4Y2OB

Structure of cfa/i pili chaperone-major subunit complex (cfaa-cfab)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
142
structure length
142
Chain Sequence
MVHHHHHHVIDLLQADGNALPSAVKLAYSPASKTFESYRVMTQVHTNADAKKVIVKLADTPQATDVLNSTVQMPISVSWGGQVLSTTAKEFEAAALGYSASGVNGVSSSQELVISAAPKTAGTAPTAGNYSGVVSLVMTLGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CfA/I fimbrial subunit A (Colonization factor antigen subuni
publication title Off-pathway assembly of fimbria subunits is prevented by chaperone CfaA of CFA/I fimbriae from enterotoxigenic E. coli.
pubmed doi rcsb
source organism Escherichia coli o78:h11 (strain h10407 / etec)
molecule tags Structural protein
total genus 8
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2015-02-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2040 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4y2oB00
3F83A 4Y2NA 3F84A 2HB0A 3F85A 3VACA 4HJIA 4Y2LA 4Y2OB
chains in the Genus database with same CATH superfamily
1B0RB 4KJQD 4NRYA 5JPMA 1FDLH 1RZIA 1AAJA 1U8CA 3UTTD 3OR6B 1RJZB 3HI5H 3HE6D 3N41B 4X4KA 3GDCA 3EO1B 1H3WM 4WGWB 2GHZA 4KZDL 1WFJA 1KYFA 3IU3A 4XP6H 4Y4KB 1QABA 4QT5B 2DDQL 4BFOA 4Y2OB 2R1XB 35C8L 1P9MC 4YHML 5IMKA 3NABH 2VO8A 4YDMA 1HOCB 4N90E 5J3HC 4KZEH 2Y6SC 1CVRA 1KIPB 3DX8B 2WWNA 4N85A 3WKMH 3VI4B 3RIAF 4KVNL 1I4FB 1JVLA 1X5MA 4ORGB 3T6QC 1PY4A 1KLGB 4FP8L 1V7NL 2BSRA 5K59E 2CR3A 5F7DA 3G7TA 5CZXD 4IOIA 4AUYA 2NSMA 3LDBB 2EXSA 3S9DB 2AKRA 3NAAL 3ALWA 5EO1A 3TBWB 1C5CH 1M2VA 1JGDB 2YGNA 2P46B 4PW3A 4TV3A 1OAKH 3C5ZB 4AKQA 1IBBA 1IBYA 1TEYA 4WY7L 4Z3IA 1ECYA 4NOFA 3HG1E 4TNGA 3V7MA 2FEJA 1XGPA 3W9DB 3FT2A 2IANE 4N24A 4YXLL 3NCMA 4O4YH 3W39A 2DI7A 1UVQA 1JHKL 3UH8A 4X6EA 4MJ6A 2ICWI 7PCYA 5ID1B 4FQXB 2VLJA 2NTFB 5D7EA 5H35B 4DK5A 5K9QG 3IKCA 4ZOBA 1SYSA 4N2MA 5JORB 2V3FA 4MRBA 4PJIE 4NNPH 2OCJA 4KH9A 5EO9B 4XR8C 5SWZD 4Z7AA 4RNRA 4FYQA 3EUUA 4Q9QL 4KDWA 4W70A 5HYJD 3GSUA 1NEZB 4NQDE 2WMPB 2OYPA 1BZDA 2CZNA 2XKUA 3DBXB 3T4YA 3ULUF 1BMZA 3U1QA 4K94C 4NQCD 5IW1B 1Y0LB 2OA9A 4NQVA 2BZCA 4G7RB 3VWJA 4JRWA 1NCBH 1HEZA 3IWUA 4BCYA 1OANA 2DWXA 2ROXA 4JO1L 4OI9A 4NUGH 4PJHE 3QUKA 2IGTA 3IVKB 3KCWA 1XMWA 3EDJA 1U8JB 5FR3A 3D07A 4MQTB 3NG5A 4X7TB 4PUBL 4G7VH 5DJXA 4BZ2H 2HB0A 3NJHA 2KQMA 1FH2A 3B6SA 3HB3D 2BCKB 4G6FD 5LCVA 3ULVE 3FO0H 1BPLB 1RZJH 1U3NA 2AQRA 1FZMA 1QSVA 4RMTA 5FWRA 1OL0A 2J44A 2CJ3A 1QSFE 3WIHH 2R39A 3CFKB 3PFUA 4NO5B 5I15L 1O6SB 5GRYA 3G9AB 3QIBD 4NZ8A 5DVNA 5KSBB 1B2WL 2JJVA 4XRCA 4BK5A 1EHLH 3NJNA 1ANUA 4OCMC 1QP1A 3DVNA 5C6WH 2GEQA 5IKCA 2Z8VC 3Q3GA 4NUJB 4WUKH 3L4TA 1BZEA 4M5YL 1GC1H 3PWPA 5CSBA 3Q8AA 5IVZA 5IVNA 3WENA 3F7VB 1XZ0B 3P30H 3AFLA 4LVEA 4LE8A 5KWYC 3O3BB 4FOMA 1E6JL 1WCQA 2XWDA 3RYMA 3FRPA 4OUUB 1MUJA 3RVWD 4ZW7A 5F7MC 4R4BB 3ABMB 1OK8A 3VFUA 1AACA 2ZWYA 1TQUA 5HHQA 3JVGC 5E8EA 1BF5A 2EACA 3PDOA 5BOPA 4HOMA 3ZDXF 2EDKA 4R8WH 1MHPL 1WF5A 2AVGA 2FCBA 3QNZB 4B53A 5JW4Q 3EYUL 3NPSB 3ARTA 4XMPL 1AZBA 4WFFD 1PPIA 4DT2A 1KBGH 2X0UA 1H8NA 4AUUA 4M61B 1ML0A 1HQ4A 4FQCH 5G2NA 2ADGA 3VDCA 1K4DA 2BY1A 4QTHA 2WLNA 4U33A 4XZUA 3QB7C 3U9PL 4UTBA 3QHTC 1JPFA 1PZ5A 4JKWA 4NUMA 3GGWA 1NKGA 2ROYA 1T7WA 5IHZB 4WW2B 3L5WB 3S5LG 1JV2B 4NZRH 2A9BA 2IOIA 2VWEC 3CBJB 1SOKA 3C9NB 4YHKL 5IIEA 3FN0H 4GLRI 3WKNA 2G2NA 3CFCH 2EDMA 3MLYL 2OS7A 3HZKB 4MJ5B 2JKSA 2QPSA 3V9EA 2RQ8A 4O02H 3V5HA 1MH5B 1SFHA 2ZT9C 3MLTB 3S3JA 5HYSA 1FL5B 3ZE2B 4Y7MA 4GUCA 4A2DA 4ZMQA 4TYUA 2F1BA 1E4XI 3GRBA 2D0HA 5FO7B 2F54E 3ZZ1A 2XQYG 4G6ML 1Z1WA 3AUVA 3EGDB 3LKQB 4H8WC 2FZ3B 3S37L 3WKPA 1QA9A 2CIIA 3VH8G 2AJVH 4BELD 3CVIH 3GBML 1SN0A 1CS6A 5L2KE 3IAGC 4A55A 4JQXA 4QRPD 2W8CA 4MZ3A 2AAVA 4YSSA 4F5CE 1YAIA 3L2LA 3CZSA 5ICZA 5T1LD 4F7CB 5BV7B 1A2YA 5HI4C 1XAKA 1U93A 1WK0A 2JB6B 4M7LT 4MA1C 4DGYH 4G42A 5KJ7E 2YQ3A 5C0BE 5ACLA 4ZXBD 2EIEA 4CMMB 4BUQA 5C0IA 2AK4A 4WU7B 1JXGA 5H94A 3BAEH 2MNWA 2VRAA 2XV3A 3AQDA 4J3OG 3VD4A 3AU1A 5FPIA 1DVFB 3BXNB 5BS0A 3CXHK 2NW2A 5ISZD 1MRCH 1O7VA 4L4VD 2AK1H 4XTRD 2H26B 2WSKA 4R26L 4YVUA 1BVLB 3VM7A 4HKBA 2ZWNA 3B9KD 3HS0B 5CN2A 3C5XA 5DJCA 3CK0L 4FHKA 3FFDA 5BXFB 3WTXA 2WHVA 4HUXA 4BWUA 2CHNA 1O0VA 5KJRH 1UKQA 3ZMRA 3A5VA 2L7JA 5KVEL 3RPIA 3ATFA 5FKPB 2RBLA 3H85A 5FM5O 3QR1A 4UCFA 2PW2A 4G43B 1AI1L 1UH3A 4U4BA 3BAYA 4EI6B 1E40A 3VXSE 1HH6A 3B2UD 5J7CC 2OXHB 4S1SH 1BMWA 1TVHA 1XDTT 5J13C 3OGCA 1KPUB 2EE3A 2ZF8A 3D39E 3IDUA 3I3BA 4MSWA 3L9BA 2PYFB 5CP7B 4Z76A 1A3LL 4F3FA 3CFDB 4K3HA 4YXHH 3HFFA 4XNZC 1MQ8A 3AROA 3MRKB 4I18B 3H8NA 4P2OC 3O2WH 4XX5A 3JWDL 2VLKD 4KKCC 4B96A 5EOQL 4F33A 5GGUA 2BSED 4N0YL 4S1DC 1NAKL 5GJTH 3WNPA 3GIVB 4G7YH 4FQ2L 4HSAC 4NRZA 3CUPB 5KVFH 1GTNA 2HKFL 5F1NA 3MRPB 4LL9A 4MXQC 1K5NA 2XWBA 3VFMA 4IRJD 5BZWA 3ZN6A 3SDAA 4WV1C 5BO1H 5I1LB 5GZOC 1XH3A 4P4KC 5C6TH 2EXWD 4NQTA 2RFXB 4P5KB 1YN6A 2V2WA 3RWJA 4ZZFA 5I0YA 3MR9A 5L9DL 1FAIH 2L4OA 2HN7A 4KMLB 4TMPA 2OKMA 1RUPL 2FWLB 1EGJA 1Q72H 4NKIL 4AITA 6CGTA 2MHAA 1EDYA 3D3VD 2FEEL 4LQFL 3NGBB 1ZANL 2GTZA 2NXZD 1MVUA 2ZCHH 1W72A 3BQUC 1A3RH 4OM1H 5B39G 3U48A 1NWPA 5KVGL 1C16A 3NTCL 1U41A 4Z7NF 1BM3L 3V4VH 2Z1PA 4XMXA 3X13B 1KPRB 3UROR 2X3BA 3MJ8B 