4Y52J

Crystal structure of 5-carboxycytosine recognition by rna polymerase ii during transcription elongation.
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Molecular basis for 5-carboxycytosine recognition by RNA polymerase II elongation complex.
pubmed doi rcsb
molecule tags Transcription/dna/rna
total genus 16
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2015-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4y52J00
3H3VK 4HNVA 2AHQA 2W48A 5J3LA 3HOXJ 3RZDJ 2DA5A 2COBA 2E1OA 3GBGA 3OOUA 2CQQA 1BA5A 2JA8J 5M5WJ 3BG5A 5JLXA 1Y1WJ 2P81A 4L5EA 5HODA 4NDLA 2YUSA 1JUMA 5EDNA 3E7LA 3OSGA 1NK3P 2GLOA 2EH3A 1Z77A 2M9HA 2XPUA 4FISA 3IH3A 1BW5A 2DA2A 1VI0A 5DTDA 5M5YJ 2ECCA 1UMQA 2MSYA 5FKNA 1MNMC 2DMUA 1ETQA 1ORKA 3DEWA 1Q1VA 5FKMA 2JJ7A 2CUEA 1QVTA 1ETWA 1X58A 1H89C 1NK2P 5EF6A 2FD5A 4FCYA 1PUFB 3FK6A 1R9TJ 1K83J 1ZK8A 3O8GA 3DCFA 3ZQHA 4S0HB 5J1RA 3QPLA 2R92J 2H8RA 2LVSA 1MBHA 2VKEA 2DA1A 3JREA 2L7MP 5K7HA 1VF9A 3HOYJ 2EZLA 1F36A 3LSJA 5FLMJ 4B1RA 1FIAA 1IJWC 4X6AJ 2L7FP 3G1OA 2Y2ZA 3W6VA 2NOGA 5IYDJ 1U9NA 1FEXA 1JKRC 2LTPA 3LNQA 2B63J 1RKTA 1EF4A 3TP0A 3G1LA 2XB5A 4BBRJ 2O8KA 2I10A 2VUMJ 1ZQ3P 2XGDA 3BR3A 2ME6A 1HLVA 3PM1A 3TEDA 4AC0A 2M2EA 1Y1VJ 2HI3A 5FJ8J 5FKKA 1ETKA 4A3FJ 2O9LA 1T56A 4FE7A 1DU6A 1BW6A 1VFCA 1Z0XA 5M3FJ 3CDLA 1DU0A 5F08A 3BR2A 1MSFC 3CCYA 5F0CA 2XPVA 4M3FA 5J1YA 4A3JJ 2CUFA 5F0HA 5FKOA 2NVQJ 3MVPA 2FQ4A 2EBIA 3HOVJ 2XSDC 3QQAA 4A3MJ 5EYRA 3JRHA 5IOZA 1TWHJ 3JRAA 4BY7J 2AO9A 4B4CA 4J19A 2XGCA 2E2HJ 5IOYA 4IHWA 4Y7NJ 1JTYA 2Y0SN 3ZQGA 5E3OA 1H8AC 1S7EA 1JKQC 2LLKA 3SFIA 4GFBA 1ZR4A 3GTGJ 3PO3J 1FIPA 4XRMA 2L7ZA 4BBSJ 2K40A 2JWTA 4A3LJ 2KT0A 1W0UA 3BTJA 3S14J 2JMWA 4M3EA 3JRCA 4W1UA 5IYBJ 4A69C 3QPSA 4FTHA 1PUFA 1QPIA 3GTMJ 2VKVA 5BNGA 1MH4A 3NARA 2L0KA 2K9SA 3CMYA 5FKLA 1E3OC 2HDDA 3RKQA 3VPRA 3WHBA 2N8GA 1VNDA 4MFEA 3IV5A 1MBGA 1WH5A 4C2MJ 3D1NI 2HYJA 3TP3A 5IP7J 2FX0A 2WB1N 1ZR2A 2TCTA 5IPAA 4A3EJ 1RESA 2IAIA 3HGYA 4X1EA 1B8IA 1WH7A 2M34A 4AYBN 3RZOJ 2LR8A 3FIWA 2EZIA 2Y9YA 3BR6A 1MBFA 3JRDA 1HOMA 1MBJA 5C3EJ 4A3GJ 2WV1A 2Y31A 4D7NA 2GBYA 1GVDA 1MH3A 2IBDA 4B3AA 4CYCB 2DA3A 2JA5J 5F0FA 1U8BA 2O7OA 3LOCA 1POGA 3WHCA 2NVYJ 3Q0UA 1P7JA 2LP0A 3TW6A 3C2BA 1H88C 1T33A 4D5CA 3CQZJ 1JT0A 1AKHB 4MFDA 2RAEA 4UUSB 1D5YA 4G12A 3BQZA 4A3KJ 1WGXA 1P7IA 3GTJJ 2HOAA 2DA6A 2CJJA 2FJ1A 3S1NJ 2LK2A 5EZGA 3HDDA 2NS7A 3ZQCA 1XS9A 5K7FA 2MG4A 3JRIA 1BL0A 3GTPJ 3MN2A 2D5VA 1JUPA 5EG0B 2NVTJ 1B8IB 1GUUA 4XIDA 1IDZA 4A3CJ 2X9DA 2DMPA 3S15J 2R0QC 2ID3A 4D5FA 3IH2A 2XPWA 3S2DJ 4DZJA 1MBEA 4MIMA 5M3MJ 1B72A 1TWGJ 2LD5A 2K9QA 1HCRA 5J1UA 2CRGA 5EZHA 4M6VA 2DN0A 2JA7J 4UUTA 3HOUJ 1WI3A 3M3YJ 3S1MJ 4Y52J 4QSHA 3BTIA 1IC8A 1X2MA 2IEKA 4JP0A 5F27A 4DYCA 1XG1A 4ABZA 1YRNB 2HOTA 4XK4A 2JA6J 2M8GX 1TC3C 1GV2A 1XC5A 4D7MA 1ETVA 4QIWN 2QCOA 1OCTC 3S17J 4I6ZA 4IHVA 4CYCA 1AHDP 2TRTA 1JGGA 3B6AA 4XICA 2ELKA 1ETYA 2HOSA 1U9OA 3A02A 1ZGWA 4A3BJ 2CU7A 1RPWA 1B72B 1FTZA 3S1QJ 2E19A 1APLC 1AKHA 3UKGA 4UUSA 1HF0A 3BTCA 4MO7A 2ECBA 2R5ZA 2WAQN 1TWAJ 5IYCJ 1JUSA 1MBKA 1JKPC 3BTLA 1QRYA 4JX6A 3BR5A 1IG7A 3ZQLA 5DS9A 2X6OA 3NAUA 1RR7A 5IP6A 4A3IJ 2R93J 4W97A 3JR9A 1G2HA 2ZB9A 1A6IA 1LE8B 3OIOA 1U78A 3Q0WA 5EG0A 3L1PA 1JKOC 4A3DJ 3S2HJ 2LFBA 4JX4A 3FISA 2R5YB 1ZTRA 3SJMA 2JK3A 2JN6A 3ZQIA 2E2JJ 5E3LA 1GV5A 3F0CA 4IHXA 4DZPA 4RBOA 2HQ5A 3FK7A 1K61A 1ETOA 3BG3A 2ME0A 1ITYA 2EZKA 4M3DA 2M0CA 1BJZA 2DTZA 2DMQA 2Y9ZA 1OFCX 1HDPA 2DA4A 3RQIA 4DW6A 4LOCA 5EGOB 3HKZN 2R5ZB 2MGQA 3BT9A 4XRSA 5C4JJ 1JTXA 1I3QJ 1FJLA 5M5XJ 4A93J 2XRLA 2Y30A 5GP9A 2EZHA 3HOZJ 2DMTA 1W0TA 2YS9A 1OJLA 1YRNA 4C3HJ 1SFOJ 3GTQJ 1I6HJ 2VI6A 5GPAA 4M3BA 5C4XJ 4JX5A 1JT6A 2GM4A 1AU7A 3BR0A 1FTTA 1QVUA 2NVXJ 4I76A 2EQRA 1JJ8C 3A03A 1GT0C 2E2IJ 2XB0X 1WPKA 5C44J 1CQTA 3M4OJ 1WCMJ 1IGNA 2K9NA 2XGEA 5GPCA 3OSFA 1LFUP 4M3GA 1MSEC 5FLVA 3ZOBA 3S16J 2L9RA 3FKIJ 4FE4A 1TWCJ 2LY9A 1I50J 3K7AJ 3A01A 3JRGA 2VPRA 3HOWJ 2HXIA 5F1JA 3LSPA 3B6CA 2CQXA 2H1KA 2NS8A 3HGGA 1RKWA 1GDTA 4V2GA 1IRZA 2LKXA 3ZQFA 2G0EA 3Q3SA 5E3MA 3I4NJ 2HXOA 3G1MA 1LE8A 4IEJA 2ID6A 4C3IJ 2PMZN 4C3JJ 3PO2J 3JRBA 3HEFA 3K2AA 4EEFG 3JRFA 2R5YA 4XRSG 1X2NA 3IH4A 3I4MJ 1ETXA 1NTCA 1IDYA 2YU9J 2R7ZJ 1JJ6C 4JYKA 3BR1A 1IUFA 1SANA 3HM5A 4RDUA 1LFBA 2OPTA 2MW8A 4BXXJ 1TWFJ 3SDGA 3O8HA 1OCPA 3Q0VA 5E3NA 2OF7A 2DMNA 4V2FA 9ANTA 3GTOJ 3A01B 3MKLA 5EGOA 1A5JA 5JLWA 1UHSA 3HBLA 3LSRA 2DJNA 5EEAA 4DYQA 1ZKGA 2KDZA 4IHYA 3BQYA 3GTKJ 1ENHA 2X48A 4BY1J 1RETA 2DA7A 2QF7A 3BG9A 5IP9J 1O4XA 3TW7A 3H0GJ 4BKXA 3S1RJ 4MLOA 1F43A 1HDDC 3HB9A 3LSGA 1IV6A 3GTLJ 5F04A 1UG2A 4DYRA 5K7ZA 4AUXA 4QTRA
chains in the Genus database with same CATH superfamily
3H3VK 1GXPA 4G7ZF 5DD4A 1QZZA 2ZJRF 4A5NA 2DBBA 2FNPA 3WTZA 1DGRM 4OWRB 2VJ4A 3HOXJ 3RZDJ 2DA5A 4XLPF 4RS8A 3GW2A 3CCEI 2OBPA 3GBGA 4JK1X 3OOUA 4RGXA 4E7HA 1FOXA 2O0YA 1FOKA 4HG2A 3K4JA 3T0YA 1WZ2A 4LG3A 5M5WJ 5JLXA 1Y1WJ 5HODA 3TO7A 3EPZA 1U5TB 2UXXA 2HKOA 3RI4A 1JUMA 2LKPA 2OAZA 3GFMA 1B1BA 3ZMDA 4B3XA 5H20A 3OSGA 1K79A 2FF4A 3DBRB 2XPUA 5CQGA 4L9TA 2DFIA 2L7KA 1IN7A 3IAM2 4IVNA 4H4KC 5AIPA 3OYNA 2ECCA 1GVJA 4XLFA 4RAYA 2DMUA 3M8JA 2RN7A 2B7EA 1ETQA 1ORKA 5GAEJ 5JR3A 5KHDA 2WTEA 1KQ9A 5CVVA 1Q1VA 3KYCB 2VN2A 2H6BA 3C2HA 2VB6A 3BJOA 3I56I 1X58A 3BG7A 5EF6A 5BPDA 1PUFB 4HZFA 2E34A 2GXAA 2VBZA 1K83J 1ZK8A 4WXCA 3ZN0A 2PJPA 2VJ5A 4Y13A 2Y0SA 4CGZA 2QQ9A 4NC8A 1MBHA 2RQPA 3TO6A 3J7AY 2DA1A 1YFHA 5IT9K 2K9MA 2KHMA 2EJRA 1KU2A 2QUFA 1VF9A 5BOXA 4EM1A 3EUAA 3HOYJ 3ESWB 2V1XA 2L7FP 3EQLF 3J81Z 3T5XA 2Y2ZA 4CCOA 1YE9A 2HQAA 1TT5B 3HTUA 3G73A 2VXDA 3EUHC 2M4GA 3HRMA 2X1EA 2LTPA 2MFZA 3LNQA 3RYPA 1RKTA 3TP0A 1FT9A 3WGIA 2XB5A 1ZQ3P 2XGDA 2ME6A 3KYLA 2KDOA 3PM1A 4M9ZA 4WXHA 3ABMH 2M2EA 1IN6A 5FJ8J 1X1AA 5FRNA 4XMYA 3NQOA 2BV6A 4YELA 1D8KA 1VQ7I 1KONA 3IWZA 4DOZA 1DU6A 4WWCA 2OC6A 4CYDA 4HX7A 2IRFG 1JE8A 5D4SA 4XSZF 3BR2A 1MSFC 3CCYA 3LSHA 4A0XA 1UG0A 2PN6A 2IXSA 4A3JJ 5F0HA 5JVGF 3CO6C 2FQ4A 4IF4A 2XSDC 1OCCH 5EYRA 3N05A 1VQMI 4CHUA 4ESFA 3P9KA 2XDVA 4J19A 1LNWA 1N78A 5HNFA 3VWBA 4IHWA 4PUSA 2HDWA 2XAGA 3CP8A 4F92B 2GWRA 3MKZA 2V9PA 1YI2I 1FZPB 1ODDA 1QHGA 1IW7F 1O7LA 4P96A 3V8KA 4GFBA 3V8JA 1ZR4A 3OYEA 3TDUC 1P4WA 4BS9A 2OZ6A 4ZDPA 3LQQA 4BBSJ 3B02A 3BC8A 2K40A 1WFXA 2KT0A 1W0UA 4LK1F 3S14J 3KP4A 1BN5A 2EPFA 2IS4A 2JSPA 3GEZA 5IYBJ 3QPSA 4IHSA 2ELHA 3GO5A 3AL0B 1KA8A 3TO9A 4G7HF 1YIOA 1YO5C 5FKLA 3FXKA 2HDDA 5E1ZB 1VNDA 4KUMA 3UNGC 1MBGA 3H36A 1PUEE 4LD5A 1MW7A 4N9HA 4X1EA 1XB4A 1B8IA 1Z3XA 2E36A 4AYBN 3BPXA 1HOMA 3WGGA 4A3GJ 1D1BA 2Y31A 5L3BA 5JI6A 3U2RA 4RB2C 3OYGA 3GWZA 5DUIA 1KQ8A 3I3LA 2Z9OA 2IPQX 1U8BA 3WHCA 1HA8A 1FYLA 2DOFA 2F4MB 1UHMA 3Q0UA 1D5VA 1P7JA 2JRTA 3FXQA 2LP0A 1YJ9I 3CCRI 1H88C 3A2KA 1MMSA 4D5CA 3DFGA 3SXYA 3E6CC 1JT0A 4MFDA 1D5YA 2G7HA 5BPIA 5B1AH 1P7IA 2KFDA 2XF6A 3VB2A 1E3PA 4IOCF 2UV1A 5D6EA 1FBSA 2NS7A 4IXAA 3RIRA 3BG6A 3ZQCA 4Y17A 1XS9A 4BHPA 4XKVA 2IGKA 4RGUA 1U8RA 2RDPA 2NVTJ 1B8IB 2DOAA 2VT2A 3TQNA 3OV8A 3CUQA 1WJDA 4G6DA 3TL4X 2QLZA 3S15J 2W7NA 2R0QC 3ELKA 1U5TC 2XPWA 1FC3A 4DZJA 5BS6A 1TWGJ 2GA1A 1BR1A 4MQVA 2OUMA 3CO7C 2ZSHB 1FBUA 5EZHA 2DN0A 2UZKA 1T0FC 4ON0A 3HOUJ 4JQFA 2K7LA 3OIPA 2BZTA 2JA2A 2HYFA 3SYTA 2D2WA 1ZG1A 2EK5A 2K27A 1IC8A 1P6RA 1W5TA 2ZJPF 2A07F 2IEKA 5F27A 2LDUA 2TDXA 4XK4A 3JCUC 3OYJA 2JA6J 1PJRA 2CFOA 4DBQA 4XN3A 2GQQA 2M8GX 3BDDA 3TOAA 3DTKA 1K78B 1QO0D 2IA2A 4Y4RA 4BNCA 1O57A 3CCVI 1U3EM 1EV7A 3CMAI 1WJBA 1WJ5A 2WA0A 1SFKA 2OD5A 3F8NA 5LFAA 1OCTC 3S17J 3K4CA 3KP3A 4O5VA 2R7VA 2CSOA 4G94A 4I98B 4OIOF 3CLOA 4I02A 2BGCA 3PL8A 3RYRA 2A6TA 2DW4A 2YSRA 5JVTA 2NRAC 2A61A 2ECBA 2ESNA 3HXLA 2WAQN 5IYCJ 3E97A 1VQNI 4J00A 3MMYB 5ILUA 4AIDA 4S05A 5FB2A 2NNYA 2Z2SB 5K5RA 1O3TA 4PK4A 2F5DA 5DUKA 5DS9A 2FMYA 4FHTA 2V1NA 1A6IA 2ZB9A 4CZZA 2RNJA 2X1DA 3TGNA 1U78A 4CH7A 2IP2A 1OYYA 3L1PA 2FE3A 4NC7A 4HA8A 4GDFA 4JX4A 1XN7A 3HPGA 3GUDA 1ZTRA 3SJMA 4TV7A 5DCMA 2OCCH 1X3ZB 4DZPA 5D5UB 4HF1A 3PSFA 3LQRA 3Q9VA 3FKJA 5D6FA 3ZQQA 4PCQA 3RKWA 3M1CA 2KQRA 1TNTA 2KISA 1K61A 3W6JB 1XMKA 2FEZA 4KISA 4M3DA 2M0CA 1BJZA 2CUZA 1T39A 4UV8A 5ICFA 2STWA 4GYGA 5CYVA 2DA4A 3IWFA 4LOCA 5EGOB 2QQBA 3WU1B 2FUG2 2X6YA 4XLCA 4A93J 4EJTA 1XDSA 2XRLA 2QWWA 1YTYA 3HOZJ 4YFKF 2A3SA 3CJQB 3M07A 3MZYA 3WE2A 3AL0C 1QGPA 4UVBA 5GPAA 2BW3A 2H8WA 3ABLH 4HEA2 5DCMB 3SDBA 1CQTA 2M8EA 4MQ9F 1H0MA 1VZ0A 1TP4A 2AS5F 1IGNA 2XGEA 1Y0UA 4I09A 5DM7F 3L2RA 1W7PA 4YIIA 3ABUA 3S16J 1LDKB 2R7DA 1TWCJ 2FBKA 3I54A 1I50J 4KDPA 3K7AJ 2AXLA 3K4NA 4RGSA 3OYKA 4EJUA 3H9QA 2VPRA 3OOPA 5LD2C 1J9IA 3CDHA 3H3UA 2ZNZA 3OYHA 2RGVA 1FOYA 3GF2A 4MEYF 1KYWA 4PGHA 5CLSA 4XLAA 3ZMZA 3HGGA 2O3FA 4MHGA 1BIBA 1FSHA 3OYLA 2CW0F 3KP7A 3KZZA 4HW0A 