4Y2OB

Structure of cfa/i pili chaperone-major subunit complex (cfaa-cfab)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
142
structure length
142
Chain Sequence
MVHHHHHHVIDLLQADGNALPSAVKLAYSPASKTFESYRVMTQVHTNADAKKVIVKLADTPQATDVLNSTVQMPISVSWGGQVLSTTAKEFEAAALGYSASGVNGVSSSQELVISAAPKTAGTAPTAGNYSGVVSLVMTLGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CfA/I fimbrial subunit A (Colonization factor antigen subuni
publication title Off-pathway assembly of fimbria subunits is prevented by chaperone CfaA of CFA/I fimbriae from enterotoxigenic E. coli.
pubmed doi rcsb
source organism Escherichia coli o78:h11 (strain h10407 / etec)
molecule tags Structural protein
total genus 8
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2015-02-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2040 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4y2oB00
2HB0A 4HJIA 3F84A 3F83A 4Y2OB 4Y2NA 3F85A 4Y2LA 3VACA
chains in the Genus database with same CATH superfamily
2E9WA 1R33A 3ALWA 3EIFA 1XSOA 2ODHA 3QIBC 4WK4B 3HS0B 4HZLB 4IU3B 3V5DB 4DFIA 4AVIA 4E9XA 1JF5A 2GJPA 2FX7L 3FCTB 3KDMB 4TVPE 1P5VA 1DDHB 2IPKB 4GQPH 3HLAA 3S97C 2NY4B 4WUUD 3W11D 3T4AA 4FA6A 4D8PA 4PLNC 3TH4T 4LOVA 1H8LA 3QO0A 5JXED 4LEXL 2XHNA 3J8F7 4F5CE 3MLYL 1KGXA 1T5XB 5T1DH 1U4FA 1XCTA 4MSWA 1QX1A 1AHMA 4NWTL 3KHOA 3RIFF 4UV7L 2W60B 2FL5A 3MODH 1A6AA 1ADQH 1B0WA 4L4JA 5HPMB 3FQ2A 4OV5A 4NZUH 2GVYA 3KS0H 1CXKA 1FPTL 5KSAD 4UZGA 1HXYA 3QUYA 5B8CB 2WZ6A 4YN3A 2IF7A 3I9IA 4QXUH 4K73A 2IIJA 3FF8A 1QEXA 2FLBT 3Q5TA 4TQEL 4AL8H 1UENA 2I69A 4WTXA 5MEPB 5LDSA 1UWYA 4P5TA 4OIFA 2WCGA 1S3RA 3NIFF 3BQUA 1FG2B 2QGBA 3SIKA 2K6WA 3IF1B 2JLLA 3C6LB 2AK4D 5L9DL 4KHTH 2FLRT 1F4XH 4HF5H 3TBSB 1E7UA 3EFDL 5CJQH 3UCRA 2CDEA 5D7IE 1IKOP 3JZYA 2GHZA 2LU7A 5T5FA 2IQAB 5DUMH 4XWGL 4HOMA 4WU7B 1HXMB 3VB9A 5D1XD 5BVPH 1TU2B 1A14H 2AABL 2EKSA 3KLQA 4AQAA 3LZOA 2O61B 1G7QA 3TBWB 1KBWA 3TNNA 3O6ML 3VRLE 3L9RA 4WUUB 2AJSH 2ZIDA 4I4WA 5G5DB 4B9PA 3D5OF 4XC3H 4ZYKB 3QHFL 4XGZA 1ACCA 3ZTJG 1M53A 1SDAB 1T20A 4JG1H 5JORB 4WI0B 5CJXA 5C0EB 2F7RA 3TBVB 4DAGH 3MFGB 4Y5XC 4OJAA 2ESVE 1VHPA 5A2JH 3LQAL 3IGAA 1A6PA 4AE0A 1ZLDA 3ULUH 4QRRD 1HHJB 2YJLA 2FJFA 4NGHL 2B9BA 3CDFA 4LSSL 5HDBE 3FUKA 4JKKA 4E9QA 2CJTA 2J5LC 3LEVH 1M2VA 4GQ9H 3U2JA 3ZMNA 5A40E 4L5FH 3T6WA 4UTAH 4BZ1H 1HK6A 4NSKB 1YRKA 2JI2A 3GT6A 2KQMA 5IJKC 2ITFA 1MPAH 3MUGA 4NM8L 4BFFA 2DEXX 3OVUB 1NFIA 3K6SA 1OF0A 2B2XH 3BDYH 4H1LB 2CBQA 4N4YB 5L7XH 4GFTB 3P4NB 1KLFB 2YSSA 3NESA 1TZ8A 3WIIH 1ZD6A 2M26A 3M17A 1H3PL 4MHHG 3VFPA 3TBCA 4EVNA 4JAMA 2Y36H 3L4YA 5F89B 4ODUB 3C5SA 1QWHA 5BQ7B 2HSIA 2YQBA 3MV7D 1A4KB 3Q2CA 1B0GA 1EXGA 4LCYB 4LDOB 2P5WD 3D12B 4DKDC 3QQDB 5A7EA 4UQ3B 5KYWB 2QDVA 3LZFH 3NFNA 5HDQL 1HYRC 3V4PA 5FV2A 1CI5A 4HK0A 2OYPA 1UB5B 1SDDB 4OI9A 1QFWI 2WVVA 1VF5C 1N5YH 2A0LD 3QIBB 4ZW3A 5TK2A 3LHPL 1OL0A 3WXVL 2F5BL 1FQ9C 3GLZA 3VI3B 3KEHA 4Z7WF 1KLGA 1JZ4A 2LV4A 5HHVH 4FF9A 3O45B 5ICUA 1D5MB 1B0RB 2EE2A 1HTYA 3HIZA 3UGUA 1JZ2A 3QDJD 1WYJA 1RULH 2W07B 2PLTA 1R5VB 1ZPLA 3OKEB 4FFVD 4O5LH 5LJYH 4UOZA 3DV4B 3I84A 5FGBC 3T3ME 4ERSL 3KPPB 5FECA 1UASA 1VEMA 1AHWC 4ZFOA 1U8MA 7FABL 4MJ5A 5IESL 3MDJA 3WIHH 4N3UA 3FU0A 3O6FA 4B0MM 3IPBA 1EK3A 1MFMA 1BBDH 1WWBX 2GFBB 4IQHA 4X5LA 1DL7L 2B1HH 4WU5A 3VE0B 1QRND 3GINA 3QIWD 5SWZA 4NZRL 3QYNA 4HWBL 3QI9C 5IQNA 1AACA 3L3IB 4JKPL 1BAFH 4N0CC 3FTVA 1ZT7A 2QSTA 5GGRA 3MLWH 4A2HA 2X6VA 3CZEA 3ARBA 1QMUA 3ZDYE 5LGHL 3EH5B 2FBOJ 3ARSA 3QQ3A 2WBJC 3D9AL 1Z9PA 2BNRE 1CGTA 1I1YB 4JG9A 1UKTA 4KMLB 1H6FA 2CIKB 2BIHA 4JRXA 3SDYL 4H8WC 2J4WL 4HZAA 1FAIH 2FJSA 2OCFD 3Q6FA 5C70A 4K3EL 1B4JH 3NH7H 3DO7B 1ZDQA 2M1KA 1X5MA 3HB3C 4F7EB 5E8EA 4HS8H 4MCYA 4M5ZH 4PGCA 1E4WH 1TETL 2KZBA 5BOZG 3RZWA 3Q1SL 2DQIH 2EADA 4R8WL 1W91A 2XWZA 4JRWA 1ROCA 3ZYJA 3QUXA 4N8UA 5KN5A 3TEUA 3UTZB 4Y5XB 3KM2A 4URTB 1KJ2B 1ONQB 3RIAF 5I26A 3VXQA 4QKTA 2XVKA 3ABKB 4P2RB 3N6YA 4XNXL 4LSTH 3UJJH 2MOVA 5HYFA 3ATDA 2HRPH 2ARJQ 3JXAA 4LOUC 4LZKA 2EEXA 5I1LA 4GRMB 4NOBA 3HRZA 4XNAA 1Z3GL 1TYRA 5E08L 2J5LB 4QRAA 4DERA 4PRAB 1FFPA 1GYVA 2Y2YA 2ZE0A 3ZTNL 2X4TA 4P99A 2DIEA 4WWKA 4DESA 4AGOA 2XWTA 3G6JB 2OMYA 3CHXA 2PMZA 4WENB 5DD0H 1LP9B 3MNZA 1IKNC 3V5HB 1PZAA 2E74C 3SYCA 4FFZH 3HUJE 5I8EB 1RLBA 1SEQL 3D2TA 3NBNA 3UPCA 4GMTH 4D3CH 4DP9X 4HGKC 5JHLL 2WSDA 4QCIB 2OLDA 1Z9NA 1L9PA 4UYQA 2F1AA 5I1JL 4IMKA 2MMXA 1QLFB 1UM4H 4E5XA 1JZJA 5IHUH 1BQ5A 5FM8A 1UH3A 4PWFA 2QSVA 1KBGL 3TYFA 3DX3A 1IQWL 1ETZA 3T2NL 3WEBA 4C57C 1TITA 1RZ8B 2QBWA 4B96A 3KW8A 3N43B 4NLAA 1JZGA 3KD4A 3H3PL 4ODWA 4QYOB 1MFDH 1D2OA 1LL1A 1QSFA 2WBJD 2K1MA 4MMYB 3KGTA 4JFOA 5L2KD 4JDVA 2GIYA 2PXYC 4GO6B 4NRXB 4G8GD 5DK0B 1QBMH 1TT6A 3ARPA 2CBTA 4DTGL 3B2XA 4L8BB 1QWNA 3KPRE 4JFHE 2HTLC 1TKWA 4NIKB 5J6GB 5HGDB 4ETQB 1J7VR 2P43B 4EI5A 1KCUL 2EDDA 4EQ2A 1WHPA 2C9AA 4N26A 1BXVA 2ENJA 2R4RH 3LEYH 4GXUN 3MRKB 1UEMA 3RB5A 2Z7ZA 3S3DB 4HWZA 1OPOA 1KLUB 3MLSL 1RJZB 1Y0LB 3FO2A 4KHXH 5TE6L 3S3JA 5IF0A 2YN5A 1AHWB 3BWSA 4HUVB 1RHFA 3FN0H 4AIOA 4K3JL 1BPVA 5KBPA 3VGBA 4PJCE 1NCBL 3P2BA 4MQXD 1F8TL 3TJPA 3DVGB 1B0IA 2PYFA 3B2DC 4XN2A 4BRJA 1E9QA 