1IFHL 1R3HB 5EULV 5C92A 1L9PA 3SDDC 5F3FA 3QWOB 4CN4A 2AEQH 3QZWG 4I0PB 1T1XB 1SY6L 1XSKA 4UU9B 1R46A 4K8RH 4UQ3A 5ADOH 2DYPA 5FGSA 1UUNA 2DWYA 5HDOA 4QOKB 3M17B 4EUPB 1S7RB 2UWEE 1YEHL 4ODVL 2ZXDA 3IJHA 4YE4H 3V0VB 2F53B 2XVKA 4ENED 1J1XL 2O5XL 3L3DB 5AVZB 3BE1L 3L4WA 3HJEA 3MGTB 4NOBA 5FOJA 3BWAA 4OJYA 2HMID 3F00A 3AMLA 3VXRE 3FL7A 3SDYL 2BSSA 3FMGH 2LVCA 1PY9A 3HC2A 1OM9A 2IPKA 3OX8A 4FXKB 4F58L 4IBWA 2ZNXA 1J0HA 4ZW3A 3TJEL 4KXDA 4NJAH 4B97A 2DQTH 1SPDA 4FZEL 2V37A 3CFTA 3DHPA 1GR7A 3CZUB 3RGVA 1OLZA 2ZAGA 1OTTC 3B9DA 1VGKA 3DGCR 3TCLB 1OAYL 4GBXC 4UQ9A 2ZXQA 4JPWL 4MA8H 4LLQB 4YDKL 1KXVC 2I9TB 1FE8H 1T1ZA 3MNWB 2BNRA 2PW1B 4JX0A 3CXDL 3MYZA 2EE6A 6FABH 4NUQA 3ORJA 2KL6A 5EC2A 3K72A 4H8HA 2HT4C 2YAPA 3HI6H 2Y9RT 1WG3A 2BIHA 4OBSA 3DYMA 2ZE0A 4OUOA 1LP9A 3D69B 3DJ9A 4WK2B 4MNHA 4HIXL 1OD9A 4G6JH 1BJ1H 4UOZA 3PWVA 4HCIA 4YO0B 4XBEH 3N41F 4HAFA 3ZQ9A 3NK3A 4MXWH 5K9JH 3I3DA 4GAFB 1T21A 1I3UA 4TQ8A 4X5QA 3RTQA 5F9JA 1BAFL 1CLZH 1YRKA 3PNRB 2NX5E 5L6YL 3VI4F 1NGWB 5HJGA 4YHYB 1WFIA 4K3DH 1FN4B 3UJJL 1ACZA 1P9MA 1KJ2L 1DANU 2A4ZA 2K9UA 3PPEA 3V0WH 3HAEH 2CBQA 3G3LA 1FZOA 5D2LE 4IEFA 2NYZA 3EYSL 2BDNH 3H7BA 3CVHA 4Q4EA 3EOYG 4ZTOH 2WVVA 1A6WL 1F8TL 3LZNA 3BN9C 4GAYA 3Q0HA 1NC2D 2O61A 5H4YA 1VDGA 1HINL 3HZMA 5KSUA 1SXBA 1SDDA 4U3SB 4EI5B 4YHIA 5B1CA 3Q1SH 5KZCD 3SDXA 5C9JB 1S5HB 1TJGL 3F7KA 1Q0XH 5DRXA 3MNZB 1DQLH 2YARA 4JDEA 2ZXCA 4HIJA 4D8OA 5I5MA 4NM8L 4Y5YB 5C3TA 5SWQA 1TVBA 2MFNA 5I8CA 4N2HA 4KXZI 4ZYKB 1TO5A 2IDFA 5C0GB 1DJYA 1QYGH 3ZE1E 3F6JA 3UPCA 5IESH 1E9OA 4PGBB 3RU8L 4MYPA 2BSCA 1NDMB 4TUOA 2P8PB 2VGLM 3F84A 4X5RA 3BCDA 1BX2A 3BVTA 3HUJB 5INCA 4HA1A 1JG9A 1WH0A 4IJ3B 1J8HE 1XF5B 2B3IA 5BVPL 1MWAB 4G1EA 1SVCP 3EO0B 4GMTH 1HESA 2RMNA 5EU5A 1O5PA 1QD0A 2F68X 5C0RH 5KUKA 3G5XA 4QD2E 4HV8A 5DR5L 5CIPH 2WY3B 1QASA 4CU6A 5JXAL 3VGGA 1FCCA 5FO9B 3PREA 2MKWA 4S1RL 2JIXA 5CBAB 4JDTH 2WB7A 1T03L 5IF0A 3MGAA 4PWJA 1LGVA 4M1GH 3T0BA 1JGLH 5D71L 2A38A 2WOBA 4WJG3 3S35L 4C56B 1CGTA 2WUCH 1B4JH 3SYAA 1UB6A 1R0AL 2B20A 3TFBA 2V17H 3O9WD 4IOSD 4KJQC 4RX4D 4LOVA 3VA6A 5KSBF 2RJMA 2PCFB 5B8CC 1SJEB 5IHUL 3NCJH 2FO4A 1N2RB 3OKDA 5E2UL 1QUNB 2FSEB 5L4FA 1UA6H 4CW1A 1XWVA 3PV6A 1YMMB 4CKVX 4YGVB 1AZCA 2L04A 4LLYB 1HQRB 3HS8A 3SKOA 5I76B 4B0MB 3WEBA 1BEYL 2QKIC 4GRMB 2GCYB 3EZJB 2VERA 5KVFE 2XA8L 5K39A 2DQDH 2VAJA 4HUWA 4AL8H 4Y1AE 5D96B 4JHWH 4UTAA 2JK5A 4PWKA 4HD5A 2F61A 4CN1A 1AG6A 3BIKA 1UJ3A 4JY4A 2F8XC 1FPTH 3RB5A 2Z92B 5ELIA 1NGQL 2ALWA 1PNCA 2C3VA 4N90D 1IB5A 3OZ9L 3H2PA 1E8ZA 1NUNB 4YMPA 4M6MH 2YBRB 3IKKA 1J1OL 3L1FA 2H7WA 3U2IA 1WEJH 5ACZB 3O6MH 1YEFH 1S7QB 4L4TB 3UTZA 2WXQA 4JJOA 3RX5A 3IFLL 1F45A 1XCWA 2IDTA 3B3BA 4O5LL 4EF3A 3GSXB 3LKPB 4WW2F 4HUVA 3LRMA 1MOEA 1AGEA 4LP5A 3EJZD 3BISA 3HMWH 4LHQB 4P49A 1CG9A 4EXKA 4LKXA 3JWOL 4WK4B 1JPSH 3F05A 4JG1H 4RA3A 2CALA 2X88A 3HG1D 3QUXC 3MCKB 3KPRD 3QDMB 3MOBH 2J21A 4Q74A 4XN4A 5DEZA 3ZE2F 2NYYC 4KTDH 4L8BA 1RK1A 2NY3B 1CBVH 3WNLA 1SLUA 4W9CC 2DAVA 4G80B 3IETA 1CGVA 2NXYD 5ERWB 4KRPB 3UG3A 4CRPA 2XPGB 1D5IH 4QWWC 4A1RA 3QFDB 5FHAH 4F27A 1XD0A 1PFOA 1WSST 4J3BA 4ZO9A 2VDOH 1ZEAH 5F7HA 1IRAY 4HGWB 4UV4H 2MCG1 1XSOA 3REVB 1VESA 2IWGA 1LO3L 4LCCC 3PWNB 1QI5A 3O4LE 3HB3C 2BJMH 4L8DA 2VXQH 1M57B 4ZUWB 3TA3C 4BK4A 4JRYE 4PS4L 35C8H 5AKRA 1KJ3L 3TIEA 1U21A 5CMAB 1JWSA 3E8UH 3QIBC 1GGUA 3LQAL 4HAGA 1IVTA 4KV5F 4RCAA 5GGSY 3MJWA 3V5DB 1DDTA 4BFGA 4ONFL 3K2KA 4PJDA 1V7NH 4PJ8D 4XOEA 4HS6B 5GRZA 3PUUA 2GI0A 1PDKA 2ARJQ 1EEYA 2GEEA 4D8PB 4LEBA 3CX5J 4FLRA 4FJZA 3BGFB 3L8QA 5BV7H 2Q8AL 2AJZA 2E0PA 2OLDA 2W07A 1R4XA 2AQTA 5DCCA 4LESA 1BQRA 1NCCL 4HEPA 5E9DA 2H6OA 3FSVA 1XEUA 3WV0A 1U8NA 4M7KL 1OTSC 3Q5OA 4FLHA 4Q9BA 3RVWC 1ZJAA 3AAZA 3NOIA 4NQXA 4WEBH 3ROOA 4GKNA 4NZFA 2WVSA 1ZGLM 3Q5YA 1UWGL 2E9IA 4PS3A 1YNLH 1SUJA 3GSQB 3HIZA 1KNOA 1B3JA 3V95A 3I75A 1WCBB 1IBDA 3PJSA 4N8CL 3T6VA 3UO1H 1K6QH 2E46A 4JN2B 2JKNA 2OW7A 2D03H 32C2A 1QPKA 3ESPA 3RY4A 3FO1B 5AWNL 4ZJ9A 4IGBB 3DUUA 5CILH 2IALB 5EZLB 2UY6B 4EN3C 5E5LA 1HS6A 4MX7A 3U7AA 3KYAA 2H32H 5D72H 1GGCH 2LTQB 4HU2A 3PWUA 4XCNA 5K9KB 1R33A 3FCUB 1O7SA 2ZF9A 3H0TA 3D9AL 4K3JL 4X7FC 3VGAB 1KCRL 2FB4H 2ESVA 4P2OA 1AXSB 3O2DL 3BAKA 2CDGB 4G6AD 4E5XB 1RIUH 1BQLL 1DJZA 2Z7WA 4YPGA 5CEXB 1GVIA 1IC7H 1FP5A 4WI0A 1T04B 1IC0A 2W9LA 1AQDB 4RDBA 3HG3A 3C08L 4CNIA 1SBSL 1EJ6A 4P9HC 2BP3A 2VMDA 3WOVA 1O9ZA 1NDTA 1KJVB 1RVFH 2GHWB 3FU7B 1SNRA 2MNUA 4P4KA 5D2NB 1IGTA 3WGUB 5HGBB 1ZLDA 5TH2A 4V1DE 2N4IA 3G6DL 3NFNA 3SQBA 4LEOB 3DJZA 2P5WE 3WTWA 2QR0A 2A9MH 1NM9A 4J3SA 1X5KA 2AJUH 1MCNA 2K8QA 2ENJA 1NMBL 1B2WH 3BQUA 3IDXH 3O6LL 4GKZB 1MJJB 2HFEA 5ID0A 1UWYA 3X1GA 3QXDA 4NBYB 3VXUB 2OPCA 4Z7UE 3GMOB 1G7MA 2YN3A 3ZE0B 2F54D 3DX6A 4LFHD 1MFEH 1NBZB 4ZXBC 3RTQD 1CDGA 3A67L 1NCJA 2Z8SA 3WD5H 2WKOF 5F96H 5JW5A 1AY1H 2C9QA 1ZTXH 1CR9L 3FRUB 4TLUA 4LHUB 3FAXA 1JRHH 4K5LA 2W94A 1QLFB 3ETBF 4F7EB 1GA2A 2ICWJ 2ID5A 1XR8B 4GXFA 2BP8A 4KKLD 4U1NB 3T8XA 2WBKA 4K9EC 1IV8A 3QJHB 4XTRC 3KYMB 4RFEA 4TQPA 3HR6A 2NDGA 3T9WA 1XB3A 3AG3B 2QHRL 2ZUTA 1M4KA 1FORL 1GPOL 4POYA 3V4LA 2P8LA 3VXOB 3ZRCC 4OKDA 5C0BD 5F8RC 1NFDE 3EYUH 1J5OH 2I9LB 