4Y52J

Crystal structure of 5-carboxycytosine recognition by rna polymerase ii during transcription elongation.
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for 5-carboxycytosine recognition by RNA polymerase II elongation complex.
pubmed doi rcsb
molecule tags Transcription/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 16
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2015-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4y52J00
1RR7A 2O7OA 1QVTA 2XGDA 4D7NA 1ZKGA 2EZLA 3BR0A 3SDGA 1O4XA 2DJNA 2X9DA 3GBGA 3HKZN 4M3FA 1UG2A 2LKXA 1PUFA 3GTMJ 3G1MA 1DU6A 2XB0X 5K7HA 1YRNB 5IP7J 2HXIA 3HOVJ 3BG3A 3F0CA 4BY1J 2JMWA 4MO7A 5JLXA 1JGGA 4QIWN 4A3IJ 2CUEA 5M5WJ 3K2AA 2K9QA 1JUSA 2FJ1A 2GM4A 2DTZA 3BT9A 5FKLA 1PUFB 3BR3A 1GDTA 2GBYA 4XIDA 4Y7NJ 1MNMC 3C2BA 3O8GA 2DA5A 2XPVA 3LSJA 5FJ8J 1OCPA 5M3FJ 3HB9A 2CRGA 4AUXA 4UUTA 3A01B 2NOGA 3LSGA 1JKRC 2LTPA 3RZOJ 4HNVA 2LY9A 1Q1VA 1WI3A 1ZQ3P 1GV2A 4QSHA 2HQ5A 5J1RA 3DEWA 1WCMJ 1IJWC 4JP0A 1A5JA 2LK2A 3TP0A 2JK3A 3SJMA 2R5YA 4M6VA 3GTQJ 2M2EA 2MGQA 2PMZN 1JJ8C 3W6VA 5J3LA 4GFBA 2B63J 1U9NA 3FK6A 4J19A 3OSGA 2Y9ZA 2JWTA 1IUFA 1K83J 4FE4A 4NDLA 4B1RA 1Y1VJ 3FIWA 1H88C 4A3CJ 2ECCA 1MBJA 2HOSA 2VKVA 2ME0A 1ETWA 3A03A 1Y1WJ 1MSFC 2OPTA 5EZGA 2TCTA 1U8BA 3D1NI 3S15J 1LFBA 1I50J 1OCTC 2CUFA 4A93J 3M3YJ 3NARA 5C3EJ 1Z0XA 1D5YA 2NVXJ 1IC8A 3E7LA 2EBIA 2E2IJ 4CYCA 2XRLA 2H1KA 1CQTA 2M9HA 2NVTJ 3QQAA 4IHYA 1ITYA 3IH4A 1B8IB 3QPSA 4D5CA 5GP9A 4AC0A 2DN0A 4UUSA 1K61A 5IOYA 1TWGJ 5EF6A 2CU7A 3ZQGA 3JRGA 3G1LA 1IDYA 2HDDA 1NK3P 1VI0A 4FE7A 2VUMJ 1RKWA 2L7MP 2DA4A 5IP9J 4A3KJ 2E2HJ 1IRZA 4B4CA 2K40A 2FX0A 3ZQIA 2Y30A 1OJLA 4MFEA 4FCYA 2E19A 2HI3A 2R93J 2LP0A 3JREA 3LSPA 5EYRA 4EEFG 1MBEA 1ETQA 3FISA 3Q0VA 2WAQN 3JRBA 3NAUA 4X6AJ 3JRFA 4RDUA 3IH2A 3JRAA 3FKIJ 3A01A 4RBOA 1JKQC 1TWHJ 3HOXJ 4A3EJ 4FISA 4V2FA 4Y52J 1LE8A 1JT6A 3HBLA 3GTLJ 1MBFA 5FLMJ 4DZPA 1RETA 3RKQA 1POGA 1U9OA 1TWAJ 2DA1A 5C4JJ 4C3IJ 5C4XJ 3S2DJ 5K7ZA 1JKPC 2QCOA 3B6AA 2WB1N 2G0EA 2YS9A 2EQRA 4M3BA 1P7IA 4D7MA 1NTCA 2JA6J 2LLKA 4BY7J 3WHCA 4G12A 1JKOC 5IOZA 2NVQJ 5E3LA 4MLOA 2VPRA 5E3OA 1BW6A 1IGNA 4C2MJ 1AKHB 1ETKA 5BNGA 1W0TA 5J1YA 3HDDA 2Y0SN 3BTIA 4DYQA 2DA6A 4QTRA 2HYJA 1JJ6C 1SANA 3IH3A 1EF4A 5F04A 1ENHA 3BTJA 1MSEC 3G1OA 2VKEA 4X1EA 1XS9A 3B6CA 4B3AA 4IHVA 1WPKA 5F27A 3S17J 4IHXA 1HLVA 4FTHA 5F0HA 4I76A 1X2MA 1XC5A 2XB5A 3ZQCA 1HDPA 1OFCX 2HOTA 2WV1A 4BBRJ 1FIAA 3Q0UA 2XPWA 2ME6A 2R5ZB 2AHQA 2GLOA 1S7EA 4M3EA 3TW6A 5HODA 1F36A 5EZHA 2ID6A 5EGOB 4JX5A 1MH3A 1LE8B 1WH7A 2DMPA 5EDNA 1E3OC 4A3FJ 1LFUP 1U78A 3ZOBA 4AYBN 3JRHA 3ZQLA 1QRYA 3MKLA 3BTLA 2COBA 4C3HJ 2NVYJ 1ETVA 1VNDA 3TEDA 2DMUA 1H8AC 3LSRA 3RQIA 3DCFA 2L9RA 1JUPA 1B8IA 1P7JA 3ZQFA 2P81A 1ZGWA 3JRIA 5IYCJ 3OOUA 3HM5A 3LOCA 4UUSB 2LFBA 3GTGJ 1BA5A 4JYKA 1T33A 5EGOA 4A3BJ 3HOUJ 2L7FP 1MH4A 3HOYJ 3Q3SA 2JA7J 2AO9A 5IYBJ 1XG1A 2YUSA 2NS7A 9ANTA 2R7ZJ 3MN2A 1T56A 3SFIA 2K9SA 3GTJJ 2E2JJ 3S1NJ 4I6ZA 2L7ZA 4XRSA 2FD5A 2Y9YA 5IP6A 1ZK8A 1AHDP 4ABZA 2YU9J 1GUUA 2W48A 2ECBA 5F0CA 1IDZA 5F1JA 4A3JJ 1HF0A 1IG7A 3CMYA 3UKGA 3BG9A 2DMNA 2R92J 3WHBA 1ORKA 2XGEA 4MIMA 3L1PA 4A3MJ 1FEXA 2M8GX 2ZB9A 5FLVA 1BL0A 2JA8J 1TC3C 4BKXA 1NK2P 5FKMA 1FIPA 4D5FA 5FKKA 1TWFJ 4LOCA 1ETXA 4XK4A 1DU0A 3CCYA 2RAEA 4V2GA 1ETYA 3JRCA 3FK7A 4MFDA 3H3VK 4A3LJ 3PO3J 4M3GA 4W97A 3HEFA 5EG0A 1APLC 1RPWA 3JRDA 3VPRA 5J1UA 2JN6A 5E3MA 2JJ7A 4CYCB 3CQZJ 1IV6A 5GPCA 3BTCA 5IPAA 2M34A 2IEKA 3O8HA 2VI6A 2N8GA 2LVSA 3BR6A 1HOMA 1QVUA 2HOAA 1HDDC 2LD5A 3OSFA 1WGXA 1F43A 4C3JJ 2D5VA 1JUMA 2E1OA 5C44J 1BW5A 4BBSJ 2XPUA 2KDZA 1W0UA 2EH3A 1GT0C 5GPAA 4L5EA 3BQYA 2TRTA 2XSDC 3S1MJ 1FTTA 5FKOA 1A6IA 2IBDA 3HGYA 1R9TJ 4IHWA 2NS8A 3I4MJ 5K7FA 2CJJA 1TWCJ 4W1UA 1GVDA 2K9NA 3S16J 3JR9A 3GTKJ 3HOWJ 2ELKA 2Y31A 5M5YJ 1QPIA 4BXXJ 2DA3A 2LR8A 2X48A 4DW6A 2JA5J 2DMQA 2DMTA 3PM1A 2R5YB 2R5ZA 1HCRA 3MVPA 3I4NJ 4M3DA 4JX4A 2O8KA 1Z77A 4DYCA 4A3GJ 1ZR4A 1FTZA 1ZTRA 3HGGA 1ZR2A 2XGCA 2HXOA 2M0CA 2QF7A 2R0QC 4DZJA 3GTOJ 2I10A 4A69C 1X2NA 3LNQA 3BR1A 2ID3A 2CQXA 3HOZJ 4XICA 1ETOA 3GTPJ 3RZDJ 3K7AJ 1FJLA 2MSYA 1MBGA 4XRMA 5M5XJ 1AU7A 3S1QJ 5EG0B 3S2HJ 1I3QJ 5M3MJ 5FKNA 2H8RA 3H0GJ 5F08A 1GV5A 2FQ4A 3ZQHA 4IEJA 2MW8A 3S14J 2DA7A 1B72A 3Q0WA 1SFOJ 3PO2J 1AKHA 1UHSA 3CDLA 1VF9A 2X6OA 1VFCA 1UMQA 3BG5A 3BR2A 1JTXA 3A02A 2O9LA 2DA2A 2CQQA 4S0HB 2MG4A 1RKTA 5EEAA 1JTYA 1JT0A 4A3DJ 3BQZA 3M4OJ 3OIOA 3IV5A 1RESA 1B72B 1BJZA 4XRSG 2Y2ZA 1I6HJ 5IYDJ 3TW7A 2IAIA 3S1RJ 1G2HA 5DS9A 1H89C 2EZHA 2KT0A 1MBHA 1WH5A 4JX6A 1MBKA 2EZIA 5JLWA 2L0KA 1YRNA 3BR5A 4DYRA 5DTDA 1X58A 2OF7A 5F0FA 3TP3A 5E3NA 2EZKA 3QPLA
chains in the Genus database with same CATH superfamily
1RR7A 2W85A 1QVTA 2FA5A 2XGDA 4Y15A 3G71I 2VXZA 1ZGJA 2W82A 3TQNA 2IS1A 4G7ZF 2IGOA 4A2UA 3KIOA 3GBGA 2LKXA 4M3FA 1UG2A 3ZN1A 4RA2A 3ZPLA 3EUAA 3WG9A 1U5TC 2KIQA 3HZJA 2E60A 5FD5A 2R7UA 2EIKH 1I5ZA 1S9HA 3JAMZ 3WGHA 3HHHA 3FXLA 1IW7F 2JMWA 3CC7I 2FE3A 1YFHA 2DK8A 3CLOA 3OYCA 3TGNA 4IL6C 5M5WJ 5CQEA 3IUOA 5HLIA 2A05A 2GM4A 2DTZA 2HWVA 3BT9A 3CJRB 3BR3A 3IHUA 4M71A 1MNMC 3C2BA 2XPVA 3K9TA 3KP7A 1S3JA 4WCGA 4AUXA 5JVGF 2CUJA 3MZYA 4L9TA 3V7SA 4MEXF 4HF2A 2R7SA 2MA3A 3LSGA 3OR2C 2ZBKA 4KYWA 2DXIA 1I1GA 2GAUA 1WI3A 2HQ5A 2X6WA 4HDUA 2L5QA 1HBXG 3D5SC 1BJAA 4L9VA 5D5XB 4JP0A 5FROA 3QPHA 5LGUA 3J7AO 4KICA 3KEQA 1J09A 2L54A 2IPQX 1Z3YA 3OYGA 4LD5A 4GFBA 3DBRB 1IO2A 1U9NA 3REOA 2ISZA 1WJAA 2DOFA 3CUQA 4FE4A 4G6TB 4NDLA 4B1RA 4DGWB 1L3LA 3FIWA 2ECCA 3CCJI 3E6BA 2ME0A 2Y0MA 3LA2A 5CVIA 4CZZA 2GXGA 3A03A 1W5CC 3QYEA 3WTTC 2RDPA 4UXNA 2G9WA 1I50J 4NC8A 1YYVA 3JAMK 3J7YJ 3NARA 3CUQC 3P7NA 4B09A 2IS4A 5CLSA 3MZHA 3C7JA 1VQKI 4RLQA 4JQFA 4CYCA 2XRLA 2A5YB 1U6GA 3N05A 3E3VA 3QQAA 2XIGA 4FQGA 1B4AA 5TISC 2OZ6A 3IH4A 1B8IB 3QPSA 2XF6A 4M74A 1STZA 2CV0A 4C2TA 3OR1C 2L2OA 3GFJA 1B8IA 5ICFA 1HSTA 3ZQGA 2M0MA 1IDYA 3CTAA 1NK3P 3RDIA 4XKBA 5LBQA 1DP7P 4LG3A 1A31A 2BY1A 2FX0A 2OV7A 5GAEJ 2VT2A 1OJLA 2ZFWA 4FCYA 2HI3A 4A6EA 2P6SA 5DDGA 5EYRA 3FMRA 2MH2A 3FISA 3Q0VA 3JRBA 3NAUA 4AIHA 3L00A 4RDUA 1XGSA 1SFEA 2DJIA 2VQHA 4A3EJ 4FISA 4AD9A 2Y75A 4XN3A 4Y52J 3GTLJ 2ZNZA 3F72A 5FLMJ 4DZPA 4HPQA 3RKQA 1R1VA 2OCEA 2WAQA 1XPXA 1K4SA 1ZN2A 5TGTA 1MDMB 1SD5A 4C3IJ 4EM1A 2HTJA 4I09A 1OCCH 1V5FA 3ISPA 4EGZA 1P4XA 4P55A 2EQRA 1P7IA 3LWFA 1NTCA 3ONQA 2JA6J 2LLKA 3KZYA 1IN4A 3VWBA 2GA2A 3RKWA 5IOZA 5E3LA 2O0YA 3JTHA 3CP8A 3M8EA 1XMKA 4CDGA 3QYBA 2ACJA 2JVGA 1AKHB 4Y17A 3HDDA 1U0JA 4HQEA 1A35A 3DV8A 5J4YA 2Y0SN 1TNTA 2R7XA 2WBMA 1X1AA 3OWTA 5GTIC 5HDKA 1ZLKA 1KGSA 3IH3A 1DUXC 1EF4A 3H36A 4IXAA 3MCZA 3H9QA 1ENHA 3BTJA 5DUIA 2DT6A 4HZFA 3DU6A 2VKEA 3G1OA 4HQMA 3V42A 5L3BA 4F55A 1FOXA 2BEOA 2K02A 4Q48A 1ODDA 4I76A 1PVEA 2EV0A 2XB5A 2FXAA 3ZQCA 1TQMA 2CQ7A 2Z99A 3CZ6A 4LMYA 3OYKA 2XPWA 5KCMA 4RM3A 1EH6A 4E70A 2R5ZB 1YTYA 3PFYA 3PNYA 4ZC3A 2A6HF 2GLOA 2Z9OA 3ECHA 1S7EA 2NAZA 2PG4A 3FBIB 5E1ZB 3ULQB 5HODA 1FYLA 1F36A 4A0ZA 5ERIA 4HYEA 4XNFA 3RI4A 2X6YA 1LE8B 3I59A 2F6CA 2W25A 1E3OC 4A3FJ 4ESJA 4BHBA 1OYWA 2BHZA 2IVMA 2FMLA 2L4MA 1KYZA 3KP6A 4PJNA 4LITA 1X3ZB 3IKTA 3ZQLA 1QRYA 4C3HJ 2DTRA 1FWZA 1A6QA 2COBA 2H09A 3BROA 5DM7F 1IUYA 1NG7A 2DMUA 2V6CA 3LSRA 3VOEA 3DCFA 1TNSA 1JUPA 2IA2A 1X1CA 2JPCA 4QWQA 1JXSA 2IJLA 1IN5A 4YIIA 2CV2A 2D2WA 2P4WA 3LOCA 4OAYA 4UUSB 2VE9A 4XLNF 2LH9A 1T33A 1NHAA 2KKOA 2X1EA 4A3BJ 2A6TA 2XAHA 1Z7UA 2L7FP 3H5AA 2BY0A 4XKWA 5E18F 4ENJA 1LDKB 2BY2A 5IYBJ 2R7FA 2YUSA 2VC0A 4P96A 3MN2A 3M7GA 4XLPF 5LEJA 1IXRC 5HDNA 1E3PA 1EH7A 1FSEA 3P9IA 3K4CA 2OJED 2QGUA 2L7ZA 1OR7A 2Y9YA 5IP6A 4LLGF 2DDBA 2UWMA 4ABZA 3H0DA 2XAQA 1GUUA 1FP2A 4H0EA 4KIBA 4L5JA 1T98A 4UVCA 4YFNF 5F1JA 3DPUA 2DFHA 1G8XA 1TT5B 3AKZA 3CMYA 2EIMH 1IG7A 3BG9A 3L2WA 1UELB 2H94A 3WHBA 2XGEA 3CO7C 3L1PA 3LAPA 1FEXA 4EJTA 1LVKA 2ZB9A 4KISA 4S05A 2CFOA 3GLXA 5FLVA 1BL0A 2JA8J 2PI0A 1M1EB 1G6NA 5FKMA 4D5FA 4PUSA 5FKKA 4F3QA 3EDPA 2RQQA 4JK1X 1SC7A 3JW4A 2KRHA 1ETXA 4XK4A 2X51A 5JFRA 3CCYA 2AXTC 2Z2SB 1XCBA 2FQ3A 3K4KA 4NQWB 5AIQA 1MJAA 2MYSA 2ELHA 4BQQA 1D8KA 1MW7A 2MH9A 3MQ0A 5K5OA 4M3GA 4W97A 2VJ4A 2W84A 2XAFA 2ZJPF 3GLLA 5DCMA 3K6GA 1D5VA 2MC4A 3DTEA 4F93B 2KMUA 1IN8A 3VDXA 2CW0F 1V55H 3HHGA 1XD7A 3CQZJ 2RV8A 2XC7A 5DCMB 1IV6A 2PJRA 4G7OF 2IEKA 4DNCA 4HV6A 3FXOA 2YX7A 4RM2A 2LVSA 2CV1A 1KQ0A 1HOMA 2LD5A 3O2PE 3HRUA 4E7HA 2BW3A 1Z6TA 3GUDA 5IT3A 2D5VA 1JUMA 3H1CA 5B5EC 5C44J 2K85A 2CUZA 4BBSJ 1W0UA 2PMUA 1VQ9I 1SFXA 2WAFA 3EETA 1RC9A 3BQYA 3ZXSA 2TRTA 3P9CA 3S1MJ 4M9ZA 2M4GA 2G7UA 4JOMA 3MD2A 2CS3A 1K78A 2ZXJA 1GVDA 3KX2A 4W1UA 1D8JA 1R5HA 3S16J 3ELKA 3GTKJ 3HOWJ 2L9VA 3R0AA 2ELKA 2JPBA 1NH3A 2BOLA 1QPIA 4DW6A 4HLYA 2JA5J 2R5ZA 2R5YB 2HYFA 1YJ9I 1XGNA 2VODA 