4Y2NA

Structure of cfa/i pili major subunit cfab trimer
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
147
structure length
147
Chain Sequence
HEKNITVTASVDPVIDLLQADGNALPSAVKLAYSPASKTFESYRVMTQVHTNDATKKVIVKLADTPQLTDVLNSTVQMPISVSWGGQVLSTTAKEFEAAALGYSASGVNGVSSSQELVISAAPKTAGTAPTAGNYSGVVSLVMTLGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CFA/I fimbrial subunit B
publication title Off-pathway assembly of fimbria subunits is prevented by chaperone CfaA of CFA/I fimbriae from enterotoxigenic E. coli.
pubmed doi rcsb
source organism Escherichia coli o78:h11 (strain h10407 / etec)
molecule tags Structural protein
total genus 17
structure length 147
sequence length 147
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-02-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2040 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4y2nA00
2HB0A 3F85A 4HJIA 4Y2OB 4Y2NA 4Y2LA 3F84A 3F83A 3VACA
chains in the Genus database with same CATH superfamily
2CUIA 5F1KC 1DSWA 2XWBB 4JFZL 3DSFH 3C6SA 3P4LA 1JYVA 3QWOA 2CDFB 4UDUA 3ZDYB 1WGOA 3PWPA 2WP3T 3KL3A 5JPMA 3VE0A 2WQWA 1KYAA 1N59A 1NBVL 3QNXB 1B4LA 1WA2X 1B6UA 3OAUH 1E90A 4RMVA 4AXWA 1LWRA 2FYVA 2ZSVA 4Q0XL 3X11A 3ATEA 3S0PA 3IDNB 4IGBB 2A99A 3OSVA 2YOCA 2P24B 4X6BB 1XV8A 1UXWB 4LGPB 4KKZA 4HG4J 1CXFA 4F8QA 2ZG1A 2MOVA 2WQ8A 4U4IA 2NZ9C 1AACA 5ICUA 5GS0H 4KZEL 2YXFA 3RZCD 1TQCC 4ZXBD 3SBWC 5IVXF 4QOKB 2IOOA 4D3CL 4Q7DA 4X6FA 1WC7A 2DI7A 1HKLL 2EVJA 4Y89A 3U79A 4MA3A 1KF9B 3HFML 3MNZA 3SE4A 4J6IA 2ZXQA 4M7LL 3PL6D 1UT9A 2CG9X 1A9EA 4FI7A 4X6DF 4F2MA 3W39B 5CGMA 4X4YB 2NYZA 1QOKA 4MMZA 2ODHA 3FU7B 3MC0A 4NX0A 4PRDB 1BQHA 4JQVC 3IJEB 3IXAB 4BWWA 3U0TB 1JBJA 4NO0B 2IPKA 3QNZB 4DCQB 1M53A 4W81A 1RZFH 4XPBL 1OAXH 4XP4L 1AHMA 3CMGA 1HH9B 4ABVA 4PS7A 4PFEA 4HFWA 5DZVA 4XVSL 4UQ9A 4PGBA 4G5AA 4LKXB 2DN7A 4LCCA 1T20B 3K6OA 5EU7E 5AW0B 3HMXH 4AGOA 1OM3L 1ZS8B 1T04A 5IMLB 1ZT4A 1KB5B 2BX5A 4Z23A 1IM3B 3KVPA 5B7EA 2DQJH 4CKQA 4PQXA 4N2LA 3QG6A 3CZFB 3ZKQD 1VGEL 3K3QA 2CAKA 4S1DD 2DZEA 1ECZA 4Q2ZA 1I7TA 1EGJL 1IBHA 5GISL 4ODHH 3U83A 4OKVB 3DO7B 3FB8A 4WI6A 1A6VL 4JPIA 5C0IA 3JZYA 3V6ZA 3MRQB 1AFVL 5KYUA 1DSFH 3RWDA 4Z7VF 3CQFA 1N10A 1NL0H 3T6ZA 1QRNA 4O58L 3BZ4A 1NEUA 3HNVH 4Z7QF 1A7BA 3LZNA 4RRPG 3MRPB 4DK5A 5JPNA 1T1XB 4NO3B 2LOEA 4EXPX 2QKSA 4IJ3C 3RKDC 4QF1A 3MO1A 4HKZB 4MNGE 1Z66A 4O5LL 4WU7B 1U8JB 1R5VB 4LGRB 5GZND 2P5PA 4OCNC 4ELME 5KTEL 1MWAB 1QFUL 1L7TH 1UXLA 3GSNH 3E7JA 3OKDA 3ESUF 4FEIA 1AP2B 4ES9A 2YJLA 4B50A 2WJ7A 4A55A 4GRLA 4FS0A 1KJ3H 2BNQA 3EJRA 4U6HA 2IH9A 5SWQA 3ZQWA 4HIHA 4Y2NA 2PW1B 3EYUH 2VXSH 3GEFA 3TLRA 3U9WA 2ENYA 4F24A 4YDKH 2E9IA 2FX9H 3UMNA 4CN6A 4AQAB 5EUOE 1SM3H 7FABL 43C9A 4Y4KA 1S9WB 4NUGL 5I6KA 1GC1C 3SKNB 2VDNB 3VU2A 5MEOB 1RJCA 2HRPL 4WKXA 3VTMA 5C9JB 4GG8B 4I4WA 3Q8AA 1QHOA 4ALAL 3DUUB 1E4KC 1LM8V 3H7BA 3QJVB 4OIAA 2WXRA 5FO7B 4NRZA 3KEDA 3UAAA 4OCSL 1J5DA 4C58B 2NSMA 3GRGA 2A74B 3UTPE 4BFKA 5C09D 1BQLH 4LEEA 5BJTB 1ADWA 3ZDXF 3LXAA 1GCYA 2OMVA 1JNHA 1KGIA 4EN3A 2X38A 3ARRA 4UU9B 1E3XA 2P5EB 5B7MA 5E9DE 3SPIA 4EIUA 4KMLB 1KWGA 4WV1B 1E27A 3DX0A 3WTYA 2BC4B 1LVEA 1X9RA 3QUZC 2AJVH 2J7LA 1GRWA 2I5YH 1BFVH 4FLSA 4LDCA 4UCFA 3QIWA 2OL3B 2X10A 5CWSA 4DOHB 2YPLA 4APXA 2CK0L 3PP3H 3QDHA 4B95C 4MJIE 5D70L 5I0DA 5I1DB 3L16A 4Y9EA 1BF8A 5DRZB 5K33A 4K7PH 1Q9OB 4KVCH 1GJWA 1TJGL 1UM5L 4ZAKC 1NJ9A 4J4PD 4PJBE 2VLMD 3NJMA 2LAGB 2C7UA 4WW2F 2WZPD 1XCWA 3UAFA 3W9DA 4YHNB 1HSBA 4LKCB 3P54A 3QFJD 4GAYA 2YAOA 3V4PB 3PWJB 3V8OA 1AR2A 1HNFA 5AVSB 2V9QA 1FE8H 4XAKD 1TTRA 3RU8H 1XD1A 1BXVA 3GBML 5BRZA 4KJPD 1XSIA 1OP3K 3PWVA 1DVFC 1JWUA 3TFBA 3ZX1A 2VM9A 3CDZB 1ZT7A 3DRQA 3ZKXC 5IEHB 3L1OH 1L9QA 3FMGL 5ESAB 4WWKC 1OTTC 2C1OB 5JOEA 4IHBA 3UADA 1KV7A 3CXDL 2QDWA 5G4MA 4BFBD 4BYHA 4YL4A 1QA9A 3N0AA 3MRLA 2HT3C 2HKFL 4JRYE 2VDRH 5B8CA 4L4TE 3RILA 5T33H 3HE6D 3EYFA 4X8JB 4CU6A 1RK1A 5CD5D 2HG0A 4KQ4L 1ZVSA 4KVNL 1KJVA 1P5UC 4LF3B 5JHDE 4EQ3A 4EDWH 2EKSB 4XPGL 3NACH 3EYOB 4JDEA 3ZTJH 3JWNE 2H5UA 3DSNB 4JVPA 2HLAB 3IDGA 4L8SB 3PAZA 1AD9B 2WMPB 5CIPA 1KXTB 2KBGA 3O9WC 3OAZK 4H7VA 2J1ZA 3M7FB 2K45A 2E46A 2FGZA 4NFBA 3MUZ1 3TP4A 4GSXA 1GVIA 4ODTL 5GZOD 4E36A 1HU8A 4X9BA 2OMXA 4OLZL 2GTWB 1M71A 1LK3L 3B7RL 3GYRA 4KXZI 4S0TD 3QQ4B 5I30L 4JG1H 1T2XA 1W8NA 3B3IA 3MV7D 1DUZA 1MCBA 1NGXB 2ZUSA 4APQC 1T0MA 3MUY1 4U1SA 4LHUG 5FYLL 4B0MB 2HCZX 1WT5A 3E6FA 4HHGA 4B9PA 1HNGA 3K0WA 3JT2A 3O3UN 3U7WL 5D7KE 1VFBB 1RULH 4TNVF 3L3HB 3IFLL 4PG9B 4PY7B 1ZHNA 1O9VA 4NRYB 1PCSA 2J43A 1VENA 4Q0XH 1K5WA 2H0FA 1U8PB 2A73A 5CJ8A 4YJZL 2FGWL 4JZJA 2E9BA 1FYTA 5I5JA 1FV1B 1UC6A 1IMHC 3KCPB 1JPGB 3DGDA 3NMEA 5CZRA 1S2EA 3FBQA 3KWXA 3MKGA 4KAQH 5HGAA 2FHBA 3E8UL 2HVKB 2C3GA 1D2PA 3MJ7B 3QDAA 3KVDD 1I1RA 2BXYA 3GMNA 4CW1A 2AXHA 1I3RA 2AJ3A 1KLGA 1G9ML 2I24N 4U1JA 4D3CH 2XX0A 1F42A 3VQ2C 1WBZA 3MJ9A 5FM5O 4JFDE 4ZUTB 3DLQR 5LCVH 4DKAA 5IJKA 2ZICA 1HNYA 2UZIL 1ZKAA 3F5WB 4PLOB 1GZPB 4NZJA 1NQBA 5C0AE 5T1DL 1J86A 3T3ME 1N3NA 4WDIA 2RTTA 3OM3B 2V2XA 2DQHL 3DX7B 2K9FB 1LGVA 1Z2KA 4L8DB 1S9XA 5JHBA 2NY1C 4PJ7E 3BH4A 3LV3B 4ABUA 2DQTL 2TSBA 32C2B 1FZKA 3B6SA 4G80B 