3D39D 3B9KA 4UV4L 4MNQA 1UCTA 2A77H 3AG4B 4YZFE 3CSFA 4QTIL 1N2RA 3QI9B 4HIIB 4H8PA 4XN7A 2DB8A 3VM5A 4QGTA 1KENL 4W9JC 5HHXL 4FQ2L 4XPTH 1U8QA 5KVDL 4NENB 4XRCA 1KGJA 3O6KH 4JO8A 1QSED 4YHNA 3NA9L 4RWYH 4LPYA 5TGBB 4L1HA 1S7VB 3SCMD 6PCYA 3VW3H 3IVKB 3C6SA 2I25N 1U91B 2A1WL 4I88A 2CBPA 1KIQA 4JVWA 4F8PA 2WBJB 2FWOB 5MEQB 1VFBA 2ZCZA 2XZAH 2BSRB 3UGXA 3PRZA 4PJFE 4NO2A 3QFDB 3DTDA 3K4DA 1F90H 4V2BA 2KZ1B 4H4NA 3HB3B 3FSOA 3D3VD 1UXWB 5K59E 4KK8D 3GWJA 2WLYA 2DD8H 3KPOB 3T0ED 4M7KH 4I3SL 1UWEH 5HGAA 3RQ3A 4G80A 1DVFD 4DO6A 2EILB 4WTZA 4ZT1A 3HN3A 3PWVB 2W5PA 1HNGA 4Z5RB 5C0CA 2VDOH 1U8PB 5FUZL 1R3JB 4I5BB 5D7JD 5J9PA 2QPSA 2AI0L 3BEVA 1X9UA 5CLTA 2DTMH 5MEND 1HYSC 3BXNA 4OGYH 1WIUA 2WHVA 3M1OA 3OGCA 4G5AA 3PV6B 1XZ0A 5E9NA 3WY4A 4B50A 5AL0A 3GMLB 2J7LA 2DLHA 2DQEL 4JNXA 4ZMWA 1YEIL 2DQHL 1P2CA 1N67A 1FNEB 5DMGD 4A6YL 4FNLL 2ZYHA 3PL6C 2HTLD 1G7HA 4ZPTA 2XG5A 2YPLD 3ETBJ 5LBSH 1TTFA 5J6HB 4KC3B 2C3VA 2X1XR 3DNKA 4JVUA 1OT2A 4JW3A 4M56A 2MPAL 4YDLC 2MCPL 4F91B 1QSEB 1E9OB 4JN2B 3RJQB 3VGGA 4AK1A 4BM7A 5DQJA 4E5XG 2XYCA 2F08A 3HNSH 4JO2L 5EUOB 3UTTB 1A3QA 4DN3L 4CNIB 3CLFH 4KK6D 3MX0B 4D0DA 4K07A 1DVYA 4HIHA 3NCEB 5JA8B 2HKFH 3ARGD 1EAPB 5AB0A 1JGVL 4YE0A 4K4KA 3EJYC 1E8XA 2F54D 3C9NA 1KIUA 1A6TB 3TT3H 2Y1VA 5GJSL 3D85A 3P73B 4MDJA 1P4LA 4H2CA 4AQ1C 5T1JA 3JVFC 1UACL 1GR7A 3DYMA 1M6OA 2HUEA 2IV8A 3HBGA 3QCVH 4FLRA 4U33A 2KMWA 2QPFA 3W5MA 4BGLA 1WBYA 4L9LA 3JSSA 3MRQA 1Q1JH 4N2LA 4QOKD 5HDRA 4EN2A 4F2MA 5J57B 4PJGA 1MRDH 3SE8L 2CXGA 2NY3C 2FHCA 1NMBL 1MI5E 5JIHA 4ZUVA 4AV4A 4X9GA 2FIKA 3EO9L 1MFAH 2H45A 2ZP9A 1OCRB 4R7XA 4EDWH 4P59H 5HY9B 1DBAH 4Z95L 2PXYB 4M9OA 4OZGF 5SWSB 1HJCA 1P7QD 4YXHH 4Z7OB 1LK3L 4P23C 5IVXE 4Y4FA 4PJHB 4EN3C 5B7FA 3CDZB 3HW7A 1QA9B 4WW2C 3POHA 3DBSA 3GI8H 5TTRA 1XTLA 1KELL 5C2BL 4UAOC 2BRRH 3U46B 1IKFL 4EIGB 4C59B 1BQSA 3D0LB 5FA3A 3DJZA 4DPBX 4UOW1 2VR7A 2IANA 5CILL 4UM8A 3SKMB 4EMZA 4OZIB 5KVGH 4OQTA 2JK5A 3GO1H 3NABL 4DGYL 1BZ7B 4AT6B 4DEUA 2K4WA 3P3YA 4K8RD 2F54B 3RY5A 4P2AA 3ZIYA 3N9GH 2OYLA 1FIGL 5I1IL 3WEOA 2R0KL 3JTSA 2WNKA 1PDKB 4FXGC 4RGMC 3TEWA 3RKDC 1PS3A 2B4CC 4CA4A 3GNMH 3GXNA 3SQRA 5AG8A 2KLRA 4JX0A 4K3DH 2YKLH 2XFXB 5EBMA 1CLZH 3HC0A 2P8MB 3BN9D 4FQQB 5HGBB 1RJYB 5F9AC 4BCZA 3RL1B 3MCLH 4R7VA 5DUJA 2NOYA 4GPVA 1CE6A 1NGPH 3LKRA 1Z1WA 5IJDC 1RIHL 5D8JL 3VFWA 1S7SA 2NY1D 1YNTF 4FEMA 5TE7H 2Q76B 1CCZA 2XZCH 3JV0A 1M7XA 1NCDH 3WY3A 1QACA 4H20H 2YD3A 3UBFA 2YAEA 3MRJB 2W9DL 3JZ7A 4OZHA 1XT5A 1XMWA 3NFPB 1BVKB 3WUWG 3LPFA 3O41A 3WEMA 3S36L 1DZBA 2LAAA 4ONGL 1WFOA 4MDRA 5C2UB 5FOBA 2WXIA 3PQYA 2Q87A 4OUUA 1JF1B 3SPIA 1U3HA 5C0BA 1AOHA 4D94A 3MNMA 3SDXE 4ZUSA 4XPHH 3RL2B 4TUKL 1BEYH 1T1WB 2W9EH 1MY5A 3WE1A 4DVBB 3BPOC 5AKRA 4YLCA 1I9RH 3DRTB 4G11A 4PJ8C 3UXFA 4LPVA 1OGAD 4WFFD 4FTVE 5IM7B 3ETBF 2J88L 3OSVA 3WUZA 3VYOA 5TQ0L 4ORGA 5GS3A 3LXUX 2HJKB 3E80A 4OCWH 1JPFB 4C4UA 1M9WA 3V4VA 5KUKA 3TWCH 2OR9H 3MRCB 4GB9A 4DGIL 2JKNA 1CDCA 3C8KB 2G0KA 3U9PL 2ZOUA 1IFRA 3PGFH 3PL6B 1PSKH 4I3GA 5EIIA 4KAQH 2D9CA 4D9LH 2WV3A 5EZOH 5GHWL 4PB9L 2QGCA 1G7MB 4XBEH 4LSQL 4LLYA 4YDLB 1JTOA 1A66A 1PBYA 3VD1A 2PN5A 3RVTD 1Y7VA 3AU1B 4NQCD 5CLXA 5ADPL 5I6XC 4MA7H 1BD2A 3VXOA 3VWKC 2I07B 5HJGA 2W95A 4UU9B 1EA9C 3LS4H 1AD0A 4JR9L 3GTNA 3ARFD 3MRIB 3DI3B 4GRLA 3QK0A 1EBPA 5K69A 2QKIB 3CFJA 5HHNB 6FABH 1TQVA 4PJ7A 5EZLA 3UJIL 1UT9A 4JANA 2H0JA 5I5RA 4QAWA 4Y5VA 4Z7NB 1CFSA 4UQDA 2OSWA 1DVUA 4AQ1B 3WGVB 5EFIB 3N04A 1HWWA 1WCBB 4UDUB 5EMYA 3O3EB 2BNUA 1HIMH 3LZLA 4JZOB 5KVMC 4PJBE 1ACXA 1XF1A 4BH8A 1CF8L 3T6ZA 2JIXB 2H5UA 5E5RB 4BK4A 1R3KB 4ZXBA 4PJDB 5D1ZI 1GPOH 2JCCB 2Z93B 3GSXB 3ROOB 1CS6A 2AJZB 3VYPA 2NY3B 2VERA 2LU5A 2RMNA 3V0WH 1A8JH 1T7XA 1A9EA 1IT9L 3L5WB 4ZX5A 1DE4B 3HE7D 2NYZA 4JE0A 2W1NA 1AO7A 4P23B 3G9VA 4EN3B 3TFKD 1KY6A 1IGTB 4WW2B 4XBGA 5ELIA 1TNMA 3SGKA 3I3DA 5KJ4A 1EPFA 1NOFA 4LVEA 3IJ8A 2ISDA 1JNNH 4UAOB 1Q8MA 5AOLA 1JD7A 2D31B 4NQCB 4G7VL 2JB6A 3U79A 2E56A 3HR5A 3NSYA 4UWQB 1S9WA 1MAKA 5FLUA 2ZNWA 3VD5A 2IAAC 1T66D 4QIRA 3GLEA 4D9RE 3V6FB 3PGDB 1EAJA 1QLEL 2ORBL 1SEBB 1JGEB 4LOFA 4WWOA 5HYQA 3MODL 3CVIH 3MI6A 1ADQL 3VFRB 5J1AB 4NZUL 3KH3A 4RGMB 4N5EC 4FXGB 3LMJL 3MRDA 2ERJC 4C4BA 4KY1H 1NEZA 3GXTA 4QXUL 2VAAA 3AXHA 4AXWB 3KXFA 5DVMA 2P8PB 2CLRB 1BP3B 3KPQB 4AL8L 3ECQA 2VXQA 2CGZA 2EUVA 1FNGB 3QUMH 1OF2A 3HZVB 4IRSC 1HHKA 4APXA 3TJEH 4G9DB 5FA4A 1OE1A 1TTUA 3HI1B 4FYTA 4UM9D 5F7EH 1F4XL 2NNAA 5ICYA 2UZXB 3B5GA 4NFDA 5CJQL 2WCPA 4XVSH 2FDBP 3HKZA 4BINA 1I8IA 2AXGB 3U6XS 1KMGA 2QADC 1QNIA 1G5AA 3P2DA 3AW5A 4IGBA 1A14L 2KC0A 4UT6A 1Z9LA 4BBWA 1AQKH 2FRGP 1CK0H 5E4EC 2AXHA 5F9JB 2PETA 3MA9H 4Z7UB 1A7PH 4CADB 4MJ6B 2Q9OA 3DRQA 4U1IB 5GZNC 2BDNH 5EB9A 3TBTA 4Y9BA 2AJSL 3TO2A 1OARL 5EOCJ 4W9HC 2IQ9L 4OVVA 4XC3L 4JY4B 3T0VA 3FUIA 1S7WB 4UILH 5CEZH 4MNGE 5CCKH 4JG1L 3BPOB 2Z35A 1JSYA 4PJ8B 1SOSA 3MJ7B 4DAGL 4NEHB 1JE6A 3NJFA 1OTTD 1UXSB 4EQ3A 4U6VH 4ZO8A 3ULUL 2J6EA 4I87A 4U3SA 2COVD 3G5VA 1X44A 5E95B 1E4HA 3R19A 5SWQB 2A9CA 3MCKA 2HRGA 1BAWA 4JPVL 2EH7H 2HYMA 1UFUA 4XNQB 4N68A 3U25A 3IJEB 3NCWA 5KVDE 1THCA 4NI6A 2KH2B 3AQDA 5AVXB 1MDTA 2QQQA 3U7YL 4FFYL 1RUQL 