1IRZA 3CUOA 3KEYA 2OQRA 2RKHA 4C9YA 4HRIA 3T8RA 3QWLA 1REPC 3H5NA 5L3CA 2E1CA 3PO2J 3JRBA 1V4RA 3HEFA 3K2AA 3LA7A 1YW7A 3DKYA 2PJRB 3R6SA 2R4GA 1R1UA 3DPUA 5FO5A 2XF7A 4K2EA 2YU9J 3QYBA 4KT6A 1IN4A 3PIPF 3ASOH 3BR1A 3IP4B 1ERDA 3HM5A 2L9SA 1TZLA 4PFOA 5H6RA 3W3CA 1ZRCA 2IA0A 4LJZF 4HNTA 3MKYB 3SDGA 1Q1HA 2LF8A 4BE2A 5E3NA 1XMAA 2R7OA 1OR7C 2R7SA 1W7PB 3D0SA 3EUHA 1HQCA 2IW5A 4A2UA 1MNDA 3WG7H 1SFUA 3K70C 2IT0A 1HW1A 1WI9A 4A5MA 1USSA 1UHSA 3LSRA 3GMEA 4Y15A 2HVQA 1YS7A 1ZKGA 2KDZA 4IZZA 4IHYA 3QU6A 2X48A 4BY1J 1RETA 1WJFA 2DA7A 4M9SA 4Q47A 5B66C 1N77A 3FBIB 4YIFA 4ZDOA 1XTAA 2FNAA 1XMXA 2E5ZA 2EFPA 1YOVB 4OIRF 2LY2A 1F43A 4HSTA 3J7AO 4HYEA 2KMUA 2PFBA 1BI3A 1PYVA 2VXZA 4G6QA 5KAFC 2DK5A 5K7ZA 3B73A 1BBYA 2J5PA 1LB2A 4B47A 4HNVA 4QPOA 3MKWB 4KMUX 1XPXA 4I2OA 3GFLA 2W48A 2O03A 1OKRA 1HBXG 3V4GA 4BJ6C 3DV8A 3DEUA 4ZZLA 2LMDA 2COBA 1G6NA 3QODA 4R8HA 5K5OA 3LA3A 4E4HA 2MH9A 1R7JA 1R6RA 2DO7A 5FRMA 4BXFA 3BG5A 3L2QA 4HDVA 2W57A 2ZFWA 3F72A 2VT3A 2L9VA 2X85A 3R0JA 4NDLA 4EATA 3ABTA 2YUSA 3L7WA 4ZJZA 2D45A 2G9WA 4L18B 2O5RA 3E7LA 2EH3A 5IY5H 3IRRA 1X3WB 5D5WB 3ERED 1E17A 1TW3A 2LY1A 2KJBA 5DTDA 1UMQA 1MNMC 3PUFA 2OTLI 3ISPA 3DEWA 5HOOA 5FKMA 3RKYA 2CUEA 1QVTA 3EYYA 4QPQA 5FROA 4RAFA 3SHFA 4Y33A 4FCYA 1V5EA 2OU2A 2V26A 3FK6A 1R9TJ 1PDNC 4LFUA 4FX0A 3ZQHA 4IQJA 5J1RA 1U6GA 2EV0A 1TBXA 2LVSA 2YPRA 3CZ6A 4D1QA 5J4YA 2P0WA 3DLLF 1IXRC 5K7HA 2R7RA 1O3QA 3QYFA 1F36A 1YW8A 4B1RA 2XV4S 2QBYA 2NOGA 3FHNA 1NH3A 5KCMA 2EIKH 1FEXA 1S9HA 2VQCA 3I71A 3I64A 1HW5A 3HL2A 3BZCA 3F8MA 5CVIA 1AWCA 1EF4A 3N97A 3G1LA 3A1YA 1FSEA 2GA2A 2I10A 3JSPA 3FXUA 4Q48A 2VUMJ 1XGSA 1RIOH 5FKKA 4P9FA 4CXFA 3TDZC 3DQVC 2UXNA 2LBFA 2P7CB 3WGHA 1ZARA 2ZFUA 1RR8C 4FE7A 3OS0A 1BW6A 1VFCA 3V7CA 2LREA 2OTJI 4AYBA 2L9NA 3GXOA 4PJMA 3K70D 1HC8A 1S6LA 1DP3A 3FX3A 4ESJA 1I27A 3J81K 3K4KA 1NG6A 5J1YA 1QA6A 2CUFA 2BHYA 3E5UA 5FKOA 1R71A 2NVQJ 3HTSB 3MVPA 2KRHA 3DPTA 4BAYA 2JVHA 2MC3A 3JRHA 4XBFA 5IOZA 3F8BA 5CJ9A 5HLTA 1TWHJ 3OWTA 3JRAA 4BY7J 1FMWA 2AO9A 1U5TA 1Z6TA 2XGCA 2E2HJ 1MGTA 5IOYA 2HR3A 1GXQA 4YIRX 4EV0A 5HS7A 2JTVA 1N75A 1XCBA 2QBYB 2V4JC 2BVLA 3ZQGA 3CC2I 2J5OA 1SAXA 1H8AC 1S7EA 1MMNA 1O7FA 2DFHA 2ZNYA 3E1SA 2LKSA 1IRGA 4HLXA 1STZA 4P55A 1MIJA 2DJIA 2Z33A 1FIPA 4NHJA 2JWTA 1RRJA 4B44A 2NXNB 4II3A 2F5CA 4ZDLA 3WU0A 2JMWA 3CJTB 4M3EA 4KFCA 1WJAA 3CCJI 4JOMA 1PUFA 3GTMJ 2QM3A 1Z21A 1BI2A 2HS5A 3E6BA 4OAYA 2L0KA 2XROA 3CMYA 4MEXF 2I8DA 3FXOA 1E3OC 1KU9A 3RKQA 3VPRA 1TL8A 3PFIA 4MFEA 1YX3A 3E3VA 3GZ5A 1WKMA 5IT3A 1YX5A 2DDBA 3PQKA 2FX0A 2LRDA 1X19A 3G6EI 2BXZA 3FHZA 2VJJA 2FSWA 4Q4ZF 2BY0A 2JPBA 2QGUA 2KL4A 4AIKA 2P6SA 3HOSA 1V55H 2KIQA 2LR8A 3RZOJ 2Y9YA 1G3WA 3JRDA 2CGPA 2BY2A 2XGXA 2W1OA 2BY3A 3C1DA 3BZ6A 5J8CA 4CYCB 2JA5J 2P8TA 3SZTA 4ETSA 3TOBA 3VYUB 3K1MA 1POGA 1W36C 2HQNA 3EYIA 1DQUA 3O6BB 3C2BA 2DFFA 3BROA 3IL2A 1EKEA 2OV7A 2RAEA 3HC7A 3BQZA 3I58A 4EJOA 3GTJJ 2CYYA 3FMSA 1J5YA 2B9SA 5ERIA 4KICA 2FJ1A 1S3JA 1F5TA 4YG2F 4DJAA 3HDDA 4N9IA 2CV0A 3E0JB 3WTTC 3JAMZ 4IHTA 4E6KG 2EFOA 5DCFA 1WQ2A 3D5SC 4LG0A 5K7FA 3CCQI 2MG4A 3DBHB 1DUXC 1LKXA 2LYCA 3M9AA 2X51A 2DQLA 2M1BA 1GUUA 2QVOA 3CJRB 4UY8I 2ESHA 3K0LA 2LG4A 2KIFA 4MNUA 3IRQA 3LSIA 4A3CJ 1ON2A 2DMPA 5B3SH 2L4AA 2X0LA 2OJED 4GO1A 5JHUA 3KCCA 3IH2A 3VSKA 4ZYAA 1MBEA 4BQOA 1B72A 2AQEA 3NEUA 2K9QA 2ZXHA 2M7AA 5J40A 5K1YA 1K4TA 1HCRA 4BQQA 2JA7J 2WB1A 1A6QA 4E7JA 2JVGA 1SD4A 2P5KA 3KZYA 3GFIA 5DM6F 1L3LA 3WU2C 1FWZA 2LNBA 3MCZA 4F91B 1LJ9A 2VJIA 3VYRB 4ESBA 1RUOA 1VQLI 2LF7A 3V8LA 4ABZA 4HV5A 3I53A 3DBLB 5LHIA 4LG0B 1YS6A 1TC3C 1YJNI 3DXJF 1VQ6I 2NAZA 4BEHB 4J01A 1V54H 3FXJA 1GV2A 1FYKA 1XX5A 2WBMA 4I6ZA 4IOAF 2UUZA 1JGGA 3B6AA 1J2XA 1Z6RA 4Z6YA 2DXIA 4ZYDA 1J7KA 1XGNA 4BHBA 4EM0B 3FXMA 4OIQF 2CU7A 1RPWA 1B72B 2A69F 3J7YJ 2CQKA 3ZMTA 2ICWG 1IN5A 3S8PA 3U1DA 1TWAJ 3PNVA 4KIGA 1JKPC 4DGWB 2XAUA 3JSOA 3CMEI 1IF1A 2KLOA 2HDCA 1Y39A 3OYIA 3ZQLA 5TRDA 3S32A 4UB8C 2QSHX 2R7TA 1W7PD 1IAWA 2VL8A 3NAUA 1ULYA 3CJNA 4XLNF 1G2HA 4A6EA 1ZRFA 1LE8B 2Q2EB 3Q0WA 3BJ6A 3R0AA 1RZ4A 2DOEA 2LFBA 1AOYA 2K3PA 1W36D 2R5YB 4U87A 3WTWC 2JN6A 3VSLA 1OR7A 2E2JJ 1R5HA 5E3LA 4LB5A 2QSGX 2VKHA 1T08B 1S72I 2HVSA 3REOA 4KMFA 4RBOA 3FK7A 2E1MB 4RLQA 3KPHA 3F6VA 1UAAA 4D9JA 2XAHA 2HQRA 5FLXK 2ME0A 3SFZA 2EZKA 1YIJI 1R23A 1ITYA 1SD6A 5CVJA 1R5ID 2FU4A 4B09A 2HEOA 3QPHA 3LAPA 3DF8A 2MYSA 1BOBA 2EV5A 3WE3A 1JTXA 1I3QJ 1FJLA 2Y30A 2JRMA 3KP6A 4N4OB 3F9KA 3I9V2 4NB5A 3VYTB 4ENKA 2W82A 1F1ZA 1SFOJ 1H9TA 3GTQJ 2VQGA 3QU3A 1YYVA 1T38A 2GXBA 2W4SA 1K78A 2EV6A 1AU7A 1FTTA 3ML6A 1QVUA 1LVKA 1ZLJA 3D5RC 2EQRA 4I76A 4M9XA 1GT0C 2XB0X 4XR6A 2DAOA 4FASD 2CH0A 3H5RA 4KITB 3ZRGA 4AVZA 1ZG3A 3ROUA 1WCMJ 1WVRA 2E7WA 3FZVA 1LFUP 2A5WA 4M3GA 2FA5A 5CQEA 1TT0A 2XUBA 3PIOF 3FKIJ 1OLTA 1SEUA 4XQFA 4I99C 4PSWA 1B9NA 1GLNA 1VQ5I 3HOWJ 2HXIA 5F1JA 2L4MA 5DDGA 1OCZH 2CQXA 2H1KA 1OQYA 2NS8A 1ZRDA 4L5IA 2P7VB 2M7BA 3I59B 3PFYA 3U9GA 2XASA 1LQ1A 1R00A 1D0XA 3HUGB 1G4DA 2K4JA 1D8JA 2CG4A 2OCEA 2ID6A 1Y6IA 3M7GA 4C3IJ 2PMZN 4C3JJ 5JHFA 2HOEA 1X2NA 2V1DA 3IH4A 2PMUA 4QLCU 4U0WA 3I4MJ 1ETXA 1XSXA 4WCGA 4R79A 1IUFA 4HX4A 1P92A 4IRGA 5E1XA 3TKYA 3HKZA 2XVCA 3LFUA 2MW8A 1Y8RB 5E1WA 1TWFJ 5ICCA 1RC9A 2IS2A 3Q0VA 2M0MA 2A6EF 2DMNA 1L0OC 3IKVA 4LIUA 5BQTA 2ZO4A 3GTOJ 3V7RA 5FGMA 5EGOA 2R3SA 5ED4A 4AIJA 5JLWA 3HBLA 3JTGA 4ZZDA 5FD6A 2O61A 4PJ0C 1MKMA 2E60A 2FRHA 3SEZA 4HOBA 1LFPA 3S2WA 1R4MB 5CKTA 1FPQA 1ENHA 1QU3A 5J47A 2G7UA 3CCUI 3BG9A 4DIQA 5IP9J 5LEKA 3AG1H 1P4XA 2IGNA 4BKXA 1MDMB 3S1RJ 4MLOA 2K3FA 1PP8F 3HB9A 3LSGA 2EIJH 2JQ7A 5LGNA 4NUBA 5HLHA 4OAZA 4DYRA 2L02A 1QZEA 3H9GA 5E8GA 3A0BC 2CW7A 4M73A 5EEHA 5J3LA 5LRRA 5FFZA 5L3EA 1YLFA 2V6CA 2RC4A 3E5XA 2E1OA 3ZMSA 5EJCA 5ICGA 2CQQA 2F4OB 1X4PA 4CA0A 2XAJA 1TW2A 1BA5A 2GZWA 4BUPA 2JA8J 2P81A 4L5EA 3K6GA 2Q8KA 1Z05A 4BU2A 2HVRA 1ZHFA 2GIZA 5CVUA 4YFNF 1NK3P 1I39A 4FISA 2Q1ZB 2W85A 3IH3A 2EILH 2XKOA 1BW5A 2DA2A 2EFQA 1VI0A 2DLLA 5M5YJ 3DWLE 2MSYA 4BQNA 2ZMEB 2E35A 5A2QZ 4BL0B 4PJLA 2PJRA 2JJ7A 3E5QA 3RSNA 4DBRA 1T8IA 4BE0A 1ZLKA 1ETWA 1YW9A 4M6XA 3Q5FA 4ITVA 2VIXA 1NK2P 1Z9CA 3KYDB 2DQRA 1D1AA 1G3SA 3VFZA 1SD7A 2VE8A 3DCFA 2A5YB 4HX8A 4BJ5C 6PAXA 2IS1A 2WV0A 3QPLA 4S04A 4PGGA 4HPQA 3GLXA 1VQPI 3ZXSA 1EH7A 2VKEA 3ULQB 1N25A 2CQNA 2Z5UA 1TTYA 1QPMA 3JREA 1DP7P 3Q9SA 1CF7B 3ZGKA 1SAUA 2E1MC 1FY7A 5FLMJ 1FIAA 4RB1A 2O8XA 3W6VA 2FMLA 1DPRA 4RMNA 2F5FA 5IYDJ 4LLLA 4I0BA 5E20A 1JKRC 2ISZA 3PQJA 2WC2A 3I4PA 2EA2A 5EEGA 3KZIC 1E0EA 2F2EA 4EVIA 3L2UA 1SC7A 2O8KA 1USTA 5TISC 3TBIA 2MLGA 4OIPF 5DV5A 3TEDA 2Z99A 4AC0A 2CS3A 4X0GA 3NWSA 1HW2A 3K69A 1ETKA 1HSTA 4A3FJ 1T56A 3ZR8X 2KPMA 1KQ0A 2FBHA 1Z0XA 3CC7I 1P2FA 1BR4A 3CDLA 5F08A 4PJNA 5F0CA 4ZH4F 2XPVA 1Z7LA 1VQ8I 4ASNA 4MTDA 5FFXA 3R60A 4CCMA 4ZYGA 2PI0A 3HOVJ 3QQAA 1HXDA 4A3MJ 3HRUA 1OYWA 2K5CA 2ZKZA 5K5QA 4B4CA 4RLFA 2HTSA 1UFMA 4WXDA 2M30A 4DQ2A 4FQGA 1MMDA 1Y56A 3SEQA 1A35A 3LMMA 1JTYA 4GRIA 5E3OA 1X1PA 4NBQA 1C0WA 3O3KA 2I5UA 2JSCA 2LLKA 3ABKH 3SFIA 4RB3C 3GTGJ 5DEQA 1YHQI 2ZSIB 4U7BA 3J7ZI 1LEAA 4A3LJ 3BCBA 3MFKA 3H0DA 1W5CC 2QKMB 4L0YB 3JRCA 2VKDA 5H2FC 3P9CA 1NG7A 3FF5A 4FTHA 4PFPA 2VKVA 3FM5A 3WTUC 2K9SA 4E7LA 3AG4H 4L0ZB 2QQ8A 3HOTA 1A04A 3IV5A 1WH5A 4C2MJ 3DP7A 4IPAA 1TQMA 3D1NI 3SQNA 3AG3H 4XKWA 2DPDA 2TCTA 2E71A 4A3EJ 1RESA 4BJTA 5D8LB 1WH7A 2A68F 2M34A 3P9IA 2BOLA 1ZG5A 3FIWA 2EZIA 5LHHA 3BR6A 4BYYA 2DODA 1R36A 4E7KA 1MBJA 1XGOA 1S29A 5C3EJ 1S7AA 4D7NA 2GBYA 4M74A 1GVDA 1MH3A 2IBDA 1UJ8A 1ONVA 2BHZA 4HQEA 3S3OA 1MZBA 5F0FA 5DYMA 1F4KA 1SFXA 2V9VA 4EGYA 2O7OA 3R61A 4BACA 2NVYJ 4PZJA 3RPUD 3BP8A 4I7HA 2IGOA 1U0JA 3TW6A 4WK8F 1T33A 2COMA 4AWXB 3CQZJ 1AKHB 3A0HC 4UUSB 4A3KJ 1WGXA 4YEJA 1VQKI 2RNGA 1KYZA 2DA6A 4ENMA 5E8IA 3S1NJ 4GCVA 3HZJA 3M8FA 3R4KA 2EA4A 2XAQA 2QSFX 1PVEA 3OYDA 3JRIA 4NQWA 3GTPJ 2EFNA 4LB6B 2D5VA 3P7NA 1JUPA 5EG0B 4NNJA 5AIQA 4LLGF 1OPCA 4L9JA 2ZBKA 2Y69H 1IDZA 5TGTA 1MNEA 5HDGA 2L01A 1XD7A 4HAMA 1B9MA 1IXCA 1Z3YA 3WTXC 3S2DJ 4MIMA 4FETA 5M3MJ 4MTEA 4IRIA 1WJEA 3KLNA 4WX9A 2CRGA 1NHAA 2JUCA 4M6VA 3HIFA 3J80Z 5L3GA 1SD5A 1UZCA 2M5WA 3K4LA 4ZYHA 1FNNA 4QSHA 3BTIA 1T95A 3EUKL 3FDYA 1X2MA 4JP0A 2BYVE 2IVMA 1R49A 1XG1A 1ZREA 2H94A 1YRNB 1D0YA 5D5VB 3H1CA 1LVAA 4NQWB 5FD5A 3G71I 1HSJA 4AU7A 3OYAA 3WTVC 1XC5A 1QHHD 1ETVA 4D7MA 4QIWN 1V5GA 2QCOA 2WY7Q 4U0VA 4CICA 3L2VA 4XOPA 5GTIC 4IHVA 3VDXA 4CYCA 1AHDP 2TRTA 4LGWA 2ELKA 1R58A 3QP6A 4MGRA 2NS0A 2MLKA 1DDNA 1U9OA 2D1VA 4O3MA 3HHHA 3PSIA 2EINH 2L5QA 2Y75A 1BR2A 5E18F 1MJAA 3S1QJ 2E19A 1APLC 3S3NA 2BE5F 3BTCA 2FOWA 1MJBA 4E7ZA 2VC0A 4UVAA 1MBKA 3OS1A 2F6CA 4RB0A 4F7ZA 2KZVA 2HZDA 1QRYA 1HKSA 5LRSA 3CCMI 3BR5A 2L54A 2GOMA 2X6OA 5ILVA 3QP5A 3QAHA 4W97A 