5EBLB 3NJGA 1BLNB 3JT0A 5TDOB 1KG0A 1G43A 1N4XH 2UXVA 2X70A 4BE5A 3OKOB 4XCYA 1UACL 1QFUH 3Q1EA 3V6FB 2KZWA 3LKRB 1I75A 5E6UB 4NC2B 4ISVA 4H26B 5JHDB 1UXMA 3L3HB 4JM4H 3ILQC 1I9EA 1R75A 1TYJA 4YSUA 3QJUB 1PW3A 4KX7A 4NLAA 3RPKA 3NEXA 4GBXA 1H5BC 2YC1A 3MCG1 5JYLA 2AW2A 1KXVA 3AT9A 2IC2A 1IM9B 1LK3H 3CFJA 1FGNL 3PQYE 2P48B 3FU3A 4LCWE 4YFLF 1DVQA 1GZHC 1NGXB 4YHKH 5DQJB 3MLYH 1D9KB 2UZIH 1GMIA 4AYGA 1P6FA 5MEQB 1HNFA 3MRIB 2FX8L 1JZ4A 3DI3B 3I02A 1DQJB 3KPOA 3QUYB 2QSTA 3D12B 1F58H 5J12C 1CXFA 3EOBB 5L4IA 4OKVB 3TYFB 1WAAF 2BOCA 4GEJA 1KBVA 2EO1A 3VFSB 2YD1A 3FQ2A 1XF1A 3EYVA 2DYSB 1K4CB 3NJVA 3QDJA 4L9LC 4PLJD 1BJMA 3WS3B 5FYKU 2DQCL 1CD1A 3LRSA 2NR6D 4JY6A 1NCWH 1X9QA 1XCTB 4P99A 4H1LA 3T1FB 4XNMA 5J57B 1BZ7A 4KKAD 1IM3D 3MUJA 4QYAA 4N0FA 3QZBA 1E30A 2H1PL 3CLFL 3GFUA 1N8OE 3UABA 2YS4A 2Y7OA 3HR5B 3ULSA 5EMYA 1BECA 5EN2B 1J18A 2XFXB 3CPLB 2DQGH 3QJVB 5IFHL 4HIEA 1K72A 4QRAA 3T2OA 2FBOJ 4K55A 5BUPA 5TF1H 3N40F 2X41A 1W0WA 1D3CA 2R4RL 2GG1A 5AAWC 3VW3H 4OGXL 1E43A 1I7RB 3ZE2E 4F1SA 2J7LA 3BPOB 5DMJB 4ZFGL 4JKLA 3IGFA 3NZHH 2WTRB 3CFUA 1RUML 3HUJF 4E9SA 4B7IA 2EDBA 1E4XL 2KKQA 4K7FB 1YEJL 4PG9B 5ETUA 2HMIC 1ZT4B 4OD3H 3RI5F 5GGTL 3H6JA 1MIMH 4HWEL 1F86A 4Y4KA 3MRNB 4TOYL 1WO2A 3U36A 4L29A 2W5PA 3F04A 4IRSD 3ULUD 1P7HL 2VR3A 2EECA 3HN3A 4HWBA 4GJTB 4AENB 1ZDQA 5I1DA 3GMNB 1LK2B 5D7LB 4ORGA 4JGNA 3A3YB 1KLGA 2NNAA 2WZPA 2ADJB 1XF3A 2YFOA 4KV5E 4PTUB 4IU3B 1MWAH 4DF9A 3B37A 3VXRD 2GITB 2AEPL 1NAKH 4QRSB 3N1FC 2P7TB 5LB1A 3KVPA 4FAAB 4OZIE 3ZY7A 2YGQA 3JBG7 4QXVA 3GJFA 4P2QA 3JQOB 3C5ZA 5HJBA 1MDTA 5J6GB 2ICWB 1QVOA 3FUHA 4Y5XB 3DOSB 2C4FU 1IJ9A 1E5ZA 1Z6JT 5EPMA 4LSPH 3W9DA 4PTTA 4Z7QE 4N8VG 1S46A 5ANHA 3D25A 2E56A 2F08A 2YXWA 1DQQA 4UI2A 3QZNA 4NKIH 4P3WA 2NY6C 2OZ4H 3ZTDC 2MNJB 5B38B 4MTMA 1EMTH 3CU7A 3N9GL 4QEGA 4C4UA 1IEHA 4DW2L 4IS6A 1MCBA 5I18H 5IBLD 5E8PA 4HF5H 1BM3H 2EEXA 1I85C 2F7RA 2YUZA 3ES6A 4G5ZL 4PWEA 1OD7A 2N1TE 5GGRA 5GGRY 3BPNB 5E94B 2GK0B 5I1CL 5DLML 4FFYH 2V5RA 3CN3A 1NEZA 4XGZB 5I30L 1W8OA 3DBXA 1ZXKA 2O6CA 5KEZA 1N59B 3L4ZA 5D1XE 5IW1A 4POZC 2O6EA 4NFCA 4YEFA 2W0LA 1SJHB 4ODVH 5ICXA 2P5EA 4YVNA 4PGJA 4HS8H 3UX9B 3AXHA 1CI3M 3L3GB 2DWEB 5EV7A 2O5XH 4TTGA 3DPBA 1MI5D 1YPZA 4OY9A 3REWA 4HWUA 5D4HA 1A7RL 3BE1H 3IVKA 5K5YA 4HCFA 5B3JE 4LVOC 1XO8A 4DN4H 4X7TA 4R2GB 5HHNB 1S8DA 4FFZL 1LE9A 4MMZA 2BP0A 4TUUA 3GSOB 1ADQA 2OJZL 3FU8A 3KYKH 4OVUA 1A6TB 5H37A 3DURB 3VU2A 4XOCA 3GUTB 1IQWL 3KM1A 2I60H 1HHHA 5C0DB 4XP1H 2Y06L 1KBWA 1ZTXE 4UNTA 2FIRT 4PLNC 3QG7L 3OMAB 4NENB 5FGCB 4M6OL 1L0XA 2AQ1A 5HHVH 1TETL 1ZVYA 2LU5A 3BLKA 3CXDH 3QUXA 4XE0A 1A7QL 5ABDE 5C2UB 5JOFA 4QRUB 4GG8B 4X9YA 2EIBA 2WYZA 2XDHA 3BKYL 2MKLC 2IWKA 2X3CA 3BZFA 1JWMB 4ADGA 1MFUA 2J8UB 1P7KB 3EZ8A 3V8OA 2Y07H 1FGVL 4Q0XH 2ESVD 2YJLA 3FULA 1HOEA 3O9WC 5C07A 4B50A 2K4AA 2A9CA 3L95A 3SZKC 4LAJH 4JFXB 2BERA 1OGSA 2LFEA 3MOQA 4XAKE 4XC1L 1PSKL 3B2MA 1A6UH 1XIWD 2QSVA 3EGSA 2B16A 3UJJH 1X5JA 1VGEL 5SWSD 3CSYA 4LIQL 3AB0B 2XTJE 5E8NB 4XXCC 3LTVA 3SDCD 2BFVH 2WVTA 2HUHA 3RHWF 3VWKC 5DURD 4QF1A 5LO7A 1X9UA 3QR2A 4WO4B 3TWYA 2YAEA 1HINH 1QSEB 4WW2A 4AYSA 4ADIA 4PI0A 1XL6A 3OAYH 3V0IA 1I3RA 3US9A 2H3NB 3IXTB 4K07A 5F7LB 3FQUB 1G9MC 3JV5A 3BDYH 3P02A 3QJFA 3HZKA 2AI0H 1E9QB 1RY7B 4NM8H 4U7KA 2CK0L 4YNYA 1MH5A 4YAQB 4NSKB 5ALBH 1FL5A 3TPUB 1NM4A 3IF1B 4FTVE 4HS3B 3S3CB 3PHQB 4UIKH 5FO7A 2ZP9A 3RU8H 2GJPA 3BSZL 4N9GA 4HKZB 5I8OH 4KITB 1TJHL 1O6VA 4JANB 1ZHLB 4W9IC 2IAMB 4EN3A 3O45A 4HVBA 4PJ5A 1IAOA 5DHVB 4P9ML 2RTTA 1VKXA 4N2FA 4NM4L 2HJLB 1KT2B 4LBEB 2WBWB 4Y5VC 2JB6A 5CEZL 2DMGA 1KCLA 2EH8L 1N6UA 4N0UB 5EIQA 5FHBL 1I8IA 4HWZA 2FQEA 1DBMH 3K5RA 4UBDD 5JXAH 1IQDA 2QZ5A 3CDZA 3MTRA 4U1SB 2APWA 2RB8A 3MA9H 3GWJA 4K7PL 2KYIA 1S9KC 5JQIB 1FNEA 3U6RB 3R7QA 3FUKA 2R56H 1XGUB 3CSFA 2HRGA 3ROLA 2NXYC 1R0AH 4JO4H 4FJ6A 3K6NA 3GIZH 3KLDA 1HC1A 1CGXA 2X4QA 5FFOA 2A2QT 1HE8A 3VGDA 2AV7B 1HN1A 1U8MA 4YIQB 1KGUA 3DUSB 1OKEA 4B7LA 5DJ6B 5E2UH 5TJWK 3GBNL 2JJSA 2FIKA 3ATDA 5BCAA 5FUCE 4U6XB 3SGDH 3ZE0F 4F7MA 5B7MA 3VX0A 1PQZB 4L3EA 5J9PA 2E8YA 2HPOA 2OXHA 1U8LA 5DD1L 5CP7A 1GYUA 2XA8H 5JHLH 2W60B 5FK9A 4L0ZA 1JHLH 1KIQB 3NJFA 3MXVL 1UD2A 1EJOL 2DWTA 3SKMA 5C0AA 5GS0L 1GS7A 5FKAA 3AG1B 2P1YA 4M7LH 3UAEA 3ULVC 3GI9H 1NPNA 1TQWA 4WVRA 3SE3C 2OSYA 5KBPA 1AD0B 2HT2C 4JRYD 4Y2DC 4AGQA 1CB4A 1KTLB 2CQVA 3NJKA 4QXTA 5K93A 3OXSA 4G9FE 1IEAB 3C5SB 4LB8A 3FTVA 3ME0B 3Q2VA 2OMWB 4DHLA 1WISA 1AHWB 4XWOD 4FZ8H 1FNHA 1AYOA 3ZQXA 3RWCB 3ZTNH 3C6SA 2G9HA 3HG2A 1BP3B 4O5LH 2GB2A 3P77A 3QAZB 5HD8C 4DSYA 2IBGA 4J27A 4J2QA 4JZJC 5KYYB 1YMME 4OCWH 4PJAB 1H3UA 3LB6C 4GI8A 4M1CC 1DQDL 1NMAH 2IWFA 4F57L 1DEEA 2IH8A 2OXGB 4MMXB 2IV9A 1S9XB 3WUZA 4WJ5A 1AGBA 3DTXA 3KZ8A 1WFMA 2YPVL 2C3GA 4ZUUB 3GRWH 1GZHA 4NWTH 1AE6L 1J0IA 4RRPM 4XHJC 1CF1A 1OB1A 2DJUA 3SGKA 4TUKL 4MD4B 1T1XA 4OZHA 1KCSH 2W0FA 3KDMB 4Y4KD 1TZHB 2HLFD 2YJQA 4GXVL 1HFUA 3M17A 3QPQD 3MBWB 2J2ZB 4R97C 3V0VA 3CHOA 1QWHA 5JW4N 1SYVB 1HL4A 2VERN 4HJGB 3M46A 4LF3B 3UTSB 5JDJA 3H3KA 4YHLH 1J0JA 1FL3A 5E5MB 5I71C 3HG4A 3RWHA 2XN9E 3AREA 3ASOB 3HVNA 1N3NB 4L9LA 4OGAD 2IVFC 4P04A 4M7JL 1FFPB 3OWRA 1IGIH 