4Y52J

Crystal structure of 5-carboxycytosine recognition by rna polymerase ii during transcription elongation.
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for 5-carboxycytosine recognition by RNA polymerase II elongation complex.
pubmed doi rcsb
molecule tags Transcription/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 16
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2015-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4y52J00
1ZKGA 1O4XA 1BL0A 2QCOA 1GT0C 4DYCA 5IP7J 2IEKA 4I6ZA 2HI3A 1YRNB 1TWFJ 2L0KA 1WCMJ 1ETQA 2CQXA 2N8GA 1SFOJ 1IDYA 2R5ZB 3QPSA 1JJ8C 2IAIA 5DS9A 2R5YA 1UHSA 4MFEA 5EDNA 2RAEA 4JP0A 3BG5A 2JA7J 3TW7A 1BW6A 1CQTA 2IBDA 2PMZN 2DA3A 4JX5A 2NVQJ 5F0FA 5DTDA 3BG3A 2AO9A 2ECCA 3IH3A 1JKQC 3A02A 3GTGJ 2OPTA 2K9NA 3JRDA 4V2FA 1I50J 2HOTA 2CUEA 4BY7J 1JKOC 5C3EJ 1Z77A 1ITYA 4JX6A 3GTPJ 4IEJA 1JUMA 1U9OA 2EZLA 2Y9YA 1IV6A 3PO2J 2XGEA 4W1UA 3D1NI 2DMPA 1MNMC 3LSGA 3F0CA 4AC0A 4C3JJ 1ZQ3P 1X58A 1JKRC 3S1NJ 3TP0A 4D5CA 2HXOA 2QF7A 3S1MJ 4CYCB 1ETVA 3I4MJ 2COBA 1HLVA 1ETOA 5FKOA 1JT6A 1JUPA 4RBOA 3HOVJ 3LOCA 2M0CA 3S1RJ 1PUFB 2EZIA 3RZOJ 5IYDJ 1XC5A 5IP9J 2VI6A 5IPAA 1POGA 2JA6J 1TWGJ 2P81A 3MKLA 3HGYA 1OFCX 4QSHA 2FX0A 3VPRA 5M3FJ 5E3NA 4IHXA 4A3BJ 4J19A 1K61A 1RKTA 1T56A 4EEFG 2XSDC 2XPUA 5IOYA 5HODA 1WH5A 2EZHA 2LY9A 2XB5A 1MBGA 1HDDC 1VFCA 1YRNA 2R7ZJ 2AHQA 2HQ5A 5EGOA 4A3JJ 1ZK8A 1JTXA 2DA2A 4DZJA 4CYCA 1ETYA 1GV5A 2JJ7A 4A3MJ 1IGNA 2ID3A 1ETWA 3ZQHA 1U9NA 4V2GA 4FE7A 1TWCJ 3BG9A 3TW6A 5FKKA 1JT0A 3PO3J 2E1OA 2B63J 5F1JA 2Y0SN 2HOSA 1HOMA 3JRHA 3O8HA 1AHDP 3TEDA 1ZTRA 4AYBN 2LTPA 3JRBA 4A3EJ 2Y9ZA 1TWHJ 3S17J 3BR0A 4D5FA 2GM4A 2LD5A 2ECBA 2WB1N 4FCYA 4XRSA 4A3CJ 4M3EA 5GPAA 1Y1WJ 2X9DA 2R5ZA 3G1MA 4GFBA 4A3DJ 3K7AJ 3QPLA 2CJJA 4BBRJ 2DMNA 3DEWA 1MH3A 1IC8A 1B72A 1PUFA 1G2HA 4DYQA 5M5XJ 1LE8A 2R92J 1RPWA 4XRMA 2LVSA 4XRSG 1P7IA 2DJNA 1Y1VJ 2Y30A 1HF0A 2XPVA 2CQQA 3FK6A 5EYRA 2DTZA 1OCTC 5FLMJ 4DZPA 3BTJA 5E3OA 1TC3C 5M3MJ 1JTYA 2VKVA 1OJLA 2NOGA 3ZQGA 1XS9A 5EG0A 5FJ8J 3HEFA 5C4JJ 3S2HJ 1HDPA 5EEAA 2L7MP 5F0CA 2ME0A 2YS9A 3BTLA 4DW6A 1MSEC 3JRFA 2JN6A 2ZB9A 1W0TA 5EZGA 3MVPA 2EBIA 4IHWA 1Q1VA 2DA7A 4B1RA 2YUSA 1HCRA 2NVTJ 4JX4A 2WAQN 4M3DA 5EF6A 1B8IB 5FKNA 2E2IJ 1QRYA 4M3FA 3M4OJ 5F27A 2DA5A 3GTKJ 1MBJA 2FD5A 3G1OA 3QQAA 9ANTA 3GTOJ 3NARA 3CQZJ 2LFBA 2MG4A 1S7EA 2EH3A 2TCTA 2XRLA 3HKZN 4L5EA 3S16J 3RKQA 2D5VA 5GPCA 3I4NJ 2DA6A 4I76A 1F36A 3HOXJ 1P7JA 3LNQA 4MO7A 2R93J 3Q0UA 5F08A 2XB0X 4XK4A 5K7ZA 4UUTA 2NS7A 4MIMA 1I6HJ 2M8GX 3LSRA 2JWTA 1ZR2A 3PM1A 2DN0A 2DMTA 4Y7NJ 3LSJA 1GV2A 4XICA 1AU7A 5FLVA 3GBGA 4M3GA 4FTHA 4FE4A 3BQYA 1ORKA 3O8GA 3HOYJ 1LFBA 1GUUA 3H0GJ 1BW5A 3HOZJ 1OCPA 2DMUA 2CUFA 5IYBJ 3TP3A 5M5WJ 5EG0B 1VF9A 3S14J 1FEXA 2XPWA 3CDLA 5J1YA 1QPIA 2E2JJ 2WV1A 4A93J 3OIOA 2Y31A 4B4CA 5GP9A 3RZDJ 1MH4A 1VI0A 4C2MJ 2ME6A 1ETKA 1U8BA 1IRZA 3Q0VA 2KDZA 4X6AJ 1B8IA 5C44J 3IV5A 2H8RA 1LFUP 1RETA 2K9SA 4M3BA 3JRAA 2MSYA 3CCYA 4FISA 1NK3P 2XGCA 3B6CA 3A01A 5F04A 4D7MA 4A3GJ 2VKEA 2R0QC 1WPKA 4A3LJ 3OOUA 4UUSA 2NS8A 3S2DJ 3RQIA 4LOCA 1AKHB 5BNGA 2EZKA 3GTLJ 4DYRA 4A3IJ 3A03A 2NVXJ 1Z0XA 4B3AA 1IUFA 1UG2A 2K9QA 3SDGA 2G0EA 3HDDA 1MBEA 4A69C 5JLXA 1DU6A 2GBYA 4BXXJ 1MBKA 3FISA 3BR3A 4S0HB 2W48A 3JR9A 3GTMJ 1JUSA 1IDZA 1BJZA 1H89C 2MW8A 1B72B 1GVDA 2K40A 1LE8B 3S1QJ 2M2EA 2E2HJ 3A01B 5IYCJ 2JA8J 2HXIA 1E3OC 3ZQCA 3ZOBA 3FKIJ 4G12A 2OF7A 2YU9J 4AUXA 5C4XJ 3HOUJ 2M9HA 1FTZA 4QTRA 5K7HA 3E7LA 2LP0A 4A3FJ 2DMQA 1D5YA 3JRIA 2HOAA 1JJ6C 2FQ4A 2JK3A 2L9RA 4MFDA 4RDUA 3Q0WA 3IH2A 2FJ1A 3UKGA 1DU0A 5K7FA 1JKPC 3H3VK 3MN2A 1FIAA 5FKLA 3GTQJ 2R5YB 3BR6A 4BKXA 1FTTA 1APLC 4BBSJ 1UMQA 2O8KA 2VPRA 2JA5J 1ETXA 3L1PA 3BTCA 2E19A 5JLWA 2DA1A 2DA4A 3OSFA 2X48A 3HB9A 1A6IA 3JRGA 4NDLA 2L7ZA 1U78A 3BQZA 3W6VA 1A5JA 1MBFA 3BR5A 5F0HA 3DCFA 3HBLA 5J1UA 2O9LA 3NAUA 1H88C 5M5YJ 1TWAJ 4HNVA 1FIPA 3WHCA 5IOZA 1XG1A 1JGGA 3HM5A 3BR2A 2X6OA 1VNDA 2JMWA 1WH7A 2HYJA 3B6AA 1EF4A 2NVYJ 4M6VA 1ENHA 3SFIA 1NK2P 1RKWA 1BA5A 3FK7A 2ELKA 4IHYA 3HOWJ 3OSGA 3FIWA 4XIDA 2I10A 1GDTA 1IJWC 3ZQLA 4IHVA 1IG7A 1K83J 4Y52J 4JYKA 1F43A 2LKXA 1MSFC 2O7OA 4D7NA 3SJMA 1R9TJ 1X2NA 3K2AA 1QVUA 4UUSB 3M3YJ 5FKMA 3S15J 1RESA 2EQRA 1RR7A 1T33A 3Q3SA 2HDDA 4A3KJ 2LK2A 5EGOB 3WHBA 1X2MA 5IP6A 3G1LA 5E3LA 1ZGWA 3IH4A 3HGGA 1I3QJ 4C3HJ 2LR8A 4QIWN 2KT0A 2CU7A 4X1EA 2XGDA 2Y2ZA 3ZQIA 3JREA 5J1RA 3BR1A 1ZR4A 2MGQA 3GTJJ 2ID6A 4MLOA 1MBHA 3ZQFA 5EZHA 4BY1J 1FJLA 1QVTA 1H8AC 3LSPA 5E3MA 2M34A 4W97A 2TRTA 1SANA 3C2BA 3CMYA 2CRGA 3JRCA 5J3LA 4C3IJ 2H1KA 1WGXA 4ABZA 3BTIA 1W0UA 2LLKA 2VUMJ 3BT9A 2L7FP 1WI3A 1NTCA 1AKHA 2GLOA