3VG0L 4PJ5D 5DHXB 4PBVC 4HT1L 3MRBA 5JHLA 5KN5A 3CZSA 1A1OA 1OB1A 5ID0A 1GR7A 3BSZL 1M3JA 1LE5A 1INDH 2CR6A 1NAKL 1H3VA 3MRIA 2YBGA 3ZE1F 1RPQA 2WTOA 2VLJE 2IMMA 4L0PB 4POUB 4DUWA 4NQXB 1XGRB 1IAII 4ELMA 1QFWM 2CZNA 5I71C 1TTFA 2BVUA 3L1FA 3O2VL 5I18L 3W1ZA 1OT1A 2NNAB 1NKOA 1MELA 3VJ6B 1AG6A 3H9YA 3FFCD 3TBSA 4C47A 5J9PB 4L1DA 3NP3A 3S37X 1VGEH 2YAEA 1L3NA 4DFHA 3GI8H 5I1HL 4BE6A 1E8ZA 2IV9A 2R27A 1CFSB 1U8QB 4AZ8B 3PJNA 1J9TA 3FO2B 5EUOA 5I6PA 3Q2NA 4UZGA 1A6VH 4JFXA 3MA9H 1AFVH 1DANT 3L3DB 3N43F 2NXYD 2DQEH 3MBEB 3K2KA 4YK4B 2X9XA 5AYQA 5EBMA 4NJAH 3KBHE 2VDMH 1JXDA 2XHNA 5E4EB 1RH8A 2PWFA 1PG7L 1N5YH 1Q9LB 3LKPA 3X13A 4O5LH 5IW1A 5KJRH 2BIPA 2IDCA 3X2QB 2EDMA 1TITA 4ZFOB 2J4WL 5KTEH 4M43L 1QFUH 1QSEB 3GMLB 4YFEA 3D25A 5T1KB 1YQVL 4YGAB 5JO5B 3UZVA 1UB6A 3ATDA 3GMOA 3QFDB 1M7XA 1QPKA 1G1CA 3GNML 3BRGC 1G5GA 2Y7MA 4JFHE 5E9DA 3BQUA 3HPLB 4UTAL 3II1A 4F20A 3HLKA 3NOIA 3QPXL 1RK7A 5I8KH 3DA0A 5MP6L 3RVWC 7FABH 5AOKA 2VERA 3VD5A 1TJHL 3X3FH 4NUGH 3QYCA 4MJIA 4OQ1A 1SJEA 3II2A 4Y8DC 2QSCH 3VD2A 1CXIA 5BUGA 2UZYA 1WFNA 3IDUA 2XN9E 3P73A 4M5ZL 4Q8BA 4WKZB 3D34A 1AGFA 4PJBA 1BBDL 1NKRA 3BVNA 5I1GH 1T89A 2ZKWA 1CURA 3WS6A 4X9YA 3FCBA 1X4XA 2H7WA 1UD5A 5BOJA 4LAJH 5ICXB 4HJ0C 4TVPH 1AGBB 5GRUH 4P5SA 4HX1A 1DQVA 2EABA 1QNZL 4U3CA 1MIMH 2YMXL 4LQFL 4NQCB 5C0RL 3WTTA 4IRJA 3T8VA 2FZ3B 4QWWD 4TXVB 1FDLL 2FX8L 3ARGD 4AVJA 1PVHA 2ZF9A 4N0YL 4R90L 5GS2D 2X4TB 2ZAGA 5FUZL 3NJFA 2KS0A 5FHBH 1M05A 2E86A 4UOQA 5DFTA 1Q38A 3D4ZA 1O7DE 1CXEA 1TSHA 4JRYA 3FZUC 4ETQA 4L4TA 3MNVB 4PBWD 3S5LB 2WBJC 1NWOA 1ZLSL 4XT1C 4WU5B 1NCAH 2YPVL 1UM5H 3KYKL 2Y6TE 3IMSA 5CHNA 5FAAA 3UZQB 5SX4I 2BHUA 5CBAA 2XV0A 5HI4D 4Z77A 3TTSA 2WY3B 4KOCA 3HNSH 4PRHB 4GSDL 1M1XB 3O41A 3BWUC 5CEZD 2H1PL 1IGCH 2ZE0A 3DX9A 1PU0A 2MQ3A 4JPKL 3TYFA 3WEBA 5ACZB 3CLEL 4I9XA 2VLRD 2XUWA 1G7HA 3GBMH 2A6DB 4UT6H 3BGMB 3LHAA 5EZOL 2FBJH 3C5ZA 3FO9B 2CHNA 2Q9OA 1D6EB 1OGTB 3E9TA 2AQPA 2H2PD 3ELQA 4YHKH 4R2GB 1N7MH 2VR9A 5CP3H 2CO1A 5I1AA 2FB4H 4RWYH 4ONHB 5E6SB 2WLLA 4HSCX 4KY1H 1XZ0A 1GZHA 5D2NC 2KT6A 3KPTA 4HCRL 4NNYB 4NQTA 2G0KA 1O6SB 5DJCB 4YVUA 3TA3A 4G7YH 3KLQA 2O26U 5IGXL 2E74C 4E0RB 3KLHC 4XVUC 4DP0X 3KYNA 5E70A 3OXSB 2CDGB 4IRSB 5LJYH 2SEBA 5I2IA 4FD0A 5ICYB 3FFDB 2EIJB 4OAWB 1WFOA 1LL1A 2GJZB 1JGLL 3ARVA 3BZFB 3PWNB 4GRWE 4PJ9B 5EBWA 5T1LA 1RZJH 3WNLA 1BFOB 3SPGA 1W6WA 3V0VB 4PPTA 1FNSL 1KCVL 4DEWA 4LLMB 1KCRL 1NAMH 1C7SA 3U30B 2YKLH 3AITA 1ZJAA 3S36H 2J8UE 3BPOC 4LPWA 5D4HA 2XV6B 3EFDL 4IHOB 2FSEA 3ARTA 5FYLE 4N0UB 4W9CC 1XFPA 3LNDA 1P0SE 2GUYA 1NCIA 5KANG 1MCOL 4Y88A 4JFDA 1T0OA 5M7QA 5LN8A 2X4UB 2XVBA 5ILTH 3UTTB 2DEYX 3NZHH 5C0AA 2D3NA 1TZAA 3D39E 3TZVB 2Z7YA 4FQQA 1AQDB 3ARBD 4PJ7A 4FQXC 4QLRA 2MQCA 5FGSA 4L3AA 5JYLA 1L9MA 3QDMB 3UBXA 5KVFL 3FB6B 2F5BH 5HJDA 2J57A 2WLKA 3QA3A 3VUAA 2DQFB 4HCGA 1AZZC 1QUPA 3JTTB 1G87A 1N6UA 3E1ZA 4HKJB 5LLIC 4PH8A 3OAYK 5C3TA 1EO8L 2BNRD 4X5WB 4ZPVA 2VLKD 4KNSA 4H4NA 4LLWB 3OF6D 3T0XA 3TWCH 1DLHA 3TURA 1C16A 4IKIA 3HMWH 1DUYB 2F19H 3FRPA 3NSXA 3H7LA 4C56A 5CLYA 5EEVA 2CMRL 2YSSB 3GGWA 3GMQB 3ESMA 2UZIH 3SYQA 2F53E 2DLEA 1YEDB 2XTJC 5FA3A 1M7DB 1BP3B 2DQHH 1R46A 2GHWB 4JM2D 3HHMA 3D69B 2EEXA 2NY0B 2VDLB 4M6NH 1JI2A 2DQTH 2WWKO 5KSBB 5H35B 5DD6B 1YEHL 3VG0H 1A3RH 4HT1H 1A7QH 4ELMF 2XKNB 4GIAA 2YEVB 4YL9A 2HJKB 1KSRA 4KDWA 1YSOA 5FYJD 3REWA 1U8MA 1Z9OA 4TNFA 4H8VA 1NGQL 1IKNC 3KLKA 2BW5A 2AXGB 3L1GA 3QFGA 1OGAD 1TSRA 1E6JH 1KPUA 1WP6A 1E28A 2QGEA 3DBXA 1HZKA 1MCEA 5HHXH 4G8FB 5AWNL 2Q8BH 1E8XA 4L1LA 3EO9L 3BP7B 2QADB 3RJDA 3ZN6A 3IRCA 1XH0A 3TJHC 1DJSA 4BD4A 1XH3A 1BLIA 1I1AB 4I77H 1MVFA 3AWFA 4OQTA 1LJMA 4X5PA 2FWOA 4YUEL 4ZW7A 3U4KA 4A2EA 3KJ4C 4FNSA 1T2JA 4BGDA 2V3FA 4G8GB 5HP5A 4OF5A 1CG9A 2FIRT 3EYVB 2RALA 1CO1A 2XVGA 5D1ZA 2KHAA 4CBZA 5DZ9A 5IROD 4HUCA 1PFOA 1HINH 2COVD 3X1GA 1OHQA 4N8VA 1SXNA 4ILDA 4G6FB 3RVXC 4QRTB 4K5NA 1MCJA 1ZPUA 1L7IL 5D93B 2ZXEB 3NRFA 2DM4A 1MHEA 2HJFB 2XDHA 5FLUA 1OP4A 3TN0C 4PB9L 2ZAIA 2ZOOA 2JQAA 3MGOB 1R3HA 4OGYL 2CRZA 4Y16B 2ADGB 5BO1L 4MNHA 1NMBL 5HHOE 3Q43A 3IMBA 3N5AA 1EHAA 3RVUC 1FH2A 2V4LA 3G5YA 4H0HB 1CFVL 2AMGA 4YHML 3D08A 4MZRA 2AGJL 4GUQA 4K3GA 1IEHA 4NO5B 3MOQA 4G59C 4U4BA 4UAOB 5EWIH 1I9RL 4WY7L 1BXXA 3B9VA 4FTDA 3L9RA 2XYBA 2Z64C 2CJSA 4UTAH 3F6IA 4PJBF 4AQOA 4H26A 5ERWA 5MP6H 2J2ZB 3VFGH 5DUPL 5IB2A 1YAIA 2FVNA 4XNMB 4A37A 3IBEA 1IC4L 3VRJA 2FLMA 4OLWH 2C34A 4PJXB 1KB5L 2YAFA 2N56A 3WTWA 3IFOA 4IU3A 1QBAA 5IG7B 1I53A 3O6FA 1URZA 3QWNA 3CN4A 1FIGL 4IKLA 2ED8A 4LFHD 4POYA 1E67A 1BMZA 2VJ8A 4P5MA 5LXVA 1MH5A 5GJTH 3WEXB 3QEGH 1OB0A 2DTSA 4PRID 4JJOA 1NFDE 2XZZA 1WZ1L 1QNZH 4JJ5A 2V5MA 1YEFL 4NCDA 4ZNEE 1XGYL 3TH3T 1RZKL 1NDGB 2J55A 4N24A 3WGVB 3C60C 1S7TA 4L1TA 1FDLH 4O51B 2JXMA 1QLEL 4FG6C 1IT9L 1L0YA 2K6YA 4FG4A 2H26A 4R4BA 4M6OL 2KQMA 3GJFH 5FUZH 4TSAH 3HC2A 4M7ZC 4AYID 2R29H 1BQUA 3CXHJ 1E5CA 5DYFA 1LO5B 4J3OC 3EYQC 3E38A 3IU3B 2V17L 3SDAB 2CJUH 4O2CA 5LG1A 4UQIM 4G8EB 4YXKL 1ECYA 2X70A 4F7KA 2FH6A 5F0MB 1T1WB 1Z3GL 4K94H 3KYKH 2R4SH 4AI7A 2A9AA 1T6VN 3LS5H 4FERA 4R3SA 4TQIA 1TCRB 3WGUB 2G2NA 2A83B 3I85A 4KKCC 2YD4A 3BH9A 2R2CA 4M4RA 5DHYB 