1PNDA 1LHZA 1HXYB 2Z31B 2PWDA 2ZJSH 4G7QB 4M8QA 2V5YA 2FT7A 2XZQL 3VFTA 3RKDC 2F1AA 4X6BB 3IDNB 3WO4B 3T3MB 3C5ZD 5AKSA 2VR6A 3GD1C 5EU6E 5J6HB 4ONFH 4Q6IB 2R7EB 2Y7QB 4HEMA 1A4CA 4A6YL 3TCLA 1OM3L 3VFWB 1A3QA 3T4AC 1JNJA 5AD0A 4KZ0A 5ESAB 5ANMB 3ZYIA 1EV2E 1FZJB 2PYEA 4OF8A 4Z7WA 3RIFF 5I6OA 4DPRA 1OP5H 4FQXD 4HUMB 1HI6A 4KKZA 2CLRA 3DYOA 2ED7A 4NLHA 3ARBA 1OPGH 1ZSHA 1FFRA 4X6DB 2APVA 3EO9L 4HT1L 4NBZB 5JHAA 3EBHA 1YCSA 3VXMB 3TEUA 4YO0A 4C54A 4X4YA 5I1AB 1G6RL 2BMKB 5MP6L 5A3IC 3DMMB 2R9HD 1L9SA 4LMQE 3T5WA 4U1MB 2A6DA 5CGYD 4M6NL 2OZNA 2XBDA 4QRFA 4PVMA 3UG5A 1TCRB 1JXFA 4JO3H 2WXFA 2LAGB 3FU6A 1HXKA 3HC0B 4UV7L 9CGTA 3ML9A 5MHSE 1UOLA 2V5SA 4GQ9H 3KVQA 4Y9BA 1A4JA 1WAAA 1AJ7H 3QUGA 4YC2B 3RVVD 3BWUC 1S9YA 1OLLA 1UD4A 2CHWA 2GTWA 4PRNB 4WDIB 5EF3A 1TYEB 4X42A 4PCYA 4GW5B 4LRIC 3DIDA 3KPTA 4A04A 5CR1A 2GTQA 3QEHA 1E28A 5D7IA 5FIEA 4Q2ZB 1A6AB 1S2EA 4ZQKB 4EI0A 4O9HL 4ZFOA 1KCRH 4RMVA 4F8TA 5GS1B 2Q7NA 5CJ8A 4LNVA 3DGGB 4FFTA 3O2DH 4PWIA 2E86A 3FB6A 3ZZQA 2KQNA 5TQ0L 2CNYA 1MAJA 3LQZB 1HZLA 5DZLA 4YL4A 3TYGL 2AZUA 3OKMB 4F2MB 2XXFA 1BCIA 1NCNA 1DFBL 2A1WL 2J1KA 5E00A 1AKPA 4ZX3A 4OF5A 2FGWH 1YYCA 4YDVA 1BZ8A 4P5TB 1KTDB 5C0GA 3TX4A 3L2MA 1RIVH 1UA7A 4HLJA 3RZCA 2BIQA 3G6DH 1DSYA 2B3RA 2X12A 3VFRB 3BWZA 1I53A 2F58L 4PGBA 4DP1X 1BFVL 4PY8J 2Z91A 3K2MC 4PLJC 1J5CA 4M5ZH 2ED6A 2IQAA 2I32A 5JXED 1HILA 2NR6C 4DQOL 3HZYB 1MHCB 4LSVL 4GMSH 2FBJH 4R96B 2AFNA 5C09E 4A2MA 3LKOB 3A67H 4MVBD 4X4XB 5CLYA 4AZ8B 2DMCA 4Z7IA 3UPRB 3RFZC 4CU8A 2I24N 4N0CD 1S7UB 3D85A 2DIBA 4LFHG 5IG7B 2ZPKL 3ZKQD 3ETTA 5DJ8B 1M3JA 3CFIC 1CFTB 4BZYA 3FSZA 5JPNB 1XTLA 1FORH 3RL1A 3T2PA 4DTGL 2X7LB 4Y16B 5D8JL 3PHOA 3SYOA 1UA3A 1NKRA 4JUSA 5F88B 4LAQL 4LZKA 3TS8A 3GK8H 4HX1B 2Q76B 3RX9A 3ESOA 3DA0A 3NIFE 1T5WB 1NC4B 2BVPB 2O5ZL 2A6IB 3U4AA 5B1KA 3VRJA 1N2RA 1TQTA 5C0EB 2BNQE 3PIQB 3BZEB 1YEEH 4YHPA 4U1KB 1DLFL 4CJ0A 3SE9H 1CFNB 5J11B 4Z3GA 2ERJB 4IRSC 1CWVA 4IQHA 1HQRA 2PN5A 3S98A 1RZJC 5I66B 4I2XB 5B21A 3GSVA 4GRMA 1UQSB 1FGNH 3MJ9A 2V9RA 3S4SB 1G7QA 1UOWA 3J2PA 3MRRB 3QXAB 3KPNB 5C0FB 4M1DL 1P6WA 4NAJA 4ZNCD 1U42A 4GQRA 1FWXA 9PCYA 4MNQB 1NDGB 2OSLB 2J8UF 1LNUB 4MCYB 4RFOL 5DZOA 1KCKA 1LWJA 5IHLB 5DMIL 3SBQA 1GC1C 2Z92A 5E9NA 2GFBA 4HQQH 4WI9A 2JI1A 2ZX9A 4ADJA 3DHUA 5F0LB 3RPBA 1I9JH 2G2RB 3GB7A 2DEWX 5D70L 1Q38A 4FXGC 1AMYA 3EF7A 2YBRA 3JTTA 3MGOB 2A73A 2WXNA 3FT3B 3APMA 4A6YB 1A8ZA 4HPYH 4JVWA 2DTML 1BZ9B 2ORBH 1DVFD 2XXGA 3O11A 4DNLA 4L3CB 5A2CA 5JHDE 1E5AA 4XXCA 3VGBA 5E56A 3U46B 1C8PA 1S7WA 2PPFA 2ZYRA 3HNSH 3FFCA 2J57A 3VWKA 2FBRA 1U3JA 4DO4A 1C5DA 1T5KA 3LZLA 4XN1A 1A0QL 3H53A 3NP4A 1PX8A 1YECL 1LDPH 3MRQA 3C09C 4TULL 5T1JA 2RALA 1B88A 4KTEL 2HWZL 4LOUC 3AADB 3HEIB 1G6RB 1KTKE 5GRXG 3BZ4A 2AITA 4PRHB 4MGXA 3H9HB 4ZOAA 1XQ4A 4GLRH 5I1KL 3QXUA 4DVRH 4TPRL 5GRWA 4Y2LA 5ERWA 1KGCD 5CINL 4C4BA 1BFTA 5T5NF 1E2VA 4OV6F 3ARWA 3CZFA 3MV9E 1D6VL 3E2HB 4L1DA 4ZMNA 1KJ2A 1S7XA 3KXFB 3P4NB 3ESNA 3RURA 1COBA 1AQKL 1YEJH 4GQPH 3LH8A 3FONB 4AGLA 2NT1A 1CGYA 3QCUL 4MA7H 2N0KA 3JWNH 4LLVB 5GGTH 4G7SB 4S0TD 4JLRB 4TOYH 2VKXA 5IMMB 2VLME 4EZMA 1KBPA 2KH2B 3ARFB 3BDXA 3N1GC 4OZ4A 4JQVC 4Y5VA 5E99L 3KNBA 1SM3L 1CVSC 3A6BH 3VCLB 4ZAKA 3DVGB 4HS6A 4KI5E 1X5XA 3QCTH 1YY8A 4GSDL 3FT0A 1WFOA 5DHVH 5FV2A 3FTYA 4F2EA 3UMTA 4ZX5A 2IANA 4UM8A 1WBYB 3RL2B 1I7TA 4FFWC 4N6QA 1HAWA 2QQQA 1N0XH 3EOAA 4NNYA 2D3NA 1ZDSA 2CLVB 1JJUA 2KT6A 2P45B 5D6DA 5E1QA 4A7UA 4ACPA 1FF5A 2WAHA 4CILA 2NNCA 1NUFA 5AUMB 4U1JA 4PJIA 3TM6A 3ABKB 4UQIM 1X5HA 1ROCA 4Z7OB 3CN2A 5AOMA 4AYBA 2FHBA 4UQDA 5ECGA 3GSQA 2J43A 1UM6L 4N28A 3T3PB 2K70A 1VCAA 3D05A 5CHNB 1TR7A 4I0PD 1F3RB 5HVGB 4NQDA 5T1DL 2GY7B 4AE0A 2FQDA 3WFDH 1OALA 1R6VA 1T0NA 3BX7C 1CLOL 3FO1A 3SO5A 5KYUA 1A9VA 3PABB 4IGBA 3N9GH 1XIWC 4QOKD 3EYFB 4MJIB 4OGYH 4RGMC 4KNSA 1T7VA 1UB5A 2F53D 3OKYA 3OL2A 4OCXH 4QDGA 4BFIB 5D7LE 5F0JB 4HALA 1MCOH 4LSQL 1E7UA 5EIIA 1XGRA 5LXGL 3HLAB 3M7OA 1EAOA 1I1YB 1LL1A 2Q8BL 2IG2H 4AEIL 5GGVL 1YEIL 5DD3L 3VQ1C 1RQ5A 2NY7L 4E5XA 3SE3A 3ABLB 4JFHE 1NEUA 1XAUA 1ASPA 4NC0B 2VDKH 4AEHH 3G5VB 1JXJA 4XAKD 1P84J 1ASOA 2P5PA 4Y2DA 2X89A 4J8QA 3NIGE 4KO6A 2I07B 2YQGA 1Q0YL 1T0PB 2QT6A 5JO5B 1F97A 8FABB 2FJHA 1JUFA 3NJMA 4PRIE 5D2NA 5HDBB 4HCRL 4PJAF 1CF8H 3U4EB 4AQ1C 1JN6B 4K5OA 1KTRL 3R1GH 1PVHA 3X1EA 1LD9A 2HG5A 1HZHH 2XWJB 2ATPB 4UAHA 1OW0A 3US1A 1FA4A 3IMRA 3GSRA 4GKZA 5ALCL 1MJJA 2YSSA 3R06B 2FQFA 5EU4A 2VXVH 4RDQF 1WQVT 2ITDB 3L3IB 1A7QH 4FKKA 5CJXC 3PDGA 1UCTA 2ZXBA 3PP3H 4I77L 5F9WB 2Z0UA 1ZLWH 4PR5B 1UZGA 1B6DA 1FNGB 3IJ9A 5IJVB 4ALAH 4YN3A 1MFDH 4RAVA 1K8IB 4LHUA 5ENWA 1TZIB 3EH5B 1AQMA 1Q1JH 1TNMA 3PGFL 5F0MB 2E7HA 3QIWC 1XR8A 3BP4A 2OK0L 4XNYH 3U0WL 4GG6A 1KLUB 3KYMA 1SHXA 1H8LA 2WWMD 1FGVH 3EYQD 5EA0H 4K8RC 2YEZA 3W57A 3C75A 5CBEB 5C97A 2EH7H 4PFEA 3OKEB 2WD0A 2B9BA 5TDOA 1CXEA 3T3MF 4EI5D 3ZPDA 1XF4B 4LLMB 3OKOA 3B7UX 3SBWC 1ZHKB 3KGRA 3LKRA 3ZL2A 1FLRL 4DP7X 2NZIA 2WBJD 2DPKA 3WFEH 1G7JA 1UFGA 4DP8X 3HS9A 5AZEH 1YEGH 3IDJB 3L3HA 5FDWA 5CCJA 1VFBA 2WQRA 1U6AH 1CTMA 4HPOL 5AZ2H 1GZQA 1GGIH 1YN7B 1JGEB 4NKQB 5HY9B 3B34A 5AVWB 3NIDE 4EVNA 4B27A 1ZPUA 3QS2A 3EFOA 3F6LA 