3FU7B 1HNFA 2RQEA 1J1OH 3IDJB 3APMA 4IS6B 5EEUA 2RBLA 2XKNA 1WA1X 3HAEA 4K9JA 4DJMA 5D7IA 2F2HA 4XP9L 5I6XB 5EC2B 2A73A 2ZPKL 3VXMD 3K5RA 4PJ9C 1TZGH 3BDYL 5L7XL 1ICTA 1M05B 2QQKH 3IK2A 2CDFB 5GQBA 3RAJH 3WIIL 4KZCA 4CC4C 4MKMA 1WAPA 1MKFA 1I8AA 1Q9LA 5D7SL 5I17B 2APTA 3K72A 3KBHE 1J9SA 1U3YA 4WCYH 5FR3A 2YUWA 1W8NA 5KJ7E 2H3XC 4FLQA 1F3DJ 5HYSG 1O7DC 3EJPA 3B1TA 3DVFA 2VKWA 2EE9A 4KDTC 5LAPA 3MRNA 3X1BA 1WD9A 3RUGF 4HEME 4OF8A 3ZUNC 1YHPA 4PP2A 4MYPA 5HHPA 3ZDZF 4Y88A 4HWUA 4PIBA 3CQPA 4NNYA 1CZ8H 4ZO9A 4KI1A 3D25A 5IMOB 3UFIA 2W0PA 3B5HA 5A7BA 5JDSA 3WTXA 4ANWA 2OZ4H 3TLRA 4M6OH 1N5YL 3EJQA 1S8DB 2ITCA 2QADD 4LCCC 3SDAD 3W0WB 1II4E 1NA8A 4JHWH 3OL2A 1GJWA 1HKLL 5FO7B 2OXGA 4OIAA 4BFOA 3K4AA 4GSDH 2HPOA 5EU7C 1A9BA 1G7IB 2HKAA 4NDMA 4ODTL 4R7LA 4PTTB 4WZ9A 5IWLC 3V9EA 1RULL 2PPCA 2R56L 2B0SH 3CXFA 4WGKA 4ZMOA 3MV11 4LAQH 3WNOA 4O5LL 4J4PC 5H37A 3BAYA 1IEBB 1YN7B 2E6JA 3WNNA 4E36A 3WIHL 1AGDB 2LW3A 1BWWA 4B97A 5ACLA 2BW5A 1I3RB 4BHUI 4ONFH 1BBDL 2B1HL 5FS5A 8FABB 4FE9A 1U58A 1MH5A 2H0FA 1S46A 2BOBB 2Q7NA 3RZCD 2ERJB 5B1JA 2AF2A 4NN5C 1GC1C 1NICA 3CQQA 3MNWB 3VI3E 3ZDWA 2BVEA 1R4XA 4PS8A 1GY1A 3FO0H 1QO3A 2Z4QB 1BAFL 4Y16D 5HHMB 5KYUB 1B2WH 4MMXA 1IUZA 4EIUA 4IRSB 3BEWA 1MHPL 3EUDA 1Q94B 3ESPA 5D96C 5JNYB 3I85A 2X1WL 2VUYA 4A7SA 2EDQA 2GJJA 3A6OA 3NIGF 3PJLA 2DI8A 5DZOA 3KL0A 3QUGA 4DO5A 3DOSB 4NPYB 4ELKB 3DTXA 1FH2A 2JCWA 1QBLH 2QADB 5C0JA 2YRBA 5I2IA 1USZA 3MC0A 1OP3H 2NY2D 2Z6FA 4PCKA 3UX9B 2FGWL 2DAVA 3MV8B 1S5HA 4ODBD 5E4EB 5IEKA 2XKUA 3GBDA 2YAFA 4GSUA 5F7UA 1KV3A 4HS8L 1TIUA 3BW9A 4KI5C 3RWJB 1E30A 4ODSH 3BRDA 2PPDA 1E4WL 5DJ6B 3AT0A 2GTZB 4OLVL 2ZXGA 3ZE1E 4HPYH 4AUUA 3VD9A 2BPBA 2WLLA 3PWNA 5E8DH 5ECJE 2DQIL 1Q9WA 3MRMB 2HLEB 2H2PC 3S5LB 5CN1A 1SLXA 3WIAA 2JTYA 2MHAB 3JV4A 5D6DA 3FSZA 5C0DA 3UC2A 1OD9A 1CGWA 3GS4A 4JFVA 4DGUA 4KJQC 4LSTL 3NZHH 4JG5A 1AGCA 3UJJL 4Z78B 3TIDB 4Z7IA 5D2NC 2WUCH 2SEBB 2VMCA 4X5WA 4GAGL 1NLBL 2R23A 2TAAA 2IPUG 3KLHC 1F13A 2Q7AA 4MQ7A 1P4UA 4XXDA 3LV3B 3SOBL 2I9TA 5J8OA 2OTUB 3ELQA 1XEUA 4QMEA 2EYSA 5HHQB 5IW6A 1SYVB 2FYYB 2HLFC 3G5YB 4QJ5B 2C9UA 4PWHA 3WY1A 1KGCE 4E41B 5HYJD 5DD0L 2XXFA 2JJSA 2BNRA 1BF2A 3OTTA 4P3DA 3QO1B 1HVXA 4PJ9B 4FFZL 1H3GA 4HSCX 4PS7A 1PKQE 1SJEB 1JMZA 1JWUA 4C8XA 1HEHC 4GMTL 5GS2D 5E6RB 1G0DA 4P2RE 5DFAA 5AVUB 3COOA 4MHHI 4ZI8A 4BRVA 4AITA 5DHMC 4PU2A 3NZ8B 1G6RB 2P80A 1QHPA 1SN0A 2BFVH 1UM4L 4NJAL 4DQAA 1AZRA 4NNXA 5IHUL 5ESQA 4C83A 4EIBA 3QAQA 4JPIA 5GGVL 3KLAA 4NQDD 4P5RA 1T2JA 4XCNB 5GRXG 3Q05A 2Q1EA 3S48A 1CLYH 1FL5A 5KJRL 1GOGA 3ECVA 4QT5A 2WSKA 4ZAKC 2ZOLB 3BSZA 2R2HA 5T1LB 2ZWYA 3RWDB 5I19H 3LN5B 3QZWB 4V11A 1FA4A 3IRPX 2YLHA 1E5UI 2XWJB 4N0UE 4GQZA 4X4KA 4LCCB 5J0BA 4L37B 5H94B 4JQXA 2ZSWA 1QBML 4ODHL 3WIFB 3FO9A 3KYAA 2XYBA 2WIMA 1IBZA 2WTRA 1WIPA 4PG2C 3TO4A 2FR4A 5AVQB 2OXHB 1WBXA 4KROD 3LDBC 1UZ8A 2DW5A 4KI5D 3SJVE 3UIYA 2R4RL 4YHZL 3B83A 4XXWC 1HHIB 2VLLA 5FX3A 1LEIB 2NY6D 3MRFA 3B37A 5HSFA 2G9KA 1FC2D 1LK2A 1H15B 4HKBA 1UB6B 1BVZA 5IVZB 2YGVA 3SDCD 2NW2A 5I16A 1LDPH 3FBQA 1M3IA 3JT0A 4PJAB 5GS0H 2AEIT 3C8HA 3BAEH 4AQ8A 2A77L 3L1OL 2R1YA 3OBAA 4NN5B 5HHOB 5I75C 2A6KA 3WS3B 2VLKD 3KLHD 3V7AG 4F9PA 4ORZC 2V5YA 2ZOKB 4KX8A 5IK3B 3O3DA 1YEEL 4GKSA 6CGTA 2Z65C 4YUEH 2NR6D 4RWYL 3TBYA 3MV9D 5D96B 3DJ9A 4TNWK 1T22A 1WISA 3OV6A 3QVAA 1ULVA 3FC8A 5LQBL 2VE6A 2EUXA 3EOYG 2H6PB 1KFAH 4DN4L 3LKQB 3AABA 1K2DA 5HVWA 3GMPB 3OKYA 4TUJB 4MB1A 1F90L 5IBLD 3PHQB 1IC4H 2B1AH 3LH2H 3JWDC 4PRPD 4R4ND 3W5NA 3IDMA 3IJHB 5DJCB 1O7SA 2GY7B 3ISYA 3T3PF 2DM2A 1Y07A 2DD8L 3OZKA 4M7KL 5AW8B 5IB4A 1QRKA 5CZVH 3FPXA 4JM2C 3LNGA 1TJIL 4M1DL 2O5XH 4GRWB 1I9JH 3WY2A 4HAGA 3KYMA 1U8LB 3U0WL 5ISZB 3P4OA 2D3NA 4PJCA 4YQXL 3LKSB 4Z0BH 3Q06A 2VDOL 4GW1A 1A64A 3DX0A 1QVOB 5INDB 3EYOB 2DTML 1EJ6A 5DT1L 3QDGD 1CTOA 3RWIA 4OGYL 1W15A 2IAMA 2FE0A 3BDXA 4EJ1C 5CLZA 3BP7A 2J1XA 5D2NB 5CF3A 3DXAA 4NQEB 1TZIB 2ZX9A 4KNTA 5J1TC 3QUZD 3GPEA 4WHYH 2NNCA 3RWGB 2XWEA 4WGVB 2XA8H 3RWEA 5DDHB 5DMIH 5LBSL 1MVUB 2X6AA 4IIZA 3X2QB 4RETB 5K9KB 5FUOH 2X4SB 3UO1H 5LXGH 1GRWA 3S3SA 4XN5A 5DJDA 5EU4A 5ENWA 1GZQA 2IWKA 3MV9B 4F93B 5KSVB 3PHOA 3GEWB 4X6EB 2JKTM 3N50A 1TTCA 1FO0B 4Q0XL 4O9HL 3MPCA 3VXRA 4AM0A 5AW9B 4PJFA 4TM9A 1KJ3H 2Z91B 4JE4B 3IDIA 4L4VB 4QLRA 1W80A 1A6ZA 1OGPA 5EIQA 4BCXA 3H7LA 1FFOB 4D8OA 2HKFL 2ZWNA 1B4RA 3S0PA 1JRHL 4ZMTA 5LGJB 3TT3L 5IJBC 4HKZB 1BF5A 2X6CA 1WT5C 2D9QB 4ANKA 4GG6B 3DMMA 1FVDB 3FZUC 3L1FA 2ILLA 3QCVL 3VXUA 2F58H 4K2UL 2G2RB 3WEXB 3FFDB 1Q1JL 5GSVB 1T1XA 1A65A 4M8QA 5IUSA 4IOIB 1MRDL 3TBBA 3VVWA 2ZJSH 3ULUE 1S7UB 4TNVK 2JFCA 5EUOE 3UTTE 4ZAKB 2WQ8A 3FUFA 3TU6A 2B77A 1MCOH 1F2XK 1MFAL 1V55B 1SVZA 3F6LA 1KN4H 1XD0A 1KCSH 3DK0A 4EDWL 4HOWA 1MIML 1DBAL 5AUMA 1T7WA 4N6QA 1Q9OA 4YXHL 4L5FE 5DHYB 4KRPC 1Z6JT 3IS1X 1F4WH 3NIDF 5IHBA 1MRCH 1SRDA 5I5JA 3LDBB 4NRYA 5HDOA 1J8KA 3JWOC 2BRRL 3CIAA 3U4BH 1JN6A 1G4RA 1SXAA 1FH5L 1S2EA 4GW5A 4DKAA 1EFXD 4XE5B 4ANUA 4LSDA 1A3ZA 3HFFA 3GMOA 4PUBH 2ADGB 3GXPA 2EDJA 3NRFA 5KSUB 3GO1L 4K0OA 3UZQA 3B7SA 1A1NB 2EIZA 4LHQB 4LIQH 4Z7OE 4L4TB 2FQEA 1IBFA 3GNML 1U3JA 4XNUH 5I75B 2EH8H 2V2WA 4PJHE 3VFNB 2R0WH 