chains in the Genus database with same CATH superfamily
2PLYA 1FC3A 3OS1A 4XONA 4I6ZA 3GXOA 1HW2A 1IV8A 5TJJA 2G7HA 2CQXA 2N8GA 2KIFA 1IDYA 3NWSA 3OOPA 3REOA 2R5ZB 1VQ5I 1JI8A 2KRCA 1LNWA 5FRMA 1MGTA 3M1EA 5E1XA 2QQBA 5DS9A 5E79C 5BMZA 5J8CA 5DM6F 4HX8A 4R79A 2KISA 4EJUA 4Z2YA 4ESFA 5EDNA 2RAEA 3BG5A 2RGVA 1KQ8A 4RGUA 1BW6A 1SAUA 1CQTA 3PFIA 2PMZN 2LG4A 2DA3A 4JX5A 1ZREA 4NB5A 1FZPB 3H5NA 1QQIA 1JKQC 3IH3A 3GW2A 3A02A 1WSUA 3L00A 1O3SA 3JRDA 1KQ9A 2X6WA 1I50J 2HOTA 4HF2A 2CUEA 4OIPF 4P9UA 1HSTA 3OYEA 1JKOC 4FETA 3DXJF 1E3PA 1MNEA 4IEJA 3JTHA 3T1BA 2Q2EB 5HLGA 2HZDA 3PO2J 3W6JB 1KU3A 4DJAA 2YSRA 1IF1A 3TGNA 1X4OA 3S1NJ 2CFXA 2XSJC 1LEAA 4D5CA 5ED4A 3RPUA 3S1MJ 2A6EF 2J5OA 3I4MJ 2OV7A 2JTVA 1K4SA 1ETOA 2ZXWH 1D1AA 2PI0A 1DP3A 3JW4A 3LOCA 3L2VA 2KRHA 4P96A 5IP9J 1V55H 2VI6A 4IOCF 1POGA 3OYCA 5TRDA 3FMRA 2P81A 1I39A 4IO9F 1D3YA 2IP2A 2C6YA 2X85A 3D0SA 2P6SA 2ZXIA 1K61A 2KZVA 1IRXA 4FX0A 3CO6C 4EEFG 4BEHB 2XPUA 1J7KA 2OZ6A 2K4JA 4HYEA 1R1TA 5HODA 2VKDA 1RIOH 1OPCA 2EZHA 2XB5A 1MBGA 3AG1H 1YRNA 3B02A 4A0XA 2XROA 2JRTA 3KX2A 4EM2A 1AA7A 4AD9A 2NOJB 2ZSIB 2MFZA 3VOEA 2O0YA 2DA2A 4L9VA 5FO5A 5ERIA 1IGNA 2E5NA 1ETWA 4LFUA 3ZQHA 1X1DA 4PJJA 4G9YA 2LBFB 3FMQA 5DDGA 3GLXA 4HLXA 2B63J 3SZPA 1MW7A 2M5WA 1OCCH 3JRHA 2DOFA 3JAMK 1P9QC 4N0BA 1ZTRA 3TEDA 3LL7A 1UELB 4F55A 3PUBA 4A3EJ 2FXAA 5FB2A 3W2VA 1Z21A 2I8DA 3SZTA 2JVHA 5JVGF 3KZZA 2BZTA 3OYLA 2KRFA 5J4VA 4DIQA 4HOBA 3OYKA 1R5HA 4OU0A 4HBLA 4HF0A 2AXLA 3DWLE 3ZGKA 3DKXA 2JA2A 5BPDA 4A3DJ 2CJJA 4IPAA 4BBRJ 5FGMA 2VXZA 1MH3A 2M87A 3CCUI 3KP7A 4F92B 4QPQA 1MNDA 2L5QA 3EYYA 1P92A 2R92J 1BI3A 3AG3H 2OQGA 3DEEA 2VQHA 3QODA 3H0DA 2KIUA 4YFXF 2VB6A 1FYLA 3WU0A 5GAEJ 3JSPA 4R8HA 2PJRA 3OWTA 4O6JA 1TLHB 2DTZA 2HTJA 5FLMJ 1OCTC 4DZPA 3OYBA 1S8NA 2MD5A 4PFPA 1ZG1A 1PVEA 3WGHA 5M3MJ 3CCSI 4ENJA 5LHHA 1FT9A 4WF2A 4HRIA 1G3TA 1HKSA 2VT3A 5BPIA 3ZQGA 5EG0A 5FJ8J 1HDPA 3LFUA 1R00A 3H35A 2R7DA 1S7OA 1MJBA 4BL0B 4IQ4A 3WGIA 3RI4A 1MSEC 4XNFA 2ZB9A 4LB6B 3CTAA 5EZGA 3PNYA 4IHWA 4B1RA 4JX4A 3QYEA 4ZH4F 2R7RA 3E97A 1R49A 3ASOH 5EF6A 3IUOA 5J47A 5CJ9A 3BROA 1RI7A 3KETA 1W7PB 3M4OJ 1D1CA 4M72A 4BAYA 4XLCA 4I0BA 4H4KC 3GTKJ 1MBJA 4XKVA 1VZ0A 3KP2A 3CCLI 3LAJA 3QQAA 2LF8A 3K4KA 4RGXA 4RAGA 3GTOJ 2MG4A 1YHQI 4JOMA 4G8XA 2TCTA 2XRLA 4L5EA 4RLQA 3PIOF 4BE1A 1K79A 2DA6A 4I76A 4RM2A 4CZCA 4LIVA 4OWRB 4XORA 4O3MA 2MLGA 2CGPA 1P7JA 3OYNA 3LNQA 6PAXA 4XK4A 5FFXA 3DV8A 2NS7A 5LBQA 4MIMA 2IA0A 2MH9A 1HSJA 4BQAA 2NXNB 5KVRA 1ZR2A 4BQNA 5CVJA 4Y7NJ 2YR2A 1ERDA 2OC6A 4XICA 3BZ6A 1AU7A 2F2EA 1BI0A 4M71A 4UB6C 3VSKA 2GA1A 4IXAA 3A0BC 5FLVA 2VE8A 4KT5C 2ZO4A 1Y39A 1ORKA 3O8GA 1T38A 2IXSA 2HDCA 2HZTA 4I7HA 1LFBA 1GUUA 2FOWA 5HLIA 3T8RA 2DMUA 2QGUA 2IS2A 4ZYGA 1XMKA 1Z67A 4F52A 3ABUA 1X1BA 1TP4A 1VF9A 2F5CA 1PP7U 3S14J 1G8XA 5L3CA 3BC8A 2DOEA 5J1YA 1QPIA 1Z9CA 1F5TA 1MDMA 2L9SA 4A93J 2EFQA 4E7SA 3QP5A 4LITA 2EFOA 3H5AA 2PN6A 2FSWA 1IRFA 1ETKA 1U8BA 5D5WB 1IRZA 3MWMA 1NH3A 2FF4A 2ZMEA 4CYDA 1RR8C 4HG2A 4XLAA 2JPCA 3OS2A 1YJ9I 1LFUP 5CVUA 2COMA 4YIFA 1WJFA 4NHJA 2MSYA 3WTXC 1YJNI 2PJRB 1N25A 2F5VA 4BACA 2PQ8A 2VKEA 3HHGA 2R0QC 2CW8A 5HNFA 2STWA 3CC2I 1SEUA 5DV5A 4EJWA 1FMWA 1LUJB 2QQ9A 3FKJA 2BY1A 3IHUA 1AKHB 1WJBA 3HYIA 3QYFA 3TL4X 4IVNA 3A03A 3I55I 3V7CA 2FBIA 1IZ1A 1DU6A 3K70D 1Z7LA 3ZMZA 2CUJA 3GTMJ 2IGNA 2BW3A 2IT0A 5ILSA 3CF5F 2KQRA 5JI6A 1GVDA 1GLNA 2F6CA 2VQCA 2ISZA 3F9KA 3FXUA 1K6YA 2ZJPF 4Y3OA 2XHKA 1D8JA 3A01B 3QPHA 3VYTB 2K3FA 3EDPA 4MTEA 3RKXA 2STTA 2L4MA 3OMYA 2JA8J 1KU7A 1FWZA 2EPFA 3ZOBA 4C2UA 2OF7A 2ZSHB 1MD0A 3FXJA 2PMHA 1FTZA 