3JR9A 2EFWA 4U7DA 2E5NA 4BQAA 1QQIA 2CV2A 1JKOC 1FBQA 3U21A 2KIMA 3WG9A 1RNLA 1P4AA 2FQ3A 2DT5A 1OCOH 4OOIA 3ZQIA 4IO9F 2BBYA 1Z7UA 2HQ5A 2CW8A 1KU7A 2CQ7A 3F3XA 1MMAA 3KIOA 1ETOA 3BG3A 3NRVA 4EMSA 5HDNA 1EH8A 1W1WE 2DTZA 2FBIA 2MH2A 4WF2A 2ELJA 5D5XB 3HPHA 2Y9ZA 3QRFF 1QBJA 3ZCOA 4BGDA 1OFCX 3AFHA 3HSFA 4ZTFA 4IRHA 3RQIA 4DW6A 2K9LA 2PMZA 1ZELA 2MGQA 3BT9A 3H92A 3DLAA 3PJRA 1YQAA 3WODF 2MBFA 5F1RA 4HQMA 4HV6A 2Z1DA 3ZMVA 3EDPA 4F3QA 5GP9A 2EZHA 1VTNC 2DMTA 1W0TA 1YJWI 3OR2C 1X1CA 3D5LA 2VI6A 1I1SA 4M3BA 3ZQ7A 4U88A 4JX5A 2X6WA 3L2WA 1WRJA 4LLNA 4CZCA 2NVXJ 3RKXA 4BEHA 3MWMA 4I01A 1JJ8C 3KEOA 5LGUA 2PQ8A 3W2WA 2DPUA 2C6YA 1DPUA 1LDDA 1IRXA 2ADUA 3HSRA 3I55I 4AM3A 2HPMA 3M4OJ 5KK1A 2WAQA 4KIBA 4L5JA 2NYXA 3GX4X 4ENJA 2DDAA 2HGCA 2CFXA 2DYSH 4HDUA 2W24A 3HJEA 3ZN1A 1MSEC 2VE9A 4BH9A 5FLVA 2R7QA 4ZC3A 4EJWA 1HKQA 2VONA 3JRGA 3TMOA 2LSOA 1MMGA 2KRFA 2F5EA 3DEEA 3LSPA 3B6CA 3MZ8A 1O3RA 1SVLA 1FP1D 4PDKA 5B1BH 4A6DA 1GDTA 1BI0A 4HBLA 4U0YA 5HLGA 2LKXA 3HSEA 1BIAA 4I0AA 2H1LA 3BCAA 3I4NJ 3G1MA 1LE8A 2Q2EA 5JFRA 3RPUA 4A12A 1IUYA 1K4SA 4EEFG 2HNHA 3JRFA 1ZGJA 4E70A 4XRSG 2R5YA 4M71A 2W00A 1NTCA 1IDYA 3OYCA 3AAFA 2R7ZJ 1EJ9A 3PUBA 1SVMA 4JYKA 4RDUA 2WY8Q 3PNTA 1S8NA 2R7WA 4G8XA 4BHCA 2OPTA 4XLHA 3BJAA 2H09A 2QQAA 2VASA 2R7UA 1JHFA 2CV1A 3BY6A 1OCPA 4FT8A 2EB7A 1V5FA 1LEBA 3DU6A 3F8FA 3AKZA 3HHGA 2DFEA 5GADJ 4KN7X 2V9KA 3V42A 4V2FA 9ANTA 3MKLA 1A5JA 1XGMA 5F64A 5EEAA 4DYQA 3GCMA 2BXYA 3GTKJ 3BPVA 3CCLI 2K85A 4L9NA 4N4NB 3E6DA 4AD9A 2UWMA 1O4XA 2LOOA 2VODA 3H0GJ 4JBAA 5HDKA 4XLEA 1J75A 1HDDC 3U1KA 3BZKA 3GTLJ 3H5AA 2HKXA 1ZAOA 2XHKA 1K6OA 5KNLA 2A6HF 3QYEA 2QYOA 4HLYA 3QOEA 3N4MA 4ANJA 2E7XA 2GAUA 2AHQA 2B0LA 3MAJA 2X6XA 3CDIA 1V3FA 4B48A 1J0RA 3K4MA 4KA4A 1R1TA 3G3ZA 2QZ8A 2PMHA 3SZPA 3DKXA 1IN8A 2V79A 3S3MA 1EA3A 1D1CA 1JI8A 3VYSB 3ZMUA 3SZGA 2F4IA 1Y8QB 4CDGA 2K4BA 5ICEA 5CVRA 4CUGA 2P5VA 4KYWA 4XKBA 3IKTA 4LK0F 3CMMA 2YR2A 2E1NA 1OMIA 4YFXF 5EDNA 3I59A 3P5JA 2GLOA 3T8TA 5IT9Z 1Z77A 2M9HA 4KIFA 2ZXWH 3HUGA 3OR1C 5L3DA 2R7FA 3I0TA 5FKNA 4LIVA 2KP6A 1G3TA 5KVRA 3ECOA 4FX4A 1F9NA 4IX7A 5HNHA 5ILSA 1H89C 3EETA 2FD5A 2ETHA 4ZTJA 1I1GA 3O8GA 4R1HA 2NVUB 3V7SA 4S0HB 4M6YA 4EJVA 2R92J 2JPCA 1HKTA 2H8RA 2D1HA 1JHHA 1QZYA 2MD0A 2L7MP 2QA4I 3IUOA 1RUNA 2R7XA 2LH9A 1UCRA 1J09A 2EZLA 4OINF 3LSJA 4X6AJ 1IJWC 3G1OA 2Y48A 2P5LC 5A2QK 1IZ1A 1U9NA 3RPQA 2QEXI 1BC8C 2JZYA 4UXNA 1B6AA 2B63J 3F22A 4EQQA 3IC7A 4BBRJ 5F6FA 1S5LC 3I5UA 4RM3A 1MDMA 1VQ4I 3BR3A 3LSKA 1HLVA 1I3AA 2A05A 4LMYA 2HTJA 4IL6C 1B59A 1Y1VJ 2HI3A 4F55A 1TLHB 2HZTA 3GFJA 2O9LA 5CPRB 1B4AA 1FOWA 2DK8A 3CF5F 1DGWY 1KU3A 2H6CA 3C2GA 4HF0A 3DKWA 2MA3A 2ZJQF 5M3FJ 1DU0A 3ZPLA 3VEPA 3VOEA 2DI3A 4V19K 4M3FA 2EWNA 4XNFA 3RJPA 2DT6A 1WSUA 4ENNA 2EBIA 2M87A 1U2WA 4KT5C 1FYMA 4OMZA 1ZN2A 3M8EA 3RTRA 1S7OA 5LHGA 2KIUA 3K1PA 4Y7NJ 2VOOA 3W2AA 1W5SA 4H0EA 3CUQB 2F5VA 4RAZA 2Y0SN 2KJCA 2STTA 5H6QA 2WAFA 1JKQC 3FXRA 4D0PA 1TNSA 2O6GE 1O3SA 3S93A 4CCJA 1W4MA 3PO3J 3H9JA 3K9TA 4RA2A 2L2OA 4XRMA 2L7ZA 2ZMEA 1UB9A 3VODA 1Y0NA 3BTJA 3W2VA 2VPLA 3F23A 3ONQA 4W1UA 1G59A 4A69C 3NWTA 2DTRA 3ERMA 1QPIA 2CO5A 2ACJA 5BNGA 2VLAA 1MH4A 3NARA 2PX9A 2XAFA 5FLXZ 3OYBA 1SMYF 2Q0OA 3BOQA 3WHBA 2N8GA 3LSTA 3LA2A 2NNNA 4CCLA 1T98A 4Q5SF 2HYJA 3TP3A 1X1BA 5HVQC 2WB1N 5IP7J 3KFWX 5L3FA 1ZR2A 1CF7A 5IPAA 2HWVA 1BOAA 3ASNH 4G7OF 3LFKA 2IAIA 3HGYA 3GZ6A 3CTAA 2RV8A 4YRVA 3JTHA 3H35A 3L9FA 1EH6A 2OA4A 1MBFA 1TQIA 2VQHA 1K6YA 2WV1A 3CC4I 2XKPA 1CGPA 4UB6C 2VC1A 2Y0MA 2F48A 4B3AA 2DA3A 3MQ0A 4BXUA 2ZC2A 1T6SA 2CWEA 3OY9A 1XCVA 3LOCA 3OL3A 4Z2YA 1IV8A 3F21A 2IS6A 2LC2A 1KGSA 1IO2A 4ZYEA 2QENA 5GAGJ 2GXGA 1SVOA 3FBNB 4P9UA 5LGTA 1TQPA 2QKLB 3OYMA 2K86A 4G12A 2WADA 2BVMA 2HOAA 1QNTA 3HRTA 1PP7U 2CJJA 4RM2A 4RGRA 2LK2A 4KJZA 1I6XA 5EZGA 1ON1A 1YG2A 4CSWA 1X1DA 5D4RA 3RQ4A 1WJCA 4E7SA 4G6TB 2RQQA 5E79C 5J6XA 4KNYA 1Z1DA 1BL0A 4GXOA 3MN2A 4HNUA 1MJ9A 3DTIA 3ZP5A 4BDZA 1JXSA 4XIDA 2XF5A 1R5GA 3CLQA 2VBXA 2XSJC 3CD6I 4B43A 4CCNA 2AQFA 2X9DA 4EGZA 3QOPA 4XRFA 4LITA 2DCEA 4UNOA 2KZGA 2M4KA 2DT7B 1XSVA 2ID3A 3IAS2 4D5FA 2M45A 1XDUA 3FM3A 5GAHJ 4L9VA 2W84A 1SFEA 2HU9A 2LD5A 3X2QH 2RVCA 5J1UA 1E3HA 5LLQA 4UUTA 1D0ZA 1WI3A 2HPIA 1VQ9I 2V6EA 3M3YJ 3S1MJ 1AA7A 4Y52J 3C18A 2JUGA 4B8XA 4BDYA 3F8CA 5AONA 4C30A 4XN0A 3L2CA 3FMQA 1M1EB 3L00A 4DYCA 3F6OA 3W6KB 4AIHA 2VBYA 3C3WA 2HOTA 1IRFA 1KZHA 5LEJA 2PG4A 1OISA 1LDJA 2BW3B 3G2BA 3MD2A 1BC7C 4P1WA 1G3YA 3LSMA 1IXSB 3J80K 1X3UA 3CCSI 4XICA 1ETYA 2HOSA 4OU0A 2KKOA 2Z3YA 4Y3OA 3PNYA 3HG9A 1WHUA 3A02A 2X4HA 4AVPA 3OMYA 1ZGWA 4A3BJ 1FTZA 3GVAA 1K7AA 3HRSA 1AKHA 3ECHA 3UKGA 4XOTA 4UUSA 1HF0A 2YX7A 1BI1A 4MO7A 3LWFA 4IKFA 5LBQA 2R5ZA 5E17F 4A0YA 1JUSA 4NC6A 3KETA 4RAGA 2BEOA 3OYFA 4N0BA 3BTLA 3RDIA 3GYHX 4JX6A 1IG7A 1ZGAA 2VQLA 5HS8A 2Z16A 4EM2A 1RR7A 5IP6A 4A3IJ 4GYIA 4M72A 1ZH5A 2R93J 3WTYC 4OMYA 4CCKA 1R22A 3MEXA 5GTHC 2OZUA 3WTSC 3OIOA 5EG0A 1Z67A 5HLIA 4A3DJ 3S2HJ 3QPTA 2PBIA 3FISA 2RREA 1A36A 5J4VA 1I5ZA 2JK3A 1GV5A 5BMZA 3UR3C 3F0CA 2K02A 4BE1A 4IHXA 1UHWA 3FWEA 2CMPA 2M3AA 4C2UA 2EIMH 3CP2A 3MZHA 1OYIA 3CUQC 3HYIA 2DMQA 1LUJB 4UUVA 2NOJB 5TJJA 1Z91A 1J59A 3A4CA 1HDPA 4IQ4A 5HS9A 2ZXIA 4E7IA 3DPLC 3HKZN 2R5ZB 3DU5A 2AXTC 4XRSA 2WWYA 5C4JJ 2ISYA 3KE2A 1X4OA 5M5XJ 3JW4A 4HF2A 2X1CA 2YS9A 1OJLA 1YRNA 2MC4A 4C3HJ 2P6TA 1I6HJ 2XC7A 1A31A 3AG2H 1FLIA 2V1UA 5C4XJ 4XONA 4A0ZA 2P4WA 1GHCA 1JT6A 4UVCA 2IGMA 2GM4A 5J8FA 3BR0A 3K10A 2XIGA 1ACIA 2YU3A 1SMTA 3BLYA 1LPQA 4II2A 3A03A 3K4BA 2E2IJ 4UV9A 1WPKA 4UHTA 3KP5A 4DNCA 5C44J 1BJAA 1BM9A 2PEXA 1R4NB 2DYRH 3E6MA 2ZJ2A 4PJJA 3G4SI 2K9NA 5GPCA 3OSFA 2KRCA 3KLOA 4XSXF 3KP2A 2XRNA 3ZOBA 2L9RA 3IHUA 2GIVA 4FE4A 3T1BA 2LY9A 4XORA 1RI7A 4F93B 3A01A 3BWGA 2L3DA 2ZXJA 3JAMK 1MD0A 2DU9A 5DD8A 5KAIC 2V7FA 4CO8A 3KEQA 2ZMEC 1H9GA 3FXLA 3CESA 3K1NA 3DTEA 1RKWA 3COAC 1OCRH 2CUJA 4V2GA 4P5OA 3ZQFA 2G0EA 2GOXB 3Q3SA 5E3MA 2FOKA 1YITI 2HXOA 4IEJA 4C2TA 4F52A 1P9QC 3LAJA 3GLLA 2IA1A 2HFHA 1FMVA 3C7JA 4HSRA 3FMRA 1JJ6C 1WWXA 2MD5A 1E2XA 3OS2A 4XM3A 2JT1A 1SANA 3H3ZA 1LFBA 2BY1A 2PLYA 3GZNB 5D8KB 4G9YA 4BXXJ 1ZYRF 3K2ZA 2ZCWA 3O8HA 2FXAA 3LL7A 4GGGA 4QWQA 4PSXA 1XSDA 2OF7A 1VQOI 5B5EC 2W25A 3RCOA 1R1VA 2HYGD 3O2PE 4XKCA 4IJAA 3A01B 1G8XA 1D3YA 2DJNA 3OIQA 4KN4X 3BQYA 3OL4A 2YX4A 1UELB 1T0FA 4XL9A 2QF7A 3L09A 1JGSA 2OQGA 1FP2A 4O6JA 2VOPA 3TW7A 1T2KA 1FX7A 2MABA 3M1EA 2H27A 1IV6A 2IJLA 2VBWA 3KX2A 5F04A 3CF2A 1UG2A 2WAEA 2LBFB 4AUXA 4QTRA
chains in the Genus database with same CATH topology
3H3VK 4HNVA 2AHQA 2W48A 5J3LA 3HOXJ 3RZDJ 2DA5A 2COBA 2E1OA 3GBGA 3OOUA 2CQQA 1BA5A 2JA8J 5M5WJ 3BG5A 5JLXA 1Y1WJ 2P81A 4L5EA 5HODA 4NDLA 2YUSA 1JUMA 5EDNA 3E7LA 3OSGA 1NK3P 2GLOA 2EH3A 1Z77A 2M9HA 2XPUA 4FISA 3IH3A 1BW5A 2DA2A 1VI0A 5DTDA 5M5YJ 2ECCA 1UMQA 2MSYA 5FKNA 1MNMC 2DMUA 1ETQA 1ORKA 3DEWA 1Q1VA 5FKMA 2JJ7A 2CUEA 1QVTA 1ETWA 1X58A 1H89C 1NK2P 5EF6A 2FD5A 4FCYA 1PUFB 3FK6A 1R9TJ 1K83J 1ZK8A 3O8GA 3DCFA 3ZQHA 4S0HB 5J1RA 3QPLA 2R92J 2H8RA 2LVSA 1MBHA 2VKEA 2DA1A 3JREA 2L7MP 5K7HA 1VF9A 3HOYJ 2EZLA 1F36A 3LSJA 5FLMJ 4B1RA 1FIAA 1IJWC 4X6AJ 2L7FP 3G1OA 2Y2ZA 3W6VA 2NOGA 5IYDJ 1U9NA 1FEXA 1JKRC 2LTPA 3LNQA 2B63J 1RKTA 1EF4A 3TP0A 3G1LA 2XB5A 4BBRJ 2O8KA 2I10A 2VUMJ 1ZQ3P 2XGDA 3BR3A 2ME6A 1HLVA 3PM1A 3TEDA 4AC0A 2M2EA 1Y1VJ 2HI3A 5FJ8J 5FKKA 1ETKA 4A3FJ 2O9LA 1T56A 4FE7A 1DU6A 1BW6A 1VFCA 1Z0XA 5M3FJ 3CDLA 1DU0A 5F08A 3BR2A 1MSFC 3CCYA 5F0CA 2XPVA 4M3FA 5J1YA 4A3JJ 2CUFA 5F0HA 5FKOA 2NVQJ 3MVPA 2FQ4A 2EBIA 3HOVJ 2XSDC 3QQAA 4A3MJ 5EYRA 3JRHA 5IOZA 1TWHJ 3JRAA 4BY7J 2AO9A 4B4CA 4J19A 2XGCA 2E2HJ 5IOYA 4IHWA 4Y7NJ 1JTYA 2Y0SN 3ZQGA 5E3OA 1H8AC 1S7EA 1JKQC 2LLKA 3SFIA 4GFBA 1ZR4A 3GTGJ 3PO3J 1FIPA 4XRMA 2L7ZA 4BBSJ 2K40A 2JWTA 4A3LJ 2KT0A 1W0UA 3BTJA 3S14J 2JMWA 4M3EA 3JRCA 4W1UA 5IYBJ 4A69C 3QPSA 4FTHA 1PUFA 1QPIA 3GTMJ 2VKVA 5BNGA 1MH4A 3NARA 2L0KA 2K9SA 3CMYA 5FKLA 1E3OC 2HDDA 3RKQA 3VPRA 3WHBA 2N8GA 1VNDA 4MFEA 3IV5A 1MBGA 1WH5A 4C2MJ 3D1NI 2HYJA 3TP3A 5IP7J 2FX0A 2WB1N 1ZR2A 2TCTA 5IPAA 4A3EJ 1RESA 2IAIA 3HGYA 4X1EA 1B8IA 1WH7A 2M34A 4AYBN 3RZOJ 2LR8A 3FIWA 2EZIA 2Y9YA 3BR6A 1MBFA 3JRDA 1HOMA 1MBJA 5C3EJ 4A3GJ 2WV1A 2Y31A 4D7NA 2GBYA 1GVDA 1MH3A 2IBDA 4B3AA 4CYCB 2DA3A 2JA5J 5F0FA 1U8BA 2O7OA 3LOCA 1POGA 3WHCA 2NVYJ 3Q0UA 1P7JA 2LP0A 3TW6A 3C2BA 1H88C 1T33A 4D5CA 3CQZJ 1JT0A 1AKHB 4MFDA 2RAEA 4UUSB 1D5YA 4G12A 3BQZA 4A3KJ 1WGXA 1P7IA 3GTJJ 2HOAA 2DA6A 2CJJA 2FJ1A 3S1NJ 2LK2A 5EZGA 3HDDA 2NS7A 3ZQCA 1XS9A 5K7FA 2MG4A 3JRIA 1BL0A 3GTPJ 3MN2A 2D5VA 1JUPA 5EG0B 2NVTJ 1B8IB 1GUUA 4XIDA 1IDZA 4A3CJ 2X9DA 2DMPA 3S15J 2R0QC 2ID3A 4D5FA 3IH2A 2XPWA 3S2DJ 4DZJA 1MBEA 4MIMA 5M3MJ 1B72A 1TWGJ 2LD5A 2K9QA 