJA 1QFUH 4M3KB 2VN4A 4C58B 1O9WA 1TQWA 3RWFA 3MI6A 4FTVA 4OZHB 1JK9A 3KLAA 5DJ8B 3T9WA 4NP9A 3S5ZA 2P9RA 4GP5B 5F71A 4YDKH 4KNTA 2KERA 1T1WA 3NN8A 1EJOH 1KJ3L 1WUZA 2BP8A 4NRZA 3U9WA 4X9BA 2YPKA 3EF7A 3LS4H 2V3EA 5AENA 3JVFC 2Q86A 1DVFD 3GBNL 3S3JA 4M4RA 1X7SA 4EI5C 3S3DB 5I15L 2LV4A 3CFJA 4HPHA 4JHWH 3AY4A 3QGVA 4RFEA 1G7LA 3BCDA 3MRPB 3AMKA 4JRYE 3L95A 1NFAA 3IGLA 2H8PA 2IH1A 2ZXGA 3BKYH 5IF0B 2L0DA 2ZIDA 1B4JL 1QBLH 1QABA 2IOMA 3BEWA 5B7EA 1E8XA 1YEFL 2VXTH 3IB4A 1AHMA 4OQTL 2WM0A 1HHIA 2FBJL 3KDMB 4YDNA 4PJ9B 5DJZB 3RAJL 3RRQA 2I25N 2E74C 4LT7A 5HD8C 3LEYH 2E3VA 5EU5B 2CMRH 4B9IA 1QPXA 3L4UA 1A1MB 4BKTC 3MNZA 1ZV9A 4G42A 3UP1A 4ES8A 2G0KA 3F01A 3VXQB 3EFFA 4WAFA 5GGTA 3NSDA 4YSSA 1BVLA 4MYWB 3MUHL 5INCB 2GK2A 2Q87A 2QQNL 2J88H 4WUKH 4UQ3A 3ZE1B 3K2KA 2IPKA 4FTVD 4X80H 2JKJA 3GSNB 4LDCA 1LK2A 3K74B 3QJFA 2MTAA 3QA3A 4J27A 5DJ6B 3ZX1A 1Z5YD 4JRWA 2R1XB 2OTWA 3EFDL 2XSKA 3WXVL 3NRFA 4KK6C 3H42L 4F7MA 2J72A 5I1LA 1GA2A 4CC4C 4P46B 3EH4B 5T3ZD 2CJSA 3F2LA 3GHPA 1EIBA 3RLSA 3AABA 1A3LH 4XP4L 5AOLA 1XBDA 4E41D 1FGNH 2WLKA 3U9UA 3SZ6A 3KWXA 1BFTA 1M1XA 4LOUC 4K07A 5JW4M 1S9YA 2X2JA 1AIFB 5DQDH 2A9MH 4LSVH 4MTMA 1UVQB 2BIHA 2EDQA 5D1ZC 5CEZD 2EAEA 2R0KL 4LRNH 1D5IH 1PL3A 4DCQB 4U1KB 1ES0B 1SFHA 2F8VA 2VJ8A 4FFYL 3NABL 3CFUA 3GLZA 1PLGH 1FNEA 4Y88A 2ISDA 4YBLB 1HCFX 1WZLA 2ZUXA 3VYPA 3UYRH 1UB6A 2VZOA 1RZGA 2ENJA 1QNZL 1K2DA 3S3CB 3MMEA 4GBXB 1MWAB 4H8WH 3M17B 1NGYB 1R19A 1S7XA 3ATBA 5CJQL 3P0GB 1BFSA 4X5WA 1MQ8A 5CD5C 3SYCA 5DUPH 4MDIA 4TOYL 1AANA 5DR5H 3IFOB 1X5JA 3D2UB 3ZYJA 3L1GA 3UC0L 5E94B 4G7RB 4F37K 1HOCA 2MPAH 3FBKA 2J57A 5H4YA 3X1FA 3HB3D 1DN2A 2B5IC 4PLJC 3IMWA 2YOCA 3PRZA 2JQAA 4ZNEA 2H1PH 4AJYV 3VO0A 4FFZA 2Y7SA 2R23A 2Q76A 2JKSA 3QUZC 3SJVD 2HT2C 3L7EB 1TJHH 3HJ0A 1X44A 2XQYA 4B9JA 2BVYA 4U4IA 1JF1B 3T8VA 4MNGE 1W15A 4OT1H 2GSIB 2FLRT 1FRGH 