4KFCA 1KU2A 2QQ8A 3GZ6A 1TQIA 3F6OA 4OOIA 2Y0MA 2IS4A 4A3FJ 2E5ZA 2DMQA 1T08B 4KITB 2V9PA 4MFDA 2FJ1A 3TMOA 5K7FA 2WA0A 1JKPC 4CCMA 2PFBA 3J7ZI 2R5YB 2K9MA 1WRJA 3ONQA 1UMQA 2O8KA 3WE3A 2HVQA 3A1YA 1TT5B 5GTHC 3LSMA 3L2WA 3BTCA 4HV6A 3OSFA 1H9GA 2R7VA 1A6IA 3H9JA 2K85A 3MKWB 2Y0SA 2L7ZA 1V3FA 4RAZA 3W6VA 2H6CA 4MHGA 1MBFA 3RKYA 2D1HA 2WBMA 2DXIA 4ZDOA 4CDGA 1ZN2A 2VBYA 4AU7A 3R0JA 2VKHA 3W2WA 1FSEA 2DAOA 4MTDA 5IOZA 3WHCA 2A6TA 2QA4I 1IN4A 4F3QA 3FZVA 5HS8A 4FT8A 3S3NA 2JMWA 1QBJA 2JQ7A 1MMSA 3M1CA 1J0RA 2UXXA 2G9WA 1Z91A 3KYCB 1WH7A 3H3ZA 3E5UA 3CD6I 1SVMA 3JSOA 1EF4A 5CVIA 4LLGF 1ONVA 1YJWI 5D4RA 4RGSA 2M4KA 2VT2A 4I09A 3GMEA 2HS5A 2XF7A 2FU4A 1I1SA 3C7JA 2HEOA 4ZJZA 2A68F 1DGWY 2PJPA 2GOXB 1IJWC 4WXHA 1NG6A 3ZQLA 2GZWA 3CLQA 3V42A 4ZZLA 1KU9A 2FRHA 2MC4A 1F43A 2LKXA 1GHCA 2LDUA 4UV9A 1H0MA 4NC8A 3GO5A 3D5SC 5FKMA 3S15J 4IJAA 2DK8A 1MIJA 1RNLA 4C2TA 5CQEA 4ENKA 3I58A 2OZUA 2IVMA 4BQOA 1RR7A 4ENMA 1S72I 4I02A 2LK2A 1QZEA 3VODA 2L02A 4KNYA 4RB0A 3F8MA 5IP6A 3CMEI 2K4BA 1XX5A 1I3QJ 4C3HJ 4EMSA 4QIWN 3ZN1A 4PFOA 3SQNA 1YQAA 1YOVB 1ZR4A 4UV8A 1R4NB 4MLOA 5DUIA 4LMYA 1MBHA 2BY2A 1L0OC 4BQQA 5B66C 3AFHA 1H8AC 4OMYA 2M30A 3SYTA 3ASNH 3S93A 3C2BA 3CMYA 3W2AA 4ETSA 2QBYB 2H1KA 2RV8A 4FASD 1WGXA 3HRTA 4ABZA 5BOXA 1W0UA 2LLKA 4RA2A 2VUMJ 1UZCA 3V8KA 1NTCA 2XVCA 4EV0A 1AKHA 1ZKGA 4L5JA 3HOSA 5DCFA 2ZCWA 4BE2A 3M07A 2DCEA 1WCMJ 2CQNA 5CLSA 2JRMA 1FP1D 3FM3A 2HPIA 1MJ9A 5B5EC 5HS9A 3FXLA 2IAIA 3J80Z 1LDDA 4BXUA 2EFWA 4BHBA 2HTSA 3EUKL 4M9XA 2R5YA 2P5KA 2XASA 4JP0A 2JA7J 3CCQI 3TW7A 3MZYA 3CDIA 4F93B 1V4RA 3BG3A 3H9QA 2CWEA 2OTJI 3DBRB 5KAFC 1ZYRF 2OPTA 4E7JA 4DBRA 1WI9A 5EJCA 1MMNA 2CW0F 2HGCA 1ITYA 3GTPJ 2IPQX 5LGUA 2EZLA 2FMYA 2K02A 1MNMC 1FMVA 2EK5A 4C3JJ 3CCJI 2IA1A 3E0JB 1JKRC 3CCVI 1DQUA 4XLPF 2QF7A 5FFZA 1ON1A 4CUGA 1W36D 1QPMA 1Y6IA 1HLVA 2UZKA 1ON2A 3PSFA 3VDXA 4EQQA 1HBXG 3RZOJ 2IS1A 1B9MA 1SAXA 3X2QH 1XC5A 3E6CC 3DEUA 5CPRB 2XAHA 1EJ9A 3BG6A 3HZJA 2JA6J 3KE2A 1OFCX 2DFEA 2ACJA 4ZDPA 3KP6A 4J19A 1RKTA 5LHGA 2CG4A 5BS6A 2W7NA 2XSDC 4EJTA 3SFZA 2E1CA 5FD6A 2L01A 1U5TC 4CCNA 4WXDA 4IRGA 2A5YB 2V26A 2M4GA 4I01A 4U0VA 1HDDC 1F1ZA 1HQCA 5JR3A 2AHQA 2HQ5A 3LA7A 5EGOA 1W5CC 2W82A 1FSHA 3E3VA 2Q1ZB 2VJIA 1ZK8A 2FA5A 4CSWA 3O6BB 2JJ7A 3JCUC 3I3LA 2PEXA 3BPVA 1TQPA 1U9NA 2DDBA 3ABMH 3A4CA 3TW6A 2Z16A 1REPC 2E1OA 4MQ9F 4EVIA 5JFRA 2HOSA 3K1NA 2VXDA 3ERED 2H09A 1AHDP 3OR2C 1OCOH 1PJRA 3JRBA 3CZ6A 4GXOA 4EJOA 4YRVA 3FXQA 2JUCA 5E20A 3S17J 4D5FA 3EUHA 4RAYA 1N78A 2J5PA 3OIQA 4KT6A 3WTUC 1DDNA 4FX4A 4RB2C 5IT9Z 1IO2A 3L2CA 2RNGA 4M3EA 1FBUA 5GPAA 1RUNA 1A35A 2R5ZA 3HUGA 2WAQA 2P5LC 2EINH 3GZ5A 3MCZA 3V7SA 4J00A 3DPUA 2DMNA 5E17F 4PSXA 4ZYDA 1W4MA 5FD5A 1ZG3A 4LGWA 1G2HA 4AIHA 3DLAA 2IGKA 1RPWA 1Y0UA 1FBQA 1FLIA 2E1MC 2NRAC 1YS6A 3TO7A 2XGXA 3ZMTA 1Y1VJ 3P7NA 5FROA 3KEQA 4CZZA 2A05A 3VYRB 1SC7A 2BHYA 2MYSA 2OQRA 3ZCOA 2LSOA 4LK1F 2BY0A 1OJLA 5KNLA 2NOGA 2WB1A 4P9FA 2AQFA 3BZCA 2XKPA 4HAMA 4DW6A 3F22A 2DTRA 3K4LA 2OCCH 3IP4B 3R0AA 3MVPA 1Q1VA 2AQEA 2YUSA 1I1GA 3A2KA 4BJ5C 3M8FA 1VQLI 4M6XA 2QSFX 5D5XB 1BC7C 4M3FA 5FLXK 4CGZA 1J2XA 4AIKA 1ZHFA 2LYCA 4P55A 1MMAA 4RMNA 4M6YA 2R3SA 4L9JA 4XMYA 1K6OA 3CCRI 1YW9A 5J6XA 3OYMA 1Q1HA 2E34A 2XF6A 4EJVA 3IAM2 5GPCA 2P0WA 2D1VA 3EPZA 1XGNA 3MKYB 3OR1C 4HSRA 4BE0A 2R93J 3ULQB 4XLHA 1I6HJ 3H92A 4HF1A 2F4IA 3IWFA 1BC8C 1FPQA 1ZG5A 4ENNA 2V1UA 1GV2A 4L18B 2KPMA 5E8IA 2A61A 4OAZA 4KMUX 2VBWA 2CO5A 5FLXZ 5LHIA 1D1BA 4BHPA 3RCOA 5DCMA 4M3GA 3BQYA 3U21A 2Z3YA 3OYIA 1ZLJA 4Y13A 2HYGD 4UXNA 3S2WA 4U87A 1BJAA 2L54A 3BLYA 3J81K 4HDVA 2O8XA 1TTYA 2XF5A 2EA4A 3Q9VA 2CQKA 4LLNA 2DOAA 1T98A 4KYWA 4E4HA 3BCAA 1IXSB 3GFIA 4BXFA 1XCBA 1CF7B 3FXOA 4BDZA 2MC3A 1XCVA 2E1NA 5GP9A 2XAFA 1T0FC 2ISYA 1MH4A 1W5SA 3ERMA 4CCOA 2UV1A 2ME6A 2MD0A 3T8TA 4X6AJ 1TNSA 5C44J 1CGPA 1X3WB 3IV5A 3IKVA 1YO5C 2H8RA 4IRIA 1DGRM 1RETA 2K9SA 4ZYAA 1RUOA 5J40A 3CCYA 4FISA 3A01A 1IXRC 3LSHA 4YG2F 1O3TA 3FXRA 2VQLA 4D7MA 4A3GJ 3H1CA 2E7XA 4DGWB 1MMGA 1WPKA 2F48A 4A3LJ 3J80K 3S2DJ 2Z5UA 3CMAI 3RQIA 1D0XA 2WV0A 4LOCA 4XSZF 4CICA 1QZZA 4B3AA 2DW4A 