4Y2OB

Structure of cfa/i pili chaperone-major subunit complex (cfaa-cfab)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
142
structure length
142
Chain Sequence
MVHHHHHHVIDLLQADGNALPSAVKLAYSPASKTFESYRVMTQVHTNADAKKVIVKLADTPQATDVLNSTVQMPISVSWGGQVLSTTAKEFEAAALGYSASGVNGVSSSQELVISAAPKTAGTAPTAGNYSGVVSLVMTLGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Off-pathway assembly of fimbria subunits is prevented by chaperone CfaA of CFA/I fimbriae from enterotoxigenic E. coli.
pubmed doi rcsb
source organism Escherichia coli o78:h11 (strain h10407 / etec)
molecule tags Structural protein
molecule keywords CfA/I fimbrial subunit A (Colonization factor antigen subuni
total genus 8
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2015-02-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2040 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4y2oB00
3F85A 2HB0A 4Y2NA 3F84A 3F83A 4HJIA 4Y2LA 4Y2OB 3VACA
chains in the Genus database with same CATH superfamily
3ZL4H 3MLXL 2VNCA 4UIKH 3MC0A 5BO0D 1AZNA 2J6EL 1YAIA 4FHBD 4IJTA 5EUKA 4B41A 2VDLB 4EJ1C 3QB7C 3BO8A 1A4AA 1JXDA 1Z6JT 2A74B 3DX8A 3M1OA 4PWEA 4L37A 1CE6B 4XVSH 3RVTC 1EHXA 4E68A 1Q1PA 1INDH 1F2QA 1XR8A 3MLRL 3SZ6A 3QDJA 4POUB 4NBYB 3GQFA 3VXRB 3BLKA 3AM8C 1HXMB 1A6ZA 3E8VA 3UEQA 1PQZA 1IQWH 2HZHA 2PTVA 1OGAD 2R1YA 2R0ZL 5E8NB 4PJ6A 4QHUA 1JPGB 1S9YA 1ONQB 1P2CA 2NNFA 4IOSD 2B1AL 4WFGD 4AE1A 4G8EB 4B9JA 3KLHD 2VZSA 2EE0A 3OXRA 4YFLF 1CT8A 2V7NB 2F54A 4Y16D 3CSPA 3UPRA 4GAYA 1C5CH 5HHME 5EO0A 2KMWA 1K3ZA 2A9ML 3UTOA 3QUMB 2XQBL 4IMLA 3UPAA 3D4YA 3V4VB 1MNUH 4YGVB 2BNQD 3OXRB 2F54B 2L7JA 1LO4H 3N50A 1PYWB 1FYHB 1ZHNA 4Y5YB 5DDHA 3B2VL 3ZZSA 1UUNA 3IJ8A 1JNHA 5KYNA 4KO9A 2MIZA 3ZR6A 1AVAA 3ASWA 5B4MC 2P1YA 2AEPL 2C3VA 3C5ZC 5GIRB 1G7LB 4Q9QL 2X6UA 3C5ZB 3MBWA 4OLZH 3EOTH 4JPWL 1CE6A 4ZNEE 1BVLA 1GGIH 3KYOA 2X1XR 3VXUE 1CVSC 1NUFA 3UAEA 1GZQB 3EYSH 4PV1C 1RJYA 5GGVL 5AB0A 3VXQB 1UXWA 5IF0A 2O4EA 4KDTA 4X6BB 1QI5A 3OAZH 3OKDA 4FG6D 5FKAA 1I1RA 4LT7A 5DK0B 4QRSA 5DZAA 2APFA 1J5OL 3CVIL 3IB4A 2OTUA 2NW3A 5INCB 3ARGD 5AOMA 4DEUA 4AMXA 3BRDA 3PHAA 1E67A 2NY0C 1HILB 5JQ6H 1RK0B 1AZVA 5AVUB 3TPKA 4LQ1A 2XWXA 1A7BA 3CHSA 4HIJB 1YEKL 4N2NA 1Q0XH 2DEYX 4R90H 3L9YA 3A47A 4N25A 5J1AA 2FBOJ 4AV4A 1EWHA 2XN9B 4PGDB 1CD0A 3GBEA 2R2HB 5FGRA 4NC2B 5DT1L 3LKQB 4KKBD 1U8LB 2BVUA 2Y6SC 1NAMA 2AV1A 1RIUH 4YZFF 3HA0A 4KKQA 5I1CH 5KVFH 4PJ7F 4X5PA 5C07B 1I1YB 2DEXX 4G43A 5D7JD 2IADA 2GJ6E 1I9JL 4RX4D 4R96A 2BXZA 4ZX3A 4ZBJA 2BSTA 5DD5L 4X6FA 1D6EB 4NQSB 4NRXB 3G08B 4UTBL 4XPFL 1NEZG 9PCYA 2FJHB 2V5SA 2ENPA 1GZQA 1QVOA 3VFPA 2ROYA 5DEGA 3S8FB 1HHHB 4OD2B 1FYTA 2DWDA 1HEZB 5K59E 12E8H 3UTTA 1X7QA 2X4PB 4UZGA 1EDQA 3ECBA 1VKXB 3FPYA 4PLOB 3WS3A 5KSAC 1J86A 1A2YA 1FRGL 4J6IA 1BM3H 2OP4L 4KFMA 3GIVA 1KYAA 1CGTA 3KEHA 3QEQE 3IF1B 4I13B 4K5NA 2CDEB 4ZW8A 4XX1E 5T1MA 5GZOA 3H53A 4UYQA 3Q1EA 1PAMA 3HNSL 4BZYA 2C9PA 1B4JL 3Q6FA 2GBAA 1BX2A 4QRQB 1MLBB 2R2HA 1KEML 5DUBA 2BH0A 4Z7WE 4AYFA 5J56B 1D5BB 1OCWH 2Z8RA 3M8OL 4XO3A 3X12A 2IAMD 1T83C 2WWKO 2Y4SA 1VA9A 4P4KA 3L5XH 4XNQA 3LB6C 3PUCA 1OVZA 4LBEA 4ODTL 1OP5K 2IEPA 3UBGA 4Y1AE 2OCJA 1FVDA 2AEIT 3JTTA 3QPXH 4AYSA 3MRRA 2WK2A 4XP4H 5D7JC 2YD3A 3HPLA 4TVPD 3U0PB 3DVNA 1XGQA 3G6DH 1IKFH 2YQGA 2VDRH 3LRSB 4Z7NE 4IRZA 1OE2A 2EABA 3KJ6L 1M7XA 3P30H 4PH8A 1JD7A 1KIUA 3WG7B 1X7QB 1W6WA 1ZPUA 4EDWH 1C7SA 1FGVH 2VN3A 4NPKA 1A6TB 3ARFA 2MRYA 3VVVA 1QLRB 3CG8A 1NGXA 4OLWL 3OX8B 4V33A 4ZS7H 2UZXA 4EZMA 1AKJD 4Z7WF 3CDZB 1Z9SA 1YJDH 4RSVA 4XXDA 2AW2A 1ZHKB 1JHTB 4MNQA 4Z3JA 3Q6FB 3BKYH 3DSNB 2J8UB 3DDFA 4H8PA 3TBYA 4DP7X 2X44D 3AGWA 3H2WA 2QGEA 1CXLA 1JGDA 3O45B 3HAEG 4NKOA 2F19H 4NX0A 4ACTA 3MLSL 3IJHB 4AMWA 1OTUC 3UBXI 3OJDA 1AS8A 4YDNA 3TT3L 3TBYB 1I8LC 4FFWD 3FQ4A 2DQFB 4OZIE 2Z7UA 4BYHA 1S8DB 3AU0A 2WCPA 5FXCH 3JQOB 4X83A 3AQYA 2E47A 2VLJD 5GGTL 5AYUL 3NCYS 3FCTB 3BWUC 1QA9A 4FG4A 5D7KD 2W80C 5SWZE 3TA3A 3W9EB 3K2KA 3ECUA 3KNBB 1CURA 4JQXC 1MFBH 3CHOA 4HCRH 4KK8D 3D34A 4YC2C 4Z0XA 4OIIL 5E0QA 1YPZE 4GRWB 4PJHF 2G75B 4BK8A 5BW7A 1JE6A 1QRNA 3SBRA 2CQVA 1IC4L 4JB9L 2VDPB 2GT9A 3NCJL 1D5ZA 4GKZA 1EZLA 2K3TA 3D25B 3ME0A 4OJCA 3ILPA 4R7DA 3QFDA 3LEYL 2P4AB 3ZKND 4JY4B 3DHJA 1ZXKA 3AVEA 3R4DA 1UT2A 4CVWA 1QLFA 2VR8A 1FC1A 3WJJC 5D1QE 5EU5B 3K5RA 5E4IA 1GGBL 4JFFB 2QV4A 4HIEA 3D2UB 4ODVH 3G5VA 1E9OB 5AVRB 3V8CA 1AZZC 2EIZB 2WVVB 1SHWA 3S37L 1AC0A 4YSPA 2ITCA 3TEYA 1BFSA 3I75A 2WV3A 3KLLA 4N0FB 5A6IA 2XU9A 5KBDA 4JG9A 3NPSC 3ARGC 3QJRB 3ZGIA 1I1FA 1NZRA 2MH4A 2YSSA 3NOIA 4K2UL 3QP3A 5GJSH 4KQ4H 2OCFD 2FJFA 5IT2L 1GW6A 3FUIA 3IKCB 4F91B 1QSEE 4YH6A 3T77A 2EUZA 4YHLH 4DGYL 4Z0XB 2HJFA 1TJXA 1KCUH 4U1LA 3D85D 3UO1L 1QP1A 2B15A 1JI2A 3SJVE 3CWGA 2ARWA 4XOAA 2DYPB 3Q9QA 3WUWG 2WBXA 3F5WB 2X6MA 1S78D 2GSMB 3WEXA 3ULUH 3E3QE 4LOFA 2Y9RT 5CZKA 3ABMB 1OPGL 2FJUB 1TTCA 2ZYHA 3BUYA 1HHJB 3KPPB 2APBA 5FYLH 3TIEA 1LEGB 5FFOA 3L4XA 4XCFH 4PRNB 1FH2A 3JZYA 1RD6A 1QLFB 4HUUB 4WGKA 3N1QC 4HXAL 1P0SE 3SBWC 4F9PA 1DBKL 4GS7C 4KPHH 1NH6A 3V5KA 1EAQA 2K78A 3WI9A 1G43A 4B96A 4L3ED 4FEIA 1AY1H 3MYZA 3TN0B 3ZDYF 2OTPA 4G6AD 2J8UF 4RZCB 2DBLH 