2VDLB 5DZLA 1KT2A 5DYOB 4TLKA 2J2ZB 4IOFC 4NQXA 3VWJC 1NEPA 3NSCA 4F8TA 2XPZA 4QLRA 5FC9A 1IM9D 2BOBB 2XZAH 5GGRB 5GRXG 4UB0L 2FB4L 3EXLA 4WWOA 1BIIB 4JFHE 4X5XA 4I4WA 3V0GA 3ZDXF 4Q9CA 4DKTA 5JW3H 5CZRA 3SO3B 3BJLA 3LRSB 1D5BB 2F7RA 2VLKE 5IMLA 1YMHA 3MLZL 2JJTA 2H5UA 4F91B 4AZUA 1J9RA 1QPKA 3F65A 1A9BA 3SYOA 4G7SB 1GTFA 1KOAA 2CCLA 3BD5A 3AZUA 4U3XA 1T2XA 1V7ML 1WS7A 4MLIA 4YOKA 4JPKH 3S5YA 2V9RA 3SPCA 1MCEA 3RILA 3VXUA 1NBVH 3WEOA 5I1AB 4B9ZA 5E00A 1FAIL 3O9WC 3LB6D 3LPWA 3N41B 3F12B 4MXQC 5ACZA 4EI0A 2OYPA 1OHZA 1HNYA 2R69H 1IGYA 3NJHA 3ZPDA 3V6OC 1G0XA 3JV6B 3QHZH 1NIBA 1YEHL 4HH8A 1RJCA 5DJCB 3F7YB 4FOMA 4OKVA 1AP2A 4Y5XB 4L8SC 4EZKA 2ZSVA 3IJ8A 4F2FA 2OMWA 4U7KA 4N1CA 4F57L 1G7MB 2K6ZA 5L2KA 4PJ7A 4ZPVB 1E0OB 1OP3H 1N10A 4DZBA 4Y2DC 3KPPB 5D4QA 2EDFA 4YXLL 3ME0B 2EO9A 2WLIB 2A99A 2VDMH 2VH5L 2O26U 4JG0L 2WVSA 4Z95L 5T1MA 1HHKA 4HUWB 3DRQA 4ETYA 1K3IA 3FFDB 2ZUSA 2LHAA 4E0RB 3FU6A 2HVKB 5I5RA 3TBYA 4FFWD 3HMXA 3FW6A 1JHTA 2ZWSA 4I1PA 2D31B 3WFEH 2J7LA 3V5KB 3B9KA 4FMFA 1XZ0A 3DTDA 3RIAK 5I18L 3KHOA 1IGCH 4CADA 2FK9A 4MSWA 3VXUD 3RZCA 4H1LG 2X0WA 1DJGA 1OAKL 2F53E 3EOBA 4TNFA 4F7KA 3IMBA 4YHMH 1I7TB 4K9EH 2COVD 2EDYA 4PLOB 5KSBB 3VRJB 1QFUL 4GEIA 3IU3B 4ANVA 1T2QH 4DQOH 1WDAA 5GZNC 1IBBA 1OAXH 4YDKL 2KBGA 4EDXA 3UGXA 4R5XA 3PXLA 3QEQD 1RJZB 1EJOL 2WVTA 3NOIA 4JRLA 4Z7NB 4GG6E 3DDGA 4WI0B 2CNYA 2FUTA 3LS4L 4N0CD 4P5SA 1WVZA 4LCUB 5J1AB 5I1CH 2QVIA 4A6YH 1USQA 3M07A 3V4UH 4A1RA 3PNRB 4QMEA 2MEJB 2NNRA 4JHWL 2C5DC 2ZOTA 4HK0B 3N40F 3CSBA 3QHFH 3GSUB 3W57A 5K5YA 3BSZA 3FYIB 4ZS7H 5HPMB 3RL1A 3BKYL 3KNBA 1BOGA 1NL0H 2V17H 2X3BA 4P2OA 5EFIA 1QBLL 3RKDC 5KVEH 1AXSB 1T1XB 2NLJB 2VXTL 3UZEA 2N3JA 1GGYA 3H8NA 1Y0LA 2HLAB 2A6JB 3LEYL 1LQSR 4B5ZA 2CMRL 2JKIS 3LSOB 2PP8A 1CWVA 3T0BA 3FNKA 2BWDA 4NIKB 3HRZB 4K5MA 2MCMA 4G6JH 2EINB 3B6SB 5F93C 3QO1B 4BRVA 5I76A 