5J8FA 3HDDA 1OQYA 3I59B 4A69C 5JLXA 4EM0B 4BXXJ 1BBYA 3HUGB 5E1WA 2VN2A 3JR9A 1EH6A 4HPQA 4ZDLA 1X4PA 4BGDA 4CCKA 3WTWC 1FOWA 2M7AA 1B72B 2K40A 3FX3A 1FYKA 2KJBA 2E2HJ 2GWRA 4L9NA 1R22A 2HXIA 4ON0A 3ZQCA 2HNHA 2DODA 4G6QA 2P7CB 5LFAA 2YPRA 4AUXA 1A31A 5IT9K 2BHZA 3HOUJ 3BJOA 4TV7A 2R7OA 4IX7A 3E7LA 3N05A 4B43A 3KZYA 5J4YA 5HDGA 3V8LA 5HLTA 4NC6A 4CHUA 1S9HA 2DLLA 2ZNYA 3OL4A 2HR3A 3JRIA 2HOAA 3H9GA 2JK3A 3V8JA 2E60A 3I0TA 3P9KA 3FXKA 4NQWB 3G4SI 1Z6TA 3AL0C 3MN2A 5L3GA 1BOAA 3BR6A 4KICA 4BKXA 4L0ZB 1DPUA 1APLC 3G3ZA 1EH7A 4OIRF 2ZMEC 4KJZA 1ETXA 4Y33A 1HF0A 4UY8I 2LH9A 3VYSB 4KIFA 3A0HC 3FHNA 2DA1A 2DA4A 1YX3A 3CESA 3PL8A 3JRGA 4JBAA 2Z2SB 4NDLA 2V9KA 1OCRH 4G6TB 3WTZA 3OYAA 4XLEA 5F0HA 1GXQA 2KLOA 1BIAA 2HQNA 3HBLA 4Z6YA 3F8NA 2HQAA 3FF5A 3E6DA 2OBPA 1WWXA 4DNCA 4XKBA 1TWAJ 5M5YJ 5HLHA 3HSRA 1XG1A 1IUYA 3KEOA 1UFMA 2MLKA 1Z7UA 2FNPA 4FQGA 3JTGA 1G59A 3HHHA 3ZPLA 3VYUB 2HYJA 1EA3A 3HC7A 3KZIC 5L3EA 2WY7Q 2NVYJ 4MGRA 2GIVA 1ENHA 3SFIA 1SFXA 4Y15A 1BA5A 2OUMA 5EEHA 5BQTA 4B48A 2PBIA 4ZZDA 2CW7A 2E1MB 4PGHA 4XIDA 1BOBA 1EH8A 1B4AA 3QP6A 3TDUC 1WHUA 3RKWA 4Q48A 4WWCA 3ISPA 4Y52J 4OMZA 1Z05A 4PZJA 1MSFC 2O7OA 3K4JA 3SZGA 3GFMA 3K2AA 5HVQC 4XLNF 2M8EA 3MMYB 1W5TA 1VTNC 2VBZA 1VQ4I 3O2PE 2EQRA 1R58A 1IN8A 1X19A 1X2MA 3GFLA 4XM3A 3IH4A 1S5LC 2KFDA 2Z99A 1K4TA 2ZBKA 1V5GA 2LR8A 3SXYA 4HQEA 2KT0A 4X1EA 2XGDA 3CJRB 3RIRA 3ZQIA 2X6XA 2Y75A 2VLAA 1V5FA 2MGQA 3GTJJ 2ID6A 3ZQQA 5EZHA 2YX4A 5L3BA 1QVTA 5K5RA 1P4XA 3CUQB 1U5TB 1ZRFA 2TRTA 1VQMI 3I4PA 2EJRA 4I2OA 3K4BA 5KAIC 3BG7A 1YX5A 2R7XA 1B6AA 1VQKI 4NBQA 2EFPA 4IHTA 1X1CA 2L7FP 4WCGA 3ZMVA 1LJ9A 2JPBA 5CYVA 2GLOA 2O9LA 2O3FA 3DTIA 1O4XA 1BL0A 1KQ0A 3P9IA 1EKEA 2IEKA 2K3PA 4DYCA 5L3FA 1YRNB 1TWFJ 2L0KA 2NYXA 1SFOJ 1S6LA 2XAQA 4I98B 3PJRA 3QPSA 2ZNZA 2GAUA 3ZMUA 4GCVA 1HW5A 2DBBA 1PDNC 2ZKZA 3H5RA 3G6EI 1UHSA 1K78A 4MFEA 3U9GA 1A6QA 3F6VA 2HDWA 4CO8A 2IBDA 3CMMA 1WZ2A 2D45A 2NVQJ 5CKTA 1B59A 5F0FA 1FNNA 4LG3A 1UB9A 2ECCA 4XRFA 3GTGJ 1I5ZA 1O57A 4HX7A 1K7AA 3F8CA 2RN7A 4BY7J 2IGMA 3TO6A 3ZP5A 2DJIA 5C3EJ 3GX4X 4JX6A 1U9OA 2Y9YA 1LFPA 1IV6A 3C2HA 2XGEA 3D1NI 2FUG2 1SMTA 2W24A 1WJ5A 1O3RA 2JSCA 1SVOA 4CXFA 5K5OA 3ECOA 1SD5A 2B7EA 1X58A 4KIBA 3TP0A 1HA8A 3FWEA 1OKRA 2HXOA 1X3UA 5GAGJ 1T2KA 2BVMA 2IW5A 2KKOA 2K5CA 1JT6A 3F21A 1JUPA 4RBOA 3HOVJ 2M0CA 3S1RJ 1XSDA 3DKWA 2EZIA 1PUFB 4UVAA 3R61A 4N4NB 4HNTA 3K1PA 2DT6A 1XGSA 2BOLA 3CUOA 4KN7X 3NEUA 3M8EA 4I0AA 3HL2A 2PX9A 3KP5A 5CVVA 3QRFF 4E7HA 2XAUA 4XLFA 4HEA2 2FMLA 5M3FJ 4IOAF 3CF2A 3PNTA 5GTIC 3VWBA 1XSXA 1YE9A 4OIOF 2KIQA 1DP7P 2QBYA 5ILVA 2GOMA 1LB2A 2JZYA 3HTUA 4J01A 1Z6RA 4EGZA 3MEXA 4LJZF 2DT5A 2LY9A 3AG4H 1VFCA 4UVCA 4KDPA 2R7ZJ 2QENA 3K1MA 2GQQA 4AVZA 2DFHA 3PFYA 2LKSA 2BBYA 4CYCA 1ETYA 2W57A 2IA2A 1XDSA 1YTYA 4FHTA 4GGGA 4V2GA 5ICEA 3LFKA 4I99C 3S3OA 1TWCJ 1YW8A 5FKKA 2JT1A 1DPRA 1JT0A 2XRNA 3PO3J 2ZFUA 1W7PA 4C9YA 1FY7A 3N97A 3I54A 3KLNA 2Y0SN 1SD6A 1HOMA 3O8HA 5E18F 3HKZA 4XN3A 4CCLA 1XD7A 3DTEA 4NC7A 2Y9ZA 1WVRA 5KHDA 2BVLA 5H2FC 1YYVA 1BR2A 2Q2EA 2ZXJA 4UNOA 2LD5A 5LD2C 4JK1X 2ECBA 3V7RA 2HU9A 2WB1N 1TW3A 2OD5A 5B1AH 2XKOA 3L2UA 5H6QA 1QZYA 3RQ4A 1Y1WJ 2X9DA 1JXSA 3G1MA 4GFBA 1OR7A 3MKZA 2DT7B 2ZJQF 2A5WA 2X1CA 4IZZA 3DEWA 3QU6A 1ZARA 1B72A 2V7FA 3R4KA 3IL2A 5M5XJ 1UHWA 4RGRA 4LIUA 2LVSA 2EIKH 1YIOA 2OTLI 3LA2A 3F8BA 1ZELA 4JQFA 2EWNA 2A3SA 1YLFA 3G2BA 1IAWA 3BTJA 3SEZA 5E3OA 5A2QK 2Y69H 1TC3C 1ZAOA 1JTYA 5AIPA 3HPHA 4A12A 3NRVA 3GF2A 2KDOA 2V6EA 2QUFA 3CCMI 1MMDA 1XS9A 4B3XA 1Z3YA 1OYWA 1BN5A 3HEFA 3WTVC 3E1SA 4U0WA 5F0CA 2JUGA 2EIJH 3BTLA 4YFNF 1TW2A 3KYLA 4UUVA 1TBXA 2F5FA 1USTA 2H94A 2CV0A 2JN6A 4L9TA 4BHCA 4ZYEA 2OA4A 4B8XA 5B3SH 2DA7A 4MEYF 1HCRA 2WAQN 3S3MA 4M3DA 1VQ9I 3DBLB 2M7BA 3TBIA 2LBFA 4HNUA 2Z9OA 1B8IB 5FKNA 2LREA 5KK1A 1QRYA 2LC2A 3RPQA 3C18A 3MZ8A 3K4CA 2DFIA 1Y8RB 9ANTA 2V9VA 3GLLA 3CQZJ 3PQKA 2O6GE 2L2OA 2BV6A 2LFBA 2EB7A 4AIDA 1S7EA 2DPDA 4ESJA 3AKZA 1ZRCA 5GAHJ 4BYYA 2ESHA 3I4NJ 2FBHA 4U7BA 1F36A 1P4AA 2HOEA 4Y4RA 2GIZA 2K86A 4XOTA 3HOXJ 1Z3XA 1FBSA 4E6KG 3F23A 4MO7A 4M73A 3DLLF 3E6MA 3Q0UA 5K7ZA 