4Y2OB

Structure of cfa/i pili chaperone-major subunit complex (cfaa-cfab)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
142
structure length
142
Chain Sequence
b'MVHHHHHHVIDLLQADGNALPSAVKLAYSPASKTFESYRVMTQVHTNADAKKVIVKLADTPQATDVLNSTVQMPISVSWGGQVLSTTAKEFEAAALGYSASGVNGVSSSQELVISAAPKTAGTAPTAGNYSGVVSLVMTLGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CfA/I fimbrial subunit A (Colonization factor antigen subuni
molecule tags Structural protein
source organism Escherichia coli o78:h11 (strain h10407 / etec)
publication title Off-pathway assembly of fimbria subunits is prevented by chaperone CfaA of CFA/I fimbriae from enterotoxigenic E. coli.
pubmed doi rcsb
total genus 8
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2015-02-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2040 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4y2oB00
3VACA 4Y2LA 3F84A 4Y2OB 4HJIA 4Y2NA 3F85A 2HB0A 3F83A
chains in the Genus database with same CATH superfamily
2XC8A 1OGAE 4UTAL 3Q43A 1CD0A 1DUZA 2AS5M 3GYRA 2OSLB 2HT2C 3WNKA 2Z0BA 1KB9K 4N2IA 2FLRT 3QISA 3GDBA 4CGUB 1BZ7A 2C1PB 1NIBA 1TEFA 5C08E 1NCWH 2DQUL 3KXFE 1QFUH 5B3NA 3WJJC 5GGUB 5EC2B 2E86A 1KJMB 1PW3A 1QRNE 1CYXA 4O5LL 1TTGA 4NP9A 5C0CB 1ZT1A 1FYTA 1UWGL 1CLYL 2GUOB 2WBJD 4JCWA 3TNMB 1USZA 4K3JL 2ARJA 2CG9X 5BZXA 3ZKSD 4CDGC 3RPIB 2JCCF 3EZJB 2RCSL 3VXPA 3OGOE 3BVNB 3K74B 3TH4T 3QAZC 1TNMA 2IBZX 3BKMH 3V95A 1OW0C 5FW6A 2VLKA 3UH8A 2IXQA 4XE0A 4XT1C 3K5SA 2E7LA 1FGNL 4UDUB 3K6FA 3MUUA 3HG1E 2GSGA 1UB5A 3MRGB 3RIKA 2F08A 1NGXA 4P5KB 2PTUA 3MOBL 1CTMA 1KDJA 4FTVE 4JGJA 5FO8B 3D1MC 3CJJA 3LD8C 1AQKH 4PJHB 3PWLA 3JWOC 5IW1A 3D39B 1VEOA 2DV6A 5EC1A 2Y1VA 2GSGB 3BESR 3O81A 4MDJA 2OW7A 4DUXA 4BJLA 5KOMC 3RIAF 3MJ7A 4Y5YA 2E27L 4WK0B 4O02A 2IFFL 5I19H 2IWEA 1ACYH 5EC1B 4ZOBA 5L4IA 1PEWA 3LQZB 5KUKA 4OCNC 5ICYA 4M03A 1S7TA 4BKLB 4N4YB 1PZ5A 4PLKD 1PD6A 1TZIA 5I66A 1A6TA 4OAWB 4QRPB 5E9DB 5GIRB 5GZNC 2GK2A 3KLHC 4HXAL 4FKKA 3NFSL 1MI5E 5ABAA 1SUJA 4APQB 4ZMXA 1PZ5B 5JOFB 2RTTA 3P77A 3IMRA 1P1ZA 4JRXE 4XPHL 1OTSC 2HG0A 3B83A 3T3PF 3L5IA 3HR5B 2N0MA 3UJJH 4OLVL 3NIDB 5HI5C 4PJ8D 2W0PA 1I3RA 2AJUH 1CN4A 1T3FA 2FJFA 4G70B 1Q0XH 4S1DC 1ACZA 5E2VL 3DMMC 2B59A 4FJ6A 5B38B 1E9OB 5CCGE 4YQXL 3KD4A 3SIKA 5EN3A 1UWXH 2Z4QB 5L2JB 1FG2A 1ZLUK 1NICA 2ZX6A 1WIUA 2WXOA 4H25A 4QWWD 2HT3C 2FJFB 5DRWA 4ZXBD 5MERB 3K8KA 3TIEB 4YE4H 5DHMC 5J13C 4Z7OF 3LDBB 1NUNB 1MLBA 2KZKA 3CE1A 3C09B 1T5WB 3IE4A 4OLUH 5M95B 3POHA 2I69A 1FFOB 4HJ0C 1RPQA 1MCIA 4ELMA 2J88H 2JKWA 4H0GA 4OGAC 4L3EA 3TO2B 3RPIA 1RZIA 2CO6B 1PDKB 3HPJB 4EI5B 3MODH 3V0VB 5I24A 4GB9A 4BDVB 1AGBB 4LVNB 1UWEL 3AADB 5IEKA 1FFOA 1UD2A 3HBZA 2VLKB 2ZXGA 2E75C 1YYCA 3TO2A 5DJ2B 2X70A 3CPLB 3K8LA 3CZFA 5LG1A 1NGXB 1YO4A 5EO1B 1M56B 5CKAA 1ID5I 2VR9A 1U3YA 4BSVA 3B4NA 4ZW3A 4BV1A 1QI5A 4X9BA 4U6YA 4CNIB 5I5IA 1OE3A 3MRMB 5ITBH 2PYEA 1WA1X 3FZUC 4OGYH 3T77B 4I0PB 2XPGB 1BYNA 4RGND 4PIBA 4MBRA 1T1XA 4QXUH 4H26A 4W6YB 4XVJL 5C0NC 3ABMB 1RVFH 5CUSH 1TU2B 5AW3B 4BM7A 4ZTEA 5C86A 3G7TA 2J3SA 1G4RA 3F6LA 3NN8B 4HKJB 1ZVHA 5JUEL 2VC2B 3G3LA 4H26B 4PCYA 4ZSOB 3ULSB 2CCVA 4DEPC 2IALB 4XCFH 2QMKA 4ZD3L 2G2RB 3S35X 1JZ2A 1KLFB 1JPFA 2V5RA 1T7YA 4JFWA 1GPOL 4APQA 1OGTB 1FZMB 1DQKA 2PXYB 3AC0A 2WLIB 2AEQL 4XTRD 4ZUSB 1EVUA 3V6OC 1T1WB 5DA0B 3ARYA 2NPLX 5ADPH 1DANU 1BIHA 2IV9A 1O9WA 2RH0A 4ZI8A 4DKEH 1I31A 2ZNWA 4N20A 2D7MA 2XQ0A 3P0YH 2GBVA 1A1OA 5EZIH 1MFBH 2OCJA 3MXVH 5D1ZC 2EYTA 1AXTL 7TAAA 1KYOJ 1K72A 3OKEA 4P4KA 4K3DH 2VOTA 4JRWA 3ARFC 3MRQA 2BNRD 2L7UA 3FQXA 1DTUA 5AVZB 4GXUM 4ZMWA 2EYTB 1FNSL 3FO2A 1T6VN 2QV2A 2ZWLT 4ZRGA 4WTZA 2LHAA 4HIQA 2VR5A 4G6MH 4GSDH 4PP2A 5F9WC 3NEXA 2VW6A 1N4XH 4EVNB 2F7RA 3WFEL 3MNVB 1T04A 2OMZA 3L8QA 3G6DL 4B3EA 4QRQA 2Z1KA 1HEZB 2CO6A 4ZW7A 2Y6SC 3RNKA 1RZ8B 2P80D 5BQ7B 4QRAA 1WIOA 5BRQA 3UG4A 1XIWA 3HMXH 4ESKA 5DFVC 2FE0A 2MTPA 4MA8H 4JHAH 4QHMB 3QUMB 4NO3B 1BOGB 2HFGL 1KXTB 3UO1H 1CFQA 3C8KA 4B53A 2X1PA 1ORQB 4IKLA 1KBKA 1CFBA 3GBNL 2Z31D 3QO0B 4DEUA 5A2FA 3FRPA 4B9CA 3BP4B 2V3DA 4FQQA 3AWEA 4MJ6A 4PJEE 2YQ2A 1M05A 2Y3AA 3P54A 5CFHA 3MSPA 1NC4A 4M6OH 2RR3A 3FCUB 1I9IL 3QQDA 4FRWA 3UBXA 4PUBH 2VLRB 2YS4A 1TG8A 2XA8L 2VZTA 4G11A 4JFHD 1S5HB 3BKCH 1SBSL 1YAZA 2A9NH 1YPZB 1TZHA 3MLTB 5FUZH 3IJSB 2N1TE 4JFPA 5K93A 3KW8A 5C0DA 3SBWA 4XODA 4KH9A 3I9AA 2JKNA 3CSYA 3MLZL 1MFEH 3MN8A 5AZ2H 1J5IA 4JY4B 4MASA 3FF8A 5FFOA 4NUGL 4AQAB 1N64L 4FP8H 1FZJA 4OUUA 4IRJB 3B7TA 3EH5B 1KFAH 3SPCA 5F3BB 4ZUTB 5DTFA 4XGZA 1ZWIA 1MCPH 2PR4L 4V33A 4KKPA 5JORA 5IB3A 2DMCA 4OF5A 3MZGB 5TE4L 1ADQH 3TEXA 1D7FA 4FFWD 4OZFA 5I2IB 4PGEA 4Z9KB 1NAMB 3OKEB 2F2HA 2QVTA 4BWUA 3WHXB 1K5NA 2BC4A 2YAQA 3V5HB 5HI3C 3AS2A 3D69A 1D5ZA 2QHRL 2NY1D 2ROYA 1FF5A 1XV8A 2JLPA 1PL3A 3QDMA 5FO7A 5T3ZE 1S7VB 2QQNL 2XA3A 3PP4L 2OZNA 3CN1A 3FB7B 4I77H 5D1XB 5D96C 2XQYG 2AJ3B 5GRJL 4FNRA 3CLWA 4X6CB 1NGZA 3AREC 1IC5H 4P2RA 5T5NG 3TU6A 3S88L 1SZNA 1JF1A 3CSGA 4E41D 1BQHG 1D5BA 1DP0A 4S1SL 1CDUA 4IDJL 4QTIH 4A68A 1I9JL 3QUYC 3W82A 4AGLA 2WQVA 4RAVB 4PV1C 4FEMA 3MJ8B 2FQEA 4ODXA 4CVXB 2X4SA 4U2ZA 7CGTA 3O11B 4GXVH 3WNPA 