1HCRA 5J1UA 2CRGA 5EZHA 4M6VA 2DN0A 2JA7J 4UUTA 3HOUJ 1WI3A 3M3YJ 3S1MJ 4Y52J 4QSHA 3BTIA 1IC8A 1X2MA 2IEKA 4JP0A 5F27A 4DYCA 1XG1A 4ABZA 1YRNB 2HOTA 4XK4A 2JA6J 2M8GX 1TC3C 1GV2A 1XC5A 4D7MA 1ETVA 4QIWN 2QCOA 1OCTC 3S17J 4I6ZA 4IHVA 4CYCA 1AHDP 2TRTA 1JGGA 3B6AA 4XICA 2ELKA 1ETYA 2HOSA 1U9OA 3A02A 1ZGWA 4A3BJ 2CU7A 1RPWA 1B72B 1FTZA 3S1QJ 2E19A 1APLC 1AKHA 3UKGA 4UUSA 1HF0A 3BTCA 4MO7A 2ECBA 2R5ZA 2WAQN 1TWAJ 5IYCJ 1JUSA 1MBKA 1JKPC 3BTLA 1QRYA 4JX6A 3BR5A 1IG7A 3ZQLA 5DS9A 2X6OA 3NAUA 1RR7A 5IP6A 4A3IJ 2R93J 4W97A 3JR9A 1G2HA 2ZB9A 1A6IA 1LE8B 3OIOA 1U78A 3Q0WA 5EG0A 3L1PA 1JKOC 4A3DJ 3S2HJ 2LFBA 4JX4A 3FISA 2R5YB 1ZTRA 3SJMA 2JK3A 2JN6A 3ZQIA 2E2JJ 5E3LA 1GV5A 3F0CA 4IHXA 4DZPA 4RBOA 2HQ5A 3FK7A 1K61A 1ETOA 3BG3A 2ME0A 1ITYA 2EZKA 4M3DA 2M0CA 1BJZA 2DTZA 2DMQA 2Y9ZA 1OFCX 1HDPA 2DA4A 3RQIA 4DW6A 4LOCA 5EGOB 3HKZN 2R5ZB 2MGQA 3BT9A 4XRSA 5C4JJ 1JTXA 1I3QJ 1FJLA 5M5XJ 4A93J 2XRLA 2Y30A 5GP9A 2EZHA 3HOZJ 2DMTA 1W0TA 2YS9A 1OJLA 1YRNA 4C3HJ 1SFOJ 3GTQJ 1I6HJ 2VI6A 5GPAA 4M3BA 5C4XJ 4JX5A 1JT6A 2GM4A 1AU7A 3BR0A 1FTTA 1QVUA 2NVXJ 4I76A 2EQRA 1JJ8C 3A03A 1GT0C 2E2IJ 2XB0X 1WPKA 5C44J 1CQTA 3M4OJ 1WCMJ 1IGNA 2K9NA 2XGEA 5GPCA 3OSFA 1LFUP 4M3GA 1MSEC 5FLVA 3ZOBA 3S16J 2L9RA 3FKIJ 4FE4A 1TWCJ 2LY9A 1I50J 3K7AJ 3A01A 3JRGA 2VPRA 3HOWJ 2HXIA 5F1JA 3LSPA 3B6CA 2CQXA 2H1KA 2NS8A 3HGGA 1RKWA 1GDTA 4V2GA 1IRZA 2LKXA 3ZQFA 2G0EA 3Q3SA 5E3MA 3I4NJ 2HXOA 3G1MA 1LE8A 4IEJA 2ID6A 4C3IJ 2PMZN 4C3JJ 3PO2J 3JRBA 3HEFA 3K2AA 4EEFG 3JRFA 2R5YA 4XRSG 1X2NA 3IH4A 3I4MJ 1ETXA 1NTCA 1IDYA 2YU9J 2R7ZJ 1JJ6C 4JYKA 3BR1A 1IUFA 1SANA 3HM5A 4RDUA 1LFBA 2OPTA 2MW8A 4BXXJ 1TWFJ 3SDGA 3O8HA 1OCPA 3Q0VA 5E3NA 2OF7A 2DMNA 4V2FA 9ANTA 3GTOJ 3A01B 3MKLA 5EGOA 1A5JA 5JLWA 1UHSA 3HBLA 3LSRA 2DJNA 5EEAA 4DYQA 1ZKGA 2KDZA 4IHYA 3BQYA 3GTKJ 1ENHA 2X48A 4BY1J 1RETA 2DA7A 2QF7A 3BG9A 5IP9J 1O4XA 3TW7A 3H0GJ 4BKXA 3S1RJ 4MLOA 1F43A 1HDDC 3HB9A 3LSGA 1IV6A 3GTLJ 5F04A 1UG2A 4DYRA 5K7ZA 4AUXA 4QTRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H3V K;  4HNV A;  2AHQ A;  2W48 A;  5J3L A;  3HOX J;  3RZD J;  2DA5 A;  2COB A;  2E1O A;  3GBG A;  3OOU A;  2CQQ A;  1BA5 A;  2JA8 J;  5M5W J;  3BG5 A;  5JLX A;  1Y1W J;  2P81 A;  4L5E A;  5HOD A;  4NDL A;  2YUS A;  1JUM A;  5EDN A;  3E7L A;  3OSG A;  1NK3 P;  2GLO A;  2EH3 A;  1Z77 A;  2M9H A;  2XPU A;  4FIS A;  3IH3 A;  1BW5 A;  2DA2 A;  1VI0 A;  5DTD A;  5M5Y J;  2ECC A;  1UMQ A;  2MSY A;  5FKN A;  1MNM C;  2DMU A;  1ETQ A;  1ORK A;  3DEW A;  1Q1V A;  5FKM A;  2JJ7 A;  2CUE A;  1QVT A;  1ETW A;  1X58 A;  1H89 C;  1NK2 P;  5EF6 A;  2FD5 A;  4FCY A;  1PUF B;  3FK6 A;  1R9T J;  1K83 J;  1ZK8 A;  3O8G A;  3DCF A;  3ZQH A;  4S0H B;  5J1R A;  3QPL A;  2R92 J;  2H8R A;  2LVS A;  1MBH A;  2VKE A;  2DA1 A;  3JRE A;  2L7M P;  5K7H A;  1VF9 A;  3HOY J;  2EZL A;  1F36 A;  3LSJ A;  5FLM J;  4B1R A;  1FIA A;  1IJW C;  4X6A J;  2L7F P;  3G1O A;  2Y2Z A;  3W6V A;  2NOG A;  5IYD J;  1U9N A;  1FEX A;  1JKR C;  2LTP A;  3LNQ A;  2B63 J;  1RKT A;  1EF4 A;  3TP0 A;  3G1L A;  2XB5 A;  4BBR J;  2O8K A;  2I10 A;  2VUM J;  1ZQ3 P;  2XGD A;  3BR3 A;  2ME6 A;  1HLV A;  3PM1 A;  3TED A;  4AC0 A;  2M2E A;  1Y1V J;  2HI3 A;  5FJ8 J;  5FKK A;  1ETK A;  4A3F J;  2O9L A;  1T56 A;  4FE7 A;  1DU6 A;  1BW6 A;  1VFC A;  1Z0X A;  5M3F J;  3CDL A;  1DU0 A;  5F08 A;  3BR2 A;  1MSF C;  3CCY A;  5F0C A;  2XPV A;  4M3F A;  5J1Y A;  4A3J J;  2CUF A;  5F0H A;  5FKO A;  2NVQ J;  3MVP A;  2FQ4 A;  2EBI A;  3HOV J;  2XSD C;  3QQA A;  4A3M J;  5EYR A;  3JRH A;  5IOZ A;  1TWH J;  3JRA A;  4BY7 J;  2AO9 A;  4B4C A;  4J19 A;  2XGC A;  2E2H J;  5IOY A;  4IHW A;  4Y7N J;  1JTY A;  2Y0S N;  3ZQG A;  5E3O A;  1H8A C;  1S7E A;  1JKQ C;  2LLK A;  3SFI A;  4GFB A;  1ZR4 A;  3GTG J;  3PO3 J;  1FIP A;  4XRM A;  2L7Z A;  4BBS J;  2K40 A;  2JWT A;  4A3L J;  2KT0 A;  1W0U A;  3BTJ A;  3S14 J;  2JMW A;  4M3E A;  3JRC A;  4W1U A;  5IYB J;  4A69 C;  3QPS A;  4FTH A;  1PUF A;  1QPI A;  3GTM J;  2VKV A;  5BNG A;  1MH4 A;  3NAR A;  2L0K A;  2K9S A;  3CMY A;  5FKL A;  1E3O C;  2HDD A;  3RKQ A;  3VPR A;  3WHB A;  2N8G A;  1VND A;  4MFE A;  3IV5 A;  1MBG A;  1WH5 A;  4C2M J;  3D1N I;  2HYJ A;  3TP3 A;  5IP7 J;  2FX0 A;  2WB1 N;  1ZR2 A;  2TCT A;  5IPA A;  4A3E J;  1RES A;  2IAI A;  3HGY A;  4X1E A;  1B8I A;  1WH7 A;  2M34 A;  4AYB N;  3RZO J;  2LR8 A;  3FIW A;  2EZI A;  2Y9Y A;  3BR6 A;  1MBF A;  3JRD A;  1HOM A;  1MBJ A;  5C3E J;  4A3G J;  2WV1 A;  2Y31 A;  4D7N A;  2GBY A;  1GVD A;  1MH3 A;  2IBD A;  4B3A A;  4CYC B;  2DA3 A;  2JA5 J;  5F0F A;  1U8B A;  2O7O A;  3LOC A;  1POG A;  3WHC A;  2NVY J;  3Q0U A;  1P7J A;  2LP0 A;  3TW6 A;  3C2B A;  1H88 C;  1T33 A;  4D5C A;  3CQZ J;  1JT0 A;  1AKH B;  4MFD A;  2RAE A;  4UUS B;  1D5Y A;  4G12 A;  3BQZ A;  4A3K J;  1WGX A;  1P7I A;  3GTJ J;  2HOA A;  2DA6 A;  2CJJ A;  2FJ1 A;  3S1N J;  2LK2 A;  5EZG A;  3HDD A;  2NS7 A;  3ZQC A;  1XS9 A;  5K7F A;  2MG4 A;  3JRI A;  1BL0 A;  3GTP J;  3MN2 A;  2D5V A;  1JUP A;  5EG0 B;  2NVT J;  1B8I B;  1GUU A;  4XID A;  1IDZ A;  4A3C J;  2X9D A;  2DMP A;  3S15 J;  2R0Q C;  2ID3 A;  4D5F A;  3IH2 A;  2XPW A;  3S2D J;  4DZJ A;  1MBE A;  4MIM A;  5M3M J;  1B72 A;  1TWG J;  2LD5 A;  2K9Q A;  1HCR A;  5J1U A;  2CRG A;  5EZH A;  4M6V A;  2DN0 A;  2JA7 J;  4UUT A;  3HOU J;  1WI3 A;  3M3Y J;  3S1M J;  4Y52 J;  4QSH A;  3BTI A;  1IC8 A;  1X2M A;  2IEK A;  4JP0 A;  5F27 A;  4DYC A;  1XG1 A;  4ABZ A;  1YRN B;  2HOT A;  4XK4 A;  2JA6 J;  2M8G X;  1TC3 C;  1GV2 A;  1XC5 A;  4D7M A;  1ETV A;  4QIW N;  2QCO A;  1OCT C;  3S17 J;  4I6Z A;  4IHV A;  4CYC A;  1AHD P;  2TRT A;  1JGG A;  3B6A A;  4XIC A;  2ELK A;  1ETY A;  2HOS A;  1U9O A;  3A02 A;  1ZGW A;  4A3B J;  2CU7 A;  1RPW A;  1B72 B;  1FTZ A;  3S1Q J;  2E19 A;  1APL C;  1AKH A;  3UKG A;  4UUS A;  1HF0 A;  3BTC A;  4MO7 A;  2ECB A;  2R5Z A;  2WAQ N;  1TWA J;  5IYC J;  1JUS A;  1MBK A;  1JKP C;  3BTL A;  1QRY A;  4JX6 A;  3BR5 A;  1IG7 A;  3ZQL A;  5DS9 A;  2X6O A;  3NAU A;  1RR7 A;  5IP6 A;  4A3I J;  2R93 J;  4W97 A;  3JR9 A;  1G2H A;  2ZB9 A;  1A6I A;  1LE8 B;  3OIO A;  1U78 A;  3Q0W A;  5EG0 A;  3L1P A;  1JKO C;  4A3D J;  3S2H J;  2LFB A;  4JX4 A;  3FIS A;  2R5Y B;  1ZTR A;  3SJM A;  2JK3 A;  2JN6 A;  3ZQI A;  2E2J J;  5E3L A;  1GV5 A;  3F0C A;  4IHX A;  4DZP A;  4RBO A;  2HQ5 A;  3FK7 A;  1K61 A;  1ETO A;  3BG3 A;  2ME0 A;  1ITY A;  2EZK A;  4M3D A;  2M0C A;  1BJZ A;  2DTZ A;  2DMQ A;  2Y9Z A;  1OFC X;  1HDP A;  2DA4 A;  3RQI A;  4DW6 A;  4LOC A;  5EGO B;  3HKZ N;  2R5Z B;  2MGQ A;  3BT9 A;  4XRS A;  5C4J J;  1JTX A;  1I3Q J;  1FJL A;  5M5X J;  4A93 J;  2XRL A;  2Y30 A;  5GP9 A;  2EZH A;  3HOZ J;  2DMT A;  1W0T A;  2YS9 A;  1OJL A;  1YRN A;  4C3H J;  1SFO J;  3GTQ J;  1I6H J;  2VI6 A;  5GPA A;  4M3B A;  5C4X J;  4JX5 A;  1JT6 A;  2GM4 A;  1AU7 A;  3BR0 A;  1FTT A;  1QVU A;  2NVX J;  4I76 A;  2EQR A;  1JJ8 C;  3A03 A;  1GT0 C;  2E2I J;  2XB0 X;  1WPK A;  5C44 J;  1CQT A;  3M4O J;  1WCM J;  1IGN A;  2K9N A;  2XGE A;  5GPC A;  3OSF A;  1LFU P;  4M3G A;  1MSE C;  5FLV A;  3ZOB A;  3S16 J;  2L9R A;  3FKI J;  4FE4 A;  1TWC J;  2LY9 A;  1I50 J;  3K7A J;  3A01 A;  3JRG A;  2VPR A;  3HOW J;  2HXI A;  5F1J A;  3LSP A;  3B6C A;  2CQX A;  2H1K A;  2NS8 A;  3HGG A;  1RKW A;  1GDT A;  4V2G A;  1IRZ A;  2LKX A;  3ZQF A;  2G0E A;  3Q3S A;  5E3M A;  3I4N J;  2HXO A;  3G1M A;  1LE8 A;  4IEJ A;  2ID6 A;  4C3I J;  2PMZ N;  4C3J J;  3PO2 J;  3JRB A;  3HEF A;  3K2A A;  4EEF G;  3JRF A;  2R5Y A;  4XRS G;  1X2N A;  3IH4 A;  3I4M J;  1ETX A;  1NTC A;  1IDY A;  2YU9 J;  2R7Z J;  1JJ6 C;  4JYK A;  3BR1 A;  1IUF A;  1SAN A;  3HM5 A;  4RDU A;  1LFB A;  2OPT A;  2MW8 A;  4BXX J;  1TWF J;  3SDG A;  3O8H A;  1OCP A;  3Q0V A;  5E3N A;  2OF7 A;  2DMN A;  4V2F A;  9ANT A;  3GTO J;  3A01 B;  3MKL A;  5EGO A;  1A5J A;  5JLW A;  1UHS A;  3HBL A;  3LSR A;  2DJN A;  5EEA A;  4DYQ A;  1ZKG A;  2KDZ A;  4IHY A;  3BQY A;  3GTK J;  1ENH A;  2X48 A;  4BY1 J;  1RET A;  2DA7 A;  2QF7 A;  3BG9 A;  5IP9 J;  1O4X A;  3TW7 A;  3H0G J;  4BKX A;  3S1R J;  4MLO A;  1F43 A;  1HDD C;  3HB9 A;  3LSG A;  1IV6 A;  3GTL J;  5F04 A;  1UG2 A;  4DYR A;  5K7Z A;  4AUX A;  4QTR A; 
#chains in the Genus database with same CATH topology