3K0LA 2M45A 2M8GX 4G7OF 3Q9SA 2R7SA 2JWTA 2CQ7A 3KLOA 3PM1A 3WODF 5TGTA 2DMTA 3DBHB 3LSJA 2WY8Q 2FOKA 2NVUB 2FE3A 5ICCA 2QWWA 1ACIA 1X1PA 3L7WA 3E5XA 3BDDA 2Q8KA 4A0YA 2R7QA 3VFZA 3QPTA 4GYGA 2O03A 1D8KA 3K6GA 3H0GJ 2IRFG 3TOBA 3HOZJ 1OCPA 3V4GA 2CUFA 3R6SA 1W7PD 5LGNA 4IHSA 3LSKA 3I5UA 3OIPA 3TP3A 3CP2A 1I27A 1OMIA 1Z1DA 5EG0B 4IKFA 3ML6A 4HX4A 3TKYA 1UG0A 3K9TA 2XPWA 1FEXA 3CDLA 5CVRA 2RQQA 1S29A 1N75A 3HTSB 4RM3A 4LB5A 4XBFA 3U2RA 3T0YA 3ZRGA 2E2JJ 2DQLA 1ZH5A 4ZC3A 4HW0A 1E3HA 1XDUA 3M7GA 3QOEA 2IS6A 3DPLC 3P5JA 1HKQA 2P8TA 2RREA 3CLOA 4PCQA 2KDZA 3G71I 4KA4A 4EGYA 2V1NA 2BY3A 2X1DA 1NG7A 4L5IA 3AAFA 4M3BA 1T0FA 5JHFA 3B6CA 1V54H 5F04A 4B09A 1I3AA 2P5VA 3GFJA 1W36C 3OOUA 2HFHA 4S04A 2R7WA 1R5ID 4UVBA 4UUSA 2VJJA 3DPTA 2DYRH 2P7VB 3CC7I 4DYRA 2NVXJ 1Z0XA 2K9QA 2DU9A 5AIQA 3BJAA 3SEQA 2L4AA 1MDMB 5H6RA 2WAEA 3FM5A 2GBYA 3RPUD 2RQPA 3FISA 4XN0A 5D4SA 3CC4I 2MH2A 4B44A 2F5EA 2O5RA 4BNCA 3M9AA 3FXMA 2RKHA 2HKXA 1LKXA 1R71A 1J59A 4HLYA 1SFUA 3RYPA 4WK8F 5HDNA 1BM9A 1G6NA 3UR3C 2B9SA 2F5DA 3S1QJ 2M2EA 4F91B 2OCEA 2P4WA 1LQ1A 1MKMA 1X3ZB 3ELKA 1TZLA 2RDPA 3U1DA 5IYCJ 3BZKA 1WFXA 3FKIJ 4G12A 2ADUA 4NNJA 4N4OB 5C4XJ 4ZYHA 2M9HA 2XIGA 1GVJA 1OR7C 4QTRA 3IC7A 5K7HA 5DD8A 4U88A 3HIFA 4BDYA 5B1BH 1LPQA 4GDFA 3KEYA 2EIMH 1D5YA 2L7KA 4D9JA 1IXCA 2GA2A 2L9RA 4MEXF 4RDUA 1OCZH 1SVLA 2BW3B 3C1DA 3IH2A 3UKGA 1IN6A 1FOYA 3OYHA 1RRJA 1DU0A 3LQQA 3H3VK 2R7UA 3GTQJ 2ELHA 3KFWX 1FTTA 3RTRA 3ZMDA 4BBSJ 5AONA 1P4WA 2VPRA 3G73A 3L1PA 2X51A 1VQPI 1D0ZA 4YIIA 1R23A 2W4SA 2OU2A 1FOKA 2X48A 3HB9A 2VC1A 1C0WA 2O61A 5D6EA 1WJEA 3DCFA 2QVOA 1R5GA 5J1UA 4DBQA 2ZJRF 1YIJI 3TQNA 3I64A 1OLTA 1H88C 1QHGA 1LVAA 4HNVA 1JGGA 3HM5A 2PMUA 2ZJ2A 5F6FA 4ITVA 1VNDA 2WAFA 3EUHC 3HJEA 5LRSA 2ICWG 3B6AA 1LEBA 1Y0NA 4XKWA 1XMXA 1P2FA 3MQ0A 1BR4A 2BGCA 1NK2P 1RKWA 3M8JA 3FK7A 1SD7A 4P5OA 2ELKA 3QOPA 3OSGA 3DQVC 3CUQA 4Q5SF 1J5YA 1QNTA 2EV5A 2E71A 2V4JC 2I10A 1E2XA 3KP4A 4Q47A 1GDTA 3OYJA 2X6YA 4WXCA 1IG7A 4PJLA 4JYKA 4E7IA 2YX7A 5D6FA 1P6RA 1STZA 3SJMA 3CJNA 3CO7C 1QVUA 4OIQF 3GUDA 2VJ5A 1RESA 3WG9A 5ILUA 1TL8A 2VQGA 3MZHA 2QQAA 5A2QZ 4YFKF 2HDDA 4PUSA 4A3KJ 4E7ZA 3I59A 3WHBA 1YW7A 3HRSA 1J09A 3IAS2 4II3A 1J75A 4KISA 3GCMA 4LD5A 1OYIA 2VODA 3ESWB 1XN7A 3BY6A 3S32A 4HDUA 2CU7A 2LKPA 2Y2ZA 3KYDB 3HSEA 2DFFA 4E7LA 3LA3A 5H20A 5D8KB 4BS9A 2V6CA 3ZR8X 5E3MA 3K10A 3P9CA 4W97A 1XGOA 3DU5A 2XUBA 4AWXB 3J7AY 3JRCA 1YS7A 1KGSA 4LG0B 3WG7H 4QLCU 3BTIA 2K27A 2QM3A 3WTTC 1WI3A 3PQJA 1AOYA 2EV0A 4HZFA 4QPOA 4V19K 2QCOA 1GT0C 2L9NA 2ZC2A 5IP7J 3OYDA 2HI3A 1T39A 2VPLA 2W25A 2P6TA 1ETQA 3FMSA 5KCMA 1B1BA 5LRRA 4LK0F 3CCEI 1JJ8C 3BPXA 2PMZA 3WTSC 1Y56A 2LF7A 3WE2A 3GYHX 1UAAA 2V1XA 2X4HA 4AIJA 1TT0A 1JE8A 4WX9A 3I9V2 4RB1A 5DTDA 3ZXSA 1VQ8I 1KYZA 3ZQ7A 3TDZC 2AO9A 3MD2A 2BXZA 5D8LB 2K7LA 4EATA 2K9NA 4O5VA 1E0EA 2WADA 4V2FA 4A5MA 2DO7A 3QWLA 1BI1A 3I56I 2DDAA 1Z77A 2KJCA 5LEKA 1JUMA 5HS7A 4W1UA 5K1YA 1G4DA 2DMPA 2YU3A 1QHHD 3LSGA 3F0CA 4AC0A 3COAC 1ZQ3P 1O7LA 1BIBA 3FBNB 1R6RA 4CYCB 1ETVA 2M3AA 2COBA 1LDJA 3ROUA 2RVCA 5FKOA 2G7UA 1KZHA 2VIXA 3OS0A 3W6KB 2H8WA 3FBIB 2QSGX 5IYDJ 2B0LA 1IN5A 4BH9A 1KONA 3QU3A 5IPAA 3KCCA 5D5VB 1U5TA 2WWYA 1TWGJ 1YFHA 3MKLA 1YI2I 3HGYA 1SFKA 2QZ8A 1ODDA 4QSHA 2FX0A 3NWTA 4XR6A 3VPRA 5E3NA 3K70C 4IHXA 4A3BJ 1F4KA 3ABKH 4XOPA 4E70A 4E7KA 4NUBA 1T56A 1F9NA 3LSTA 1VQ7I 1R4MB 3F3XA 5E8GA 1HC8A 3W3CA 1IN7A 1R1VA 4D1QA 5IOYA 5F64A 2ETHA 1WH5A 3LQRA 2EILH 1VQ6I 2CFOA 1J9IA 1R36A 1USSA 2LOOA 2EV6A 4A3JJ 1R7JA 2L9VA 3OY9A 1JTXA 4DZJA 1GV5A 4A3MJ 2LRDA 2W00A 1QGPA 2ID3A 1YG2A 5D5UB 3D5RC 3AG2H 4A5NA 4A6DA 4C30A 1T6SA 1G3SA 4FE7A 2F4OB 3BG9A 2BXYA 1UJ8A 1WJCA 3FDYA 3Q5FA 2GXAA 4B47A 4R1HA 4S05A 2M1BA 3WTYC 2E36A 2M0MA 1B9NA 5F1JA 3RSNA 4AYBN 2A07F 3DU6A 2LTPA 4KUMA 1WJAA 4HQMA 1DUXC 2W85A 1TWHJ 3OYGA 3BR0A 3HRUA 4AVPA 2GM4A 3ABTA 2BE5F 4KIGA 4CCJA 2NNYA 4UB8C 4FCYA 4XRSA 4A3CJ 2Y48A 4K2EA 4PGGA 5LGTA 4PJMA 4A2UA 3K7AJ 3QPLA 1UHMA 2F4MB 3VEPA 4PJ0C 1S7AA 3E5QA 5ICGA 2VE9A 2X1EA 2ELJA 1IC8A 3ZMSA 4BJ6C 1PUFA 2DI3A 4DYQA 3J7AO 1LE8A 3WU2C 1G3YA 4XRMA 1WJDA 4G7ZF 2QKLB 