4KVCL 1P5UC 1AGBA 5DK2B 1T89C 2X1QA 3EO9H 5KYYA 1E8XA 3DX0A 5E7BA 3WJMA 1BLNA 3FXIC 5HHMB 3HFML 2CDFA 2ZJSH 3K91A 2V7HB 1G6RB 3PWVA 5JZ7C 1G7JA 1HH6B 2C1PB 3MKKA 1M7IB 4PY7B 5EDSA 2ZONA 4JZNB 4OT1H 1BDYA 1QFPA 3GS4A 3RY4A 3S3SA 1GTNA 2ZCLL 2G75A 1R5IA 2HRPH 2WLLA 4YWGL 3VE0A 1HL5A 2BDNH 5KJ4A 3TBBA 4OM0H 5J6GA 4OZ4A 3D25A 4PWGA 2GJRA 1KJVB 3HAEA 1N8OE 5MI0C 1IGTB 1R24B 1TZHA 2HA1A 3NIGB 3U79A 5BOZG 3TO2A 4JY5H 2BSSA 5C09B 2Z91A 5F0LB 5I5RA 3DJ9A 5GGUB 4APXB 3A22A 5CINH 2EH8L 5I1IL 3EDEA 4M6OL 2HFGL 2X6CA 3UAFA 3WUZA 5FYKH 5ANMA 1H3GA 5BZDA 5F7BA 2WVVA 3L81A 4ZX6A 4B0MB 1A1OA 3O6FA 4KTGA 5CEYA 8FABA 4GUOA 4LLWA 3QS3A 3FO1A 2VDLL 2F5BL 5C0DB 4MAYB 4ANVA 4MNQE 4IMKA 4FQJL 2HVJA 3ZTDC 1S7SA 3O8XC 3MRLA 3E1ZA 3T6ZA 2XIDA 3RWFB 2YPVH 4WKZB 3WE1A 4HJIA 1TFHA 4LLYA 2OL3A 2J6EA 1KBGL 3D39A 4L8DA 4YSOA 3LH8A 1UVQB 4OQ1A 3SDAB 3S35X 4MWFB 1B90A 4BH8A 1MG2C 4YBQC 3CSBA 2L7EA 2G4GA 1YQVH 1LDPH 1DQQA 4P05A 4OCWL 1J9RA 2O6CA 2Y69B 1ACXA 4P3WA 2OMBA 4OY9A 4MAUL 3GXNA 4L4VB 5CHNA 3V4PH 2F53E 3W0WA 4U6HA 2GK0A 1J8HE 1LP9F 3LPGA 2OJZH 4AM0A 4B9ZA 3WKMH 1QSEB 5GZOD 1CICD 1QRNE 3OR7A 4FQLH 1X6NA 2HLEB 2AQTA 4Q0XH 3STZB 4N0CC 4Z0BH 3RTQC 1OWWA 4X6CB 5IFJB 1F4HA 1L9SA 4WQOA 4TM9A 3QDJD 3U6RA 3JWNH 5KYYB 2MQGA 2IPKA 2ZKHL 1G84A 2EDHA 3T4YA 4FQQA 2KZWA 5DGRA 4DN4H 5I66B 4ZW6A 4IYKA 1X9UA 4LARL 4ONGL 5GGQH 1EXGA 3TN0C 3B2MA 3U6RB 1TJGL 1ACYH 1KIPA 1M1XB 3VMPA 3M7OA 2GG1A 3DV4A 4PJ8C 1HSBA 1T0PB 3DUSB 4PJAF 4NO3A 4LKCA 1RI8A 2WQ8A 2XJKA 3I3DA 3KBPA 2CIIB 4WO4D 3UTSB 3E2HB 4PWJA 4YDKL 1FJ1B 4RRPG 3UTQA 5LLIC 2QHRH 3X2QB 3RWEA 3QWNA 5D7IB 3OJVC 2VABB 1L5GB 4NN7B 2BNQE 3GEWB 3QC5X 4FGMA 1V27A 4JRWA 4UNIA 3SGKC 5C2BH 5AZ2L 1BVNP 4R26L 4Y4FC 2IBZX 2C3VB 2IH8A 3SYQA 1KN2H 4GG6E 4KJPC 4Y8AA 3DX8B 4NKIH 1CFQA 3BD3A 5F9DC 1Y6KR 5C0JA 4YDJA 3CN3A 1CVRA 4P49A 4LCIL 3BN9C 1P9MC 1QASA 1QBMH 1XSJA 3MRLB 4XWOC 1T22A 5C0CB 1F3JA 1QBAA 2VN5A 4X6BA 5E9AA 3L3OB 5I19L 1LDSA 4XPTH 2WP3T 3GKWH 1K4CB 2R0LH 3HE7A 4YDJB 5DUMH 4DKEL 1B88A 4WGVB 1SXBA 3LXAA 3R1GL 3MCYA 3EYVA 2XQ0A 3GMMA 2J8UE 1UGNA 5HI5D 4U1SB 1KXTA 4QRRB 3U46A 2FVNA 1OSZA 3RTQB 2O5XL 4PJ7E 3ET9F 4BELD 2BNRD 2CHXA 3RNKB 2A6JA 1UCTA 4FQXC 1OANA 3U46B 1TZGH 5BVJA 1FCCA 4ZG1A 5HPMA 2IGFH 2YZ1A 2N7AA 4YE0A 4PGJA 1ET7A 5DD0L 1CD1B 3C6EA 4U3SA 2ZX8A 1RULH 3O9WD 1KB5L 1EO8L 3HEIB 5GGRB 3DECA 2YQ2A 2B14A 1GTFA 4BIKA 3K2UH 2ZOUA 3FQTA 4TNFA 4KXZI 2L7UA 3L7EB 3KYOB 1A4BA 1T0OA 4B7IA 3Q6GH 3SDCA 5LGKA 1EXUB 1ZXQA 3V6OC 2AEQH 3QNZA 5C0JB 4NM8H 4S1RH 1JK8A 4XH2A 5I66A 2DQEH 4IM8A 3RAJH 2C9VA 2QSQA 4ZTPL 4LVOC 3MR9B 3HC0A 5IUSA 3MXVL 1E9QB 1I53A 3LKNB 1WT5A 1A9EA 4FXKA 1ZTMA 4NBZB 2LQRA 4PS4L 3LQAL 2OX5A 4H25B 3BEVB 4FFYH 1OGPA 1EAOA 5HVFB 3N9GH 1H3VA 1N6VA 3FQUA 2NX5E 2X4OB 2YXWA 2P5WA 4KC3B 3QCUH 2XPGB 2ADJB 3VGHA 15C8H 2A3TA 3RJQB 4EN3A 5ITFB 2QGDA 2R1YB 1HHGB 5T1LA 4YAQB 5DS8B 1ECYA 3INUL 5KYXA 2BVOB 1YNKH 1VLXA 3KD4A 3QZWG 4RAUA 5MERA 1QR4A 3O4OC 5D72H 4YSUA 2D03L 5DI8B 4OBRA 3MPCA 2BHYA 3MRGA 1RZQA 5TJWK 3HPJA 1F4YL 3ZY7A 4LQFH 3CJJA 1E28A 3WY2A 2DJ4A 1JNHB 2GTZA 4MS8C 4P2RA 5EO1B 1I75A 1LO5B 3LPFA 1CMOA 4RFNC 3RA7L 2XV6B 1A7QH 2FGZA 5GGVY 4QTHA 5C9JA 1BD2B 4XNXH 3MLTA 1WC7A 4PJDE 5D6CA 4OFYD 5E4AA 3PP3H 4Y16C 5BV7C 1HIMH 1L7IH 5CP7A 2QADC 2E3VA 1X5GA 5I6XC 3WV0A 5K1NA 5D7JB 3V4VH 5J12C 5CR1A 4MMXA 2IPUK 5EOQL 1G9NC 2OMVA 3L54A 3X13A 1A3RH 4GP8B 4NC1C 3CFEA 3Q8BA 1NFIA 4PI2A 4GAGH 5E2WL 3ULUL 4KX7A 2G5BB 4HCGA 1AI1H 1QPKA 2IMMA 1KLGA 3CFBB 4DT2A 1HWWA 1G6VK 4U31A 3C2AL 1XT5A 2YLKA 4HT1L 1M3JA 2R56L 1EZVX 1PG7X 3HZMB 2BIIA 2ZKYA 5IBLC 1U8JA 1NJ9B 4UT9A 2IBZY 1FZKB 4PRIE 3DMMC 2J2ZA 2WINA 4YSTA 4RGNE 5ICYB 4U7SA 4KI1A 3MUZ1 2UXVA 4LCVA 4TNWK 4TSBH 3WXWL 2L0DA 4H8WL 5CEZL 3UC0L 3QJFB 2D7NA 3GXUB 3BO8B 2XVLA 2HT4C 4HD9A 5HHNA 5C0BE 2YC1A 3JWDL 4EUPG 2VXQL 1CLZL 3LZFL 5JTWA 1MCKA 3IETB 3MJ7A 3ESVF 5IBUG 2O1AA 4QNPE 4XP9L 4W6WB 2ZX7A 3NACH 1JHLL 1JN6A 1GH7A 1TEYA 4FHJA 1OK8A 3BSGA 2FLRT 4X6FB 3EDJA 3LKRB 4Q9CA 1B3JA 2YEVB 1DBMH 2CLZA 4J3OG 1ZANH 4OJYA 3JT0A 4GG6A 1SF3A 2DQHL 5J9PA 4IIQC 4ZAKA 5KVGH 4U6YB 5ADOH 2NUPB 2F1AA 5A2AA 1XAUA 1OCZB 1FVCA 3IRCA 4NNYB 1MPAH 1CYWA 6PAZA 1ORQB 5F9OL 5F3HB 1OK0A 4IRJC 3SCMB 2MTAA 4YDLB 1VZIA 1VIWA 3GI8H 3HUJA 3ELQA 1KT2B 5F89A 5IJVA 3NRQA 1J0ZA 4RWYL 5FUZH 4WUKH 4LRIC 4FNUA 1JXKA 5IVZA 3SDDD 4G9FD 2F15A 4HIIB 5E8PB 4NAJA 1OL0A 4XVUC 5HYSB 3BKMH 2ORBH 2Z0UA 3EOBA 3QDJE 4OIAA 3GMOA 1ZS8B 1IAMA 1UT1A 4NQSA 2YD5A 4JKKA 3NG5A 3REVB 4M6NH 1FUNA 5JMOC 4MDRA 5GGSB 3APMA 4KKAD 5KSBA 5B38A 2P52A 1JDDA 2QKIC 3B7TA 1A3LL 4CW1A 3QQ3B 2WN3A 3FTGA 1ZS8A 4C8XA 4XVJH 3QFGA 1NDMA 4Q9RL 2JLLA 1FN4B 1JVKA 5EUOE 1PZ5B 4PJGA 5JR1L 3U0PA 3L08A 3ALXA 1KMGA 5BS0E 2NTSP 4ZOAA 3KBEA 5AZEL 3GLAA 3GSNH 4NQTA 1QLEH 2ATPB 4H44C 4U6YA 3I6KA 3TT1L 5BO1H 2JNZA 3GXIA 5DZPA 2WUCL 4G9FB 1NMAL 1I1AA 4KV5F 3D2TA 1VFAA 1JF6A 1AZBA 2EC9U 2XQYG 2DH2A 4H40A 4WIQA 5T1MB 2VERN 4JX0A 4WWID 3T8XA 1FNSH 1L0XA 1PU0A 4WI0A 4FZ8H 2NSXA 3O8XA 5T5FH 5CBEB 3DO3A 1B0GB 1J8KA 4PJFE 5EORL 5J3HC 2VITB 4WO4A 2IQ9H 3NBNA 3TYFA 5HHNB 2AK1H 2LV4A 2NX5A 1SQMA 5DZVA 3BGFC 4I0PD 4EEEA 4ERSL 2J4WL 