3T5XA 2OA4A 3OIQA 2O8KA 4DYCA 1YG2A 3I54A 3BY6A 1ZR4A 1LJ9A 2K4JA 2P7CB 1K6YA 2BZTA 4MQVA 3BR1A 4CA0A 3KCCA 1J5YA 4XICA 3HOZJ 4ZYDA 3M1EA 4BDZA 2JUGA 2HFHA 3ASNH 4XRMA 4P9FA 2P6TA 1FSHA 2DW4A 5EG0B 4OU0A 3S2HJ 4HW0A 1GXQA 1I3QJ 4XMYA 1PDNC 2F4MB 3BDDA 4ESBA 3KEYA 2PMZA 1BOAA 3K0LA 4IEJA 2EFWA 1B72A 1X3UA 1SFOJ 3DXJF 1G4DA 1Z21A 1RIOH 1EA3A 3I58A 1G3WA 1B1BA 2LYCA 2X6OA 2VQGA 2NNYA 1VFCA 5D6EA 3FXUA 4EV0A 3LSHA 3LAJA 4HA8A 1R36A 2K3FA 3PQKA 4I01A 3A02A 3K4MA 3R61A 3HJEA 3IAS2 2FMYA 1AWCA 2DBBA 1W4MA 1JT0A 4QLCU 3OYIA 4A3DJ 1GVJA 3NRVA 5H20A 3KPHA 3PIOF 3OIOA 5DV5A 1FOWA 1B72B 1BJZA 3H92A 4CCJA 2JSCA 3KZZA 2BVLA 2Y69H 3W2VA 2FNAA 2HTSA 1G2HA 2RC4A 1DPRA 3L2UA 3DU5A 1IN7A 1I1SA 4XSZF 2TDXA 2EZIA 1W5TA 3KFWX 4DYRA 5DTDA 2OF7A 1USSA 2KJBA 4XN0A 5F0FA 1Z9CA 1J0RA 4Y13A 1TQIA 3QPLA 4MGRA 4ZDLA 1ZKGA 1DDNA 3L7WA 3BP8A 3BR0A 3VB2A 1EJ9A 4B47A 1Z1DA 1CF7B 2K9LA 4ENMA 4U0WA 3HKZN 1KYWA 2OAZA 1D3YA 1MZBA 2DPDA 1ZG3A 3GTMJ 2RQPA 2VASA 3G1MA 2EA2A 2XB0X 4KITB 1VQ4I 3G6EI 2W57A 2XGXA 5IP7J 1YHQI 5FGMA 3HOVJ 2JRTA 3BG3A 5BS6A 1XGOA 4KNYA 4BJ6C 4MO7A 1V54H 4D9JA 3IRQA 3H3UA 2QQ8A 1LDJA 1YW9A 2WTEA 3GF2A 5DD4A 2CUEA 4ETSA 3K2AA 3QWLA 1IZ1A 3O3KA 2GBYA 2XSJC 2O3FA 4BE1A 1R5GA 2LF8A 2QVOA 3O8GA 2DA5A 1OCZH 1PP7U 3A4CA 3E5QA 5M3FJ 2FBHA 4AIKA 4I98B 5GTHC 2BXYA 2NOGA 3A01B 5JI6A 1JKRC 1ZH5A 2JSPA 2M45A 4XORA 3OYMA 4FT8A 1UHMA 4QSHA 5J1RA 1Y39A 4CXFA 2E36A 3Q9VA 1F1ZA 3A2KA 3EYYA 4EVIA 4CO8A 4L18B 2D1VA 2LK2A 1UG0A 3TP0A 2R5YA 4M6VA 3W6VA 3C3WA 2QBYA 2P0WA 2K3PA 2LF7A 2F5FA 3KETA 3CC2I 2B63J 4J19A 5CKTA 4EM2A 1HKSA 1IUFA 3W6KB 3L2CA 3LSIA 3GW2A 1TTYA 3H5NA 1QA6A 3GXOA 1R1TA 2VKVA 4A6DA 5M5YJ 1Y56A 5DCFA 1MSFC 1SMTA 5EZGA 1D0ZA 2QEXI 3G73A 4AVPA 2CW7A 3S15J 4IF4A 2OUMA 2CUFA 4A93J 3M3YJ 1TT0A 1Z0XA 2ZFUA 5DUKA 5D5UB 4R79A 4OMYA 4KMFA 4M73A 3J80K 1VQNI 2NVXJ 1IC8A 2OCCH 3WTSC 2M4KA 1QPMA 2H1KA 3R0JA 1CQTA 1KONA 1R49A 3IL2A 4YFXF 2M8EA 4B43A 4CYDA 2STTA 1LEAA 2E1MB 3EUHA 3BC8A 1S72I 2YPRA 2X4HA 1W7PB 2QYOA 1VI0A 4EJVA 2IP2A 3CF2A 1ZREA 4NB5A 2GXBA 3WU0A 2E2HJ 3CESA 3SYTA 2GWRA 3S3MA 1DP3A 1ZRCA 2K40A 4ZTFA 2L7KA 1SD4A 3ZQIA 5ICCA 2RKHA 3OY9A 2HGCA 4MFEA 2E19A 2LP0A 3RYPA 2G7HA 2NS0A 4EEFG 4AIDA 2V9VA 1YOVB 1V5GA 4BHPA 2F5EA 4RBOA 4CH7A 2EFPA 2YU3A 3SZPA 3DPTA 4XM3A 3WTYC 4U87A 1XB4A 1LQ1A 3C2HA 1DGRM 3CCRI 2CYYA 2CH0A 2LBFA 1OCRH 3S3OA 3RYRA 2VQCA 4HDVA 3WU2C 2C6YA 2A68F 1G3TA 3SFZA 2HDCA 5C4XJ 2V1NA 4IX7A 2OTLI 3BPVA 2YS9A 1R5ID 2V1XA 4M3BA 1XN7A 4O6JA 5BPDA 2O03A 4BY7J 3WHCA 4PDKA 1JKOC 4HBLA 2E1CA 2NVQJ 4HOBA 4NNJA 3WGGA 3IKVA 3V7RA 3RSNA 1DPUA 3K1NA 4MLOA 2EJRA 1WQ2A 2VONA 5CVUA 2Q8KA 5BNGA 1YJWI 5J1YA 3OYHA 1FLIA 3AL0B 1I27A 1DQUA 2HPIA 2DA6A 4QTRA 5JHUA 1OQYA 5F64A 4ZJZA 1SANA 1SMYF 2JA2A 2WA0A 3EYIA 2DQLA 4EJOA 2K4BA 4B3AA 1X3WB 1UFMA 4IHVA 5K5RA 4FTHA 5F0HA 3J81K 2CQKA 3AAFA 3VEPA 1X19A 1REPC 5JVTA 3CUQB 2BE5F 3CMMA 2K27A 1W7PD 4IOCF 4F91B 3ABUA 2WV1A 4PK4A 5HLTA 3MKWB 5FFZA 1FYMA 1FIAA 2D45A 3Q0UA 2QWWA 2KPMA 3FX3A 5KHDA 4IPAA 2HPMA 3TDZC 4IVNA 1BI3A 4CCLA 2ZSHB 4YG2F 4M3EA 4OMZA 4BE2A 2EV6A 3K10A 1FP1D 3WU1B 2ID6A 5EGOB 1MH3A 4AU7A 4NUBA 3V8JA 3S8PA 3V8KA 4JBAA 4RB2C 3F6VA 4GDFA 3MWMA 3ZCOA 3JRHA 1Y0NA 3PJRA 1B9MA 3I4PA 2H27A 3TEDA 1FOYA 2KDOA 4J00A 3E6MA 1UZCA 4XKCA 1PP8F 1WVRA 2YR2A 2V79A 1IXCA 2B7EA 3ZQFA 4ENNA 2P81A 2FOKA 5IYCJ 1QQIA 2LFBA 4N9IA 1BA5A 4JYKA 2BVMA 2NOJB 5BMZA 1P92A 5EGOA 2GOMA 1WSUA 4X0GA 3RQ4A 1QBJA 4BQAA 1RR8C 3HOYJ 2J5OA 5AONA 4BEHB 2JA7J 1P4WA 3HG9A 5E8IA 3DWLE 2NS7A 2JUCA 4BEHA 1T56A 1E0EA 2Q2EB 3HOTA 3GMEA 2O5RA 5EEGA 3VYTB 1HKQA 2FD5A 1OKRA 3GZ6A 3F8NA 2PQ8A 1AHDP 5E1XA 5KAFC 4HNUA 1E2XA 3WE3A 2YU9J 2W48A 2BGCA 3WG7H 2ECBA 3HTSB 1YS7A 1HF0A 1GXPA 2CW8A 3WE2A 2F5VA 4DBQA 3UKGA 1C0WA 3I56I 1FMVA 4Y33A 4LGWA 2IA1A 1S7AA 4MIMA 1ULYA 2Q2EA 3WTZA 4WXCA 5L3DA 4MQ9F 3JTGA 3QYFA 4LIUA 1AOYA 1DGWY 3BZKA 5JHFA 1TWFJ 2AXLA 3CMEI 2OU2A 2P7VB 1DU0A 1S29A 2KJCA 1MNEA 3WTWC 4QPQA 2RAEA 1ONVA 4CGZA 1ETYA 4NHJA 1RZ4A 3JRCA 1O7FA 1ERDA 4P5OA 1WKMA 5IY5H 3H3VK 3VYUB 3PO3J 2QM3A 1SEUA 1HQCA 3F8MA 4WX9A 5HS7A 4BXUA 4RGRA 1APLC 1RPWA 4KN4X 3VODA 3JRDA 3ABMH 5J1UA 5H2FC 5HLGA 2A5WA 3ZMSA 1VQ6I 4ITVA 4CYCB 2QA4I 4KMUX 3OYLA 4MNUA 3WTVC 4BJTA 5IPAA 1EV7A 4L0ZB 1QHGA 5HVQC 3O8HA 3QP6A 5CVRA 1F9NA 2Z33A 3WTXC 3FXQA 5B1BH 4OOIA 3BR6A 4PSXA 5DYMA 2XVCA 2HOAA 1HDDC 4RMNA 3TKYA 2P5LC 3G2BA 1WGXA 3R4KA 4WXDA 3HC7A 2XHKA 2XPUA 3M8FA 5LD2C 5FD6A 2A3SA 2DYRH 5GPAA 4L5EA 1U3EM 3KYDB 3WGIA 2QQAA 5GAHJ 1TLHB 1VQ5I 4RGUA 2EFNA 1MGTA 2IW5A 2LNBA 2NXNB 2HKOA 3NEUA 2RNGA 2GIVA 3OIPA 3HGYA 5FKOA 1BI1A 5KVRA 4BE0A 2CGPA 2NS8A 1ZRDA 3I4MJ 2KLOA 3OS2A 2X1CA 4BACA 3TO7A 2K9NA 3HUGB 3JR9A 1FNNA 1WRJA 1O3QA 1R6RA 3V4GA 2KRFA 1V4RA 2LR8A 4OWRB 2DMQA 2DMTA 4UNOA 1MMAA 3HUGA 3KYLA 1JI8A 1HCRA 3I4NJ 3OV8A 3ZMVA 2VT3A 1HA8A 4JX4A 3K4JA 4O5VA 2Z5UA 3DTKA 3HSFA 4A3GJ 4ZYAA 1L0OC 3E6CC 1FTZA 3I0TA 2KP6A 2M0CA 2R0QC 2VXDA 4G8XA 1MD0A 2L3DA 1MJ9A 3L2RA 1T39A 2ID3A 3ZRGA 3KP2A 1ETOA 4I99C 2R7OA 5A2QK 2JQ7A 1LFPA 3BWGA 5M5XJ 1KQ9A 1AU7A 1T8IA 3IWZA 3D5LA 3S1QJ 1Z7LA 4ZDOA 5EJCA 4YIRX 5M3MJ 4U0YA 5F08A 2FQ4A 3ZQHA 2MW8A 3TL4X 1AKHA 4NC6A 4AM3A 2I8DA 4BYYA 1VF9A 4KIGA 1MMSA 3DFGA 1KQ8A 3CP2A 4XLCA 2M30A 5FO5A 3V7CA 3CUOA 1D1AA 5J47A 4IRHA 1K79A 1R1UA 5J40A 3LQQA 1MJBA 3HTUA 2MG4A 5JR3A 3KP3A 4L0YB 2HU9A 1JTYA 2DCEA 4B44A 4MEYF 3BQZA 3SZTA 3ZP5A 4CCOA 1PJRA 3GCMA 2RVCA 3CD6I 1KU2A 3VSKA 4XRSG 2Y2ZA 5LLQA 3IWFA 2EIJH 4IZZA 5IYDJ 4XBFA 4MTDA 3RPQA 3U21A 2Y0SA 1Y6IA 2XRNA 2KT0A 3H35A 1MBHA 1WH5A 2ETHA 3MKZA 4JX6A 2MD0A 2HQNA 2QQ9A 2R4GA 1JHFA 3M9AA 3OYEA 5D5WB 2O8XA 4J01A 3MEXA 2L0KA 1YRNA 1FC3A 1WJEA 2DOAA 3I59B 5B66C 2O7OA 4D7NA 3FM3A 3ROUA 5LHGA 1N78A 2E1MC 5ILVA 1A04A 1WI9A 1K78B 2EK5A 2DJNA 1HW1A 1BOBA 2Z3YA 2X9DA 5DEQA 1W36D 3N4MA 3R6SA 2XF7A 1DU6A 2DQRA 3HYIA 3QPTA 5K7HA 5K5QA 1YRNB 1ZHFA 2E71A 2VOPA 2F4OB 2L02A 5CQGA 2H6BA 4G6DA 1X4PA 3F0CA 4F52A 2VL8A 4WXHA 4BY1J 4XL9A 1T38A 5JLXA 4L5IA 4BXFA 3PSFA 1XDSA 4EJUA 5K1YA 1U5TA 3FKJA 1OMIA 3QU3A 3RTRA 1JUSA 3ABTA 4XONA 4Y7NJ 1VQMI 1H9TA 4XR6A 3LSJA 5FJ8J 2FF4A 1IRGA 3DEUA 1OCPA 3HB9A 4TV7A 5D8KB 2PFBA 3OYNA 3ASOH 4HSTA 3EQLF 3LA3A 2X1DA 1ZQ3P 3BG7A 1WCMJ 1BIBA 2IGNA 1NG6A 1O3SA 1A5JA 1B59A 2DLLA 2QKLB 2E5NA 2FSWA 2JK3A 3DKXA 2ESHA 1ZGAA 3GTQJ 2GOXB 2MGQA 1JJ8C 4BU2A 5J3LA 5LRSA 3UNGC 2ESNA 2A07F 2GIZA 4WWCA 2IT0A 4M9XA 3KYCB 2Y9ZA 3JSOA 5CPRB 5LGNA 4Z6YA 1XMAA 3TDUC 1H88C 3FXRA 3E5XA 1ETWA 4YELA 4II3A 4WK8F 3OYBA 1EH8A 1F4KA 2TCTA 2WY8Q 1U8BA 1LNWA 3D1NI 4E7IA 1LFBA 1T0FC 3F3XA 1OCTC 2BBYA 2IGKA 2HDWA 1YIOA 4XRFA 3R60A 1RUNA 3OS1A 1TL8A 2ZXWH 4E7JA 4N4OB 2ZO4A 1N77A 3D5RC 3GFLA 4IHYA 4IHTA 1XTAA 2XASA 1QO0D 2Q1ZB 4D5CA 5GP9A 2ZJQF 3FHNA 3OL4A 1TWGJ 5EF6A 4M6XA 3G1LA 2HDDA 3CJQB 3BJ6A 2KIMA 2VUMJ 3QU6A 4PFOA 4A3KJ 4XOPA 4R1HA 3RKYA 4YFKF 1IRZA 3T8TA 4B4CA 1ZG1A 3ZMZA 3I3LA 2M1BA 4LFUA 4BNCA 3J80Z 2WAEA 2ISYA 2FU4A 4A5NA 3JREA 1Z3XA 1BR2A 2KZGA 1MBEA 2ZMEC 3S2WA 1Z05A 4PSWA 2DFEA 5FRNA 4I0AA 2MABA 3HPGA 2VLAA 3A0HC 4ON0A 2PX9A 1OYYA 4MTEA 1SAUA 3A01A 1JKQC 2BV6A 4V2FA 1JT6A 2W1OA 4LB5A 2PMHA 5E8GA 1MBFA 3G4SI 2ZMEA 2UXXA 1TWAJ 4HSRA 3ZN0A 1YLFA 4GXOA 1WZ2A 2P8TA 4A0YA 3CF5F 2PJPA 5CJ9A 1X4OA 3GVAA 1JKPC 2QCOA 3B6AA 2G0EA 1XX5A 2ZCWA 4D7MA 4ENKA 2LSOA 2E1NA 2OZUA 1OLTA 1IF1A 4G12A 3TOBA 3DLAA 2LKPA 1V5EA 2XF5A 3OL3A 2UZKA 1T2KA 5E3OA 1IGNA 3A0BC 4C2MJ 4E7SA 1Y8QB 2DYSH 2BHYA 4N9HA 4XSXF 3GZNB 4DBRA 3NWSA 5HDGA 1CGPA 1SD7A 2K86A 3P9KA 3CCVI 1WJCA 2E35A 2HYJA 2HKXA 5E1WA 1WJ5A 1JJ6C 5LGTA 2M5WA 2EWNA 5F04A 2UV1A 3ZMUA 5B1AH 4UV9A 2VN2A 1FX7A 3PSIA 1XS9A 3B6CA 5E20A 1WPKA 5F27A 3S17J 4I0BA 4IHXA 1HLVA 3MKYB 3DF8A 4EGYA 5CVJA 3E1SA 2GXAA 4LLNA 1X2MA 2JRMA 2XAUA 3WODF 3PUBA 3BPXA 1HDPA 2F4IA 3RCOA 1OFCX 2HOTA 2H8WA 4PJLA 2JZYA 4BBRJ 2XV4S 2CSOA 3HKZA 3QAHA 4CCKA 3HRSA 1YIJI 4KIFA 5J6XA 3HRTA 2HVSA 2FNPA 3AG4H 3MAJA 3TW6A 3BCAA 4UB6C 3K70D 3CCMI 1R58A 4ASNA 1IN6A 2DMPA 5EDNA 2L9NA 2Z16A 2VC1A 1Y8RB 3V8LA 1U78A 4GGGA 4AYBN 2PLYA 4DOZA 3MKLA 4HEA2 3QRFF 1LB2A 3CLQA 1VNDA 1HKTA 1H8AC 1SVOA 2L9RA 2YX4A 1P7JA 1I3AA 3B02A 2EPFA 2QUFA 1X1DA 2X6XA 3OOUA 3JRIA 3DBLB 2FRHA 5FFXA 2LOOA 2ADUA 4KJZA 4ESFA 1H9GA 2RREA 1BN5A 1MH4A 2H6CA 3Q3SA 4K2EA 5E79C 3VFZA 1XDUA 2AO9A 3DBHB 1XSXA 1ON1A 2I5UA 4HV5A 4A12A 4CCNA 3LQRA 3CJNA 3KEOA 3K69A 2A61A 3D0SA 2QSHX 2BXZA 3LSTA 3SFIA 2K9SA 3GTJJ 3B73A 4A0XA 1SVMA 3S1NJ 4HNTA 3L9FA 4I6ZA 1SVLA 3AG2H 4OIOF 2WADA 4C30A 2OBPA 3RKXA 3F23A 1IRXA 3ZR8X 1YJNI 1P4AA 1T0FA 2XROA 1IV8A 5F0CA 4LK0F 4RGSA 2LY1A 3CO6C 1W36C 5A2QZ 2V7FA 4KDPA 4IRGA 3GX4X 2MLGA 2DMNA 2R92J 2A6EF 2W4SA 1OR7C 1ORKA 4FHTA 1WJDA 4A3MJ 4IHSA 5D8LB 2M8GX 