3OKKB 4NJ9H 2Q6WA 2WB1A 5DQJA 3HE7C 5DK0A 3TT1L 3MRBB 2OL3L 4JZOB 5L2KA 1FYTB 5LDSA 1UOKA 3LNGA 4ZUTB 2A9NL 5I19H 4JFVA 1KLFA 2UZPA 2FK9A 2G60L 2K7PA 4OKVA 4HZ1A 2X0WA 1IGMH 1I7UB 3QDGB 5HDQH 1MHEA 2XA3A 4B5ZA 1XR9A 4XWOC 4AX3A 4GSXA 1A9BA 5HHOB 3PL6D 1TJHH 2DQJL 5F3BA 1K4CA 2EVIA 3QQ3B 5MEOA 3TNNB 3WN5B 4FNQA 1OGAB 1LO5A 1XCTA 1Y18B 3JYCA 4HPHA 4HXAH 5I5IA 4C56D 3C2AL 5I1HL 4PLKC 4JFFE 1UT1A 2EH8H 2K1MA 2OP4L 1OCWL 1UGKA 2DKUA 2WBXA 3VD3A 3HR5A 3K6DA 4W9FC 3BP7B 3MJ7A 2P42B 1ZV2A 1Z9LA 2D4FA 5HPMA 1WZAA 2XFXA 4K3GA 4AYFA 1JK9A 1X9RA 3MLXH 4JR9H 2VZVA 1FJ1A 3L7EA 5C1MB 3BGMB 4W68A 1YMMD 4NN7C 3Q9QA 3JWNE 2XVLA 4NO3A 3QPQC 1GOHA 4R7DA 5AEAA 5E08L 3HHSA 4CL7A 2GT9B 3X14A 5KSAB 4CADB 4AG4H 1CQYA 4KXZH 1FSKB 5M94B 2DQHH 3QFJA 2WTRA 3LD8B 4OZGE 3SQRA 1X7QB 2J73A 5TGBB 2OMTB 1L9OA 4PG9A 3R7RA 4ZMOA 1Z5LA 1ERNA 3AG4B 3MODH 4XOBA 2YXMA 1NGYA 1ZT4A 3BDBA 3CFBB 2RCSL 3MV7B 4R4NC 4U6YB 3WJMA 3C5JB 2X1QA 5LHDA 2VXSH 4IKLA 3H4FA 5DWUL 1PKQB 3VD5A 4JFEB 1ZGLB 1BQUA 3BJLA 5C71A 3MFGB 3MQIA 3E6HA 3CHXA 4RMRA 1U8HB 4XBPB 1LEIB 3IDGA 5I1GL 1F4WL 1G5GA 2FR4B 2QV4A 3JT2A 1HHJA 4L4TD 2QADC 1EO5A 4PTUA 3RFZA 2D3JA 5BRZB 1KEGL 1NGZB 3NRPA 2GITA 4I48B 1AP2B 4PB0H 2OMZB 2XACC 3GMLA 4JM2C 2YLKA 3RJOA 4MNGB 1FV1A 4FJYA 5BUAA 3S7GA 2AJXL 4M29A 1PL3A 5SV4A 3FYIB 1C12B 1CE6A 3GNML 4UILH 3BVNA 1CGWA 1NUDA 2JKLA 3PGDB 3U1SL 3II1A 3FU9A 4RMBA 2YD7A 1RZFL 3CFNA 3GXIA 4FERA 4H0HB 4D7PA 4FTDA 4Z5RA 3P0VL 3QDMD 3WLBA 2RACA 4JKMA 2FNBA 2ICEB 5DC4B 1F90H 4ECNA 4TS6A 4EBQL 1U30A 5KN5B 2NY3D 3L7FB 4NO2A 4IRZL 2E8ZA 2WXLA 1DQDH 4HW6A 4V33A 1XF2B 4PI2A 2EKSB 2WO3B 4WUUB 4BZ2A 4N2GA 4YHNB 2G4GA 3LEVH 4KRPD 1HSBB 2UWEA 2Y36L 4CVXA 1QTPA 4LSUH 2J1YA 2VL4A 1OTUD 4XBGB 1L5GB 3RAJL 2YPVH 5I1EL 1QFWM 4OJCA 4AIEA 4HHWA 2K4WA 1DDHA 1EAQA 1MW0A 1XFPA 4NP9A 1NLDL 4XO4A 3SKUD 1Y07A 1CIUA 1KYOJ 3QWRA 4DZBA 4JPIB 2PUQT 5MHSD 1XGTB 5CD3A 3V0HA 3HAEG 1LO2L 4PJCE 3DV4B 4JFSA 5IOPA 3NACL 5EZIH 4UOW0 1E5BA 5FO8B 5AW6B 3EHBC 4LLWB 5FGBC 4X7DC 5DS8A 1A1NB 2CCWA 2XV2A 2CNZA 4B3VA 4FXGA 2IO5A 5ABAA 4OI8A 3WUWA 2X1OA 3ZSTA 2ZUQC 1CLVA 3PP3K 2I7SA 2EKJA 1ZT1B 1E3ZA 4M7JH 5HHNA 4HDIB 3RWFB 1AR1C 1I8UA 1PYWB 4F1ZA 4PJAE 2FNWA 1A6TA 2GBUA 3DURA 1R3JB 2A83B 2D7TL 2YPKB 5C0DA 3L4CA 5I6XB 2XG4A 3QEUA 2OL3B 4HFUL 2OMYB 3EJUA 3MMEA 3EDEA 3QUML 2ZXWB 3U9UA 3OB0K 4XNAA 1ZXQA 2BRRH 4MVBC 1X5GA 3VFVA 2F19L 5IB4A 3QE5A 3FUFA 4EDWH 2NX5A 4TUJA 4IGBD 1NMCB 1SDYA 2G3XA 4Z7VB 2XWTB 3F83A 5I16A 3CCHA 4FMVA 2CRZA 2NZ9D 4LEXL 1QHPA 4FXTA 4UUJB 4G5AA 1KB9J 3UTSE 1M7IB 4QHKI 1KGJA 4APQC 3MRFB 4CA4A 4F7TB 4O02A 1FVDB 3BP6A 1OAUL 4PREA 5D7HA 4RGOH 3EYOA 1UZ6F 4OLUL 5EWIL 2P8MA 4M7ZB 4UQ2B 3CZEA 3IGAA 3U2JA 1J1PH 3T3ME 3CMOL 5F71A 4UNVA 1OF2B 4JQVA 4MHHG 2VITB 4E0RA 4UAOB 2CR6A 1TMQA 1AKJB 2F5BH 4LGPB 3ARGB 5F7FA 4Z3TA 3TN0B 5FECB 3F7RA 4X5XA 3VTMA 5AL0A 4WO4A 4N6RA 1QSEA 5EF2A 4J1UB 3IJYA 1Z3GL 2XN0A 3TYGH 1QEWB 3GMQA 4Z7OF 2H3NA 2AHIA 2VLRB 3IXTA 4YDJB 2QELA 2DM2A 2WNGA 4P46B 1MREH 1H3XA 4OFDA 1E9QA 3LRHA 4TSCL 3T3PF 1VADB 5CCKL 1MFVA 4P5RA 3UBXA 2HRLA 3QS3A 1J8HA 2IH3B 2YN5A 3CHPA 3MLWH 4NSKA 4RQQB 4YAQA 3W81A 5BV7C 3VXUD 4KOCA 4L5FL 3TPUA 4FN0A 4W9DC 2OMUB 4HS3A 4FQ1H 1E5CA 2O30A 1L9TA 4C8XA 1WGVA 4JPSA 2F58H 5GSVB 2A6KA 3IU4H 3KLSA 1GHFH 3MCYA 5KUMA 3EOTL 4LHUD 3WXWH 5ESQA 1R5VB 5F7NC 4ZRGA 1KIUB 1ZHLA 1WD8A 4A7GF 1HZKA 4EIZC 5JUEL 1DN0A 3H9YA 5LDUA 4S10A 1BG9A 4HJJL 3TNMB 1ZVNA 4FGMA 5EZJB 1D5XA 3CE1A 3RVXD 1DQML 4NKMB 5M7QA 3HS0C 5HXMA 1CDCA 2PPAA 5I6PA 3INUL 5HVHC 2GAZA 1I8MA 4I1RA 5KJ4A 4FX5A 2QSQA 4D3CH 1CDHA 1I7ZA 4NN5C 1ORSB 2E6PA 3NSJA 5FWQA 1VPOH 2H0JA 3D50A 4QRQA 5I6LA 1EFQA 3X11B 2KLRA 2P52A 2YPLA 4GO8A 4KROB 1KC5L 2UY7B 4OD1H 5HDBF 5JHDD 5FAAA 3FTGB 3UZQB 1T1WB 3UBFA 4OBRA 4HOXA 1XGUA 4UDTB 1QW8A 5D8JH 3UTQB 2H45A 1Y6NR 3FOMA 1IM9D 1X9LA 1RJLA 4N4YB 3GZOA 1NCAL 1J86A 3DK0A 1H6FA 4I18C 3FQ1A 4Y1AA 4DIXA 4ATTA 3DNKA 2TRHA 1D9KD 2R2EB 5DJ6A 4ENZA 2DIAA 2IADB 2Y3AA 3ZHDA 3ILPB 3KJ6H 1EDQA 5D1XC 2W80C 3QUYD 1II4E 1U92B 4GRLC 1E4WL 4KQ3L 1W0VB 5F89A 43CAB 4J3OH 2AXGB 2J6WA 3ZO0A 4LLAA 4Z9KB 4X9GA 4P2RB 1VF5C 4FQQB 4UT6H 3MNVA 2IXQA 2OCFD 1CJYA 2QTVA 4FULA 1CFSB 3KLKA 4PV8A 1S9WB 1T6BX 2HFFB 2XXCB 5I8KL 1CL7L 1UZ8B 1TTUA 3QRGH 2VJXA 4FFZA 4RWHA 5EC1A 3NGBC 3I9AA 3CFMA 3PNWB 2WYIA 1GZPA 2EEFA 2EYRA 2LFGA 2YGPA 4QCIA 4YSQA 3D0VB 2WLYA 2VDPL 4M3JA 5D70H 1JTTA 1QRNE 3FC8A 3P3YA 2R1YB 3DTDA 2BS71 5C0JA 2FO8A 2OR8A 4ZS7H 3UEQA 4PV1C 2OJEA 2GIMA 2OSWA 3LCYA 1QFWI 3SBWA 3GRGA 4PJ9B 2G5UA 3QUMB 5CLWA 1A6ZA 1QBBA 4M4RA 4MYWB 4TVPH 1AOZA 3MKGA 4DKEL 2FX7L 3SD5A 4AE1A 2DS4A 4ODHH 1QTSA 1D5MA 4H8UA 4RA0C 3GEWB 3A4EA 5I75C 3IGLA 4UDUA 2EYTB 3FT1A 3ZX1A 1PKOA 2HWZH 3R8QA 3UAJA 4OV5B 4UNIA 3EH4B 4NZDA 3V4UL 4AOFA 3HE7A 1Z2KA 4MD4A 1Z9SA 2J4WL 2YRLA 4O2FA 1AYRA 4TPRH 2NRDA 4GS7B 4R3SB 4XMUA 1QKZL 3OXRA 2BHFA 1E4KA 4L8SC 3TZVB 1TT6A 1JF1B 2XTJC 1U8QB 2J2ZA 4FG2A 1WAEA 5D7LD 4XE5B 4LOEA 1SYVA 4NT6A 1WPCA 3GXDA 4M62H 3V5KB 1N3NA 2JKTM 3DDGA 2H3XC 2X1XR 2XUWA 1BVNP 2E6QA 4RBPK 4BCXA 5A2FA 4JFHD 1AMXA 1FFNA 5EEUA 4XP9L 3GEFA 1ETZB 4Y4FB 2CKBL 4P06A 2NUTB 3H3BC 1SEBB 2PR9A 1KCUH 