 3H3V K;  1GXP A;  4G7Z F;  5DD4 A;  1QZZ A;  2ZJR F;  4A5N A;  2DBB A;  2FNP A;  3WTZ A;  1DGR M;  4OWR B;  2VJ4 A;  3HOX J;  3RZD J;  2DA5 A;  4XLP F;  4RS8 A;  3GW2 A;  3CCE I;  2OBP A;  3GBG A;  4JK1 X;  3OOU A;  4RGX A;  4E7H A;  1FOX A;  2O0Y A;  1FOK A;  4HG2 A;  3K4J A;  3T0Y A;  1WZ2 A;  4LG3 A;  5M5W J;  5JLX A;  1Y1W J;  5HOD A;  3TO7 A;  3EPZ A;  1U5T B;  2UXX A;  2HKO A;  3RI4 A;  1JUM A;  2LKP A;  2OAZ A;  3GFM A;  1B1B A;  3ZMD A;  4B3X A;  5H20 A;  3OSG A;  1K79 A;  2FF4 A;  3DBR B;  2XPU A;  5CQG A;  4L9T A;  2DFI A;  2L7K A;  1IN7 A;  3IAM 2;  4IVN A;  4H4K C;  5AIP A;  3OYN A;  2ECC A;  1GVJ A;  4XLF A;  4RAY A;  2DMU A;  3M8J A;  2RN7 A;  2B7E A;  1ETQ A;  1ORK A;  5GAE J;  5JR3 A;  5KHD A;  2WTE A;  1KQ9 A;  5CVV A;  1Q1V A;  3KYC B;  2VN2 A;  2H6B A;  3C2H A;  2VB6 A;  3BJO A;  3I56 I;  1X58 A;  3BG7 A;  5EF6 A;  5BPD A;  1PUF B;  4HZF A;  2E34 A;  2GXA A;  2VBZ A;  1K83 J;  1ZK8 A;  4WXC A;  3ZN0 A;  2PJP A;  2VJ5 A;  4Y13 A;  2Y0S A;  4CGZ A;  2QQ9 A;  4NC8 A;  1MBH A;  2RQP A;  3TO6 A;  3J7A Y;  2DA1 A;  1YFH A;  5IT9 K;  2K9M A;  2KHM A;  2EJR A;  1KU2 A;  2QUF A;  1VF9 A;  5BOX A;  4EM1 A;  3EUA A;  3HOY J;  3ESW B;  2V1X A;  2L7F P;  3EQL F;  3J81 Z;  3T5X A;  2Y2Z A;  4CCO A;  1YE9 A;  2HQA A;  1TT5 B;  3HTU A;  3G73 A;  2VXD A;  3EUH C;  2M4G A;  3HRM A;  2X1E A;  2LTP A;  2MFZ A;  3LNQ A;  3RYP A;  1RKT A;  3TP0 A;  1FT9 A;  3WGI A;  2XB5 A;  1ZQ3 P;  2XGD A;  2ME6 A;  3KYL A;  2KDO A;  3PM1 A;  4M9Z A;  4WXH A;  3ABM H;  2M2E A;  1IN6 A;  5FJ8 J;  1X1A A;  5FRN A;  4XMY A;  3NQO A;  2BV6 A;  4YEL A;  1D8K A;  1VQ7 I;  1KON A;  3IWZ A;  4DOZ A;  1DU6 A;  4WWC A;  2OC6 A;  4CYD A;  4HX7 A;  2IRF G;  1JE8 A;  5D4S A;  4XSZ F;  3BR2 A;  1MSF C;  3CCY A;  3LSH A;  4A0X A;  1UG0 A;  2PN6 A;  2IXS A;  4A3J J;  5F0H A;  5JVG F;  3CO6 C;  2FQ4 A;  4IF4 A;  2XSD C;  1OCC H;  5EYR A;  3N05 A;  1VQM I;  4CHU A;  4ESF A;  3P9K A;  2XDV A;  4J19 A;  1LNW A;  1N78 A;  5HNF A;  3VWB A;  4IHW A;  4PUS A;  2HDW A;  2XAG A;  3CP8 A;  4F92 B;  2GWR A;  3MKZ A;  2V9P A;  1YI2 I;  1FZP B;  1ODD A;  1QHG A;  1IW7 F;  1O7L A;  4P96 A;  3V8K A;  4GFB A;  3V8J A;  1ZR4 A;  3OYE A;  3TDU C;  1P4W A;  4BS9 A;  2OZ6 A;  4ZDP A;  3LQQ A;  4BBS J;  3B02 A;  3BC8 A;  2K40 A;  1WFX A;  2KT0 A;  1W0U A;  4LK1 F;  3S14 J;  3KP4 A;  1BN5 A;  2EPF A;  2IS4 A;  2JSP A;  3GEZ A;  5IYB J;  3QPS A;  4IHS A;  2ELH A;  3GO5 A;  3AL0 B;  1KA8 A;  3TO9 A;  4G7H F;  1YIO A;  1YO5 C;  5FKL A;  3FXK A;  2HDD A;  5E1Z B;  1VND A;  4KUM A;  3UNG C;  1MBG A;  3H36 A;  1PUE E;  4LD5 A;  1MW7 A;  4N9H A;  4X1E A;  1XB4 A;  1B8I A;  1Z3X A;  2E36 A;  4AYB N;  3BPX A;  1HOM A;  3WGG A;  4A3G J;  1D1B A;  2Y31 A;  5L3B A;  5JI6 A;  3U2R A;  4RB2 C;  3OYG A;  3GWZ A;  5DUI A;  1KQ8 A;  3I3L A;  2Z9O A;  2IPQ X;  1U8B A;  3WHC A;  1HA8 A;  1FYL A;  2DOF A;  2F4M B;  1UHM A;  3Q0U A;  1D5V A;  1P7J A;  2JRT A;  3FXQ A;  2LP0 A;  1YJ9 I;  3CCR I;  1H88 C;  3A2K A;  1MMS A;  4D5C A;  3DFG A;  3SXY A;  3E6C C;  1JT0 A;  4MFD A;  1D5Y A;  2G7H A;  5BPI A;  5B1A H;  1P7I A;  2KFD A;  2XF6 A;  3VB2 A;  1E3P A;  4IOC F;  2UV1 A;  5D6E A;  1FBS A;  2NS7 A;  4IXA A;  3RIR A;  3BG6 A;  3ZQC A;  4Y17 A;  1XS9 A;  4BHP A;  4XKV A;  2IGK A;  4RGU A;  1U8R A;  2RDP A;  2NVT J;  1B8I B;  2DOA A;  2VT2 A;  3TQN A;  3OV8 A;  3CUQ A;  1WJD A;  4G6D A;  3TL4 X;  2QLZ A;  3S15 J;  2W7N A;  2R0Q C;  3ELK A;  1U5T C;  2XPW A;  1FC3 A;  4DZJ A;  5BS6 A;  1TWG J;  2GA1 A;  1BR1 A;  4MQV A;  2OUM A;  3CO7 C;  2ZSH B;  1FBU A;  5EZH A;  2DN0 A;  2UZK A;  1T0F C;  4ON0 A;  3HOU J;  4JQF A;  2K7L A;  3OIP A;  2BZT A;  2JA2 A;  2HYF A;  3SYT A;  2D2W A;  1ZG1 A;  2EK5 A;  2K27 A;  1IC8 A;  1P6R A;  1W5T A;  2ZJP F;  2A07 F;  2IEK A;  5F27 A;  2LDU A;  2TDX A;  4XK4 A;  3JCU C;  3OYJ A;  2JA6 J;  1PJR A;  2CFO A;  4DBQ A;  4XN3 A;  2GQQ A;  2M8G X;  3BDD A;  3TOA A;  3DTK A;  1K78 B;  1QO0 D;  2IA2 A;  4Y4R A;  4BNC A;  1O57 A;  3CCV I;  1U3E M;  1EV7 A;  3CMA I;  1WJB A;  1WJ5 A;  2WA0 A;  1SFK A;  2OD5 A;  3F8N A;  5LFA A;  1OCT C;  3S17 J;  3K4C A;  3KP3 A;  4O5V A;  2R7V A;  2CSO A;  4G94 A;  4I98 B;  4OIO F;  3CLO A;  4I02 A;  2BGC A;  3PL8 A;  3RYR A;  2A6T A;  2DW4 A;  2YSR A;  5JVT A;  2NRA C;  2A61 A;  2ECB A;  2ESN A;  3HXL A;  2WAQ N;  5IYC J;  3E97 A;  1VQN I;  4J00 A;  3MMY B;  5ILU A;  4AID A;  4S05 A;  5FB2 A;  2NNY A;  2Z2S B;  5K5R A;  1O3T A;  4PK4 A;  2F5D A;  5DUK A;  5DS9 A;  2FMY A;  4FHT A;  2V1N A;  1A6I A;  2ZB9 A;  4CZZ A;  2RNJ A;  2X1D A;  3TGN A;  1U78 A;  4CH7 A;  2IP2 A;  1OYY A;  3L1P A;  2FE3 A;  4NC7 A;  4HA8 A;  4GDF A;  4JX4 A;  1XN7 A;  3HPG A;  3GUD A;  1ZTR A;  3SJM A;  4TV7 A;  5DCM A;  2OCC H;  1X3Z B;  4DZP A;  5D5U B;  4HF1 A;  3PSF A;  3LQR A;  3Q9V A;  3FKJ A;  5D6F A;  3ZQQ A;  4PCQ A;  3RKW A;  3M1C A;  2KQR A;  1TNT A;  2KIS A;  1K61 A;  3W6J B;  1XMK A;  2FEZ A;  4KIS A;  4M3D A;  2M0C A;  1BJZ A;  2CUZ A;  1T39 A;  4UV8 A;  5ICF A;  2STW A;  4GYG A;  5CYV A;  2DA4 A;  3IWF A;  4LOC A;  5EGO B;  2QQB A;  3WU1 B;  2FUG 2;  2X6Y A;  4XLC A;  4A93 J;  4EJT A;  1XDS A;  2XRL A;  2QWW A;  1YTY A;  3HOZ J;  4YFK F;  2A3S A;  3CJQ B;  3M07 A;  3MZY A;  3WE2 A;  3AL0 C;  1QGP A;  4UVB A;  5GPA A;  2BW3 A;  2H8W A;  3ABL H;  4HEA 2;  5DCM B;  3SDB A;  1CQT A;  2M8E A;  4MQ9 F;  1H0M A;  1VZ0 A;  1TP4 A;  2AS5 F;  1IGN A;  2XGE A;  1Y0U A;  4I09 A;  5DM7 F;  3L2R A;  1W7P A;  4YII A;  3ABU A;  3S16 J;  1LDK B;  2R7D A;  1TWC J;  2FBK A;  3I54 A;  1I50 J;  4KDP A;  3K7A J;  2AXL A;  3K4N A;  4RGS A;  3OYK A;  4EJU A;  3H9Q A;  2VPR A;  3OOP A;  5LD2 C;  1J9I A;  3CDH A;  3H3U A;  2ZNZ A;  3OYH A;  2RGV A;  1FOY A;  3GF2 A;  4MEY F;  1KYW A;  4PGH A;  5CLS A;  4XLA A;  3ZMZ A;  3HGG A;  2O3F A;  4MHG A;  1BIB A;  1FSH A;  3OYL A;  2CW0 F;  3KP7 A;  3KZZ A;  4HW0 A;  1IRZ A;  3CUO A;  3KEY A;  2OQR A;  2RKH A;  4C9Y A;  4HRI A;  3T8R A;  3QWL A;  1REP C;  3H5N A;  5L3C A;  2E1C A;  3PO2 J;  3JRB A;  1V4R A;  3HEF A;  3K2A A;  3LA7 A;  1YW7 A;  3DKY A;  2PJR B;  3R6S A;  2R4G A;  1R1U A;  3DPU A;  5FO5 A;  2XF7 A;  4K2E A;  2YU9 J;  3QYB A;  4KT6 A;  1IN4 A;  3PIP F;  3ASO H;  3BR1 A;  3IP4 B;  1ERD A;  3HM5 A;  2L9S A;  1TZL A;  4PFO A;  5H6R A;  3W3C A;  1ZRC A;  2IA0 A;  4LJZ F;  4HNT A;  3MKY B;  3SDG A;  1Q1H A;  2LF8 A;  4BE2 A;  5E3N A;  1XMA A;  2R7O A;  1OR7 C;  2R7S A;  1W7P B;  3D0S A;  3EUH A;  1HQC A;  2IW5 A;  4A2U A;  1MND A;  3WG7 H;  1SFU A;  3K70 C;  2IT0 A;  1HW1 A;  1WI9 A;  4A5M A;  1USS A;  1UHS A;  3LSR A;  3GME A;  4Y15 A;  2HVQ A;  1YS7 A;  1ZKG A;  2KDZ A;  4IZZ A;  4IHY A;  3QU6 A;  2X48 A;  4BY1 J;  1RET A;  1WJF A;  2DA7 A;  4M9S A;  4Q47 A;  5B66 C;  1N77 A;  3FBI B;  4YIF A;  4ZDO A;  1XTA A;  2FNA A;  1XMX A;  2E5Z A;  2EFP A;  1YOV B;  4OIR F;  2LY2 A;  1F43 A;  4HST A;  3J7A O;  4HYE A;  2KMU A;  2PFB A;  1BI3 A;  1PYV A;  2VXZ A;  4G6Q A;  5KAF C;  2DK5 A;  5K7Z A;  3B73 A;  1BBY A;  2J5P A;  1LB2 A;  4B47 A;  4HNV A;  4QPO A;  3MKW B;  4KMU X;  1XPX A;  4I2O A;  3GFL A;  2W48 A;  2O03 A;  1OKR A;  1HBX G;  3V4G A;  4BJ6 C;  3DV8 A;  3DEU A;  4ZZL A;  2LMD A;  2COB A;  1G6N A;  3QOD A;  4R8H A;  5K5O A;  3LA3 A;  4E4H A;  2MH9 A;  1R7J A;  1R6R A;  2DO7 A;  5FRM A;  4BXF A;  3BG5 A;  3L2Q A;  4HDV A;  2W57 A;  2ZFW A;  3F72 A;  2VT3 A;  2L9V A;  2X85 A;  3R0J A;  4NDL A;  4EAT A;  3ABT A;  2YUS A;  3L7W A;  4ZJZ A;  2D45 A;  2G9W A;  4L18 B;  2O5R A;  3E7L A;  2EH3 A;  5IY5 H;  3IRR A;  1X3W B;  5D5W B;  3ERE D;  1E17 A;  1TW3 A;  2LY1 A;  2KJB A;  5DTD A;  1UMQ A;  1MNM C;  3PUF A;  2OTL I;  3ISP A;  3DEW A;  5HOO A;  5FKM A;  3RKY A;  2CUE A;  1QVT A;  3EYY A;  4QPQ A;  5FRO A;  4RAF A;  3SHF A;  4Y33 A;  4FCY A;  1V5E A;  2OU2 A;  2V26 A;  3FK6 A;  1R9T J;  1PDN C;  4LFU A;  4FX0 A;  3ZQH A;  4IQJ A;  5J1R A;  1U6G A;  2EV0 A;  1TBX A;  2LVS A;  2YPR A;  3CZ6 A;  4D1Q A;  5J4Y A;  2P0W A;  3DLL F;  1IXR C;  5K7H A;  2R7R A;  1O3Q A;  3QYF A;  1F36 A;  1YW8 A;  4B1R A;  2XV4 S;  2QBY A;  2NOG A;  3FHN A;  1NH3 A;  5KCM A;  2EIK H;  1FEX A;  1S9H A;  2VQC A;  3I71 A;  3I64 A;  1HW5 A;  3HL2 A;  3BZC A;  3F8M A;  5CVI A;  1AWC A;  1EF4 A;  3N97 A;  3G1L A;  3A1Y A;  1FSE A;  2GA2 A;  2I10 A;  3JSP A;  3FXU A;  4Q48 A;  2VUM J;  1XGS A;  1RIO H;  5FKK A;  4P9F A;  4CXF A;  3TDZ C;  3DQV C;  2UXN A;  2LBF A;  2P7C B;  3WGH A;  1ZAR A;  2ZFU A;  1RR8 C;  4FE7 A;  3OS0 A;  1BW6 A;  1VFC A;  3V7C A;  2LRE A;  2OTJ I;  4AYB A;  2L9N A;  3GXO A;  4PJM A;  3K70 D;  1HC8 A;  1S6L A;  1DP3 A;  3FX3 A;  4ESJ A;  1I27 A;  3J81 K;  3K4K A;  1NG6 A;  5J1Y A;  1QA6 A;  2CUF A;  2BHY A;  3E5U A;  5FKO A;  1R71 A;  2NVQ J;  3HTS B;  3MVP A;  2KRH A;  3DPT A;  4BAY A;  2JVH A;  2MC3 A;  3JRH A;  4XBF A;  5IOZ A;  3F8B A;  5CJ9 A;  5HLT A;  1TWH J;  