5EIVA 3ZL4L 4FD0A 4YHNA 5C09D 1YYML 1LEKA 4G7YL 4F8LA 4YE4L 4GRLB 4CMHC 4K8RC 3P0YH 1XGQB 2VQ1A 4EUPH 2Z93A 3PAUA 4Q14A 1N5YH 5KYWA 2TAAA 3P0GB 2JK5B 2NQ3A 3Q06A 2GSIA 2VDOH 3L45A 3UYRL 5B1JA 1A14L 4A04A 4B3EA 5IFAL 5GS1C 4X5XA 4Y4KD 4HLEA 4AGMA 1JYWA 3UZVB 2NY4D 2Q2EB 4LL9A 1IC7L 3X3FL 1ORQA 5ECGA 3TZVD 1IGMH 4IKIA 3FO0L 4CC1A 3HR5A 1AC6A 3AT0A 2UZIL 5TF1L 4O5LH 1HK6A 1CU4L 1CLCA 4XP1H 5FFGA 1FAKT 9CGTA 3WY1A 1P6WA 4HJUA 4DKTA 5CCKH 1X7SA 5DA0B 1KGYE 3BT2L 2XA8L 2DYPD 3B2VH 2I25N 1X5JA 1INQA 2Q5BA 2XQYA 4PPTA 3BHBA 3V7AG 2PTTA 4P5TB 3G3LA 4OFQA 4XB8A 3QORC 3D85A 1QWUA 2WW8A 3L3JB 2WZ5A 5BNXD 3L95B 1VERA 4XZUB 1ET5A 2OBGA 5EUOB 4CW1B 4X4XA 2V33A 3H7BB 5LQBH 4KI5D 5MENE 2LVEA 1C12A 4H2AA 5EOCJ 4AQAB 3TA3B 2EE3A 5H8DA 3I75B 4O51A 2XZQH 4WFGE 5D1ZB 5DJAB 4BCXA 1G7QB 4BH8B 1SMOA 3BAIA 4ZW5A 1U42A 4KO6A 4DP8X 5EEVA 2G3ZA 1UEMA 1PGRB 4K7FB 5HHMD 5I1JL 1SXCA 2QMJA 2NX5D 3IT8D 3T8XB 3JSSA 5I8OH 1XSKA 1T1YB 3PHOA 4Z7WA 4A39A 1A9BA 5I74B 3QIBB 5AW4B 2LW3A 4X50A 4I85A 1ITCA 4M1DL 1SXSA 2VDNB 2RALA 4OFIA 4MX7A 1GL4B 1OTTC 3ZRSA 3E6HA 3QI9B 3NH7L 1ILUA 2E75C 4Y1AA 1A9BB 2IFFH 1WAAF 2VLKA 3SOBH 1YNTB 4DK6A 4R7NA 2BCKB 5HDQL 3TWCL 5T3ZE 1I3UA 1VADA 4GKNB 2EIEA 4X8CA 5D70H 4HGWA 4JRYE 3SE9L 1ZJAA 4Z7QF 1KELH 2ODHA 3HB3B 1OGTB 4K5LA 4C83B 3J27A 4N6RB 3GS0A 1ZRUA 1JNNH 3KPSB 2C1OA 4TNWF 5JORB 4K3DL 1C12B 3OZ9H 4L1TA 1VPOH 5I0WA 1UYWL 3I74A 3L5HA 3KXFD 3ULVL 3W37A 4KHXH 3TNMB 3D4CA 5SX5H 4Z7OB 2F8XC 3AY4A 5DJ8B 2EZ0C 4PV9A 4QRUA 5ANHA 5C0ND 3FSVA 5TGBA 5JNYB 1CF8L 1LK2B 1FH5L 1QOKA 3O3AB 3U1SH 5KSBE 1KG0B 4JGMA 4K3JH 1JMXA 4Y2OB 1T20A 2CALA 3EF4A 5T33H 5EBLB 1RPUA 1G1YA 1LILA 4JY6B 3SDAD 5L4JA 4XCCL 1ZT4A 3S3BB 1MRCH 2DKMA 1JF1A 1ZHKA 3MOAL 3Q2CA 4P57B 5AOIA 5EIIG 1SN5A 3QXVA 4XT1C 3T8MA 4XMLH 2Z8WC 5EU7C 3Q5TA 2VLRA 3OLIA 5KZCB 1WS7A 2MTPA 5K59F 4CSPA 3CD4A 2ZUSA 4P2QB 5D7LE 4NN5B 5E6IB 3CFNA 1NGYA 2VO5A 4HMCA 3VQLA 1CB4A 3MFFB 1TKWA 4QXGL 2CO1A 2XV2A 2BZDA 3FB6A 2O93L 2DQJH 4ELMF 4PB0L 1PG7H 5EC1A 1WK0A 4WNQB 5EFIB 5B8CB 2Q20A 1MNNA 5FYJL 4JM2F 4AUUA 2FATL 1TQBB 3WL9B 2IOMA 4TNVK 3L5JA 3VFMA 3C6LA 2W92A 3VFTA 1S9WB 4WNSA 1ZA6A 3KE0A 2D0GA 5EDXA 4Y2OA 1CIDA 1IBGH 1G94A 1NIFA 1OAZL 1KLUA 4YHMH 4XO5A 5CEXA 1EAPB 4KHTL 2CRZA 2X4SB 3NJNA 5F1SA 3TBSB 3VI3F 3VFSA 4R7VA 4UT9L 3AC0A 1SLWA 4JY4A 3UTSD 1DJZA 5AW5B 1NSNL 2BVEA 4G72B 4Z3TA 3H0TB 3SKNB 5E1QA 3AJ7A 1J9TA 3O41B 4ZMNA 3FO1B 1OZUA 3VO0A 5EU5A 2Q8AH 3GGWB 3DETD 2VC2L 4ESKA 5T3XD 4TRPL 1U8CB 3QWRD 2VXVH 4ZXBD 4DJMA 4H5SB 2Y1ZA 4DZBA 1YEGH 2Q6WB 1WLHA 2ZSVA 4LHUA 1SEBA 4PREA 3RDTA 3MNVB 3O3DB 1CCZA 4Y19B 4M48H 4LLYB 4NQED 1FO0L 5E8DL 2CHWA 3TJEL 1JYNA 3ATFA 4BGLA 4DHLA 4OZFA 1BYOA 5FHBH 4OLUH 1MFDH 2FJFB 2E74C 4F37F 3TF4A 4FABH 5C3IA 3LN5B 3NAAH 2J72A 3O3DA 4HKXA 4Y19A 5GS3A 3RNKA 4QKTA 2YS4A 3OLEA 4MA3A 5C0GB 1AAJA 5ACZB 4ALAC 4C56D 2Z7WA 1VFBB 5BVJB 1E4XL 3FUDA 4GRWE 4HPOH 3REWB 3NSCA 1G7MB 2V5YA 5DR5L 2ZTBA 2J21A 3GHBL 3MJ9L 1V7ML 3LHPL 3JWNG 4OD3L 3IU3A 1DVSA 3A6BH 35C8H 5AWNH 4X6CA 5IFJA 3BQUD 2XUWA 2KC0A 2HPTA 3IMWA 2CUIA 4QT5B 4XN9A 1WZAA 5E9DA 4AV5A 3GJEB 3DNKA 3BP5B 1G87A 4HK3J 2P24A 2YRLA 4MCZB 4U1KB 2F08A 3U0TB 2L8AA 2AJ3B 2F1BA 3ARED 2C9XA 1C8PA 1XF4A 3BFOA 1ID5I 1KTJA 3VACA 1F90L 4Q6KA 2HB0A 1JBJA 4M8UA 4RH4A 5D5ME 4HJGB 3WGUB 7CGTA 1DQQB 4IJ3C 3E6FA 1G7JB 2C1PA 2MNUA 4BHUA 2NY6D 4EIGB 3BXNB 1CXEA 5K1JA 3NQKA 3GSVB 3FH5A 4GT0A 3UTQB 4FYQA 1XXDC 3N1GC 2CR0A 2YA1A 2UYLB 1UCBL 3AUWB 5D1QD 4HJEA 5SV3A 3CFDA 1FWXA 1ECZA 4ZS6D 4MFHA 4MA7H 3EYVB 4PN6A 4RGND 3TJHC 2A99A 1UXSB 4LLVA 1SJEA 3O3EB 1NAMH 3CNKA 4IRSC 2UWEF 3RB7A 2WBJC 3CLFL 4GAAA 4P2CG 4UB0H 2NY6C 2YEZB 3OLDA 1U8IB 3U36A 2XZAH 4JKPL 4B27A 2F58H 3MLTB 1CGUA 3ES6B 4L8CA 3VI3B 3QG6A 5ANMB 3G6JB 1LO2L 4FQPA 4MHHG 4NENB 1XXFC 3BD4A 4Y5XC 4PIRF 3S35L 4O9HH 1FC2D 1I4FA 3BP6B 2WZPD 3QCVL 5DWPA 3NZHL 2VSKB 3X13B 4N0CD 4AKPA 2J55A 3ARUA 4G8FB 5CD5D 1S7QA 3VI4A 4DP1X 4FFVD 1MWAB 2JJTC 3NTCH 2BWQA 2EKJA 1HFUA 2WN2A 4Y5VC 5I75B 2X4UB 3QNXA 4RSYA 4UMGA 3ZU8A 3SDAC 1AFVL 1QPPA 3C60D 3II2A 4X7TA 5IHLB 2RFXB 3U4BH 4R0LC 4XGZB 4YUEH 3RWEB 5I82A 3C9NA 25C8H 1CLOH 4JM2C 3Q3GB 2WINB 1HHIB 3RWJB 4YDMA 3PGDB 2ZXBA 2DLHA 1NOLA 1E2ZA 3B9KA 3BWAB 5C8JB 1EEZA 1TJIL 3NDYE 2JCCB 5TDPB 2DWSA 4S1DD 4BUQA 4V1DB 1IGFL 1Z9LA 3CGTA 3NCXA 5T1LB 5E51A 4ANXA 4MKMA 1A7RL 3FH8A 1P7QB 3MBEA 2ENSA 1ND0A 2JMRA 3T0WA 4GW4A 5F6HJ 1U8IA 3U36B 3LY6A 2O5YL 5IVXE 3P9LB 3N41B 4HS8L 5TE6L 2V17L 3AY2A 5KVDH 1K5NA 1A3ZA 2F5BH 1ND0B 4KV5E 5ITBH 3A0OA 2ATAA 2B16A 4UNUA 1JZDC 2ALWA 3QIWA 5EZOL 1MZZA 2OZ4A 5ID0B 1E9QA 1GMIA 3ZDXB 2WQVA 5DMKA 3SSGA 1NDGB 4JO8A 3MUUA 4G8EA 2JKNA 5A16B 4AIZB 4BRVA 1LO5A 3QG7H 3AY4C 1XTMA 4HU2A 1A1NB 1DTUA 1OTTD 1RUKH 1U91B 2YPVL 1PNCA 3GM8A 4AQ1B 2H8PB 2BVYA 3IJSB 4WDIB 3WSQL 4PJCA 2HTKC 2IANA 3UGUA 3GZQA 3FK3A 1WZ1L 1XH0A 2WXNA 4YHYC 3PU7A 2X0UA 2NY5C 1SUJA 2ZXCA 4YBLB 5IR1B 3FCBA 5IEKA 2E7BA 5FGBC 1YQVL 1JZJA 5DS8A 4YAQA 3BESR 3SKJL 2KH2B 2R9HC 2ZUUA 5KYXB 4X6DF 5BZWA 3I6GA 4G6KL 1BQHA 2YN5A 1PIFA 1T89A 4DZ8B 1FJ1A 3VTMA 4YIQA 4NDMB 2KPWA 4ES8A 5JYLA 1NIBA 2LE9A 2GW5A 1GYUA 2CXGA 3EOBB 3T6QC 3L9RA 3C5ZA 