4UB8C 2EA4A 4BKXA 1P9QC 2FOWA 2VKDA 1NK2P 4HX8A 2CO5A 4KA4A 1WFXA 2XAJA 1YS6A 2OQGA 4LJZF 2MFZA 4M72A 4L9NA 5FLXK 4V2GA 5FB2A 3FK7A 1P2FA 2EV5A 3OOPA 2EINH 3RIRA 4A3LJ 3HEFA 2ZXHA 3M1CA 1BM9A 2QKMB 2WC2A 2ZJ2A 2O61A 3VPRA 4IQ4A 2JN6A 4CSWA 3HPHA 1KU9A 1TZLA 3WTUC 4KUMA 3ECOA 2VKHA 2M34A 4E6KG 1YI2I 2IS2A 1KU3A 4QPOA 2DFIA 1BC8C 5CYVA 3DLLF 1QVUA 2DT7B 3OSFA 3ZMDA 4FX0A 2LG4A 4C3JJ 1YE9A 3PUFA 1YW8A 2E1OA 2ZSIB 1FZPB 1BW5A 3W2WA 1J59A 1USTA 3FMQA 4E7KA 1GT0C 1MMDA 6PAXA 4RAGA 2K5CA 2COMA 3F6OA 4KT5C 5H6RA 3QP5A 1XSVA 3CDIA 1R9TJ 2IBDA 2H1LA 5K7FA 5IT9K 1IAWA 2HR3A 3I9V2 2VBWA 5L3GA 2DPUA 3CDHA 4BXXJ 2DA3A 3PM1A 4BS9A 3MVPA 3TMOA 4RS8A 1VQPI 4M3DA 4CHUA 3GO5A 1Z77A 4M9SA 3O6BB 1G3SA 3DP7A 3I53A 1ZR2A 2HXOA 3EUHC 3GTOJ 5HS8A 1VQ8I 1GHCA 3ESWB 1E3HA 3LNQA 1ZARA 1R22A 4LLLA 2CQXA 5LFAA 3FDYA 3SDBA 1MMNA 3K7AJ 1FJLA 2MSYA 3HRMA 3F22A 1MBGA 3ZQ7A 1UAAA 3FXKA 3IP4B 1MDMA 4XLEA 5FKNA 3H0GJ 2H8RA 5E17F 4CUGA 1J75A 2V6EA 3S14J 3LSKA 2YSRA 4LIVA 1QZEA 5HNHA 3S93A 1UHSA 1MIJA 2P5KA 1S5LC 1UMQA 3PIPF 3BG5A 1D1BA 2P5VA 3FM5A 3BR2A 1FBQA 3HIFA 1UB9A 2ZKZA 4D0PA 3J7AY 2O9LA 2DA2A 2CQQA 2HQAA 4S0HB 4ZYHA 3W6JB 3T1BA 1RKTA 5EEAA 1G59A 1LPQA 1OCOH 2CQNA 2KZVA 4U0VA 3DTIA 4XLAA 2V1UA 4PGGA 3DKYA 4RAYA 3U9GA 4P9UA 1RESA 4PZJA 4EQQA 1FY7A 2F5DA 3LMMA 1I6HJ 2KRCA 5LHIA 3COAC 4RB1A 4XOTA 2M87A 3PL8A 4N0BA 2HVRA 2RGVA 1TP4A 5D4RA 1BR1A 4XKVA 2VQLA 3CMAI 1X58A 2DODA 3TP3A 4IO9F 2EZKA 2IS6A 4LB6B 3KP5A 2EZLA 5TJJA 2R7TA 2L4AA 3SDGA 3K1PA 2QQBA 3OS0A 3L2VA 4RB3C 2O6GE 2ZNYA 1O4XA 4U88A 4Q5SF 5ICEA 1BBYA 2OQRA 2FUG2 3QOPA 2DAOA 1SFUA 1PUFA 3F8BA 1RNLA 2D1HA 5ILUA 4HX4A 2HOEA 3SZGA 2LDUA 3F8FA 3AL0C 3FWEA 5LHHA 4DJAA 2HXIA 3K1MA 3FXMA 4BL0B 3E5UA 2QSGX 3G3ZA 2DI3A 1ON2A 2IGMA 5ICGA 3CJTB 3JSPA 2IRFG 1JGGA 4QIWN 4A3IJ 4B48A 3U2RA 2K9QA 2FJ1A 1B6AA 5FKLA 1PUFB 1J7KA 1YQAA 1GDTA 1W5SA 5LRRA 3FMSA 4XIDA 3ZMTA 1B9NA 1X1PA 1J9IA 3K4NA 1JE8A 4FASD 4II2A 2CRGA 4UUTA 1BI0A 4BGDA 2LTPA 2HZDA 1TBXA 2RNJA 3RZOJ 4HNVA 1T6SA 1Q1VA 2LY9A 2OC6A 1GV2A 2Z1DA 4OIQF 3DEWA 2FBKA 2M3AA 1QNTA 3U1DA 2XDVA 4UVBA 4N4NB 3GFIA 1IJWC 1MMGA 1N75A 2X85A 3SJMA 2DT5A 3A1YA 4WF2A 2M2EA 2PMZN 3CCEI 4O3MA 3H3ZA 1UJ8A 1VTNC 5FRMA 3GWZA 3FK6A 3OSGA 3C2GA 2JWTA 2GQQA 1K83J 2W7NA 1WWXA 1S8NA 4LK1F 1QHHD 1Y1VJ 1XSDA 4A3CJ 2M7BA 4GO1A 1MBJA 2HOSA 4PJJA 4KN7X 2PBIA 1TW2A 1Y1WJ 1O3RA 2OPTA 3LL7A 4RAFA 5FLXZ 4E7ZA 3HL2A 1FBUA 5C3EJ 1D5YA 1K6OA 5BQTA 3KP4A 2BY3A 2F48A 3CCLI 4YRVA 2JVHA 3GFMA 3NQOA 2A69F 3E7LA 3HXLA 2HNHA 2XAGA 3L09A 5DD8A 2EBIA 2E2IJ 1SFKA 3C18A 4BQNA 2M9HA 3RPUD 1YW7A 3LFKA 2NVTJ 2V9PA 5J8FA 2XKOA 1QU3A 1ITYA 4CZCA 1LKXA 4AC0A 2DN0A 2WV0A 4UUSA 2MD5A 5IOYA 1K61A 4ZYEA 3T8RA 1R23A 1O7LA 2CU7A 4GYGA 4PFPA 4EM0B 3JRGA 4KT6A 3CCSI 3QODA 4FE7A 3BZCA 1RKWA 4BAYA 2R7DA 2L7MP 2DA4A 5IP9J 2IA0A 1U5TB 1Z6RA 2XKPA 2AQEA 3Q9SA 3F21A 2Y30A 5L3EA 4HLXA 4NC7A 2R93J 1QZYA 4IQJA 3BZ6A 4UV8A 3U1KA 3LSPA 5GAGJ 4OIPF 5D4SA 1ETQA 2LC2A 1YX3A 4H4KC 1GLNA 2WAQN 4L9JA 4X6AJ 2KISA 2LY2A 3JRFA 4GCVA 1G3YA 1N25A 1ZLJA 3IH2A 3JRAA 3FKIJ 1T08B 1TWHJ 2JTVA 3HOXJ 2CG4A 1EKEA 3W2AA 2FBIA 3FBNB 4C2UA 5AIPA 1LE8A 3HBLA 5H6QA 3CC4I 5ED4A 1BC7C 2X0LA 3DKWA 1R7JA 1RETA 4HG2A 4PCQA 1POGA 1U9OA 2DA1A 2OTJI 3PNVA 2HEOA 2ZC2A 1LUJB 1D0XA 1ACIA 2NVUB 3OYFA 3OYJA 3F9KA 5C4JJ 1YITI 2EFOA 3S2DJ 3MZ8A 4BHCA 5K7ZA 1KU7A 4F92B 1KA8A 3DPLC 4IKFA 2WB1N 1BI2A 3SEQA 1SD6A 4U7BA 2AS5F 4ZDPA 4Z2YA 4F7ZA 3E0JB 2M7AA 1FOKA 3KE2A 2DK5A 3I71A 4G9YA 5D5VB 3PFIA 1ZELA 1F5TA 4NQWA 2VPRA 4I02A 1BW6A 4B3XA 2DDAA 3RJPA 2J5PA 4HRIA 1ETKA 1W0TA 1LEBA 2LMDA 3VYRB 3BJAA 1R71A 3HSEA 3BTIA 2E5ZA 4DYQA 2R7WA 1BR4A 1ZG5A 2K7LA 3Q5FA 5TRDA 4EMSA 1K7AA 3LSMA 3P5JA 3OYAA 4ANJA 1K4TA 1MSEC 4OIRF 4X1EA 3BG6A 4BJ5C 3X2QH 3N97A 1LVAA 1UCRA 3TBIA 2NYXA 4HF0A 1XC5A 5J8CA 2L9SA 2NNNA 3AFHA 4CICA 1UHWA 3CCUI 4G7HF 2EB7A 4AYBA 1HC8A 1FBSA 3C1DA 3GZ5A 3L2QA 3BCBA 2ME6A 4UUVA 2LRDA 4E7LA 2AHQA 2HVQA 4EJWA 3ML6A 1R4MB 3H9GA 4P1WA 1WJFA 3HOSA 5EZHA 5HS9A 4U7DA 4A5MA 4S04A 4JX5A 5KK1A 1I39A 1WH7A 4ZZLA 3AG3H 2EFQA 1KZHA 1LFUP 3M07A 5EEHA 4Q47A 1VQ7I 4IRIA 2RN7A 3ZOBA 2PJRB 2L01A 1RI7A 4GRIA 1TW3A 2ZJRF 2KFDA 3KZIC 3BTLA 1VQLI 3VSLA 2NVYJ 4G6QA 1ETVA 3LFUA 1CF7A 4LG0A 2R7RA 3BOQA 3RQIA 3I64A 2NRAC 1HSJA 1Z91A 4IOAF 1HXDA 3GEZA 2BW3B 2E7WA 4LG0B 1ZGWA 1U2WA 3HM5A 2MBFA 3KLNA 4RGXA 2CMPA 2VJJA 3GTGJ 1P6RA 2ZMEB 2QLZA 3RPUA 1QGPA 4Y3OA 2JT1A 3AG1H 2KL4A 3HOUJ 4PJMA 1RRJA 4RB0A 1BIAA 3PNTA 4Q4ZF 1D0YA 3JCUC 1AA7A 2VBYA 2CFXA 1XG1A 2XUBA 9ANTA 3ABLH 2R7ZJ 4DQ2A 2ZXIA 1X1BA 4HF1A 5J4VA 3S3NA 2W00A 2E2JJ 3TO6A 1Y0UA 4FX4A 1W1WE 4I7HA 4R8HA 2FEZA 4XRSA 2VJ5A 3E97A 1OPCA 1ZK8A 2V1DA 4ZZDA 1IDZA 2QENA 4XLHA 4A3JJ 2VIXA 3SHFA 3ERMA 4MHGA 1Q1HA 3K2ZA 2LKSA 4I2OA 3EUKL 3K4LA 5HNFA 3TO9A 5L3CA 3H9JA 3QOEA 4PGHA 3LA7A 1PUEE 1QZZA 4YIFA 1TC3C 2ICWG 1FIPA 3KLOA 4BQOA 3VYSB 1HW5A 2VBZA 2STWA 2VOOA 4LOCA 5HLHA 2VPLA 1XMXA 4YEJA 4KFCA 2R7VA 3PQJA 3K70C 2HYGD 4HX7A 3ZQQA 3TOAA 4MFDA 4OAZA 4UVAA 1FYKA 3IC7A 4UHTA 1MNDA 5KNLA 3ERED 2Y48A 1E17A 2IXSA 3BJOA 5EG0A 3FF5A 4C9YA 3M8JA 1PYVA 2QSFX 2E7XA 1JHHA 3I55I 2B0LA 5ILSA 5E3MA 2JJ7A 1YX5A 5GPCA 1RUOA 3BTCA 3J81Z 3S32A 3I5UA 4M6YA 2VI6A 2N8GA 2V4JC 1WHUA 3IAM2 3F8CA 5BOXA 5D6FA 4OINF 2WY7Q 5B3SH 4AVZA 5GADJ 1F43A 2PEXA 1YO5C 3MMYB 3DEEA 4FETA 4DIQA 2KDZA 2EH3A 2DFFA 2WWYA 1W7PA 4BUPA 3T0YA 1Z67A 2UUZA 5L3FA 2XSDC 4RLFA 5IT9Z 1FTTA 4IHWA 1A6IA 1D1CA 3EPZA 2CJJA 3NWTA 5DM6F 1O57A 1TWCJ 3ABKH 4CCMA 3CCQI 2VB6A 2Q0OA 3OMYA 1OYIA 2Y31A 2HZTA 2VE8A 1FPQA 2E34A 2X48A 1XGMA 1LDDA 3HSRA 4HAMA 3FHZA 1V3FA 1ZRFA 1ZAOA 1OISA 4GYIA 1FMWA 3UR3C 1VZ0A 4G94A 4XQFA 2R3SA 5F6FA 3SXYA 1WJBA 1ZTRA 2EILH 2MC3A 3HGGA 2XGCA 2QF7A 1VQOI 2K9MA 4DZJA 1O3TA 2KIFA 2I10A 4A69C 4BDYA 1X2NA 2HQRA 3SEZA 3GTPJ 2F5CA 2LBFB 5HOOA 4AIJA 3RZDJ 1S6LA 1T95A 1U8RA 4E4HA 2QBYB 1R00A 1XCVA 1SAXA 2HS5A 1GV5A 3DQVC 2DA7A 1IRFA 2R7QA 3Q0WA 3H5RA 3PO2J 1JGSA 1FT9A 2AQFA 3CDLA 1IXSB 2DOEA 4Y4RA 2GA1A 2PN6A 2B9SA 2DU9A 2V9KA 4D1QA 3FZVA 5KAIC 2DO7A 4BH9A 2W24A 3FXJA 3MFKA 1JTXA 2UXNA 1I6XA 1S7OA 2KHMA 2WB1A 3ZGKA 3IRRA 4V19K 2KQRA 2KIUA 2QZ8A 4RAZA 4ZTJA 4B8XA 3OYDA 2CWEA 3GYHX 2GZWA 5BPIA 3M4OJ 4ZYGA 1H0MA 3IV5A 2BYVE 4AWXB 1J2XA 1ZYRF 1R4NB 5CVVA 3W3CA 5F1RA 4UY8I 3TW7A 2IAIA 2VJIA 1TQPA 3S1RJ 5DS9A 1H89C 4XLFA 2EZHA 1HW2A 2OD5A 4ZH4F 2VBXA 4IJAA 5LEKA 3J7ZI 3K4BA 1MKMA 1MBKA 2F2EA 3SQNA 5JLWA 1A36A 4PJ0C 3BR5A 2LREA 2V26A 4EATA 2MLKA 4NBQA 5E3NA 2ELJA 3E6DA 3BLYA
chains in the Genus database with same CATH topology
1RR7A 2O7OA 1QVTA 2XGDA 4D7NA 1ZKGA 2EZLA 3BR0A 3SDGA 1O4XA 2DJNA 2X9DA 3GBGA 3HKZN 4M3FA 1UG2A 2LKXA 1PUFA 3GTMJ 3G1MA 1DU6A 2XB0X 5K7HA 1YRNB 5IP7J 2HXIA 3HOVJ 3BG3A 3F0CA 4BY1J 2JMWA 4MO7A 5JLXA 1JGGA 4QIWN 4A3IJ 2CUEA 5M5WJ 3K2AA 2K9QA 1JUSA 2FJ1A 2GM4A 2DTZA 3BT9A 5FKLA 1PUFB 3BR3A 1GDTA 2GBYA 4XIDA 4Y7NJ 1MNMC 3C2BA 3O8GA 2DA5A 2XPVA 3LSJA 5FJ8J 1OCPA 5M3FJ 3HB9A 2CRGA 4AUXA 4UUTA 3A01B 2NOGA 3LSGA 1JKRC 2LTPA 3RZOJ 4HNVA 2LY9A 1Q1VA 1WI3A 1ZQ3P 1GV2A 4QSHA 2HQ5A 5J1RA 3DEWA 1WCMJ 1IJWC 4JP0A 1A5JA 2LK2A 3TP0A 2JK3A 3SJMA 2R5YA 4M6VA 3GTQJ 2M2EA 2MGQA 2PMZN 1JJ8C 3W6VA 5J3LA 4GFBA 2B63J 1U9NA 3FK6A 4J19A 3OSGA 2Y9ZA 2JWTA 1IUFA 1K83J 4FE4A 4NDLA 4B1RA 1Y1VJ 3FIWA 1H88C 4A3CJ 2ECCA 1MBJA 2HOSA 2VKVA 2ME0A 1ETWA 3A03A 1Y1WJ 1MSFC 2OPTA 5EZGA 2TCTA 1U8BA 3D1NI 3S15J 1LFBA 1I50J 1OCTC 2CUFA 4A93J 3M3YJ 3NARA 5C3EJ 1Z0XA 1D5YA 2NVXJ 1IC8A 3E7LA 2EBIA 2E2IJ 4CYCA 2XRLA 2H1KA 1CQTA 2M9HA 2NVTJ 3QQAA 4IHYA 1ITYA 3IH4A 1B8IB 3QPSA 4D5CA 5GP9A 4AC0A 2DN0A 4UUSA 1K61A 5IOYA 1TWGJ 5EF6A 2CU7A 3ZQGA 3JRGA 3G1LA 1IDYA 2HDDA 1NK3P 1VI0A 4FE7A 2VUMJ 1RKWA 2L7MP 2DA4A 5IP9J 4A3KJ 2E2HJ 1IRZA 4B4CA 2K40A 2FX0A 3ZQIA 2Y30A 1OJLA 4MFEA 4FCYA 2E19A 2HI3A 2R93J 2LP0A 3JREA 3LSPA 5EYRA 4EEFG 1MBEA 1ETQA 3FISA 3Q0VA 2WAQN 3JRBA 3NAUA 4X6AJ 3JRFA 4RDUA 3IH2A 3JRAA 3FKIJ 3A01A 4RBOA 1JKQC 1TWHJ 3HOXJ 4A3EJ 4FISA 4V2FA 4Y52J 1LE8A 1JT6A 3HBLA 3GTLJ 1MBFA 5FLMJ 4DZPA 1RETA 3RKQA 1POGA 1U9OA 1TWAJ 2DA1A 5C4JJ 4C3IJ 5C4XJ 3S2DJ 5K7ZA 1JKPC 2QCOA 3B6AA 2WB1N 2G0EA 2YS9A 2EQRA 4M3BA 1P7IA 4D7MA 1NTCA 2JA6J 2LLKA 4BY7J 3WHCA 4G12A 1JKOC 5IOZA 2NVQJ 5E3LA 4MLOA 2VPRA 5E3OA 1BW6A 1IGNA 4C2MJ 1AKHB 1ETKA 5BNGA 1W0TA 5J1YA 3HDDA 2Y0SN 3BTIA 4DYQA 2DA6A 4QTRA 2HYJA 1JJ6C 1SANA 3IH3A 1EF4A 5F04A 1ENHA 3BTJA 1MSEC 3G1OA 2VKEA 4X1EA 1XS9A 3B6CA 4B3AA 4IHVA 1WPKA 5F27A 3S17J 4IHXA 1HLVA 4FTHA 5F0HA 4I76A 1X2MA 1XC5A 2XB5A 3ZQCA 1HDPA 1OFCX 2HOTA 2WV1A 4BBRJ 1FIAA 3Q0UA 2XPWA 2ME6A 2R5ZB 2AHQA 2GLOA 1S7EA 4M3EA 3TW6A 5HODA 1F36A 5EZHA 2ID6A 5EGOB 4JX5A 1MH3A 1LE8B 1WH7A 2DMPA 5EDNA 1E3OC 4A3FJ 1LFUP 1U78A 3ZOBA 4AYBN 3JRHA 