3OWT A;  3JRA A;  4BY7 J;  1FMW A;  2AO9 A;  1U5T A;  1Z6T A;  2XGC A;  2E2H J;  1MGT A;  5IOY A;  2HR3 A;  1GXQ A;  4YIR X;  4EV0 A;  5HS7 A;  2JTV A;  1N75 A;  1XCB A;  2QBY B;  2V4J C;  2BVL A;  3ZQG A;  3CC2 I;  2J5O A;  1SAX A;  1H8A C;  1S7E A;  1MMN A;  1O7F A;  2DFH A;  2ZNY A;  3E1S A;  2LKS A;  1IRG A;  4HLX A;  1STZ A;  4P55 A;  1MIJ A;  2DJI A;  2Z33 A;  1FIP A;  4NHJ A;  2JWT A;  1RRJ A;  4B44 A;  2NXN B;  4II3 A;  2F5C A;  4ZDL A;  3WU0 A;  2JMW A;  3CJT B;  4M3E A;  4KFC A;  1WJA A;  3CCJ I;  4JOM A;  1PUF A;  3GTM J;  2QM3 A;  1Z21 A;  1BI2 A;  2HS5 A;  3E6B A;  4OAY A;  2L0K A;  2XRO A;  3CMY A;  4MEX F;  2I8D A;  3FXO A;  1E3O C;  1KU9 A;  3RKQ A;  3VPR A;  1TL8 A;  3PFI A;  4MFE A;  1YX3 A;  3E3V A;  3GZ5 A;  1WKM A;  5IT3 A;  1YX5 A;  2DDB A;  3PQK A;  2FX0 A;  2LRD A;  1X19 A;  3G6E I;  2BXZ A;  3FHZ A;  2VJJ A;  2FSW A;  4Q4Z F;  2BY0 A;  2JPB A;  2QGU A;  2KL4 A;  4AIK A;  2P6S A;  3HOS A;  1V55 H;  2KIQ A;  2LR8 A;  3RZO J;  2Y9Y A;  1G3W A;  3JRD A;  2CGP A;  2BY2 A;  2XGX A;  2W1O A;  2BY3 A;  3C1D A;  3BZ6 A;  5J8C A;  4CYC B;  2JA5 J;  2P8T A;  3SZT A;  4ETS A;  3TOB A;  3VYU B;  3K1M A;  1POG A;  1W36 C;  2HQN A;  3EYI A;  1DQU A;  3O6B B;  3C2B A;  2DFF A;  3BRO A;  3IL2 A;  1EKE A;  2OV7 A;  2RAE A;  3HC7 A;  3BQZ A;  3I58 A;  4EJO A;  3GTJ J;  2CYY A;  3FMS A;  1J5Y A;  2B9S A;  5ERI A;  4KIC A;  2FJ1 A;  1S3J A;  1F5T A;  4YG2 F;  4DJA A;  3HDD A;  4N9I A;  2CV0 A;  3E0J B;  3WTT C;  3JAM Z;  4IHT A;  4E6K G;  2EFO A;  5DCF A;  1WQ2 A;  3D5S C;  4LG0 A;  5K7F A;  3CCQ I;  2MG4 A;  3DBH B;  1DUX C;  1LKX A;  2LYC A;  3M9A A;  2X51 A;  2DQL A;  2M1B A;  1GUU A;  2QVO A;  3CJR B;  4UY8 I;  2ESH A;  3K0L A;  2LG4 A;  2KIF A;  4MNU A;  3IRQ A;  3LSI A;  4A3C J;  1ON2 A;  2DMP A;  5B3S H;  2L4A A;  2X0L A;  2OJE D;  4GO1 A;  5JHU A;  3KCC A;  3IH2 A;  3VSK A;  4ZYA A;  1MBE A;  4BQO A;  1B72 A;  2AQE A;  3NEU A;  2K9Q A;  2ZXH A;  2M7A A;  5J40 A;  5K1Y A;  1K4T A;  1HCR A;  4BQQ A;  2JA7 J;  2WB1 A;  1A6Q A;  4E7J A;  2JVG A;  1SD4 A;  2P5K A;  3KZY A;  3GFI A;  5DM6 F;  1L3L A;  3WU2 C;  1FWZ A;  2LNB A;  3MCZ A;  4F91 B;  1LJ9 A;  2VJI A;  3VYR B;  4ESB A;  1RUO A;  1VQL I;  2LF7 A;  3V8L A;  4ABZ A;  4HV5 A;  3I53 A;  3DBL B;  5LHI A;  4LG0 B;  1YS6 A;  1TC3 C;  1YJN I;  3DXJ F;  1VQ6 I;  2NAZ A;  4BEH B;  4J01 A;  1V54 H;  3FXJ A;  1GV2 A;  1FYK A;  1XX5 A;  2WBM A;  4I6Z A;  4IOA F;  2UUZ A;  1JGG A;  3B6A A;  1J2X A;  1Z6R A;  4Z6Y A;  2DXI A;  4ZYD A;  1J7K A;  1XGN A;  4BHB A;  4EM0 B;  3FXM A;  4OIQ F;  2CU7 A;  1RPW A;  1B72 B;  2A69 F;  3J7Y J;  2CQK A;  3ZMT A;  2ICW G;  1IN5 A;  3S8P A;  3U1D A;  1TWA J;  3PNV A;  4KIG A;  1JKP C;  4DGW B;  2XAU A;  3JSO A;  3CME I;  1IF1 A;  2KLO A;  2HDC A;  1Y39 A;  3OYI A;  3ZQL A;  5TRD A;  3S32 A;  4UB8 C;  2QSH X;  2R7T A;  1W7P D;  1IAW A;  2VL8 A;  3NAU A;  1ULY A;  3CJN A;  4XLN F;  1G2H A;  4A6E A;  1ZRF A;  1LE8 B;  2Q2E B;  3Q0W A;  3BJ6 A;  3R0A A;  1RZ4 A;  2DOE A;  2LFB A;  1AOY A;  2K3P A;  1W36 D;  2R5Y B;  4U87 A;  3WTW C;  2JN6 A;  3VSL A;  1OR7 A;  2E2J J;  1R5H A;  5E3L A;  4LB5 A;  2QSG X;  2VKH A;  1T08 B;  1S72 I;  2HVS A;  3REO A;  4KMF A;  4RBO A;  3FK7 A;  2E1M B;  4RLQ A;  3KPH A;  3F6V A;  1UAA A;  4D9J A;  2XAH A;  2HQR A;  5FLX K;  2ME0 A;  3SFZ A;  2EZK A;  1YIJ I;  1R23 A;  1ITY A;  1SD6 A;  5CVJ A;  1R5I D;  2FU4 A;  4B09 A;  2HEO A;  3QPH A;  3LAP A;  3DF8 A;  2MYS A;  1BOB A;  2EV5 A;  3WE3 A;  1JTX A;  1I3Q J;  1FJL A;  2Y30 A;  2JRM A;  3KP6 A;  4N4O B;  3F9K A;  3I9V 2;  4NB5 A;  3VYT B;  4ENK A;  2W82 A;  1F1Z A;  1SFO J;  1H9T A;  3GTQ J;  2VQG A;  3QU3 A;  1YYV A;  1T38 A;  2GXB A;  2W4S A;  1K78 A;  2EV6 A;  1AU7 A;  1FTT A;  3ML6 A;  1QVU A;  1LVK A;  1ZLJ A;  3D5R C;  2EQR A;  4I76 A;  4M9X A;  1GT0 C;  2XB0 X;  4XR6 A;  2DAO A;  4FAS D;  2CH0 A;  3H5R A;  4KIT B;  3ZRG A;  4AVZ A;  1ZG3 A;  3ROU A;  1WCM J;  1WVR A;  2E7W A;  3FZV A;  1LFU P;  2A5W A;  4M3G A;  2FA5 A;  5CQE A;  1TT0 A;  2XUB A;  3PIO F;  3FKI J;  1OLT A;  1SEU A;  4XQF A;  4I99 C;  4PSW A;  1B9N A;  1GLN A;  1VQ5 I;  3HOW J;  2HXI A;  5F1J A;  2L4M A;  5DDG A;  1OCZ H;  2CQX A;  2H1K A;  1OQY A;  2NS8 A;  1ZRD A;  4L5I A;  2P7V B;  2M7B A;  3I59 B;  3PFY A;  3U9G A;  2XAS A;  1LQ1 A;  1R00 A;  1D0X A;  3HUG B;  1G4D A;  2K4J A;  1D8J A;  2CG4 A;  2OCE A;  2ID6 A;  1Y6I A;  3M7G A;  4C3I J;  2PMZ N;  4C3J J;  5JHF A;  2HOE A;  1X2N A;  2V1D A;  3IH4 A;  2PMU A;  4QLC U;  4U0W A;  3I4M J;  1ETX A;  1XSX A;  4WCG A;  4R79 A;  1IUF A;  4HX4 A;  1P92 A;  4IRG A;  5E1X A;  3TKY A;  3HKZ A;  2XVC A;  3LFU A;  2MW8 A;  1Y8R B;  5E1W A;  1TWF J;  5ICC A;  1RC9 A;  2IS2 A;  3Q0V A;  2M0M A;  2A6E F;  2DMN A;  1L0O C;  3IKV A;  4LIU A;  5BQT A;  2ZO4 A;  3GTO J;  3V7R A;  5FGM A;  5EGO A;  2R3S A;  5ED4 A;  4AIJ A;  5JLW A;  3HBL A;  3JTG A;  4ZZD A;  5FD6 A;  2O61 A;  4PJ0 C;  1MKM A;  2E60 A;  2FRH A;  3SEZ A;  4HOB A;  1LFP A;  3S2W A;  1R4M B;  5CKT A;  1FPQ A;  1ENH A;  1QU3 A;  5J47 A;  2G7U A;  3CCU I;  3BG9 A;  4DIQ A;  5IP9 J;  5LEK A;  3AG1 H;  1P4X A;  2IGN A;  4BKX A;  1MDM B;  3S1R J;  4MLO A;  2K3F A;  1PP8 F;  3HB9 A;  3LSG A;  2EIJ H;  2JQ7 A;  5LGN A;  4NUB A;  5HLH A;  4OAZ A;  4DYR A;  2L02 A;  1QZE A;  3H9G A;  5E8G A;  3A0B C;  2CW7 A;  4M73 A;  5EEH A;  5J3L A;  5LRR A;  5FFZ A;  5L3E A;  1YLF A;  2V6C A;  2RC4 A;  3E5X A;  2E1O A;  3ZMS A;  5EJC A;  5ICG A;  2CQQ A;  2F4O B;  1X4P A;  4CA0 A;  2XAJ A;  1TW2 A;  1BA5 A;  2GZW A;  4BUP A;  2JA8 J;  2P81 A;  4L5E A;  3K6G A;  2Q8K A;  1Z05 A;  4BU2 A;  2HVR A;  1ZHF A;  2GIZ A;  5CVU A;  4YFN F;  1NK3 P;  1I39 A;  4FIS A;  2Q1Z B;  2W85 A;  3IH3 A;  2EIL H;  2XKO A;  1BW5 A;  2DA2 A;  2EFQ A;  1VI0 A;  2DLL A;  5M5Y J;  3DWL E;  2MSY A;  4BQN A;  2ZME B;  2E35 A;  5A2Q Z;  4BL0 B;  4PJL A;  2PJR A;  2JJ7 A;  3E5Q A;  3RSN A;  4DBR A;  1T8I A;  4BE0 A;  1ZLK A;  1ETW A;  1YW9 A;  4M6X A;  3Q5F A;  4ITV A;  2VIX A;  1NK2 P;  1Z9C A;  3KYD B;  2DQR A;  1D1A A;  1G3S A;  3VFZ A;  1SD7 A;  2VE8 A;  3DCF A;  2A5Y B;  4HX8 A;  4BJ5 C;  6PAX A;  2IS1 A;  2WV0 A;  3QPL A;  4S04 A;  4PGG A;  4HPQ A;  3GLX A;  1VQP I;  3ZXS A;  1EH7 A;  2VKE A;  3ULQ B;  1N25 A;  2CQN A;  2Z5U A;  1TTY A;  1QPM A;  3JRE A;  1DP7 P;  3Q9S A;  1CF7 B;  3ZGK A;  1SAU A;  2E1M C;  1FY7 A;  5FLM J;  1FIA A;  4RB1 A;  2O8X A;  3W6V A;  2FML A;  1DPR A;  4RMN A;  2F5F A;  5IYD J;  4LLL A;  4I0B A;  5E20 A;  1JKR C;  2ISZ A;  3PQJ A;  2WC2 A;  3I4P A;  2EA2 A;  5EEG A;  3KZI C;  1E0E A;  2F2E A;  4EVI A;  3L2U A;  1SC7 A;  2O8K A;  1UST A;  5TIS C;  3TBI A;  2MLG A;  4OIP F;  5DV5 A;  3TED A;  2Z99 A;  4AC0 A;  2CS3 A;  4X0G A;  3NWS A;  1HW2 A;  3K69 A;  1ETK A;  1HST A;  4A3F J;  1T56 A;  3ZR8 X;  2KPM A;  1KQ0 A;  2FBH A;  1Z0X A;  3CC7 I;  1P2F A;  1BR4 A;  3CDL A;  5F08 A;  4PJN A;  5F0C A;  4ZH4 F;  2XPV A;  1Z7L A;  1VQ8 I;  4ASN A;  4MTD A;  5FFX A;  3R60 A;  4CCM A;  4ZYG A;  2PI0 A;  3HOV J;  3QQA A;  1HXD A;  4A3M J;  3HRU A;  1OYW A;  2K5C A;  2ZKZ A;  5K5Q A;  4B4C A;  4RLF A;  2HTS A;  1UFM A;  4WXD A;  2M30 A;  4DQ2 A;  4FQG A;  1MMD A;  1Y56 A;  3SEQ A;  1A35 A;  3LMM A;  1JTY A;  4GRI A;  5E3O A;  1X1P A;  4NBQ A;  1C0W A;  3O3K A;  2I5U A;  2JSC A;  2LLK A;  3ABK H;  3SFI A;  4RB3 C;  3GTG J;  5DEQ A;  1YHQ I;  2ZSI B;  4U7B A;  3J7Z I;  1LEA A;  4A3L J;  3BCB A;  3MFK A;  3H0D A;  1W5C C;  2QKM B;  4L0Y B;  3JRC A;  2VKD A;  5H2F C;  3P9C A;  1NG7 A;  3FF5 A;  4FTH A;  4PFP A;  2VKV A;  3FM5 A;  3WTU C;  2K9S A;  4E7L A;  3AG4 H;  4L0Z B;  2QQ8 A;  3HOT A;  1A04 A;  3IV5 A;  1WH5 A;  4C2M J;  3DP7 A;  4IPA A;  1TQM A;  3D1N I;  3SQN A;  3AG3 H;  4XKW A;  2DPD A;  2TCT A;  2E71 A;  4A3E J;  1RES A;  4BJT A;  5D8L B;  1WH7 A;  2A68 F;  2M34 A;  3P9I A;  2BOL A;  1ZG5 A;  3FIW A;  2EZI A;  5LHH A;  3BR6 A;  4BYY A;  2DOD A;  1R36 A;  4E7K A;  1MBJ A;  1XGO A;  1S29 A;  5C3E J;  1S7A A;  4D7N A;  2GBY A;  4M74 A;  1GVD A;  1MH3 A;  2IBD A;  1UJ8 A;  1ONV A;  2BHZ A;  4HQE A;  3S3O A;  1MZB A;  5F0F A;  5DYM A;  1F4K A;  1SFX A;  2V9V A;  4EGY A;  2O7O A;  3R61 A;  4BAC A;  2NVY J;  4PZJ A;  3RPU D;  3BP8 A;  4I7H A;  2IGO A;  1U0J A;  3TW6 A;  4WK8 F;  1T33 A;  2COM A;  4AWX B;  3CQZ J;  1AKH B;  3A0H C;  4UUS B;  4A3K J;  1WGX A;  4YEJ A;  1VQK I;  2RNG A;  1KYZ A;  2DA6 A;  4ENM A;  5E8I A;  3S1N J;  4GCV A;  3HZJ A;  3M8F A;  3R4K A;  2EA4 A;  2XAQ A;  2QSF X;  1PVE A;  3OYD A;  3JRI A;  4NQW A;  3GTP