2WXQA 1G1CA 5D5MB 1CLZL 3CZGA 3F64A 3MCLL 4PWEA 3O2DH 1U33A 1XF3B 1H9VA 3AWFA 4RBPH 1NGPL 2CIIA 1WLHA 3EG9B 1NC4A 2XZCL 4JFFE 1NCDL 2JWYA 4HH9B 3K6IA 4H20L 1NINA 1XGQB 3T0XA 5EWIH 1HXKA 1N0XH 3BT2H 5D4JA 4WTQA 5IVXA 2WWOA 3H56A 4PTUA 4OU3A 1XDTT 2FZ3A 3GC3A 3NSDA 1NGYA 3W9DA 2OM5A 5FCUH 4BSWB 3A6BH 5DRWA 3JV5A 1I7RA 3NK3A 3WNJA 4NYLA 5HD8C 5CSBA 3VH8B 2GBUA 5F3BA 1I8LC 3TA3D 1WITA 1U9KA 4O00A 4H8HA 4AJ0A 4Z7QB 4JM2B 1Z5LB 1ZT1B 1KPVB 4DQOL 2W9EL 5I18H 5FK9A 4ZFZB 5DZAA 3CVHL 1I9RL 3TC9A 1AY1L 3RB7A 4ZMLA 2AEQH 1E50A 4RIRA 2ZUTA 4L3EA 2OL3H 1F00I 3AB0C 3CSYA 3MLTB 4YDVB 5FFGA 4OCWL 3RIKA 1X4XA 2XN9B 3CCHB 1ORQA 2OR9L 3TWCL 2I7SA 1ZJBA 2A6JB 1KCKA 1H0DA 4CVZB 3E6HB 3PGFL 1IQDA 1PSKL 1EGJA 3B9AA 4KAQL 4D9LL 5EZOL 4FQLH 4DIXA 4GBXA 4S2SA 4R4BB 3CHOA 2WXHA 1CE1H 3QP3A 1E6JH 3VFSB 3LS5H 4YE4H 3LIZL 3U4EB 1X9RA 1E8YA 3E3QE 1KTJA 3D30A 3WHE0 4ZX4A 3MZTA 3LS4L 5JW5A 3L5HA 4CDHA 1WIOA 4UYPA 3OGOE 5H35B 1PZ5B 2ATKA 2ZP0T 1BQHB 3PAVA 5HJ3B 4H8VA 4V33A 4DOHB 1ZE3C 1UURA 4BA0A 1JYWA 1DBKH 3O4LD 3ULAB 4RWHA 1A6WH 3SDXA 2CALA 1I3GH 1YG9A 2BWDA 3FB6A 4AYFB 4QTHB 2G9HB 3CK0H 3KWUA 2NQ3A 1R5IB 2ARJB 2P47B 1HIML 2FJUB 4KXZH 1RK1A 2DMBA 4GQRA 4OF5A 5E5MA 5KBLA 1J88A 2K70A 4X80H 2DMCA 1UUSA 4YXLH 4RZCB 1HH6B 4G8EA 3CVBA 4NCC1 3U2IA 1UGKA 3EYQC 2JSFA 5E9AA 4PS4L 1IAMA 2L04A 1S3KL 4UZUA 3HI6H 4U6TA 3B2PA 5E1QA 4TLUA 1AGBB 1MWAH 4YGAB 5DI8A 3CGTA 3ABLB 3SY6A 2R2EA 1AZCA 1UXMA 5JZ7D 4Z6AT 1FE8L 4NC0B 4NPKA 4KRPB 1S7QA 5E94B 5I66B 2GCYB 4MGXA 1WA0X 3IWVA 2VMDA 2IO5A 5BUPA 5C9JB 3NACH 1HSAB 2FWLB 3VCLB 1HQRB 4EUPA 3D0VB 5EO9B 4MKTA 5I1HH 5DJ8B 4JKNA 4CGUB 1V8HA 3BVWA 2EE6A 2YBRB 3P2TA 1I7UA 1SXNA 4AEIH 4UQBA 2VR5A 2NY0D 1MHCB 4LP5A 4M7LT 1F45A 2JCCE 5AEAA 1R3HA 1SHMA 2FBJL 5KWYC 1UD3A 2BERA 4P46A 4BELD 1DO6A 1H8NA 4OH2A 1ACZA 3O3UN 3GGWB 4MB4A 4WY7H 4WVRA 2SODB 2JKWA 3L3DA 3UAJA 4W68A 4I3RH 1R3LA 3QPQC 3ZIMA 3CVIL 2AZAA 1W72A 1VKXB 3FRPA 4KUCF 1BFVH 1LO5A 3IPFA 3QPXL 2GI7A 4AMXA 4GT7A 4KY1L 3MLVL 3O8XC 5FYLH 4OLXH 2QFPA 4PM1A 3MJGX 15C8H 1JZDC 1NGXB 4XCCL 2JJWA 3QUML 5F1IA 3CPLA 3EGSA 5DF0A 5D1QC 1MHHA 2EDHA 3GXMA 3O3AA 5DS8B 3IMVA 2I5YH 3WN5A 5F7EL 4BFKA 2VAJA 1UKSA 2K3TA 3C75A 2WB1A 4IRJC 4XVSL 4TLKA 3FFCD 4NO5A 2A83A 3PJSB 3GSNA 2YOCA 5E0FA 3T09A 1TQBC 3L4WA 4LMQE 1AQKL 4PP1D 5CJOH 1IILE 1QLRA 1CK0L 4FHBD 5LGYA 3TVMC 1OP9A 2XACC 3MA9L 3ZL1A 3ZOAA 1A7PL 3FH7A 1E28A 3AFLA 5BRZB 3BKYL 2BDNL 4ALAC 4CKQA 5CR1A 2D7QA 5F7DA 3LKNB 4UILL 1CGSH 5CEZL 1U8KA 2UZYA 4KKCD 5CCKL 2F5AH 4MA3B 3KWVA 4ANXA 4HGWB 5EU6A 3WNIA 4U3XA 5EO0B 2XJKA 4QAMB 5F97E 2IDCA 3UBGA 2Q0ZX 2PR4H 3D08A 3QZPA 1DEEA 4U6VL 4LAJH 2YWZA 2C9VA 2AEOA 4YR6B 5ES4B 3HS0A 4JRYB 4HZLA 4K5LA 3BFQG 4B9CA 2A74C 4G83A 4IU3A 1FYHB 3V5DA 2EH7L 5TF1H 1N5AB 3FCTA 2WAHA 3KDMA 1L9RA 3BGMB 1DDHA 2IPKA 4JREC 4TUUA 1PEWA 1O5PA 4DSYA 4Z7UE 5LLIC 3RNKB 2ENSA 5KSBB 3OKMB 3A21A 3JUZA 5I6OA 3OJVC 1J1OL 4AC2A 1A7BA 2LE9A 1UFGA 4TLTA 1T5XA 3MLXH 2JE8A 2ZX7A 5GZOA 1NFKA 3I74A 3CFNA 5T5FH 5KEZA 2W60A 1TZGL 4X8GA 3AVEA 4IRZL 4AG4H 3GMMB 2AJYL 2V5SA 3DX4A 5HPMA 2FD6H 2JMRA 3RAJL 3V0EA 1EUTA 2QTVA 4KRMB 4CL7A 1BZ8A 4HKJB 1H3XA 5B8CA 1U2YA 3MN8A 1DUYB 1TQTA 2KUTA 1Z3RA 2VUOA 4WCYL 4HWEH 5L8KB 2VDQL 5MEPA 2BC4B 1BX2B 3CN0A 4I9WD 1WAAE 2C3XA 1KYUA 1FG2A 5AAMC 4RNRB 3IF1A 4AVHA 3VDBA 1N12A 3C6LA 1YEHL 4TNVF 1YUHB 1J5DA 4FN0A 5I8KH 3ZR5A 2QSQA 4UQ9A 1CQYA 2GK0B 3IBEA 3TBSA 1KBKA 3ARVA 4FHKA 2AXFB 2EDMA 1MJ7L 2IQAA 1Z9MA 4U3CA 4WU7A 1HXMA 2NUTB 4U0QB 2J20A 3B4NA 1TU2A 2I9LB 5B7EA 3FB8B 3H3BC 5AKSA 4NO3B 4K7PH 1CLCA 3IFLH 2O61A 5C3LD 3TBWA 4NQQA 2DLIA 3C60D 4XWOC 4AK2A 4N20A 4WUUA 5G5DA 1LGVA 2NX5B 1V05A 3MRHB 3E8UH 2C4XA 2GITB 4TSAL 4GSDL 1MAJA 2PO6D 5E9DE 4DUVA 1MFBH 2Z34A 1ZGLM 5JORA 5EZJB 3BAJA 4WI0A 2JTDA 5MERB 5C0EA 2B0SL 4IJ3C 3TBVA 1UG9A 3CN4A 4LAQL 3CFIC 4K7PY 1P4IL 1L7IL 5CEYB 2YFOA 1HHJA 1VEPA 4YSUA 3P1VA 4QHPA 5ITFB 4APQC 4NKDB 2FJHB 2VN4A 1KCWA 1L0QA 4ONFL 4UIKH 5DS1A 3P3RA 4JDZB 43C9B 3H9ZA 4AQOA 4IBLT 1XH0A 4NWUH 4ZFFB 3D2UD 1XD1A 4MLSA 2VQ1B 4OLWH 2R4SH 3W0WE 1FNFA 4HEMA 5T1KD 3O8XB 3CZFB 1TEYA 5CINH 4NSKA 3FO0L 2ZAGA 2ZUSA 5AVWB 4OZFB 1B2WL 1VGKB 5D1QB 1P5UC 1D9KD 2HFEB 4H1LA 4K9EC 3SO3C 2GB2A 3A22A 3P4NA 1KLFA 4NQVB 4EE2A 2I7OA 4J39A 4IRJB 4YFEA 4KNSA 3GMNB 2F53D 5KAQG 1DANT 2P8LB 5F89A 4EF3A 1TQBB 4ODUA 5A6LA 3SPJA 4BE5A 4ABVA 5BQ7A 3UPRB 1A4KA 3TVMB 5E70A 3GSVB 4LCYA 5DEFB 4X50A 3LJ3A 3QQDA 4X4ZA 1MCPL 2TRYA 4KH2A 4ODSL 4UQ3A 5KYWA 4W9ZA 1KEML 2XPYA 4GYBA 4HPYL 3TPKA 5E8DL 4QDGA 4Q58C 1VFUA 6TAAA 3PFQA 5KVGE 2D73A 5HVFB 1ZV5A 4QJ4B 1UB5A 5IROD 1SDDA 2M83A 1N68A 3WNMA 4N8CH 3ZDXB 3QFJB 3S6CA 1I1RA 1MFNA 5J1SC 3CHQA 3PXLA 3QIBA 4OD3H 5FGBA 3VJ6B 1HNYA 3FU6A 1F6LL 2A74B 3VI3A 1WS8A 2DYPD 2O1AA 3O45A 5ITBH 1XSJA 1D5MA 2AAAA 1B0RA 1R17A 2NT0A 4JREB 4N8PA 4XWOD 3MV8E 1P84K 3NJLA 2W07A 5CSZB 3UP6A 5K9JH 1R5VA 3ULVH 3OKEA 5CGBA 2XV2A 3DV4A 2D7OA 5K1JA 3KPPA 2XC8A 3BP4B 1A7OH 2OL3B 4FHJA 1JGLH 2IGTA 2Y22A 5CXPA 5FW6A 1AIFB 3OJDB 4HEPA 1J1PH 4Y0GA 4ABQA 1JYVA 2WXOA 4W9FC 3BUYB 2WINB 4GKZB 5DZVA 2APFA 1NM9A 2GFBA 4GSRA 3FNKA 1IMHC 3VE0A 4POZD 3SDDC 3QQ9C 4GP4B 5GGRY 2JKXA 