3ZQLA 1QRYA 3MKLA 3BTLA 2COBA 4C3HJ 2NVYJ 1ETVA 1VNDA 3TEDA 2DMUA 1H8AC 3LSRA 3RQIA 3DCFA 2L9RA 1JUPA 1B8IA 1P7JA 3ZQFA 2P81A 1ZGWA 3JRIA 5IYCJ 3OOUA 3HM5A 3LOCA 4UUSB 2LFBA 3GTGJ 1BA5A 4JYKA 1T33A 5EGOA 4A3BJ 3HOUJ 2L7FP 1MH4A 3HOYJ 3Q3SA 2JA7J 2AO9A 5IYBJ 1XG1A 2YUSA 2NS7A 9ANTA 2R7ZJ 3MN2A 1T56A 3SFIA 2K9SA 3GTJJ 2E2JJ 3S1NJ 4I6ZA 2L7ZA 4XRSA 2FD5A 2Y9YA 5IP6A 1ZK8A 1AHDP 4ABZA 2YU9J 1GUUA 2W48A 2ECBA 5F0CA 1IDZA 5F1JA 4A3JJ 1HF0A 1IG7A 3CMYA 3UKGA 3BG9A 2DMNA 2R92J 3WHBA 1ORKA 2XGEA 4MIMA 3L1PA 4A3MJ 1FEXA 2M8GX 2ZB9A 5FLVA 1BL0A 2JA8J 1TC3C 4BKXA 1NK2P 5FKMA 1FIPA 4D5FA 5FKKA 1TWFJ 4LOCA 1ETXA 4XK4A 1DU0A 3CCYA 2RAEA 4V2GA 1ETYA 3JRCA 3FK7A 4MFDA 3H3VK 4A3LJ 3PO3J 4M3GA 4W97A 3HEFA 5EG0A 1APLC 1RPWA 3JRDA 3VPRA 5J1UA 2JN6A 5E3MA 2JJ7A 4CYCB 3CQZJ 1IV6A 5GPCA 3BTCA 5IPAA 2M34A 2IEKA 3O8HA 2VI6A 2N8GA 2LVSA 3BR6A 1HOMA 1QVUA 2HOAA 1HDDC 2LD5A 3OSFA 1WGXA 1F43A 4C3JJ 2D5VA 1JUMA 2E1OA 5C44J 1BW5A 4BBSJ 2XPUA 2KDZA 1W0UA 2EH3A 1GT0C 5GPAA 4L5EA 3BQYA 2TRTA 2XSDC 3S1MJ 1FTTA 5FKOA 1A6IA 2IBDA 3HGYA 1R9TJ 4IHWA 2NS8A 3I4MJ 5K7FA 2CJJA 1TWCJ 4W1UA 1GVDA 2K9NA 3S16J 3JR9A 3GTKJ 3HOWJ 2ELKA 2Y31A 5M5YJ 1QPIA 4BXXJ 2DA3A 2LR8A 2X48A 4DW6A 2JA5J 2DMQA 2DMTA 3PM1A 2R5YB 2R5ZA 1HCRA 3MVPA 3I4NJ 4M3DA 4JX4A 2O8KA 1Z77A 4DYCA 4A3GJ 1ZR4A 1FTZA 1ZTRA 3HGGA 1ZR2A 2XGCA 2HXOA 2M0CA 2QF7A 2R0QC 4DZJA 3GTOJ 2I10A 4A69C 1X2NA 3LNQA 3BR1A 2ID3A 2CQXA 3HOZJ 4XICA 1ETOA 3GTPJ 3RZDJ 3K7AJ 1FJLA 2MSYA 1MBGA 4XRMA 5M5XJ 1AU7A 3S1QJ 5EG0B 3S2HJ 1I3QJ 5M3MJ 5FKNA 2H8RA 3H0GJ 5F08A 1GV5A 2FQ4A 3ZQHA 4IEJA 2MW8A 3S14J 2DA7A 1B72A 3Q0WA 1SFOJ 3PO2J 1AKHA 1UHSA 3CDLA 1VF9A 2X6OA 1VFCA 1UMQA 3BG5A 3BR2A 1JTXA 3A02A 2O9LA 2DA2A 2CQQA 4S0HB 2MG4A 1RKTA 5EEAA 1JTYA 1JT0A 4A3DJ 3BQZA 3M4OJ 3OIOA 3IV5A 1RESA 1B72B 1BJZA 4XRSG 2Y2ZA 1I6HJ 5IYDJ 3TW7A 2IAIA 3S1RJ 1G2HA 5DS9A 1H89C 2EZHA 2KT0A 1MBHA 1WH5A 4JX6A 1MBKA 2EZIA 5JLWA 2L0KA 1YRNA 3BR5A 4DYRA 5DTDA 1X58A 2OF7A 5F0FA 3TP3A 5E3NA 2EZKA 3QPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RR7 A;  2O7O A;  1QVT A;  2XGD A;  4D7N A;  1ZKG A;  2EZL A;  3BR0 A;  3SDG A;  1O4X A;  2DJN A;  2X9D A;  3GBG A;  3HKZ N;  4M3F A;  1UG2 A;  2LKX A;  1PUF A;  3GTM J;  3G1M A;  1DU6 A;  2XB0 X;  5K7H A;  1YRN B;  5IP7 J;  2HXI A;  3HOV J;  3BG3 A;  3F0C A;  4BY1 J;  2JMW A;  4MO7 A;  5JLX A;  1JGG A;  4QIW N;  4A3I J;  2CUE A;  5M5W J;  3K2A A;  2K9Q A;  1JUS A;  2FJ1 A;  2GM4 A;  2DTZ A;  3BT9 A;  5FKL A;  1PUF B;  3BR3 A;  1GDT A;  2GBY A;  4XID A;  4Y7N J;  1MNM C;  3C2B A;  3O8G A;  2DA5 A;  2XPV A;  3LSJ A;  5FJ8 J;  1OCP A;  5M3F J;  3HB9 A;  2CRG A;  4AUX A;  4UUT A;  3A01 B;  2NOG A;  3LSG A;  1JKR C;  2LTP A;  3RZO J;  4HNV A;  2LY9 A;  1Q1V A;  1WI3 A;  1ZQ3 P;  1GV2 A;  4QSH A;  2HQ5 A;  5J1R A;  3DEW A;  1WCM J;  1IJW C;  4JP0 A;  1A5J A;  2LK2 A;  3TP0 A;  2JK3 A;  3SJM A;  2R5Y A;  4M6V A;  3GTQ J;  2M2E A;  2MGQ A;  2PMZ N;  1JJ8 C;  3W6V A;  5J3L A;  4GFB A;  2B63 J;  1U9N A;  3FK6 A;  4J19 A;  3OSG A;  2Y9Z A;  2JWT A;  1IUF A;  1K83 J;  4FE4 A;  4NDL A;  4B1R A;  1Y1V J;  3FIW A;  1H88 C;  4A3C J;  2ECC A;  1MBJ A;  2HOS A;  2VKV A;  2ME0 A;  1ETW A;  3A03 A;  1Y1W J;  1MSF C;  2OPT A;  5EZG A;  2TCT A;  1U8B A;  3D1N I;  3S15 J;  1LFB A;  1I50 J;  1OCT C;  2CUF A;  4A93 J;  3M3Y J;  3NAR A;  5C3E J;  1Z0X A;  1D5Y A;  2NVX J;  1IC8 A;  3E7L A;  2EBI A;  2E2I J;  4CYC A;  2XRL A;  2H1K A;  1CQT A;  2M9H A;  2NVT J;  3QQA A;  4IHY A;  1ITY A;  3IH4 A;  1B8I B;  3QPS A;  4D5C A;  5GP9 A;  4AC0 A;  2DN0 A;  4UUS A;  1K61 A;  5IOY A;  1TWG J;  5EF6 A;  2CU7 A;  3ZQG A;  3JRG A;  3G1L A;  1IDY A;  2HDD A;  1NK3 P;  1VI0 A;  4FE7 A;  2VUM J;  1RKW A;  2L7M P;  2DA4 A;  5IP9 J;  4A3K J;  2E2H J;  1IRZ A;  4B4C A;  2K40 A;  2FX0 A;  3ZQI A;  2Y30 A;  1OJL A;  4MFE A;  4FCY A;  2E19 A;  2HI3 A;  2R93 J;  2LP0 A;  3JRE A;  3LSP A;  5EYR A;  4EEF G;  1MBE A;  1ETQ A;  3FIS A;  3Q0V A;  2WAQ N;  3JRB A;  3NAU A;  4X6A J;  3JRF A;  4RDU A;  3IH2 A;  3JRA A;  3FKI J;  3A01 A;  4RBO A;  1JKQ C;  1TWH J;  3HOX J;  4A3E J;  4FIS A;  4V2F A;  4Y52 J;  1LE8 A;  1JT6 A;  3HBL A;  3GTL J;  1MBF A;  5FLM J;  4DZP A;  1RET A;  3RKQ A;  1POG A;  1U9O A;  1TWA J;  2DA1 A;  5C4J J;  4C3I J;  5C4X J;  3S2D J;  5K7Z A;  1JKP C;  2QCO A;  3B6A A;  2WB1 N;  2G0E A;  2YS9 A;  2EQR A;  4M3B A;  1P7I A;  4D7M A;  1NTC A;  2JA6 J;  2LLK A;  4BY7 J;  3WHC A;  4G12 A;  1JKO C;  5IOZ A;  2NVQ J;  5E3L A;  4MLO A;  2VPR A;  5E3O A;  1BW6 A;  1IGN A;  4C2M J;  1AKH B;  1ETK A;  5BNG A;  1W0T A;  5J1Y A;  3HDD A;  2Y0S N;  3BTI A;  4DYQ A;  2DA6 A;  4QTR A;  2HYJ A;  1JJ6 C;  1SAN A;  3IH3 A;  1EF4 A;  5F04 A;  1ENH A;  3BTJ A;  1MSE C;  3G1O A;  2VKE A;  4X1E A;  1XS9 A;  3B6C A;  4B3A A;  4IHV A;  1WPK A;  5F27 A;  3S17 J;  4IHX A;  1HLV A;  4FTH A;  5F0H A;  4I76 A;  1X2M A;  1XC5 A;  2XB5 A;  3ZQC A;  1HDP A;  1OFC X;  2HOT A;  2WV1 A;  4BBR J;  1FIA A;  3Q0U A;  2XPW A;  2ME6 A;  2R5Z B;  2AHQ A;  2GLO A;  1S7E A;  4M3E A;  3TW6 A;  5HOD A;  1F36 A;  5EZH A;  2ID6 A;  5EGO B;  4JX5 A;  1MH3 A;  1LE8 B;  1WH7 A;  2DMP A;  5EDN A;  1E3O C;  4A3F J;  1LFU P;  1U78 A;  3ZOB A;  4AYB N;  3JRH A;  3ZQL A;  1QRY A;  3MKL A;  3BTL A;  2COB A;  4C3H J;  2NVY J;  1ETV A;  1VND A;  3TED A;  2DMU A;  1H8A C;  3LSR A;  3RQI A;  3DCF A;  2L9R A;  1JUP A;  1B8I A;  1P7J A;  3ZQF A;  2P81 A;  1ZGW A;  3JRI A;  5IYC J;  3OOU A;  3HM5 A;  3LOC A;  4UUS B;  2LFB A;  3GTG J;  1BA5 A;  4JYK A;  1T33 A;  5EGO A;  4A3B J;  3HOU J;  2L7F P;  1MH4 A;  3HOY J;  3Q3S A;  2JA7 J;  2AO9 A;  5IYB J;  1XG1 A;  2YUS A;  2NS7 A;  9ANT A;  2R7Z J;  3MN2 A;  1T56 A;  3SFI A;  2K9S A;  3GTJ J;  2E2J J;  3S1N J;  4I6Z A;  2L7Z A;  4XRS A;  2FD5 A;  2Y9Y A;  5IP6 A;  1ZK8 A;  1AHD P;  4ABZ A;  2YU9 J;  1GUU A;  2W48 A;  2ECB A;  5F0C A;  1IDZ A;  5F1J A;  4A3J J;  1HF0 A;  1IG7 A;  3CMY A;  3UKG A;  3BG9 A;  2DMN A;  2R92 J;  3WHB A;  1ORK A;  2XGE A;  4MIM A;  3L1P A;  4A3M J;  1FEX A;  2M8G X;  2ZB9 A;  5FLV A;  1BL0 A;  2JA8 J;  1TC3 C;  4BKX A;  1NK2 P;  5FKM A;  1FIP A;  4D5F A;  5FKK A;  1TWF J;  4LOC A;  1ETX A;  4XK4 A;  1DU0 A;  3CCY A;  2RAE A;  4V2G A;  1ETY A;  3JRC A;  3FK7 A;  4MFD A;  3H3V K;  4A3L J;  3PO3 J;  4M3G A;  4W97 A;  3HEF A;  5EG0 A;  1APL C;  1RPW A;  3JRD A;  3VPR A;  5J1U A;  2JN6 A;  5E3M A;  2JJ7 A;  4CYC B;  3CQZ J;  1IV6 A;  5GPC A;  3BTC A;  5IPA A;  2M34 A;  2IEK A;  3O8H A;  2VI6 A;  2N8G A;  2LVS A;  3BR6 A;  1HOM A;  1QVU A;  2HOA A;  1HDD C;  2LD5 A;  3OSF A;  1WGX A;  1F43 A;  4C3J J;  2D5V A;  1JUM A;  2E1O A;  5C44 J;  1BW5 A;  4BBS J;  2XPU A;  2KDZ A;  1W0U A;  2EH3 A;  1GT0 C;  5GPA A;  4L5E A;  3BQY A;  2TRT A;  2XSD C;  3S1M J;  1FTT A;  5FKO A;  1A6I A;  2IBD A;  3HGY A;  1R9T J;  4IHW A;  2NS8 A;  3I4M J;  5K7F A;  2CJJ A;  1TWC J;  4W1U A;  1GVD A;  2K9N A;  3S16 J;  3JR9 A;  3GTK J;  3HOW J;  2ELK A;  2Y31 A;  5M5Y J;  1QPI A;  4BXX J;  2DA3 A;  2LR8 A;  2X48 A;  4DW6 A;  2JA5 J;  2DMQ A;  2DMT A;  3PM1 A;  2R5Y B;  2R5Z A;  1HCR A;  3MVP A;  3I4N J;  4M3D A;  4JX4 A;  2O8K A;  1Z77 A;  4DYC A;  4A3G J;  1ZR4 A;  1FTZ A;  1ZTR A;  3HGG A;  1ZR2 A;  2XGC A;  2HXO A;  2M0C A;  2QF7 A;  2R0Q C;  4DZJ A;  3GTO J;  2I10 A;  4A69 C;  1X2N A;  3LNQ A;  3BR1 A;  2ID3 A;  2CQX A;  3HOZ J;  4XIC A;  1ETO A;  3GTP J;  3RZD J;  3K7A J;  1FJL A;  2MSY A;  1MBG A;  4XRM A;  5M5X J;  1AU7 A;  3S1Q J;  5EG0 B;  3S2H J;  1I3Q J;  5M3M J;  5FKN A;  2H8R A;  3H0G J;  5F08 A;  1GV5 A;  2FQ4 A;  3ZQH A;  4IEJ A;  2MW8 A;  3S14 J;  2DA7 A;  1B72 A;  3Q0W A;  1SFO J;  3PO2 J;  1AKH A;  1UHS A;  3CDL A;  1VF9 A;  2X6O A;  1VFC A;  1UMQ A;  3BG5 A;  3BR2 A;  1JTX A;  3A02 A;  2O9L A;  2DA2 A;  2CQQ A;  4S0H B;  2MG4 A;  1RKT A;  5EEA A;  1JTY A;  1JT0 A;  4A3D J;  3BQZ A;  3M4O J;  3OIO A;  3IV5 A;  1RES A;  1B72 B;  1BJZ A;  4XRS G;  2Y2Z A;  1I6H J;  5IYD J;  3TW7 A;  2IAI A;  3S1R J;  1G2H A;  5DS9 A;  1H89 C;  2EZH A;  2KT0 A;  1MBH A;  1WH5 A;  4JX6 A;  1MBK A;  2EZI A;  5JLW A;  2L0K A;  1YRN A;  3BR5 A;  4DYR A;  5DTD A;  1X58 A;  2OF7 A;  5F0F A;  3TP3 A;  5E3N A;  2EZK A;  3QPL A; 
#chains in the Genus database with same CATH topology