4XRSG 2XC7A 5DD4A 1P7IA 2KP6A 2DJNA 2X0LA 2Y30A 3KIOA 4D0PA 2XPVA 2CQQA 3B73A 3FK6A 3KPHA 5EYRA 4IRHA 3J81Z 3U1KA 4LG0A 2A69F 4RAFA 3RJPA 4II2A 1U0JA 3DFGA 2VKVA 3C2GA 1BI2A 1IRGA 4HA8A 5C4JJ 3S2HJ 5EEAA 4ANJA 2PG4A 2L7MP 2ME0A 2YS9A 3EETA 3QAHA 3CDHA 3IRRA 2QEXI 3RDIA 3GEZA 3JRFA 1VQOI 1CF7A 3LSIA 5DUKA 2HYFA 1W0TA 3GZNB 2EBIA 1XPXA 2NVTJ 3ZN0A 2E7WA 5K5QA 3QYBA 3IWZA 5IY5H 4M74A 4ESBA 1EV7A 2ZFWA 2E2IJ 4U7DA 3EUAA 3L09A 5LLQA 5F27A 2DA5A 2DQRA 1PYVA 2EA2A 3HSFA 3MAJA 1XGMA 2FD5A 3G1OA 2XAJA 3NARA 3HPGA 2CSOA 4XKCA 5HDKA 2EH3A 3HKZN 3K4NA 3S16J 3RKQA 2D5VA 4G6DA 4F7ZA 2CMPA 2L3DA 3VB2A 3GWZA 4XL9A 4ASNA 4Q4ZF 1SFEA 5F08A 2XB0X 5DYMA 4UUTA 3H3UA 4RS8A 4ZTJA 3LSRA 1W1WE 2DN0A 3OL3A 1WQ2A 2DK5A 4PDKA 4RLFA 3VSLA 5F1RA 3FHZA 3N4MA 1JGSA 4IL6C 1JHFA 2LMDA 3DKYA 1GXPA 1WKMA 3C3WA 3GBGA 4FTHA 4FE4A 2XDVA 2V1DA 4A0ZA 3HOYJ 1TQMA 3SDBA 1BW5A 4HSTA 2VJ4A 2Z1DA 4RB3C 5IYBJ 5M5WJ 1AWCA 3ECHA 1S3JA 1ULYA 2VL8A 4DQ2A 5IT3A 4BUPA 2CV1A 4G7HF 2VOOA 2WV1A 1JHHA 3OIOA 2VASA 2Y31A 4B4CA 3RZDJ 3KP3A 2XV4S 1VI0A 3I71A 4C2MJ 2AXTC 3NQOA 1I6XA 4ZTFA 1XTAA 3Q0VA 2W1OA 3E6BA 3K2ZA 1B8IA 2BYVE 2VC0A 1U3EM 1LVKA 2WTEA 1HXDA 2NAZA 1LDKB 3BCBA 2H6BA 4GO1A 5DCMB 1A36A 2KMUA 4AYBA 3JRAA 1SMYF 1NK3P 2DPUA 1FYMA 3WU1B 2XGCA 2AS5F 2ESNA 2LY2A 1T8IA 3CJQB 2LY1A 2HPMA 3PUFA 3T5XA 3L2RA 3CP8A 1ZGJA 1N77A 1A04A 1IW7F 2BEOA 5TISC 1OYYA 2KHMA 2CYYA 3L2QA 2NS8A 2TDXA 3MFKA 4IF4A 5BNGA 1NHAA 2EZKA 2GXGA 3LAPA 4A3IJ 1QA6A 3GTLJ 1IUFA 1UG2A 4M9ZA 4PJNA 3SDGA 2G0EA 4PK4A 4L0YB 2QLZA 1MBEA 3L9FA 3EQLF 3HOTA 3LWFA 1MBKA 3BR3A 4P1WA 3F72A 4S0HB 2W48A 1D0YA 5CQGA 1JUSA 4NQWA 1BJZA 1H89C 1IDZA 2MW8A 4KMFA 3SHFA 2ZMEB 1HKTA 3BOQA 2IGOA 4XSXF 3CUQC 5E1ZB 1ZRDA 3F8FA 1LE8B 3I53A 5GADJ 3AL0B 2QSHX 4MQVA 1KA8A 2R4GA 1E3OC 4A6EA 1L3LA 3H36A 3BJ6A 2JVGA 2YU9J 1RZ4A 3PIPF 4OAYA 1Y8QB 4IQJA 1O7FA 1T95A 2WC2A 1PP8F 2D2WA 3J7YJ 4UHTA 2QKMB 1PUEE 1E17A 2LP0A 1YITI 5JHUA 1FX7A 4M9SA 1JJ6C 2FQ4A 5HOOA 1KYWA 3Q0WA 1SD4A 4U0YA 3DTKA 4X0GA 3HXLA 1FIAA 5FKLA 1QO0D 2A6HF 2CS3A 4H0EA 2FEZA 5EEGA 2UWMA 3BWGA 2JA5J 3IKTA 4GRIA 1UCRA 3O3KA 3OV8A 1FP2A 3D5LA 2E19A 5JLWA 3LMMA 2CUZA 1U2WA 1X1AA 1O3QA 2K9LA 3TO9A 4BU2A 1XMAA 2I5UA 3WGGA 2VOPA 4YELA 1U78A 3BQZA 1A5JA 3BP8A 2HKOA 3BR5A 2E35A 3JAMZ 4Y17A 1OISA 2OAZA 3NAUA 3UNGC 2FBKA 2VONA 1MJAA 5ICFA 3ABLH 3TOAA 2W84A 1FIPA 2V79A 2R7TA 3BR2A 4YIRX 1FOXA 2VBXA 2Q0OA 2Z33A 5HNHA 2X6OA 1XB4A 3RYRA 2HVRA 4XQFA 1K78B 4M6VA 5DM7F 5DEQA 1D5VA 4AM3A 1G3WA 4DOZA 3DF8A 1XSVA 1TNTA 1ZGAA 4G94A 3HOWJ 4IHYA 3FIWA 2CH0A 2HWVA 2XAGA 3S8PA 2NNNA 2NS0A 1QU3A 5JVTA 2FQ3A 4IHVA 2HVSA 1K83J 4HV5A 4BEHA 2FNAA 4QWQA 2LNBA 4EM1A 4D7NA 2RNJA 1R9TJ 1X2NA 4UUSB 3M3YJ 1H9TA 2MBFA 2KIMA 3IRQA 4PSWA 1T33A 1BR1A 2MABA 3Q3SA 4N9HA 4OINF 3HRMA 3DP7A 4GYIA 5EGOB 4BJTA 3R60A 2JSPA 3K4MA 4LLLA 3G1LA 5E3LA 1ZGWA 4N9IA 3OYFA 3GVAA 3HGGA 5FRNA 1U6GA 4YEJA 2KZGA 2UXNA 4CA0A 4MNUA 2EFNA 2KL4A 2OJED 4KN4X 3EYIA 2DYSH 1RC9A 3PSIA 3JREA 5J1RA 3BR1A 2IJLA 1M1EB 2R7FA 5LEJA 1U8RA 1R1UA 2GXBA 3ZQFA 4BY1J 1FJLA 3K69A 3LSPA 2RC4A 2M34A 2HQRA 2H1LA 2CV2A 1SANA 2ZXHA 2CRGA 3PNVA 1V5EA 5J3LA 4CH7A 1MZBA 4C3IJ 1HW1A 5L3DA 1ZLKA 2MA3A 3CJTB 2UUZA 1VQNI 2H27A 3BT9A 2QYOA 3HG9A
chains in the Genus database with same CATH topology
1ZKGA 1O4XA 1BL0A 2QCOA 1GT0C 4DYCA 5IP7J 2IEKA 4I6ZA 2HI3A 1YRNB 1TWFJ 2L0KA 1WCMJ 1ETQA 2CQXA 2N8GA 1SFOJ 1IDYA 2R5ZB 3QPSA 1JJ8C 2IAIA 5DS9A 2R5YA 1UHSA 4MFEA 5EDNA 2RAEA 4JP0A 3BG5A 2JA7J 3TW7A 1BW6A 1CQTA 2IBDA 2PMZN 2DA3A 4JX5A 2NVQJ 5F0FA 5DTDA 3BG3A 2AO9A 2ECCA 3IH3A 1JKQC 3A02A 3GTGJ 2OPTA 2K9NA 3JRDA 4V2FA 1I50J 2HOTA 2CUEA 4BY7J 1JKOC 5C3EJ 1Z77A 1ITYA 4JX6A 3GTPJ 4IEJA 1JUMA 1U9OA 2EZLA 2Y9YA 1IV6A 3PO2J 2XGEA 4W1UA 3D1NI 2DMPA 1MNMC 3LSGA 3F0CA 4AC0A 4C3JJ 1ZQ3P 1X58A 1JKRC 3S1NJ 3TP0A 4D5CA 2HXOA 2QF7A 3S1MJ 4CYCB 1ETVA 3I4MJ 2COBA 1HLVA 1ETOA 5FKOA 1JT6A 1JUPA 4RBOA 3HOVJ 3LOCA 2M0CA 3S1RJ 1PUFB 2EZIA 3RZOJ 5IYDJ 1XC5A 5IP9J 2VI6A 5IPAA 1POGA 2JA6J 1TWGJ 2P81A 3MKLA 3HGYA 1OFCX 4QSHA 2FX0A 3VPRA 5M3FJ 5E3NA 4IHXA 4A3BJ 4J19A 1K61A 1RKTA 1T56A 4EEFG 2XSDC 