5D70L 3PJSB 4N8UA 4ABVA 4MB3A 4PPTA 1CLOL 5EWIL 1JE6A 5CILL 3X3GL 4BA8A 3BT2L 4IRZA 2K4AA 3NAAL 1SJXA 4P48A 3C8KB 3EW3B 4G7YL 3MUY1 1UM5L 2WOYA 4CN6A 2VYRE 1WS7A 3VG9C 2A6JA 2MQ3A 5GGVH 2PTTB 5IROA 2RD0A 1DEEB 2GEEA 4KTEL 3RJOA 5EF3A 1OARH 5EBWA 4MAYB 3SYPA 4J3UA 3QDGD 4ZO6A 3QJFA 3BUYB 3KGTA 4QR7A 2VISA 2M1KA 3O9WD 1F3DJ 3MRBB 5SWZD 3H9SE 4NQCB 1S5HA 1RFDH 2K8MA 4OLZL 5AG9A 3O0RH 4POZD 3EGDB 5EBWB 4DP5X 4JG1H 3TFBA 4U1HA 4FNPA 1HE7A 5HVHC 1MCWM 2X6AA 5BOPA 1Q0XL 2AMUA 4ZO7A 3OB0K 3B7RL 5J3HD 3HI6L 2ZUSA 3V0IA 5TTRA 2GK0B 1BZ8A 3U4BH 2BZDA 2O61B 1NCCH 5F7FA 3D0LA 1FIGL 3EOBB 5B39B 4KZ0A 2OYLA 1MVUB 1S4IA 5EA0L 5B22A 1YYLH 3EAKA 5DK0B 4PLJC 3VXME 1UOWA 2CXGA 4FQCL 3VX0A 4OBRA 5DJXB 1ONQA 2HUEA 4O4YH 4P2OA 4P59L 3SYCA 1VIWA 1Z1WA 3GUFA 3FUFA 3CXFA 1G9MC 1UEMA 1E9QA 2JMRA 2H3KA 4L4TB 3UEQA 5JQ6L 1IBZA 3WL9B 2EICA 2XG5A 4LCYB 2NY7H 3DV6A 4HIEB 1R0AL 1DJGA 3ARFA 1OAYL 1YQ2A 2YPVA 2EILB 4QEGA 5JPMB 4J5VA 3HC4H 4TMPA 2R0WH 1A14L 1AO7E 1CT8B 5BCAA 4K71B 4G6ML 3T04D 4Z7QE 1VZHA 5D1XA 3MLPA 5C0AA 3S6CA 4LCYA 5A16B 1WFIA 5KBDA 4HJTA 3ECBB 4PB0L 4PJAF 4TLSA 3WKNA 2JKIS 2R2BA 4YH6A 5DYFA 3D9AH 4M7KH 4R97C 1MNNA 4UM8B 5AAWC 4X6DF 4NO5A 2BFVH 2YEZB 5DMKB 4R7DB 4X0KB 2DM3A 4J4PC 3S3CB 3CFKA 3FUNA 3RGVD 4PRAA 4XAWH 3VM7A 4KGLA 2VSMB 2UZPA 1DQIA 5F7EL 2ZWKA 1RJLA 4LSVL 5KVGH 4R8WL 3B8SA 4Y19A 4MMXB 3WY2A 1MDTA 4ENZA 3TBWA 5IOKA 1H6FA 3EO0B 1X5JA 4HUXA 5EOTA 4NHUA 1FO0B 2XTJB 3B3IA 1S7UB 4XOBA 3BFQG 3OQ3B 7FABH 3TV8A 4W9CC 1IC1A 1KIQA 4BUQA 3QWOA 5FYJL 5F89A 5GS2D 2DMGA 3FSOA 4G8GD 2CXKA 2I27N 4CVWA 3CU1A 1PX8A 4JFEB 4AYDC 5EBMB 2EDHA 4G6FB 4LLWB 2XZCL 3KJ6L 4YGVA 4XRCB 3D4YA 2MKLC 1Q38A 4MSWB 4NZRL 2Q10A 1BQLL 5DT1L 4LL4A 5IJKA 3J07A 5I6KA 5I1EL 4E42A 1BD2E 4HU8A 4CU8A 1CXFA 1VCAA 3S35L 1CBJA 3GI9H 3LCYA 3P73B 5FHBH 4YXKL 2WIIA 3PYCA 1ZSDA 2X4TA 5KS9E 1BQLH 5DT1H 1S7RA 3QNXB 1TUPA 3KPRA 2IGTA 5DK0A 2HX7A 4Z1PA 5SX4I 1EEUA 5F96H 2Z8SA 1C12A 3P73A 3L3HB 5HHME 3AS0A 3VGBA 4P3CH 2J1WA 1JV2A 2WWOA 2CHDA 3MV8B 3TO4D 1ZT4A 4HGMA 3A21A 1A64A 4QXTA 2EEAA 1Z7JA 1J86A 4YS4A 5E6ID 4UANA 4DKAA 1EDHA 2VRAA 4U6VL 1F97A 2E74C 1EHNA 3NCEB 3WNJA 3P0VH 5F2FA 1U93A 1BZOA 1RXLA 1JPEA 1OGSA 2AXWA 3FCSB 1HQRB 3MLUH 3WY3A 1MAJA 3PHQB 4A2GA 2K78A 3WTVA 5F93C 3B2UC 4OQTA 4L5FL 2ZKXA 2G3XA 4N2NA 1R6VA 3O6FC 1P4IH 2VABB 4CC4C 4CAGA 5I5JA 2AV1B 3IXTB 4W9LC 3VXSE 3QO1B 1QQDA 4Y1SA 3VWKB 5T33L 3U7AA 1BXXA 4XAWL 1HHHA 2W60B 3VG0H 3APCA 3LKSA 4AUUA 4GMTL 1OE2A 4UV7L 1RZPA 4L3EE 1MN4A 4LF3A 3QDJD 5I74C 3HZKB 5MENA 2Q87A 5CZXC 1GSMA 2W81C 4OUOA 4QJ3B 1JGVH 4PRPB 4PV9A 1T1YA 1MG3C 4HWBL 4FQ1L 1FVDB 1N59A 1BGXH 1I7TA 1W0WB 1J8HA 3PNWA 4OCYH 3QDJB 1CZ8L 1G7QB 4P07A 1E9PA 3OC5A 2OX5A 4P2CG 4BGLA 3TA4D 4NHUB 3ULVL 1HAUA 2G2NA 1CDCA 1PX4A 4M6NH 4PV9B 4RDBA 4NN5B 1W0WA 1RK1A 4IMKC 2BIQA 1NCBH 2V7NB 4RWYL 3T1FB 1B0RB 4FFYL 1ECYA 1XH0A 5C7XL 1EEYB 1YEEL 1NFAA 4JFEA 4ELKA 4M6MH 3B2VH 1U41A 3BH9B 2F7QA 2EEBA 3N40P 3SE4A 3UACA 2VXQA 1IARB 1NBZB 2F53D 4K73A 5JXAL 4NQEE 3IETA 1UA7A 5BV7B 1CL7I 5I5RA 3PAUA 1KWGA 2Q7AA 1JTTA 3EH1A 3HS0C 5D4IA 1B0GB 3ECQA 4PRDA 3UL4A 3C9NA 4DFIA 5HYJA 1RFDL 4OLZH 1GH7A 1H3TA 2ZUQC 5EZJB 1HL9A 1RCYA 2L4OA 3P3YA 1ZT4B 4B9JA 5TDOA 1AIFA 4Y9GA 2J2ZB 2OMUA 1X5HA 3V2AR 5J9PA 3BKJL 2ICEB 3UX9B 3ZGIA 3CV5A 1UENA 3FTVA 4B9ZA 5IJDC 2WUBL 1E27A 2YLKA 4LBEB 1BMZA 5DHYB 2VDOH 3BH4A 2WANA 2YRZA 3QCTH 1AHWC 5FR3A 2A9BA 1ZLVH 5IG7A 1JZJA 3PL6A 1OTUC 4WFEE 1XTMA 2D03H 3OAUL 4OFPA 2DM4A 1AO7B 4F8PA 4L8CB 1EBPA 3W1ZA 2WXRA 5I1AA 1T0MA 2WQRA 1FFNB 4KHTH 4XB7A 4FQ1H 3PL6B 4QRBA 2V9TA 5G55A 4DP4X 5BOJA 5KVGE 4A6YB 4PJEB 3NCYS 2EDXA 4L8CA 1MQKH 4QTFA 4ZK8A 2DJMA 4NBZB 4KK8D 4B0MM 4X9YA 1ZTMA 1JSYA 2EEDA 4U1LA 1J8HB 3N41F 4XMPH 4YSQA 4XX5A 3B5TA 3MGTB 4N85A 2PABA 2XIIA 1N12A 1CG9A 1QATA 3QJUB 4AJVA 1INDH 2IDUA 1F6AB 1K3ZA 3UAAA 1U8CB 4BD4A 3IMWA 4HS6B 3T4AA 1NCDH 1S7SA 5A2AA 3WIIL 3V55A 4J8RB 3IMUA 2DYSB 4JZJB 1MRCH 4HSAC 1T5XA 1AR1C 1I8KB 3O9WC 1II4E 4FYQA 5HGBB 4HS6A 4N2OA 4NFCA 2EJ1A 4ALAL 3FUDA 2YWYA 4J8RA 4KVNH 3KPPB 4JZJA 2Y72A 4M1DL 1CLCA 4GEIA 2NCEA 3EZ8A 3DETC 4Z7UF 1JZ7A 3AGWA 5EZPA 2NY0C 3KPLB 3SGEI 5J3HC 3VXRE 1G5GA 4A37A 2X9YA 4X5WA 3O2DL 5C6TH 4MJIE 3GUTB 5CNHA 2F7OA 4K9JA 2CKBA 1FZKB 3R7RA 1DFBH 3UG5A 1YJDC 1S8DB 1WBXB 3M45A 2DTMH 4YZWA 3FT1A 4HLZG 4RDQF 4KK9D 5F8RC 3X1NA 1N6VA 1T0OA 3MJ6A 3RVXD 5CP7B 5PAZA 4BK4A 2MOGA 3VYNA 4TRPH 2OL3H 2YAEA 1EEZA 1E90A 1T4KA 5IV2A 1IM9B 1OGAA 3EG9A 4F7CA 1H19A 2ATAA 4UU9B 3QPQD 4XP6L 3E8UL 2ZUQB 3GMNB 4FXGA 1E27B 4LBEA 4HWZB 5CP7A 1NGYB 4LCWA 3HS8A 4KXCA 3IJYA 4GP4B 3BEWA 5DRXA 3BD4A 4XMXA 4XPFL 4EXPX 2FJGB 2ODHA 3VXSA 3D06A 2YSSB 4L29B 4NC1E 1X5FA 3IAGC 1FZOA 1KDIA 3V5KB 3HCVA 3ARGD 2P49B 3ZTNH 1H15A 5C09E 5CCKH 3BMWA 1BEYL 1HHGA 4ADGA 2WSKA 3CXDL 3CC5B 4JPIB 4IU3B 4LOUD 3IF1A 4E9SA 5J13B 1N4XL 5DU7A 4CSSA 4XPTL 4ODTL 3STZA 3T8XA 1NGQH 1NGWB 2H2SD 2HFEA 2WQUA 4OKDA 5CGTA 5D5MF 1OP5K 4MJIA 4DP6X 5AVWB 3H9SB 4Z3GA 3E0GA 5JO5B 4JPIA 1IRAY 4ZW6A 1T1ZA 3FT9A 1Z9LA 3O4LE 4D9LH 3PQYB 4QRUB 1CO1A 4UT6L 2CLZA 3JWNG 4TSAH 1S7SB 3IKCB 4K3DL 3T09A 3RWEB 4K2UH 3WBDA 5T1KB 3O4OB 3GBNH 3QP3A 1WCQA 