 1RR7 A;  2W85 A;  1QVT A;  2FA5 A;  2XGD A;  4Y15 A;  3G71 I;  2VXZ A;  1ZGJ A;  2W82 A;  3TQN A;  2IS1 A;  4G7Z F;  2IGO A;  4A2U A;  3KIO A;  3GBG A;  2LKX A;  4M3F A;  1UG2 A;  3ZN1 A;  4RA2 A;  3ZPL A;  3EUA A;  3WG9 A;  1U5T C;  2KIQ A;  3HZJ A;  2E60 A;  5FD5 A;  2R7U A;  2EIK H;  1I5Z A;  1S9H A;  3JAM Z;  3WGH A;  3HHH A;  3FXL A;  1IW7 F;  2JMW A;  3CC7 I;  2FE3 A;  1YFH A;  2DK8 A;  3CLO A;  3OYC A;  3TGN A;  4IL6 C;  5M5W J;  5CQE A;  3IUO A;  5HLI A;  2A05 A;  2GM4 A;  2DTZ A;  2HWV A;  3BT9 A;  3CJR B;  3BR3 A;  3IHU A;  4M71 A;  1MNM C;  3C2B A;  2XPV A;  3K9T A;  3KP7 A;  1S3J A;  4WCG A;  4AUX A;  5JVG F;  2CUJ A;  3MZY A;  4L9T A;  3V7S A;  4MEX F;  4HF2 A;  2R7S A;  2MA3 A;  3LSG A;  3OR2 C;  2ZBK A;  4KYW A;  2DXI A;  1I1G A;  2GAU A;  1WI3 A;  2HQ5 A;  2X6W A;  4HDU A;  2L5Q A;  1HBX G;  3D5S C;  1BJA A;  4L9V A;  5D5X B;  4JP0 A;  5FRO A;  3QPH A;  5LGU A;  3J7A O;  4KIC A;  3KEQ A;  1J09 A;  2L54 A;  2IPQ X;  1Z3Y A;  3OYG A;  4LD5 A;  4GFB A;  3DBR B;  1IO2 A;  1U9N A;  3REO A;  2ISZ A;  1WJA A;  2DOF A;  3CUQ A;  4FE4 A;  4G6T B;  4NDL A;  4B1R A;  4DGW B;  1L3L A;  3FIW A;  2ECC A;  3CCJ I;  3E6B A;  2ME0 A;  2Y0M A;  3LA2 A;  5CVI A;  4CZZ A;  2GXG A;  3A03 A;  1W5C C;  3QYE A;  3WTT C;  2RDP A;  4UXN A;  2G9W A;  1I50 J;  4NC8 A;  1YYV A;  3JAM K;  3J7Y J;  3NAR A;  3CUQ C;  3P7N A;  4B09 A;  2IS4 A;  5CLS A;  3MZH A;  3C7J A;  1VQK I;  4RLQ A;  4JQF A;  4CYC A;  2XRL A;  2A5Y B;  1U6G A;  3N05 A;  3E3V A;  3QQA A;  2XIG A;  4FQG A;  1B4A A;  5TIS C;  2OZ6 A;  3IH4 A;  1B8I B;  3QPS A;  2XF6 A;  4M74 A;  1STZ A;  2CV0 A;  4C2T A;  3OR1 C;  2L2O A;  3GFJ A;  1B8I A;  5ICF A;  1HST A;  3ZQG A;  2M0M A;  1IDY A;  3CTA A;  1NK3 P;  3RDI A;  4XKB A;  5LBQ A;  1DP7 P;  4LG3 A;  1A31 A;  2BY1 A;  2FX0 A;  2OV7 A;  5GAE J;  2VT2 A;  1OJL A;  2ZFW A;  4FCY A;  2HI3 A;  4A6E A;  2P6S A;  5DDG A;  5EYR A;  3FMR A;  2MH2 A;  3FIS A;  3Q0V A;  3JRB A;  3NAU A;  4AIH A;  3L00 A;  4RDU A;  1XGS A;  1SFE A;  2DJI A;  2VQH A;  4A3E J;  4FIS A;  4AD9 A;  2Y75 A;  4XN3 A;  4Y52 J;  3GTL J;  2ZNZ A;  3F72 A;  5FLM J;  4DZP A;  4HPQ A;  3RKQ A;  1R1V A;  2OCE A;  2WAQ A;  1XPX A;  1K4S A;  1ZN2 A;  5TGT A;  1MDM B;  1SD5 A;  4C3I J;  4EM1 A;  2HTJ A;  4I09 A;  1OCC H;  1V5F A;  3ISP A;  4EGZ A;  1P4X A;  4P55 A;  2EQR A;  1P7I A;  3LWF A;  1NTC A;  3ONQ A;  2JA6 J;  2LLK A;  3KZY A;  1IN4 A;  3VWB A;  2GA2 A;  3RKW A;  5IOZ A;  5E3L A;  2O0Y A;  3JTH A;  3CP8 A;  3M8E A;  1XMK A;  4CDG A;  3QYB A;  2ACJ A;  2JVG A;  1AKH B;  4Y17 A;  3HDD A;  1U0J A;  4HQE A;  1A35 A;  3DV8 A;  5J4Y A;  2Y0S N;  1TNT A;  2R7X A;  2WBM A;  1X1A A;  3OWT A;  5GTI C;  5HDK A;  1ZLK A;  1KGS A;  3IH3 A;  1DUX C;  1EF4 A;  3H36 A;  4IXA A;  3MCZ A;  3H9Q A;  1ENH A;  3BTJ A;  5DUI A;  2DT6 A;  4HZF A;  3DU6 A;  2VKE A;  3G1O A;  4HQM A;  3V42 A;  5L3B A;  4F55 A;  1FOX A;  2BEO A;  2K02 A;  4Q48 A;  1ODD A;  4I76 A;  1PVE A;  2EV0 A;  2XB5 A;  2FXA A;  3ZQC A;  1TQM A;  2CQ7 A;  2Z99 A;  3CZ6 A;  4LMY A;  3OYK A;  2XPW A;  5KCM A;  4RM3 A;  1EH6 A;  4E70 A;  2R5Z B;  1YTY A;  3PFY A;  3PNY A;  4ZC3 A;  2A6H F;  2GLO A;  2Z9O A;  3ECH A;  1S7E A;  2NAZ A;  2PG4 A;  3FBI B;  5E1Z B;  3ULQ B;  5HOD A;  1FYL A;  1F36 A;  4A0Z A;  5ERI A;  4HYE A;  4XNF A;  3RI4 A;  2X6Y A;  1LE8 B;  3I59 A;  2F6C A;  2W25 A;  1E3O C;  4A3F J;  4ESJ A;  4BHB A;  1OYW A;  2BHZ A;  2IVM A;  2FML A;  2L4M A;  1KYZ A;  3KP6 A;  4PJN A;  4LIT A;  1X3Z B;  3IKT A;  3ZQL A;  1QRY A;  4C3H J;  2DTR A;  1FWZ A;  1A6Q A;  2COB A;  2H09 A;  3BRO A;  5DM7 F;  1IUY A;  1NG7 A;  2DMU A;  2V6C A;  3LSR A;  3VOE A;  3DCF A;  1TNS A;  1JUP A;  2IA2 A;  1X1C A;  2JPC A;  4QWQ A;  1JXS A;  2IJL A;  1IN5 A;  4YII A;  2CV2 A;  2D2W A;  2P4W A;  3LOC A;  4OAY A;  4UUS B;  2VE9 A;  4XLN F;  2LH9 A;  1T33 A;  1NHA A;  2KKO A;  2X1E A;  4A3B J;  2A6T A;  2XAH A;  1Z7U A;  2L7F P;  3H5A A;  2BY0 A;  4XKW A;  5E18 F;  4ENJ A;  1LDK B;  2BY2 A;  5IYB J;  2R7F A;  2YUS A;  2VC0 A;  4P96 A;  3MN2 A;  3M7G A;  4XLP F;  5LEJ A;  1IXR C;  5HDN A;  1E3P A;  1EH7 A;  1FSE A;  3P9I A;  3K4C A;  2OJE D;  2QGU A;  2L7Z A;  1OR7 A;  2Y9Y A;  5IP6 A;  4LLG F;  2DDB A;  2UWM A;  4ABZ A;  3H0D A;  2XAQ A;  1GUU A;  1FP2 A;  4H0E A;  4KIB A;  4L5J A;  1T98 A;  4UVC A;  4YFN F;  5F1J A;  3DPU A;  2DFH A;  1G8X A;  1TT5 B;  3AKZ A;  3CMY A;  2EIM H;  1IG7 A;  3BG9 A;  3L2W A;  1UEL B;  2H94 A;  3WHB A;  2XGE A;  3CO7 C;  3L1P A;  3LAP A;  1FEX A;  4EJT A;  1LVK A;  2ZB9 A;  4KIS A;  4S05 A;  2CFO A;  3GLX A;  5FLV A;  1BL0 A;  2JA8 J;  2PI0 A;  1M1E B;  1G6N A;  5FKM A;  4D5F A;  4PUS A;  5FKK A;  4F3Q A;  3EDP A;  2RQQ A;  4JK1 X;  1SC7 A;  3JW4 A;  2KRH A;  1ETX A;  4XK4 A;  2X51 A;  5JFR A;  3CCY A;  2AXT C;  2Z2S B;  1XCB A;  2FQ3 A;  3K4K A;  4NQW B;  5AIQ A;  1MJA A;  2MYS A;  2ELH A;  4BQQ A;  1D8K A;  1MW7 A;  2MH9 A;  3MQ0 A;  5K5O A;  4M3G A;  4W97 A;  2VJ4 A;  2W84 A;  2XAF A;  2ZJP F;  3GLL A;  5DCM A;  3K6G A;  1D5V A;  2MC4 A;  3DTE A;  4F93 B;  2KMU A;  1IN8 A;  3VDX A;  2CW0 F;  1V55 H;  3HHG A;  1XD7 A;  3CQZ J;  2RV8 A;  2XC7 A;  5DCM B;  1IV6 A;  2PJR A;  4G7O F;  2IEK A;  4DNC A;  4HV6 A;  3FXO A;  2YX7 A;  4RM2 A;  2LVS A;  2CV1 A;  1KQ0 A;  1HOM A;  2LD5 A;  3O2P E;  3HRU A;  4E7H A;  2BW3 A;  1Z6T A;  3GUD A;  5IT3 A;  2D5V A;  1JUM A;  3H1C A;  5B5E C;  5C44 J;  2K85 A;  2CUZ A;  4BBS J;  1W0U A;  2PMU A;  1VQ9 I;  1SFX A;  2WAF A;  3EET A;  1RC9 A;  3BQY A;  3ZXS A;  2TRT A;  3P9C A;  3S1M J;  4M9Z A;  2M4G A;  2G7U A;  4JOM A;  3MD2 A;  2CS3 A;  1K78 A;  2ZXJ A;  1GVD A;  3KX2 A;  4W1U A;  1D8J A;  1R5H A;  3S16 J;  3ELK A;  3GTK J;  3HOW J;  2L9V A;  3R0A A;  2ELK A;  2JPB A;  1NH3 A;  2BOL A;  1QPI A;  4DW6 A;  4HLY A;  2JA5 J;  2R5Z A;  2R5Y B;  2HYF A;  1YJ9 I;  1XGN A;  2VOD A;  3T5X A;  2OA4 A;  3OIQ A;  2O8K A;  4DYC A;  1YG2 A;  3I54 A;  3BY6 A;  1ZR4 A;  1LJ9 A;  2K4J A;  2P7C B;  1K6Y A;  2BZT A;  4MQV A;  3BR1 A;  4CA0 A;  3KCC A;  1J5Y A;  4XIC A;  3HOZ J;  4ZYD A;  3M1E A;  4BDZ A;  2JUG A;  2HFH A;  3ASN H;  4XRM A;  4P9F A;  2P6T A;  1FSH A;  2DW4 A;  5EG0 B;  4OU0 A;  3S2H J;  4HW0 A;  1GXQ A;  1I3Q J;  4XMY A;  1PDN C;  2F4M B;  3BDD A;  4ESB A;  3KEY A;  2PMZ A;  1BOA A;  3K0L A;  4IEJ A;  2EFW A;  1B72 A;  1X3U A;  1SFO J;  3DXJ F;  1G4D A;  1Z21 A;  1RIO H;  1EA3 A;  3I58 A;  1G3W A;  1B1B A;  2LYC A;  2X6O A;  2VQG A;  2NNY A;  1VFC A;  5D6E A;  3FXU A;  4EV0 A;  3LSH A;  3LAJ A;  4HA8 A;  1R36 A;  2K3F A;  3PQK A;  4I01 A;  3A02 A;  3K4M A;  3R61 A;  3HJE A;  3IAS 2;  2FMY A;  1AWC A;  2DBB A;  1W4M A;  1JT0 A;  4QLC U;  3OYI A;  4A3D J;  1GVJ A;  3NRV A;  5H20 A;  3KPH A;  3PIO F;  3OIO A;  5DV5 A;  1FOW A;  1B72 B;  1BJZ A;  3H92 A;  4CCJ A;  2JSC A;  3KZZ A;  2BVL A;  2Y69 H;  3W2V A;  2FNA A;  2HTS A;  1G2H A;  2RC4 A;  1DPR A;  3L2U A;  3DU5 A;  1IN7 A;  1I1S A;  4XSZ F;  2TDX A;  2EZI A;  1W5T A;  3KFW X;  4DYR A;  5DTD A;  2OF7 A;  1USS A;  2KJB A;  4XN0 A;  5F0F A;  1Z9C A;  1J0R A;  4Y13 A;  1TQI A;  3QPL A;  4MGR A;  4ZDL A;  1ZKG A;  1DDN A;  3L7W A;  3BP8 A;  3BR0 A;  3VB2 A;  1EJ9 A;  4B47 A;  1Z1D A;  1CF7 B;  2K9L A;  4ENM A;  4U0W A;  3HKZ N;  1KYW A;  2OAZ A;  1D3Y A;  1MZB A;  2DPD A;  1ZG3 A;  3GTM J;  2RQP A;  2VAS A;  3G1M A;  2EA2 A;  2XB0 X;  4KIT B;  1VQ4 I;  3G6E I;  2W57 A;  2XGX A;  5IP7 J;  1YHQ I;  5FGM A;  3HOV J;  2JRT A;  3BG3 A;  5BS6 A;  1XGO A;  4KNY A;  4BJ6 C;  4MO7 A;  1V54 H;  4D9J A;  3IRQ A;  3H3U A;  2QQ8 A;  1LDJ A;  1YW9 A;  2WTE A;  3GF2 A;  5DD4 A;  2CUE A;  4ETS A;  3K2A A;  3QWL A;  1IZ1 A;  3O3K A;  2GBY A;  2XSJ C;  2O3F A;  4BE1 A;  1R5G A;  2LF8 A;  2QVO A;  3O8G A;  2DA5 A;  1OCZ H;  1PP7 U;  3A4C A;  3E5Q A;  5M3F J;  2FBH A;  4AIK A;  4I98 B;  5GTH C;  2BXY A;  2NOG A;  3A01 B;  5JI6 A;  1JKR C;  1ZH5 A;  2JSP A;  2M45 A;  4XOR A;  3OYM A;  4FT8 A;  1UHM A;  4QSH A;  5J1R A;  1Y39 A;  4CXF A;  2E36 A;  3Q9V A;  1F1Z A;  3A2K A;  3EYY A;  4EVI A;  4CO8 A;  4L18 B;  2D1V A;  2LK2 A;  1UG0 A;  3TP0 A;  2R5Y A;  4M6V A;  3W6V A;  3C3W A;  2QBY A;  2P0W A;  2K3P A;  2LF7 A;  2F5F A;  3KET A;  3CC2 I;  2B63 J;  4J19 A;  5CKT A;  4EM2 A;  1HKS A;  1IUF A;  3W6K B;  3L2C A;  3LSI A;  3GW2 A;  1TTY A;  3H5N A;  1QA6 A;  3GXO A;  1R1T A;  2VKV A;  4A6D A;  5M5Y J;  1Y56 A;  5DCF A;  1MSF C;  1SMT A;  5EZG A;  1D0Z A;  2QEX I;  3G73 A;  4AVP A;  2CW7 A;  3S15 J;  4IF4 A;  2OUM A;  2CUF A;  4A93 J;  3M3Y J;  1TT0 A;  1Z0X A;  2ZFU A;  5DUK A;  5D5U B;  4R79 A;  4OMY A;  4KMF A;  4M73 A;  3J80 K;  1VQN I;  2NVX J;  1IC8 A;  2OCC H;  3WTS C;  2M4K A;  1QPM A;  2H1K A;  3R0J A;  1CQT A;  1KON A;  1R49 A;  3IL2 A;  4YFX F;  2M8E A;  4B43 A;  4CYD A;  2STT A;  1LEA A;  2E1M B;  3EUH A;  3BC8 A;  1S72 I;  2YPR A;  2X4H A;  1W7P B;  2QYO