3MBWB 1U8LA 1HC1A 1E6JH 2XHNA 4S2SB 4XNMA 4CL7A 4YDVB 5DRZB 3V6ZA 4PGDA 4AG4L 1QUNA 4KXZH 2NUTB 2D2CC 4NUGH 3ZTEA 2BS8A 4HH8A 2BP3A 5C0FB 2OSLA 3L4TA 1WHPA 2GSIB 4LVEA 2EIJB 3IETA 2R2CA 1K2DB 1QUNB 3JBG7 2YC1B 3D4ZA 4ZDHA 3JWOC 3P4MB 1N7ML 3O4OB 1CIUA 4Q2ZA 3RGVB 2VE6A 1FNLA 1U8PA 3DSFH 4CILA 4DNLA 4OGAD 4HUVB 1BQRA 5IQMA 3KPRA 4FG0A 4TVSa 5E6UB 2YD0A 1HEZA 3HG2A 3IXAA 4IIZA 4H88L 5ERWA 4UTAL 2ED6A 1BAWA 4WW1B 4D8PB 4WW2C 5C0AE 3ARGB 3P4NB 3MX0B 3KG5A 3QXDB 3HPJB 4Z7VE 3H55A 2BC4B 5AB1A 5C0CE 1EH9A 1WWBX 2NX5B 3S96B 1UENA 5DUBB 4OB5H 4OGQC 4UINL 2W60B 4LRNH 4F8NA 4GMSL 3ZYIA 1VCBC 1EQWA 2AANA 1OEZW 1I82A 3QUHA 5LCVL 1DQTA 1KTBA 3IJEB 1SYSA 4GRMB 5JW3L 1RUAH 1JZ4A 5L6YL 4AGNA 2Y06L 1G7HA 2E7DA 3PQYD 3BH8A 2IPTH 1FVDB 2BNQA 1MXDA 5EZLB 3UMTA 3M17A 2DOCA 3B56A 5GSRB 1E8WA 3V10A 1QBML 3ECBB 4HKBB 2BSED 3VSQA 4Y2DD 1U2YA 2H2PD 2YHGA 1MFEH 4OJFH 2Y72A 3W57A 3BUPA 3HZKB 3SIKA 5E8NA 1NEUA 5J0BA 4HWNA 1XIWD 1O6SA 4MNGA 3V0WL 3MRKA 4KXBA 4QRTA 4OF6A 5DJ6B 4QY8B 1D5XA 1N4XH 2VLKD 3FTGB 3L1OH 4XO9A 1J8RA 1PX4A 4G1MA 3IDIB 1MCOH 1OSYA 5ERWB 4M8QA 3GNMH 1CDJA 4MJ6A 1AXIB 1IM9B 1YNLH 4A7VA 2XPGA 2W9DL 4JFQB 2IADB 1H3UA 3WTVA 3DJZA 1FFNB 4KK9D 4JFXB 3RL2B 1BVOA 2BJMH 1X5ZA 3O8XB 1VGKB 3R8QA 2RTTA 4EPSA 1I3VA 1BV8A 4ILDA 1EIBA 3ML9A 2PXYA 2WP3O 5FR3A 2VITA 1SDDA 2WLYA 3T1FA 3DSNA 5GGSY 1DJSA 1GKEA 2VH5H 4PJCF 5CGBA 1WCBB 5HYJB 1AH1A 3FQWB 1AZUA 1QABA 4ZI8A 3T71A 1GGUA 2H1LM 5HGBA 3QO1B 3WJLC 4DVRH 3D8MA 3GBMH 4HSAC 3MV11 1S78C 2AK4E 1MFCL 5LBVA 2R69A 3D4GA 4I3SL 4GMTH 4QNPF 2QT6A 1G7QA 3AU1B 3FFCE 3IMBA 1UOKA 5D7JA 4LPUA 2PYFA 2MCPH 4LESA 3WIHH 1AGCB 1BG9A 3IF1A 4HG4K 4G6MH 5F3HA 1UXWB 4QRSB 2GKIA 2I9LA 3OHMB 5EF3A 4DP4X 5IB3A 4DGIL 2CA4A 5DSCA 2WD0A 1L6ZA 4W93A 1IZJA 3OMNB 1J88A 4EI5C 3S37X 3ZGHA 5A6MA 1OSPL 1MNUL 3CZLA 4MJ6B 4P04A 2HT2D 4KBPA 2EXSA 2GVYA 4MRBA 2BC4A 3FTXA 4YPGB 2NLJA 4G7SB 2YMXL 2HRLA 4XP5H 4JO1H 4EQ3A 1MEXL 1Q94A 3SN6N 2BSEA 1WIPA 2Q86A 4YHNB 3CIAA 1MCBA 4RMTA 1H8OA 1M9WA 1EX0A 4Z7QB 4DKFH 1ODAA 3CXHK 1UA6L 1R19A 4YSAA 5IJKC 3UPCA 2PXYC 1MFNA 2H3XC 5HHQA 1RZ8A 2X70A 3GBLA 3QRLA 5JPNC 3QS2A 4MJ2A 2D0HA 2C3HA 4G43B 2D8KA 4IEFA 4XNXL 5AQ0A 4M7LL 3FU7A 1FL6A 3PXHA 4A38A 4N0FA 1FQ9C 4ZTOL 5KEZA 1MCQA 3ELAT 2N01B 4WENB 2P47B 3L3IA 3ZQXA 2QPDB 1FG9C 1I85C 3HZKA 5ES4B 4JHAH 1RUQL 4W9GC 3NZUA 3OX8A 1UH4A 4UU9A 3FT3B 3LYRA 1Z9SB 4CN1A 3VFMB 5TE4L 3ZXAC 4Z8FL 1JCVA 1ZTXH 4PJBB 3U7YH 4O51B 2GCYB 5IHUL 3EGDA 3MA7A 5FC9A 4ZFZA 2I7OA 4J3TA 2V9TA 4WWKA 5I6MA 3VG9B 3DGDA 3GIVB 4MMZC 4WHYH 5TDNA 3GPEA 4AZ8B 3BAYA 4BA8A 2B4CC 2GK2A 3LIZH 4AQZA 5FV2A 2Q86B 5G4MA 4POYA 2ZICA 4HLZG 1IBFA 1JWUB 4PW9A 4L5FH 4L8SB 1QA9B 1WBZB 4J3WA 1U8CA 3S3JA 3LV3B 5JOEA 1EUTA 3DX1A 5FGBA 4K7PY 2LLNA 3FB6B 3HR6A 1B2WH 3ALPA 2H1XA 2ZXWB 4G8AC 2YFOA 3IS1X 4TQEH 4Q52A 3FU8A 3HZVA 2R59A 2KQNA 4X9FA 1FLRL 1KWGA 5AL0A 4GRWF 4G3YH 3QJUB 1M56B 5DQJA 3OTTA 4H26A 1MJ7H 4DOHE 3B7UX 2FQEA 1GPOH 4L8BA 2DQIL 3TO4D 3MZTA 1DVYA 2G60L 3FMGL 4U3XA 1XMWA 4OUOA 3VMOA 4AEHL 3K6SA 4YXLL 4JRXA 1CG9A 1AG6A 3BWUF 1YZZA 4PJGE 5HGGS 2JCCF 3M88A 4G7VH 2UZXB 3VXRE 2BZCA 2V3EA 4JM2A 3GI8L 1UATA 1WP6A 1OP5H 1T20B 5H94B 3LDBB 2ZOLA 3VXNB 2WBJB 3K6NA 3UZQB 3GXDA 3EKCA 4I2XA 4IU3A 4RWYH 4U0QB 4N26A 3PP4H 5LN4A 4MJIB 4ODTH 1KJMB 2J6EH 2SEBB 3IGKA 1KPVA 3ZZ1A 1NCOA 3F6JA 3ZR5A 1QSED 1UACL 3CK0L 1L9RA 3UZQA 1FVEA 5AAPA 2EYTA 3G6DL 4AIXA 1PKOA 2R29L 5C0DA 4FMKA 5J6HB 3FNKA 3VYNA 1NCCL 4FQHB 5IROD 3US9A 3RFZA 3MI6A 1CL7L 2VDQL 4O02A 3F8UB 1N0LA 4MAYA 5HGAB 4BFNA 4K9JA 1T5KA 4X80L 4UU9B 4A63A 1Q90A 1HOCA 3QT2A 5IGXH 1CJYA 5LAXA 3ROOB 3A6OA 1WT5C 2Y5QA 5FA3A 3QUML 5DXWA 1RZ7L 3ECVA 4UT6L 1S9VA 3RWFA 4BHUI 1MRFL 1PKQB 2A9MH 3QJZA 1FNFA 4RMBA 4W9DC 2J5LC 5D2NE 4MX7B 2VXSL 4MNHA 4FI7A 2RQEA 1H0DA 1EO5A 1Z5LB 3VM7A 1UXSA 4LLVB 4PLJC 5AD0A 5JQHC 4Y1AD 4Z23A 4UTBA 4HZLA 1OAXL 3PWNB 2HPOA 5JHDE 4AVKA 3HMWH 4U6HB 1PEWA 5JPMB 3O6FD 2I60H 3KDMB 4JGUA 2KDYA 2IQ9L 4I2XB 5CU9A 3FO2B 3ARPA 1HI6B 3FUHA 4DN3L 1DUZA 2W0FB 4CC4A 1DJIA 4Q89A 1OO2A 1HEJC 1NCWH 5IT2H 2X9XA 4AQ8A 5MENA 1YYMH 1H3TA 1I1AD 2WXKA 3CLEL 1Y18A 1XGUB 4EIUA 4KKCD 1KGIA 3JUYA 3DJRA 1TMQA 4PD4J 5AYUH 1JERA 4PBVC 2KLTA 3L1FA 2IXQB 2YMOA 1KIRB 4ZMLA 1JAEA 1RZKL 3NESA 5HBBA 5I76A 1J0YA 3CVIH 3DPDA 1UWYA 3QZLA 1P6AB 1Q4NX 4OVVA 5ISZA 2F8IA 4X5WA 1AMXA 4JDVA 2WWMC 3I3EA 4GUPA 4DK3A 3O2WL 3DUSA 3MSPA 2WQAA 3NFSH 4QO1A 1I8IA 5K39A 1W2KT 1EERB 5FOBA 2J3SA 5I76B 2X4QA 2PR4L 4G2AA 3KGTA 4NSKA 1WTGT 1CLYL 1WQVT 3FRPA 2F2HA 4E0RB 1J5DA 1S7XA 2X7LB 3BDYL 3D3VB 5TDPA 3GMRB 4YHKH 2ESVA 2YEZA 2OYPA 1H3PH 5EEXA 1X4ZA 3D69B 4HC1L 4JANA 2YPLA 1TEGA 1IU1A 1RZJH 2FD6H 2W0PA 3V5KB 1DUZB 1QO3A 4NQXA 5HHPA 3RPKA 5D7KE 4M1GL 3BPLC 3MFFA 4W70A 1GHFH 3RVUD 1GAFL 3TZVA 4DEPB 1ROWA 2R2EB 3KCWA 5EU4B 1J48A 2FLBT 4NLAA 1FZOB 1QEWA 3W5NA 3MRFB 5DEFB 1KIPB 1OPOA 1TJMA 3ZDYE 2BY1A 5DFTA 2FIKA 4U1GC 3CH1B 2VQ4A 1O6VA 4HPYL 1E5BA 4M7JH 4WI9A 4C56B 4TSCL 1ASPA 3JWOH 1E50A 4DVBB 4MCZA 4U1KA 1QFUL 1U3HC 1C5BH 4M8VA 5E03A 1S5HA 1JGIA 1G7PB 1VGEL 2IBBA 3IDUA 2MKWA 5CD3A 1WZLA 3VH8B 1K4CA 4AL8L 5LJYH 5DRXB 2VZ3A 1OAKL 4MNHB 4PJDB 5E5MB 1QSEA 