4GSDH 2UWEB 3IT8D 4NZUH 2R0WL 1ONQB 1U92B 3LRSB 1XCQB 5C07E 1Y1UA 2YGPA 4H8HA 5FV1L 2GSGA 1D2OA 4GAJL 5EZOH 2VDNL 5LHDA 1V5JA 2J8UA 4PP2B 3RZWA 1QEWA 2H2SC 3ULVC 4QTHB 3WFCL 4PTUA 4AEHL 1KZYA 3N1PC 2F1AA 4MFHA 3AACA 3HN8A 4KJYA 4XN5A 3AGVA 4OIIL 3OQ3B 2Q7YA 3EGXB 3VFWB 4H5SA 5B1JA 5I8OH 5IK3B 4HCRH 3D39A 4P2QD 3HRPA 4F7TB 4D9LL 4UDTB 4HIQA 1NBZB 4X98A 2J25A 1IGYB 2VXVL 3BUYA 3CH1A 4GSRA 2IAND 2QQNL 1DQJB 4H20L 1ESOA 1HOEA 4D8PA 2DQGL 2G9HB 3MLSH 2C9SA 1X5LA 3DETC 1R0AL 1JGLH 4RAVB 1IIIA 4AC2A 1EUUA 2PCFA 5I23A 5DMYA 1FAIL 3BAJA 5FWQA 1F4YH 1N5AA 1DZBA 2NXZC 1KCRH 2E3VA 2YUWA 2OL3L 3S3BB 1NIAA 2Y07L 5MEPB 5F70A 5C08E 2XXFA 5JUEL 3GUFA 3T3MF 4D9QE 1KLUB 4PWFA 3V0DA 5C6PB 4CNIB 3FQUB 1NLBH 3EFDH 3TIDB 1WTGT 3BDXA 4PJ7F 4R96A 4FTVB 1WQVT 4Z3GA 2W95A 1BQSA 1L0XA 2CO4A 2QQQA 4MJ4A 3ZQXA 1AXSB 3WFDL 5EF2A 2Q7AA 3H3PH 2F53A 4U2YA 3ARDD 3NPZB 3G6DL 3DX8B 4JG9A 4LNRB 3V4PL 3OVUB 3WKPA 2O5YL 2XRAH 4FX5A 5KVFE 4NQEE 1MLCA 3V4VB 3C6LD 4S1RH 5AOZA 1J05B 3T6WA 4XBPA 4YBLB 4PV8A 3UBXI 3BSZA 5F1SA 4N0RA 3TO2B 3FCSA 1MJJB 5E00A 5AYUH 2ZYSA 2EDNA 2GKIA 3ULSA 3FSWA 1BZ9B 2DI9A 4WUUE 3ZDZB 5KSUB 1YG9A 3NN8B 3QORC 2R23A 4M00A 5C8JA 4MD5B 3RJQB 4I0PB 5DK0B 1QSZA 5I76A 1U3HC 1RU9L 5DJ6B 4A2LA 4P9HL 4F7CA 2AEPL 4E41D 4XN7A 3VTAA 4ONGL 4U1GB 2W59A 1U36A 2P8PB 3V0WL 3W9EA 3RHWK 7PAZA 3MCLL 2JI1A 2OTUB 3IJSB 2CMRH 4EKXA 3RDTC 4OD2B 4RIRA 3IPEA 3KXFD 4KKRA 4RMBA 3RIFF 3LNHA 3AREA 4WHYH 5M94B 3TS8A 1AO7D 3CZUB 3QRLA 1RJYA 3FH8A 3PREA 5E8PB 1MREL 2RA1A 3QO0A 2AF2A 5EN3A 3AG3B 3DX4A 4L9LB 1JHTB 1KEML 4XRCA 3TNNA 5IMKB 3E6HB 2BS8A 4Q52A 2FL5B 4XMVA 2CKBH 1OP5H 4CMMB 4DW2L 5CCKH 2FQFA 1I1CA 5EO1B 3RGVA 2NY7H 5B38B 2DY2A 3R7RA 4QXGL 5HVHB 3GLAA 1KOAA 4JHUA 1TU2A 3OBAA 4W6YB 1Q94B 3LNEA 3ZDYE 1KC5L 3I3DA 2XWRA 3RZCC 4FP8L 4ZXBC 3K8MA 5I16B 2PPEA 3PIQB 5C6WH 1VF5C 5AWNH 1I75A 3PHAA 1FBIL 4I13B 5B22A 2VCOA 4GKSA 3LB6D 4TQEL 1P5VB 5K9OA 3FQNA 4P48A 3PL6C 1B2WH 4CC0A 4G1EB 4RMTA 2W60A 4XNQB 5D1ZI 5HSFA 1RLBA 4ODSL 2VABA 5GGVL 2CCVA 1CJYA 4K3EH 5LGJA 1MWOA 4QRRE 3VXUE 2APSA 2J5LC 1FNHA 3K2MC 2WUBL 3GXIA 4DK6A 1KGYE 3CZNA 5E7BA 4Z7OE 3TO4A 3DOSB 3L8QA 2F54A 4YOKA 1OVZA 2QJDA 4ZT1A 3PUUA 4K71B 1MZYA 4OM0L 3R7QA 3G5VB 3B9AA 3BD4A 3R06B 4RRPM 3MREB 3GD1C 5FO2A 4LO9A 1SRDA 3MRGA 4X6CB 4EJ1C 2FYYA 3PJLA 4TRPH 5DUML 1J0JA 3RRQA 5HHQA 2XPGB 3K74B 1RUQH 3LQZA 4EZKA 3TVMA 2WB7A 1C5DB 1NFDA 4LBEA 4S1DC 4F8TA 1CFVH 4YHMH 3PGFL 4R8WH 2H6UA 4ZNEA 5I8CB 5IB1B 3L4WA 2B1OA 1GYVA 3UZEA 4QRUB 1JAEA 2DQIL 1QR4A 2BP0A 4LVOC 5SWSB 4JDTL 4LGSB 4QXVA 5TQ2H 4MXWH 2ADIB 1GGTA 3MLYL 5ADPH 5DFVD 4RDQF 1A3LH 2HFFA 5J12C 1YEEH 3B9KB 3GZPA 5DUPH 2Z8VC 2XZQH 4U31A 2XFGB 3DWTA 4GG6B 1BBJA 1D5RA 2XZCL 4B9CA 1AXTL 3EFOA 4AMWA 4Y5YB 4KXZH 2F8VA 4H1LA 3MODH 4JO8A 1HK6A 3EXLA 1L5GA 5GZNC 5D4JA 3E3QC 5DR5L 1MCHA 5AAWC 5DC9B 1JPTL 2CE6A 2AJXL 4PRPE 2K70A 4CMHC 5DLML 2AJZB 3IMTA 3APFA 3WDHA 4OF6A 2CIKB 1MSPA 1TFPA 1YEFH 3LH8A 3VFSA 4A6YB 2B9BA 2X7LB 4AVHA 1YNTA 1N70A 1HAUA 1A14L 2GEQA 5HJ3B 2CRYA 1YA5A 1XGQA 2EDFA 1AHWA 3T9WA 1IT9H 2X2YA 3JV6B 5F7DB 3S9DB 2HUEA 3P3TA 2Z7WA 1HZLA 2O6CA 5GRVK 4WK4B 4D0CA 4M1DH 3CVHB 4EI5B 2P42B 2V17H 4P2CG 1EAJA 3T0AA 4ZFOL 1MWAH 4GP5B 5BXFB 3DTUB 2J6EL 3QWQB 1KELL 3ULUF 5ISZB 1CN4A 1MAML 2DQUL 1G7PA 3PAYA 2UXTA 1U58A 3KH3A 2J8UF 3QNYB 3R8QA 4NC1E 2QZ5A 5L4MA 4ZX5A 4P04A 4AH2A 1GZQB 1E4XI 3PWLB 3QQ9D 2HKAA 1YC8A 5CINL 1BHGA 4NN5C 4NQVA 2ZUQC 3HHSB 2Z31B 5SWZE 2JELL 4LESA 5AW8B 4GAJH 3KYOB 2VDNH 1OCOB 5AFAA 2OJEB 4TOYH 4IK7A 2J44A 4WGWB 4FQ1L 2V5SA 4YZFE 1GHFL 5C1MB 5GS0D 5CP7A 5E8NB 1PZ5A 2BXZA 3EJQA 1NOAA 4KQ3H 1IAIH 1TJIH 4MNQB 1NBYB 4IBYA 5HY9B 4X7EC 3VXTA 4I1NB 4J4PC 4LSVL 4TM9A 1RZQA 1JNLL 3PDOB 4JY5L 4LCUA 5CJOL 4D9LH 1DBKH 2ENQA 1NGZB 2P5EE 3MJ6A 3UPRB 3UBXG 3GRBA 4IOFD 3ISRA 3BZDA 4H20H 1SY6A 4LCIL 1EHNA 2WXJA 1KGCE 3VVWA 4KJPC 4R26H 4WUUA 3D48R 3OR7B 2I9TB 4R4FL 4ZUWB 1UM6L 4HP5A 3QRBA 1ACCA 1UXSA 1XIWA 4DPRA 5CKAA 5JNYA 3VI4B 3V79C 2X4OB 1KPRB 2OW7A 4LOUD 2DWEA 5EZJA 1YDPA 5DFWH 3FRPG 4IKNA 3DGGB 4OD3L 2GBUA 4BCXA 1FFOA 5DRWB 5CJBA 2IQ9H 3APCA 1DVUA 3SKOB 1HHGB 1JWSB 1MIEL 3LN5B 2K7QA 3UTQA 5CF3A 3S88L 1DDHB 2Y1ZA 3HE6C 4HEPG 1M57B 1EEZB 3G6DH 1P7QD 5CD5C 2X6CA 1ND0B 2EP6A 3PP3K 5D7LB 3D0LA 4M5YL 2BJMH 1JPEA 2WINB 2FD6L 1D9KA 2Q1EA 1OM9A 2Z91B 3GMRB 4K5LA 1N64H 1I9JH 1JGDA 2IWEA 2BRRL 4PWHA 4WI9A 4UUJB 2YD8A 3SGJC 5CCJA 4X6CF 1V3MA 2GC4C 3QJSB 5HDOA 1J11A 5GZOC 1XR9B 5CR1A 3CSYA 1F8TL 1NIEA 1RU9H 3LOWA 4QHLB 3JWDL 4P9HH 1IM9A 2NNFA 3BPNC 4OGAD 2AEPH 3AQZA 4OBRA 2IALB 4NIYE 4QCIA 2QVFB 4Y4FB 3BESR 4H0IA 4FAAB 2H0PA 5TF1L 4TPRH 2AK1L 3D4GA 1A3ZA 1U8HA 2X1PA 2EEFA 4L3FA 5GXBB 2VC2H 4EDXA 3Q8CA 4WFHD 5AVRB 2VN6A 3FQWB 3KR3L 3NCCB 4GS7C 4PLKD 3TEUA 4XMLL 4L37B 5IUSA 2CHXA 3VXUA 3SDCD 43CAA 3IMVA 4QRRA 1MFCH 4JX0A 4GFTB 3N55A 2DM7A 4N8VG 2D7NA 3ZHDA 1XDTT 3VFOB 1MXDA 5E1IA 5JMRA 1VZHA 4RMUA 4LSRL 1U33A 3VGDA 2OXHB 3HC0B 5F9AC 4XNXL 2ZOTA 1UZ8B 1Z3RA 5GGRA 1MHPL 2FNWA 3DIVA 2NW2B 5ELIA 1HHJB 1GGIL 2R1YA 4GXUM 1TO5A 2F7QA 2OPCA 4FP8H 5IBTL 3SD2A 2PP8A 3L81A 2AK4A 3PP4L 1T1ZA 2WZ5A 5TQ0L 2FNBA 2DWDA 5SX4H 4D9RE 4PRBA 