J;  2EFN A;  4LB6 B;  2D5V A;  3P7N A;  1JUP A;  5EG0 B;  4NNJ A;  5AIQ A;  4LLG F;  1OPC A;  4L9J A;  2ZBK A;  2Y69 H;  1IDZ A;  5TGT A;  1MNE A;  5HDG A;  2L01 A;  1XD7 A;  4HAM A;  1B9M A;  1IXC A;  1Z3Y A;  3WTX C;  3S2D J;  4MIM A;  4FET A;  5M3M J;  4MTE A;  4IRI A;  1WJE A;  3KLN A;  4WX9 A;  2CRG A;  1NHA A;  2JUC A;  4M6V A;  3HIF A;  3J80 Z;  5L3G A;  1SD5 A;  1UZC A;  2M5W A;  3K4L A;  4ZYH A;  1FNN A;  4QSH A;  3BTI A;  1T95 A;  3EUK L;  3FDY A;  1X2M A;  4JP0 A;  2BYV E;  2IVM A;  1R49 A;  1XG1 A;  1ZRE A;  2H94 A;  1YRN B;  1D0Y A;  5D5V B;  3H1C A;  1LVA A;  4NQW B;  5FD5 A;  3G71 I;  1HSJ A;  4AU7 A;  3OYA A;  3WTV C;  1XC5 A;  1QHH D;  1ETV A;  4D7M A;  4QIW N;  1V5G A;  2QCO A;  2WY7 Q;  4U0V A;  4CIC A;  3L2V A;  4XOP A;  5GTI C;  4IHV A;  3VDX A;  4CYC A;  1AHD P;  2TRT A;  4LGW A;  2ELK A;  1R58 A;  3QP6 A;  4MGR A;  2NS0 A;  2MLK A;  1DDN A;  1U9O A;  2D1V A;  4O3M A;  3HHH A;  3PSI A;  2EIN H;  2L5Q A;  2Y75 A;  1BR2 A;  5E18 F;  1MJA A;  3S1Q J;  2E19 A;  1APL C;  3S3N A;  2BE5 F;  3BTC A;  2FOW A;  1MJB A;  4E7Z A;  2VC0 A;  4UVA A;  1MBK A;  3OS1 A;  2F6C A;  4RB0 A;  4F7Z A;  2KZV A;  2HZD A;  1QRY A;  1HKS A;  5LRS A;  3CCM I;  3BR5 A;  2L54 A;  2GOM A;  2X6O A;  5ILV A;  3QP5 A;  3QAH A;  4W97 A;  3JR9 A;  2EFW A;  4U7D A;  2E5N A;  4BQA A;  1QQI A;  2CV2 A;  1JKO C;  1FBQ A;  3U21 A;  2KIM A;  3WG9 A;  1RNL A;  1P4A A;  2FQ3 A;  2DT5 A;  1OCO H;  4OOI A;  3ZQI A;  4IO9 F;  2BBY A;  1Z7U A;  2HQ5 A;  2CW8 A;  1KU7 A;  2CQ7 A;  3F3X A;  1MMA A;  3KIO A;  1ETO A;  3BG3 A;  3NRV A;  4EMS A;  5HDN A;  1EH8 A;  1W1W E;  2DTZ A;  2FBI A;  2MH2 A;  4WF2 A;  2ELJ A;  5D5X B;  3HPH A;  2Y9Z A;  3QRF F;  1QBJ A;  3ZCO A;  4BGD A;  1OFC X;  3AFH A;  3HSF A;  4ZTF A;  4IRH A;  3RQI A;  4DW6 A;  2K9L A;  2PMZ A;  1ZEL A;  2MGQ A;  3BT9 A;  3H92 A;  3DLA A;  3PJR A;  1YQA A;  3WOD F;  2MBF A;  5F1R A;  4HQM A;  4HV6 A;  2Z1D A;  3ZMV A;  3EDP A;  4F3Q A;  5GP9 A;  2EZH A;  1VTN C;  2DMT A;  1W0T A;  1YJW I;  3OR2 C;  1X1C A;  3D5L A;  2VI6 A;  1I1S A;  4M3B A;  3ZQ7 A;  4U88 A;  4JX5 A;  2X6W A;  3L2W A;  1WRJ A;  4LLN A;  4CZC A;  2NVX J;  3RKX A;  4BEH A;  3MWM A;  4I01 A;  1JJ8 C;  3KEO A;  5LGU A;  2PQ8 A;  3W2W A;  2DPU A;  2C6Y A;  1DPU A;  1LDD A;  1IRX A;  2ADU A;  3HSR A;  3I55 I;  4AM3 A;  2HPM A;  3M4O J;  5KK1 A;  2WAQ A;  4KIB A;  4L5J A;  2NYX A;  3GX4 X;  4ENJ A;  2DDA A;  2HGC A;  2CFX A;  2DYS H;  4HDU A;  2W24 A;  3HJE A;  3ZN1 A;  1MSE C;  2VE9 A;  4BH9 A;  5FLV A;  2R7Q A;  4ZC3 A;  4EJW A;  1HKQ A;  2VON A;  3JRG A;  3TMO A;  2LSO A;  1MMG A;  2KRF A;  2F5E A;  3DEE A;  3LSP A;  3B6C A;  3MZ8 A;  1O3R A;  1SVL A;  1FP1 D;  4PDK A;  5B1B H;  4A6D A;  1GDT A;  1BI0 A;  4HBL A;  4U0Y A;  5HLG A;  2LKX A;  3HSE A;  1BIA A;  4I0A A;  2H1L A;  3BCA A;  3I4N J;  3G1M A;  1LE8 A;  2Q2E A;  5JFR A;  3RPU A;  4A12 A;  1IUY A;  1K4S A;  4EEF G;  2HNH A;  3JRF A;  1ZGJ A;  4E70 A;  4XRS G;  2R5Y A;  4M71 A;  2W00 A;  1NTC A;  1IDY A;  3OYC A;  3AAF A;  2R7Z J;  1EJ9 A;  3PUB A;  1SVM A;  4JYK A;  4RDU A;  2WY8 Q;  3PNT A;  1S8N A;  2R7W A;  4G8X A;  4BHC A;  2OPT A;  4XLH A;  3BJA A;  2H09 A;  2QQA A;  2VAS A;  2R7U A;  1JHF A;  2CV1 A;  3BY6 A;  1OCP A;  4FT8 A;  2EB7 A;  1V5F A;  1LEB A;  3DU6 A;  3F8F A;  3AKZ A;  3HHG A;  2DFE A;  5GAD J;  4KN7 X;  2V9K A;  3V42 A;  4V2F A;  9ANT A;  3MKL A;  1A5J A;  1XGM A;  5F64 A;  5EEA A;  4DYQ A;  3GCM A;  2BXY A;  3GTK J;  3BPV A;  3CCL I;  2K85 A;  4L9N A;  4N4N B;  3E6D A;  4AD9 A;  2UWM A;  1O4X A;  2LOO A;  2VOD A;  3H0G J;  4JBA A;  5HDK A;  4XLE A;  1J75 A;  1HDD C;  3U1K A;  3BZK A;  3GTL J;  3H5A A;  2HKX A;  1ZAO A;  2XHK A;  1K6O A;  5KNL A;  2A6H F;  3QYE A;  2QYO A;  4HLY A;  3QOE A;  3N4M A;  4ANJ A;  2E7X A;  2GAU A;  2AHQ A;  2B0L A;  3MAJ A;  2X6X A;  3CDI A;  1V3F A;  4B48 A;  1J0R A;  3K4M A;  4KA4 A;  1R1T A;  3G3Z A;  2QZ8 A;  2PMH A;  3SZP A;  3DKX A;  1IN8 A;  2V79 A;  3S3M A;  1EA3 A;  1D1C A;  1JI8 A;  3VYS B;  3ZMU A;  3SZG A;  2F4I A;  1Y8Q B;  4CDG A;  2K4B A;  5ICE A;  5CVR A;  4CUG A;  2P5V A;  4KYW A;  4XKB A;  3IKT A;  4LK0 F;  3CMM A;  2YR2 A;  2E1N A;  1OMI A;  4YFX F;  5EDN A;  3I59 A;  3P5J A;  2GLO A;  3T8T A;  5IT9 Z;  1Z77 A;  2M9H A;  4KIF A;  2ZXW H;  3HUG A;  3OR1 C;  5L3D A;  2R7F A;  3I0T A;  5FKN A;  4LIV A;  2KP6 A;  1G3T A;  5KVR A;  3ECO A;  4FX4 A;  1F9N A;  4IX7 A;  5HNH A;  5ILS A;  1H89 C;  3EET A;  2FD5 A;  2ETH A;  4ZTJ A;  1I1G A;  3O8G A;  4R1H A;  2NVU B;  3V7S A;  4S0H B;  4M6Y A;  4EJV A;  2R92 J;  2JPC A;  1HKT A;  2H8R A;  2D1H A;  1JHH A;  1QZY A;  2MD0 A;  2L7M P;  2QA4 I;  3IUO A;  1RUN A;  2R7X A;  2LH9 A;  1UCR A;  1J09 A;  2EZL A;  4OIN F;  3LSJ A;  4X6A J;  1IJW C;  3G1O A;  2Y48 A;  2P5L C;  5A2Q K;  1IZ1 A;  1U9N A;  3RPQ A;  2QEX I;  1BC8 C;  2JZY A;  4UXN A;  1B6A A;  2B63 J;  3F22 A;  4EQQ A;  3IC7 A;  4BBR J;  5F6F A;  1S5L C;  3I5U A;  4RM3 A;  1MDM A;  1VQ4 I;  3BR3 A;  3LSK A;  1HLV A;  1I3A A;  2A05 A;  4LMY A;  2HTJ A;  4IL6 C;  1B59 A;  1Y1V J;  2HI3 A;  4F55 A;  1TLH B;  2HZT A;  3GFJ A;  2O9L A;  5CPR B;  1B4A A;  1FOW A;  2DK8 A;  3CF5 F;  1DGW Y;  1KU3 A;  2H6C A;  3C2G A;  4HF0 A;  3DKW A;  2MA3 A;  2ZJQ F;  5M3F J;  1DU0 A;  3ZPL A;  3VEP A;  3VOE A;  2DI3 A;  4V19 K;  4M3F A;  2EWN A;  4XNF A;  3RJP A;  2DT6 A;  1WSU A;  4ENN A;  2EBI A;  2M87 A;  1U2W A;  4KT5 C;  1FYM A;  4OMZ A;  1ZN2 A;  3M8E A;  3RTR A;  1S7O A;  5LHG A;  2KIU A;  3K1P A;  4Y7N J;  2VOO A;  3W2A A;  1W5S A;  4H0E A;  3CUQ B;  2F5V A;  4RAZ A;  2Y0S N;  2KJC A;  2STT A;  5H6Q A;  2WAF A;  1JKQ C;  3FXR A;  4D0P A;  1TNS A;  2O6G E;  1O3S A;  3S93 A;  4CCJ A;  1W4M A;  3PO3 J;  3H9J A;  3K9T A;  4RA2 A;  2L2O A;  4XRM A;  2L7Z A;  2ZME A;  1UB9 A;  3VOD A;  1Y0N A;  3BTJ A;  3W2V A;  2VPL A;  3F23 A;  3ONQ A;  4W1U A;  1G59 A;  4A69 C;  3NWT A;  2DTR A;  3ERM A;  1QPI A;  2CO5 A;  2ACJ A;  5BNG A;  2VLA A;  1MH4 A;  3NAR A;  2PX9 A;  2XAF A;  5FLX Z;  3OYB A;  1SMY F;  2Q0O A;  3BOQ A;  3WHB A;  2N8G A;  3LST A;  3LA2 A;  2NNN A;  4CCL A;  1T98 A;  4Q5S F;  2HYJ A;  3TP3 A;  1X1B A;  5HVQ C;  2WB1 N;  5IP7 J;  3KFW X;  5L3F A;  1ZR2 A;  1CF7 A;  5IPA A;  2HWV A;  1BOA A;  3ASN H;  4G7O F;  3LFK A;  2IAI A;  3HGY A;  3GZ6 A;  3CTA A;  2RV8 A;  4YRV A;  3JTH A;  3H35 A;  3L9F A;  1EH6 A;  2OA4 A;  1MBF A;  1TQI A;  2VQH A;  1K6Y A;  2WV1 A;  3CC4 I;  2XKP A;  1CGP A;  4UB6 C;  2VC1 A;  2Y0M A;  2F48 A;  4B3A A;  2DA3 A;  3MQ0 A;  4BXU A;  2ZC2 A;  1T6S A;  2CWE A;  3OY9 A;  1XCV A;  3LOC A;  3OL3 A;  4Z2Y A;  1IV8 A;  3F21 A;  2IS6 A;  2LC2 A;  1KGS A;  1IO2 A;  4ZYE A;  2QEN A;  5GAG J;  2GXG A;  1SVO A;  3FBN B;  4P9U A;  5LGT A;  1TQP A;  2QKL B;  3OYM A;  2K86 A;  4G12 A;  2WAD A;  2BVM A;  2HOA A;  1QNT A;  3HRT A;  1PP7 U;  2CJJ A;  4RM2 A;  4RGR A;  2LK2 A;  4KJZ A;  1I6X A;  5EZG A;  1ON1 A;  1YG2 A;  4CSW A;  1X1D A;  5D4R A;  3RQ4 A;  1WJC A;  4E7S A;  4G6T B;  2RQQ A;  5E79 C;  5J6X A;  4KNY A;  1Z1D A;  1BL0 A;  4GXO A;  3MN2 A;  4HNU A;  1MJ9 A;  3DTI A;  3ZP5 A;  4BDZ A;  1JXS A;  4XID A;  2XF5 A;  1R5G A;  3CLQ A;  2VBX A;  2XSJ C;  3CD6 I;  4B43 A;  4CCN A;  2AQF A;  2X9D A;  4EGZ A;  3QOP A;  4XRF A;  4LIT A;  2DCE A;  4UNO A;  2KZG A;  2M4K A;  2DT7 B;  1XSV A;  2ID3 A;  3IAS 2;  4D5F A;  2M45 A;  1XDU A;  3FM3 A;  5GAH J;  4L9V A;  2W84 A;  1SFE A;  2HU9 A;  2LD5 A;  3X2Q H;  2RVC A;  5J1U A;  1E3H A;  5LLQ A;  4UUT A;  1D0Z A;  1WI3 A;  2HPI A;  1VQ9 I;  2V6E A;  3M3Y J;  3S1M J;  1AA7 A;  4Y52 J;  3C18 A;  2JUG A;  4B8X A;  4BDY A;  3F8C A;  5AON A;  4C30 A;  4XN0 A;  3L2C A;  3FMQ A;  1M1E B;  3L00 A;  4DYC A;  3F6O A;  3W6K B;  4AIH A;  2VBY A;  3C3W A;  2HOT A;  1IRF A;  1KZH A;  5LEJ A;  2PG4 A;  1OIS A;  1LDJ A;  2BW3 B;  3G2B A;  3MD2 A;  1BC7 C;  4P1W A;  1G3Y A;  3LSM A;  1IXS B;  3J80 K;  1X3U A;  3CCS I;  4XIC A;  1ETY A;  2HOS A;  4OU0 A;  2KKO A;  2Z3Y A;  4Y3O A;  3PNY A;  3HG9 A;  1WHU A;  3A02 A;  2X4H A;  4AVP A;  3OMY A;  1ZGW A;  4A3B J;  1FTZ A;  3GVA A;  1K7A A;  3HRS A;  1AKH A;  3ECH A;  3UKG A;  4XOT A;  4UUS A;  1HF0 A;  2YX7 A;  1BI1 A;  4MO7 A;  3LWF A;  4IKF A;  5LBQ A;  2R5Z A;  5E17 F;  4A0Y A;  1JUS A;  4NC6 A;  3KET A;  4RAG A;  2BEO A;  3OYF A;  4N0B A;  3BTL A;  3RDI A;  3GYH X;  4JX6 A;  1IG7 A;  1ZGA A;  2VQL A;  5HS8 A;  2Z16 A;  4EM2 A;  1RR7 A;  5IP6 A;  4A3I J;  4GYI A;  4M72 A;  1ZH5 A;  2R93 J;  3WTY C;  4OMY A;  4CCK A;  1R22 A;  3MEX A;  5GTH C;  