3KPMB 3TCLB 3RB5A 3CN0A 4LVHB 1AQDB 3GSOB 4LQFH 2X38A 3IBEA 4OCLC 4JPKL 3TNMA 1MFDL 2A73B 2EXWD 3UJIL 1W72B 4KX7A 4NPJA 4MS6A 3GSXB 5DI8B 2CIIA 4F91B 1Y18A 4OD2A 4RVBA 4TM9A 1BYPA 4I48B 3EDDA 3U1QA 2JELL 5C71A 5IIEB 3INUL 3RKPA 2JXMB 2XV3A 4N9GA 1WZLA 2XY2A 5KN5B 5I15H 2AJYL 3L4UA 1D5MA 4HLZH 1WBXA 1I3GL 1W72H 4AEHH 2PWHA 1PKOA 3EBHA 4X7SH 1FSKB 1TQVA 3QUYB 3LJ3A 4JDZA 4UQEA 1ZHBB 5FV2A 5A1AA 1UGKA 3T9WA 2E8YA 1GZHA 3HJ0A 2YA1A 4PGDA 5D1ZI 2EDBA 2O6DA 3DSNB 4PJ5D 2YPKB 4YHLH 5FWQA 4Y2DA 4DGIH 4UQDA 4LSQL 3F6JA 4JEGB 5IMKB 2G75A 5KSUA 3SJVB 5ITBL 4BINA 2GITB 3DX2A 5C0BB 3SKUD 4GRLC 4KI5C 3WO4C 3HZYA 2BZCA 3I3BA 3QWRD 4HFWA 2P5WD 2FRGP 2X6MA 3SJVD 2GJ6D 3QJSB 5KYUB 1TZIB 1RJYA 3JXAA 3E3QC 2VERN 4JDTL 3S5LA 4IBUA 1WUZA 5T8IA 4DN3H 2KLRA 1QI3A 4PJBF 5TE6L 1MQ8A 1NPJA 4WHYH 3ZKXB 3HI1A 4PS4H 1I3UA 1EUTA 2X40A 3K0YA 1MH5A 1MY7A 1UM4L 3INUH 1ZHLA 5DHVH 5EOQH 4UNVA 4NCC2 2J43A 4Z3JA 4WGVB 5CZVH 2JWYA 3DX0A 1USQA 2P9RA 5GGSY 4JG0L 1OM3L 1JJUA 3BGFB 1WV7T 4FADA 3DO4A 5EC2A 3B34A 2HH0L 2CO3A 2YGPA 3STLA 4I18C 4FL4C 3ZIYA 5HHXH 4GSRA 1A8JH 2JB5L 4K94H 5CWSA 4GRLA 1V27A 2GCYA 3KCPA 2EDRA 4I9XA 3TIDB 1JBJA 2YPLE 1T6WA 3TVMD 4X7TB 4IBSA 3BQUC 1RIHL 4GXUN 2XKUA 3HC3H 1A0QH 1XGQA 2IAMA 5BRZA 1OT1A 5T1MB 5GZOD 5LXGL 3KJ4C 2XNAA 2FHBA 3L1GA 5IFHH 2XHNA 1TKWA 1XCQA 4GI6A 1KFAL 4ZFOL 3NFSH 1BZ9A 2GTQA 1E28A 5FW8A 4DGVL 3EIFA 5IW3A 1ZVYA 1JGLL 1B6UA 1CR9H 1G5AA 3IS0X 2P45B 4PR5A 2KYIA 3P30L 3CDFA 1JNNL 2Y3NA 3EOTL 1E28B 2B08A 3K71B 5JYMA 1BFSA 3OKMB 3V6FB 3QUXA 3MBED 2P8PA 4HOZA 4FG6D 2GAZB 2GI7A 3ILPA 4TN9A 1L7TH 2W65B 2B20A 3OKKA 1JN6A 4OFIA 3QXUA 5HVHB 3U0TA 4Q6IB 3DXAD 1ZA6A 4QYOB 4BH7B 1ODAA 1S3KL 2F54A 4N22A 3MV9A 5F71A 4P2OC 3TXAA 1KGXA 3BAIA 4FNLH 4NKQB 5I28A 5JOFA 3LKRA 5KYUA 5F7UA 3QSKB 1G7PB 3U6RA 1DDHA 4DGYH 4WTZG 2G2RA 3QIWB 1QR4A 3BIAX 4I4WA 4KY2A 1W8NA 1U0QA 1U8MB 5C08A 3EOAA 1NBVH 2WCGA 4WWKD 5IVOA 3T0EA 3AUWB 1JI2A 1X7SA 1JWUA 2ODIA 2HXAA 1DDHB 3QJRB 2JJVA 4MA8L 4V2CB 5J12C 1A25A 2D3NA 4BWWA 5J6HA 2WLLB 3QORD 2EVGA 1AI1L 4LHUB 5IREA 1DHKA 1DVQA 3FSWA 3I50L 2VXTH 1S9KC 1OSEA 1IQDA 2WWNA 1DUZB 4GMSH 3EFOB 3CSFA 1JNHA 1PIFA 1EZVX 1ACYL 3QUXC 3MMEA 4WKXA 4Y5XA 1BVZA 3BWZA 5DVOA 3FH7A 3U6XS 3ZDWA 5JOEA 3WIHA 1LXMA 1B4TA 2VN4A 3HS9A 3L4YA 4XXDB 4ZAKD 3CCHB 4XPFH 5IBUB 4AYEC 3BZ5A 4M8QB 4Y1AE 4OTXL 4NDMB 2ICES 3MV7D 4DKDC 3RFZB 4E0RB 4HUWA 4GINA 5I8CB 4A38A 2ZJSL 5CUSL 1UQSB 3V0VA 3LIUA 2Z35A 1JPTH 2BOBA 1NBCA 2W80C 3MOBH 1MHHB 3P3SA 3PHOA 3PXLA 4JHUA 4ZZFA 1ASOA 2C5DC 2DQFB 2LVEA 4GUOA 4IRJD 4QTHA 5G5DB 3VXPB 1HEZA 4X9IA 4FNQA 3M17B 5H37H 2DQEL 4EN3B 5DZNA 2X42A 4EZMA 1U58B 4TLKA 4UOJA 4ZAKC 4FYSA 3WFDH 2ZG1A 1PIGA 4LT7A 2PP7A 5IJVA 3IN2A 2DDQH 1EJOH 1QTPA 3KPSD 4I3RH 4HUVB 2IBZY 4OZHA 3ZE0F 3LPFA 3GMPA 1MREL 3MV01 2YAMA 4EN2A 2O5ZL 1VRSA 2R8SL 5IUSA 2MHAA 4Z77B 4GS7C 5F7BA 1EPFA 1N8ZB 3V0DA 4G6JH 3OX8A 3DX1A 1NC4B 4ADIA 1N2RA 1M71B 2OJEA 4LCCA 4JRYA 1LDPH 1TQBC 4QHUB 1TJIL 5FXCH 3SBPA 3E6HB 1Z3RA 1QTSA 1OB1A 4GUQA 2DWYA 3O8XB 4BH7A 4ORGA 3CUPB 4D2NA 2ZKHH 4PY8I 4Y1AA 2D7PA 3NJHA 3NIDF 3RGHA 3ULUH 3ARVA 4FQJL 4V2BA 2OJEB 2PXYA 4N8CH 5K9QG 4GAJH 1EDQA 5E9DA 4GAGL 5DMIH 3SKNA 5KVMC 1HWGB 1KGCD 2DI8A 3CSPA 3DX3A 3LNHA 4GNKB 5IOPA 1GCFA 2E6JA 3CFBA 3C60A 3MV8D 4CU6A 1U8QA 4O00A 1QHQA 2Y5QA 5IK3A 32C2B 3RUGF 1YMME 3ARED 3SKNB 4QRSA 2Y1YA 5I0VA 1OP4A 4OR1A 1HDMB 3JTTA 1XH2A 2NNAB 1KXVC 4AMWA 5DJCB 2EUVA 1R3HA 3UTTB 4OD1L 3RWFB 2XPZA 2H6OA 4R97B 3A4DA 3VWJD 3INOA 4NKMA 2E6QA 1K5NB 1PLBA 2BC4B 1WAAF 3M8OH 4GW1A 3O9WB 1CVRA 1W8OA 4LRNH 1TZ8A 5BUAA 2HLAA 2R27A 4EVNA 3Q9QA 4MCYB 3RWCA 1NLBH 2R69H 4Q9QH 5TQ2L 4D0CA 1QSVA 5ACZA 1KIRA 3B3BA 3APFA 4E2OA 5FOBA 5EPMA 5JHDA 4NM8H 5AYQA 1XAKA 2E7BA 4X6BA 4NQDB 1L3WA 1OSZA 2EH7H 3M88A 4QOKD 2EVJA 4WI8A 4AGPA 4Y4FC 4NUMA 1CGUA 4AL8L 5ESVB 4YSDA 1NJ9B 4OLVH 5CJOH 5HPMB 1R3IH 2IG2L 3N9GL 5I16B 1IC7H 1KIUB 4L3CA 4OY9A 4GMTH 1KEGL 5IR1B 1N7MH 4XVSL 2YUZA 4L1BA 1J9SA 1J9CT 3Q3GA 2FX7L 4HIHB 3BEVB 3MRJB 4G71B 1QP1A 1XX9C 1ZHNA 2KDGA 4HXAH 3EJSA 1IGJA 2L0DA 2DH3A 1L0PA 2XG4B 3V8CA 1ZJAA 2BVOA 2G9HB 4BFNA 1YSOA 3L95A 1MCFA 3EHBB 5HDBF 3NA9H 1A4AA 1QFPA 3D85B 2IMMA 1FL3B 3IRPX 4X2UA 43C9A 4Y4KA 2WK2A 4F8NA 2ZWYA 3UTSD 4ORGB 4ZMZA 4MMZB 3EFFB 2E6PA 3SKOB 1AQMA 1ROWA 5C9JA 5LBSL 1H3WM 2XN9B 1CK0L 5E0QA 4EEEA 1QOKA 1AJ7L 1H5BA 3WENA 4ZX3A 1GJUA 5GGQL 4WIQA 4ACPA 1JNLL 2FQDA 4PJFF 1Z3GL 3VXMA 4JFFA 4WU7A 4GKNA 3SCMB 4FCAA 4D9RE 3G6AB 5GHWH 5DR5H 5HVFB 1NAMA 4LPCA 3DBSA 5I82A 4NC2B 3TZVB 3UJTL 5AENA 1BM3H 3SB3A 3NOIA 2H1PH 1T7VA 4P5RA 3PGCB 3QWQB 2CRYA 1JFHA 2NT1A 3BAJA 4U1GB 1OAQL 4ZMTA 4QLRA 1T5KA 5FS5A 3QUHA 4YXLL 3L3GA 3QUZA 4JG5A 5G2NA 4IRSB 1IM3D 5FDWA 4HC1A 3FQWB 1NKGA 2ARWA 4OGXH 5C3TA 4RAVA 5F97E 2WQ8A 5A16A 2BSSB 4YDVA 3WAKA 4UYPA 5EU7E 2QADD 4ANVA 3F3HA 4NQVB 1DBBL 2WZPD 5ELIA 3OLDA 5A6IA 1JCVA 5FCSH 2VIRB 2DIAA 3GK8L 5CAYB 3HFML 3Q48A 3GSUA 2R29A 1A3ZA 4MXQD 3W2DL 5F7MC 4QRPE 3EGXB 2YUVA 2NY1C 5H94A 3U36B 5KYWB 3REVA 4X6DA 1SF5A 5AW7B 4X6FA 5IR1A 5FHBL 3F7VA 3DIVA 3MACH 3IM1A 2J8UE 1KXTA 4L8SA 1CQYA 5GJTL 3LV3B 2ZYIA 1CXKA 3AUVA 4KO7A 3WXWL 3BPCA 3B7YA 3WTTA 