2EVFA 3L3HB 2EXSA 3KPLB 2DQTH 4BK5C 3L3IA 3CFKB 2BFVL 4BKTC 3ULUD 1MRFH 3FTZA 2X4PB 1ZK5A 3QRLA 2EC8A 1AE6H 4WW1A 3ZQWA 3BSHA 1WEJH 4P2OC 2X89D 2VZVA 2XQYG 5KYXB 4ZODA 3PAYA 3DOHA 2VITB 2YUVA 4OLZL 3P4MA 2YD6A 5CJ8A 5BZZA 3Q2LA 4J3OF 4E41E 1LMKA 4ZZFA 1NMCC 1FGNH 3V6ZA 2H7WA 2OZNA 1HCYA 2CIKA 3CZSA 5AYTA 4ILDA 5I19L 2WYIA 3U9WA 4EO5A 4BFNA 3DO7A 5BVJB 4F7EA 4Y2OB 1RZ7H 3FQWB 3L81A 4G8FB 1JGDB 4FQJL 4DPCX 1A02N 2QT6A 1N9PA 2EDKA 3L6FB 2R69L 3GDCA 2EE3A 4MXVF 1J8HD 3R7QA 3OPZL 3ZT6A 5A2CA 4IJ3B 2IH1B 3Q7JA 2VDNH 1YPZE 4YAQB 4Y5XA 3UTZA 2Y7OA 1KJ2A 2HUHA 4IM8A 1ONQA 2ROXA 4X9BA 1WZAA 1MW3A 3ML8A 5CZKA 4F15C 4P2RA 5EOCL 5JXAH 1AHKA 5E8NB 5J5EA 4NOFA 4AGNA 5FHAL 2O5ZL 3EO0B 3EJTA 2ZG2A 5F9WC 1F4AA 5KS9E 4PJXB 4APQB 4GRMA 1GVIA 2YWYA 2XCMC 3K8MA 3C5ZC 5GS0L 3K6FA 3VI4F 4YSRA 4FABH 4P5KB 4PRAA 4WJ5B 3CZNA 4TOYH 2YGQA 4HU2A 4KXBA 1SXBA 2X3AA 5CNHA 5IJKA 5IB1B 3G6JA 3QXWA 5C86A 2WVUA 3AGVA 1LP9A 1P5UB 1TENA 3V5HA 3WTVA 4YUEL 5JYLA 5I8EA 3C08H 2YRZA 3SO3B 2OX5B 4DP8X 5KVEL 6PAZA 1KFAL 4MZIA 4OCXH 4PB0H 4RFNC 4QCIA 4GAAA 2YR3A 5AWNH 2HVKB 4RGND 4XN9A 3SDDD 4H5SB 1QLFA 3DETD 3LPGA 4JFUA 1RD6A 1KV7A 3ML9A 3LH2L 4ONOA 4Z3FA 2HT3C 5AZUA 1WC7B 3PIQB 1F56A 5HHOE 1IE4A 2NZ9D 3R4RA 5FF6B 3BWAB 1RZ8A 4XNBA 5CZVL 5GPRA 4MJ4A 2VDKB 4Z7VB 1XCWA 1KB5H 2O5XL 1I9JL 4HJSA 2PW1B 1P53A 2V2TA 4Z0BL 3NCCB 4QYOA 3MLZL 4MMYA 3AITA 2QKSA 4HYTB 3EOBA 3X1FA 5I15H 2YBGA 4NRXA 5DK0A 3G7TA 3H2WA 1U93A 4L8BA 4NRZB 3WKPA 5J6GA 5HGDA 4ETQA 4PVLA 3G5WA 3ZT5A 3DVNB 2XA8L 1MN4A 5DMIL 3IU4H 1K5NB 3MRKA 4JGMA 5GRVK 5E8OB 4Q74A 5FUOL 3UO1L 4WEMB 1KLUA 1TZOA 3QXVA 1RJZA 1Y0LA 1XXDC 4LARH 4RAHA 4Y19B 4J3OH 5DC2A 5B39G 3UJTL 3P11L 3B34A 1AHWA 5FYJD 3ZKQD 1P84J 4GRWE 4HUVA 4IJTA 3G3LA 5ISZE 2IOIA 4J5VA 3O9WC 1RI8A 2EUWA 3DVGA 5CU5A 4X6CB 5C3IA 3FDWA 1COBA 5A43C 1VPOH 4YHKH 3S9DB 1AR1C 3QI9A 3ULVC 1RAMA 4NQEE 4HIIA 3QQXA 2HVBA 1SY6H 1ZLUK 4KQ4L 5JLZB 4Z77B 5CEZE 4A2LA 3GJFK 2AQSA 3ZN6A 2Y0SA 2YLKA 2F58L 2Z31D 4NKOB 3ZKND 2Y3NA 4P06A 3LH8A 4P2OB 2J55A 4Q8BA 5TGBA 1S7VA 4WWNA 3IVKA 3VXSE 1U91A 1TVHB 2WBJA 2FWOA 5MEQA 3FAXA 2WLIB 3VU2A 1E27B 2WZ5A 4FQXC 1T21B 2BSRA 4XP5H 3QFDA 1KN4L 1T5WB 1KCSL 4JHAH 2CGRL 4XNMB 1NC2D 2X2JA 4L4VE 4OZHF 1U6AH 4IW4C 4LHUD 3A0OA 4PW3A 1UXWA 4RSYA 2IV9A 4U1LA 4ZOEA 3KPOA 2C8NA 4LEOB 5GRZA 1F4WL 3VWJD 2VQUA 1DVXA 1MRCL 4TVUA 5DZNA 3AQZA 3PWVA 4F3FB 4X98B 1CGYA 3HZ3A 1BWMA 4V1DD 1NAML 4Z5RA 1U8PA 1R3JA 2X6BA 2YS4A 3MJ9A 4I5BA 4JO4H 4UCFA 4XVJH 5B22A 2BY2A 4F15B 2GUYA 3EYVB 1HU8A 3AMLA 4LPWA 4PY8I 3GMLA 1CXIA 1TCMA 2L4OA 1T3FB 2TRHA 1V54B 4NZJA 3LQZA 1FNEA 3BZ5A 3C5ZB 2WUBL 3QWRA 4LIQL 5FFLA 4JQVC 5HGHB 3QISA 4DKTA 5J6HA 2W0KA 4H44C 4XNUL 3W39B 3N2JA 3D6GA 1QSEA 2R0WL 2X3CA 3RTQC 1INDH 1L7TH 1E9OA 4JN2A 5DFVC 4XODA 2NCEA 2BWQA 3S35H 3O2DL 3PABB 5EUOA 1CFNB 2Q3XA 2DQJH 5AVVB 3UTTA 1IKNA 1VIWA 4CNIA 1PZ2A 4RAUB 3MX0A 4YDNA 5IQOA 1T0OA 4JGJA 4O58H 2GTWB 3NCXA 4O2EB 2NZIA 3LAFA 5D71H 1DBMH 1X5IA 2V5MA 5T3ZH 4JM4H 1EAPA 3FU9A 4HZ1A 4RFNB 1J05B 1N0XL 2HFGL 3BT2L 4MD4B 5LGKA 4UTAA 1A6TA 3OKDB 1SOKA 4BZ1A 4U7KA 1D5IH 3K0WA 3P73A 1R19A 4PJ7F 5FCUL 1AR1D 3NFNB 3NT0A 1PVHA 2B8OT 4L4TE 4G59C 1RZJH 4Z7WB 5CIPB 5AYUL 2R2BB 4GEIA 5D5ME 3RDTC 1KT2B 5JMOC 5C09D 4XPFH 4O51B 4PQXA 4BGDA 2VLJE 3F04A 3PUUA 1WZ1H 3MLUH 3R4DA 3QNFA 4OQTH 3VNYA 2AJUH 2AEQL 4FP8H 5E0QA 4HUMB 5HY9A 3LRGA 4FQXD 2WGXA 1VEOA 5SWSA 2BP8B 2OMTB 3LN4B 4PJHA 5DMYA 3CDZA 5F93C 1QA9A 2DIAA 4AOFA 1XR9B 1K3ZA 2IH9A 3HC3H 1XR8B 5DC0A 1A1OB 1CPUA 4KO5A 3U46A 4ADGA 4Z8FH 2UXVA 4AUJA 5D7EA 1OAUH 3D0LA 1GGUA 1JZEA 1CE1L 3GMRB 1OK8A 4Z7QE 2OW7A 4ES8A 3LS5L 1D5RA 3SKMA 4LHJB 4OZIA 5F21B 4XMLH 2XZQL 3O6LH 3O9WB 2CA4A 3QIUD 1FG9C 4CBPA 1BZ7A 2Y23A 3AG2B 3J27A 4AT6A 5D2LB 2F54A 2QTEA 4X7FC 1OTUD 5F8QC 2BY0A 4YSPA 4I0PC 5AZ2H 2CGYA 2NDFA 2CO4A 1PDKA 4XHJD 1AR1B 5IHZB 1UGNA 2AMGA 1A6WL 2I60H 2XFXA 3GF8A 3JQOB 4EPSA 1I3GL 3BRGC 2P8MA 4FQQA 2GSIB 1RJYA 5HGBA 3RL1A 5HI4C 2WLJA 3VD3A 2NXZD 4OR1A 5C09B 1NPJA 5AVTB 2OR8A 4IEFB 2Q76A 2VLRE 3CN3A 4YXLL 4PLJD 3GBMH 3K7UA 2BS9A 2H0EA 2Q5BA 4QRUB 4B5ZA 3NFSL 3MRJA 3HI6L 3V4VH 4FQXB 5E9DD 1E5YA 3NFPA 1BVKA 1QABA 1MWAL 1NBVL 1N64H 3P9WB 2FSEB 5I0WA 2BH0A 4DOHE 3RJDA 4J3WA 4DP5X 2FEDC 1JF1A 3PP3H 5HI5D 3RGVC 4HA1A 1IM9D 2PF6A 2X1PA 1PIFA 1RZKH 3NACL 3RL2A 3CC5A 1T1WA 5I24A 1DEDA 3CV5A 4HKXB 1IM3D 1ZANH 5I1HL 4BSVB 2VXUH 2AAVA 5FUCC 1S6NA 4DVBA 1IO4C 3DRTA 1W0WB 5IG7B 3TV3H 4Y1AD 4QHMB 3K46A 4AEIL 2Y9RT 1PMYA 4MCZB 4FJYA 2HJKA 4KFMA 1JPFA 3IWUA 1KXTB 3D87B 3MRCA 1A6UH 4WY7L 3C8KA 3VVVA 1T0NB 2YEQA 3RY6C 3GKWH 3PL6A 1S9YB 1TJGH 1BFVL 2VO5A 1G7MA 1G9NC 2BNQB 1BVOA 3WCYA 1QNZL 1V10A 2VDNB 2A9MH 3WYRA 1HKFA 5B4MC 2WBXA 4N0FB 4OLXL 3RTQB 4F8QA 4LP4A 4HHGA 1X5YA 4RMQA 43CAB 4I89A 3AU1A 4XBPB 1EVUA 4AVKA 1CXFA 4A2EA 4ZUUA 3QT2A 3LEXB 5D7IF 2I07A 4UU9A 4GIOA 3MRIA 3RPKA 3K3QA 5CP7B 4F7TB 2J43A 3QXAB 1HL5A 1OAZH 2IDFA 3S34L 3MKKA 1C1EH 2H8PB 3BESR 4ZOBA 4GO9A 3VRLF 1YSOA 4JFQB 4AQ1A 3FQXB 5CJOL 5EFIA 2EXWC 2HKHL 1WCBA 4P4KC 4UDUA 3O3EA 1IVLA 2CRYA 1YLBB 4JZOA 4NZDA 3WNPA 4C58B 3TS8A 2JIXA 5ANHA 4PCYA 1R3KA 2QLYA 4PJDA 3GSXA 2JCCA 2Z93A 3RDTB 