5E1AA 4Z0XA 2AABL 2QBWA 3G5WA 3IJEB 3QJOA 5KS9B 1EXHA 5JW3L 1IJNA 2R7EA 2CUAA 2WXMA 1R3KB 4HLEA 1NCIA 2BW4A 2FYYA 1CK0L 3X3FL 1OT1A 1R5IA 3R0MA 4NHCL 1QLRA 3P0YL 1FBIL 2HJKB 1ED3B 4JFZH 3QORC 1UG9A 4XMLH 4F9PC 4YHYC 1KELH 4XPFL 4ODTL 4JPVH 4X6DA 5IJKC 3BSZA 3U0PB 5M95B 3QPKA 5DJ2B 4Y2NA 3VXMA 4S11A 1BBDH 3E1F1 4JCMA 5T3ZH 1S3KH 3VSVA 2VZSA 3DMMA 2WWMC 1NWOA 3EYQC 4W9ZA 1SJMA 2IQ9L 1GXEA 3FQTA 3QWRD 1HU8A 2WIIB 3WFHB 1TCRA 3T0EB 3W11D 3TFKD 1G7HB 3QEGH 2MWCA 4XMKL 1XCXA 1P1ZB 1DBJL 3Q01A 5D1ZC 2Z93B 4ZPVA 1IBGH 3KR3L 5AW8B 3ZDZB 1KDIA 3EG9B 4DPCX 3LRLA 3ZL1A 3LIZH 4PGCB 5L8JB 4PRNA 2WBJC 4LOFA 3BO8B 3RBGA 3B7YA 5L4MA 4RGNB 5BW7C 1H3GA 2W91A 3UERA 4X5LA 2PCPA 3GMPB 4OZFA 4Q2ZA 4EUPG 1CE1L 1F1AA 2EVFA 4X99A 4R2GD 4PYHA 1DN2A 5D7JA 2XBTA 2P5WA 5EOCH 3GZPA 2XWCA 3LPFA 4JM2A 3KL0A 3VGHA 4BWTA 3P4MB 5FUCC 2K45A 2WUBL 1CDBA 4Z7OE 1F02I 3DSNA 1TMCB 4GQQA 4PJFE 1KTDA 4HCRH 1EZUA 5DZJA 4Z7UA 1MCWW 3B8SA 3TH2T 2BVOA 4M43H 5AAMC 3QULA 4Z77B 1EFXB 1HJCA 1HL9A 1AHMA 3PL6C 4L0PB 1AO7A 3MX0B 2GJ6A 4D0CB 3IMWA 4WZ9A 2JXMA 1JNNH 2XQYK 1GAFL 5FYJL 3IDIB 1JZDC 3GSWB 1DVXA 3MV01 1EHXA 4A67A 5C3IA 4TSBL 4OCYL 1ZD6A 5CSZB 1MJ8H 1G0DA 2DH3A 4FG4A 1TTBA 2CCLA 3B7SA 3MNDA 1BBJB 1W2KT 1JDAA 1NFDA 1CGSL 1WA1X 4X4XA 4XAWL 3H42L 1X5IA 2VDPB 3HNTL 2D9CA 4GYBA 3UPRA 1FH5L 2CPCA 4KJYA 4BH7A 1PMYA 3MLRL 4B95C 2D2CC 1K8DB 4FQLH 4OCSL 1U3HC 1OAZH 1MLBA 3U0WH 1YUKB 2Z3FA 3TO4B 3AWFA 1O75A 5FGBA 2DM4A 1A1MA 1RXLA 1CFTA 1GYWA 3HZVB 3FQXA 4JY5L 1NH6A 4MZ2A 3K2UL 5IROC 1BOGB 4BQ6A 1CZ8L 4WO4D 3ARDB 1QSED 3UJIH 2AF2A 3IDYC 4GAJL 3CC1A 2Q76A 5DU7A 5IK3B 3BUDA 3GHPA 4NQSA 1IGCH 3PQYA 4LCWA 3FB5B 1QBML 4UOJA 2BVPA 3SPCA 2AXWA 2I25N 2AQSA 2R0ZH 5DGRA 3D4GA 2DL2A 2YAHA 4U1KA 4DUVA 1CFNA 1YYLL 4KXAA 1D6EB 1FNSL 1LO4L 2OYLA 4G1MB 4ZMPA 3FQYA 5DUMH 5I66A 3W2DL 5HI5D 1JNLL 2QSCH 3GC3A 3GKWL 4Z7VF 5JHBA 1NEPA 2AEOA 4AXWB 3S4SA 1X44A 3V6OE 3RP1A 2VISA 2VABB 3TT1H 4JDVA 5ITBH 2OL3H 3BPCA 4JKPL 2L7QA 4KOBA 5LBGA 1NDGA 2IAMD 2VW6A 1LNUA 1MCIA 2WW8A 3KPSE 1G1OA 3HPLB 2UZYB 4F7PA 4XVSL 4N86A 4UTBL 4AM0A 4GUPB 1TLMA 3QEQB 1TZ8A 4GP8B 1L7TH 4XVJH 3S97C 1AZNA 3T2NL 1S9VB 4JHZA 4TVPE 1IIKA 4AQOA 2D31A 2XI9A 2CKBB 2WLZA 2ZOWA 4MB3A 3U7YL 4S1QH 5A16A 5I17B 2JNZA 1TSRA 1RUKL 1EZVX 4NFDA 2DQJH 3QWQB 2NMSA 4UT9L 1Q9WB 1L0PA 3FT3A 3RWDB 5CD5D 4NRYB 1CI5A 5JPMB 4A6YA 1REIA 1RZIB 3MCLL 4XVTL 1CUOA 2E76C 3JVFC 1U8CB 3BW9A 4ONGL 1WA0X 4U3CA 4XNXH 5F7BA 3SYQA 5DUPL 3TCXA 3MLSL 3ATEA 3IRCA 4LK4A 1SXZA 3D6GA 4BRVA 3FYEB 4KRPC 4R5VA 2VXQA 4WU5A 1OCWH 2XKNA 2ZSVA 1HCFX 4PIBA 1OPOA 2X4PB 3L4UA 1KBBA 1W80A 1RMFL 1MWOA 4X50A 3ZHLA 5DVKA 3VB8A 2XX0A 1G6RA 2BSRB 3F85A 5DUBA 4ZNEE 1VLXA 1SQ2N 2JQAA 5F7DB 3RNQA 4IOIB 4OCRL 5BJTA 5ESVB 2AKRB 1I8AA 1QTYT 1UT9A 3SBRA 2IGFH 5C0CE 1M2VB 1HX0A 1UUSA 5C9KA 2EDHA 2X53A 4JCWA 4BFBD 4X8GA 3MTXA 1BYPA 2J25A 5EUOF 1E4JA 3ARUA 5HHOE 3RX8A 4XZ4A 1W15A 1KXQA 1T2QL 1KOAA 5EORH 4U31A 5BMFH 5E24E 1XGPB 4WNSA 3FT2B 1V3KA 3W39B 4G8GB 4QJ3B 1DJHA 3I50L 4X6EB 1V8HA 4MJ6B 1ZT7A 2VLJB 3DC0A 1AZVA 3Q44A 3IKCB 4AI7A 2VSDA 1MFNA 2E9BA 2HH0H 1SYSB 3IFPA 5E4OA 5DZPA 3U30B 1WD9A 2WLIA 3NSXA 5JZ7D 2XY2A 1UD3A 3DXAE 4UYPA 5DI8B 1F13A 1DUZB 1XX9C 2H32A 4RNRB 1KEGH 3K7UA 5T3ZE 1CLYL 5IVXB 1WBYA 3FTXA 3GSUB 3NCFB 3GI8L 1P84K 5HVWA 3T4YB 2XETA 4GY4A 1FIGH 2AJXH 2AQPA 2GYSA 3VWJB 3GNMH 5AUMA 1GW6A 1ILSA 3TEYA 3ZYZA 4F93B 2LTQC 1K3ZA 5IR1B 4XH2A 4R84A 3QQDB 1BF8A 3QNYB 1CPUA 2CHDA 3BPLB 3WY2A 4FXLA 3VGAC 1NCTA 2UZXA 1UM4H 3MV8E 3HKZA 1AGCB 1PLAA 2I26N 3ARPA 4AGNA 5DJXB 1RURL 3GJEB 3HN8A 5DTFA 3B6SB 1X6NA 2P44B 2XRAH 4JKNA 3UAAA 1FZMB 1BHGA 1PKQE 4GRLA 1WC7A 2XZAH 4JFEE 4JFUA 1CFVL 1HIML 1JIBA 4JQIL 1U0QA 2J6EL 1LMIA 1JZ6A 3UTSD 2DW5A 5D93B 5IGXL 1VSCA 2D8KA 4XRCB 1NBYB 1QFPA 2VZ1A 3HLAA 3DVNB 3HFMH 5DRWB 2P80A 3F65A 3Q6FA 5IKCB 3Q3GB 2V3DA 5BRZE 4JGJA 4WEUD 1EGJL 4PJGA 3Q2LA 5CJ5A 2Z31D 3PWPB 4GRWH 1CICC 5IVZB 1BQHG 1PD6A 1W72L 4YEEA 1XD1A 2E47A 3BOVA 2LE9A 2XG5A 3U4BL 3FRPB 4X9BA 5IB2A 1WITA 1DBKL 3IBOA 3WCYA 2EXYC 2OMBA 2X4UA 5D7SL 3NESA 4V2BA 3VFUB 4FQHA 1TJIH 3S3PA 1IAIM 2VUKA 3EDFA 5E8EB 4XCCL 5DD0L 3PDOB 5TE6L 4CSPA 1SMOA 1L6ZA 1S7VB 2PR4L 2PXYA 3VI3E 1HYRC 2DQIH 2ZCKH 2YA2A 4WFED 2B0SL 4FNUA 1JHTB 2OULB 1WZ1H 2OX5B 2LT9A 5IFJA 4MDRA 3FTUA 4WLCA 2BXZA 3VXMD 3IFNL 4MDJA 1L0QA 3NYKA 3O0RL 5I0ZA 3DMMD 2HTLD 1K4DB 1LO0H 4LPYA 1H15A 3QUMH 1FAKT 4QTHB 2NQCA 4J12A 2ITDA 4XZUB 3L3IA 3RVXC 1WWCA 2H2SD 3GS4A 3LPWA 1JPFB 1PZ5B 3GGWB 3L48A 1SDAB 1SEQL 5CEZD 4WHYH 4ZD3L 2VDMB 1EERB 1ICTA 1OWRM 3RJQB 2VQ1A 4MQSB 3QA3A 5FUZL 1IZJA 1H6EA 3TASA 5IIEB 1RSFA 4L8SA 1MW1A 4OW6A 2D3VA 4BQCA 5KBMA 2QGDA 3O6KL 3V5HB 2MTAA 3OPUA 1A8JH 5HYSB 4WI7A 2MIZA 4LPVA 5DA0B 2Q5BA 4N1HB 1ZK5A 2ZZUT 2VR4A 4BUHA 2A4EA 4PSRA 3M1BA 4XXWC 4L3AA 5GZND 1HHGA 2CMRH 4H13C 4LCVA 1XF4A 3K5SA 5KS9F 1D9KC 3O4OC 3BFQG 4NXKA 1RZ8A 2B5IC 2EILB 4ZSOB 2EEAA 1KCVH 2PCXA 1OSZA 3K1DA 4AMKH 2YA1A 4MCNA 4P5TD 2YR3A 4JFOA 5ICZB 3K8LA 4G2AA 1U9KA 4ONHA 4FTVA 1JGEA 1A2YB 2TAAA 2H0PA 2YD3A 1U93B 4OU3A 2JE8A 4P23C 2NCEA 1Z9NA 3LKNA 4X6CB 4P5MA 5A6IA 1C9SA 6PAZA 3BVDB 3QORA 3KE0A 2AK4B 5C0IB 3VD9A 