1MJ8H 4FXGB 3WL9B 5EEXA 1OF2A 4I5BA 2PTTA 3QUGA 4PJFA 4UINL 4YGVA 3MRDB 1S5HB 2EVHA 3L2NA 5E1GA 2GC7C 15C8H 1CYXA 4HWEH 5DUBA 2APTA 5ECGA 2W8CA 1S7VA 5K9KA 4DP9X 4XHQA 4LCWE 1KB5A 2HPTA 4OFYD 1BQ5A 3BAEL 1AY1L 4LVHC 5ENWB 3P40A 5GGSA 1P6AB 4N0CD 5IREA 4QJ5B 3BEWB 3OWRA 4NLHA 5BQ7B 3NJKA 2KZKA 1I3GL 1NFDF 4RDQG 2GABA 4LSQH 1F86A 5BOPA 3FB7A 3QJTB 3S3JA 4U0QB 3HLAA 1VAHA 3F00A 1A4BA 4GRMB 4RZCB 5E6IC 3LKRA 4XE5B 3FUMA 4Z0XB 3K6IA 5CN3A 4PRPA 2FEDD 1AC0A 1AZVA 2MNUA 4HQQH 1ADQL 4W9ZA 4Q4EA 5AL8A 4HS3A 3RNQA 3QDJB 2N01B 2VDLL 1DQTA 3CX5K 3O6ML 4RNRA 3DIDA 1W0WA 2XN2A 4JPVL 4XI5C 3OZ9H 4PD4J 4R7DB 4ZMPA 5HPMA 2EO7A 5DK2B 1Z6JT 4N5ED 4UF7C 3U4BH 3E2HC 5F3FA 2DQIH 1JHLL 4P3DB 2AITA 4MYPA 1F2XK 4F15B 4JDTH 2FWSA 3C5XA 2NXYC 1WCBA 4R5VA 3FCUB 4L29A 4TUKH 2ARWA 2GITB 6FABL 1J7VR 4HPYL 1SEBB 3C9NB 4HV8A 5E2VL 2PW1A 2MCMA 1Q1JL 4ESKA 5DRXA 5EC2B 1EXUB 1GYUA 1M7UA 4EO5A 5IHZA 3VD3A 3MZTA 1IZKA 4XCNB 5TDPA 1YNTF 4QXTA 3VXME 4KRMB 5DR5H 1SDDB 4PI2A 4X9GA 5F0JB 4B3VA 4KDTC 2GY7B 3SKNA 2AJXH 3BDBA 3MNDA 2UX6A 3ECWA 5FCUH 1RMFL 3BUQA 4LT7A 3VI4F 3RFZB 1EUTA 2IJ0C 2JF1A 3QRGL 5G4OA 2VRQA 5SWZA 4TL4A 4DN3L 5JHDD 4UQBA 4A1RA 3IETA 4GJTB 1OAQL 5CEXA 5I1IL 5K39B 5LBSL 2ICES 4PJAB 4J23A 4TLSA 2DMCA 2A6IA 1N4XL 2J72A 2NY4B 3HC4L 4YAQA 2YAHA 3KJ6L 3TBVB 3QUXA 3NPSC 1G9HA 3E0GA 3FU0A 3D3VA 2R56L 1QSEE 3LSOA 3MJ9H 5F3HA 1RVFL 2AEIT 5I0WA 3EJUA 3LN4B 4GP4B 3HZKB 2ZCLL 2P8MB 1ZLDA 1IGIL 1BVZA 4KTDL 3HE7A 1CFBA 1KUMA 4ZFFA 5A43C 4PYGA 3F6LA 1MAMH 1PX4A 4PV1C 4I48B 1NFKA 5FHAH 2ED9A 3QIBB 3DPBB 4ZG1A 3JVGA 1QATA 5LBVA 4FLOA 2BSEA 4K5OA 5DD0H 2WXKA 1XCXA 3QUMB 5I1DA 3C09C 4FQJL 4IMKC 2C3VA 1ZXQA 5D7KD 1SZNA 5FKPA 3ARGC 4TLTA 5B38G 2JELH 4LL4A 3SJVE 4DHLA 1ZA6A 3SE9H 2ESVA 1S9KC 1U30A 3KPQA 1MFBL 4FQ1H 4M1GH 5J13C 3CN1A 1B90A 2BP5M 5IV2A 1GHFH 4WVRA 4XNZB 5DHDA 1A7OH 4IIZA 4N1CA 2R69A 4PGDA 5D1XD 3WE6A 2ICEC 2XI9A 4XXWA 1JPST 3LXBA 1PLGL 4MJ6A 4FG0A 4NQCE 5DHVB 2HH0H 2ZWYA 1A6WL 4LSUL 1LDPH 4JZNA 4PCYA 2KERA 2WKLA 5GGQH 5HI4C 2XG5B 4QLWA 5I1KH 3BVTA 3U9PL 1QBBA 1E5ZA 3AZUA 4P59L 3LD8C 3LZFL 4MQXD 4L3EB 2IDQA 2IXQA 3BT0A 4XMXA 2A9CA 2MKWA 2BERA 2CDEB 3L3IA 3UH8A 3KCWA 3Q6FB 3NAAL 5DD5H 4OJAA 1KTLA 2B0SH 5C0DB 2H2PC 1BXUA 3AY4C 2VZ3A 2CO7B 1MUJA 1JOIA 2ZUTA 2XY2A 2EKSA 2FE0A 1KJ2A 3EYOA 1WFJA 2OZ4A 4HWZA 1S6NA 2P80D 4PRHE 1LEGB 1N6QH 3NCEB 1ZGLA 1BVNP 2N0KA 2VLJD 4MDJA 3BKCL 1REIA 2MRYA 3LKOA 4HOZA 1PKQB 3AG1B 4NP4L 4I7ZC 4Z7NB 3U0PA 1SVCP 1NKGA 3K72B 4GKZB 1WHPA 3U1QA 4M5YH 1EPFA 2VUKA 3DHMA 1QHQA 2YRLA 4XCYA 4U1HA 4WW1B 2R4RH 3UEQA 1CR9H 3KPNA 6PCYA 1BW8A 3SQOL 2PPCA 3SE6A 3WD5L 2JWYA 2YD7A 4BA0A 5BS0B 2EDEA 2W92A 3H56A 3F8UB 3N9GL 4XB7A 4X7TA 4W9EC 1IBBA 3OMNB 4P2RE 1IAKA 5HHMB 3Q2CA 3FC8A 1IAIM 5F93C 3WHXB 5I0YA 2BNUA 5C0ND 4U2ZA 3X1BA 2VYRE 3IDJA 3V5KB 4J3VA 3CVIL 5DMGD 2P8LB 4DKEL 3I9IA 1CFTA 3O45A 4M8QA 3K4ZA 2Y25A 3P69A 3ARBC 4LLDA 3W0WB 5DSCB 3F12B 1AS8A 3T0ED 1JF5A 2HVKA 4WWOA 2X44D 5KOVC 2WWMD 1LK2A 1QQDA 4LCWA 4YR6A 4JQVA 1HQ4B 3KWWB 1BD2A 3UIYA 2CPCA 5KYNA 4UM8A 3EJZD 2XLLA 1G7QA 2V7NA 1G9NC 4XPHH 4XNXH 1A21A 5F6HJ 4DNLA 3F7YA 1RZ8A 5T1JA 2PYFB 4NXKA 4F7PA 3C5JA 4PRAB 1BWWA 1PIFA 4NFCA 3DUSA 3RYMA 4WNQB 4NQUA 3D30A 4PJFF 4S1QL 4KZDH 4HK0A 3O3EA 4DO4A 4I9WE 1MRDL 1ED3A 1F2QA 1SEQH 2XN9D 1KCBA 3PP4H 3V4VL 4S2SB 3EOTH 3ZOAA 1VEPA 3K8LA 3FN0H 4WK0B 1FCGA 1IQDB 1XF3B 4YSOA 1MJ7H 3M8OL 5LO7A 4JM2C 4ZTOH 1S7XB 1J8SA 3P0VL 1WAAA 5DJ8A 4UINH 3IDYB 2AZUA 2XOTA 3BE1L 3LRKA 4WI2A 5KSAB 2GSIA 1LO2L 1TEYA 4FQHA 1D5XB 3OGOE 3CFDA 2IAMB 1FGVH 2EO9A 4YFLF 5E8EA 4U6VL 4NT6A 1U3YA 2HVBA 1FHNA 1RUAL 2LVCA 1F11A 3RWJB 2YAQA 3BAEH 3WNMA 4H1LG 4MD4A 1P4UA 1YJDH 1DFXA 4TSCL 1JZ7A 3M07A 1NEZA 1WE5A 4YFLI 5L88L 2NCMA 5H94A 2ARJB 3QZMA 3MYZA 3BD3A 1CC3A 1OALA 4N28A 2AQ3A 4N0FB 2NYKA 1T0NB 5F1NB 3LPPA 2YEZB 4E5XA 3OC8A 4HGWA 3EFFA 3KPSD 3VXMA 3UX9B 1T1YB 3IWVA 5KSBE 1Y1DA 1SGKA 1U6AL 4PJEB 2I07A 3C87A 5I9QC 1EHXA 4PRNB 2VR6A 3KWUA 5B39B 4BUGA 4F27A 4JPVH 2RFXB 2QPSA 2X6UA 3UACA 3PGDA 3O3DA 5IROC 3I6KA 5AW5B 5DQJB 1TXKA 5E2TH 4OZGA 4KITB 2ARJQ 2A4CA 3L7EA 1U8LB 4JO3H 4NKOB 4K2UH 2VIRB 4ZO6A 2J6EA 3AS0A 1A9VA 4XE0A 2LU7A 4KKLD 1X7QA 5IQOA 3MR9A 4NUQA 4PGJA 1E9OB 6FABH 5GGTL 1HCFX 2E56A 2R15A 4G8GE 4PREA 3C2AH 4Y4HB 1E4KA 1Q1JH 4K7PX 1LEKA 2FWUA 4B0MM 1MCKA 1MF2L 5C7ZA 3AMLA 4X80L 3R4RA 1KLFA 4P4KD 5CJXC 1U91B 3BW9A 2BLFA 2B15A 1NPUA 2QSQA 4M7KH 4UT9A 1MCPH 1UFUA 5CN2A 1IEBA 4ZD3H 4WSGA 4Y1AD 4AW4A 3N0PB 3WKQA 2CO6A 5EPMB 5L9DL 4LPUA 4WNSA 1B9ZA 4FFYL 3UABA 3CK0L 3MU3A 3SJVA 5BZDA 5LQBL 1Y7VA 1OAQH 4N2FA 4C8XA 2D03L 5LBSH 3SKMB 5DC4B 1DBBL 1NA8A 1X5JA 3BRFA 1PDKA 3HC4H 3V4UL 1YYCA 1NC4A 4PN6A 4F9LC 3O2DA 3QUZA 5EDXA 4YPJA 1A6UL 1SLVA 3HRZC 2OV0A 4GYBA 2EYTA 2ZKMX 4NHCL 5HYFA 2WQRA 1EERB 2MJWA 3TONA 4G9DB 4FQCH 5FYLD 4U7MA 4ZAKA 1EO7A 2VDKL 2YRPA 3EYSL 4NB7A 1HL8A 2L8AA 3GMMA 4W9JC 1B0WA 3ATFA 1G43A 5JOFA 3K91A 3SDYL 2IOIA 2Y72A 4Y2DD 1SF5A 3ZHKA 4N1HB 1OP9A 1KG0B 3IYLW 2DTML 3BEVA 4UB0L 5D6DC 3RPIA 3MLZL 3VXRA 1D5IH 3S5LA 1DVFA 3WV0A 3G04B 2H1LM 1LO4L 2QHLA 5BV7C 3QXDA 5A7BA 5I1CL 2OSLB 3H3BC 4JVUA 4WWKA 4KGJA 2AV7A 5D7JD 