1DJYA 3N1QC 4OCMC 3ROOA 1CGSL 2AJZA 3KMDA 4HUWB 5B21A 4ZK8A 2F5AL 5JHDD 1QFPA 1JIBA 4JO1H 2XTLA 2WJ5A 5C6TH 3LZPA 3L5WA 1DE4A 2PR4L 1DANU 2VQ4A 3NCYP 4PJEE 2WGNB 1JBJA 4P23A 1RZJC 2L0DA 1XH1A 3OXSB 1F18A 3QEHB 2GABA 4EN3A 4OGXH 3BVDB 1IGTA 3KE0A 4WW2A 4UOJA 5CLWA 5MI0C 3ZW3A 1KB5B 2OSYA 2LOEA 2VXQH 3NJJA 4OFYD 5I5MA 2VSMB 2D31A 4NQCA 5E6IC 2FAUA 5D70H 3EHBC 3VAEA 4ZFGH 4U3HA 5BS0B 4KX7A 2PWEA 3S35X 5DD1H 5SX4I 3V6FA 3MLXL 4M00A 2HTKD 4AUYA 3UYRL 2Z64C 1SEBA 1JGEA 1JK8B 2ZCKH 3BOVA 1DQMH 2CG9X 1PY0A 5T5FL 3ULSB 3VRJB 1G0XA 2ENYA 3EJZC 4XO9A 5J1AA 1BVNP 3VFRA 4I0PB 1NH6A 3SZKC 4FXGA 4JRYE 1LNUB 2KDYA 5IR1A 3MRGB 4AXWA 1AQDB 1PNCA 4HWEL 2P8PA 2CLRA 3KPQA 3F2LA 1FNGA 3FTGB 1IJ9A 3ROLB 3MVSA 3HZVA 4X99A 3FOLB 5DRNB 3ZL4L 1LWHA 1BZOA 5A2BA 1AS6A 1YNLH 3APDA 5A2KH 5KSBE 4G9DA 1Z2KA 4ODXB 2YA1A 2UWEE 3HI1A 5I8KL 4FZ8H 3QDHA 1OKEA 2NY5C 1HL9A 5AG9A 2J6EH 2AXGA 4KQ3L 5CD5D 2ICCA 3LKPB 3IFLL 5F9JA 4Z7UA 4CADA 4MJ6A 3RGVB 2WMPB 2E7BA 4MFHA 4U1IA 4DPRA 4F7KA 3F84A 2EXWD 2JKRM 4P4KD 1K72A 4JY4A 4Y2NA 1S7WA 2V3FA 3MBED 1MFBL 4RQQB 1WV7T 3T3MF 3HAEH 5F1SA 1IGMH 3S98A 5I1KL 3BH8B 1RUMH 4PJ8A 3MJ7A 3PE9A 3LSOB 3VM7A 1UXSA 4HUCA 2MWCA 2OW6A 3GIVB 1X5KA 1VZHA 4JZJC 5SWQA 1GIGH 2E6PA 3DUSB 3CVDA 3CDYA 3Q5OA 4V2CB 1KIRB 3Q43A 1CDGA 3HN8A 4XNQA 5ALBH 3IJEA 4UIKL 4NZTH 3SOTA 4NWUL 1RZGA 4OLWL 3ETTA 3FU7A 1X5AA 2IXQB 5CINL 4YBQD 3IDJA 3QJFB 4C47A 4IS6A 5EZIH 4LVNC 1J0JA 2EZ0D 3UG4A 3ZDYF 3QUKB 4HX1B 3IT8D 5H8DA 5EC2A 3FT4B 3INUH 3DROB 3L3KB 1SBBA 3V4PL 3X1GA 4Y4HD 2H1PH 2E27H 1M05A 1X4YA 2EDLA 4LHUG 2UUDH 5KYNA 4UT9H 2CDFA 2ZOWA 3WTYA 1LE9B 3FU3A 1E65A 3C2AH 5J4MA 5C0RH 3BAXA 2H26B 1A2YB 4DK3A 5I17A 4MJHA 2Y06H 1G9MH 3K91A 1SJMA 5CGTA 3GUFA 1JV2B 3GXUB 4OZGB 4P4KB 1H8OA 3CZJA 3F05A 1CDJA 2KT6A 3A67H 3UERA 3HPLB 1JVOA 5DFWH 3SQOH 4OT1H 4WFGD 4G82A 1GS7A 1HH9B 1NAKH 2E4FA 2YKKA 3FFOA 4PRHD 2EXYD 5H37H 5IMOA 5EZPA 4ZFOL 3GZQA 4AYSA 4W4OC 4AMKL 4C4KO 2EVIA 3HZYB 4BZYA 4NNPL 5PAZA 2Z92B 3GUTB 4LIQE 2NYYD 1RIVH 1S8DA 4OD3L 2BS71 4OV6F 3UH8A 1GW0A 4U6HB 2YD9A 4HHWA 1TDQA 3W0WA 5CCGE 2DLGA 5HDWA 5BZWB 2XIBA 2XN0A 5FO7A 1A5FL 4OSUL 5DD5H 3WFCH 1HOEA 1N70A 3L2NA 5MI0B 3TP4A 5ITBL 1LO3H 1MSPA 2Y7NA 1A9VA 1G7IA 4UQAA 4PTTA 1MCCA 4LU5L 3RTLA 4FEIA 3EZJB 5E6IB 3EHBB 1KN2H 1NCHA 1WFMA 4KVNL 5DZJA 3KLLA 4D2NA 3FRUB 3HUJF 3QNZB 1DBJH 1IEBA 1YN7A 4PI2A 1EZLA 1E43A 1T04B 1AGDA 1J1PL 4DKFH 1MCWW 1XCQB 2YZ8A 1YNTB 3WD5H 3NCJL 1I3RA 3SE9H 3IGFA 2QQNH 3QFJE 3ZDXE 2LLLA 4E2OA 5JIMA 5IFHH 8FABA 5I5IA 4M7JH 2VUKA 3H54A 4AYBA 5A3ID 3DDGA 2BOBA 1SQMA 2OKMA 3EO1B 5E1AB 2OS7A 3MNWA 2VDMH 3F7PC 3VXSD 3JWNH 4FNRA 4L1DA 1MRFL 1L0YA 2YAMA 2Z4QA 5K5YA 3F7VB 2ITEA 4Y1SA 5KYUA 1AE6L 4IRSA 2VGLM 3WENA 1Q94A 5JNYA 3VO0A 3CFMA 4TUOB 4K94H 3WS6C 2KZKA 3G6AB 5JOPD 1QHQA 5LN8A 2R0ZL 1C7TA 2V33A 3DOSA 1OLLA 4NPYA 1FGNL 4ELKA 5DURB 1ZCRA 4TXVB 4LOEA 4MAZA 3KPSE 3QS2A 3MV8A 1I9EA 2H6OA 3PF2A 1BIIB 4CRPA 5GZNA 2VR3A 3RWJA 4Z7AA 1SN2A 5DWPA 5DJ6A 2J73A 2GTZA 1ORSB 3CBKB 4HH8A 3MRMA 4EBQH 1ACYH 2NXYC 3S5LA 1SBSH 4LLAA 3OLIA 2MHAA 1WE5A 1ETB1 3AC0A 2Z8WC 1V7NH 4U1KB 4PJCF 1SFHA 2DWXA 5JXAL 4JZJB 4Z78A 3TIDA 4UBDD 2SEBA 1UT2A 1XGPB 2J1WA 3PP4H 3IETB 2VERN 3IMUA 1PYWB 1OAYH 2CHNA 1NCGA 2GUOB 3C87A 2YPKB 2VN3A 3EGXB 1IL1B 1J9CT 3LV3A 3L48A 1OQXA 2DL2A 3JUYA 4HBCH 2OTUA 3KNBB 3VMOA 2Y4SA 3ATAA 1FI8C 5HHQA 4C56B 1SYVA 2FYYA 4KKZA 3G5YA 4LVNB 4E41A 3F65A 2DM4A 2Q8BH 3QO1A 1N0LB 5GRJL 3BSZH 4PJ9A 1Q72H 1G6VK 1SJEA 2E75C 32C2B 1CMOA 4CC4A 3SY0B 4PJFF 4EXKA 4X0KB 4I18C 1XSKA 1OEZW 3NZ8A 1G6RA 1AH1A 2AGJL 4PJXE 4WFEE 3NVQA 4AEHH 3NJHA 2VLJD 4KTDH 2R0LH 4A7QA 4X5XB 3II2A 4KDTA 4X7TB 4XCNA 4XCFL 1NIFA 3I6GB 2X6MA 4HC1A 1OCZB 1F58H 5JPNC 4OGAC 2WXJA 5AOZA 3CDGB 2FT6A 2ZOLA 5T1LA 1DSWA 3RWDA 4M1CD 3LN5A 3ZT7A 1CI3M 3C6EA 3T6XA 3QZWA 3T77B 2XWJA 3GZPA 4R97C 5D7LD 3STZA 1ITCA 4LCCA 4L37A 5H94A 4WF7A 4HVBA 3WIFA 3IPEA 3L9EA 5FYLE 2E7DA 1U8JB 4HD9A 5DXWA 4JFEB 5CBEB 2OXHA 2R29H 4LSPH 2X4UB 4BFBD 2XQYK 4X4YB 1HS6A 1EQWA 4DF9A 4OCSH 4YHYC 5IWLA 3BRFA 3IU4L 1LE5B 4E42B 2PCPB 4LCUB 2A99A 3GZKA 1HHIA 1J86A 3CAFA 2NW3B 1LEIA 4WI3A 1MCRA 2NXYD 4LCWD 4J4PA 5LUMA 3BVNB 5IEHA 1H15A 4UNIA 2MTPA 1UB6A 5E2UH 5IVZA 4NBXB 3SGDI 1XXFC 4YO0B 3TEXA 1LXMA 3L08A 4PJAA 5C0IB 4UQCA 3SBPA 2FUQA 4G9FD 5KOMC 1VPOL 1UC6A 1W8OA 4YHMH 1KY7A 4YXKH 5HHOA 5E1GA 5H4YA 3WS3A 2VLRD 1U36A 3ARDD 3HG1D 3NEOA 3O0RL 3DYOA 4LLWB 4NQDA 4JGNA 2ZOKA 5IK3A 3NP4A 4R3SB 3OKKB 1E5AA 5E2TH 1P6AB 5AW2B 3BZDA 1MCQA 3M88A 1ND0B 4M4RB 1URZA 5BNXD 3KZ8A 4NP4H 4X5PA 3REWB 4KKLC 2VMJA 5C08B 4D0CB 2H6PA 5HXMA 3LKQA 1YQ2A 1BZDA 3P3SA 5B38B 3JWNC 2NTFB 4XP5L 3GMPA 4TUJA 1HZHL 3MFFB 1SXSA 5IVXF 3S37H 1JZ7A 1GZHC 2C3GA 3PHQA 4X6CE 7CGTA 1BYPA 2B08A 4MZ3A 2X7LB 3NSJA 5BZDB 2V2XB 3WLBB 1KB9K 5C6PB 1IBGH 1X9QA 3IJHA 5DJCA 2G5UA 5BMFL 4F8TA 1UYWH 3Q9PA 4GW4B 4PV1C 3N44F 2D7TH 1D7CA 2WVTA 2BOLA 1UJ3C 5D1ZC 1D7FA 5CGYD 1U8LA 2IH8A 3PY9A 5ISZA 1QAWA 2ZZUT 5AOJA 3LKSA 4NS0A 1CGXA 5AW1B 1NQBA 1YYMH 4IMLB 2QHLA 1KGYE 1JS4A 1RHHB 4JO4L 1QVOA 2DM3A 5INDA 3EYOA 1OB1B 4FFWD 3QJVB 1UH2A 4ICWA 2CKBB 1C16B 3MREB 3Q3GB 2J8UB 4OGZA 5D2NA 