2XPUA 5IOYA 5HODA 1WH5A 2EZHA 2LY9A 2XB5A 1MBGA 1HDDC 1VFCA 1YRNA 2R7ZJ 2AHQA 2HQ5A 5EGOA 4A3JJ 1ZK8A 1JTXA 2DA2A 4DZJA 4CYCA 1ETYA 1GV5A 2JJ7A 4A3MJ 1IGNA 2ID3A 1ETWA 3ZQHA 1U9NA 4V2GA 4FE7A 1TWCJ 3BG9A 3TW6A 5FKKA 1JT0A 3PO3J 2E1OA 2B63J 5F1JA 2Y0SN 2HOSA 1HOMA 3JRHA 3O8HA 1AHDP 3TEDA 1ZTRA 4AYBN 2LTPA 3JRBA 4A3EJ 2Y9ZA 1TWHJ 3S17J 3BR0A 4D5FA 2GM4A 2LD5A 2ECBA 2WB1N 4FCYA 4XRSA 4A3CJ 4M3EA 5GPAA 1Y1WJ 2X9DA 2R5ZA 3G1MA 4GFBA 4A3DJ 3K7AJ 3QPLA 2CJJA 4BBRJ 2DMNA 3DEWA 1MH3A 1IC8A 1B72A 1PUFA 1G2HA 4DYQA 5M5XJ 1LE8A 2R92J 1RPWA 4XRMA 2LVSA 4XRSG 1P7IA 2DJNA 1Y1VJ 2Y30A 1HF0A 2XPVA 2CQQA 3FK6A 5EYRA 2DTZA 1OCTC 5FLMJ 4DZPA 3BTJA 5E3OA 1TC3C 5M3MJ 1JTYA 2VKVA 1OJLA 2NOGA 3ZQGA 1XS9A 5EG0A 5FJ8J 3HEFA 5C4JJ 3S2HJ 1HDPA 5EEAA 2L7MP 5F0CA 2ME0A 2YS9A 3BTLA 4DW6A 1MSEC 3JRFA 2JN6A 2ZB9A 1W0TA 5EZGA 3MVPA 2EBIA 4IHWA 1Q1VA 2DA7A 4B1RA 2YUSA 1HCRA 2NVTJ 4JX4A 2WAQN 4M3DA 5EF6A 1B8IB 5FKNA 2E2IJ 1QRYA 4M3FA 3M4OJ 5F27A 2DA5A 3GTKJ 1MBJA 2FD5A 3G1OA 3QQAA 9ANTA 3GTOJ 3NARA 3CQZJ 2LFBA 2MG4A 1S7EA 2EH3A 2TCTA 2XRLA 3HKZN 4L5EA 3S16J 3RKQA 2D5VA 5GPCA 3I4NJ 2DA6A 4I76A 1F36A 3HOXJ 1P7JA 3LNQA 4MO7A 2R93J 3Q0UA 5F08A 2XB0X 4XK4A 5K7ZA 4UUTA 2NS7A 4MIMA 1I6HJ 2M8GX 3LSRA 2JWTA 1ZR2A 3PM1A 2DN0A 2DMTA 4Y7NJ 3LSJA 1GV2A 4XICA 1AU7A 5FLVA 3GBGA 4M3GA 4FTHA 4FE4A 3BQYA 1ORKA 3O8GA 3HOYJ 1LFBA 1GUUA 3H0GJ 1BW5A 3HOZJ 1OCPA 2DMUA 2CUFA 5IYBJ 3TP3A 5M5WJ 5EG0B 1VF9A 3S14J 1FEXA 2XPWA 3CDLA 5J1YA 1QPIA 2E2JJ 2WV1A 4A93J 3OIOA 2Y31A 4B4CA 5GP9A 3RZDJ 1MH4A 1VI0A 4C2MJ 2ME6A 1ETKA 1U8BA 1IRZA 3Q0VA 2KDZA 4X6AJ 1B8IA 5C44J 3IV5A 2H8RA 1LFUP 1RETA 2K9SA 4M3BA 3JRAA 2MSYA 3CCYA 4FISA 1NK3P 2XGCA 3B6CA 3A01A 5F04A 4D7MA 4A3GJ 2VKEA 2R0QC 1WPKA 4A3LJ 3OOUA 4UUSA 2NS8A 3S2DJ 3RQIA 4LOCA 1AKHB 5BNGA 2EZKA 3GTLJ 4DYRA 4A3IJ 3A03A 2NVXJ 1Z0XA 4B3AA 1IUFA 1UG2A 2K9QA 3SDGA 2G0EA 3HDDA 1MBEA 4A69C 5JLXA 1DU6A 2GBYA 4BXXJ 1MBKA 3FISA 3BR3A 4S0HB 2W48A 3JR9A 3GTMJ 1JUSA 1IDZA 1BJZA 1H89C 2MW8A 1B72B 1GVDA 2K40A 1LE8B 3S1QJ 2M2EA 2E2HJ 3A01B 5IYCJ 2JA8J 2HXIA 1E3OC 3ZQCA 3ZOBA 3FKIJ 4G12A 2OF7A 2YU9J 4AUXA 5C4XJ 3HOUJ 2M9HA 1FTZA 4QTRA 5K7HA 3E7LA 2LP0A 4A3FJ 2DMQA 1D5YA 3JRIA 2HOAA 1JJ6C 2FQ4A 2JK3A 2L9RA 4MFDA 4RDUA 3Q0WA 3IH2A 2FJ1A 3UKGA 1DU0A 5K7FA 1JKPC 3H3VK 3MN2A 1FIAA 5FKLA 3GTQJ 2R5YB 3BR6A 4BKXA 1FTTA 1APLC 4BBSJ 1UMQA 2O8KA 2VPRA 2JA5J 1ETXA 3L1PA 3BTCA 2E19A 5JLWA 2DA1A 2DA4A 3OSFA 2X48A 3HB9A 1A6IA 3JRGA 4NDLA 2L7ZA 1U78A 3BQZA 3W6VA 1A5JA 1MBFA 3BR5A 5F0HA 3DCFA 3HBLA 5J1UA 2O9LA 3NAUA 1H88C 5M5YJ 1TWAJ 4HNVA 1FIPA 3WHCA 5IOZA 1XG1A 1JGGA 3HM5A 3BR2A 2X6OA 1VNDA 2JMWA 1WH7A 2HYJA 3B6AA 1EF4A 2NVYJ 4M6VA 1ENHA 3SFIA 1NK2P 1RKWA 1BA5A 3FK7A 2ELKA 4IHYA 3HOWJ 3OSGA 3FIWA 4XIDA 2I10A 1GDTA 1IJWC 3ZQLA 4IHVA 1IG7A 1K83J 4Y52J 4JYKA 1F43A 2LKXA 1MSFC 2O7OA 4D7NA 3SJMA 1R9TJ 1X2NA 3K2AA 1QVUA 4UUSB 3M3YJ 5FKMA 3S15J 1RESA 2EQRA 1RR7A 1T33A 3Q3SA 2HDDA 4A3KJ 2LK2A 5EGOB 3WHBA 1X2MA 5IP6A 3G1LA 5E3LA 1ZGWA 3IH4A 3HGGA 1I3QJ 4C3HJ 2LR8A 4QIWN 2KT0A 2CU7A 4X1EA 2XGDA 2Y2ZA 3ZQIA 3JREA 5J1RA 3BR1A 1ZR4A 2MGQA 3GTJJ 2ID6A 4MLOA 1MBHA 3ZQFA 5EZHA 4BY1J 1FJLA 1QVTA 1H8AC 3LSPA 5E3MA 2M34A 4W97A 2TRTA 1SANA 3C2BA 3CMYA 2CRGA 3JRCA 5J3LA 4C3IJ 2H1KA 1WGXA 4ABZA 3BTIA 1W0UA 2LLKA 2VUMJ 3BT9A 2L7FP 1WI3A 1NTCA 1AKHA 2GLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZKG A;  1O4X A;  1BL0 A;  2QCO A;  1GT0 C;  4DYC A;  5IP7 J;  2IEK A;  4I6Z A;  2HI3 A;  1YRN B;  1TWF J;  2L0K A;  1WCM J;  1ETQ A;  2CQX A;  2N8G A;  1SFO J;  1IDY A;  2R5Z B;  3QPS A;  1JJ8 C;  2IAI A;  5DS9 A;  2R5Y A;  1UHS A;  4MFE A;  5EDN A;  2RAE A;  4JP0 A;  3BG5 A;  2JA7 J;  3TW7 A;  1BW6 A;  1CQT A;  2IBD A;  2PMZ N;  2DA3 A;  4JX5 A;  2NVQ J;  5F0F A;  5DTD A;  3BG3 A;  2AO9 A;  2ECC A;  3IH3 A;  1JKQ C;  3A02 A;  3GTG J;  2OPT A;  2K9N A;  3JRD A;  4V2F A;  1I50 J;  2HOT A;  2CUE A;  4BY7 J;  1JKO C;  5C3E J;  1Z77 A;  1ITY A;  4JX6 A;  3GTP J;  4IEJ A;  1JUM A;  1U9O A;  2EZL A;  2Y9Y A;  1IV6 A;  3PO2 J;  2XGE A;  4W1U A;  3D1N I;  2DMP A;  1MNM C;  3LSG A;  3F0C A;  4AC0 A;  