3RZCD 2ZUTA 3TCXA 2I69A 3QQ9C 4Y9EA 1IQDB 1YPZA 3UJIH 1OW0A 1X5XA 4IOIA 1GYWA 2J88L 2UVEA 1XH2A 2YFOA 3JWDC 4WI3A 1DEEB 4WUKL 3EFOB 4RMVA 4CAGA 4X80L 2VN3A 4TNWK 1IC4H 4N2EA 4XX1G 1W8EA 1TFPA 4KX8A 3KWWB 1LE9B 4TUKH 2GK0B 3CV5A 3RNQA 5I66A 1FO0A 2PWEA 4M6AA 4OCRH 2E76C 4PR5B 5J6SA 1MUJA 4PV8A 2X4UB 2YPLE 1E6JH 2PYEE 1A3LL 3BKCH 2WOBA 1CICA 1Z5HA 2VM4A 2DQGH 5EZJB 1BD2A 5L9DH 1FGNL 4XNDA 4GXFA 3ULSA 2ATKB 5DQDL 2A9ML 4LSVL 4XNQA 4P2OD 4LRNL 1D5IL 2OM5A 4BH8B 4F2EA 1MDAA 1G0YR 4GQRA 5JIMA 1NOFA 1ROWA 1ICTA 1PLGL 3IJSA 4IBWA 4WNJA 1ED3A 3FTUA 5F1IB 5KSUA 3UYRL 2QVTA 3AS2A 3IDUA 4M00A 1T03H 4H8WL 2OQJB 4O02B 3UABA 4RAUA 1HHHB 3RWHA 1JPFA 4F33B 1GKOA 2MCAA 1H5BB 5DUPL 4AI7A 1EMTH 5E6IB 1N5AA 2LFGA 2H2PD 3NCJH 4PGDA 5DR5L 3ILPA 4PRPB 2I7SA 3TZVD 3HG1D 3SGJC 2WKGA 3RX5A 5EZIH 5B7MA 3DIFA 4UAHA 5ID0B 3Q3GB 4LEBA 4B96A 5KVDE 1B6DA 2MPAL 3PWNA 1E8ZA 1HHJA 2YD7A 3G5XB 5E8NA 1DVQA 5B4MD 5D9SB 1MI5B 1OB0A 2H1PL 1J86A 1O6VA 3SY0A 2AV1A 4HJSA 2X4NB 3Q1SH 3B2PA 3AG1B 4EOWH 3WN5A 4ZUUA 3FAWA 1RJLA 1TJHL 1AC6A 4HJJH 3OAZK 3R06A 5MENB 1UZGA 4CMHC 2WGXA 4OT1L 2XTJE 2N1TE 1FRGL 5I71C 1K4DB 1AQMA 1DTUA 4EN2A 2IANB 3JBG7 2XU9A 5FGCB 3E3QC 1FYTB 1QHQA 1ZLVH 2BIQA 3APMA 2XZAL 3RWCB 1MHPH 2GSMB 3HI6H 3L9YA 5JW3L 1E5CA 5IFAH 5HYQB 5C0CB 3NCYS 1A21A 4ES9A 1S7UB 1DQTA 1S7QB 2M2DA 3JUZA 4GRLA 3ES6B 3QG6A 4GB9A 5E5MB 5F96H 1QSZA 4F7PA 3I6GB 3T6XA 1JHLH 3SD5A 3IDMB 4ZTOH 4FXGB 4JPKL 1NQBA 4OFPA 1PQZA 1NBVL 3ALXA 1PF3A 2HJKB 5EZLB 1BA9A 5DU7A 2R69L 5FYJU 2XIBA 1G4RA 4PJAA 3QHZL 5DWUH 3SYPA 3BMWA 3WIHH 1M71A 3IE9A 1U58A 4F15C 5J4MA 5D5MB 4V1DB 3MRJB 4NM8H 2EYTA 2G9HA 2FJSA 1BX2A 1DLHB 1M3JA 2WYZA 2JJSA 4D8PB 4YLQT 2KLRA 3Q2CA 4D9RE 4JFOB 4JFDB 3QSKB 5JHLA 4UM8B 1AD9A 2J1WA 2WCGA 4G8FA 3NIDE 5E8EA 2VDML 2P5EA 1YYCA 3HLKA 4KTYA 1KUMA 3L17A 5CJ8A 3ZDXB 5AB9A 3G6JB 2I7OA 4ZW8A 4GP8B 5DJAB 