5EZIL 4M1DH 1EEUA 1R24A 1TZHB 5KSUB 5INDA 3LNDA 3ARWA 3HAEB 3QEQD 3CFDB 4G8GB 1IC5L 3OKLA 4LXFA 4P9ML 5CN1A 2ENQA 3BI9X 3DJSA 1KGUA 4UT7L 4W6XB 2HJLB 4R4FL 5DJ2B 5HXMA 3VQ1C 3H3BC 1LO3H 2W65A 3IMUA 5JHLH 1WSST 2OL3H 4HUMB 5ILTL 4YLCA 2Y07L 5BZDB 4OCXH 3D1MC 1CTOA 3MJ6A 3QWRA 4FFYA 4Y0GA 5IK3A 4LHUG 2WCSA 2A1WL 4BQBA 1Z3GL 4J7RA 2ZSVB 2YIHA 2B3RA 4PREB 2F53B 3RDTB 3U4AA 3MCG1 1TMCB 3D33A 1NDGA 4APQA 2OM5A 1F0LA 1XL4A 3T0ED 4L37B 5F0JB 4A7TA 2QKIB 2XXMB 3P1VA 5IMLA 3GMMB 3WFEL 3EH3B 2YRPA 2P46B 4N2HA 4JFED 4HUWA 2WWKT 3FQ2A 4DAGL 3V52L 1DBJL 5L88L 3WKYA 4HUVA 4KI5F 3SB3A 1BF5A 1A7OH 4APQB 4XCNA 2WMPB 1D7BA 3LJ3A 2BSCA 3C12A 4UBDD 3AFLA 1N67A 3UBXB 1QUPA 3VXUA 1NMCC 5C0NC 5BRZE 2NXYD 2XICA 4CGTA 2VMFA 3T4AA 1CT8B 2V7NA 4NS0A 5DJYA 2E6QA 1RJLA 3BZEA 3GMRA 5EN3A 1S9WA 2BFVH 2C4XA 1V05A 3KYMB 3N0PB 2HWZH 3C75A 1XQ4A 3V4VA 3WEBA 5ECJE 4FC3E 1WFNA 2XETA 2FO4A 4NKDA 1L7TH 1R17A 5KSBF 3QXTA 3B9KB 5JIIA 1UUSA 4QEGA 1CF1A 5CN3A 1MQKL 5FW7A 4OZHA 3QA3A 1PIGA 5F88B 1QFHA 1FO0B 3AAZB 3H9SA 4ADGA 1RVFH 3AB0C 5EBMA 5FDWA 3GINA 3ZQWA 1XZ0B 1SLXA 1IQDB 3HMXA 4HIPA 4NJAH 3STBA 1NBYA 4QYOB 5C08E 3IDMB 4J2XA 2XX1A 2A6KA 4NUPA 1XCQB 4QHLA 1BFVL 4WU5A 4XOCA 3C9NB 4QHNB 3ULAB 4N2BA 2FT7A 4NWUH 4D8PA 2VXTL 4GQ9L 3F6LA 1MHCB 3U48A 2DJSA 4OFKA 4PR5B 3VG0H 3ZJAA 2G5BA 3ZHFA 2BW5A 4XNZC 4U1NB 3MXWH 3OV6A 1U8MB 4FCAA 2CLRB 2DPKA 2XN9A 4D2NA 4LCYB 1AR2A 4JN2B 1R34A 5D4IA 4ENED 3X11B 4DO6A 4DERA 3NP4A 2APVA 2G5UA 2UY7A 4O02L 4JLRB 2F7OA 4HK3N 2ZF8A 4KROD 4UAHA 3QZPA 1XH2A 1SYSB 4FQLL 2GUOB 3VRIB 2H3KA 2LU3A 1N6QL 4LLMA 4LIQE 4WTQA 2BNRA 5KTEH 5HYJA 2HYMA 1HINL 2AAAA 3E7JA 3QYMA 2F53A 3W0WE 5ESQA 1LNUA 1SF5A 2DYSB 2Q8AL 4BH7A 4I0PC 2OMVB 3I50L 4IRSB 1PFCA 5ESAB 2ROXA 3LRHA 1UEYA 1HZLA 3UAJC 5FDWB 2BSTB 2C3GA 2X12A 3QHZH 3E0GA 3AUVA 5I6XB 3F12B 4GAFB 1E7UA 2J1ZA 3GJEA 1MIML 3DRTA 2XBDA 1H6UA 1E43A 2BP8B 3FQUB 3OAZK 5FUCC 4YX2L 5BXFA 2RFXA 5CZVL 1NBVL 1TSRA 3SGEH 2K70A 2P24B 4RFOL 2R7EB 1G1OA 1VKXA 3LH2H 3UTTB 2RA1A 2V2WB 3HE6B 5E56A 2Q87A 1HCYA 4H20L 1SDYA 1OSZB 5F0MB 3UO8B 2LT9A 1R3IL 4HVBA 1DE4A 5I5MA 2R0WH 2R15A 4NZFA 4IDJL 1XR9B 4ZAKB 5J5EA 3I6LD 3RJDA 4OZFH 1H9DA 32C2A 3SCMA 1VSCA 3RTQA 4JFYA 3QDMA 4XWGH 2Q7NA 1GYWA 4XMXA 2XKNA 3V5HA 3VGGA 3AITA 1QRKA 2AABL 4FI6A 5A7BA 1AACA 1HL8A 1YPZB 1DSWA 4S2SA 2UY7B 2VDKL 1R0AL 2EYSA 1YO4A 2IPUG 4P5TD 1AY1L 1ETB1 3BSZL 2NUTA 4X6DA 1EAJA 2V2TB 4DGVH 5C0RH 3EJZD 1Q72L 5JA8B 4JQIL 1T5XA 3CU7A 4LCIH 3STLB 1RUMH 3C6LC 5E4EB 5GGRA 3F7QA 5HDBF 1UM4H 4OJDH 3X17A 4BZ2A 3ZDZE 2BCMA 2IH9A 3DIDA 1JIBA 2HJKA 1IGJB 2YWYA 5E5RB 3OKYA 4L4TD 1T04B 1INEH 4JFDE 3GSOA 4PRBA 1F90H 3MUJA 1F4AA 3GS7A 4HCIA 3T65A 2WVUA 4NRXA 4Y4KB 1E5UI 4UV7L 3H2PA 4D0CA 3KZ8A 2D7PA 4R4ND 3QEHB 4IMLB 1I9IL 1WJ3A 2CH8A 4WWKD 1E4WL 3EYFB 4N2KA 4HXBL 2AQ1A 3IE9A 1KGCD 4D9QD 4L9LC 3KYAA 1MAML 3APCA 4E42A 1QR1A 2J8UA 4GOSA 4RMQA 3CXFA 5E8OA 2FSEA 1PD1A 1YPZA 4CDGC 1OD7A 4NKQB 4AVIA 4RAVB 1MF2H 2VR9A 1MW0A 4X8XA 3WIFA 4V1DA 1YY8A 2EECA 3BLBA 3IRPX 5C0FA 4L8SA 4U6TA 3F7PC 2DLEA 2GTZB 3MREB 4P2RB 5EC2A 2YAOA 2CLZB 4DQAA 3QWQB 4NZRH 4RAVA 2QL1A 3VW3H 4HOMA 4WHCA 4POZC 1G9HA 4XPBL 4PJCE 3LZPA 5AUMB 2J71A 4HW6A 3KXFE 5C9JB 3E9TA 2E56A 4MMXB 5TK4A 2O6PA 1NWOA 4PG9B 4UQEA 4PLNC 3UG4A 5EOCH 1U3NA 1Y0LB 4U33A 4KK9C 2X2YA 4JDEA 5AW2B 3TVMB 1T83A 2DQUL 4LP8A 3K6FA 4CBPA 3MX0A 1DQLH 4H2CA 5CN2A 4PCYA 3HZMA 4FQXD 5HY9B 2AJZB 1AR1B 1P5UA 2OPCA 5BCAA 3NA4A 5JMRA 3WJLA 4X8JA 4P2OC 3SY6A 3EZ8A 2WZPA 3Q13A 3T8VA 3ZE2B 3W11C 2I9LB 5D6DC 3O3BA 1C16B 4X0KB 4GBXC 3MCLL 4BUHA 4IIQA 3GMLA 3QDHA 4ZAKC 3O9WA 5TF0A 4HJJH 2R69H 1H5BB 4Z0BL 5D8JL 3FQRA 4PGZA 2MEJB 4APQC 2B39A 4MXWL 1JZGA 2EYTB 4JFZL 4Z7VB 5H4YA 1S9KC 4KZEL 3SPCA 1HIML 1OF2B 3I9PA 2XQYK 1GGTA 2CO3A 2QR0B 1USQA 3T2NH 1NFKA 1XGTB 3EJQA 3HNTL 3LS5L 1KTRL 1EHLH 4N1EA 5D9SA 2VLKE 5B3SB 4ZXBA 1DVFD 4JFEE 3RDTC 3PDOA 1NAKL 4JAMB 5IVXA 5J12B 5DJAA 4MQXD 4IEFB 4M02A 4CVUA 2OZ4H 1DO5A 2F8VA 1U41A 1LYQA 3MOQA 2DDQL 4TKWA 4IGBD 5DC0A 3RE0A 4TTDC 4F57L 4G1EB 1XMEB 5GS2H 2F5AH 2JLPA 2OW7A 2B3IA 5F0PB 5E2UH 1CICA 3WEAA 1ZA3B 1F6LL 4R5TA 4B9YA 4KUCD 2ZOLB 4LE8A 3VXNA 3VSTA 3KNBA 3RVVD 1U6AH 4HWUA 5EH1A 4MZRA 2YAHA 4KOCA 4OV5B 1H3WM 3E6HB 3QI9A 4G5ZL 3AXLA 1TCRB 3S0PA 3CX2A 3SE8L 4F7PA 4P4KB 4GKNA 3QO1A 2EUXA 1T4WA 4MS8D 3QW9A 2EEBA 4Z7VA 1BOGB 1V3LA 3KM2A 3OL2A 5I6KA 4M5ZL 2A9NL 2OMXB 4HKZB 4AIEA 1DDTA 4GRMA 1DANT 1BGXH 3ARBA 1DBML 1N0LB 5HGAA 3OGOE 3AWFA 4ZS6C 1YJDC 1HSAA 2ITDB 4A6YB 2AJUH 4XVOA 2H47C 4NQCB 5EIQA 5B38G 3EBIA 1N7MH 4I3GA 3V9CA 1TPXB 3IPEA 3OR6A 3VFWA 5I8KH 4WTWA 1Q9WB 5TE7L 3BMWA 4F5CE 1NCAL 5E4OA 2VM9A 5DRNB 5AW7B 3B9KC 2GCYA 1DVUA 4L18A 2VGLM 3CVDA 4PWHA 3T3MB 3V4LA 3HC4H 1WD8A 4I8DA 3B8SA 4X8JB 1MRDL 5F9JB 3TO2B 5EOTB 2E7LA 3DK0A 5ABDE 5IB2A 2PW1B 3RIFF 3HBZA 4GP4B 1WHOA 2BMKA 1KBBA 3DGGB 5DRNA 3SQOH 4X4ME 3W3BA 3VXOA 2YLHA 1VADB 1ZT4B 4XZ4A 1T80A 1RU9L 3G6AA 1D9KB 1DL7L 4ZX5A 1BVKA 4A2MA 1XF2A 1VF5C 3P40A 5FO7B 2OK0H 5AKRA 1EJ8A 4TULL 5I1CL 2MCAA 5D1XC 1SEQL 5IEHA 2AK4A 3TEZA 2GAZB 2E59A 1G6RH 1MREL 2WYZA 2NY5H 4XAKE 4NHCH 3GPSA 3POCA 1S6NA 4NFDA 1A1OB 1IQWL 4QMEA 5E08L 