4Z7VE 4EMZA 5H94B 4JZOA 3TGXA 5GS0D 3LSOA 5HYFA 3QHZL 3QGVA 1EANA 5IJKA 3KWTA 2ZNWA 3OHXC 2Y5TA 4YSCA 4XMVA 5BS0B 3CZNA 4HP5A 4B5EA 2Z9TA 4KJPD 3S36L 1NFIA 1DCEA 2F1EA 3EFDH 3ZDZF 1DQIA 5ITFA 3DWTA 1INEH 4ZFFA 4AVIA 4MLIA 1UWXK 2VR5A 3ARXA 5D1QA 4KI5C 1JFQL 1OP3K 1A14H 3U7WH 1VZGA 3OAZH 4Z78A 5DJCB 5D1ZA 1JZ8A 1MHHA 3IXAA 2X4TB 5J5EA 1LJMA 2PNDA 4IMKC 3AT0A 1OGAA 3O8XB 5TE4H 5J06A 3HNVL 3KGUA 4HJJH 3RPIB 4LHUG 4ATWA 1JYXA 5BW7A 1FFTB 4Y16D 2PW2B 4O2EA 2C9XA 4EPSA 5CS7A 1LEGB 4OI7A 4LPCA 3RGBA 4J23A 4OQTH 2XV6B 5J4MA 1UXLA 1TVHB 1T0MA 5HHPB 3OGCB 1FRGH 3L1EA 4MSWB 4J4PA 4RISL 1QQDA 2E9GA 4X9FA 4YWGH 1NC4D 4LARL 3AM8C 3T2QA 4Z76B 2Y5EA 3ZHKA 2V5MA 3WS6C 4Q9CA 4UIMA 2ICCA 4QTIL 2RD0A 4QY8B 4BJLA 3ARYA 3LRGA 4F33B 5JMOC 1M3IA 4QXWA 3GXTA 1T3FA 4HJ0D 4NRZB 4X2UA 4ZW8A 1ZPLA 2GT9A 1UD5A 1LE5B 3P3RA 5F1NB 5AZUA 1K5NB 2XWBB 3VFMB 1ZMYA 2ITEA 5BZWB 4FA7B 3SDAB 2VQ4A 5IY5B 1P7QA 4K94L 2ADFL 2ZX7A 4QHNB 2OBGA 2CO6A 3DSFH 2X0VA 3V52H 1E9PA 1W0YT 1C1EL 2JFCA 4MNQD 1YN6B 2V2WB 5EUOE 3CFBA 3RWJB 3VJ6A 4KMTH 1BFOA 3MR9B 3X1BA 2DB8A 4L9DA 5HDRA 2CR0A 2VN5A 2WINA 4G3YL 3GJFK 3C5JA 1MJUH 1E4WH 4KQ3H 3OHMB 1J8SA 3FTWA 4MS8C 1GTFA 1H6TA 4HG4J 2NY4C 4G9FA 2GTZB 3I9IA 1MVUB 1TF4A 1W72B 2DQ6A 3QWNA 2OZ4A 4OQ1A 1C16B 1SOSA 2BVTA 3AG2B 1U8HA 3PF2A 3TVMD 2J5WA 5MENE 3ZSSA 3LZOA 4O00A 1GS8A 4KMQA 2AGJH 4LKCA 3KH3A 3WFBH 5I8KH 2GSIA 2XXMB 1NGZA 4D9RD 3WXVL 1AP2A 2ADIA 3UTTE 1U3HA 1EBPA 2ENSA 2ZUVA 4MNGA 4QKXB 1SBBA 4UQ3B 3A23A 1WYJA 1IBZA 2DYPB 3X3GH 4FC3E 1ID5I 5IROA 1BXAA 4XN2A 5DWPA 3IPEA 1Y7VA 4XPHL 5D6CA 3BPNC 4CMHC 4PGEA 4YSAA 1CIDA 1GMEA 4Y4HC 4UTAL 2I7OA 2WZAA 1QNZL 1TQVA 3GMMA 5JIHA 3W11C 1BEXA 4PRHD 2F5AH 3BWAB 3WJLA 1IT9L 2XZZA 2XC8A 5KN5A 3H3PH 3FB7A 4PJXA 5DXWA 4G83A 5ADPL 2BSSB 4PHZA 4DK6A 4WUUA 3OX8B 5HYEA 1XF2A 4A66A 4WHCA 4GRWE 5L2JA 2DH2A 4HH9B 4P2RE 5KSVB 2VN6A 4XBGA 5I1IH 3KXFD 4X0NA 4UTCA 5I1JL 3A4AA 3RGVB 3RNKA 3G08B 5IZ7A 2CO4A 4R2GC 3O81A 1VGKB 4XPGL 1N5YL 4PJ7E 3V4UH 1A7OH 2N1KA 2B2XH 3OAWA 4AK2A 1UATA 2I5YH 3K8MA 2BNRB 3MRLB 2WCGA 2XT1B 3ARFD 5H2BA 1IAII 2R69H 2Y7LA 4LNRB 2DICA 1ZLUH 5EC2B 3K72B 4DWHA 1P6AB 1ZA3A 3BWSA 4I3RL 1B0WA 3X1FA 4FS0A 4U6HB 1DVUA 2WXRA 1MLCA 1T4KA 1UC6A 2CA3A 2W9EH 1AIFA 2R29L 4FNPA 1LP9B 3A21A 4MNHB 4ETYA 3PWVB 1LWRA 2NT0A 5SWZE 1U4EA 1ECZA 1TJXA 4YXKH 4GO9A 1ODAA 1BIIA 5BQDA 4HDIA 1T2JA 4TNWK 4ZMLA 5HJ3B 5HYJE 4HBCL 4MAUL 4DOHE 1M6OA 5F9JB 1G7IA 4WFGD 3VFPB 2CKBH 1QFWL 4F9LA 1R3JA 3G6JA 2BWQA 4R4FH 4Z3JA 4NQCE 4OLVH 2YPKA 3N50A 3QAQA 3P2TA 1EBAA 4PJEB 2GBAA 1X5YA 4DFIA 4XI5D 5CF3A 4H8WL 1ZWIA 1XGQA 1FZOB 4NIKB 4IEFB 3KM2A 3UC0L 4GB9A 2WVVB 4GOSA 3K0YA 3OC8A 4GAYB 4OFIA 2QQLL 3K6SA 3BT0A 3IJSA 4GIOA 2O61B 5F9OH 1NCDH 2CDFA 3HZMB 4ZI8A 5KSUB 4ODTH 2N59A 1SDDB 1RUAL 4YHIB 3NFSL 4MJID 2CDEA 1TQCC 4M8RA 4QXGL 3SDXB 1BSIA 5B38G 1YY9C 1WIPA 4WWKC 4HIJB 3HBPA 3V4PA 2QEJA 5CAYB 1VENA 2BVYA 3CLEH 4KHTL 4MD5A 4DZ8A 1WFTA 4A2FA 3TV3L 4E41A 3KR3H 3T77B 4PG2C 1KEML 1E9OB 4NZUL 2B1AH 1FCGA 1JF5A 4L3FA 3ZRFC 4AT6B 4CDHA 1OAQL 5DO2D 1FVEA 3RGHA 4PBXA 5EF0A 1X4YA 4U2YA 2IFFL 2R0LH 5INCB 4W9GC 4BA0A 1MN4A 2IH1A 3FT9A 3JWNC 5IVXF 5L88L 3ARGA 5FECA 2YK1H 1UWEH 4F8NA 4K3EH 2DMKA 2OR9H 3TPKA 1IGYA 5EU5B 1RZ7H 2FGZA 2V2TA 4JG5A 1QEWA 2ENPA 4FFVC 4HV8B 3P73A 2RQEA 2A74A 5I9QC 4LSDA 1DANT 3M1CA 5FDYA 2C1OB 5A43C 4WFFE 4XPAL 4QGYA 4I9WD 2D7PA 3EDDA 2JIXB 2G0LA 2XWXA 4KPHH 3WIIL 2IH3A 2NDFA 2VZTA 2FATH 1M7XA 2EDOA 4BQBA 3WNKA 2AXHA 3T0EE 1OT2A 1MIEL 3MRGA 3HLKA 1J5DA 4JG0L 2MPVA 5FM5M 1NSNL 1N6VA 3C6LA 3KPSD 2D7MA 2YSTA 4AIZB 4UF7C 2FEEI 3RY5A 1N18A 4CW1B 1BIHA 1OP4A 3PV6B 3PXJA 1RLBA 2WO2B 3JTBA 1EHAA 3FOLB 3SKOB 4J2XA 5LCVH 1K2DA 3BVVA 4XAWH 4I87A 3H42H 4QRTB 2VIRB 1E5UI 3F5WA 3WEMA 3TBTA 3L5JA 2UX6A 5K39B 1CICA 4HUWB 4ZMWA 5JNYA 3LZQA 3CD4A 4AVJA 4QJ4B 2WQXA 2BNQA 4L18A 4UZUA 5DEFA 2Y69B 3WFCH 3BIKB 4JY4B 2BWIA 3N85L 3P1VA 1DL7H 4QRPE 3BEVA 4IRZA 5IMOB 2W65A 1W6LA 2NY0C 4GFXA 4HIPA 3CFEA 3AITA 4HKXA 2C3VB 4DPBX 3MOAL 3NQKA 1FO0L 1P4LB 1K3IA 2YOCA 4RESB 3SQOH 3WGVB 3L5HA 4KXCA 1WICA 4N2BA 4PWHA 3H56A 2R2EA 1R9FA 2IADA 1FYTD 1KTCA 3MU3A 4U1GB 3UTZB 5DC2A 2EVJA 1OAXH 1MDAA 3SGEI 5DT1L 5E0QA 3LEYL 5ISZE 1W0VA 5EDSA 4DP6X 4L4VE 4HUVB 4DP2X 3QDGD 3H7LA 3GKWH 4QMEA 4CGUB 5JZ7C 5LJYH 1YNTA 1CG9B 4FQQA 5HHOD 2CWRA 5D4IA 4H20L 3FH7A 4JPKL 1S9WA 1Z32X 1NL0H 2BWDA 2ZONA 3IAQA 3RVTC 1OGAD 1XGYL 2WWKT 25C8H 1YLBB 3EJCA 4XVSH 2X6UA 3RZWA 4IK6A 3MACL 3C8DA 1N12A 2OTPA 4L8BB 5F70A 5T5NG 1RK1B 2BSBA 3P11H 5EU3A 4AGOA 1WV7T 2VDMH 2NUPA 4ZMZA 1PZSA 4MMXC 4ALAC 3IETB 1PZAA 3U7YH 2C34A 4X98A 1DO6A 1RUKH 3BKMH 3FAWA 2IPTH 4IBQA 2APBA 4IIQC 4ABWA 4XXWA 4ONGH 1A64A 2Z7ZA 4J39A 5I26A 4RWYH 5DUPH 1ZOXA 3QHFH 4L8DB 1ZLUK 1BJ8A 5B39B 2DLFH 4QHLA 4XPBH 2YEQA 3BD5A 3DX1A 5D7KE 3EXJA 4DAGL 4HWNA 5DJAA 3RRQA 4AVKA 3TIEB 5T3XL 3LH9A 4X6CF 5KSAD 1QLEL 2XN1A 1JWSB 3B9EA 2C4XA 1JZJA 1P5UC 5SX5K 2ZCLH 1M9WA 2IPUG 5GGSB 4MA1B 5DJYA 1AFVL 4N8PA 4PJDB 3TJHD 1PDKB 2VDNL 5AYQA 1UM5L 3MV7D 2QVIA 3TU6A 1FHGA 2ENQA 2EXTA 2AJZB 5IQ9A 3M8OL 2W07B 3WO4C 5E9DB 4JFED 3BEWA 3C2SA 5LKNA 1MFMA 1ZA6A 3UC2A 5EEZA 2VTFA 4Q6IC 4NQXB 