A;  1VI0 A;  4EJV A;  2IP2 A;  3CF2 A;  1ZRE A;  4NB5 A;  2GXB A;  3WU0 A;  2E2H J;  3CES A;  3SYT A;  2GWR A;  3S3M A;  1DP3 A;  1ZRC A;  2K40 A;  4ZTF A;  2L7K A;  1SD4 A;  3ZQI A;  5ICC A;  2RKH A;  3OY9 A;  2HGC A;  4MFE A;  2E19 A;  2LP0 A;  3RYP A;  2G7H A;  2NS0 A;  4EEF G;  4AID A;  2V9V A;  1YOV B;  1V5G A;  4BHP A;  2F5E A;  4RBO A;  4CH7 A;  2EFP A;  2YU3 A;  3SZP A;  3DPT A;  4XM3 A;  3WTY C;  4U87 A;  1XB4 A;  1LQ1 A;  3C2H A;  1DGR M;  3CCR I;  2CYY A;  2CH0 A;  2LBF A;  1OCR H;  3S3O A;  3RYR A;  2VQC A;  4HDV A;  3WU2 C;  2C6Y A;  2A68 F;  1G3T A;  3SFZ A;  2HDC A;  5C4X J;  2V1N A;  4IX7 A;  2OTL I;  3BPV A;  2YS9 A;  1R5I D;  2V1X A;  4M3B A;  1XN7 A;  4O6J A;  5BPD A;  2O03 A;  4BY7 J;  3WHC A;  4PDK A;  1JKO C;  4HBL A;  2E1C A;  2NVQ J;  4HOB A;  4NNJ A;  3WGG A;  3IKV A;  3V7R A;  3RSN A;  1DPU A;  3K1N A;  4MLO A;  2EJR A;  1WQ2 A;  2VON A;  5CVU A;  2Q8K A;  5BNG A;  1YJW I;  5J1Y A;  3OYH A;  1FLI A;  3AL0 B;  1I27 A;  1DQU A;  2HPI A;  2DA6 A;  4QTR A;  5JHU A;  1OQY A;  5F64 A;  4ZJZ A;  1SAN A;  1SMY F;  2JA2 A;  2WA0 A;  3EYI A;  2DQL A;  4EJO A;  2K4B A;  4B3A A;  1X3W B;  1UFM A;  4IHV A;  5K5R A;  4FTH A;  5F0H A;  3J81 K;  2CQK A;  3AAF A;  3VEP A;  1X19 A;  1REP C;  5JVT A;  3CUQ B;  2BE5 F;  3CMM A;  2K27 A;  1W7P D;  4IOC F;  4F91 B;  3ABU A;  2WV1 A;  4PK4 A;  5HLT A;  3MKW B;  5FFZ A;  1FYM A;  1FIA A;  2D45 A;  3Q0U A;  2QWW A;  2KPM A;  3FX3 A;  5KHD A;  4IPA A;  2HPM A;  3TDZ C;  4IVN A;  1BI3 A;  4CCL A;  2ZSH B;  4YG2 F;  4M3E A;  4OMZ A;  4BE2 A;  2EV6 A;  3K10 A;  1FP1 D;  3WU1 B;  2ID6 A;  5EGO B;  1MH3 A;  4AU7 A;  4NUB A;  3V8J A;  3S8P A;  3V8K A;  4JBA A;  4RB2 C;  3F6V A;  4GDF A;  3MWM A;  3ZCO A;  3JRH A;  1Y0N A;  3PJR A;  1B9M A;  3I4P A;  2H27 A;  3TED A;  1FOY A;  2KDO A;  4J00 A;  3E6M A;  1UZC A;  4XKC A;  1PP8 F;  1WVR A;  2YR2 A;  2V79 A;  1IXC A;  2B7E A;  3ZQF A;  4ENN A;  2P81 A;  2FOK A;  5IYC J;  1QQI A;  2LFB A;  4N9I A;  1BA5 A;  4JYK A;  2BVM A;  2NOJ B;  5BMZ A;  1P92 A;  5EGO A;  2GOM A;  1WSU A;  4X0G A;  3RQ4 A;  1QBJ A;  4BQA A;  1RR8 C;  3HOY J;  2J5O A;  5AON A;  4BEH B;  2JA7 J;  1P4W A;  3HG9 A;  5E8I A;  3DWL E;  2NS7 A;  2JUC A;  4BEH A;  1T56 A;  1E0E A;  2Q2E B;  3HOT A;  3GME A;  2O5R A;  5EEG A;  3VYT B;  1HKQ A;  2FD5 A;  1OKR A;  3GZ6 A;  3F8N A;  2PQ8 A;  1AHD P;  5E1X A;  5KAF C;  4HNU A;  1E2X A;  3WE3 A;  2YU9 J;  2W48 A;  2BGC A;  3WG7 H;  2ECB A;  3HTS B;  1YS7 A;  1HF0 A;  1GXP A;  2CW8 A;  3WE2 A;  2F5V A;  4DBQ A;  3UKG A;  1C0W A;  3I56 I;  1FMV A;  4Y33 A;  4LGW A;  2IA1 A;  1S7A A;  4MIM A;  1ULY A;  2Q2E A;  3WTZ A;  4WXC A;  5L3D A;  4MQ9 F;  3JTG A;  3QYF A;  4LIU A;  1AOY A;  1DGW Y;  3BZK A;  5JHF A;  1TWF J;  2AXL A;  3CME I;  2OU2 A;  2P7V B;  1DU0 A;  1S29 A;  2KJC A;  1MNE A;  3WTW C;  4QPQ A;  2RAE A;  1ONV A;  4CGZ A;  1ETY A;  4NHJ A;  1RZ4 A;  3JRC A;  1O7F A;  1ERD A;  4P5O A;  1WKM A;  5IY5 H;  3H3V K;  3VYU B;  3PO3 J;  2QM3 A;  1SEU A;  1HQC A;  3F8M A;  4WX9 A;  5HS7 A;  4BXU A;  4RGR A;  1APL C;  1RPW A;  4KN4 X;  3VOD A;  3JRD A;  3ABM H;  5J1U A;  5H2F C;  5HLG A;  2A5W A;  3ZMS A;  1VQ6 I;  4ITV A;  4CYC B;  2QA4 I;  4KMU X;  3OYL A;  4MNU A;  3WTV C;  4BJT A;  5IPA A;  1EV7 A;  4L0Z B;  1QHG A;  5HVQ C;  3O8H A;  3QP6 A;  5CVR A;  1F9N A;  2Z33 A;  3WTX C;  3FXQ A;  5B1B H;  4OOI A;  3BR6 A;  4PSX A;  5DYM A;  2XVC A;  2HOA A;  1HDD C;  4RMN A;  3TKY A;  2P5L C;  3G2B A;  1WGX A;  3R4K A;  4WXD A;  3HC7 A;  2XHK A;  2XPU A;  3M8F A;  5LD2 C;  5FD6 A;  2A3S A;  2DYR H;  5GPA A;  4L5E A;  1U3E M;  3KYD B;  3WGI A;  2QQA A;  5GAH J;  1TLH B;  1VQ5 I;  4RGU A;  2EFN A;  1MGT A;  2IW5 A;  2LNB A;  2NXN B;  2HKO A;  3NEU A;  2RNG A;  2GIV A;  3OIP A;  3HGY A;  5FKO A;  1BI1 A;  5KVR A;  4BE0 A;  2CGP A;  2NS8 A;  1ZRD A;  3I4M J;  2KLO A;  3OS2 A;  2X1C A;  4BAC A;  3TO7 A;  2K9N A;  3HUG B;  3JR9 A;  1FNN A;  1WRJ A;  1O3Q A;  1R6R A;  3V4G A;  2KRF A;  1V4R A;  2LR8 A;  4OWR B;  2DMQ A;  2DMT A;  4UNO A;  1MMA A;  3HUG A;  3KYL A;  1JI8 A;  1HCR A;  3I4N J;  3OV8 A;  3ZMV A;  2VT3 A;  1HA8 A;  4JX4 A;  3K4J A;  4O5V A;  2Z5U A;  3DTK A;  3HSF A;  4A3G J;  4ZYA A;  1L0O C;  3E6C C;  1FTZ A;  3I0T A;  2KP6 A;  2M0C A;  2R0Q C;  2VXD A;  4G8X A;  1MD0 A;  2L3D A;  1MJ9 A;  3L2R A;  1T39 A;  2ID3 A;  3ZRG A;  3KP2 A;  1ETO A;  4I99 C;  2R7O A;  5A2Q K;  2JQ7 A;  1LFP A;  3BWG A;  5M5X J;  1KQ9 A;  1AU7 A;  1T8I A;  3IWZ A;  3D5L A;  3S1Q J;  1Z7L A;  4ZDO A;  5EJC A;  4YIR X;  5M3M J;  4U0Y A;  5F08 A;  2FQ4 A;  3ZQH A;  2MW8 A;  3TL4 X;  1AKH A;  4NC6 A;  4AM3 A;  2I8D A;  4BYY A;  1VF9 A;  4KIG A;  1MMS A;  3DFG A;  1KQ8 A;  3CP2 A;  4XLC A;  2M30 A;  5FO5 A;  3V7C A;  3CUO A;  1D1A A;  5J47 A;  4IRH A;  1K79 A;  1R1U A;  5J40 A;  3LQQ A;  1MJB A;  3HTU A;  2MG4 A;  5JR3 A;  3KP3 A;  4L0Y B;  2HU9 A;  1JTY A;  2DCE A;  4B44 A;  4MEY F;  3BQZ A;  3SZT A;  3ZP5 A;  4CCO A;  1PJR A;  3GCM A;  2RVC A;  3CD6 I;  1KU2 A;  3VSK A;  4XRS G;  2Y2Z A;  5LLQ A;  3IWF A;  2EIJ H;  4IZZ A;  5IYD J;  4XBF A;  4MTD A;  3RPQ A;  3U21 A;  2Y0S A;  1Y6I A;  2XRN A;  2KT0 A;  3H35 A;  1MBH A;  1WH5 A;  2ETH A;  3MKZ A;  4JX6 A;  2MD0 A;  2HQN A;  2QQ9 A;  2R4G A;  1JHF A;  3M9A A;  3OYE A;  5D5W B;  2O8X A;  4J01 A;  3MEX A;  2L0K A;  1YRN A;  1FC3 A;  1WJE A;  2DOA A;  3I59 B;  5B66 C;  2O7O A;  4D7N A;  3FM3 A;  3ROU A;  5LHG A;  1N78 A;  2E1M C;  5ILV A;  1A04 A;  1WI9 A;  1K78 B;  2EK5 A;  2DJN A;  1HW1 A;  1BOB A;  2Z3Y A;  2X9D A;  5DEQ A;  1W36 D;  3N4M A;  3R6S A;  2XF7 A;  1DU6 A;  2DQR A;  3HYI A;  3QPT A;  5K7H A;  5K5Q A;  1YRN B;  1ZHF A;  2E71 A;  2VOP A;  2F4O B;  2L02 A;  5CQG A;  2H6B A;  4G6D A;  1X4P A;  3F0C A;  4F52 A;  2VL8 A;  4WXH A;  4BY1 J;  4XL9 A;  1T38 A;  5JLX A;  4L5I A;  4BXF A;  3PSF A;  1XDS A;  4EJU A;  5K1Y A;  1U5T A;  3FKJ A;  1OMI A;  3QU3 A;  3RTR A;  1JUS A;  3ABT A;  4XON A;  4Y7N J;  1VQM I;  1H9T A;  4XR6 A;  3LSJ A;  5FJ8 J;  2FF4 A;  1IRG A;  3DEU A;  1OCP A;  3HB9 A;  4TV7 A;  5D8K B;  2PFB A;  3OYN A;  3ASO H;  4HST A;  3EQL F;  3LA3 A;  2X1D A;  1ZQ3 P;  3BG7 A;  1WCM J;  1BIB A;  2IGN A;  1NG6 A;  1O3S A;  1A5J A;  1B59 A;  2DLL A;  2QKL B;  2E5N A;  2FSW A;  2JK3 A;  3DKX A;  2ESH A;  1ZGA A;  3GTQ J;  2GOX B;  2MGQ A;  1JJ8 C;  4BU2 A;  5J3L A;  5LRS A;  3UNG C;  2ESN A;  2A07 F;  2GIZ A;  4WWC A;  2IT0 A;  4M9X A;  3KYC B;  2Y9Z A;  3JSO A;  5CPR B;  5LGN A;  4Z6Y A;  1XMA A;  3TDU C;  1H88 C;  3FXR A;  3E5X A;  1ETW A;  4YEL A;  4II3 A;  4WK8 F;  3OYB A;  1EH8 A;  1F4K A;  2TCT A;  2WY8 Q;  1U8B A;  1LNW A;  3D1N I;  4E7I A;  1LFB A;  1T0F C;  3F3X A;  1OCT C;  2BBY A;  2IGK A;  2HDW A;  1YIO A;  4XRF A;  3R60 A;  1RUN A;  3OS1 A;  1TL8 A;  2ZXW H;  4E7J A;  4N4O B;  2ZO4 A;  1N77 A;  3D5R C;  3GFL A;  4IHY A;  4IHT A;  1XTA A;  2XAS A;  1QO0 D;  2Q1Z B;  4D5C A;  5GP9 A;  2ZJQ F;  3FHN A;  3OL4 A;  1TWG J;  5EF6 A;  4M6X A;  3G1L A;  2HDD A;  3CJQ B;  3BJ6 A;  2KIM A;  2VUM J;  3QU6 A;  4PFO A;  4A3K J;  4XOP A;  4R1H A;  3RKY A;  4YFK F;  1IRZ A;  3T8T A;  4B4C A;  1ZG1 A;  3ZMZ A;  3I3L A;  2M1B A;  4LFU A;  4BNC A;  3J80 Z;  2WAE A;  2ISY A;  2FU4 A;  4A5N A;  3JRE A;  1Z3X A;  1BR2 A;  2KZG A;  1MBE A;  2ZME C;  3S2W A;  1Z05 A;  4PSW A;  2DFE A;  5FRN A;  4I0A A;  2MAB A;  3HPG A;  2VLA A;  3A0H C;  4ON0 A;  2PX9 A;  1OYY A;  4MTE A;  1SAU A;  3A01 A;  1JKQ C;  2BV6 A;  4V2F A;  1JT6 A;  2W1O A;  4LB5 A;  2PMH A;  5E8G A;  1MBF A;  3G4S I;  2ZME A;  2UXX A;  1TWA J;  4HSR A;  3ZN0 A;  1YLF A;  4GXO A;  1WZ2 A;  2P8T A;  4A0Y A;  3CF5 F;  2PJP A;  5CJ9 A;  1X4O A;  3GVA A;  1JKP C;  2QCO A;  3B6A A;  2G0E A;  1XX5 A;  2ZCW A;  4D7M A;  4ENK A;  2LSO A;  2E1N A;  2OZU A;  1OLT A;  1IF1 A;  4G12 A;  3TOB A;  3DLA A;  2LKP A;  1V5E A;  2XF5 A;  3OL3 A;  2UZK A;  1T2K A;  5E3O A;  1IGN A;  3A0B C;  4C2M J;  4E7S A;  1Y8Q B;  2DYS H;  2BHY A;  4N9H A;  4XSX F;  3GZN B;  4DBR A;  3NWS A;  5HDG A;  1CGP A;  1SD7 A;  2K86 A;  3P9K A;  3CCV I;  1WJC A;  2E35 A;  2HYJ A;  2HKX A;  5E1W A;  1WJ5 A;  1JJ6 C;  5LGT A;  2M5W A;  2EWN A;  5F04 A;  2UV1 A;  3ZMU A;  5B1A H;  4UV9 A;  2VN2 A;  1FX7 A;  3PSI A;  1XS9 A;  3B6C A;  5E20 A;  1WPK A;  5F27 A;  3S17 J;  4I0B A;  4IHX A;  1HLV A;  3MKY B;  3DF8 A;  4EGY A;  5CVJ A;  3E1S A;  2GXA A;  4LLN A;  1X2M A;  2JRM A;  2XAU A;  3WOD F;  3PUB A;  3BPX A;  1HDP A;  2F4I A;  3RCO A;  1OFC X;  2HOT A;  2H8W A;  4PJL A;  2JZY A;  4BBR J;  2XV4 S;  