1QVOA 4JKWA 4W9ZA 5JOPD 3B2DC 4NIYE 2R1XA 5D1QD 3B5GA 2EIBA 1UM6L 2NXZB 4JPVH 2OK0H 2C8NA 3BDXA 4MWFA 1R5IA 4OM0L 1P9MC 4YDNA 3SDYH 4F9LC 3F7YA 4JFXA 4PG9A 5SWQB 5GRVL 1J5OL 3IJSA 4JFPB 3I50H 1JK9A 4P2OD 4Z0BL 1DLFL 4MWFB 1X6NA 4ZTPL 5E8NB 1NEZA 3LRSA 4FQ2L 4PGJA 1EJOL 4I3RL 5JHLH 2DZEA 1KJMA 1OD9A 5AW2B 5DJ6A 2H1PL 4MXWH 1ULVA 3II1A 3RWIB 1EFXD 2VN5A 5DTFB 2A74B 3T2QA 3ZMEA 3SDCD 3I2CH 2WLZA 2Y7MA 5LBSA 1R34A 5D1XD 2Z31C 4CKVX 4EI0A 25C8L 3UERA 3FFDA 1MI5A 3CFCL 5C7ZA 4XNUL 3QR0A 4BFIA 1ZTXL 1ZE3C 1I9RH 3MKGA 4PLKC 4ZS7H 4L3FA 1IBGH 3DRTB 1OK8A 4X8JA 4DF9A 1D5ZB 5DEFB 3L17A 2R0WL 4RGOH 3FQWA 4GEJA 4PYHA 3KEHA 4H20H 5JR1L 5CN1A 1SOKA 2UWEE 5JXEC 4LPXA 5DUBA 4YBQC 2BSSA 2CZNA 5F7HA 5EDXA 5JLZA 3WTYA 2H0FA 4FA6A 3SE8H 4G9FD 2XVBA 3LQAH 3GLZA 2IVFC 2ZPKH 3TGXA 3FUEA 1SEQL 4W9DC 5MEOA 5D2NB 4BUGA 3D34A 1WUNT 3VUAA 3RIAK 2VDLL 4B60A 5MENE 1JDDA 1FLTX 1AGEA 3PDOB 3SO3B 5DD1L 4LF3B 1ORSB 3APNA 2C9UA 4HVBA 3ARXA 1VEPA 4DTGL 4L8SB 5K59E 2VSDA 4FI7A 3BKYL 2WINB 2I60L 5FF6A 2R29L 2A6DB 1EXUA 4DKFL 4AM0A 3TF7C 4DP2X 4JVWA 1LO0H 3I6GB 3GMRA 1XGYH 4Z7VA 4XRCA 3RL2A 1W2KT 3VD5A 5B38A 1TQSA 5HHXL 2Y69B 4NOBA 4ZPVA 2HRPL 3TA3A 4X4XA 4O2CA 2CIKA 3GZPA 5AOMA 4KJYB 2WPGA 5E1AA 4PV8A 1E50A 3RL2B 2ZAIA 4X9HA 3H54A 1DYZA 3KMDA 2APBA 1HH9A 3BT2H 4JG0H 2VC2H 3NG5A 2L7EA 5AAMA 2WBJC 3F62A 3L3OB 4GAFB 4WI0B 1GYWA 4XBGB 3N42B 2DQTL 1J5DA 5E1AB 1XO8A 1NC2B 1ZMYA 4L1SA 3WD5L 1KCRH 3OMIB 3PGFL 1BX2A 4XBGA 2EDWA 4B9IA 1U2YA 2MSPA 3FFDB 4BDVA 4HUKB 3HZ3A 1X4YA 2GFBA 4UQBA 4LAJH 4DERA 4PHZA 1U6AL 3NPZB 4RFOL 4HMDA 2B4CH 3IDNB 2P3YA 4UWQB 1BX2B 1I1RA 2UY6A 2YAHA 4NBYB 2VJXA 1MG2C 3N55A 4C57C 5JPMA 4L5FE 4YDMA 2D7NA 1A6UL 3IMSA 3B2MA 1LEGB 3C5JA 1RAMA 4TTDD 3IU4L 4MD0B 5AB1A 3GRWL 3NIFE 1EIBA 4KV5E 4Z7VE 1HCFX 2E7DA 2OMYB 2CO2A 4G7YH 3C5JB 2RALA 2Z91A 2ZIDA 4OF0A 3IDMA 4FABH 4JPQA 1CD1B 3ZQ9A 2XI9A 5CU9A 4NC1C 4OZHF 4PGBB 2NY6B 4XVOA 4JLRB 3KH4A 2JELH 2X0WA 1F11A 4F80A 2VUYA 1A9VA 3LEVL 4MD5B 5CJXA 4EZLA 4JUSA 1PY9A 4PJEA 4WTXA 3OPUA 3OLIA 5KJRL 2WGNB 3OZ9H 1G7JA 1M42A 4KGJA 2R83A 4P2QE 1KYUA 2I25N 5DLML 4NC0B 4BRJA 5L4JA 4JHWL 4G59C 1FL5B 3OR7B 2BVTA 3U7WH 5E6ZA 3VYPA 1TQCB 4LLMB 3RL1B 1F2QA 4AXWA 5B7EA 1VFAB 5DUPL 2FB4L 4HV8B 2C9VA 4QIRA 1D6VH 1XGRB 3LXAA 3OHXA 3VQMA 5K5YA 2B1AH 3FHEA 3IFPB 2IPKA 2EXSA 2CMRH 4R4BB 1FVEA 4LP4A 5DF0A 5KVFH 2ZCKH 3NPSB 3VNYA 2HJKA 5A40E 4BZ1A 3EYQC 4JM2C 4LCWE 5TE4H 3S34H 2IPUK 5AW1B 5HDQL 1VPOL 1SLWA 3P9LB 3QPQC 3JQOB 3N43B 4PP2B 1YMMD 3SPVB 4FQLL 3ARDA 2HJKB 2IQ9L 3B7UX 1UCBH 1TTUA 4MQXC 2JE8A 2EDMA 3FUJA 3CVHB 1XD0A 3VYOA 5CCKL 3HUJE 3RNKB 5TGBB 1MFEL 3FT4B 5I18H 4PJ7A 1RPKA 1I1CA 3AW5A 2WJ7A 5EN2B 2BERA 3BJLA 3PQYD 2BSRB 4PSRA 2W5PA 1GIGH 4ZD3H 3AT0A 4NT6B 5ICUA 3CVHA 3RA7L 1BVLA 4TLTA 3ULUC 3UAJA 3H53A 1TJGL 4UAHA 3JTSA 4L37A 4PWGA 2IWFA 5J1SC 3GRWH 1MCOH 3PFQA 5LGYA 4NT6A 4KKNA 2JK5A 2OP4H 1HWHB 4IMLB 5JXEA 2Y2WA 3IJHA 4WUUB 4F2MB 2VXVL 1OP5H 2G9KA 3KGUA 4R0LB 1LO5A 5AKVA 1U3HA 4JHZA 4L3AA 5DSCA 4OGYL 1EEQA 5MP6L 2WTPA 12E8L 1T7WA 3EADA 3C08H 4X7FC 3VFSB 4HCRH 4NQTA 3I2CL 4FG2A 1S7QA 4XX1G 2J7LA 5C92A 1X7TA 3KPSE 1PJ9A 4XCNA 1NFDB 3S37H 2RAMA 2PMZA 2Z4TA 4AV5A 5HYSG 5D1QE 4MDIA 5JNYB 1NDGB 4Z7UB 1TMQA 4OZFG 1UA3A 3S36X 3T65B 3ZMRA 5IZ7A 2Q8BH 1NFDA 4NAJA 3JYCA 1T1YB 3OAZH 4HWEL 2M8XA 4GKSB 2WLYA 4KVCL 4N8VG 1HSAA 2VR6A 5KANI 3H9SA 4DQAA 4LKXA 1T1ZB 2WUCL 2HCZX 3L3DA 1FL5A 3QYCA 4WWKC 3ZKMC 4ABUA 1GCYA 1S9WA 2BW4A 3KVQA 5FHAH 3ES6A 3VFVA 1C08A 3V8OA 3H4FA 3G6JA 2VLJD 1HSAB 1ZVSA 3KS0H 2OL3L 1Q72H 3PAYA 4UT9H 4G7SB 4LKXB 3ARBA 4DW2H 3VFTB 1RVFL 2CAKA 5CIPA 2XWBB 3ZUCA 2J6WA 5GGTH 3UDWC 2YD4A 3KPSB 5EUOA 3NBNA 4LL9A 1U9KA 3A4EA 3OXSA 4Q2ZA 3PWPA 5EULV 2E5EA 3DTXB 3QXTA 5CIPB 4B5EA 1M2VA 2DM2A 4K5NA 1AZRA 1BQHB 3ZZLA 2W1NA 5FIEA 3V5DA 1TITA 1WG3A 2Q6WB 4NJAH 2ZSVB 2COVD 4U1KA 3PGFH 2DLFH 3IDGA 1UOKA 3LKNB 3MDJA 5BQDA 2Y7NA 5J0BA 1EEZB 1UJ3A 4K7PH 2J8UF 4UIKH 3C12A 3EG9B 4F7CB 4N28A 3QWNA 1JDCA 4KWUA 2VR4A 3OAUH 2GIYA 2B1HL 4J6RL 3LXCA 2GJJA 4GQRA 3RI5K 1RHFA 1UG9A 2DBLL 3HBQA 2WBJA 1GAFH 4JM0A 1T0PB 3FQUB 5FM5O 4P5TB 1AXSA 1JHKH 3FU7A 4WJ5A 1JK8A 1FQ9C 1HOCA 3CBJB 3K6NA 3ZYIA 5DHYA 2FYYA 4KROB 4P5TD 1Z9SB 3BKYH 3DIFB 2EUXA 5D7LB 4LGSB 4PW4A 2COQA 1H3UA 2UY7B 5DVPA 4F37K 2DWTA 3VFRA 4MGXA 4ZXBB 2VERA 1A6VL 3EJQA 3NACH 3NRPA 1FFNA 3GS7A 5JPMC 3AS3A 3ZRFC 1TPXC 1J8RA 1QBMH 4C8XA 1CGVA 4HG4J 2CR6A 2VL5A 5T1LB 3D07A 2MCAA 4XPHH 4OVUA 4M48L 4C4UA 1S78C 3RZCA 5FCUL 4PJBA 3GEWB 2CQVA 3GRGA 4F8QA 1M7XA 2PCYA 4M6ML 4G3YH 3GSNB 2Y4SA 4P23D 4Y5VB 5ILTH 1ASQA 5HI3D 1YEEH 2PP8A 4L23A 2FATL 4NQCD 1IFGA 1EANA 5IHZA 4FGMA 3LDBC 5CEXB 3UCQA 3RPBA 5AVSB 2LE9A 3QA3B 4X9GA 4ONHA 1QFUL 1SDDB 4P99A 4WW1A 5EU6A 5EUKA 4MQXD 3KPOB 1EVTC 4NN7C 3RTQA 3ARFB 1ZT1B 5DLLA 3ULVH 1HE8A 1TVBB 4OJDH 2MPAL 2VDNH 5D6CA 4FZ8L 4XE5B 3N0PB 4LXFA 2R0LH 5F0JB 4R90H 1R5WA 1N8OE 4WI3A 4Q4IA 4WY7H 1VFBA 1NGQL 2V2WB 3BKML 2B15A 3E6FA 1T22A 3DOIA 4LLUB 4JDZB 5CSGA 3IDGB 3LKNA 4UM8A 2ZICA 3X1BA 1LDSA 3TX4A 1C5CH 3GZQA 2CBPA 1Y0LB 5MHSD 4Y9CA 1FH5L 5CD5C 4WW2C 4G82A 1GGUA 4PRPE 2VUKA 3DGDA 1JGIA 4CVZB 2R4RL 1IM9A 1OGAB 2DL2A 