2OZU A;  3WTS C;  3OIO A;  5EG0 A;  1Z67 A;  5HLI A;  4A3D J;  3S2H J;  3QPT A;  2PBI A;  3FIS A;  2RRE A;  1A36 A;  5J4V A;  1I5Z A;  2JK3 A;  1GV5 A;  5BMZ A;  3UR3 C;  3F0C A;  2K02 A;  4BE1 A;  4IHX A;  1UHW A;  3FWE A;  2CMP A;  2M3A A;  4C2U A;  2EIM H;  3CP2 A;  3MZH A;  1OYI A;  3CUQ C;  3HYI A;  2DMQ A;  1LUJ B;  4UUV A;  2NOJ B;  5TJJ A;  1Z91 A;  1J59 A;  3A4C A;  1HDP A;  4IQ4 A;  5HS9 A;  2ZXI A;  4E7I A;  3DPL C;  3HKZ N;  2R5Z B;  3DU5 A;  2AXT C;  4XRS A;  2WWY A;  5C4J J;  2ISY A;  3KE2 A;  1X4O A;  5M5X J;  3JW4 A;  4HF2 A;  2X1C A;  2YS9 A;  1OJL A;  1YRN A;  2MC4 A;  4C3H J;  2P6T A;  1I6H J;  2XC7 A;  1A31 A;  3AG2 H;  1FLI A;  2V1U A;  5C4X J;  4XON A;  4A0Z A;  2P4W A;  1GHC A;  1JT6 A;  4UVC A;  2IGM A;  2GM4 A;  5J8F A;  3BR0 A;  3K10 A;  2XIG A;  1ACI A;  2YU3 A;  1SMT A;  3BLY A;  1LPQ A;  4II2 A;  3A03 A;  3K4B A;  2E2I J;  4UV9 A;  1WPK A;  4UHT A;  3KP5 A;  4DNC A;  5C44 J;  1BJA A;  1BM9 A;  2PEX A;  1R4N B;  2DYR H;  3E6M A;  2ZJ2 A;  4PJJ A;  3G4S I;  2K9N A;  5GPC A;  3OSF A;  2KRC A;  3KLO A;  4XSX F;  3KP2 A;  2XRN A;  3ZOB A;  2L9R A;  3IHU A;  2GIV A;  4FE4 A;  3T1B A;  2LY9 A;  4XOR A;  1RI7 A;  4F93 B;  3A01 A;  3BWG A;  2L3D A;  2ZXJ A;  3JAM K;  1MD0 A;  2DU9 A;  5DD8 A;  5KAI C;  2V7F A;  4CO8 A;  3KEQ A;  2ZME C;  1H9G A;  3FXL A;  3CES A;  3K1N A;  3DTE A;  1RKW A;  3COA C;  1OCR H;  2CUJ A;  4V2G A;  4P5O A;  3ZQF A;  2G0E A;  2GOX B;  3Q3S A;  5E3M A;  2FOK A;  1YIT I;  2HXO A;  4IEJ A;  4C2T A;  4F52 A;  1P9Q C;  3LAJ A;  3GLL A;  2IA1 A;  2HFH A;  1FMV A;  3C7J A;  4HSR A;  3FMR A;  1JJ6 C;  1WWX A;  2MD5 A;  1E2X A;  3OS2 A;  4XM3 A;  2JT1 A;  1SAN A;  3H3Z A;  1LFB A;  2BY1 A;  2PLY A;  3GZN B;  5D8K B;  4G9Y A;  4BXX J;  1ZYR F;  3K2Z A;  2ZCW A;  3O8H A;  2FXA A;  3LL7 A;  4GGG A;  4QWQ A;  4PSX A;  1XSD A;  2OF7 A;  1VQO I;  5B5E C;  2W25 A;  3RCO A;  1R1V A;  2HYG D;  3O2P E;  4XKC A;  4IJA A;  3A01 B;  1G8X A;  1D3Y A;  2DJN A;  3OIQ A;  4KN4 X;  3BQY A;  3OL4 A;  2YX4 A;  1UEL B;  1T0F A;  4XL9 A;  2QF7 A;  3L09 A;  1JGS A;  2OQG A;  1FP2 A;  4O6J A;  2VOP A;  3TW7 A;  1T2K A;  1FX7 A;  2MAB A;  3M1E A;  2H27 A;  1IV6 A;  2IJL A;  2VBW A;  3KX2 A;  5F04 A;  3CF2 A;  1UG2 A;  2WAE A;  2LBF B;  4AUX A;  4QTR A; 
#chains in the Genus database with same CATH homology
 3H3V K;  4HNV A;  2AHQ A;  2W48 A;  5J3L A;  3HOX J;  3RZD J;  2DA5 A;  2COB A;  2E1O A;  3GBG A;  3OOU A;  2CQQ A;  1BA5 A;  2JA8 J;  5M5W J;  3BG5 A;  5JLX A;  1Y1W J;  2P81 A;  4L5E A;  5HOD A;  4NDL A;  2YUS A;  1JUM A;  5EDN A;  3E7L A;  3OSG A;  1NK3 P;  2GLO A;  2EH3 A;  1Z77 A;  2M9H A;  2XPU A;  4FIS A;  3IH3 A;  1BW5 A;  2DA2 A;  1VI0 A;  5DTD A;  5M5Y J;  2ECC A;  1UMQ A;  2MSY A;  5FKN A;  1MNM C;  2DMU A;  1ETQ A;  1ORK A;  3DEW A;  1Q1V A;  5FKM A;  2JJ7 A;  2CUE A;  1QVT A;  1ETW A;  1X58 A;  1H89 C;  1NK2 P;  5EF6 A;  2FD5 A;  4FCY A;  1PUF B;  3FK6 A;  1R9T J;  1K83 J;  1ZK8 A;  3O8G A;  3DCF A;  3ZQH A;  4S0H B;  5J1R A;  3QPL A;  2R92 J;  2H8R A;  2LVS A;  1MBH A;  2VKE A;  2DA1 A;  3JRE A;  2L7M P;  5K7H A;  1VF9 A;  3HOY J;  2EZL A;  1F36 A;  3LSJ A;  5FLM J;  4B1R A;  1FIA A;  1IJW C;  4X6A J;  2L7F P;  3G1O A;  2Y2Z A;  3W6V A;  2NOG A;  5IYD J;  1U9N A;  1FEX A;  1JKR C;  2LTP A;  3LNQ A;  2B63 J;  1RKT A;  1EF4 A;  3TP0 A;  3G1L A;  2XB5 A;  4BBR J;  2O8K A;  2I10 A;  2VUM J;  1ZQ3 P;  2XGD A;  3BR3 A;  2ME6 A;  1HLV A;  3PM1 A;  3TED A;  4AC0 A;  2M2E A;  1Y1V J;  2HI3 A;  5FJ8 J;  5FKK A;  1ETK A;  4A3F J;  2O9L A;  1T56 A;  4FE7 A;  1DU6 A;  1BW6 A;  1VFC A;  1Z0X A;  5M3F J;  3CDL A;  1DU0 A;  5F08 A;  3BR2 A;  1MSF C;  3CCY A;  5F0C A;  2XPV A;  4M3F A;  5J1Y A;  4A3J J;  2CUF A;  5F0H A;  5FKO A;  2NVQ J;  3MVP A;  2FQ4 A;  2EBI A;  3HOV J;  2XSD C;  3QQA A;  4A3M J;  5EYR A;  3JRH A;  5IOZ A;  1TWH J;  3JRA A;  4BY7 J;  2AO9 A;  4B4C A;  4J19 A;  2XGC A;  2E2H J;  5IOY A;  4IHW A;  4Y7N J;  1JTY A;  2Y0S N;  3ZQG A;  5E3O A;  1H8A C;  1S7E A;  1JKQ C;  2LLK A;  3SFI A;  4GFB A;  1ZR4 A;  3GTG J;  3PO3 J;  1FIP A;  4XRM A;  2L7Z A;  4BBS J;  2K40 A;  2JWT A;  4A3L J;  2KT0 A;  1W0U A;  3BTJ A;  3S14 J;  2JMW A;  4M3E A;  3JRC A;  4W1U A;  5IYB J;  4A69 C;  3QPS A;  4FTH A;  1PUF A;  1QPI A;  3GTM J;  2VKV A;  5BNG A;  1MH4 A;  3NAR A;  2L0K A;  2K9S A;  3CMY A;  5FKL A;  1E3O C;  2HDD A;  3RKQ A;  3VPR A;  3WHB A;  2N8G A;  1VND A;  4MFE A;  3IV5 A;  1MBG A;  1WH5 A;  4C2M J;  3D1N I;  2HYJ A;  3TP3 A;  5IP7 J;  2FX0 A;  2WB1 N;  1ZR2 A;  2TCT A;  5IPA A;  4A3E J;  1RES A;  2IAI A;  3HGY A;  4X1E A;  1B8I A;  1WH7 A;  2M34 A;  4AYB N;  3RZO J;  2LR8 A;  3FIW A;  2EZI A;  2Y9Y A;  3BR6 A;  1MBF A;  3JRD A;  1HOM A;  1MBJ A;  5C3E J;  4A3G J;  2WV1 A;  2Y31 A;  4D7N A;  2GBY A;  1GVD A;  1MH3 A;  2IBD A;  4B3A A;  4CYC B;  2DA3 A;  2JA5 J;  5F0F A;  1U8B A;  2O7O A;  3LOC A;  1POG A;  3WHC A;  2NVY J;  3Q0U A;  1P7J A;  2LP0 A;  3TW6 A;  3C2B A;  1H88 C;  1T33 A;  4D5C A;  3CQZ J;  1JT0 A;  1AKH B;  4MFD A;  2RAE A;  4UUS B;  1D5Y A;  4G12 A;  3BQZ A;  4A3K J;  1WGX A;  1P7I A;  3GTJ J;  2HOA A;  2DA6 A;  2CJJ A;  2FJ1 A;  3S1N J;  2LK2 A;  5EZG A;  3HDD A;  2NS7 A;  3ZQC A;  1XS9 A;  5K7F A;  2MG4 A;  3JRI A;  1BL0 A;  3GTP J;  3MN2 A;  2D5V A;  1JUP A;  5EG0 B;  2NVT J;  1B8I B;  1GUU A;  4XID A;  1IDZ A;  4A3C J;  2X9D A;  2DMP A;  3S15 J;  2R0Q C;  2ID3 A;  4D5F A;  3IH2 A;  2XPW A;  3S2D J;  4DZJ A;  1MBE A;  4MIM A;  5M3M J;  1B72 A;  1TWG J;  2LD5 A;  2K9Q A;  1HCR A;  5J1U A;  2CRG A;  5EZH A;  4M6V A;  2DN0 A;  2JA7 J;  4UUT A;  3HOU J;  1WI3 A;  3M3Y J;  3S1M J;  4Y52 J;  4QSH A;  3BTI A;  1IC8 A;  1X2M A;  2IEK A;  4JP0 A;  5F27 A;  4DYC A;  1XG1 A;  4ABZ A;  1YRN B;  2HOT A;  4XK4 A;  2JA6 J;  2M8G X;  1TC3 C;  1GV2 A;  1XC5 A;  4D7M A;  1ETV A;  4QIW N;  2QCO A;  1OCT C;  3S17 J;  4I6Z A;  4IHV A;  4CYC A;  1AHD P;  2TRT A;  1JGG A;  3B6A A;  4XIC A;  2ELK A;  1ETY A;  2HOS A;  1U9O A;  3A02 A;  1ZGW A;  4A3B J;  2CU7 A;  1RPW A;  1B72 B;  1FTZ A;  3S1Q J;  2E19 A;  1APL C;  1AKH A;  3UKG A;  4UUS A;  1HF0 A;  3BTC A;  4MO7 A;  2ECB A;  2R5Z A;  2WAQ N;  1TWA J;  5IYC J;  1JUS A;  1MBK A;  1JKP C;  3BTL A;  1QRY A;  4JX6 A;  3BR5 A;  1IG7 A;  3ZQL A;  5DS9 A;  2X6O A;  3NAU A;  1RR7 A;  5IP6 A;  4A3I J;  2R93 J;  4W97 A;  3JR9 A;  1G2H A;  2ZB9 A;  1A6I A;  1LE8 B;  3OIO A;  1U78 A;  3Q0W A;  5EG0 A;  3L1P A;  1JKO C;  4A3D J;  3S2H J;  2LFB A;  4JX4 A;  3FIS A;  2R5Y B;  1ZTR A;  3SJM A;  2JK3 A;  2JN6 A;  3ZQI A;  2E2J J;  5E3L A;  1GV5 A;  3F0C A;  4IHX A;  4DZP A;  4RBO A;  2HQ5 A;  3FK7 A;  1K61 A;  1ETO A;  3BG3 A;  2ME0 A;  1ITY A;  2EZK A;  4M3D A;  2M0C A;  1BJZ A;  2DTZ A;  2DMQ A;  2Y9Z A;  1OFC X;  1HDP A;  2DA4 A;  3RQI A;  4DW6 A;  4LOC A;  5EGO B;  3HKZ N;  2R5Z B;  2MGQ A;  3BT9 A;  4XRS A;  5C4J J;  1JTX A;  1I3Q J;  1FJL A;  5M5X J;  4A93 J;  2XRL A;  2Y30 A;  5GP9 A;  2EZH A;  3HOZ J;  2DMT A;  1W0T A;  2YS9 A;  1OJL A;  1YRN A;  4C3H J;  1SFO J;  3GTQ J;  1I6H J;  2VI6 A;  5GPA A;  4M3B A;  5C4X J;  4JX5 A;  1JT6 A;  2GM4 A;  1AU7 A;  3BR0 A;  1FTT A;  1QVU A;  2NVX J;  4I76 A;  2EQR A;  1JJ8 C;  3A03 A;  1GT0 C;  2E2I J;  2XB0 X;  1WPK A;  5C44 J;  1CQT A;  3M4O J;  1WCM J;  1IGN A;  2K9N A;  2XGE A;  5GPC A;  3OSF A;  1LFU P;  4M3G A;  1MSE C;  5FLV A;  3ZOB A;  3S16 J;  2L9R A;  3FKI J;  4FE4 A;  1TWC J;  2LY9 A;  1I50 J;  3K7A J;  3A01 A;  3JRG A;  2VPR A;  3HOW J;  2HXI A;  5F1J A;  3LSP A;  3B6C A;  2CQX A;  2H1K A;  2NS8 A;  3HGG A;  1RKW A;  1GDT A;  4V2G A;  1IRZ A;  2LKX A;  3ZQF A;  2G0E A;  3Q3S A;  5E3M A;  3I4N J;  2HXO A;  3G1M A;  1LE8 A;  4IEJ A;  2ID6 A;  4C3I J;  2PMZ N;  4C3J J;  3PO2 J;  3JRB A;  3HEF A;  3K2A A;  4EEF G;  3JRF A;  2R5Y A;  4XRS G;  1X2N A;  3IH4 A;  3I4M J;  1ETX A;  1NTC A;  1IDY A;  2YU9 J;  2R7Z J;  1JJ6 C;  4JYK A;  3BR1 A;  1IUF A;  1SAN A;  3HM5 A;  4RDU A;  1LFB A;  2OPT A;  2MW8 A;  4BXX J;  1TWF J;  3SDG A;  3O8H A;  1OCP A;  3Q0V A;  5E3N A;  2OF7 A;  2DMN A;  4V2F A;  9ANT A;  3GTO J;  3A01 B;  3MKL A;  5EGO A;  1A5J A;  5JLW A;  1UHS A;  3HBL A;  3LSR A;  2DJN A;  5EEA A;  4DYQ A;  1ZKG A;  2KDZ A;  4IHY A;  3BQY A;  3GTK J;  1ENH A;  2X48 A;  4BY1 J;  1RET A;  2DA7 A;  2QF7 A;  3BG9 A;  5IP9 J;  1O4X A;  3TW7 A;  3H0G J;  4BKX A;  3S1R J;  4MLO A;  1F43 A;  1HDD C;  3HB9 A;  3LSG A;  1IV6 A;  3GTL J;  5F04 A;  1UG2 A;  4DYR A;  5K7Z A;  4AUX A;  4QTR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...