8FABB 3US0A 3UTPE 3FZUD 3R0NA 3VMNA 3ZKMD 3QNYB 3LTVA 2Y7LA 1SXAA 3H56A 3LN4B 4DQOH 4FYRA 1O6TA 4GUPB 1LK2A 4AW4A 2JKWA 1OGAE 3JXAA 1FL3B 1FL5A 2RMNA 5E99H 3NSFA 3FH7A 4AZUA 3QUKB 2AI0H 4A7QA 5GS0H 2E9JA 4BK5C 1FA4A 2NSMA 1MCOL 4L3CB 3TURA 1DQJA 4L3EA 4L4VA 5HTSA 5CLYA 1YNTA 2AJVH 1MLCB 1UOLA 2HCZX 2KHAA 2X1PA 1AQKL 2PW1A 2W9DH 4FN0A 3F84A 2CPCA 3TJPA 1XD0A 4U1MA 3BGMB 3D0AA 3AABA 3PHSA 4NKMB 3VSUA 3D2UA 1J0HA 1INQB 3BFQG 3L2MA 3DO4A 2AJXL 4PBDA 4NYLB 3KDMA 3RTQD 1KDJA 5T3XH 2NY3D 1KFAL 4ATTA 5CEZD 3ZT5A 4U1JA 1K6QL 1S7TA 3RHWK 5E1AB 1JGUH 4GQPH 4JM4L 4F2MB 4MZIA 2ZD0A 4OUUB 2DMGA 4PRHA 3OKNB 3SKNA 4LSQL 3STZA 5F1NB 3DX7B 3Q5OA 4AYDC 2KI6A 4QOKE 1HU8A 3MRNB 2QZQA 3MRHB 4BFBD 1S7TB 3V9EA 4E9TA 3IDJA 4KQ0A 4NN6B 1L4IA 2M1KA 2WMPA 3ESPA 4MKTA 5F93C 5FA3B 2LTQB 3DX7A 4PB9L 4OJAA 4ADJA 5BPPA 3NABH 1G0YR 4IBYA 3SD2A 4WO4C 2CUMA 1NCBL 3OWRA 5D4QA 1E4HA 3SDXE 4E41D 3WEXB 4D9QE 3N40F 3BVWA 1J5HA 3DX3A 4FKKA 3QUZD 5FF6A 4A7SA 4ZX4A 1ADQA 1N2RB 2HKHL 1GGCH 5LBSL 4JHBA 4D0DB 3D39B 5F44A 2AGJL 1BAFL 4PRDB 1YJDL 3LRMA 1WGVA 4PHZA 2W65B 4QXUH 1F4XH 4PJ7A 4TPRL 3E9UA 1MEXH 4Y1AB 4HS3A 5C6WH 2LLGA 1G5GA 3FOLA 4L29A 1WGOA 3TN0A 3VQ2C 2EEXA 5DO2D 3CSYB 1Z66A 4UDTA 1RKRA 3MNWA 4D3CH 3TIDA 3B83A 3RB5A 4QWWD 2AMUA 3UH8A 3QQ4A 1NPUA 3S88L 3VWKA 1BLNB 2YPLB 1JV5A 1TO4A 2YKLL 3MNMA 4LCWB 1EJOL 5EEUA 3PFUA 3CFMA 3FFCD 4PVMA 3B3IA 3SGEI 3X1GA 5HGHB 3UAJD 1Z5YD 3RVTD 3MODL 3K46A 2IG2H 3L3OC 3I2CL 4KUZH 1UWEL 1MPAL 1EJ6A 5D1QB 2VDNH 2EZ0D 4XE0A 3NUKA 1T0NA 5TTRA 4UM8A 4IKLA 1LEIA 3MRJB 1ZWIA 4M62L 5GZNA 1BFOA 3CX5K 3P9MA 3F2LA 4XXCC 4RAHA 3FCSB 3MTRA 5ETUA 1QQDA 5KUKA 2WB1A 2ZPKL 4D0DA 2AITA 4ZQKB 4M9PA 2XY2A 4KJQC 4NO3B 4NQVA 2GPZA 1PLBA 1T4KB 1JK9B 5MEND 1DSFH 1YMMB 5E6ZA 4Y4HB 3CXDL 4AMKL 3V0IA 1WZKA 4HAFA 4YHOH 2XN1A 2N0MA 7FABH 1ZVYA 5EUKB 4O2EA 2HJLA 5DJ2A 4YQXL 5EB9A 4P5RA 4NQQA 4Z7UE 3U2JA 5KBPA 1MIEL 4EKJA 4P4RA 3GSQA 3MRHA 3C08H 2AKRA 3T0VA 4GW5B 1KCKA 4K2UH 4YHIB 3BWSA 1RZJC 3K6OA 3MR9A 3U30B 5GJSL 1G7PA 4FXKB 2W0KA 2ZSWA 1BWWA 7PCYA 1YECL 4P23D 2G60H 3FMGH 1O7DC 4FZEH 3VXPB 4XC3H 2ED9A 4PP2B 4NRZB 4P07A 3H9YA 2DIBA 2EDNA 2ZG1A 4ISVB 2ICEC 3FRUA 1RP9A 3VJ6A 2E9WA 2F19L 1E5CA 5DI8A 4MD4B 4KK6C 1QBLH 5CLTA 4BFOA 1YG9A 2AK1L 5K9OB 2M83A 1YSOA 3WTXA 2VJ8A 3PP4L 4CMMB 3E3QC 4OW6A 1JPFB 3VA6A 3ZUCA 5JPMA 2JXMB 4FOMA 1J8SA 1XEUA 2B1OA 2AJYL 2B1HL 5FFLA 1S7QB 3N2JA 3VI4B 3S2AA 1A6WL 5IQ7L 3EFOB 2OMWA 1A6UH 4OLXH 1KY7A 4OIFA 1W16A 2Q3XA 1J1XH 4DZBB 2AV7A 4PRIB 1CFVH 5IG7B 1M05B 4PY8I 1F02I 4H0HB 1HEHC 5GRYA 5EIIA 1FBIH 3QRGL 3MRPB 4ELDA 1ZJBA 1PZ3A 5DK0A 4JZOA 3CFEB 4U1GB 5DMKB 1OY3B 2C9RA 4JO2L 4LP4A 1ETZA 3LN5A 4NFBA 2CR3A 4OGZA 3PL6C 4P3DB 1FNAA 1IBGL 4WHDA 4KNQA 5J89A 5DWUH 1JPSH 4QHUB 1D5MB 1UWXK 5FCUL 1MHCA 3ISYA 4K71B 4I5BA 4N2CA 4OF5A 2NZ1A 3GMQA 4H8WC 1FAIL 1Q9KA 2WUBL 4LKXA 3NK4A 5IEKB 4QHNA 1JZ3A 5FK9B 5E9DE 1IEBA 3WS6A 4TF4A 4YN3A 4M5YL 3L7FB 1TSHA 3FFDA 4FXLA 4HF5L 2CJUL 4FMVA 5FCSH 4I88A 3KYKL 1HNYA 5HYQB 3BZFA 3HKFA 4IU2B 3QJFA 1B0RB 3DXAE 2HG5B 1PYWA 3BKJH 4Y5YA 3FF7A 3VXSD 5I9QC 1N68A 4DH2A 2PXYD 3GSNB 1D6EA 1CGSL 4WTZA 3ULUD 4JFDB 3FSZA 1T22B 4ZRGA 3MRBB 1LO0L 2R1XA 3ZTNL 2R2EA 2X9ZA 1S9XB 4W9IC 2ZWKA 2CCLA 3HE7B 4U7MA 4P59L 5ESAA 3MRMB 4GEIA 1U3ZA 3DX9A 5I30H 3D5OF 4KRNA 1A6VL 3T0EA 2CO6B 2KS0A 3NA9H 4HUCA 1BD2A 2M26A 1AR1D 1OPGH 2QQNL 2WQUA 4JPKH 4Z18A 1V3KA 2P42B 1P5UB 2X3BA 1E4XH 1E2WA 2NXYC 1C08A 4PJFA 2BIMA 3EUUA 1IGIH 3MBEB 3WN5A 1DEEB 4LSUH 1A7PH 2X53A 5BJTB 1A0QH 5B1JC 2LGNA 2NW3B 3O3UN 1EGJH 2L4OA 5INCA 4RDQG 4YDVA 5D1XD 1TNMA 2Y3NA 1BX2B 2BRRH 3FUNA 3IMVA 1IAKB 2YGNA 2R23B 3B4NA 2Z92B 2MPAL 4KROC 4MNGE 5FHAL 4HHWA 1OLZA 2G9HA 1CD1A 2EDKA 5LNGA 2Q7YA 3SCMD 3HI1B 3N04A 4XPGH 3UJTH 1FZMB 1IBZA 3G6JE 1WAEA 4JFTA 4KY1L 1KV7A 4XCEB 1BM7A 3GMOB 3LKOB 4BKLB 1HXMA 1BP3B 3P4MA 4QYOA 2AQQA 2J1XA 4NJ9H 2IAMC 1YCSA 2E5EA 3DVNB 2D3NA 1XIWB 2DIJA 3PXJA 4G6AC 2OYMA 4G8FA 1BCIA 1RIHH 1Z32X 4JDEB 4Z7IA 5KVEL 1OGSA 2E7MA 2VQTA 5HHXH 4UOJA 3JWOL 3T0EB 3F62A 1E4KA 1IE4A 3GK8L 4BD4A 1XFPA 1MZYA 1JFQH 4WKXA 2JKSA 4H25A 1M71A 2IWEA 1QSFE 2Z31D 1Q0YH 4YSEA 2HKAA 1F11A 3PGCA 2BNUB 5EO0B 1YN6B 1DEDA 5EULV 4P5KB 4TUKH 2FX8L 3QDMB 1E9PB 5IBUB 5TDOA 1PZUB 3X3GL 1A6PA 2OAAA 2A6IA 3RUGF 1ZV9A 1N64H 4X4ZA 2OI9B 2FBRA 3RJOA 3MUGB 3K71A 3VFUA 4AT6B 1RMFH 3AXLB 2RQ8A 1Y1UA 1CQYA 1A8JH 3WTUA 4JO3H 3D0VA 4YHPA 5HYJD 3MV8B 2FSEB 1X5FA 4OM1L 1FDLL 2FEDD 3RILA 1S2EA 4K7PL 1KN2L 5CCJA 3P4OA 3DX4A 4BRJA 4NKIL 4L05A 1JMZA 5E2VH 3W2DL 5KVFE 3MRBA 2WYTA 1PJWA 1RURL 1ADWA 1BQHG 3O11A 2PN5A 4A6YA 2A83B 1UWGH 4PVLA 1DBBL 3WFEH 5DJ6A 5HYSA 2C7FA 4HQQL 4Z9KB 4AYID 3O81A 3H3KA 4OZHE 3LVEA 3MRRB 1BAGA 2B4CL 5DFWH 1JI1A 3IDIA 5I0VA 4MB5A 4MASA 2IANB 1IFHH 3LNHA 5FKPB 4MA1C 2QGBA 4M7ZB 3AU1A 1JL8A 3D87B 2QFPA 2R2BB 4OFDA 2VRAA 3MA9H 5C08A 1SQ2N 1FSKC 2DQDL 2HFFA 3EZJB 2NQCA 1B6UA 2K9UA 5IB3B 5E8OB 4EBQL 1OAUL 2FLMA 4GUCA 5KJ7E 5EU6D 4IMKC 5L2JB 1YEWA 2H32H 1W8EA 4MAYC 2XV0A 4X6DB 3ZO9A 4YFLI 1V7NL 4R2GB 5BQ7B 4GJTB 5GRUH 2YAQA 3O6KH 2EDOA 4NHUA 5FO7A 3QUMA 2WNXA 4NDMA 4NQUA 2OMZA 3L3JA 3O6LL 1QYGH 4PV8B 4WK2B 2ENYA 4P5TA 