4EI0A 4NQEA 1TZIA 4NUQA 4G9FB 5DHVH 4N1HB 4N2DA 4MASA 5E24E 2YD4A 2CR0A 3RWGA 3TZVD 2VL5B 1RKRA 3HG1B 1ZK9A 4UTCA 4AQEB 5CD3B 5DDHA 5J3HC 1KB3A 1MVUA 1YEFL 1JZHA 2BHZA 4WGWB 1N10A 2X9ZA 5K9KA 1XGYH 4Z3IA 2X4SA 5C0AD 4AI7A 1SMAA 2PCYA 4P2QB 5IIEB 1PD0A 5F9DC 3MV9A 3LZNA 4OKDA 3ZHFA 3S35L 5KSVA 4TYUA 4X6EA 1W0VB 1FNLA 2DQJL 4GEJA 3RUGB 3UTSD 5EEWA 1FO0A 2QLVB 4MWFB 3PUCA 4G6FD 2N1KA 3ZDZB 4O58L 5HI3D 3F7YB 2Z91A 4L4VA 1FFOA 1DBML 2DOCA 4I18B 2XUWA 2WWMD 2X10A 4WEUD 5LGJA 1F41A 2Y6SC 1D5IL 4HKZA 3MLRL 3IMSA 4HIQA 2X4RB 3TASA 4GG6A 5AVRB 3BE1H 3SDXF 1FVDA 1IBHA 4P8QA 5AOKA 1XZWA 2G2RA 3FFDA 3WEXA 5GSVA 2A4CA 3BWZA 4OGQC 4X6BB 5GS0D 2IWFA 4IOIA 3N55A 1BQKA 4GXVH 3ZTJH 3BVUA 4X7CC 2Y24A 5JPNB 4EAEA 1GHFH 1S7UA 4XPFL 5LN4A 4ZAKA 2EVHA 5DCCA 1WZ1L 2Z8VC 4OQTL 2WTOA 5A2FA 4H88H 2VDPH 4IBVA 4R97B 4HIXL 5ID0B 5AKVA 2X9YA 2QPDB 4P9HH 5DHYA 2GSGB 2K9FB 3VD0A 4PG2A 1CFQB 1H3TA 4M7LH 1PX4A 5FCSH 4YHIB 1Y1UA 4KZ0A 3WV0A 3FMGH 4N22A 5CUSH 4JG0H 4HFWB 4YHYB 1PZUB 1RZQA 3H9SB 4OY9A 4S1SH 8PAZA 1L0XA 3ASOB 4XXWA 4XO5A 2FB4H 3P0YL 1K4CB 2G3ZA 3L5XH 1E4KC 4W9EC 4PWJA 4UTBH 1JNLH 1INEH 1F4YL 2H2SD 3MTXA 2ADGA 5KSUA 2VC2B 2VCOA 3JTTB 3NIGB 1BW8A 1A1NA 5AZ2L 2VRKA 4FULA 4K55A 3K74B 1TEGA 3HG0A 4KJWC 4L4TA 4DK6A 3E8VA 3TF4A 3VFNA 4Z3JA 2I60L 3OAUH 5J3HD 5D5MA 4PJBF 4M5YH 4DP1X 1L9TA 1RU9H 2EIJB 5I8OH 1JL8A 1XF3A 4QXTB 3ECBB 4UIMB 5T33H 3GD1C 2IDSA 3EG9A 1BFOB 2IOOA 3EUUA 2R83A 4M3JA 4HH9A 3GBML 3D1MC 1XGQA 3EOAB 2I24N 1J5OH 1KXQE 2BRQA 4NCC2 3V4VL 4ECNA 1DQVA 2DRUA 4RFOH 2DKMA 1N64L 3MHZA 4BSWA 3L7EB 1H19A 3F85A 2WLLB 1NANI 3VH8A 2CU9A 5FB8B 3ULVE 4B0MB 1TVBB 1NBZB 1JXDA 1F6FB 4IYKA 1BLIA 3ZBMA 4DW2H 4P2CG 1A6VH 1RZKL 2D7NA 3AGWA 4JM2A 1Z5LA 5D1ZB 1ZT1A 1KPVA 3HLKA 1UJ3B 4ZPVB 1ZANL 4ZFZA 2VXUL 1KB9J 4ELDA 3N91A 5JO5B 3EH1A 4JFDD 4Y9GA 2FVNA 3TV3L 3NJVA 1RZFH 5A2AA 1DDTA 1R24B 2OMWB 4XT1C 3SE3C 4JRXE 4AGMA 1F97A 1A7NH 3OR7B 3HA0A 4NO0D 3MLTA 4YDVA 3FQNB 5GRYA 1MFVA 2VZOA 3HR6A 3CCHA 2XN9A 5DJ0B 1A6UL 2A6JA 4U05A 5DVKA 4CVZA 3ESMA 5DGRA 2QR0B 3VG0H 3E6HA 3GKWL 4I9XA 1TJGL 3AT8A 1IU1A 1CTMA 4R4BA 4L1TA 4J8QA 2CLVB 3NGBC 1TYEB 2A9ML 5C92A 1JXGA 4KJPD 4XO3A 3VFSA 4BH7B 2WLZA 3EH2A 2PYED 4YDJB 1CDIA 2QDWA 4NN6C 1QFUL 2PUQT 1PNDA 2VN6A 3U4EA 3WI9A 3WMQA 5I6LA 1D2PA 4C55A 3LKOB 1S9XB 3KJ6L 3B8YA 3P54A 2AJVH 3OMAB 2PWGA 3CQFA 3DGCR 2VOTA 4GAYB 5H35A 1PZ5A 1BQHA 4JPKH 5BPPA 5HJ3A 2ZKXA 4YSAA 3S37X 3TN0D 4I1NB 1FRGH 3LHAA 4Z76B 4W70A 4PLKC 3QBTB 1YYLH 1WT5A 2GC4C 4KJWD 2EDOA 4QTHA 3V0IA 4AYFA 4EUPH 1D5BB 4HU8A 1R5IA 2ARJA 1T83C 2BNQE 3IXTB 4NKIL 3PWPB 4XP1H 4XTRD 1CD9B 2HJLB 1BJ1H 4U6YB 1TVDA 2L7JA 1HH6A 2GJ6D 1CF1A 4RZCA 3ZE0E 1EO8L 3QC5X 4B9FA 4NO0B 1OD7A 2DZEA 2HA1A 2XWDA 1YMMB 4JO1L 1HE8A 5DD3H 3S4SB 4B95C 1AGBA 2B3RA 4Y4KC 2R8SL 2D0FA 1U21A 3LIUA 1W72H 2CJSA 3KWXA 5E94A 1OAKL 2GCYA 5I66A 2DLTA 5C9JA 1HSAA 3RHWF 1M7IB 3VCLA 1HQRA 3D0VA 1P6WA 5EO9A 2VXQL 5DJ8A 4BUGA 3GMQB 3SKJL 2D2CC 1G94A 2QQLH 1WFNA 4GI6A 2YBRA 5D70L 4ZFGL 1M42A 4Q9CA 1MHCA 1QSFE 4HSQA 1TTAA 4HJ0D 1SXZA 2V0AA 2FWUA 4B5EA 2VW6A 4MJIB 3UTQB 3GGWA 4XPGH 2ZCKL 1DQML 1MF2H 4DWHA 3GSNH 2CHZA 3PS6A 4G6AC 5MHSE 1VKXA 2ZAHA 4UT6L 1YJDL 1UD8A 1AXIB 4KUZH 3RX8A 1KWGA 2P5ED 2GK2A 3E9UA 3BKJH 1SJHB 3KYNB 2E47A 1NGXA 4F57L 3ALXA 1ZAGA 2ZUYA 4IHOB 1CBVH 2CMRL 2V5TA 3T3PB 2DQMA 4RRPM 5DS8A 3ZHKA 1YNLL 2WZ0A 4KKBC 4NERA 3KPSD 1OM3L 1IB5A 3LB6C 4YHOH 4FZ8L 3RVVD 2NLJB 4LSRL 1RPQA 2J6EL 3PJSA 1IZJA 1E8ZA 4QHUB 4X8CA 4RMUA 4ZTPH 4URKA 5FKAB 4CSSA 3EJUA 4X4XB 3UTPE 4MQTB 2DLFH 1PFCA 3LPWA 1I8LA 5BRZA 4FLSA 1AQMA 3KR3L 1DVSA 4KDWA 4UMGA 3VWKB 5SX5H 3LKNA 1UM6H 5D9SB 4PVMA 4MA3A 2AS5M 1JP5A 1KG0B 4CBZA 4HGWA 5EO0A 2D0HA 4XZUB 3N42B 3FCUB 4CAGA 3R0MA 4ANVA 4WFHE 1QR1B 1HC1A 2X42A 4FG6D 5B3JE 5J89A 1JK9B 4YR6A 3UL4A 4JRYA 2BHYA 3I2CH 4YC2C 1CO1A 1XB6A 4CJ0A 5A16B 5IOPB 1N5AA 2N56A 1XWVA 3EFOB 3VI3F 2W80C 5ALBL 3BGMA 3II3A 3DPBB 4NZTL 2ARWA 3EBGA 4FMFA 3RNKA 1OAQH 5KSBA 3OKMA 1CBJA 3NGBB 3PGCB 1NFDB 2ADFH 3BP6B 4PSPA 4JCMA 5KW9H 4LL9A 4TQPA 2DJUA 3RIFK 4X9FA 1XIWD 2CO1A 3M45A 5FUCE 2J1ZA 4A7GA 1MFEH 1ZS2A 4P5MB 3TT1H 1C8QA 2H1PL 4MMZC 5DHVB 3W57A 4HUNB 1MWOA 1UADC 2E27L 1ES0B 3FUDA 5EU5B 2Y7MA 1E5BA 2ENPA 1J1XH 1Z0MA 3C2AL 4Y8DC 5C0RL 4HKJA 1DUYA 2W88A 5DMJB 5E6UB 2Y06L 4ZUTB 4MYWB 1G9ML 1G4MA 4OCYH 1G84A 4QWWD 5GRVL 1IFHH 2ZWZA 2BC4A 1BX2A 2OP4H 3T71A 3VSTA 2F7OA 1IZKA 5J13C 3ZE1F 1FYTD 4RNRA 3EF7A 3NTCH 4ZS6C 1RMFH 1JPGB 4WJG3 4FKKA 1YUHA 3NIDB 1WPCA 1FZMB 2GK0A 4OQ1A 4N28A 4RX4D 3SQOL 2P26A 3L4TA 4KKBD 2AXFA 1W6LA 1KCLA 1PY9A 3ARED 2NUTA 2BS8A 2I9LA 3CE1A 4PRID 2VZUA 4Y4KB 3FB8A 4L8CB 3E9TA 3GBNH 4NO3A 3ALPA 3WHXB 3U1SH 2GIXA 5G55A 1RXLA 1O9ZA 2HX7A 5EN2B 5A2LH 2IFFH 5DD5L 2NX5A 3WFCL 1YECL 3MRHA 1M57B 3KS0J 4KK5D 1EJOH 4PJGE 5EZJA 5MERA 4ISVB 4ACTA 2DQUH 3PDDA 3UPAA 4H1LH 5I28A 3OB0H 5CEYA 1RK7A 2EIZB 5T3ZE 1DBJL 2AEPH 2Q2LA 5I1CL 4XI5C 4IKKA 5KBDA 4WKXA 2X3BA 5ITFA 4NKDA 1T2QH 2FJHA 3DSFH 1AS7A 4NI3A 2AQRA 2I85A 4PJIB 4Q6KA 3SE9L 1HEZB 2YXMA 5IVOA 43C9A 5IFHL 3LNHA 4M7JL 3B7YA 5DO2D 4ZFFA 2VQ1A 3BDBA 5BRQA 2HG5B 3O8XA 3CZFA 2VDML 4FI7A 4QHLB 3VFGH 3B3IB 2OCCB 