3MCKA 5EU5B 8CGTA 2NQCA 2ATAA 3FT2B 1YMHA 3D33A 5J1TC 3MRKA 3MLTB 3V5HA 1TQVA 4LLVB 2XQBL 5EU6D 5F88B 4OQTH 1AE6H 3GSQA 5F2FA 2K3TA 3UG5A 4LOEA 2AI0L 3VD9A 3LEYH 1OZTG 2J73A 2LQRA 3HG1D 3KPRB 3QDGE 4GW5B 4LSUH 3L9BA 4NGHL 5F0LB 4CVZA 2ENJA 5EEUA 4N20A 1P5UA 1I3UA 4G9FB 4A6YL 3STZB 2Q3AA 4Y7MA 1DQQA 3B2XA 3DX6B 3K1KC 1DE4A 4AQ1B 1IJ9A 1FL5A 3O9WA 1ICTA 4HMCA 1E7UA 3LHPH 3QZPA 2BS9A 3II3A 3VXSD 1HWHB 1U3JA 3EZ8A 3NAAH 3L3GB 3L5WA 4RA0C 4LLUB 3B7SA 2X2UA 4ZBJA 2JLLA 1ZT1A 1V54B 2QGCA 1P4IL 2Y7OA 3CVHL 4P2RA 4WEEA 3MLUL 1EVTC 4ONOA 1JUFB 3S8FB 4GINA 5AG8A 3GMPB 4R4ND 4HBCL 4LXFA 4A7TA 4ZMZA 1MI5B 3QIUD 1FN4A 1P53A 1KYOJ 2UWEE 4RFEB 3ULVL 4AGNA 5TDOA 4APQA 2NT1A 4LRIC 1AJ7H 3L9EA 1DVTA 3BKCH 2WD0A 5D2NE 2UY6B 5HYQB 4NP4H 4E9TA 5KSVA 3GIVB 4M7LT 2AVGA 2XFXA 2HRLA 1DEEA 1KNOA 2KMWA 4R5XA 1PL3A 1QW9A 2I32A 4HKXA 1YEIL 1JV5B 5AD0B 2VLLB 4JDZB 4ODUA 3P4NA 2CALA 4U1NB 4EQ2A 5KJ7E 3IDIB 1PEZA 4DGVH 3ZMEA 1XGPA 1T80A 2ZXCA 2LU5A 1ODAA 3SN6N 4NJ9L 2CLVB 3CZGA 1R75A 1WICA 3M7OA 2YD1A 2WAHA 2XBZA 4KXCA 4EKJA 3UGXA 4HLJA 4M7JH 2JJWA 4PJEF 3N9GH 3ETBF 3GFUA 1AMXA 4P05A 2J1KA 4PJCB 2E9GA 3JV5A 4JFED 2YD0A 4TNEA 1DBJL 3VFVB 1CTOA 5FS5A 3S3CB 3ARDC 3LKQB 3WJLC 1PGRB 2Z1PA 3CVIH 3KPOA 2VR4A 4AE1A 3C6LC 4BM7A 3POCA 4UYPA 3O4LE 3U9UA 4M61B 1B3IA 2OMBA 2QVMA 4X4ME 3T8XA 5L8LB 1EEUA 1LE9B 1UEYA 3DRTB 1DLFL 3JZ7A 1J8KA 5FM8A 1C7TA 5EA0L 3EJYD 2MCAA 1WISA 4L4VE 3HZVA 3OKEB 2G4EA 2AERT 3CSTA 2ZAHA 4JRXA 4MMZC 5JW3L 2CIIA 4KXAA 4NPYB 5DVOA 4JHWH 1HDMA 3ZHNA 1FZOA 3I75A 4BZ2A 2NY6B 2OQJA 2YQ3A 3D69A 3T0WA 1JDCA 1QP1A 1YYLL 5IKCA 1KIQA 1WAAF 2IH3A 1PPIA 5D1QB 5E5LA 5H4YA 2ICWA 1B0RB 4U0RB 1PSKL 4MAYB 2VERN 4YSCA 1K8DB 3LEVL 4KOBA 3V4VH 3GC3A 4NO2A 2RIKA 1EFXB 3ZDZE 3CCHB 2D4DA 3ZGIA 2M8XA 3RTQB 7PCYA 3LKNA 3F01A 4QDGA 4BCYA 4D0DA 3ULUH 1SYVA 1E4XH 2O6EA 3JT0A 4G42B 5HHPB 2XTJE 5EU4B 5EEWA 1GYWA 3WY1A 1UWFA 3RWGB 4U6VH 4Y19A 3O0LA 5J0BA 3EOAA 2B7DT 2ITDB 2ZG3A 1YNKH 1TVBB 2Y1YA 2H32A 4BHUI 3E1F1 2BFVH 4MJ5A 3BI9X 1WD8A 3ZO9A 1GTNA 3D52A 3EO0A 4YHZL 1PZ3A 3A67H 3JTSA 4AGPA 2L7UA 5C97A 5TGBB 1T22A 4YDNA 4LASH 3FTGB 4D2NA 4ZTEA 1MFDH 5IFHH 4NQSB 3Q5TA 5CMAA 1VPOL 3LB6C 2JSFA 1RUPH 2FATL 2OM5A 5E94B 4OZGF 1UA7A 2YRZA 3MV9D 3ZTNL 1HEJC 5CILL 4N5UA 2EZ0D 4AT6B 5IW6A 1A2YB 2XBDA 2ZCHL 5IB5B 4XC1L 1FL6B 2VSCA 4YSTA 1IGJA 2B5IC 5HDLA 1KBGL 4J8QA 4YHLL 4WTWA 3T1FA 1U8OB 2VDOH 1JI1A 3FQ1A 3NZUA 3SQBA 4OIBA 3J27A 3S37L 2HXAA 2IADB 1CD9B 4XBGA 1AH1A 1U41A 3L3OC 2AKRA 1MCSA 3V10A 5MHSD 2RHEA 4Z7UB 3VXNA 3T8MA 2WLJA 3QJFB 5E2JA 4P23B 4HJGA 5HI5D 5ABZA 5FO8A 4IEFB 4KK9D 1OP5K 4XMPL 1T7VA 4UQAA 5IFAH 3NESA 4GI6A 4JZOA 4GBXD 3H85A 5G2NA 4K3DL 4EI6B 2Y7SA 5FKAA 1MF2H 4X80H 3LVTA 1BV8A 4XP5H 2J12B 3FO1B 5C0BB 3U48A 5SV4A 1BIIA 4KJWD 1FVCB 1HWWA 2XWTB 4G7RB 1JHKH 2VQTA 4UQ2B 3RLSA 3WG7B 3N6YA 1A6TA 4HJIA 5IHWA 3FQTA 2DQDL 2FO4B 2GSMB 4J7RA 1S7UB 1F18A 2QEJA 4UMSA 4ZNCD 2BSRB 2W07A 3WEAA 3VD7A 3IN0A 4AX3A 4RCAA 4X6EB 2BVPB 2ROYA 3MCYA 4FGMA 4OR1A 1U8KB 4UTBL 5DFVC 5GRWA 4LPXA 3V6OE 1A7RH 1DBBH 4G70B 4ELKA 2B4CH 3V4UH 4O2EA 5DJZB 4XPFH 1BEXA 1F90L 4G43A 4PRIB 4ZUVB 5I28A 1A6UH 2P5WB 1UHVA 2ITEA 3KVQA 4NHCH 5C08D 3DYOA 1BZ7B 2F58L 3EGDB 3IE9A 4BSVB 2Y2TA 4D9QD 4PJ8B 1MLBB 5AAPA 1GGBL 1INEL 1CD1B 3ARSA 4R0LB 2WBJA 1VKXB 3GQFA 2HP4A 3QDGA 5FW8A 1QLRA 5SWSE 3WSQH 4W9LC 2NY2D 2WQVA 3RBSA 5CSZA 2B59B 2OI9C 2BVOA 1SN2A 2ALWA 2CGRH 3IF1B 3WUWB 4AL8C 5D7SL 4JLRB 4GG6E 3FS9A 2HN7A 4NQED 1OOWA 2EYSA 4PW4A 1J8HB 1DQLL 2GG1A 3MLZH 4YNYB 3GXMA 4PJIA 5DS8A 1W6LA 1FH5H 4U1LB 3I50L 4BXVA 4LAQH 2W9DL 3P4OB 3S36X 2OMWA 4Q6IB 4J8RA 4G8IB 1GMEA 4GMSL 4JUTA 4NAMA 2X09A 1FVEA 3AAZA 2KH2B 2DH2A 5EFIA 1WTLA 3SYAA 3GSOB 3UDWC 2PNDA 1IFGA 3MRRB 1T03L 5D2NA 4F7MA 4KPHH 1SJVA 1TKWA 4UNVA 1CMOA 2OCFD 2AZAA 2ZOKB 3D4YA 1NZRA 3T0DA 2D8KA 2RCSL 3TV3H 3US9A 1GGYA 3GSWB 3PU7A 1DVZA 1M6OB 5B8CC 3NJGA 1KGUA 4OUUB 2CO3A 4AEFA 4GSQA 3QQ9C 4JFFE 1BEYL 3BN3B 1A22B 1BG9A 1JZ3A 1W8EA 2JKSA 1NBZA 4GW4A 2FIKB 1HH6A 3WKML 3GKWH 5D71L 2IANB 5F9OL 1NCGA 3CVHH 1YECH 3MOBL 5CJQH 3ULVE 4WFGE 3VVVA 5L4IA 1IAMA 2VH5L 4QRQA 3AU1A 1VESA 4TNVK 2AQQA 4RQQB 5HGBA 2Q2EB 5D7IA 4OZHB 3AXLB 4WO4B 2JLPA 4OV6F 4ZS6D 1KT2B 5PAZA 1EAPA 2MKLC 4DEPC 3MRMA 2NPLX 3TEXA 3O4LA 4X4MA 3DIFA 4E9SA 4IOFC 5MEPA 5DVMA 3HCVA 1MCQA 4Z3HA 1Q9WA 3QUML 2NDFA 3ARFB 3O11A 4FQXA 5FECA 4IGBD 4RFOL 2I9LA 1QFHA 2GBVA 4L4VA 3RWEA 2NX5B 5MEQB 2Y24A 4W93A 5L2KA 2PCPB 3CLWA 3BVWA 3B8SA 5C0CE 1XAUA 1AXSA 1KN4L 3FQ4A 3FHEA 2O93L 2EE3A 3CD4A 5AG9A 5L2JA 4HBQA 4LOUC 3D2UA 4LVNB 4NJ9H 3OX8A 1UJ3C 4PGEA 2VQ1A 1RXLA 3W2DL 4QOKD 3I02A 2P4AB 1NFIB 4YHPB 4BFIA 4GH7B 1PYWA 4JB9H 4KTEH 3FH7A 2BPBA 2R2HA 2LV4A 2P1YA 1YYML 4HYTB 2F8XC 4PJGB 5EU7C 1QFOA 1X44A 1KIUA 4U1MA 5EC1B 2XWJA 5HHNB 1BMWA 4DP8X 5EUKB 3FB5A 4U6YB 5GGRY 2HX7A 4NO0D 1EXHA 1MCLA 4XVJL 5AB1A 4W4NA 3JSSA 3PAUA 4YDVA 4OZIE 3H2PA 4NN7C 3GXUB 3MFFB 3PABB 2HAZA 1PX8A 1NEZG 3RNKA 5MENA 3HI6L 4N90E 1F4WL 4K9JA 4YXLL 5JW3H 2ZG2A 4MRBA 5E1QA 5FYKL 4LEOB 1JE6A 1TEFA 3ES6B 4E5XG 5ITFA 4V2BA 1IKNA 2EIZB 4OGAC 2HVJB 2ICWI 5D7LE 3PYCA 1FG9C 2IO5A 5AZ2L 1IM3D 3UJIL 4DN4H 2OP4H 