3IXAA 3FFOA 2PXYB 4U1LB 3WFEL 1CFSB 2JCCA 4LNRA 2IH3B 2ICES 4GRWF 4XN4A 3RDTA 1S9WA 4HIPA 2B0SH 3MXVH 2PCFB 1IGCL 3LXBA 4H2AA 4QGTA 4OKDA 4YHPB 5E6RB 1SEQH 4GMTH 4ECNA 1RH8A 3VRLF 1DFBH 4NHUA 3GSQB 1NDGA 4JDVB 4BE6A 3SDDA 4YHML 5I8CB 1SHXA 4K9EL 1TQUA 1NEZB 2MQCA 3HNSH 5C6TH 2R4SH 5D1QB 1PEZA 1SEBA 1AKJD 3CZFB 3O4OB 5DHYA 3HRZC 3VU2A 1T2QL 3CN0A 5ICYA 4DQOL 5FKAA 1MW2A 4M61B 1OAXL 3SKOB 4P49A 1D5XA 1S2EA 4QHMA 3FU8A 1YMMD 4CMMB 4K3JH 4NQCA 3PJSA 4UUJA 4UIMA 4PJBF 4RMQA 5I1CL 2BOLA 4PFEA 3GKWH 2VW4A 3VD9A 5I1GH 4HJ1A 4A6YL 2I07B 3V4UL 4D0BB 4ODUB 4QR7A 1ZXKA 1JSYA 2BIMA 5FOBA 4L1DA 2XWEA 4BSJA 4O2CB 4PRIB 5GS1A 3QHFL 1HH6A 1DO5A 4ZS7L 2DICA 3F6LA 3LZLA 2AJUH 1T66D 1NL0L 2V17L 3VFSA 2ZUYA 5ITFB 5KVEL 4KZ0A 1P5UB 1FZJB 4KO9A 2WZ0A 4MQSB 4OD2A 4HA1A 3VD3A 4PY8J 4N90D 2HLFD 4Y1SA 1AGDA 1BVKB 2VAAA 4WW2A 3T2LA 1QSFA 1FL6B 3RDTD 3TO4D 2VN6A 4XCNB 4Y4HB 5H35B 5D1ZA 1TVBA 1R5VB 4U6VH 3VI4E 3QNYA 6TAAA 4G6JL 4KI5D 1JTTA 3BH8B 4N8PA 4Z7UE 1A6AA 3RYMA 2ENQA 3CPLB 5LAXA 1FI8C 2DMKA 2QBWA 3UJIL 1BLIA 4E5XA 4OZIA 4POZD 3ESMA 1N8ZB 2K7QA 4D0DB 1M57B 1K3ZA 3WHE1 2KS0A 4JFPB 1IC4L 5IB5B 5C08E 2E9JA 4YC2C 1RMFH 1ID2A 1RK7A 4AKQA 4H8UA 1U8QA 4TUKL 4P23D 5CLYA 4YBHA 2HJLB 4NQCD 5F9JA 3WBDA 3DC0A 4JFFA 2YAMA 4OCRL 3MUJA 4KUCD 4XOEA 3V55A 3N40P 4OLXH 4ZMAT 4RETB 1XF2B 2MQGA 1ASPA 1LO5A 4OZGF 3FAXA 1E6JL 2QHRH 3ULVF 1IBGH 2UUDK 3LQZA 3PWJB 2DQGL 2LLLA 1VADB 4NC1E 3U0TA 3VGFA 5L9DL 3O45A 3OC8A 1MCSA 4P2RA 2JK5A 3FYEB 4NZJA 3GSVB 3QFJA 5JO5B 2BZ7A 3C5ZB 2NUPB 3MYZA 4N9GA 4KKQA 3CCHA 3QE5A 4JNXA 2VZSA 1KN2H 2W5PA 4U7SA 2ZUQC 3S35H 3BAIA 4ZAKA 1U8LA 2X9YA 5I24A 1EHXA 3K71A 1QSFD 2XVGA 2NZ9D 1ZLSH 2OTUA 2L7QA 4G80A 2J4WH 1T03L 3RE0A 4UT7H 4L3CB 4ZUSA 3C8KB 1IGMH 2IMMA 1A66A 2R29H 1EMTL 1CI3M 3FSZA 4OLEA 3NCJL 1L7TH 1CXLA 2DM4A 2WNGA 1EO5A 5EIIB 5EZIL 4MA8H 3MRMA 5D7KD 3VG9B 1N7MH 