4XPHL 1S5IH 4BFGA 3FYEB 4DPAX 1ZT7A 4UV4L 3BX7C 2XC8A 1TJGH 4FFZA 3CZSA 3VI3E 3VFPB 2Z0BA 3LZNA 3HG1E 1Y0LA 1A25A 3T08A 4ZTPH 4HC1A 3MGAA 3LRLA 3R19A 1OM9A 4GO8A 1JXJA 2B1AH 3FN3A 3TONA 5C0EA 4OGYH 4ONFH 4TSAH 3PGFL 3T3PE 4ZDHB 1N10A 3WD5H 2R0ZH 2AXFB 3Q2WA 1E8YA 1U8KB 3QJHA 4Z7UB 3RGHA 2VXTH 4GQ9H 3WO4B 4F1ZA 1S3KH 1QR1B 1WDAA 4IOIA 5TDOB 3VG0L 1M53A 1TLKA 3FHQA 2HRHA 5AAMA 1EHNA 3IJ9A 6FABL 4JCWA 1C5CL 3QIBA 4XNQB 1LK3L 5DQDH 3MV9B 3WIFB 3OF6D 3HN8A 4X7CC 4BFIB 1D5BA 2D0FA 4JFYB 3X12B 2VDRB 5HGDB 1UURA 2WAHA 5AWNL 3QXDA 3FN0L 3O6ML 3V0DA 3S5LB 3JWDC 1YC7A 3WFHA 5D2LA 3FCGA 1MUJB 5JIQA 5KJRL 3WFCL 2EVJA 4HGWB 3PS6A 4YFDB 3WFDH 4X2UA 1OHZA 5I6LA 3JWNC 1HYRC 4PGBA 5KSAB 1TLMA 4R96B 1OALA 2G2RA 2C1OB 2PPAA 3GSXB 4S1DC 3N43F 4XNUL 1FL5B 1VFOA 2OXHB 1JVOA 1HH6A 4KTYA 3VRJB 2MOVA 1KIQB 1SFDA 3KGUA 1UHVA 4KRPB 4NEHB 3U0WL 1TQUA 1Q1JL 4QRTB 1NINA 4GAJH 1Q9WA 1OP3K 3ZX1A 3F85A 2R0WL 1KB5B 4XBPA 5HI3C 5AEAA 2UWEB 4NQDD 2Y5TB 1UGKA 1KEGH 1FGNL 1JGDB 3QUYA 1AHKA 3K6IA 4XWGL 43CAB 4LASL 2N56A 3ARQA 4QLRA 4JY6A 5CJ5A 5H2BB 5HYIA 2FYYA 3O2VL 4YVUA 4ETYA 4HIHA 5E9DD 5K9KB 3AQZA 3A67L 2Y5TA 3C60A 5DLMH 1IT9H 1FIGH 4UDTB 4L0PB 5LGHL 1CI3M 2NR6A 3IU4H 3OKNA 5GJTH 1SOXA 5CJBA 5CJOH 3B6SB 2A6DA 3BVUA 5FUOL 1JXGA 2JK5A 1SDDB 2ZUQC 4LCWA 5K9QI 3CMOL 2W07A 5IWLA 4OCSL 5C7XL 4A2DA 2WIMA 5J6HA 2Q2LA 1I7UB 4UZUA 2J88H 4X6DE 2X2IA 3TEUA 3QDGA 1HNGA 2OXHA 1GW0A 1KC5L 1MXGA 1D5RA 2ZCKH 3K8KA 1II4E 2GUYA 2PWHA 5D71H 1RSYA 3HN5A 3KPNA 3S3CB 4FTVA 2R1WB 3HZ3A 2NY2B 4L1SA 1BM3L 5DSCB 3WCYA 4DKDC 2AZUA 4XHJD 1Z9PA 2V7HA 2D7TL 3EJPA 4NCC2 4OCRH 5E7FA 2P7TB 1IO4C 2BVPB 4FQ1H 2EEDA 4F9LC 1HHKA 4HJ1A 3TBVA 4FKHA 1K4DA 1Z0NA 3ARDC 3MACH 1DJYA 4HDIA 4PG2A 1KLUB 1E9OA 1HQ4A 1ZMYA 5F6IB 5JW5A 4Y4HD 3T3MF 3QC6X 1ES0B 1TOXA 3KL5A 5FM8A 3BOVA 4ZFFB 2DJMA 4L4VD 5MEOA 4NXSA 1JVLA 3Q2NA 1L3WA 1A1MA 5KVDL 4CAGA 3VDBA 2ISDA 1G9MH 3NJKA 2BY2A 5EOQH 3LXUX 3QJQB 3HBGA 3TCLA 4A7GF 4XRCA 3VH8G 5DURB 3T77B 4RGNB 5HHQB 3FW6A 1NLBH 3SPHA 5DHVB 1XGUA 3UROR 5ALCH 1TJHL 4IBQA 3QZMA 3UFIA 3R8BB 1MJUL 1TNNA 3MNDA 4EDWL 5AVWB 3DYPA 2NQDA 5FPIA 1UB5A 1W72A 4ZXBB 2FE0A 4W68A 3QORA 3M6DA 3TT1H 2XACC 3HNVL 2XYCA 4M6AA 2HP4A 4N8CH 2ITEA 5DF0A 3U7WL 3ZE2F 2VSDA 4ZQKA 1FNSL 4TYUA 2JI2A 5L9DL 3ABLB 3ESOA 3Q44A 2X4RA 1ZE3C 5EZPA 5FAAA 3L3KB 4NO0B 5KS9B 1ANUA 1KCRL 2CMRH 3CZEA 3L1GA 4HIHB 3L5WA 3K81A 4XO4A 2K0RA 2R4SH 3T3PF 4CC4C 5FO8A 5AAWA 3D9AL 3QO0B 4RISH 5DHEA 2GAZA 1FNGB 5JXEC 1KJ2B 5LGJA 1CK0H 5MEOB 2YWZA 2ESVB 3NCYP 4KH9A 4HSCX 4QPEA 3IS0X 1WPCA 3TXAA 5C0BD 1FHNA 3NCBB 3SGJA 2GK0B 5BRPA 3DUUA 3QNYA 4KRPD 4PRDA 2PCFA 3VYPA 2F68X 4N2OA 4FEMA 2XVKA 3J8F7 5KSVB 2WQXA 2XG5B 4HIEB 3T2PA 1BIHA 3A6CL 1U36A 5CLXA 4XMWA 1I7UA 3NCFB 1MI5B 4KJPD 3RWHB 3LPWA 2XWTA 2FIKB 4X5WB 5C92A 3CH1A 3HG3A 4C56A 4D9RE 4KKPA 5KN5B 3ILEA 1QFWH 1PZSA 2VISA 4HJGA 2WSPA 1D9KC 2Y22A 4ZOCA 4F80A 4N2DA 3MLUL 5I0ZA 3VB9A 2QLYA 3TNMA 4C4BA 5EPMA 1U8OB 1DQJB 3CV5A 3SGDI 3OC5A 3WYRA 4XPAL 5CZXC 1OB1B 2DDQH 3IDXL 3VI4E 1N2RA 5CLWA 4OZIF 1MWAL 3GEFA 1U30A 4OF8A 1BJMA 5I16B 2Z4TA 4J3VA 1A66A 4QI3A 1DJXA 2EAEA 3FN9A 4KY2A 1XCTB 3EO1B 1CG9B 1IVLA 1O75A 4P57A 2BHZA 4OTXH 4LRNL 4G8GA 5SWSE 5KSUA 1I9JH 4ODVL 4KGLA 4O00A 3TESA 1MCLA 3WFBH 1CD8A 3SOTA 1EMTH 1NMBL 5LKNA 1BXAA 3VNYA 5DD1L 5BUGA 4UIMA 1XVSA 3IPFA 1KPVB 4ZMWA 2ZQKA 3C5XA 3S37H 1P84J 1AGEB 4WUUE 1KCSH 3ZT6A 3GLDA 3MV7D 4M7LT 3BVVA 3S98A 2E27H 2Z6FA 4HCFA 3RPIB 3JWNE 2N3JA 2Q3ZA 2XPYA 4P5SA 1U4FA 3QEGH 1N59B 3SPIA 3GRWH 3JT2A 4PRPA 43C9B 4HAKA 4YXLH 5KBNC 2EDWA 1FPTL 2DTSA 1U8QA 2G0KA 1OCRB 3BWAA 3P77A 5C8JA 4OD1H 4P9HL 4HFWB 4YS4A 4W4NA 2BPBA 1HHGA 4WWKC 3L3HA 2BJML 3VE0B 4QAWA 5DA4A 4DW2H 1MLCA 1SVBA 3BAKA 4PSPA 1VEOA 4Q4IA 1X3DA 3H0TA 1H0DB 1Z5LA 4JRXE 3EH4B 4HZ1A 4FTVE 4XB7A 1AKJA 3CHQA 2WZ6A 5ADPH 4HEME 3QARA 3WO4C 4FQQB 4ZT1A 4A1RA 5IHZA 2X2HA 4NYLA 5K33A 3P9LA 2FECI 2IH3B 2XN9E 5CJXC 4DVBA 3BAWA 5E08H 2D2OA 1B0WA 3AS2A 4HA1A 4F2MA 3OSVA 3DX9B 4I1NB 5CILL 1DQKA 4ODUA 4M61A 1FE8L 2XN0A 3L7EA 2NRDA 3V4UL 1HNFA 1RH8A 2FBJL 5B3JE 4GY4A 1TU2A 5DC2A 3IJYB 1FFTB 2HX9A 3SQBB 1QHOA 4NZDA 3ARDD 4GBXB 4HK0A 4OCNC 5ISZB 4KO5A 5TF1H 1MRFH 1NPNA 1JPTL 1IGYA 2P5EE 4JHUA 5D7IA 2IC2A 1FIEA 3ZDYB 4R3SA 1P2CB 4P2OB 5FYJE 2MPVA 3I6GB 1P4BL 4YDIL 1UC6A 2CJSA 1KJ3L 3KJ6H 5IMOB 4LSRH 3KWTA 4FL4C 4HK0B 4IK6A 4FP8L 1OAXH 2Z92A 3ARBC 1T4KA 1KULA 4KK6D 5IESL 4WFFD 3SD5A 1UKSA 1RFDH 3D0VB 4JANB 3C5JA 4WFED 1NGQL 1CDCA 3AAZA 4KVNH 4PJ9D 5T1DH 2EDYA 1BIIB 4U6VL 5HHVL 2BS71 3FU9A 4KH2A 2I24N 3V8OA 3VXUD 4FJYA 1HL9A 2HFGH 3QIUA 4JKNA 5FYKL 1XGPA 1I8AA 5JIKA 4K8RL 4NOBA 1WCQA 4W81A 2XRAH 4MXVF 1KZYA 5E2TH 4G70B 1UZ6F 2ITFA 4JHAL 2YUWA 3GSNA 5BZXA 3QIUB 4N4YB 2VERA 2Y2YA 5CM1A 5BV7L 4F7KA 4GG6B 2R1XB 5CBAA 5TD4A 3QAQA 4MHHI 5D6CB 4AY0A 3QXAB 43C9A 3ML8A 3VFNB 2CK0L 3D18B 3HG5A 2CG9X 2CO6A 5IJDC 1ZCRA 1OM3L 2R7EA 4LAQL 2JB5L 2DQTH 4AJWA 5ACLA 4MCNA 5DVKA 1ZAGA 4I5BB 5AVQB 5IMOA 1E5AA 1U91A 1SOQA 1T0MB 3C87A 3EADA 4AQ1A 1DVZA 2ED8A 5JHBA 5ISZE 4Y4KC 4NP4L 3ESMA 3DYOA 3QIUC 4FTVD 5T3ZL 3UGXA 4X98A 3OKOB 4M6ML 4W9EC 1KF9B 3MVSA 5ESQB 3SE3C 1W8NA 2EYSB 2WPGA 