3QAZC 4ODWA 4NRXB 2V37A 5AVXB 5IW3A 4ANUA 2L04A 1YEWA 4S1SH 1PSKH 5EO1A 5DD3H 5F7EL 5EOQL 5FX3A 3VGGA 4P2YA 4UMGA 4XMUA 1ROCA 4PLKC 5KYWB 4K9EC 1O7VA 3VCLA 2I7SA 5KBLA 1ETZA 4QRPB 1W80A 1P2CB 5GGSY 1QBLL 3SDCC 4HSAC 2IBBA 4HLEA 3N1QC 3FOMA 1LNUB 1P84J 3V0IA 4Q74A 4FI8A 4X0KA 4LRNL 2EKJA 3QQNA 1A4CA 3H6JA 3LZRA 4CUCA 1P7KB 2MHAA 4LEXH 4HIJB 5IM7B 2ZSWB 4OT1H 3SCMB 5JORA 5KOMC 4N26A 4JKWA 3WENA 1BPVA 5ES4B 4X8GA 3MZGB 5DI8A 1OAZL 1B9KA 1A7PL 1NCBH 4RX4D 2QPFA 1N8ZA 3APNA 4XB3A 1Q8MA 3BT2L 4FZ8H 3TN0A 4C4KO 5IFJB 1I82A 2XNAA 2HT2D 3MRNA 2AEWA 1I7RA 2PO6B 1JGUL 4ZMYA 3VI3B 1SY6H 3ROOB 1INQA 1F1AA 4HAKA 4G6ML 1TPXB 3NRQA 5CILH 1BYNA 3EJCA 5KS9A 4N1EA 1CLOH 4BUHA 4XC1H 4NNPL 2QVTA 5CU9A 4UOZA 2A6JA 1T4WA 3KNBA 3H9ZA 4PMFA 2O6DA 1C08A 4NCC2 4WHCA 3DJZA 3OJ2C 1FLRH 4N0CC 5E23A 5EO0A 4NHUA 4HJUA 3ECBA 1UG9A 1WZLA 3IMRA 4LL1A 4H8WC 4BQBA 2ZP8A 5JW5A 4LCVA 2MPAL 1URLA 1W72B 3VGAB 1JRHL 5EO9A 1YNLH 5DT1H 2JIXB 4QHNB 1HXMA 3OSKA 3PHQB 2PXYB 3IGAB 1S3KH 1ZV5A 3SDDB 5KYYB 4EIGB 1HHIB 5I74C 3NGBB 1T89C 5ECJE 1HQRB 4I2XE 4JFOA 1QHPA 2ZJSL 2P5ED 1QRND 4N5EC 1UVQB 2YAPA 3FF7A 3CVCA 5ALBL 1RL1A 3DROB 4P5TB 3AC0A 5HGHA 3C60A 4F3FA 4F57H 1O6TA 5MI0B 2WWOA 5CEYB 1SDAB 2N1KA 3W5NA 2IFFL 2IGFH 1OZUA 1FFPB 5B3JF 3VW3L 1QYGL 1NGYB 3GBNL 3QHFH 3BWUF 3LX9A 2J1YA 4XWGH 4BH8B 5FK9B 1C8QA 4O02B 4PJIF 5IESL 1OE3A 2WGNB 3KG5A 5E6YA 3BH8A 1ZTMA 3AJ7A 1QTSA 2R9HD 2ZUVA 1FAKT 5FEBA 2I85A 1KTDB 2XA8L 2EUXA 3ILQC 3EDKA 3DPDA 3MGTB 4ODVL 4WZ9A 2DLHA 4FXKB 3HZYA 3MV01 4JFFA 5D7SH 4BFRA 4FJ6A 1KIPA 1VADB 1Z5YD 3IMUA 4YLBA 3JWNC 1CGVA 2FT6A 3T3PF 1C12B 1IV8A 3HC3H 3WHE0 4DQAA 3S8GB 4W9FC 2IWFA 1UJTA 3RUGB 2W9DH 2VITA 1UYWH 3ZZQA 5JR1H 3SE8H 1I8LA 4MA8L 4XOCA 1SHSA 5DDHA 2QVKA 3CFQA 4HCIA 4Y5VC 3CSFA 5IQLA 3VGFA 4L3CB 1F4XH 2P26A 1DSYA 2H6PA 1XCTA 4P06A 4Z0BL 3I6GA 1EHLL 4WHTA 1S8DB 1K2DB 1Z0NA 2EE9A 4Z78B 4DVRL 4PJAE 2RCSH 4IKKA 4R84A 1GZHC 5JW4R 4YDJA 5EHFA 4DZBA 4IBLT 5BCAA 2W80C 3ZY7A 2X0WA 3IS0X 3HB3B 5C09E 1WGVA 5C0CA 4Y5XB 2X1QA 2BSTA 3G7TA 1WFIA 4CU8A 3O6KL 2QHRL 2Y7QB 1QACA 5D7IF 3V7AG 3NZ8A 5D5MB 3RL2B 1FGNL 4AMKL 2ATPB 1XGZA 4JRFA 2G3NA 4HIEA 1AIFB 2R2BB 1O9ZA 1GIGH 4JE0A 4JQIA 2DLGA 5GSRA 2JB6A 3LS4L 3MOBH 4W68A 1IL1B 1GW0A 4BFOA 5AW6B 2VH5H 5D1XC 1F3RB 4B9YA 2ZWNA 2XG4B 2N1TE 2VSMB 5DEGB 4YDLB 3KDPB 5A2JH 3PWUB 4MDIB 5E5UB 3WIHL 4HUXA 1XH2A 3QNFA 2CGYA 4NWUH 4X5LA 3FCGA 2YFNA 1OTUD 3LKSB 5E2WH 3QUMH 4KUZL 4MQXC 2P28B 2ZYIA 4WJ5A 1DFBH 3QFJE 5JDSA 2XN1A 5DEJA 4JR9L 4RFOH 2CM6A 1CQKA 4JFPA 4OZIA 4LDLB 2A9DA 2WUCH 2Q6WB 4PGZA 4MCNA 3T4AC 4IS6A 1KGXA 1KN4H 1P1ZB 1D5MB 4NAJA 1R24B 4Y1TA 5GGVY 2Y1AA 3QORA 4GQRA 1FO0B 1FORL 1ZSDA 2VRAA 1K4CB 5HBBA 4O2FA 1XXDC 1U3HA 3MUUA 1V7NL 1CTNA 1Q0XH 4RGMB 4MSWB 3W2DH 3ZIYA 1YVLA 2IH1B 1E40A 2X4PB 3ETTA 2WVVB 4L3EE 4YVNA 2YBRA 5DZPA 3EADA 2G5BB 4Q56A 4CKVX 1YYMH 1I8AA 1LMIA 1MHHA 2F74B 3D18A 5FOBA 3RDTA 3RE0A 4A2MA 7TAAA 3FUFA 1QX1A 5GRZA 1YEJH 1M7IB 3KS0H 1C8PA 5BZWB 4JN2B 2IALA 3VXOA 1HHHA 4JANB 2AXJA 1UWXH 3I84A 4A7GA 1IE4A 4UT7L 4LLQB 5FYKE 3VXQB 1DTUA 3UYOD 3GSNB 3FHAA 2WIIB 2ZX9A 3F7RA 4MXVF 4EZLA 3HI6H 4NBYB 1F4WH 4XN9A 3TIEB 1PKQE 2BW4A 1I1FA 1IUZA 4Z7NE 1JS4A 4XCEB 4AJWA 3RZCA 3KHQA 3UG3A 4ZXBA 4X50A 2HFGL 4TUOA 3AB0C 3BP6A 5C0NC 4L0ZA 2JJUA 1KYFA 1R3KA 3MMEA 1GY2A 1HXYA 2WO4A 3MV7E 4X5XB 5DMGC 1F58L 3FTWA 1U2CA 2QR0B 3PL6A 4TKWA 3ROLB 4XZUA 5KVDL 5I17B 1EDQA 5BS0E 2WWMC 2YUXA 2ZOLA 5J11C 2WSDA 4IRZA 1U93A 4JHAL 1FNEB 2WO2B 3MBED 1S9VA 1MFEH 5GSVA 3EJZC 4UV4H 1ACXA 4XH2B 1J0YA 2XWEA 5FDWB 4HJJH 2M83A 5DURB 3B56A 1GSKA 4B6ZA 4B27A 1RK0A 3QJRB 3DHJA 1I8IB 1SYSA 1M2VB 5T3ZH 2VXQL 3W0WE 1OAZH 4ALAC 5KS9F 1LWJA 1QSED 4ZSOB 2KPNA 5T1KD 1A4JB 3QARA 4MMXB 4I18B 4MQTB 1OSYA 4MZIA 1L9NA 1IC5L 3IK2A 4I2XA 5FA4B 4MLIA 2W9EH 3S7GA 1MHCA 2M1KA 5F96H 4XTRD 2LFEA 4XP1L 4ZYKB 2E5EA 4A67A 4U1IA 1R3IL 3BHBA 5DQ9B 4U6XA 4UANA 5B1KA 3ILPB 1I7ZB 1I8MB 1X5AA 4FXLA 4JHZA 4F8PA 1XO8A 4FYQA 5IBUG 5TFSL 2OTWA 3G6AB 4PJ5E 1TUPA 1KJ2H 4YBQD 2OZ4H 2EADA 4BA8A 1H8SA 1SXBA 3ZE2B 2ZWLT 1YY8B 1U8NA 2B2XH 2KYIA 3CZEA 3OXRA 5T5FL 4G6KL 1UQSB 4WI8A 5DUJA 2YMOA 3SZ6A 5I75C 2HG5B 3CHSA 1QKZL 3EGSB 3RWHB 3MNMA 1ML0A 1O7DC 2DEWX 2F9BT 5KVGL 5IIEB 5GZNA 1V7MH 2H0EA 4HC1A 5FFGA 3RX5A 4R7NA 3KEHA 1DQML 5BRPA 1Q0YH 1RJLB 4M62H 2BMKB 4QHUB 5AAWA 2R1WB 2DWYA 4FFZA 1SXCA 2CBOA 4NQCD 1G6RL 1LHZA 4P46B 4V2CB 5D5MF 3MV8B 5E5MB 3ZPDA 4JPWH 4BUQA 1JSYA 2VDRB 4KZ0A 1RQ5A 3WN5C 4YIQB 3CX5J 3P0YL 4J3OF 5ALBH 2RB8A 1RZGA 4ZTPL 2XTLA 3QCUL 5GGUA 4RAUB 4KHTH 3VFRB 3UTSA 1ZD6A 3FUEA 4WSJA 4DGYH 4EAEA 3WS3B 1PFCA 4JPSA 2B1HH 3TPKA 4HH9A 4KKLC 1CGUA 4L8BB 1IFHH 1F3JA 3BSHA 4BH7B 4OVUA 1VFAB 1ZAGA 1S7QA 3OL2A 1G7JB 2E7DA 1QYGH 2GT9A 4TULH 2ATKB 9PCYA 3PGCB 1IAOA 4P4KC 3UTZA 1YN6A 4PRHD 5TD4A 3D2TA 4EVNA 3B8YA 3DHPA 2MMXA 1JZ8A 1EH9A 3LQAL 2EYRA 4KY2A 5C09A 3THML 4CC1A 3WMPA 5IT2L 2DQ6A 1BJ8A 4P9ML 3HUJB 3HIZA 3L6FA 3UFIA 2MCG1 2MIZA 2LGNA 1RURL 3WFEL 2WN2A 1LO3L 2NYYD 1OCWL 4GKOA 5FWRA 4NSKB 4R2GD 1XGUB 3D5OF 3TESA 2EC9T 1PD0A 3R8BB 3Q1SL 2O6FA 4M6ML 3ULAB 1PQZA 2CLRB 1T5WB 3BUPA 4FQ2H 5ID1B 1JN6A 6CGTA 4MA8H 4DIXA 3D07A 3EH2A 