1DJXA 4IIQA 4X7FC 2FJGA 3GINA 4BHUA 1QFWH 2BRRH 1IB5A 1EPFA 1WK0A 1GS7A 4YZFE 4MJ5B 3K80A 4NC0B 5EO1A 5BZDA 4MASA 3Q1SL 1UACH 4HIHA 4EOWL 2DWDA 4R26H 3T4AC 2DTMH 4HJJL 3W81A 3T2PA 2C4FT 1W0YT 4NN6B 4PEEA 1X5FA 3DX6B 3SGEI 1G9EA 4OFVA 4UQDA 4LAJH 3PL6C 4P2RD 5CXPA 4L8BB 1AO7E 4MS8D 4XCYA 1J5OH 3W9EA 1OK8A 3QFJD 1NCAH 3OKKB 4LSPL 3BRDA 2X6AA 2O5XH 3UYPA 3VYOA 2DQIH 3FRPB 1MHPL 2XJLA 1FV1B 3F5WA 5KW9H 3IETB 3HI6L 3UIYA 2HX9A 4ZAKD 3F05A 5I74C 5IFAL 4LL9A 5AAMC 4ABQA 1UGNA 4J3BA 1PZ3A 4N0FA 3VSUA 4O51B 4UAOB 5DJDA 4HLEA 3D3VA 5F96L 4L4TE 3U46B 1YN7B 4D7PA 4BK8A 1P84K 1JHLL 4ZTOL 4FAAB 1NCCH 4MNQE 4AV4A 1R5WB 3GLDA 1NM4A 1MRFH 2E7DA 2DDQH 5H37H 3HLAA 3P4MA 3TFKC 1I1AB 3MRQB 5L4IA 5L2JA 3D6GA 4QYOB 2VNCA 3E80A 4J8RB 4AM0Q 4MBOA 2EACA 5I17A 3VXRD 3JWNE 5E6YA 5DWUL 4GG8B 3WIHL 4J28A 1NICA 3AACA 2Z9TA 2NUTA 2AQSA 2C9XA 3FQXB 3EJQA 4LCCB 3IJHB 1Y6NR 4NM8L 4XO4A 2ZE0A 3HE6D 5D1QC 5A2BA 3BN9D 4OZ4B 4ZMLA 2OSYA 3O4OC 4KJPD 4A7QA 4F27A 2FEEI 3L3DB 4KO5A 4ODWB 1MLBA 5E4IA 2X09A 4YL4A 3MOAH 1JZ7A 1ZHLB 1N3NA 1ZKAA 4QRUA 3ZGHA 3LKSB 5CEXB 1W0VB 2E9BA 4PTTB 3BZFA 3L3JB 4BWUA 1IEAA 1SDAB 2KLSA 2NY2D 1OY3B 2ENPA 4XBMA 2KC0A 5HGBA 5I30H 2BNQB 3T0VA 3ARSA 1UJ3B 5HVHB 2EE0A 1FL3B 3ZL1A 3DPBA 4C8XA 5DRNA 1RULH 2X5PA 1ILUA 3D3VD 3I6KA 3LZRA 2IPTH 1G43A 2B0SL 3MXVL 1CLOH 4BGDA 1J7VR 1BF2A 1OGSA 1SEQL 3Q6FA 1DFBL 5G55A 1E42A 5IB2A 1K8IB 3M45A 1MCIA 3HNSL 4APQB 2OYLA 5EULV 5C6TL 5LHDA 3MODH 2R4SL 1IBHA 3QULA 2TAAA 3US9A 1KWGA 3PDDA 3K2UH 5IP4A 1NGWB 2OMUA 1AZCA 5DD5H 3SKMB 1I1FA 1BG1A 4QOKE 4K3JL 1DEDA 3M88A 2CA3A 1DQDH 3BQVA 5FYJE 2YRBA 1NCWH 3GUFA 3L54A 2H0PA 3WYRA 2WPGA 3GKWL 2ZOLA 4GSUA 5I1GL 1GOHA 4N6RB 2FECL 1DJSA 2XA3A 3NZHH 1FNLA 5D2LF 1NZRA 3CTTA 3EJTA 4OFQA 1V3LA 2QMKA 1O7DE 4R2GD 2XG5A 1TU2B 2OMVB 4KTDH 1A4JA 2AJUL 4S1SH 2A83A 4RRPA 1XMWA 3BPOC 1B3JA 2QQQA 1DCLA 5TTRA