3HG2A 1OSZB 2YC1B 3A24A 4OZFA 1VGKA 2IANE 3QUYD 4E9WA 5D1QA 1QTSA 4WEBH 4ZTEA 2HFEA 1AYRA 2XOTA 1TQSA 2DMKA 4K94L 3S5YA 4NQVA 3RBSA 3FH5A 4P5TD 4F8NA 2WLNA 2IH3B 3DX7B 4UT7H 4XMWA 4J8RB 3BQUD 4IRJA 1A0QH 4PRIB 5DR5H 3GMNA 3QPKA 5AW7B 3AS1A 3ZK0A 4D7PA 2P8LA 1YMHB 1HAUA 3MXWL 4OVUA 2CWRA 1CL7L 4NXKA 4ZOCA 3UPRA 3KGRA 2CR6A 3TVMA 1SOQA 3GSVA 1AC0A 5DEFA 4X7SL 2UY6B 5ANMB 4P3CL 1VLXA 5D7KD 1AXSB 4OCRH 3ZO0A 4H26B 5D4QA 1I8MB 1WZLA 1K8IB 1CN4A 2WXRA 2KERA 3H2QA 1ACYL 4EBQL 5IQMA 4Z3EA 1MHEB 2GC7C 3N43F 3BLKA 3QORC 1OW0C 1V7NL 3UZVB 4OZHE 1U2CA 4J28A 3QFJA 4KDVA 2VSKB 3O11B 1ZY9A 4K5PA 3VJ6A 4KPHH 2XSKA 1EANA 1ZSDA 2A74A 3AROA 4YC2B 4BKLB 5DZPA 2BLFA 3QNXB 5C0BE 4DCQB 1CICC 2YMXL 4WHYG 3Q2WA 5CSZA 4HBCL 1DQIA 3TH2T 4FAAB 5IW1B 3N85H 4KUCD 2PWHA 1XFPA 1S7RB 3BP4A 4G8IB 2OL3A 3QH3B 2CHDA 4LDCA 1G5GA 4KMQA 1AIFA 3OJDA 1G7PB 3SBQA 2Q8BL 5IHHA 2BP5M 1ANUA 2YAPA 5CSGA 4MMZB 3UADA 3BSZL 1Q72L 3WKNA 1YNKH 2WINA 4GKZA 2HXAA 4QRPB 1DFXA 4LLMB 5K9QG 1S78C 4N2AA 1U4EA 2XXGA 3RVWD 3L3HA 4ZMQA 4B7IA 4YGVB 3KPLA 1XF2B 5GGUB 1EXUB 5C8JB 3CFKA 2WO2B 4IDJH 4NJ9H 2X4PA 4CW1B 3G04B 2APBA 2G30A 4U1JB 4KTDL 2R0LL 4XX5A 5J13B 5TFSH 5AAMA 2XBDA 1H6UA 4ENED 1A22B 5KYXA 1HSBB 2VITA 1KJ2H 3QAZC 1F58L 1QQDB 2F19L 2K3HA 3L4UA 1JNHB 5HYIA 1E4XH 1EUUA 5C07B 3W11C 3V79C 1C08B 4W9DC 3TIEB 5BVJA 5JXEC 4Y2OA 1FF5A 3EBAA 3H55A 3FQWA 3CFEB 4G8FA 3CHPA 3BZFB 1G9EA 1JGDA 4MX7B 1F86A 5IREA 3L6FA 4JZNB 4LSPL 2XTJE 4X8JB 3LNDA 3L4CA 2V3EA 2Y3AA 1RVFH 2CBOA 3RA7H 3RIAK 3QXUA 2IH1A 1AAJA 4YAQA 3VFMB 5KSAC 1HE7A 3ESVF 2CA3A 5F0MB 1KPRB 1NIBA 5E8NA 1W72B 1HDMB 5E2UL 2HT4D 3EO0A 3HBQA 3ORJA 1AO7E 2JVUA 3GDBA 4PJXA 4FKHA 4APQA 2XQBL 5D55A 5AVZB 1EXHA 4PJ5B 3H3KA 4J6RH 3OKNB 1QASA 2PTVA 4RDQG 3UABA 1CURA 5I71C 5L8JB 4P5KA 4B9IA 2BMKB 1KBVA 4WJ5A 1KC5H 3CSTA 4YXKL 1CICD 4YHML 3VACA 4JM0A 3ZU8A 5DK3A 5HTSA 3GSWB 4JFEE 4NBYB 3FT3B 5I1AB 5IB1A 3QEQB 5E1HB 5E2TL 1IV8A 4U4IA 5SWZD 5D1XC 2ZXCA 4FQHB 2QMJA 5I8CB 1P5UA 3O2VH 1O9VA 5EUOF 4NP4L 1KTDB 2OX5A 2VZTA 3BP5B 3RX5A 3RX9A 2DH2A 5K1NA 1QHOA 3THMH 3U4KA 3LD8C 2HVKA 1PLGL 1ZVHA 3ARBD 4HJUA 4H5SA 3S37L 2QVTA 3CC1A 2I32A 3FUHA 4HD5A 2ICWI 3L95B 4MDIB 4ZDHB 3HOGA 4HJGB 1IBGL 1WC7A 2VJ0A 3PIQA 4PH8A 3ARQA 4JRXD 1YQVL 1TLKA 4XXCC 2NQDA 5FF6A 2GJZB 2DBJA 3BWAA 1EEUA 3V0VB 1UYWL 3QG7H 1MCEA 4Z7VA 2BVPB 2PW1A 3QORB 3MOAL 1YYML 2HLAB 4XB7A 3FQ1A 4Z3TA 4PN6A 3DGDA 5LDUA 3PHSA 5TH2B 3KEDA 3EYFB 4A7UA 5C08E 3OZ9H 2O6DA 3QUXD 3ARUA 4NRZA 1EWHA 5KOVC 4Z7OF 3I6LD 3BJLA 1CICB 2FHFA 1JHKL 4KKPA 4PJHF 3DVNA 4WHDA 1K5NA 3QWOB 2HJFB 5E8OA 2DDQL 4M5TA 2WXFA 5TDNA 1I1AC 4Y19A 3SBWC 1GOFA 5ID1B 4JFZH 1U95B 1A7QH 3H7BB 3NG5A 1CFVH 1RK0B 1THAA 4U1NA 3Q8EA 3ZE2E 4ES9A 4QJ3B 3UBXG 4WWKD 2A9NH 1WGOA 3MBXH 1MLBB 3RWFB 5JW4R 3ARYA 5I6PA 2OFQA 1T7ZA 4H8WH 4X6CA 4Q14A 2D03H 3U1PA 3SDDA 4HIPA 2FCBA 1QTPA 5CLYA 4KBPA 4ODVH 3RE0A 2J8UE 1JRHI 4FL4C 3DIFB 3BAWA 4NPJA 4BK5A 5KZCD 3ZTEA 5JLZA 3OAYH 4Z77A 2GY5A 3BE1L 2BIQA 2YO3A 3U30C 4NKOA 4P2OA 2OK0L 2A0LC 4K5NA 3U2SB 3DO4A 3MJ9H 1MQ8A 4P2QE 3QAZB 1DQJB 1E2VA 1TVHA 4BFRA 3RBGA 4HT1H 4XAWH 2WLIA 1E27A 4NHUB 5F9OH 1T21A 4IK6A 1GYAA 4JFPB 1T5WA 1NGWB 4XNMA 2VDPL 1KPUB 3QWNA 3LOWA 1NMAH 4Q56A 4FFVC 3NSFA 4P9HL 3VDCA 5AVYB 4FNUA 1S7TB 1QSFD 1OWRM 1M71B 3V6OC 4LEOA 2UY7B 2VH5H 1UEYA 2OMXB 3GRWH 2X28A 4M7LL 1X5JA 3FMGL 5CUSL 2WM0A 3SD2A 1XL6A 1K9TA 4X98A 5GJTL 3TYGL 4F3FA 3JT2A 3SKUD 4S1SL 4P3WA 1CC3A 3VD7A 3D4YA 4FQIH 4JL1A 2FB4L 3QIWC 5ETUB 4B3EA 3Q1EA 4EI5D 5KSAB 2FEJA 2X2YA 3L5XL 1XBRA 4HG4K 3FQ4A 4HISA 1AIZA 2OTWB 3KAAA 4YSOA 2VM9A 3EYVA 3I9PA 4HMCA 4J3SA 4YNYB 4YBLC 4B60A 2FQDA 1T3FA 2RB8A 4UINL 3C5ZA 4OLYL 5FO9B 3L7FB 1YEGH 5I71B 2AK4B 5HGHA 1X5LA 4O4YH 5L8LB 3W39A 5I0VA 5HP5A 2EXTA 1TPXC 3V4UL 3OAUL 3EJSA 2ICWJ 4MJJA 3B9KD 4MNQD 1RU9L 3WO3B 4LRIC 2CPCA 3PABA 1PZBA 1CFNA 1SNRA 4XPBH 5D1XB 5I8OL 3H9SE 2VDLB 2YA0A 3V2AR 4YDKH 1I1AD 5L6YH 4H0HB 2ZICA 4RAUA 5T33L 2J21A 2O4EA 3QNYB 3S8GB 1L9OA 2J1KA 3HG3A 2GTWA 5TDOB 3UTPD 3VQ2C 4O2EA 2E9JA 1MNUL 3HZKB 1AQHA 4TULH 3MA7B 3U36B 1J05A 3TCXA 4MD4A 1J5OL 3LD8B 3OKDA 2ZYRA 4J3OD 4UB0H 3HN5A 4Z23A 5DZLA 2C9RA 4XOEA 1WSST 1KEGH 1TQWA 3I50H 1EGJL 1TYJA 4Z7WA 5CIPA 3BQVA 2X4NB 2R2BA 4RLDA 1RUPH 4QRRB 4DW2L 2X9XA 4KKAD 1A6VL 5DLML 5I74C 1KT2A 1OGSA 4F20A 3EYUL 3TF7C 2K7QA 4O51A 4WTWA 2JCCF 4YHLL 3S96B 1ZHBB 1RZFL 1YC8A 5CZXD 2WNGA 3N1FC 2FH8A 4L8SC 1A7NL 1WZKA 1E40A 4H40A 5FYKD 2IJ0C 2BSTB 2BP8A 2OMTA 5ADOH 2BY3A 3LN4A 5ILTH 2YMOA 5E4OA 5C0CD 3JWNE 2VSCA 3PXHA 2MSPA 1XR9A 3FTWA 4X9YA 4XPAH 3AG1B 1XR8A 2CQVA 4OI7A 4WW2F 1A1OA 4J3UA 1P69B 3BSGA 3QCUH 3GM8A 3GMRA 5JHAA 1I1AB 1XH2A 2YQ2A 4KRLB 2YK1H 4X6DB 3H4HA 1M1SA 1IGCH 1KXQA 3GIZL 1MDAA 3OD3A 3O9WA 3MV7B 4M61B 3R1GL 2AQPA 2WOBA 3IAPA 5D2LA 2AJVL 3VXNA 2P5WB 5AQ0A 5KANG 3SYQA 1M9SA 4LK4A 2V9RA 4WW1B 3WXWH 4GKOA 5IHZA 1KFGA 4FL4B 4A39A 3OKLB 1MQKH 1BDYA 2ZUVA 5CU9A 2GSIA 1RP8A 3L45A 1OY3B 4RFEB 3U30B 1QPPA 3P4MB 3HMXH 4OJEH 3VFOB 5HJBA 5C09A 4ZX3A 3MCYA 4ZTOH 1S5IH 3V6ZB 1BLNB 3D85D 1M2OA 4IEFA 2VW4A 3WFEH 1UZ6E 4ENZA 4GOSA 4PHXA 4QRUA 3KHQA 5GISH 2NDGA 4B53A 3WKYA 4FQXA 3PG2A 3QDJB 4HIJB