2L4OA 2A77L 2GJ6B 5DJYA 3QZWA 2CLZA 1BMGA 2EH8L 3NSCA 3D85B 1R5WA 4R97C 4J4PA 3VXPA 1E4WH 4M5TA 2R0LL 1M9WA 1CUOA 1PY0A 1SOQA 4IRSD 3T65B 1EHLH 2WZPA 3TT3L 1CLZL 3OHXB 1CICB 4U7KA 4B9ZA 3V5DA 2P7TB 3QFJA 4PJ9D 5I24A 4Y2DC 5F1IB 5JXED 5JQ6H 3BIBX 3H2QA 3QI9B 3AS1A 1ZTXL 3W11D 3FT4A 3G5ZB 1S7WA 4JW3A 4ANKA 1YZZA 3I6SA 4ZQKB 2XICA 4OLYL 3MNWA 4I1PA 4MVBD 4LSSL 1RFDL 3LZOA 5D7JC 3ZQ9A 1IGFL 2YQBA 3QEQB 3WLBA 2DKUA 3R0MA 1GKOA 1B4TA 3F6JA 4ORGA 3F7QA 5BVPH 4FNQA 3UTTD 4DGWC 2DH3A 3A4DA 3ZR5A 1G9MC 2AQRA 2VQUA 3UPAA 4B9FA 2VQ4A 2VAJA 3UBGA 2VE6A 4LSTL 3U2IA 3TZVD 3WTUA 2W0FA 4OZIF 5EH1A 3H9SB 3RAJH 2OMYB 3HE6A 1YMMB 1BVLB 2HPOA 2NCEA 1E4HA 1PIGA 3QC6X 3QDMD 2XIIA 4I9WD 3T04D 1ORQA 2YFOA 1EDYA 5F71A 4C55A 3FN3A 1X5GA 1NPJA 3N42B 5IF0B 3RVVC 4B9IA 3HZMA 2NSXA 1ZXKA 4XP6L 4HH8A 2UV3A 1A4KB 3SGJA 3BGFC 5FB8A 2NNXA 3QHTC 5IHUL 1JGEA 1VHPA 3C5SA 2HJLB 4N25A 4QXUL 4M9OA 3X1NA 2OK0L 5G5DA 3RIFK 5GZOA 1T4KB 4J3XA 1UTDA 3KPRE 1J48A 3GXTA 4G6JH 5CD3B 4DT2A 3K6SB 4R4NC 1AD0A 4G9FE 3D09A 3P2BA 4MA1B 3QIUC 1G7IA 2DS4A 4UT9H 3MV7A 5GPRA 4ZDHA 3GSVB 5HDBB 4TSBL 1XT5A 2Q5BA 1O6VA 2ERJC 3WFZA 1PY9A 3B37A 3JWOL 2BDNH 5IMOB 2WZ0A 4YHYC 2NY0D 1C1EH 2VMDA 2G30A 4NZTL 4XO8A 2YGVA 3HS0C 3Q06A 4JBSA 2J6WA 1HS6A 5AVYB 1C5BL 3Q3GA 3QCVL 4U7SA 1EV2E 3H42H 5I6XC 3O2DH 2GTQA 3KW8A 3T0BA 1TIUA 3VX0A 1U8CA 1MI5E 1FL3A 2WTRA 1AKJB 4U1KA 1RIHL 1CU4H 4IOIA 3CQQA 5JIIA 4HXBL 2UY7B 2YA2A 1PAMA 3P4MA 3SDXB 4ANWA 1XXFC 3T0EB 4YHOL 1A9BB 4TUUA 2OYMA 2FBRA 4YDIL 2QADD 12E8H 4UILH 1I1AD 2WCSA 2HFGH 3B5TA 3PHOB 5HDQH 4AQ8C 1XF5A 3VG9B 5HYSA 5K9JL 4MAUL 2BY2A 2YQGA 5KVDE 3F05A 4YH6A 3CHOA 2WKOA 3CHXA 4G8GD 2CXGA 1NIBA 5LXGL 2GUOA 1FCCA 3H2WA 2Q86B 4HPOL 4HWBA 1EQWA 3F7VA 1V3LA 1UGKA 1BFSA 4PRAA 5EZIH 5A16B 1QBML 2ZKYA 2WC7A 3EJYC 2BIHA 4PJ5A 2CRMA 5F7WC 4PJCE 2HTKD 1EZVY 1KTBA 1H15B 1XL4A 4MWFA 2QVIA 4XGZA 5FUOL 3RX9A 4ACPA 3G08B 3AS2A 2WLIB 3QUYC 4QO1B 4JKMA 4C56D 4G1MB 2ZF8A 3OR6A 4AKOA 1OAKL 1GMIA 1I1YB 2VLKE 4AGMA 1JERA 5E1AA 1WRFA 1LQBC 3CFJA 4WWID 4IK6A 3L17A 3QEHA 3UEZA 2GJPA 4CVUA 5G55A 2PTVA 3JV4B 5E6IA 3UO1L 4UNTA 4DQOH 5CLWA 3FFCA 2BINA 3TBTB 4DKDC 4KI5E 1CF8L 3SY0A 4K7FA 5IJCC 2R0KL 3UP6A 2EXYD 1MCRA 2H3NB 4HU2A 5GJSH 4AKQA 2DDQH 1R3IH 5JLZB 2VDPB 4S11A 4MKMA 1D7CA 2CR3A 4OD1L 1OGPA 3HI1A 1URIA 4KTGA 3TC9A 2IV8A 3UG4A 3WY2A 4CSZA 5J6GA 3GLZA 4FN0A 4V1DB 5KVGE 4KU1A 4ISVB 1JTTA 4G6KH 4A7UA 5EZPA 3G5XB 3LZQA 1OGAE 2Z7UA 4AKPA 5TPWH 1FNLA 4KKBD 2WIMA 1BVKB 4JE4B 3LDBB 4H2AA 4G3YL 4NZDA 5A7EA 5GS3A 1JNNL 5FF6B 4Q9RL 4YDZA 5DJAB 2B1AL 3Q2LA 2O5XL 2E0PA 1JPFA 4KDTA 4QY8A 1TTBA 1U9KA 3OKMA 4Y0GA 2XT1B 1WA1X 1MCWM 5EN2B 1WCQA 1ZWIA 3RWFA 1NGPH 1IE5A 4L18A 2K3HA 2JB5H 4ZTPH 5F97E 3RWCB 5DQDH 1RUMH 1U91A 2FEJA 2IDUA 2JKXA 3QCUH 4UYQA 5INDB 3VD1A 1FF5A 1AGCA 1FNGB 3PAVA 4F8NA 5A6MA 25C8H 4IYKA 3SDAD 5HI5C 2Y6SD 3ALWA 5HGDA 2UZXB 1SDYA 2C1PA 4KK9C 4PWJA 4PJDE 4CSSA 2EDDA 2AXFB 4DK3A 2YS4A 3CFBB 3SO3B 2H45A 1UENA 4GBXC 3PNWA 2OMUB 1BX2B 2ZPKL 5G4NA 1R5IB 4ODXA 4HALA 4GNKB 1NAMB 3EDDA 4EIBA 3VH8B 2GAZA 3GIZH 2J5WA 4HXAL 4KJWC 1RSFA 3K46A 3PCYA 2W65B 3MRCA 4HPHA 4JKKA 2WZAA 1R47A 5LAXB 1Q1PA 3THMH 1Y18A 3GSUA 4Z7UE 5AW1B 4E42A 2OMZA 3PQYB 2BWQA 2NUPB 3A6CL 2BHFA 3HR5B 4IMKA 1RI8A 5GIRB 1DYZA 2VISA 1G1YA 3LIZA 3R1GL 3ARGA 5FO9B 3WFEH 1LO3H 4AIZA 3CMOH 4BZ2H 2C3XA 1HVXA 4B7LA 3SGKC 5J6HB 3S5ZA 2GJJA 1W72L 3DMMD 1T3FA 1LMKA 3WIHA 4LZKA 3P3RA 4F8OA 4HHAB 2OMTA 3DO3A 2ICEA 2JCCA 1NGWB 2EH8H 1J1PL 1E9PB 1QUNA 5LNEA 2ZKHL 3VFNB 3DXAB 3O8XB 5L4JA 3L3JA 3LZPA 2FHCA 4JFQB 2Z8WC 2NY2C 1J1XH 3B43A 1NMCB 1ZTXE 2W81C 3ML8A 4P2OB 3GUTB 3BP5A 3M1OA 1HX0A 1X5IA 3FQXB 3QISA 4PRIE 3HN3A 2VLRA 4WTZA 5ESVB 5DJ0B 1HOCA 5EU6B 3SDXF 2N4IA 5C0JB 5F6IB 3BKML 2YN5A 4N8CL 2H32H 4RDBA 5AW9B 3M6DA 4I3RL 4OLYH 1DJWA 4X4KA 4ES8A 1RFDH 4BDVA 4FTVD 4ATWA 1KENH 3AY4A 2LR4A 2P3YA 3OKOB 4L8CA 1KEGL 1GKEA 4GW1B 4KC3B 3STZA 2FJSA 3WJMA 3VYPA 1IC1A 1OF0A 4O02L 1YN7A 5D6CB 1FG2A 4TLUA 2APVA 4AIOA 35C8L 1J8HE 4N6RB 1PD1A 3DYPA 4DPAX 3T2PA 5F89B 5FGBC 1AQMA 1KACB 1QFWL 3IDMA 3V6FA 1E3FA 3B34A 1TZHA 3ILEA 3S2AA 2PYEB 3AG4B 3OKNB 3MLVL 3DVGB 1S5IH 2EH7H 5DRNA 4OZ4B 3SHSA 5EIIA 3FQRB 2QDVA 1IU1A 1SXZA 3N44F 4I0PD 4AENB 1JYXA 2WXOA 2FJHA 5C0GB 5IHUH 3NIGF 2BOLA 4X9IA 3OAUL 2YA1A 4CSTA 1Z9SB 5AVUB 2R2EB 1NDMA 1WZKA 5F3BB 3EJJX 4WI0B 3O3BB 3UAJD 5LN4A 3AWEA 3PUCA 3UGEA 1JK8A 1SFDA 4X9HA 1CFQB 2WVSA 2EECA 4FOMA 3U6RB 5LGHH 2WYHA 3T77B 1YPZB 4ZS6C 2ZWKA 2MNWA 5GS0L 4TSBH 5AOLA 1MFAH 1R3LB 4FEMA 4P2QE 3G6JA 5BUPA 3AADB 1P4BH 2L7JA 3JWOH 3LEXB 4ZMOA 3ARBA 4GUPB 5EOTA 2N0MA 4PTTA 1GS7A 3KYMB 5JW4M 2VKXA 5KYXB 4NZTH 4IGBC 1ZANL 5E4AA 2IANE 2XPZA 1LILA 2VAAB 3DTXA 1UACH 1J9QA 3HBQA 2O61A 3A23A 5KW9L 5D9SB 1C5BH 1A1NA 3T2QA 3AABA 3AUVA 1IB5A 2Y3NA 2XQYA 4DO5A 4OZHE 4MXQD 1SHMA 4H25B 3KPPA 4Q58C 1RHHB 2BNRA 2JK5B 2ZP0T 2VLKA 2WKOF 4HXBH 3LPFA 3OF6A 1HCZA 1IEAA 1K4DB 1PX3A 3CFUA 4OF0A 4PBXA 4YHOH 4BXSV 5BVJB 2Z4TA 1LEIB 4CSPA 1OAXL 4YDIH 4PCTA 2BK8A 1UT2A 1F4HA 3VWKB 4Z7WE 2Q8AH 2W1NA 1FZMA 2GCYB 2LE9A 5AZUA 5JQIB 2NSQA 2X1XR 3HMXL 3HW7A 1N0LB 3P9MA 3TGXA 2CM5A 2Y1VA 1HZHH 2G9KA 