3AAZB 3NN8A 4R7XA 3R18A 3ROOB 5KAQF 3CPUA 4GKNB 1PJWA 1K9TA 1KNOB 5BRZD 3I75B 5CKGA 3HC3L 3PJSB 5F1KC 1GYCA 4U05A 4NN6C 4XMWA 4DVBA 3Q7JA 1AHKA 1KB5H 32C2B 5CZKA 4KK5D 4AEEA 4OIIH 2J5LC 2E4TA 2OQJB 4U3HA 3DUUB 3IJEA 1LILA 3MLZH 5BO0D 5LG6A 4MX7B 4AJYV 3UZEA 2CJUL 2ZWLT 3MJGX 2R2BA 1MCDA 1URIA 3DARA 2DLEA 1R3KA 3PWUB 4XCNB 3UDWA 2VDLH 1OWWA 4XVUC 3AM8A 4JB9H 4XPTL 5HGAB 4XNZB 4R0LA 2JTYA 2HJKA 3GI8H 3VX1A 4YC2C 4P2OB 4UB0L 3T0VA 4A7QA 3AXLA 4WUUD 3R4DA 1YEKH 4HWBL 4YPGB 1BAWA 3U4KA 3AS1A 1Z9OA 4YDIH 3NDYE 3PWLA 5GJSL 3HN5A 5FB8A 2EIZA 4BFRA 3MRMB 4CNIB 5GS1C 4NX0A 3S96A 5C0ND 1G9NH 4UQEA 4P4KB 1IGTB 3A6CH 3SE8L 2Y1ZA 1N6QL 3LHAA 3ZTCC 1G7HA 4D9LL 5IEKA 3V9CA 4D0BA 3SQBB 2YLHA 4FABL 2QR0B 4PGCA 5G4MA 1E8WA 1VFMA 3I3EA 5KBNC 4RDQG 4FQJH 3KW7A 4GAGH 5JIPA 3V10A 4LGSB 3BQUB 3V55A 1SQMA 3NFPA 5ID0B 1HE7A 4PRIA 3SPVA 1L3WA 2HYMA 5T5FH 2DD8H 1ZE3H 3QXDB 4HIHB 5KTEL 1EGJH 3SCMC 4AY0A 3OD3A 1G7MB 1AQ8A 3DX6B 3SDDB 1QOKA 1E50A 1FO0B 4HSCX 4FQIL 1IC5L 2PKDA 1HWGB 3QARA 4U0QB 2HJFB 1A7BA 5PAZA 1ET7A 2YKLH 2FE0A 3QJRB 4W4OC 2VM9A 3L45A 2BP8B 4R7LA 3T8XB 1LQBC 2ZKWA 2C9RA 3QI9C 1AGFA 4PB9H 4RFEB 2H2PC 2VN4A 1S7SA 4Y4HA 1SVZA 4WSJA 5DD0H 5LVEA 1DFXA 4KTGA 2P8LB 2PR4H 3HPJA 3P4LA 5B22A 3BT2L 1E3FA 1RK0A 1KG0B 1C5BH 2EZ0D 2P4AB 4BDVA 2X70B 2CD0A 5CSGA 4XCYB 2FEDC 2QKSA 2NY1C 1V55B 2KLTA 5JPNC 4Z23A 3GM0A 4OTXL 1KXHA 5JA9A 4K2UH 2A77L 2GK2A 1BBJA 2LLNA 1ADQL 1R3IL 4GBXB 4U1IA 2YC1B 4AMWA 1PZ3A 2DIJA 3WE6A 1CU4L 1TG8A 4CBZA 1LP9F 2DBLL 4X7SH 5FUZH 5DFVD 1CTNA 2WM0A 3LNDA 4IDJL 3OLGA 5E95B 1E27B 3TO4A 3SGJA 1AKJD 3ARGD 1HTYA 4WI4A 4X4ME 3TN0D 4HJ0C 2L7EA 3EJYD 2AQNA 4XWGL 2VJ0A 4MFHA 4B41A 2HVKB 2YWYA 1GJIA 2BOCB 5IK3A 4OCNC 3V0FA 1QLEB 3K46A 1MCEA 3FB5A 3OF6D 1KUMA 2VLRD 4KHXH 4PJEF 1AXTH 1WRFA 5DVOA 4P46D 3QDJB 4OLWH 4Z8FL 1T7XA 1OQXA 4ZUVB 2IV8A 3U6XS 1CD1B 4L2YA 2VDNB 4A38A 4JY6B 3O3EA 5C2BH 1MFAL 4WCYL 4G1MA 4XNMB 5CO1A 1BZ7B 3B5GA 5CJOL 4N0FB 2W0PA 4IOFC 1DBBL 3VD1A 1PG7L 3KWWB 3SDXF 3TVMC 1ZHNA 4JO2L 2VDQL 1OARL 1TTRA 2OM5A 4ANUA 2VABA 4QXUL 2AXFA 2CRIA 2ZQKA 1GGTA 5D5MA 4W9LC 2VSKB 4HIEB 3CVHH 2UZYA 1WTGT 4HGKC 3NCBB 3UXFA 5AAPA 1W0WB 3QEQA 4N2EA 1S9VA 1CYXA 3I6LE 1FG2A 4FLOA 4PP1D 3LZFL 1I1AC 5E1HB 4PS7A 1A7PL 3HKFA 2OV0A 5ICYA 3RWDA 2BIPA 4PG2A 1UFUA 3OZLA 5E0FA 4PCTA 4D7BA 5K1JA 5DRZA 3WLWD 5ETUB 4KROD 3QCVL 4OFPA 4ETQA 3BH9B 3U36B 3L1GA 4GNKB 3AY4C 4L29B 3B2DC 1UT2A 5LQBL 2B1HL 3MBXH 1BG1A 2X4PA 5HGDA 5I1DB 1ODUA 2CHZA 4OZGA 1XB8A 2ZYHA 4JN1H 3TH3T 2NNAB 1XF3B 4KAQH 4H8PA 5TPWH 3SZ6A 1KIRA 1MSPA 3H9SB 4IDLA 1O9VA 2VAAA 2Y24A 4JCLA 4X8JA 3TT3H 2VXUH 3MNMA 1KENH 4DGUA 5ESVA 2KS0A 1CDYA 4QNPE 5KYWB 3LEXA 2ATKA 2PO6C 1PF3A 3BHBA 4P2RD 3SPIA 4FF9A 3GJFB 2KDGA 4P2QB 1NBCA 2NZ1A 4HJ1A 3PP4H 4YSRA 4YZWA 2FJGA 4LL1A 4YBHA 1NBVH 1QVOB 1C1EH 1E67A 3II3A 5IHWA 3Q8EA 1J10A 5EPMB 1OQOA 4PTTB 3KPRE 4OLZL 7FABH 1QFHA 5C6PB 2E7LA 1F4YH 3D25B 4G8GA 4TVSa 3L9RA 1DQQB 1M1XA 4P57A 2MCPH 4P9HL 4V11A 1TFHA 3S34H 1KXTA 1QI3A 2YWZA 3OJMB 4EOWH 4WNQA 4Y0GA 2LU4A 4XI5C 5LWYH 4IS6B 3BESR 2HRPH 5E8PB 3ES6B 1YNKL 1YYML 3TC9A 4E9RA 5DI8A 5GGRB 1DUZA 1P5VA 5HHXL 1IC4L 4OJDH 1N64L 2WGNB 4PJ9D 5IVXA 2JVUA 3CWGA 2OI9C 3D2TA 5LBSA 4UT7L 1CMOA 4HIIA 2G30A 4GH7B 4ANWA 1WHOA 4PLOB 2WXGA 3WTSA 3WJJC 3WY3A 1THCA 5IB1B 3AUWB 5FYLL 1CD9B 5JQ6L 2F7IA 5ICXB 2P5EB 4X80L 3VD7A 5IR1A 2KZ1B 2DOCA 2ITCB 1SLXA 3CH8A 4FRWA 3QQDA 5E2WH 2IFGA 3FSAA 3QNYA 4KFMA 4UMSA 1E4HA 3DPBB 5TQ2H 1YPZB 5BOJA 1N0LB 3REWB 1IIIA 4KDTC 3P9LA 3OJVC 5TE7L 3M86A 1AGCA 3QNFA 4QGTA 3E8VA 3BUTA 3BKJH 2FD6H 1S8DB 3GJEA 1LE9B 3WIAA 4K9EL 4MMZB 2BP0B 3ULUH 3VFNA 4CUCA 1JXDA 1T1YA 1TPXC 3T0WA 3NH7H 3TZVD 1QR1A 1HHHB 1MRDH 3MZGB 3MBEC 2DI9A 4KO5A 5I1JH 3UFIA 3IM1A 2C4FT 4EKXA 1NBYA 3W9EA 1L7IL 1N5YH 4XPGH 1ZLVK 5J56B 4OR1A 5DRWA 5DQDH 3WN6A 1KY7A 3QUXB 4J3OC 4NC1E 1JGVH 1DBAH 5JOFB 2GJRA 1BAGA 5JW4R 3B2VL 1M9SA 4Y4FD 4GP4B 4YGAB 3LHPH 2VC2L 3OJDA 1JFHA 4KNQA 3BJ91 3TBVA 1PZCA 3L3KA 1JPTL 2WN3A 4R83A 3FSOA 3PUCA 1BQKA 4BFJA 1V27A 5I23A 3BZFB 2XWEA 4IIQA 1HKLL 5F9WC 1KV3A 4ODSH 1EPFA 5FCUL 2WSPA 1ZS8A 3NP3A 4HBCH 3JZ7A 1S7VA 1BDYA 4LCCB 5C07B 3V6OC 1QFWH 1EO7A 3HB3B 1XMEB 3L95B 1KJMA 4R7NA 2JJTC 1ZIAA 5IM7A 1JHTA 2OX5A 2E27H 3TA3B 5I28A 1ZVSB 3Q6GH 3EGSB 4XVOA 4PJDF 4TRPH 3KPQB 3CSYB 5KW9H 3CZKA 2B59B 2IBBA 1ETJA 4BXSV 2C9AA 4QF1B 3QUZC 5HHMB 3BP5A 3UCQA 3W5MA 2HX8A 2QQLH 4I0CC 3T0ED 2JKRM 1RJYB 2KBGA 2QQKL 1XXDC 2AANA 1YUHA 2IJ0C 5AYUL 3KLHD 4KUZL 3NFSH 4I9XA 4M4PA 5IOKA 1UKSA 2AS5M 1I3RB 4QXGH 5LGKA 4UT9A 4EZKA 4YX2H 3ML8A 4Q6KA 1IAIL 4RGND 1IBHA 3MXWL 3QJFB 2ZUUA 1HK6A 2CUMA 3SPGA 3MYJB 3ETBJ 3P40A 3CDCA 3QZPA 4YNYB 3L3OC 1A6VL 4PJ6A 4YL9A 3U79A 1EVTC 5TFSH 2RGSA 1DEDA 2JWYA 1CDJA 5E6IC 4KGLA 4XX1E 2FTAA 3UBXI 2FL5A 5FFLA 3OSVA 3BUIA 1FNLA 3PV7A 3RA7H 4N9GB 5SX4I 2OCCB 1MG3C 4ZSOA 4OF6A 2SODB 1I9RH 5L88H 4EN3B 3B5HA 1AGDA 1VFOA 2YD0A 3O45B 4PJ5B 1IAOB 4RSVA 4O58L 4U7MA 4XC3L 1VKXB 5B4MC 5L7XH 2APSA 2Y1VA 3BUPA 3FHAA 3O2VL 3QPXL 2WKLA 2UVEA 4MAYC 1EFXD 3VAEA 3OR7B 4X6CA 1I8IB 1Z3RA 4MDIA 4HWZB 4NZTH 4C83A 4LSSH 2DLGA 3ZK0A 4OJEH 4DKFH 3S8WA 3QZOA 3WN5C 1SF5A 1IQDB