2W65A 2DEXX 2D2OA 3ARGB 1AY1L 2TAAA 3L5XL 1KACB 2D31A 2N7SA 3VGGA 3L2MA 4R3SB 2R1YA 3OB0H 1KGCE 3NTCH 3QEGL 2OK0L 4HGKC 4ZS7L 4OGQC 3LX9A 2AJXL 1I53A 1EAPB 4C4KT 5D7JD 4DETA 1TO4A 1UFGA 4P3CL 2R1YB 1E67A 3IPBA 3NK3A 3N44F 2YSSA 4L29A 4XO5A 3J7HA 2DJ4A 1UD4A 4BFGA 5GS2H 5LO7A 3S3SA 1I1FB 4WVRA 5HSFA 2IAAC 3DMMD 2DTML 3CZKA 3LEXA 5I8OL 1OAXL 2YAFA 4AJ0A 1G7MB 1IT9H 2XZQL 1VFOA 1MFUA 1GZQB 2FECI 1GRWA 4PJBB 5GHWL 4KKLC 5DEJA 3ROLB 4A7VA 2X4NB 3H0TA 4U1JA 1NIAA 4Z95L 2X4TB 1CJYA 2N0KA 2YC1B 3WEAA 1LWRA 2CBQA 5AZEH 3TBTB 4XXDA 1C5DA 4ZMYA 3WTWA 5F9WB 2Y5EA 4TUKL 2RACA 4NDMA 2B39A 2FTAA 3IPEA 1JV2B 5IWLA 3OL2A 3QW9A 1TR7A 1AY1H 1ERNA 2ZWSA 3BUTA 5E8EA 4KTGA 5DGQA 3DX9B 1DQLH 3EJCA 4OT1L 5F9OL 1YEJH 4JO4L 5EOCH 1PZAA 1WFNA 5HDRA 1AGCA 2A83B 2EYSA 4QRFA 4PJGF 1OT2A 4WI9A 4P3DB 3H3PL 5DD0L 4A2HA 2WZAA 4DK5A 2OQJB 3MBEA 4XP1H 5C2BL 3DX9A 1FNGB 4HQQL 3TPUA 4YHYB 3EXJA 4WHDA 4WLCA 5AG8A 5C09D 4XNZB 3UAFA 5HGAB 43CAA 1IAMA 5I8EB 1ZGLM 2QELA 5KBKA 2XZAL 4WDIB 4WEMB 5F1IB 6PCYA 1RZFH 3BPNB 3LRMA 1BJ8A 4TUJB 2VXSL 4O02B 1JN6B 1QSEB 1JGDB 4LHJB 3WCYA 4HJGA 4NZTH 3IRZA 1BIIB 3ESVF 2IOOA 2WZ0A 2YJLA 3K80A 1WC7B 4AQ1C 4F8LA 5ICYB 3FTZA 1QYGL 1GA2A 3BPOB 4LHUG 1F3DH 1FVDA 2MKWA 4DP0X 3LYRA 4RETB 5IWLC 1NLBL 2R69L 1BIIA 3V6ZB 3RE0A 4U49A 4KKRA 5DYOB 3TZVC 3QHZL 1KSRA 2MQGA 5C0FA 1E7VA 3NCXA 1YNTF 3KNBA 5IESL 3WKML 4NQSA 4AQ8C 4N5EC 2A77H 1AKJD 1KLFA 4H13C 5FKPA 5IOPB 1FIGH 3BZDA 2PW1B 4N2HA 3H7BA 2IPUG 5FCUH 2ADGB 4Z7NB 4JNXA 4M5TA 4AL8H 3G08B 4NWTH 4Y9EA 1WH0A 4MMZC 3SY6A 4QHPA 3OJDB 3WDHA 2JJTC 2VT0A 3FU0A 4XCEA 1MHCA 2VMEA 4BK5C 5C8JA 2WAQA 2X4OB 3HN5A 5HGDA 4BFOA 1RPUA 1T03L 4PS7A 2YC1A 2J1YA 3EF7A 3RGVA 2QVKA 1EV2E 3NP3A 3ZDZF 1C5DB 1OZUA 1ZIAA 4KK5C 3LN4A 4HDIB 4CJ1A 1V54B 4NO2A 3C9NB 2PO6A 3NPSC 1J1PL 5BOZG 1DN0B 2VDKB 4O51B 4EAEA 3PWVB 4HH8A 1PZSA 1LDPL 1SJHB 1OOWA 3LN9A 1G6RA 4CGTA 3HPJA 4EI5A 3M7FB 4LLVB 1VFMA 1N0LA 5H4YA 3VI4E 5AALA 4HKZA 1Q9OA 1P4LA 5GISH 3SGKC 5JW4R 5JZ7D 2YPLD 5E6UB 3BI9X 1JXKA 4S1RH 1AGCB 2A83A 4MAYD 5E2UL 4PRNA 1IEBA 3PS6A 2GBTA 3MBEB 1NPUA 3CC1A 5E5LA 1CMOA 4NZFA 5B1CA 5KSAB 5HY9B 1U8NA 3ZTJG 1V7NL 4JRYD 1QNIA 3K4AA 2XJKA 2VLRD 1R4XA 2E56A 2O6FA 4WDIA 2CO4A 2ATPA 3L7FA 3QUMA 3IS1X 2P5ED 1JD7A 5DZ9A 3EO9H 3VG0L 2F1EA 4LLDB 2MJWA 3KWUA 4QHUA 5EO9A 4KRPC 3T3PE 3BZEA 3VD2A 3V6FA 3HHRB 1HTYA 5E99L 4WO4A 1KENH 4KZCA 1FCGA 1G9NL 1WC7A 2SEBA 2DLTA 3CH1B 3U9WA 3S88H 5GGTL 1IQWL 2H2PD 1DSYA 3KPRD 4U1LB 35C8L 4GO9A 2D0HA 3N40F 4K5MA 4CBPA 4G8EB 4QHKI 4AIOA 2ZYSA 4KAQL 1JZFA 3EBAA 5I8KH 2XUWA 4NNXB 3MLYL 4UUJA 5GJSL 2HMIC 5EOQL 1G94A 4ATWA 1NIFA 4XC1L 1VGEL 4QRSB 1JUFB 3S36H 4D8PB 4E5XG 4Z8FL 4X4YB 1JWMA 3FYEB 5JIQA 2H1XA 4J6IA 1O6SA 3PWJA 5GGRB 5LGHL 5ADOL 2MFNA 1NCGA 5AW6B 4TNEA 3G08A 2F53E 5DS1A 4PJFA 1MXDA 2I9LB 3LMJL 12E8H 3QJHB 3CMOH 3GMMB 2CLVA 1GS8A 3S37L 4OCRH 4P9HH 1AZBA 3KPLA 1IQDB 1R5VA 3T0XA 4ISVB 4LPWA 4YBLC 3Q8EA 3R19A 3JWDC 2R0LL 3LH9A 2YKLL 5DCCA 1NUFA 1XXFC 3D69B 3CVBA 3MBWA 4GIOA 4JFSA 1HXMB 4PJAA 4OCSH 3F7RA 5AYUH 1CYWA 1CIUA 2WO3B 3BSZA 5FDYA 4ISVA 1IEAA 2B8OT 1F8TH 4L8DB 4L0ZA 3NH7H 4QRQB 1H0DB 2I24N 2NUTA 1UQSA 1G6RB 3ARZA 4LARH 4XXCA 3WOVA 4AGQA 4D3CH 1N0LB 1T4KB 4JKMA 1G9HA 2VZOA 2DEWX 2J25A 4F2EA 5A7BA 3OSVA 3M1CA 4O2FA 2OTPA 3FTUA 1PCXA 3LPOA 1TOXA 3SDXF 3SQBB 4AYID 3QZWG 4C56D 1XL4A 1N68A 4PRNB 3EOTH 4PREA 5KEZA 3UZVA 1NGPL 2TSBA 2DN7A 4Q0XH 4R2GD 3QUZC 1A22B 1XF4A 1EZSA 1WEJL 3ZMNA 5H94B 1D2PA 5EEUA 1BVOA 2KL6A 5EBGA 3FRPB 3BVWA 2VQTA 4R7NB 2QMJA 4GUPB 4LSVH 4X6FB 4B9GA 3BVDB 5C6WH 2WXHA 5C0JB 2X53A 4GUCA 1MIEL 4RNRB 3MR9B 1MFCL 3BAEL 2F53A 1M7IB 2VXVH 3LNGA 4J3OC 3TFKD 2GEQA 4UIMA 4DGYL 3RWJA 4F7MA 1PBYA 2ZJSH 1TTFA 4JO2H 1FYTE 3SGDH 2AXGA 3BCDA 3HA0A 4KZEL 1KGWA 4LVOB 3AQDA 1OB1B 1ZHKB 1DANT 2BOCB 2VN6A 3LB6D 4N1CA 1KB5B 4LSUL 3ZR6A 4N24A 4LSPH 4JHWH 1YN7B 5AW8B 1HYSC 3QG6A 1UA6H 5DVLA 4UBDC 5IP4A 1QACA 4U1HB 5FYLL 3G6AA 2GBAA 3FT3B 3Q5TA 2MCG1 4XCCL 3T8VA 5JQIB 4GAAA 5IMMA 3DGCR 3HR6A 3Q6GL 1QWHA 3BN9D 2WXMA 1ZEAH 4QKTA 1UZ6F 3C60B 2XN1A 3KPMA 1Z9PA 3BAXA 2R2HA 4UQIM 4Y88A 1FDLL 5F6IB 3MREB 4YSTA 5GRUH 3Q8BA 1H3PL 1Y6KR 4KRPD 4WGKA 3L3JA 2AZUA 4HYTB 4HEME 3L2LA 1INQA 3TBSB 1TF4A 4NENB 3LS5H 1QLEL 4QO1B 4Q8BA 4XCFL 3MRIB 3MREA 1GC1L 5T1KD 3RGVC 4GIAA 3MV11 1FIEA 5EU4A 3V4PL 1E6OH 4TXVB 5B39G 5JPNA 3AAZA 1XFPA 1WK0A 1RULH 4JG1L 2CK0H 5ALBH 4RH4A 3FO0L 3T1WA 1NCAH 4I0CC 1A4BA 1ETA1 4AGNA 2LVCA 1T7XA 3AVEA 3GHBH 4RQQA 5E8OA 1V3MA 3TYFA 1NUDA 3MJGX 4X80H 5ALBL 3VFWA 3VD3A 2ARJQ 4F7TA 3Q8AA 5I6OA 1OEZW 1OM3H 1UZ6E 1YMHB 1JERA 2WLKA 3LMJH 4AYBA 2XT1B 1JNNH 3L5HA 5E8OB 3CFIC 4XN1A 5AUMB 2XN2A 3MLXH 2GITA 4P04A 5C0BA 4DN4H 1L6ZA 1CC3A 4F57L 3MTXA 4G42B 3TO4A 2DQTH 3AQXA 4U0QB 1A8ZA 2EIJB 3HZVA 3I9GL 1UKQA 2XV0A 4HISA 1RKRA 4Z23A 3K2KA 1W8EA 1AOHA 1DBMH 1UXWB 4PJCB 1ORSA 4Y4KC 2N01B 4JO1L 3FUHA 3HC3L 4OLUL 4ZOAA 3GBMH 4HJIA 3O6FA 3HI1B 4K8RL 4RNRA 2A6IB 1RZGB 1F4AA 1V10A 2VL4A 4EZJA 4LDEB 3OGCB 3KLQA 1FO0A 3SE9L 1PFCA 2ENSA 4PG9B 1F1DA 3GEFA 1ZHLB 4LMQI 1JXFA 5SWSD 5JPNC 2RMNA 2BS71 2X2YA 2AP2A 3OTTA 1UA6L 5A6LA 3D0AA 1ODUA 1I1AA 1WZKA 1YN7A 2DI9A 2ADYA 