5I1LB 4JM2A 2FECL 1TYRA 2N59A 4GKNA 3NK3A 4NNXB 2DQJL 5KWYC 1XF2B 5FPIA 4X8CA 4PWEA 4ZFGH 3BWSA 1FO0L 2A9BA 1HEZA 2XZAH 4UQ3A 4ZX3A 5DJDA 3MXVH 4AIXA 1K8DA 4YSRA 4OJFH 3S35X 2CWRA 1DVQA 1A5FH 3LQMA 3PJSB 4I8DA 4RVBA 1IJNA 3TFKD 4QAWA 5IMMB 2A2QT 3IAQA 1OGAA 1DSFL 3GSRB 4FULA 1CD8A 2D7MA 4F9PC 1NL0L 1G6RA 4HJTA 4E41E 3EXJA 4LLYA 3FUDA 3HNVL 1FFNB 4BSWB 1P7BA 4K3HA 5LDSA 4BKLA 1CXKA 5F7YC 3Q7JA 4KVPA 3WNIA 4YXHH 1PKOA 3IAPA 3M46A 4PGCA 4N2HA 1PZSA 3PPEA 4BZ1A 5SWSD 1A6AA 5C6TH 1RZKC 2KKQA 3GSNL 4E68A 4LHUB 4BRVA 1MVUB 5CZKA 4CGTA 1E9QA 3B9KD 1KFAL 4L4JA 5IROA 5CGBA 3TL5A 1KJ3L 3CZJA 4Z5RB 3U46A 5L7XH 3TH2T 1T2QL 3EYUL 3MV9B 2VXSL 4PJDA 1FLTX 4MS6A 4YHIB 4YDKL 5GS1B 1ZK9A 2DIBA 2FX9L 5T1MA 1ZV2A 4ZRGA 1QSFB 4PHZA 3HKZA 2NUTB 4KX7A 2Q76B 4FCHA 4QRPE 4X6DB 2NW3A 3WMSA 1IGTA 1WWBX 2AV1A 5K93A 2HT2C 1LO0H 4KO6A 3V7MA 1EEYB 1YUKB 5ICZA 3KLSA 2D0HA 1A8ZA 4RGNB 2Q2LA 5CJXA 2B39A 3WNNA 1F56A 5HYJB 4XN1A 2C5DC 2D7TL 2JJTC 5AAMC 4JGMA 1DCLA 1NCCL 1XF4B 4QHMB 4QPEA 5ESQB 3QZNA 1W8OA 4M48H 4NBXB 4BFFA 1NLDL 3ENEA 2F54D 3BXNA 4XNBA 3NIFF 4MA7H 1J0IA 3H55A 2ADJA 3U4AA 3U36A 3BCDA 2C3HA 2WLZA 3QSKB 1XEDA 2EIKB 3DVNA 1BQLL 5J6SA 3WFHA 2NLJA 3HG3A 5AOIA 3GSXB 3CHRA 1SUJA 3VI3E 4F9LA 3FRUB 3HRZA 5EIQA 4QUOA 1KXVA 3QEUA 3NFNA 5EB9A 1BJ1H 1NCOA 5ISZD 4AC4A 2AJVL 5HJBA 3MDJA 4IIQB 2A74C 1BFVL 2I5YL 4CVXB 1BECA 3VFPB 2AQ1A 3W3BA 1U0QA 2JV6A 3WTXA 4UIMB 4S10A 3RWIB 4HOWA 1KY7A 4HXAH 4Z7VB 1J88A 4K7PL 4Y7OC 1F00I 4KVCL 4PRIA 1OCCB 2DYPB 2Z31D 3DO4A 3MRJB 2OSWA 1HILA 3FU3A 5EV7A 3MROB 4RLDA 2FUQA 4WV1C 4PWIA 4LL9A 2BOCB 4AM0A 4RZKA 1H5BB 5D6DA 4JHVA 5ALCH 4M8UA 3WFBH 1I9IH 3T2NH 2Y36H 4HJEA 3NFPB 3UO8B 5ANMB 1UM4H 2JCCF 3BFWA 1FE8L 4MCMA 1Z7JA 2QKIB 2AQTA 3Q9QA 4MNQD 4CRPA 1JDDA 4NQDB 5MERB 1E6OH 3KPMA 1B4RA 4W4OC 4CN4A 3L1OL 1T6WA 3P77B 4ZMLA 2F8IA 1THCA 3TPUB 3VSVA 3QR0A 2P49B 1T83C 5DTFB 1Z9LA 3M1CA 4OTXL 2VNCA 3KMDA 2R9HC 2VN4A 3CGTA 1GGUA 4AQEA 5DS2A 2VDRL 2E6PA 3T4YA 4E2OA 3L4VA 5JHAA 3DV4A 5D7HA 3V0AC 4MDRA 4JFYA 3VWJB 1I8KB 5T33L 3ZL4L 5CFHA 3H53A 3I9PA 1XR8A 3ABGA 1H6EA 2X40A 3NACL 1I7UB 1KPVA 5DVLA 4I3RH 4OW6A 3AM8C 4JREB 1D7BA 4P9HC 2Y2WA 3GSWA 5CLXA 3EF4A 5DJXA 3T6QC 1IKFH 3FUKA 3QZOA 1E7VA 4N90D 3VMOA 1PBYA 4NKMB 1R4XA 3EOBB 5BW7A 4EUPA 1WAPA 2CKBB 3QXVA 3S4SA 1T5XA 2H8PA 3LH2L 3QULB 3VFTA 3ZDXB 1RZIA 2DLIA 3CVBA 4P2QA 1S7SA 5D7LD 2KZ1B 4MJHA 4LRIA 1CK0H 1P4LB 2HWZH 3QJHA 4L8SC 2HX8A 3TT1H 4A2FA 2GY5A 2Z34A 2IANA 4ZFZA 3BSGA 2QV4A 3RUGE 1T21B 2AJYL 2NY3B 3MLVH 1TMQA 3KLAB 4MAZA 3CV5A 4JFSA 3ARXA 4KXDA 3WBDA 4Q9CA 3QUHA 3BP4B 3TCLB 1NC2B 4ICXA 5HD8D 1RULL 4OJEH 2OTPA 4Z9KB 1TMCB 1CE6A 4W6XB 2X4RA 4WW2B 4IW4C 4QIRA 4PR5A 3G6JF 4Y4FD 4MD0A 2M2DA 3UJJH 4Z8FH 3MX0A 3CUPB 3GEWB 4Z7WA 1AXIB 3OJDA 4NKIH 2YD5A 4X42A 4KAQL 3MRHA 2FLRT 2ZIDA 3NJIA 5CZXD 1KTKE 4UM9B 3ARDA 4JKPH 4Y2OB 5K1JA 3Q0HA 3DK2A 3WJLA 1CGWA 1OTUC 3C6LA 1CVSC 5INCB 5FGCE 5LCVL 2WXGA 1QI4A 3P9WB 1GOGA 1ZANH 2DEXX 4RMSA 3GB7B 1M56B 4YPGB 1G7LA 1FC2D 1WIUA 5KW9H 4P3WA 4G72B 4EOWH 1L6ZA 2RQ8A 1U2HA 1TQUA 4MCZA 2MFNA 5HPOA 5CZVH 3HS8A 4LP8A 1S7RA 4PIRF 1Y0LB 3KPLB 3VRLE 3CZLA 4JY4B 4E41A 1AC6A 4Z76B 1JV2A 4LSPH 2ZX7A 1INDL 1WBYA 4JM2F 2VZVA 5BZXA 3VH8G 1VGKB 4ZOEA 4ZUUB 5IQ9A 4P0DA 1VACA 1JF1A 1WF5A 3M88A 3KXFA 1AGDA 3CDCA 8FABA 1TQSA 3ME0B 2DJ4A 1AO7A 1P6WA 3HG2A 3PV6A 4F5CE 5I6NA 3C6SB 2ZOWA 5HXMA 3QWOB 1AOZA 4UDUB 1J9CT 3PWPB 5JPMB 4PD4K 3VE0B 3SBPA 1N59B 2AAAA 1BM7A 2DD8H 1FO0H 5D72H 2YLKA 1GYAA 1JK9A 3GI8L 1V10A 4AXWB 3IKCA 2ZSVB 4G11A 3X11B 4C83A 2YAMA 4LIQH 3MA9L 2V2TA 4FDWA 1DVSA 2DQEL 2FEEL 3UJTH 1OL0A 3DARA 5E08L 1WVZA 3IDXH 4NJAL 1G9EA 2X89D 3QDJD 1BFTA 2VDML 4NKDA 3SBQA 1QW8A 4AITA 2DJSA 2JJVA 1N5YL 4X6FB 4FQPA 4UNIA 2XJKA 1WC7B 4WFHE 4FYTA 1L6PA 4E9VA 4ZZFA 2X4QA 3CDGA 4OV5A 3HAEA 5KJRL 3RJOA 2KI6A 4PJDF 5I5IA 1NMAH 4MA3B 4GP8B 3MNZB 4P4RA 4TS6A 4HFUL 1XTLA 4P99A 2EDTA 1F02I 3MBEC 4OZFA 4XPAL 4NOBA 1EVUA 1A9EB 2FDBP 2VM3A 4YK4C 4F2MB 4JQIH 1KFAH 1LXMA 5E4EC 4N9OB 5BMFH 1BQHB 3L3OA 4YSQA 2CUMA 1T2QH 1JD9A 5E51A 5B1CA 3OKKA 1JTPA 1XB3A 2IPKB 4DPBX 3CFTA 3L4CA 3MTXA 1UWXK 1KBKA 5ETUA 5I8KL 5KVEH 4EBQH 1S46A 3MACH 3SPVA 4HKBA 3DGCR 4NENB 4HFWB 3FCTA 4PGBB 4H40A 3X3FL 3N41F 1K5NB 4FNRA 2QSCL 4LCCB 4OVVA 5EZLB 1F97A 1T04B 2D7TH 1ZT4B 1QVOA 1NCCH 4L5FH 5I1GL 4XTRC 5IQNA 3AGWA 4NM4L 1CFNA 1AZUA 1P69B 5I1JH 1NLDH 3UMTA 4QYOA 5FFOA 3ZE1B 2CBMA 3OG4B 3QG6B 4LMQE 2A4EA 1ZHBA 2NY4D 2MCPH 4TVPL 4Q2ZB 4URTB 1I7TB 5GRUL 2H4EA 3CSBA 1EAQA 4XN8A 1MIML 4YBQC 3ZZLA 1JZIA 4ZSOE 4D0BA 3FB8B 4JPIB 5IOPA 5C0IB 3V6ZB 1ASOA 4JO4H 5KYUB 3BMVA 3RWDB 3L45A 4XXDA 1QRNB 3IGLA 5HJGA 3BZ4B 1EJFA 4JCMA 4Z3TA 1R9FA 3QH3A 4EEEA 5FHBL 5JPNB 4GIPD 4GQPH 1IBGH 1J18A 3QIBD 2H9GA 3FSZA 2HFEA 4P57A 3JUYA 4QF1B 3MO1B 4WTZG 3N43B 1VFMA 3EBHA 3MA7A 3NIDE 3WN6A 1NCAL 4ZS7H 3OKDB 2OR7A 5T5NF 1OSEA 3QXTA 3WMQA 4G2AA 3HNSL 3P9LA 2VW7A 4GRLB 2BNQB 4U6HB 5SWQB 2XJLA 4HIHB 3H8NA 1IGCL 1E8WA 4PS8A 4XP9H 3UOAB 4MZ3A 3HPJB 5K1NA 1IQWH 4MX7A 4YLQT 4UT6L 2FBJL 2VMJA 2VZTA 2G75A 4IBQA 5D2LE 4AWJC 4YLCA 43C9B 4Y4KB 3MV8E 4GIOA 3UDWA 5I82A 2L7QA 2YXWA 1V05A 4I4WB 4YHKL 4OGXH