5HYQA 5E8PA 4AXWB 5FYKD 2DJUA 5CO1A 4I4WB 1A64A 1KXVA 1EFQA 2OYKA 5GHWL 2K8QA 1GZPA 3GO1L 3LEYH 2ESVE 5I73B 5JO5B 1UKTA 2Q3AA 3P9WB 4OGXH 4TQEL 5IG7A 3S88H 2H26A 1OAJA 1ZLVK 4QRPE 4Q74A 4Q0XL 4WJG3 4RMSA 4G3YL 1V55B 3EYUL 3FBQA 1RLBA 2XVBA 2NSQA 4ODXA 1T5XB 2OS7A 3II3A 3OKEB 2VO8A 1NUGA 1WA1X 2V2WA 3BMVA 3HE6A 3QFJD 3WLWD 4P4RB 1D5IL 1I9RH 1NM9A 4HS6B 3A24A 2DQCL 4XMKL 3LKOA 2NXZD 1BQLH 1YRKA 3QQDA 1EV2E 1QG3A 4Z7UA 1EUUA 3H9SD 4N2IA 2EKSB 4LEXH 5DO2C 4XGZA 1BQSA 2XKNB 4HUKB 2EXYD 5IOKA 1ZY9A 2J57A 2LABA 3WS3B 4LEOB 1DZBA 4KKZA 4W4OA 3T65B 4LLDA 3B2UC 1M7DB 2H2PC 3LIZA 1T0MA 1XD1A 2EC8A 2XXCB 3ECWA 3G9AB 4FFTA 4U6XB 5F7KC 4ANKA 1JYXA 1DJWA 5C2BL 3VQMA 4ZD3H 1N3NA 2J7LA 3O4LD 5C2UB 1PZ2A 2ADFH 4LLDB 5CJQH 3RG1C 3CZGA 4UZSA 2B20A 1KB9K 1F3RB 4WW1A 1YY8B 1ZV2A 4XC1H 1NFDB 4J3UA 3EDDA 3R0MA 4N24A 3WLBA 3QZBA 1YEFH 4WWNA 3K71B 5F88A 3B5TA 2DLIA 4QXTA 2VAJA 1BBDH 4OFPA 4BDVB 2J6WA 5J06A 1XB8A 5IQOA 1DQML 2CA3A 5FYJH 2BZ7A 4AK1A 1UB6B 2GHZA 5AOKA 3BW9A 1NKGA 3V0AC 1BW8A 5GGTA 1GC1H 3TBWB 1J12A 5GS0D 2QSCL 3PXLA 4KJQD 4MAZA 1N5AA 1XGYH 1XCQA 4HEMA 5EIIB 2DLFL 1QAWA 32C2B 3R06B 1A6ZB 1V10A 4GRLD 1GIGH 3GRGA 2Q8BL 3R4RA 2ARJQ 5ID1A 2FX9L 1S9YB 1BVNT 5GSRA 4ZFQA 3WFZA 1YEHH 3KVPA 1KTDB 4U1NA 2BFVL 4C59B 5C07E 5BZWB 5E1HB 4QRAA 4LVHC 4TNEA 3O2DH 5KANI 3VM5A 4MJJA 1IVTA 3DXAA 3ENEA 3MJ8B 3STLA 4LCUB 5I2IB 3HMXH 1IGCL 1U95B 1EEYB 1PD0A 2EDRA 1KTDA 4WJ5A 3BUBA 3P4OB 4BSVA 3X1FA 4EI6A 2P8LB 2MQ0A 3RIAK 2OSLB 3KGSA 5L2JA 4PJ8A 3NEXA 2ZXQA 2HT2C 4P23A 2CO7B 3AB0B 4JY5L 3LPPA 3NJJA 3WMSA 1B0IA 2ZYSA 5CINL 2OSXA 3NIGF 3RAJL 4U3HA 2QR0A 3B5HA 4YBHA 4NQEB 5EZJB 3WO3B 3GM0A 3ZYZA 2DQFA 4M7ZC 3TNNA 4LL1A 2FWSA 5HD8D 1IKOP 2ILLA 1Z9OA 3KBHE 1LWJA 2C34A 5FKPA 2WNGA 2AVFA 4QRBA 1F11B 1MJ8H 3KPNB 3PGCB 2P5WD 4W9ZA 2BM3A 3W56A 4N0YL 3P02A 3Q48A 1AHMA 3D50A 3DX2A 5HGBB 5DUPH 1U0QA 2DMHA 1OTSD 4R7LA 2CWRA 3SE6A 3O3BB 5AALA 4KMQA 2PMZA 1AXSB 2PWDA 2OMYB 3JTBA 4JPVL 5F1OB 2X3CA 1LP9B 2XQBH 3V4PL 2F0CA 3S36H 3RWIA 4MA8L 1WIOA 4I9WD 1RHHB 4B53A 1SHSA 4LCUA 5I2IA 4IW4C 3DHUA 3LNGA 2ICEA 2PP9A 3LS4L 1JD9A 1JZFA 2P9RA 4I77H 5LG6A 1F2XK 3QHFL 1A22B 4GO6B 5DLLA 1CDHA 2PLTA 4MAUH 2H9GA 4KMTL 4JE4B 2A4EA 5TQ2L 3FAWA 3NIGE 2Y1AA 4QTIH 5MHSE 1T7YA 3TCLB 5DVNA 3CQQA 2V17H 1R3JA 3BHBB 3C09C 1BSIA 3BH8B 1R33A 1YC8A 1CFMA 1YNTF 4WI2A 3CDCA 2ITCB 4NQEA 5EZJA 2NYYD 3L4UA 1E3FA 2VW4A 3A21A 4JFOB 1FORH 4ZO9A 4QY8A 1JN6B 4FLOA 4LNVA 1F6AA 1PPIA 2VKWA 5IB1B 4K5PA 4G9FA 3WSQH 3SDDA 2EE6A 3B5GA 3RIKA 4HGMA 3GSWB 2SODB 4UQ3A 5AL8A 4ZXBC 3L3IB 5BMFH 2QPUA 3Q5YA 2FRGP 2D7MA 1TQTA 3OB0H 2R56H 1HH9B 2HLAB 3BGFB 3BE1L 1OAYH 4FNPA 4PJXE 4IOFC 2EDJA 3KPRD 5AZ2H 4EDXB 1U95A 3BUYB 3BPNB 2CE6A 4L2LA 2OL3L 4JFXA 1PVHA 1EANA 1VJSA 2IFGA 4NQDA 5EU6A 4YK4C 3A3YB 3L4VA 3L9BA 1P4LA 2JTDA 3QR0A 1KN4H 1G7IA 2QHRL 3D3VE 4PJ8B 4W9JC 2F54E 4GRLA 3MV8A 4NWTH 3MV9D 1CBVL 3EDKA 4NNXB 3Q05A 3FCTA 4NUGL 5KYWB 1KYOJ 4PIBA 4DFIA 3B6SA 4UTBH 4XPFH 4IKKA 3DBXB 1GS8A 3FQXA 3V52H 2Z31C 4PWKA 5F72S 4D9RD 2UXGA 2GSGA 1JNJA 25C8L 4ZUVA 2ALAA 5AUMA 1U8KA 1P4IL 3BEWA 4Y5VB 1D7CA 4UOQA 4X42A 4ZPTA 1AGCA 2L7QA 3WKPA 2TSAA 1A5FH 4XCYB 1MW3A 2WO4A 3HRZC 3PQYA 2H1PL 1L6XA 2NY2C 1R9FA 3T6XA 3HR5B 4PRHE 1F4WL 2CD0A 2YD1A 4E9RA 4FXGA 3RVWC 1ZA6B 3DGCR 1M3IA 3FFCB 4GXVL 4Y5VA 2YEQA 5KS9A 4BFIA 2AXJA 4XPTL 3WS6C 4JFUA 4J3OD 3Q1SH 1VFAB 2P7TA 4QIRA 3TOPA 3BAJA 1GZHA 4JPIB 4B7LA 1L7TL 2NY3B 3HRZB 4FFZH 4GKOA 4P48A 2F9BT 3BGMA 2OQJA 1EO8H 4JMNA 1G9NH 3MRCA 3LKPB 4R2GD 4UTCA 1G7IB 1GA2A 1R75A 2YA2A 5J8OA 4WO4B 1T2QH 1KCVH 1B4LA 3IMRA 5JXAH 3D0LB 2FH6A 4RQQB 3EBAA 1PLGH 4J3XA 5F21B 5FV1L 3VXRD 3F05A 4PG2C 4UOW1 2NYKA 2FWOA 3VWJC 2ATKA 2Z35A 4KZCA 2E7CA 4XAWH 3LQAH 3S8WA 4JREB 2WGXA 1F6AB 2K1MA 4P46B 4K5MA 1INDL 2BP0B 4HUXB 4XMPH 4Z7WB 2DQMA 1XCXA 1KB5A 2DI7A 5A2LH 1XZWA 2AEQL 2ZUWA 4LVNB 3IN0A 3WDIA 2J56A 5FWQA 2BVPA 4QO1B 1N4XL 5B1CA 3VTTA 4FCHA 4TLTA 4O02B 2DQDH 1CICB 4JJ5A 2QVKA 2GQHA 5T5FL 3WNMA 3VWKC 1J5CA 5GSVB 3C60B 4O02H 4GYBA 5I6NA 4N0UA 5HDBB 4HFUL 2YD8A 4WSKA 3QFDB 4RCAA 2R83A 3NJXA 2XWRA 3BKYL 2NR6D 1OZTG 3DTUB 1BOYA 3LOWA 5EORH 4N5UA 3CBRA 3AROA 3DURA 1KENL 3E8UL 2XVGA 1KJ2H 4Z76A 1AHWC 5D2LB 1FZOA 1EDHA 1GOGA 1QEWB 1Q9LA 1LJMA 3QEQA 4OLYL 2XWJB 4IKJA 3S5LG 4RQQA 3MQIA 4G8IB 4YR6A 4ENZA 3PWPB 3V4VL 1EHLL 5LDSA 1E7VA 5F7DA 4NQCE 5EF0A 4J6RL 5BZZA 4LQFL 3UTZB 5B1AB 3D08A 3GGWA 4XZUA 1HE7A 4WV1C 3R18A 2LU4A 3CZFA 2E46A 1GGIL 4B5EA 4OKDA 1CWVA 1FFOB 1MI5A 1Q0XL 4OIIH 3DV4B 3QCTL 5EBWA 2X4RB 2IQAB 5DZLA 1IGML 3LNFA 2BMKB 3DGGA 4MS6A 4YEEA 2KUTA 1QTSA 2UZIH 5I1HH 3QPKA 1KJ2A 4Z7OE 3CHRA 5BRZA 1VFBA 3WMPA 4B3VA 3VWKD 5L4FA 2X4NA 3RI5K 5CCKL 4PBWD 2YARA 4PGEA 2QQLL 1BZ8A 1XB6A 1FVEB 1J0KA 1I7TB 2WXMA 3CMGA 4N3TA 1WZMA 3KPLA 4YHZH 1RZIA 4MSWA 4Z95H 4HKJB 3WUWB 5J9PB 1PBYA 1WVZA 2DH3A 3PIQA 4G8GD 2PF6A 1CFQB 3QEQB 4LIQL 4TUOA 2QKIA 3QH3B 2WLMA 5EMYA 1BA9A 3DARA 3OAWA 1I7TA 2H45A 4ZTOH 5LWYH 2BK8A 3TBTA 3IVKA 3BJLA 1UM5L 5EFIA 3P3YA 1TR7A 1NCAH 3D18A 1TYJA 3L4CA 4B60A 4FQ2H 4OSUL 3U9PL 4OLVL 1IBHA 4AIOA 1MI5D 2BOBA 2KYIA 3GSRA 1N19A 4P4KC 4U4IA 4YBQD 5LCVA 3ABKB 3VD7A 4ZUTB 2BIOA