3QZWA 4X5PA 3F7PC 4ABWA 2PPCA 2PCFA 4Z7QF 1YYMH 3MJWA 4UMSA 2AQ2A 3FAWA 1IKNC 2WQSA 3ML8A 3ML9A 5CLZA 3EYFA 4FXTA 3KYMA 3LRHA 5AVUB 5J6GA 3QFJB 5IMMB 1LGVA 1CFVH 3N6YA 1H3PH 4ZUUA 1F45A 4Y19E 3DURA 4H8VA 3HVDA 4WU7B 4R0LC 1ADQL 4MMXC 5IHBA 1EAJA 3N06B 2OKMA 2HJFA 1BEYH 4GKZB 1S6NA 2XICA 5FOJA 5IMLB 3BDBA 2XIDA 4GG8B 4UF7C 3BRGC 4YR6A 2R0ZL 1NH6A 1B88A 2QSVA 3HE7A 4XN8A 5DWUL 4FP8L 2CDFA 4H0IA 5IJCC 3VDBA 4M7LH 4YO0B 4G1MA 2VZUA 3VCLA 2HJLB 3V52H 5AAMC 4F27A 1S7WA 1KCVL 3MYZA 4WUUE 1T6BX 2EXYD 3QDGE 4D3CL 2ATKA 3WLWD 4IOFD 4F33A 1KBWA 3QT2A 3KS0J 3FCSA 4G1MB 3F00A 5KJ4A 3DV4B 1D6VL 3X14B 2HJLA 2QGEA 1XWVA 5D7IA 1EGJH 5DQ9A 1T21A 4JN2B 3TWCL 1IB5A 2VB5A 3ILDA 4RAHA 2H0PA 4PRPD 1KBGH 2IANA 2Y7QA 3IYLW 4NWTL 5EIIG 1QPKA 3KXFA 3RVVD 3MXVL 3LAFA 1CDGA 5BS0E 3IFLH 3FJTA 4NIKB 25C8H 2DL9A 2XQYK 4OM1H 4OCRL 4JJHA 4MMXA 2QHLA 5IY5B 5B8CC 2X0VA 2FLBT 3EO0A 1MWAL 5F70A 2FR4B 1IC4L 1AH1A 1MPAL 2Z93A 1OQXA 4FI6A 2NY6C 3VQ2C 3I6GA 1T2QL 3KWTA 1RZGA 1SXZA 4BQCA 2IWKA 4IEFA 1UJTA 2CBMA 3CHXA 2R23A 5IHUL 4N6RB 1AR1B 4P2QD 4RRPG 1XF1A 4WV1B 4Z7OB 4K2UL 4L18A 5EBMA 1OVZA 4ZMQA 4LOUC 2QR0A 3VWKD 4JJOA 3QQXA 2H6PA 5AZEL 3MNMA 4NP4H 4IEFB 4C58B 1JNHB 1YEGH 2FEEL 3VRIA 3P4NA 4X8XA 3FQRA 5KUMA 1FYTB 2PLTA 1G7HB 3QZPA 3UYRH 1Z5YD 2J8OA 3TN0B 2EDDA 4PWKA 3SPJA 4R5XA 3L4ZA 3NJJA 3FW6A 1OCZB 3SPVA 4MXWL 2H3NA 1AG0A 3RWIA 3WY4A 3AQYA 4XHJD 3QHFL 4B9FA 1YY9C 4L1HA 4LNVA 4N68A 1H6TA 3OKDA 1G0DA 2UY6B 4R26H 4HCIA 3M1BA 1JYNA 4EN3A 1E3ZA 1A6PA 1V3KA 1QD0A 5B1JA 1JNLH 1I9EA 2ZCHL 4FQIH 4PFEA 4X7EC 2DJUA 3SGJC 4EIBA 3A6CL 5L6YL 5J11B 1FNAA 4YSPA 1HN1A 4KMTH 4WFFE 5K9JL 3OLGA 4X6CF 4JFHE 1O7DE 4JFZL 3EDEA 2DIEA 5CZKA 2BFGA 4P2RE 3CH8A 4LPUA 3F01A 1TVDA 5FWRA 1BD2D 3MRNB 4WSGA 2IEPA 2WUBH 4KKAD 5DD3L 3MRMA 1EAQA 5FA3B 1F4YL 3QUML 3WS3B 4QCIB 4Z95H 3G6JE 5K1NA 1G43A 4ODHH 3DK2A 5GJTH 3WNLA 4GQZA 3K3QA 3V4VB 1LEKA 4PRBB 5T5FH 2MNUA 5E99H 4G8GE 1SM3H 2W91A 3TS8A 2XWXA 2ZAHA 4ZSOA 3ULSA 3MKKA 5HHOA 1HHJB 4NZUH 4GRLD 3JV6B 4JL2A 1VF5C 2X1XR 4UQ2B 4FA8A 5FECB 3Q13A 2NSXA 4LGPB 3TVMA 2CUIA 2JIXA 2O72A 1JPFB 2IPTL 3E2HC 2JCCB 3QC6X 1HHJA 5KANG 3GXTA 3UIYA 2A6DA 3T1FA 2ZUTA 1LMIA 1EXUB 3RVUD 2NDFA 1H8NA 4JB9L 1RUKL 3AY4C 3I6KB 2N4IA 3HRZA 1FG2B 1MWAB 5KBNC 5HBBA 3NFPA 1ZVSB 2XXCB 1M1SA 2QFPA 1JFQH 1OCWH 5F9JA 1J0IA 3DIDA 5DQDH 4YE4L 2OPCA 4F15B 1YUHA 4UI2A 1V3LA 3GNMH 4O2CB 1MCKA 1ES0A 3TJHC 1TJHH 4ANXA 5F7AA 4XXWC 1BZDA 3FAXA 3VB8A 3SDDC 3CPUA 3DTXA 4KKCC 2L8AA 2BNRA 1I85C 1PG7W 3DI2B 5ESAA 4YHIA 5FOBB 2ZZUT 5CGMA 3MNVA 3ZE0E 4TOYH 5DURB 1FGNH 4OF8A 3QRFM 3V79C 2FT8A 4LHQB 2GJ6B 4QWWC 3KJ4B 6TAAA 5LLIC 5IESH 3MAWA 4GAGH 4FOMA 3RIFF 3SOTA 3FTGA 5F7KC 3AY4A 2C1OA 5HHVH 3PLYA 3Q44A 1NMCB 3AWGA 4R0LA 4M4RB 3IDXH 3PWUA 5J1AB 1KC5L 2KERA 2YGOA 5AYTA 4BFEA 1KLUB 3DX7A 4XAKD 3T6VA 2R4SH 3IJYB 1AD9B 4HIJA 4PJAE 5EV7A 3ESNA 1FBIH 4HKJA 1FAIH 2YAPA 1NA8A 1V05A 1WAAA 3FRUB 4G8FA 3P4OB 3VSUA 3B1UA 4FQCH 3BCFA 3D85A 4U4IA 4XNMA 3U1PA 1P4BH 4RGMC 3PIQB 3GHEH 4L0PB 2B7DT 2J8UA 3H9SD 4HEPA 4P9MH 4JY6A 3V9EA 1FO0L 5FO9A 4LEOB 4EI6A 2YQBA 4XNBA 2XN9A 3ZL4H 3R0NA 1FFPA 4JANA 3MLSL 5DK3A 4N2KA 3RBSA 5KVEH 1R3LA 3ZZSA 2YARA 3I6LE 3N04A 5TK4A 3B43A 4IRJA 5EF0A 4N87A 4U3SB 1OF0A 1P4IL 3RUGA 2VR7A 1CICA 3UXFA 3X12B 4ZUTA 1DE4A 5KSVB 1BBDH 4UTBA 3QWRA 3OR7A 4LBAA 1KN2H 1M4KA 3RDTC 4LE8A 4AX3A 3H56A 3VXQA 4PJ9B 3ULUD 1U92A 1WISA 4J28A 2AVFA 4HGWA 5JIHA 3KPSA 5EUOB 4OZFB 5I2IA 4AXWB 3QEHA 1HVXA 1W80A 4NNPH 2XV2A 2VZ3A 3TP4A 4R6UA 3KGSA 4MA7H 4HPYH 1OKEA 3GINA 2Z31B 3TCLA 3C6LA 5IBLD 3V5DB 1D7BA 3P0GB 2WXPA 4WWID 3ZTDC 3QEHB 1P7QD 4E41E 4XNQA 2BY1A 2ITCB 4PJFE 1KLGA 2FVNA 1XCWA 3V4PA 4HU2A 3GTVA 4OF6A 4ZS6D 4DPCX 1LVEA 3QXAB 2QQLL 3CN2A 4NJAL 5TDPA 1QZ1A 4N0UA 4HUUB 1L6XA 2JI3A 2WY3B 3GKWL 4XNQB 3IPFA 2Q86B 2HWZL 4K23H 4Y89A 3B9EA 2WTOA 4IDJH 4QTIL 4WRLA 1AHWB 3WNIA 1YCSA 4PJ7B 3EDFA 4YC2B 2XZCH 3K2UL 4P5TA 3QUYA 1ZV9A 5KYWA 3CK0L 4WWKB 3RILA 3O2WL 4DW2L 3UAJC 5F88A 3ZKND 4QHKJ 2YPKA 4PLOB 5E94A 1KB5L 2V5YA 2Y36H 4MA1C 5FUOL 1ESOA 2EDJA 5GZOA 1E4XL 3P3RA 3UBXB 3SGDI 1DVUA 2ORBL 2UY7A 2JK5B 4IMLA 1NMAH 4HIJB 3HFFA 3MRHA 4KNUA 3TYGH 4IYKA 2YR3A 5I75B 3JWNC 1U3HC 2XTLA 3FTWA 1KCUH 2Y1ZA 4UV4L 5J1TC 4KQ4L 2AV7B 2BP8A 3HPLB 1AP2A 2CUMA 4CUCA 3RNQA 3HG1D 4JY6B 2DLHA 2Y7SA 1AE6L 3STZB 1D5IL 4H0HB 1D7CA 3E8VA 1OD7A 3GSNA 4PHXA 5FFLA 2V7HA 1A2YB 1PZDA 1MNUH 2H26B 4I3SL 5E8NA 2QGBA 3VGFA 2QLVB 1FNFA 2P26A 3DOHA 1Q9KA 4P46A 2XVKA 4GKSA 1S5IH 4S1QH 5IVZA 5CEXA 1JI1A 2VITA 3D12B 3MXWH 4IIQA 2WXQA 1A2YA 4Q6IC 1SDDA 4WW1B 5EU6B 1T0NA 1QEWB 3UYPA 1J9QA 5AW4B 3BWAB 2AHIA 2VQ1A 4J1UA 5FB8A 5I17A 2FWOB 4HGWB 4XX1E 3KLKA 4BFFA 3WFCL 3FOLB 5C08D 3RPKA 3P2DA 1KYAA 2BIPA 4WJKB 3ETBF 3BWAA 5JMRA 1MFAL 4H1LG 4I2XA 2J4WL 3AM8A 4LCIL 3BQUD 4GQPH 5H4ZA 5BRZB 1HIMH 3ECWA 3LTVA 2H2SC 4I88A 4ZT1A 1IGML 4UTAA 1CLZH 1QPXA 3GGWB 4PWEA 1BQSA 1TPXB 4P4RA 4S11A 2NY4C 3V0HA 15C8H 1KN4L 4TSBL 4XP5H 3EH2A 4XOCA 2JTDA 1RU9L 3NSCA 1LMKA 1CLOH 5ANHA 5EWIH 8CGTA 3H8NA 4LU5L 2H8PA 3HI6H 4OCXH 5MEOB 2CGYA 2P24A 3X11A 3FB6B 5MEQB 4AY0A 2EVHA 3FB8B 1G87A 3HG2A 4JKLA 4MS8D 3IFOB 2FL5B 2QEJA 