2CSO A;  3HKZ A;  3QAH A;  4CCK A;  3HRS A;  1YIJ I;  4KIF A;  5J6X A;  3HRT A;  2HVS A;  2FNP A;  3AG4 H;  3MAJ A;  3TW6 A;  3BCA A;  4UB6 C;  3K70 D;  3CCM I;  1R58 A;  4ASN A;  1IN6 A;  2DMP A;  5EDN A;  2L9N A;  2Z16 A;  2VC1 A;  1Y8R B;  3V8L A;  1U78 A;  4GGG A;  4AYB N;  2PLY A;  4DOZ A;  3MKL A;  4HEA 2;  3QRF F;  1LB2 A;  3CLQ A;  1VND A;  1HKT A;  1H8A C;  1SVO A;  2L9R A;  2YX4 A;  1P7J A;  1I3A A;  3B02 A;  2EPF A;  2QUF A;  1X1D A;  2X6X A;  3OOU A;  3JRI A;  3DBL B;  2FRH A;  5FFX A;  2LOO A;  2ADU A;  4KJZ A;  4ESF A;  1H9G A;  2RRE A;  1BN5 A;  1MH4 A;  2H6C A;  3Q3S A;  4K2E A;  5E79 C;  3VFZ A;  1XDU A;  2AO9 A;  3DBH B;  1XSX A;  1ON1 A;  2I5U A;  4HV5 A;  4A12 A;  4CCN A;  3LQR A;  3CJN A;  3KEO A;  3K69 A;  2A61 A;  3D0S A;  2QSH X;  2BXZ A;  3LST A;  3SFI A;  2K9S A;  3GTJ J;  3B73 A;  4A0X A;  1SVM A;  3S1N J;  4HNT A;  3L9F A;  4I6Z A;  1SVL A;  3AG2 H;  4OIO F;  2WAD A;  4C30 A;  2OBP A;  3RKX A;  3F23 A;  1IRX A;  3ZR8 X;  1YJN I;  1P4A A;  1T0F A;  2XRO A;  1IV8 A;  5F0C A;  4LK0 F;  4RGS A;  2LY1 A;  3CO6 C;  1W36 C;  5A2Q Z;  2V7F A;  4KDP A;  4IRG A;  3GX4 X;  2MLG A;  2DMN A;  2R92 J;  2A6E F;  2W4S A;  1OR7 C;  1ORK A;  4FHT A;  1WJD A;  4A3M J;  4IHS A;  5D8L B;  2M8G X;  4UB8 C;  2EA4 A;  4BKX A;  1P9Q C;  2FOW A;  2VKD A;  1NK2 P;  4HX8 A;  2CO5 A;  4KA4 A;  1WFX A;  2XAJ A;  1YS6 A;  2OQG A;  4LJZ F;  2MFZ A;  4M72 A;  4L9N A;  5FLX K;  4V2G A;  5FB2 A;  3FK7 A;  1P2F A;  2EV5 A;  3OOP A;  2EIN H;  3RIR A;  4A3L J;  3HEF A;  2ZXH A;  3M1C A;  1BM9 A;  2QKM B;  2WC2 A;  2ZJ2 A;  2O61 A;  3VPR A;  4IQ4 A;  2JN6 A;  4CSW A;  3HPH A;  1KU9 A;  1TZL A;  3WTU C;  4KUM A;  3ECO A;  2VKH A;  2M34 A;  4E6K G;  1YI2 I;  2IS2 A;  1KU3 A;  4QPO A;  2DFI A;  1BC8 C;  5CYV A;  3DLL F;  1QVU A;  2DT7 B;  3OSF A;  3ZMD A;  4FX0 A;  2LG4 A;  4C3J J;  1YE9 A;  3PUF A;  1YW8 A;  2E1O A;  2ZSI B;  1FZP B;  1BW5 A;  3W2W A;  1J59 A;  1UST A;  3FMQ A;  4E7K A;  1GT0 C;  1MMD A;  6PAX A;  4RAG A;  2K5C A;  2COM A;  3F6O A;  4KT5 C;  5H6R A;  3QP5 A;  1XSV A;  3CDI A;  1R9T J;  2IBD A;  2H1L A;  5K7F A;  5IT9 K;  1IAW A;  2HR3 A;  3I9V 2;  2VBW A;  5L3G A;  2DPU A;  3CDH A;  4BXX J;  2DA3 A;  3PM1 A;  4BS9 A;  3MVP A;  3TMO A;  4RS8 A;  1VQP I;  4M3D A;  4CHU A;  3GO5 A;  1Z77 A;  4M9S A;  3O6B B;  1G3S A;  3DP7 A;  3I53 A;  1ZR2 A;  2HXO A;  3EUH C;  3GTO J;  5HS8 A;  1VQ8 I;  1GHC A;  3ESW B;  1E3H A;  3LNQ A;  1ZAR A;  1R22 A;  4LLL A;  2CQX A;  5LFA A;  3FDY A;  3SDB A;  1MMN A;  3K7A J;  1FJL A;  2MSY A;  3HRM A;  3F22 A;  1MBG A;  3ZQ7 A;  1UAA A;  3FXK A;  3IP4 B;  1MDM A;  4XLE A;  5FKN A;  3H0G J;  2H8R A;  5E17 F;  4CUG A;  1J75 A;  2V6E A;  3S14 J;  3LSK A;  2YSR A;  4LIV A;  1QZE A;  5HNH A;  3S93 A;  1UHS A;  1MIJ A;  2P5K A;  1S5L C;  1UMQ A;  3PIP F;  3BG5 A;  1D1B A;  2P5V A;  3FM5 A;  3BR2 A;  1FBQ A;  3HIF A;  1UB9 A;  2ZKZ A;  4D0P A;  3J7A Y;  2O9L A;  2DA2 A;  2CQQ A;  2HQA A;  4S0H B;  4ZYH A;  3W6J B;  3T1B A;  1RKT A;  5EEA A;  1G59 A;  1LPQ A;  1OCO H;  2CQN A;  2KZV A;  4U0V A;  3DTI A;  4XLA A;  2V1U A;  4PGG A;  3DKY A;  4RAY A;  3U9G A;  4P9U A;  1RES A;  4PZJ A;  4EQQ A;  1FY7 A;  2F5D A;  3LMM A;  1I6H J;  2KRC A;  5LHI A;  3COA C;  4RB1 A;  4XOT A;  2M87 A;  3PL8 A;  4N0B A;  2HVR A;  2RGV A;  1TP4 A;  5D4R A;  1BR1 A;  4XKV A;  2VQL A;  3CMA I;  1X58 A;  2DOD A;  3TP3 A;  4IO9 F;  2EZK A;  2IS6 A;  4LB6 B;  3KP5 A;  2EZL A;  5TJJ A;  2R7T A;  2L4A A;  3SDG A;  3K1P A;  2QQB A;  3OS0 A;  3L2V A;  4RB3 C;  2O6G E;  2ZNY A;  1O4X A;  4U88 A;  4Q5S F;  5ICE A;  1BBY A;  2OQR A;  2FUG 2;  3QOP A;  2DAO A;  1SFU A;  1PUF A;  3F8B A;  1RNL A;  2D1H A;  5ILU A;  4HX4 A;  2HOE A;  3SZG A;  2LDU A;  3F8F A;  3AL0 C;  3FWE A;  5LHH A;  4DJA A;  2HXI A;  3K1M A;  3FXM A;  4BL0 B;  3E5U A;  2QSG X;  3G3Z A;  2DI3 A;  1ON2 A;  2IGM A;  5ICG A;  3CJT B;  3JSP A;  2IRF G;  1JGG A;  4QIW N;  4A3I J;  4B48 A;  3U2R A;  2K9Q A;  2FJ1 A;  1B6A A;  5FKL A;  1PUF B;  1J7K A;  1YQA A;  1GDT A;  1W5S A;  5LRR A;  3FMS A;  4XID A;  3ZMT A;  1B9N A;  1X1P A;  1J9I A;  3K4N A;  1JE8 A;  4FAS D;  4II2 A;  2CRG A;  4UUT A;  1BI0 A;  4BGD A;  2LTP A;  2HZD A;  1TBX A;  2RNJ A;  3RZO J;  4HNV A;  1T6S A;  1Q1V A;  2LY9 A;  2OC6 A;  1GV2 A;  2Z1D A;  4OIQ F;  3DEW A;  2FBK A;  2M3A A;  1QNT A;  3U1D A;  2XDV A;  4UVB A;  4N4N B;  3GFI A;  1IJW C;  1MMG A;  1N75 A;  2X85 A;  3SJM A;  2DT5 A;  3A1Y A;  4WF2 A;  2M2E A;  2PMZ N;  3CCE I;  4O3M A;  3H3Z A;  1UJ8 A;  1VTN C;  5FRM A;  3GWZ A;  3FK6 A;  3OSG A;  3C2G A;  2JWT A;  2GQQ A;  1K83 J;  2W7N A;  1WWX A;  1S8N A;  4LK1 F;  1QHH D;  1Y1V J;  1XSD A;  4A3C J;  2M7B A;  4GO1 A;  1MBJ A;  2HOS A;  4PJJ A;  4KN7 X;  2PBI A;  1TW2 A;  1Y1W J;  1O3R A;  2OPT A;  3LL7 A;  4RAF A;  5FLX Z;  4E7Z A;  3HL2 A;  1FBU A;  5C3E J;  1D5Y A;  1K6O A;  5BQT A;  3KP4 A;  2BY3 A;  2F48 A;  3CCL I;  4YRV A;  2JVH A;  3GFM A;  3NQO A;  2A69 F;  3E7L A;  3HXL A;  2HNH A;  2XAG A;  3L09 A;  5DD8 A;  2EBI A;  2E2I J;  1SFK A;  3C18 A;  4BQN A;  2M9H A;  3RPU D;  1YW7 A;  3LFK A;  2NVT J;  2V9P A;  5J8F A;  2XKO A;  1QU3 A;  1ITY A;  4CZC A;  1LKX A;  4AC0 A;  2DN0 A;  2WV0 A;  4UUS A;  2MD5 A;  5IOY A;  1K61 A;  4ZYE A;  3T8R A;  1R23 A;  1O7L A;  2CU7 A;  4GYG A;  4PFP A;  4EM0 B;  3JRG A;  4KT6 A;  3CCS I;  3QOD A;  4FE7 A;  3BZC A;  1RKW A;  4BAY A;  2R7D A;  2L7M P;  2DA4 A;  5IP9 J;  2IA0 A;  1U5T B;  1Z6R A;  2XKP A;  2AQE A;  3Q9S A;  3F21 A;  2Y30 A;  5L3E A;  4HLX A;  4NC7 A;  2R93 J;  1QZY A;  4IQJ A;  3BZ6 A;  4UV8 A;  3U1K A;  3LSP A;  5GAG J;  4OIP F;  5D4S A;  1ETQ A;  2LC2 A;  1YX3 A;  4H4K C;  1GLN A;  2WAQ N;  4L9J A;  4X6A J;  2KIS A;  2LY2 A;  3JRF A;  4GCV A;  1G3Y A;  1N25 A;  1ZLJ A;  3IH2 A;  3JRA A;  3FKI J;  1T08 B;  1TWH J;  2JTV A;  3HOX J;  2CG4 A;  1EKE A;  3W2A A;  2FBI A;  3FBN B;  4C2U A;  5AIP A;  1LE8 A;  3HBL A;  5H6Q A;  3CC4 I;  5ED4 A;  1BC7 C;  2X0L A;  3DKW A;  1R7J A;  1RET A;  4HG2 A;  4PCQ A;  1POG A;  1U9O A;  2DA1 A;  2OTJ I;  3PNV A;  2HEO A;  2ZC2 A;  1LUJ B;  1D0X A;  1ACI A;  2NVU B;  3OYF A;  3OYJ A;  3F9K A;  5C4J J;  1YIT I;  2EFO A;  3S2D J;  3MZ8 A;  4BHC A;  5K7Z A;  1KU7 A;  4F92 B;  1KA8 A;  3DPL C;  4IKF A;  2WB1 N;  1BI2 A;  3SEQ A;  1SD6 A;  4U7B A;  2AS5 F;  4ZDP A;  4Z2Y A;  4F7Z A;  3E0J B;  2M7A A;  1FOK A;  3KE2 A;  2DK5 A;  3I71 A;  4G9Y A;  5D5V B;  3PFI A;  1ZEL A;  1F5T A;  4NQW A;  2VPR A;  4I02 A;  1BW6 A;  4B3X A;  2DDA A;  3RJP A;  2J5P A;  4HRI A;  1ETK A;  1W0T A;  1LEB A;  2LMD A;  3VYR B;  3BJA A;  1R71 A;  3HSE A;  3BTI A;  2E5Z A;  4DYQ A;  2R7W A;  1BR4 A;  1ZG5 A;  2K7L A;  3Q5F A;  5TRD A;  4EMS A;  1K7A A;  3LSM A;  3P5J A;  3OYA A;  4ANJ A;  1K4T A;  1MSE C;  4OIR F;  4X1E A;  3BG6 A;  4BJ5 C;  3X2Q H;  3N97 A;  1LVA A;  1UCR A;  3TBI A;  2NYX A;  4HF0 A;  1XC5 A;  5J8C A;  2L9S A;  2NNN A;  3AFH A;  4CIC A;  1UHW A;  3CCU I;  4G7H F;  2EB7 A;  4AYB A;  1HC8 A;  1FBS A;  3C1D A;  3GZ5 A;  3L2Q A;  3BCB A;  2ME6 A;  4UUV A;  2LRD A;  4E7L A;  2AHQ A;  2HVQ A;  4EJW A;  3ML6 A;  1R4M B;  3H9G A;  4P1W A;  1WJF A;  3HOS A;  5EZH A;  5HS9 A;  4U7D A;  4A5M A;  4S04 A;  4JX5 A;  5KK1 A;  1I39 A;  1WH7 A;  4ZZL A;  3AG3 H;  2EFQ A;  1KZH A;  1LFU P;  3M07 A;  5EEH A;  4Q47 A;  1VQ7 I;  4IRI A;  2RN7 A;  3ZOB A;  2PJR B;  2L01 A;  1RI7 A;  4GRI A;  1TW3 A;  2ZJR F;  2KFD A;  3KZI C;  3BTL A;  1VQL I;  3VSL A;  2NVY J;  4G6Q A;  1ETV A;  3LFU A;  1CF7 A;  4LG0 A;  2R7R A;  3BOQ A;  3RQI A;  3I64 A;  2NRA C;  1HSJ A;  1Z91 A;  4IOA F;  1HXD A;  3GEZ A;  2BW3 B;  2E7W A;  4LG0 B;  1ZGW A;  1U2W A;  3HM5 A;  2MBF A;  3KLN A;  4RGX A;  2CMP A;  2VJJ A;  3GTG J;  1P6R A;  2ZME B;  2QLZ A;  3RPU A;  1QGP A;  4Y3O A;  2JT1 A;  3AG1 H;  2KL4 A;  3HOU J;  4PJM A;  1RRJ A;  4RB0 A;  1BIA A;  3PNT A;  4Q4Z F;  1D0Y A;  3JCU C;  1AA7 A;  2VBY A;  2CFX A;  1XG1 A;  2XUB A;  9ANT A;  3ABL H;  2R7Z J;  4DQ2 A;  2ZXI A;  1X1B A;  4HF1 A;  5J4V A;  3S3N A;  2W00 A;  2E2J J;  3TO6 A;  1Y0U A;  4FX4 A;  1W1W E;  4I7H A;  4R8H A;  2FEZ A;  4XRS A;  2VJ5 A;  3E97 A;  1OPC A;  1ZK8 A;  2V1D A;  4ZZD A;  1IDZ A;  2QEN A;  4XLH A;  4A3J J;  2VIX A;  3SHF A;  3ERM A;  4MHG A;  1Q1H A;  3K2Z A;  2LKS A;  4I2O A;  3EUK L;  3K4L A;  5HNF A;  3TO9 A;  5L3C A;  3H9J A;  3QOE A;  4PGH A;  3LA7 A;  1PUE E;  1QZZ A;  4YIF A;  1TC3 C;  2ICW G;  1FIP A;  3KLO A;  4BQO A;  3VYS B;  1HW5 A;  2VBZ A;  2STW A;  2VOO A;  4LOC A;  5HLH A;  2VPL A;  1XMX A;  