2X2UA 1UKTA 3OKNA 4DIXA 5F88B 4J4PA 3UTZA 4NKOA 4K94L 2WINA 1MCHA 3CFJA 3MC0A 5FGCE 1G1KA 3TBWB 5DWPA 2WW8A 1J0KA 5DYOA 3UTTD 3I02A 3V52L 1HNYA 3CZSA 3VI4A 1BVNP 5C0FB 5FUCE 4M7LL 2QHRH 4MCZB 2JCWA 3PDGA 4PMFA 3ZDZB 2EINB 3BLKA 4MJHA 4ZQTA 2YO3A 3V4VH 2KKQA 4PJEF 4N5ED 5D1ZD 3VMNA 5TE7H 3H85A 2GK0A 1MJUL 2ITDB 2OXGB 4H1LB 1NCCL 4PJGB 5JHDE 3IFNH 3HB3D 5H35B 4PVBA 4YSRA 4F58H 2FJHB 3MYJB 1M6UA 2N56A 2OS7A 1OTTD 4K5PA 5D71L 5TE7L 3NJKA 1KXVA 4FCHA 3KCWA 5DFAA 2K1MA 4PWIA 4X99A 4DN4L 3VGAC 4OV5B 4MNQA 1P5UB 4WWOA 9CGTA 4L4TA 3VFOB 3I74A 4LQFL 2GJPA 2WAHA 1KXQA 4ZPTA 3WFDL 4AMKH 5EH1A 4LVNC 2XV6B 4KOCA 4KZDL 3BKCL 2CR0A 4ETQB 2O6PA 5ALCL 2WSDA 4YHNA 3WEMA 1E6OL 2ICWA 1F4WH 3VD1A 2OI9B 5D7EA 3AREA 5FEBA 5HDBB 4Q74A 1KTKE 4AL8C 3UTPE 5C3LD 4ETQA 1HI6B 2HKAA 1SXNA 3L9RA 4PJHF 2W9DH 1RLBA 3H9HA 1W6LA 4E5XB 3TJEH 5G5DA 1A1NA 1ND0B 2IO5A 1HESA 1SQ2N 1VFBB 3VFPB 3CFKB 3BFOA 4LU5H 5KSAA 1AI1H 5SWSB 4E5XA 4F57H 1FDLH 2VMJA 3OKOB 4G6FD 2QV4A 2TRYA 3FN0H 4QRPD 5E4AA 4OLEA 2ZF9A 3DTUB 4NFBA 4Q0XL 2XBZA 4F1ZA 3MV7B 1YEIH 3RVTD 2BHUA 4GW5A 3M46A 1RIUL 4NJ9H 2HPTA 5B38G 2C7FA 1IGIH 3OKNB 1T20B 2SEBB 3CH1A 3UTZB 2FQFA 3G5VB 1ED3B 1N2RB 1NAKH 3KNBB 3P4MB 4XMTA 1IBGL 2PCPA 1VCBC 3K81A 1MI5D 2DW5A 4JDVB 5I30L 4NZJA 1A6WH 2HLEB 5DJ8A 4B97A 1VEMA 5AVXB 2AGJL 3C8DA 4H88L 1NAKL 3T0EB 1I4FA 4LLMA 3RL1A 3G6JF 4CC4A 4YUEL 4XBPB 2XQYA 4YHPA 3AG1B 3H9ZA 3VRJA 2J8HA 3R1GL 2L3BA 2EVIA 1I1FA 1QBBA 2G5UA 3FFCB 4RZKA 1FAKT 1NGPH 2PO6D 1ZSDB 2YZ8A 4YHPB 3ZVVA 1FI8C 1F1GA 2B59B 1ZGLA 4LO9A 1KWKA 3VH8G 1T2XA 4PGZA 4JFED 2XRAL 5L2JA 1U33A 1HILB 5SWZB 1BOYA 1QTYT 3UROR 2ALAA 4AVJA 3K5RA 4J3OD 3TFKC 3SDXB 5JHMA 3PWNA 1IZKA 4E41B 3KPNB 2GPZA 1M53A 1FV1B 5I8CA 1E4WL 2VDQL 4BBWA 4QOKB 2NYYC 5D5MA 3TYGL 4MLSA 2VAAB 1Q9OB 3SDXA 2BNQE 1IAOB 3ET9F 1R3JB 3MCKB 2BSRA 4PLJD 3VH8B 3ZTCC 3WNMA 1FNLA 1RD6A 3MTRA 5LN4A 3HHSA 3U9UB 3BUPA 5CLYA 5JW5A 5DLMH 1GYAA 5HJDA 2V2TA 4AKOA 2AV1A 4XPTH 4ZFOA 5IJVB 1MUJB 5GGSA 2VGLM 5EO1A 4NQQA 3W2DH 3VWJB 1WZ1L 3RJQB 5I16A 3TA3D 4ZSOE 3BZFA 3THMH 3ZTEA 1UATA 3D33A 4FQ2H 5FGRA 5PCYA 4FLQA 3HZKA 1F6FB 3REWA 5LGHH 5DHVA 4GSQA 4KJQC 4XPBL 3DECA 4FABL 3DDFA 3RX8A 1YG9A 3EYVA 4JHBA 3LIZA 1TU2A 1UACL 3BZFB 1V3JA 5HYJE 5DJAB 4WTQA 3VXUB 1X9UA 1T20A 4HETA 3T65A 5HI4C 1AKJB 1UKSA 3UIZA 3TN0D 3JWOL 2FX8H 2WJ5A 3QIBC 1BHGA 3VD4A 2HRPH 3JWNE 1F4XH 3FU3A 3MGTA 3QZOA 4CMHB 1CG9B 4OZGE 3W0WD 4JDVA 4MMZA 3QG6B 1EEYA 1NEZG 4WUKH 4PVMA 5DHDA 1R24A 4MQTB 1LWHA 2WLIA 3T0WA 1JYXA 1UT9A 1WZMA 3U7YL 2ROXA 1IEHA 4Y4FA 1HX0A 3SJVE 5KTEL 3ZQXA 1HDMA 3FU5A 1QSFA 5E4IA 1P0SE 3QCUH 3FQ1A 5E95B 1KIPB 2K7PA 3PJLA 4GAYA 3QJZA 5D71H 5CD3A 2ESVE 4J3OG 5E1HB 5F8QC 4HUCA 4RMWA 3OJDA 2E8ZA 4KUZH 1B0GA 3MRQB 4XMKH 2BOLA 1OSYA 2DQIL 4GLRI 2J73A 4K7PX 1IEAB 5JUEH 3MNDA 1KXQE 4IIZA 5A6MA 5LNGA 3ECUA 4HK0B 5ETUB 4C56A 1FHGA 3FQTB 1UOLA 5EPMB 1VDGA 5FK9A 5L4MA 3MCKA 2UYLB 1LO0L 2GT9B 4FS0A 4GBXB 3CG8A 1KC5H 1KTCA 3FO9A 5C0RH 5ID1A 3UC0L 3O3DA 4HKZB 5FK9B 2Y2TA 1X5LA 1EAOA 1YC8A 2LTQB 3IB4A 4NWUL 1FNHA 1YEDB 2VLLA 5E8PA 4NZTL 5E5UB 4GBXA 3T4YA 2B14A 4R9HA 2VXSH 1TZGH 4JR9H 4GJTB 2AJZA 3TO4B 1NFDF 1DZBA 4CA4A 1ORQA 4G7QB 3DO7A 1DQDL 3MR9A 3BOVA 3QCVL 5E6SB 4DTGH 3N50A 2VN7A 3CFMA 1ZHNB 2VH5H 3VFGL 3WAJA 2IC2A 5L2KB 1CE1H 1M05B 4NAQA 5HHNA 5ABDE 2OSYA 1F58H 1PZBA 1A3RH 4JFQB 4D9QE 4LLDA 3O4LD 1Q0YH 2NR6A 4HK3J 1YY8B 3UG3A 3O3AA 2VDQB 1MF2H 3QNYB 5AEAA 3D48R 1F18A 4CSPA 4FQXA 3WKMH 2IGFL 2WN3A 4IHOA 4DP8X 1Z66A 2X4QA 4CMMA 3K1DA 3VFNA 2YD2A 1OTSD 4Z76A 3MLUL 2OR9H 1E4XI 2X44D 4P0DA 3MV7E 1RUKH 4LIQH 4DSYA 3V7MA 3CLFH 5KVFE 2IFFH 3PQYA 2D7TH 5I19L 3MOAL 2P47B 2Y6SD 4GRWE 5IB3B 2AK1L 2MQ0A 4PQXA 1UH4A 2P8MA 3BXNB 1TLMA 2BY0A 2ERJC 4QO1A 1FHNA 2G0KA 4DZ8A 1D2OA 5CSZB 1UB5B 3S3DB 1QUPA 3GMMA 1A7QH 2PWFA 1NLDH 2QTEA 3DVGB 2P8MB 4OI9A 1AC0A 4L4VD 1AR1D 4R5VA 1BXAA 3TL5A 3WEOA 5TQ2H 2IGLA 1L5GA 1YEJL 4JO4H 1F3RB 1S7WB 2ZCLL 3C2AH 4HT1L 2LT9A 2CJTA 3J27A 1M7UA 3IGLA 1D6EA 4KDTC 1YMHA 3DHUA 1DBKH 5CBEA 3WFHB 4HBCH 2ZSWA 4YOKA 2YHGA 5DZLA 2AQQA 3GJFA 3VFUA 1TYJA 5L7XH 5CJ8A 1NCDL 2GW5A 4HZAA 3EHBC 3WDIA 1ZY9A 2KI6A 4PW3A 1YEDA 2VLLB 2D31B 2ZUXA 1JGVL 3KPQB 1RZFL 2WWMD 3LRGA 3W5NA 3T4YB 1XGPA 4JGUA 1MW1A 3FQ2A 5CO1A 1FZOB 4FZEL 3V5KA 1N10A 1NEPA 4F7PA 5A3IC 5KVGL 2PW2B 5F9AC 5D5ME 3P4LA 1H15B 2EEXA 4PVNA 2O6CA 1BQRA 1RHHA 2EKSB 5F3HB 5AB0A 3BPCB 2FIKB 4R7NA 4Z7WF 5B3SB 4HIXL 2JF1A 2P5WA 2LLNA 3C6LC 2VW4A 1CDIA 2R1XB 4KDWA 1GHFL 1UZ8B 3Q6FB 3OAYH 3PDDA 4OT1H 2ZOLB 3QZMA 4UM9D 5F9OH 3VI3E 4M3JA 5B8CB 1GZQA 2ICWI 3H3KA 3KJ6H 1ZOXA 2OMWA 5KBPA 1AIZA 1IJ9A 1E65A 4NP4L 5DRNA 3V0JA 4WV1C 4M00A 3WTSA 4UTBL 1HH6B 3MCLH 3GMRB 2GABA 5IBTH 3D0VA 1SBBA 4HOMA 5B8CA 4JFZH 1UH3A 3ARWA 2AEIT 4QUOA 5CFAA 1DBKL 2GC4C 3KYMB 2X4PA 3ZTJH 4S0HA 1NFKA 4TPRH 3MGOB 4U3HA 3LH8A 4V1DE 5TD4A 3T3MF 1TYEB 1SJEB 1KPRB 5M7QA 1FH5H 3MA7B 4LPYA 1RZQA 4MXVE 4KI1A 4KNSA 1HYRC 5EFIB 4BKSC 1Q0YL 1DJSA 4WFED 1M1XA 1G1OA 3W11C 4AQ1B 1QA9B 3CGTA 4ANUA 1G4MA 1J5CA 5C0CA 4IOSD 2KLSA 2IH1A 4JMNA 5D7SL 2QSTA 5T3XL 4YO0A 2P7TB 5D7LE 1Z5HA 4LGRB 2EUWA 1J05B 1M1XB 2O5NA 8FABB 3BVNA 4CILA 3D2TA 3EH4B 