4YEJ A;  4KFC A;  2R7V A;  3PQJ A;  3K70 C;  2HYG D;  4HX7 A;  3ZQQ A;  3TOA A;  4MFD A;  4OAZ A;  4UVA A;  1FYK A;  3IC7 A;  4UHT A;  1MND A;  5KNL A;  3ERE D;  2Y48 A;  1E17 A;  2IXS A;  3BJO A;  5EG0 A;  3FF5 A;  4C9Y A;  3M8J A;  1PYV A;  2QSF X;  2E7X A;  1JHH A;  3I55 I;  2B0L A;  5ILS A;  5E3M A;  2JJ7 A;  1YX5 A;  5GPC A;  1RUO A;  3BTC A;  3J81 Z;  3S32 A;  3I5U A;  4M6Y A;  2VI6 A;  2N8G A;  2V4J C;  1WHU A;  3IAM 2;  3F8C A;  5BOX A;  5D6F A;  4OIN F;  2WY7 Q;  5B3S H;  4AVZ A;  5GAD J;  1F43 A;  2PEX A;  1YO5 C;  3MMY B;  3DEE A;  4FET A;  4DIQ A;  2KDZ A;  2EH3 A;  2DFF A;  2WWY A;  1W7P A;  4BUP A;  3T0Y A;  1Z67 A;  2UUZ A;  5L3F A;  2XSD C;  4RLF A;  5IT9 Z;  1FTT A;  4IHW A;  1A6I A;  1D1C A;  3EPZ A;  2CJJ A;  3NWT A;  5DM6 F;  1O57 A;  1TWC J;  3ABK H;  4CCM A;  3CCQ I;  2VB6 A;  2Q0O A;  3OMY A;  1OYI A;  2Y31 A;  2HZT A;  2VE8 A;  1FPQ A;  2E34 A;  2X48 A;  1XGM A;  1LDD A;  3HSR A;  4HAM A;  3FHZ A;  1V3F A;  1ZRF A;  1ZAO A;  1OIS A;  4GYI A;  1FMW A;  3UR3 C;  1VZ0 A;  4G94 A;  4XQF A;  2R3S A;  5F6F A;  3SXY A;  1WJB A;  1ZTR A;  2EIL H;  2MC3 A;  3HGG A;  2XGC A;  2QF7 A;  1VQO I;  2K9M A;  4DZJ A;  1O3T A;  2KIF A;  2I10 A;  4A69 C;  4BDY A;  1X2N A;  2HQR A;  3SEZ A;  3GTP J;  2F5C A;  2LBF B;  5HOO A;  4AIJ A;  3RZD J;  1S6L A;  1T95 A;  1U8R A;  4E4H A;  2QBY B;  1R00 A;  1XCV A;  1SAX A;  2HS5 A;  1GV5 A;  3DQV C;  2DA7 A;  1IRF A;  2R7Q A;  3Q0W A;  3H5R A;  3PO2 J;  1JGS A;  1FT9 A;  2AQF A;  3CDL A;  1IXS B;  2DOE A;  4Y4R A;  2GA1 A;  2PN6 A;  2B9S A;  2DU9 A;  2V9K A;  4D1Q A;  3FZV A;  5KAI C;  2DO7 A;  4BH9 A;  2W24 A;  3FXJ A;  3MFK A;  1JTX A;  2UXN A;  1I6X A;  1S7O A;  2KHM A;  2WB1 A;  3ZGK A;  3IRR A;  4V19 K;  2KQR A;  2KIU A;  2QZ8 A;  4RAZ A;  4ZTJ A;  4B8X A;  3OYD A;  2CWE A;  3GYH X;  2GZW A;  5BPI A;  3M4O J;  4ZYG A;  1H0M A;  3IV5 A;  2BYV E;  4AWX B;  1J2X A;  1ZYR F;  1R4N B;  5CVV A;  3W3C A;  5F1R A;  4UY8 I;  3TW7 A;  2IAI A;  2VJI A;  1TQP A;  3S1R J;  5DS9 A;  1H89 C;  4XLF A;  2EZH A;  1HW2 A;  2OD5 A;  4ZH4 F;  2VBX A;  4IJA A;  5LEK A;  3J7Z I;  3K4B A;  1MKM A;  1MBK A;  2F2E A;  3SQN A;  5JLW A;  1A36 A;  4PJ0 C;  3BR5 A;  2LRE A;  2V26 A;  4EAT A;  2MLK A;  4NBQ A;  5E3N A;  2ELJ A;  3E6D A;  3BLY A; 
#chains in the Genus database with same CATH homology
 1RR7 A;  2O7O A;  1QVT A;  2XGD A;  4D7N A;  1ZKG A;  2EZL A;  3BR0 A;  3SDG A;  1O4X A;  2DJN A;  2X9D A;  3GBG A;  3HKZ N;  4M3F A;  1UG2 A;  2LKX A;  1PUF A;  3GTM J;  3G1M A;  1DU6 A;  2XB0 X;  5K7H A;  1YRN B;  5IP7 J;  2HXI A;  3HOV J;  3BG3 A;  3F0C A;  4BY1 J;  2JMW A;  4MO7 A;  5JLX A;  1JGG A;  4QIW N;  4A3I J;  2CUE A;  5M5W J;  3K2A A;  2K9Q A;  1JUS A;  2FJ1 A;  2GM4 A;  2DTZ A;  3BT9 A;  5FKL A;  1PUF B;  3BR3 A;  1GDT A;  2GBY A;  4XID A;  4Y7N J;  1MNM C;  3C2B A;  3O8G A;  2DA5 A;  2XPV A;  3LSJ A;  5FJ8 J;  1OCP A;  5M3F J;  3HB9 A;  2CRG A;  4AUX A;  4UUT A;  3A01 B;  2NOG A;  3LSG A;  1JKR C;  2LTP A;  3RZO J;  4HNV A;  2LY9 A;  1Q1V A;  1WI3 A;  1ZQ3 P;  1GV2 A;  4QSH A;  2HQ5 A;  5J1R A;  3DEW A;  1WCM J;  1IJW C;  4JP0 A;  1A5J A;  2LK2 A;  3TP0 A;  2JK3 A;  3SJM A;  2R5Y A;  4M6V A;  3GTQ J;  2M2E A;  2MGQ A;  2PMZ N;  1JJ8 C;  3W6V A;  5J3L A;  4GFB A;  2B63 J;  1U9N A;  3FK6 A;  4J19 A;  3OSG A;  2Y9Z A;  2JWT A;  1IUF A;  1K83 J;  4FE4 A;  4NDL A;  4B1R A;  1Y1V J;  3FIW A;  1H88 C;  4A3C J;  2ECC A;  1MBJ A;  2HOS A;  2VKV A;  2ME0 A;  1ETW A;  3A03 A;  1Y1W J;  1MSF C;  2OPT A;  5EZG A;  2TCT A;  1U8B A;  3D1N I;  3S15 J;  1LFB A;  1I50 J;  1OCT C;  2CUF A;  4A93 J;  3M3Y J;  3NAR A;  5C3E J;  1Z0X A;  1D5Y A;  2NVX J;  1IC8 A;  3E7L A;  2EBI A;  2E2I J;  4CYC A;  2XRL A;  2H1K A;  1CQT A;  2M9H A;  2NVT J;  3QQA A;  4IHY A;  1ITY A;  3IH4 A;  1B8I B;  3QPS A;  4D5C A;  5GP9 A;  4AC0 A;  2DN0 A;  4UUS A;  1K61 A;  5IOY A;  1TWG J;  5EF6 A;  2CU7 A;  3ZQG A;  3JRG A;  3G1L A;  1IDY A;  2HDD A;  1NK3 P;  1VI0 A;  4FE7 A;  2VUM J;  1RKW A;  2L7M P;  2DA4 A;  5IP9 J;  4A3K J;  2E2H J;  1IRZ A;  4B4C A;  2K40 A;  2FX0 A;  3ZQI A;  2Y30 A;  1OJL A;  4MFE A;  4FCY A;  2E19 A;  2HI3 A;  2R93 J;  2LP0 A;  3JRE A;  3LSP A;  5EYR A;  4EEF G;  1MBE A;  1ETQ A;  3FIS A;  3Q0V A;  2WAQ N;  3JRB A;  3NAU A;  4X6A J;  3JRF A;  4RDU A;  3IH2 A;  3JRA A;  3FKI J;  3A01 A;  4RBO A;  1JKQ C;  1TWH J;  3HOX J;  4A3E J;  4FIS A;  4V2F A;  4Y52 J;  1LE8 A;  1JT6 A;  3HBL A;  3GTL J;  1MBF A;  5FLM J;  4DZP A;  1RET A;  3RKQ A;  1POG A;  1U9O A;  1TWA J;  2DA1 A;  5C4J J;  4C3I J;  5C4X J;  3S2D J;  5K7Z A;  1JKP C;  2QCO A;  3B6A A;  2WB1 N;  2G0E A;  2YS9 A;  2EQR A;  4M3B A;  1P7I A;  4D7M A;  1NTC A;  2JA6 J;  2LLK A;  4BY7 J;  3WHC A;  4G12 A;  1JKO C;  5IOZ A;  2NVQ J;  5E3L A;  4MLO A;  2VPR A;  5E3O A;  1BW6 A;  1IGN A;  4C2M J;  1AKH B;  1ETK A;  5BNG A;  1W0T A;  5J1Y A;  3HDD A;  2Y0S N;  3BTI A;  4DYQ A;  2DA6 A;  4QTR A;  2HYJ A;  1JJ6 C;  1SAN A;  3IH3 A;  1EF4 A;  5F04 A;  1ENH A;  3BTJ A;  1MSE C;  3G1O A;  2VKE A;  4X1E A;  1XS9 A;  3B6C A;  4B3A A;  4IHV A;  1WPK A;  5F27 A;  3S17 J;  4IHX A;  1HLV A;  4FTH A;  5F0H A;  4I76 A;  1X2M A;  1XC5 A;  2XB5 A;  3ZQC A;  1HDP A;  1OFC X;  2HOT A;  2WV1 A;  4BBR J;  1FIA A;  3Q0U A;  2XPW A;  2ME6 A;  2R5Z B;  2AHQ A;  2GLO A;  1S7E A;  4M3E A;  3TW6 A;  5HOD A;  1F36 A;  5EZH A;  2ID6 A;  5EGO B;  4JX5 A;  1MH3 A;  1LE8 B;  1WH7 A;  2DMP A;  5EDN A;  1E3O C;  4A3F J;  1LFU P;  1U78 A;  3ZOB A;  4AYB N;  3JRH A;  3ZQL A;  1QRY A;  3MKL A;  3BTL A;  2COB A;  4C3H J;  2NVY J;  1ETV A;  1VND A;  3TED A;  2DMU A;  1H8A C;  3LSR A;  3RQI A;  3DCF A;  2L9R A;  1JUP A;  1B8I A;  1P7J A;  3ZQF A;  2P81 A;  1ZGW A;  3JRI A;  5IYC J;  3OOU A;  3HM5 A;  3LOC A;  4UUS B;  2LFB A;  3GTG J;  1BA5 A;  4JYK A;  1T33 A;  5EGO A;  4A3B J;  3HOU J;  2L7F P;  1MH4 A;  3HOY J;  3Q3S A;  2JA7 J;  2AO9 A;  5IYB J;  1XG1 A;  2YUS A;  2NS7 A;  9ANT A;  2R7Z J;  3MN2 A;  1T56 A;  3SFI A;  2K9S A;  3GTJ J;  2E2J J;  3S1N J;  4I6Z A;  2L7Z A;  4XRS A;  2FD5 A;  2Y9Y A;  5IP6 A;  1ZK8 A;  1AHD P;  4ABZ A;  2YU9 J;  1GUU A;  2W48 A;  2ECB A;  5F0C A;  1IDZ A;  5F1J A;  4A3J J;  1HF0 A;  1IG7 A;  3CMY A;  3UKG A;  3BG9 A;  2DMN A;  2R92 J;  3WHB A;  1ORK A;  2XGE A;  4MIM A;  3L1P A;  4A3M J;  1FEX A;  2M8G X;  2ZB9 A;  5FLV A;  1BL0 A;  2JA8 J;  1TC3 C;  4BKX A;  1NK2 P;  5FKM A;  1FIP A;  4D5F A;  5FKK A;  1TWF J;  4LOC A;  1ETX A;  4XK4 A;  1DU0 A;  3CCY A;  2RAE A;  4V2G A;  1ETY A;  3JRC A;  3FK7 A;  4MFD A;  3H3V K;  4A3L J;  3PO3 J;  4M3G A;  4W97 A;  3HEF A;  5EG0 A;  1APL C;  1RPW A;  3JRD A;  3VPR A;  5J1U A;  2JN6 A;  5E3M A;  2JJ7 A;  4CYC B;  3CQZ J;  1IV6 A;  5GPC A;  3BTC A;  5IPA A;  2M34 A;  2IEK A;  3O8H A;  2VI6 A;  2N8G A;  2LVS A;  3BR6 A;  1HOM A;  1QVU A;  2HOA A;  1HDD C;  2LD5 A;  3OSF A;  1WGX A;  1F43 A;  4C3J J;  2D5V A;  1JUM A;  2E1O A;  5C44 J;  1BW5 A;  4BBS J;  2XPU A;  2KDZ A;  1W0U A;  2EH3 A;  1GT0 C;  5GPA A;  4L5E A;  3BQY A;  2TRT A;  2XSD C;  3S1M J;  1FTT A;  5FKO A;  1A6I A;  2IBD A;  3HGY A;  1R9T J;  4IHW A;  2NS8 A;  3I4M J;  5K7F A;  2CJJ A;  1TWC J;  4W1U A;  1GVD A;  2K9N A;  3S16 J;  3JR9 A;  3GTK J;  3HOW J;  2ELK A;  2Y31 A;  5M5Y J;  1QPI A;  4BXX J;  2DA3 A;  2LR8 A;  2X48 A;  4DW6 A;  2JA5 J;  2DMQ A;  2DMT A;  3PM1 A;  2R5Y B;  2R5Z A;  1HCR A;  3MVP A;  3I4N J;  4M3D A;  4JX4 A;  2O8K A;  1Z77 A;  4DYC A;  4A3G J;  1ZR4 A;  1FTZ A;  1ZTR A;  3HGG A;  1ZR2 A;  2XGC A;  2HXO A;  2M0C A;  2QF7 A;  2R0Q C;  4DZJ A;  3GTO J;  2I10 A;  4A69 C;  1X2N A;  3LNQ A;  3BR1 A;  2ID3 A;  2CQX A;  3HOZ J;  4XIC A;  1ETO A;  3GTP J;  3RZD J;  3K7A J;  1FJL A;  2MSY A;  1MBG A;  4XRM A;  5M5X J;  1AU7 A;  3S1Q J;  5EG0 B;  3S2H J;  1I3Q J;  5M3M J;  5FKN A;  2H8R A;  3H0G J;  5F08 A;  1GV5 A;  2FQ4 A;  3ZQH A;  4IEJ A;  2MW8 A;  3S14 J;  2DA7 A;  1B72 A;  3Q0W A;  1SFO J;  3PO2 J;  1AKH A;  1UHS A;  3CDL A;  1VF9 A;  2X6O A;  1VFC A;  1UMQ A;  3BG5 A;  3BR2 A;  1JTX A;  3A02 A;  2O9L A;  2DA2 A;  2CQQ A;  4S0H B;  2MG4 A;  1RKT A;  5EEA A;  1JTY A;  1JT0 A;  4A3D J;  3BQZ A;  3M4O J;  3OIO A;  3IV5 A;  1RES A;  1B72 B;  1BJZ A;  4XRS G;  2Y2Z A;  1I6H J;  5IYD J;  3TW7 A;  2IAI A;  3S1R J;  1G2H A;  5DS9 A;  1H89 C;  2EZH A;  2KT0 A;  1MBH A;  1WH5 A;  4JX6 A;  1MBK A;  2EZI A;  5JLW A;  2L0K A;  1YRN A;  3BR5 A;  4DYR A;  5DTD A;  1X58 A;  2OF7 A;  5F0F A;  3TP3 A;  5E3N A;  2EZK A;  3QPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...