5E6RB 1AZUA 3G9VA 4R90L 4V1DD 2BWQA 1EO7A 4IK7A 4BCXA 4C47A 4HZ1A 3W9EA 2XWTB 2P5WE 4M4PA 4N0CC 5DFTA 5L0QC 2FDBP 1FLRL 4BZ2H 4F7EB 4V1DB 2APFA 3LB6C 4PJHA 2XWTA 1DQMH 3MBXL 4KXBA 1NCUA 1EFQA 1BWWA 2VXQH 4F7TB 2AERT 5E4EC 3QIUA 5CP3A 2AJVL 3KPQA 4Y4HB 4I0PD 4PRBA 4Q6IA 3E9UA 4OLYL 3KLHD 4PJ5B 4EIGB 2Z93B 4JLRA 2PTVA 3LZNA 4GXFA 4HCFA 4AE1A 4YHKH 5FM5M 4AZUA 3BZ4B 4OZGA 1A21A 1WSST 4OLWH 2G2PA 4FTVB 3F7LA 4WY7L 1A0QL 5TH2A 3TOPA 2EKJA 3ZLQC 2J6EH 2UUDH 2X3CA 3MV9D 4B96A 1A7NL 4MKTA 1NTDA 2P5WB 3L9BA 4H88H 3QWOB 2HVKB 4P5SA 4WU5B 3P2BA 4LVOC 3V0AC 1RQ5A 4JS7A 5TH2B 3TWCH 4QAWA 1U3HD 3QI9B 1J0JA 5DRNB 4NWUH 4XH2B 3MJ9L 4IOIA 1IGCH 1BZ7B 2C1PA 3PAVA 3UC0H 5AFAA 1KJ2L 5I1GL 1I3RB 4Y5VC 1IX2A 4KNQA 2K4WA 2JVUA 1XGRA 1WFTA 4XN4A 1B4RA 1EXHA 2BIMA 4WI0A 1FCCA 3HS0B 1I8LC 2Z4QA 3ZRSA 5K9OB 1FVEB 2WXNA 1LD9A 2R0ZH 2DQIH 4YHML 4NI3A 3MLRL 4OCMC 1NC2A 1F58L 2FH6A 3QNXA 3RFZA 1DBML 1F5WA 4RMVA 5D93B 1CE1L 2F74B 3PABB 4XHJC 5C0AE 2NY3C 2ZTBA 2DLFL 4JO1H 3HN8A 4O9HH 3LS4H 1XIWB 4Y2DC 3DOSB 1PLGL 2FUQA 3MUZ1 4JDTH 3ARBC 4ZMLA 4GKZA 1J05A 3ULAB 3IVKB 4ONFH 4C59B 1I9JH 2HLFD 2BNQB 4ZUVA 1OSPL 5HPOA 3I85A 4YZFF 1H9VA 3HE7B 2QDVA 4HJSA 3SO3C 1NDTA 1BF5A 1U8NB 2VDNB 4Z3HA 1TIUA 4A55A 1NUGA 3FTGB 1E8ZA 4WUKL 4XNDA 3U0WL 4U4BA 4Y8DC 4IRZH 5T1LD 1A7BA 3ZHDA 4HAGA 2EDEA 2KZBA 2Z91B 3WGVB 2IH8A 3D2UB 1G7IB 2EH8L 4ZFFA 1QLEH 4F2MA 2Y0SA 3NJNA 3HG4A 4JQIL 3H2WA 1TZHB 3NSDA 4ZNEE 5HYEA 4TTGA 4KKZA 2CSPA 2XPYA 2IH3A 4NRYB 3NQIA 2XFXA 4X6DE 2OXHA 4UQ3B 2UXFA 3A6CH 4LZKA 4XCYB 2XQBH 4FEIA 5IEHB 1FZJB 1AFVH 3VWJC 1ZLVK 4ODVL 3VSVA 3NEEA 3QIBA 3BZ4A 4NUJA 4NSKA 4GG6A 1TQTA 2WKOF 3OHXC 4X4MA 1XMWA 5T3ZL 5J6HB 3CFBB 1W91A 3LNFA 1PYWB 1U2CA 3D8MA 2FJSA 3FCBA 3W9DB 2OZ4H 4W68A 3PWJB 5GGRA 1N26A 1VFAA 1OPGL 5F9JB 3EFOA 3GMLB 3ZKNC 3KW7A 3WUWG 3D9AL 5IQ7H 3BAWA 4WV1A 3VXQB 2EXYC 1MIML 4LSRH 2FUTA 4FHJA 1K6QL 4QNPF 4OTXH 4TQPA 1KT2B 3T0AA 4JKPH 1I8IB 3QI9C 3HOGA 3BIBX 5EZOH 2EDKA 3PP3K 4X6CA 1MFCH 1XCTB 3BAEH 5ID0B 5JDSB 1BMWA 4PBDA 4X0NA 2Z35B 1N3NB 1SY6A 5JW4N 2NQDA 4PU2A 1ETZB 3KM2A 4RWHA 4B3VA 1U8LA 5I15L 1P2CB 1P53A 4Q2ZB 4XP4L 1NANH 2EABA 5HI5D 1XGUB 4EO5A 1BQHA 5KZCB 1WGOA 2FD6L 4K7PY 3ZTNL 1T2QH 1ETZA 1DVFD 3QDME 1OSZB 1HIML 4RMQA 1BVLB 1QBAA 2CBOA 3STBA 3OF6D 3HMXL 5I1LB 1AO7D 5D7JB 1PQZA 1YECL 2Q7YA 1A7PH 4KK9C 4PREB 3S4SB 2BNQA 2FD6H 5FYLH 4F2FA 4POZC 2RA1A 4L9LA 5DRZA 2D4DA 5AKRA 1KLUA 1L9OA 2YBRA 1WBZA 2YPVL 4ZFQA 2Z3FA 4PJDF 3D51A 1DEEA 2V9RA 1XBDA 5IG7B 4TSAL 4HIHA 5AL8A 5CLXA 3ZHFA 1FN4A 5IQ7L 1S78D 1EO8H 1M7IA 3SYQA 3S5LG 3MCYA 3O8XA 4HJEA 3C5ZD 3A5VA 4H2AA 2VAJA 4P9HL 3L95B 5FUCC 2Z6FA 2V5MA 2ZX7A 2AXGB 1PG7L 5E9AA 1E5AA 4MDIB 2IALA 4KO9A 3V10A 1XQ4A 4BUHA 2C3VA 3M7OA 5A2BA 1KB5A 2ZXWB 2DS4A 3CFQA 2Q7NA 5AB9A 4ZXBA 2DOCA 4XWOD 3N85L 1OGTA 1Q90A 4LCVA 1X7QB 4EOWL 4YL4A 4U3SA 3RUGB 4EI5D 4EPSA 4KUCD 3WUWA 3ZX1A 4PG2C 1RP9A 1EWHA 2AEQH 3WS6C 5LG6A 2RHEA 5IBUG 2EQDA 2WLNA 1XGTB 2CWRA 4IGBD 1JGUH 4IIQB 4JQIH 4AG4H 2CMRL 4MJ5A 1T0NB 1F02I 1J7VR 1QFWI 4JQVC 4ODUB 2DQDL 3OJVC 4P57A 1SVZA 3DV6B 4ZJ9A 2FWOA 5D8JL 2FNBA 5HDWA 1BPVA 3VSTA 3Q1SL 1INQB 2X05A 4KKAC 4YX2L 2F5AH 4D0CB 5DFWH 3LZQA 4PBVC 4Y9FA 5EU4B 1FORH 3B2XA 4AK1A 4BSWB 1AZVA 2GUYA 2ZSVA 3GS0A 4HAFA 4XR8C 1CTNA 5I71B 3Q1EA 4YHOH 3ELQA 2QKIC 3ILQD 5I76A 4JZOA 2QPDB 2P48B 3CHRA 4X7SL 3GKWH 1QHOA 1PLGH 3AG2B 3U4EA 2W0FB 2Y2YA 3WEBA 3D08A 4ATTA 3C5SB 1AYOA 4JMXA 3FH5A 4X4ZA 5D96B 2BMKB 5AW5B 1UM4H 4POUB 3V0EA 1XR8B 1OWRM 4ODXB 3CX5K 2VDLH 3TPKA 4ODBD 4WFHE 2YRPA 3PFUA 1OZTG 3ZYZA 4CSZA 3NZHL 3GMNA 4FXGB 3VXSD 4ANKA 4KKBD 4CVUA 1BW8A 2R59A 2QVMA 1UWYA 1N0XH 3BP4A 3IN0A 3SCMD 1WBZB 3VJ6B 5IQOA 1JWSA 2KHAA 4HZLB 1E5CA 4KKQA 2BVOB 3EH3B 3HNVL 3GM0A 4MB1A 3UBGA 1WHOA 4PJIE 2H45A 4UT7L 2R1WB 2C9RA 2HT4D 2IADB 5INDA 3WFCH 4ZMVA 4PUBL 1WHPA 4P4KD 5IJBC 3FRUA 3PL6C 4G8FB 2WP3O 2RFXB 1AQKL 4NRZB 2TSAA 3EJUA 2XTJD 4OZHE 1HU8A 2BHYA 2WYTA 1AZCA 4RAUA 3RDTA 5A3ID 3A23A 4BQ9A 5ITFA 1BSIA 4B27A 4LEOA 3UGEA 1X9RA 1M2OA 2OXGA 4H1LA 4XPGH 5FYLD 5F3BA 3LXUX 1AS7A 1XVSA 3UTSB 3LKQA 4JHAL 3QFJA 2VC2L 2CALA 1SEBA 2FO8A 2YRBA 4YIQA 4P23C 2AQ1A 5F0MB 2O61A 1IL1B 5BS0A 3IKCA 3UTPD 4BK5A 2XWEA 5IMOA 5C6PB 1EZUA 1P5UA 4WWPA 1RURL 1WD8A 5AOZA 2N3JA 5DD5H 4MMYB 1U92B 2VXQL 4DAGL 5FO7B 4NGHH 5D7KE 4UNIA 4Z3FA 3SE6A 4U1SB 1U93B 4RMBA 3WL9A 1GMIA 1UM6H 4JPVL 2Z31A 1QO3A 3VRLF 4Q9RH 3CZEA 3V4UH 1ZCRA 3WIAA 1T22B 4LLUA 4ODTH 3HC0B 2K7QA 5KS9F 5IQMA 3EYQD 4JM2D 5CSBA 2X12A 3MXWL 1OPGH 1AZNA 4L1DA 4MJJA 3UBHA 1S5IL 1GOFA 2JQMA 1C1EH 5DK2B 4KITB 2ZKMX 2BH0A 2C3HA 4XP5L 5L9DL 3ZDYE 2UWEA 1SLXA 3F65A 4WNJA 5GPRA 3GMOA 2NXYD 1JXDA 1FFTB 3P69A 5DEGB 2NTFA 2CM5A 2NQCA 5INCA 4O5LH 4RBPK 2I85A 1LP9E 3NCBB 5E51A 2OX5B 4QT5B 3CBRA 2IFGA 3T3MB 2CH8A 4AIXA 2B16A 1I7ZB 2HUHA 4HPOL 1EFXB 3VI4B 5E94B 1ED3A 4HF5L 4MAYA 3RB7A 4RGNC 3GF8A 1VADA 4AYSA 3GXPA 2CJ3A 3NT0A 4OM0H 2DMHA 4YBHA 3SDYL 4UOZA 3T2OA 3O6LH 2AZAA 3H9YA 2W8CA 4JFXB 4YFDB 2AXJA 5CIPH 4U33A 5SWQA 1F8TL 4B50A 5HJBA 4YXLH 3GFUA 3EGDA 3S5ZA 4XPAH 1JK9B 1YEKH 2A99A 5AYUL 5F89B 2DY2A 2ZT9C 3IU3A 4XBPA 4ZNCD 3ZL1A 4HALA 5J11C 2BP8B 1YN6B 4WKZB