4C3J J;  1ZQ3 P;  1X58 A;  1JKR C;  3S1N J;  3TP0 A;  4D5C A;  2HXO A;  2QF7 A;  3S1M J;  4CYC B;  1ETV A;  3I4M J;  2COB A;  1HLV A;  1ETO A;  5FKO A;  1JT6 A;  1JUP A;  4RBO A;  3HOV J;  3LOC A;  2M0C A;  3S1R J;  1PUF B;  2EZI A;  3RZO J;  5IYD J;  1XC5 A;  5IP9 J;  2VI6 A;  5IPA A;  1POG A;  2JA6 J;  1TWG J;  2P81 A;  3MKL A;  3HGY A;  1OFC X;  4QSH A;  2FX0 A;  3VPR A;  5M3F J;  5E3N A;  4IHX A;  4A3B J;  4J19 A;  1K61 A;  1RKT A;  1T56 A;  4EEF G;  2XSD C;  2XPU A;  5IOY A;  5HOD A;  1WH5 A;  2EZH A;  2LY9 A;  2XB5 A;  1MBG A;  1HDD C;  1VFC A;  1YRN A;  2R7Z J;  2AHQ A;  2HQ5 A;  5EGO A;  4A3J J;  1ZK8 A;  1JTX A;  2DA2 A;  4DZJ A;  4CYC A;  1ETY A;  1GV5 A;  2JJ7 A;  4A3M J;  1IGN A;  2ID3 A;  1ETW A;  3ZQH A;  1U9N A;  4V2G A;  4FE7 A;  1TWC J;  3BG9 A;  3TW6 A;  5FKK A;  1JT0 A;  3PO3 J;  2E1O A;  2B63 J;  5F1J A;  2Y0S N;  2HOS A;  1HOM A;  3JRH A;  3O8H A;  1AHD P;  3TED A;  1ZTR A;  4AYB N;  2LTP A;  3JRB A;  4A3E J;  2Y9Z A;  1TWH J;  3S17 J;  3BR0 A;  4D5F A;  2GM4 A;  2LD5 A;  2ECB A;  2WB1 N;  4FCY A;  4XRS A;  4A3C J;  4M3E A;  5GPA A;  1Y1W J;  2X9D A;  2R5Z A;  3G1M A;  4GFB A;  4A3D J;  3K7A J;  3QPL A;  2CJJ A;  4BBR J;  2DMN A;  3DEW A;  1MH3 A;  1IC8 A;  1B72 A;  1PUF A;  1G2H A;  4DYQ A;  5M5X J;  1LE8 A;  2R92 J;  1RPW A;  4XRM A;  2LVS A;  4XRS G;  1P7I A;  2DJN A;  1Y1V J;  2Y30 A;  1HF0 A;  2XPV A;  2CQQ A;  3FK6 A;  5EYR A;  2DTZ A;  1OCT C;  5FLM J;  4DZP A;  3BTJ A;  5E3O A;  1TC3 C;  5M3M J;  1JTY A;  2VKV A;  1OJL A;  2NOG A;  3ZQG A;  1XS9 A;  5EG0 A;  5FJ8 J;  3HEF A;  5C4J J;  3S2H J;  1HDP A;  5EEA A;  2L7M P;  5F0C A;  2ME0 A;  2YS9 A;  3BTL A;  4DW6 A;  1MSE C;  3JRF A;  2JN6 A;  2ZB9 A;  1W0T A;  5EZG A;  3MVP A;  2EBI A;  4IHW A;  1Q1V A;  2DA7 A;  4B1R A;  2YUS A;  1HCR A;  2NVT J;  4JX4 A;  2WAQ N;  4M3D A;  5EF6 A;  1B8I B;  5FKN A;  2E2I J;  1QRY A;  4M3F A;  3M4O J;  5F27 A;  2DA5 A;  3GTK J;  1MBJ A;  2FD5 A;  3G1O A;  3QQA A;  9ANT A;  3GTO J;  3NAR A;  3CQZ J;  2LFB A;  2MG4 A;  1S7E A;  2EH3 A;  2TCT A;  2XRL A;  3HKZ N;  4L5E A;  3S16 J;  3RKQ A;  2D5V A;  5GPC A;  3I4N J;  2DA6 A;  4I76 A;  1F36 A;  3HOX J;  1P7J A;  3LNQ A;  4MO7 A;  2R93 J;  3Q0U A;  5F08 A;  2XB0 X;  4XK4 A;  5K7Z A;  4UUT A;  2NS7 A;  4MIM A;  1I6H J;  2M8G X;  3LSR A;  2JWT A;  1ZR2 A;  3PM1 A;  2DN0 A;  2DMT A;  4Y7N J;  3LSJ A;  1GV2 A;  4XIC A;  1AU7 A;  5FLV A;  3GBG A;  4M3G A;  4FTH A;  4FE4 A;  3BQY A;  1ORK A;  3O8G A;  3HOY J;  1LFB A;  1GUU A;  3H0G J;  1BW5 A;  3HOZ J;  1OCP A;  2DMU A;  2CUF A;  5IYB J;  3TP3 A;  5M5W J;  5EG0 B;  1VF9 A;  3S14 J;  1FEX A;  2XPW A;  3CDL A;  5J1Y A;  1QPI A;  2E2J J;  2WV1 A;  4A93 J;  3OIO A;  2Y31 A;  4B4C A;  5GP9 A;  3RZD J;  1MH4 A;  1VI0 A;  4C2M J;  2ME6 A;  1ETK A;  1U8B A;  1IRZ A;  3Q0V A;  2KDZ A;  4X6A J;  1B8I A;  5C44 J;  3IV5 A;  2H8R A;  1LFU P;  1RET A;  2K9S A;  4M3B A;  3JRA A;  2MSY A;  3CCY A;  4FIS A;  1NK3 P;  2XGC A;  3B6C A;  3A01 A;  5F04 A;  4D7M A;  4A3G J;  2VKE A;  2R0Q C;  1WPK A;  4A3L J;  3OOU A;  4UUS A;  2NS8 A;  3S2D J;  3RQI A;  4LOC A;  1AKH B;  5BNG A;  2EZK A;  3GTL J;  4DYR A;  4A3I J;  3A03 A;  2NVX J;  1Z0X A;  4B3A A;  1IUF A;  1UG2 A;  2K9Q A;  3SDG A;  2G0E A;  3HDD A;  1MBE A;  4A69 C;  5JLX A;  1DU6 A;  2GBY A;  4BXX J;  1MBK A;  3FIS A;  3BR3 A;  4S0H B;  2W48 A;  3JR9 A;  3GTM J;  1JUS A;  1IDZ A;  1BJZ A;  1H89 C;  2MW8 A;  1B72 B;  1GVD A;  2K40 A;  1LE8 B;  3S1Q J;  2M2E A;  2E2H J;  3A01 B;  5IYC J;  2JA8 J;  2HXI A;  1E3O C;  3ZQC A;  3ZOB A;  3FKI J;  4G12 A;  2OF7 A;  2YU9 J;  4AUX A;  5C4X J;  3HOU J;  2M9H A;  1FTZ A;  4QTR A;  5K7H A;  3E7L A;  2LP0 A;  4A3F J;  2DMQ A;  1D5Y A;  3JRI A;  2HOA A;  1JJ6 C;  2FQ4 A;  2JK3 A;  2L9R A;  4MFD A;  4RDU A;  3Q0W A;  3IH2 A;  2FJ1 A;  3UKG A;  1DU0 A;  5K7F A;  1JKP C;  3H3V K;  3MN2 A;  1FIA A;  5FKL A;  3GTQ J;  2R5Y B;  3BR6 A;  4BKX A;  1FTT A;  1APL C;  4BBS J;  1UMQ A;  2O8K A;  2VPR A;  2JA5 J;  1ETX A;  3L1P A;  3BTC A;  2E19 A;  5JLW A;  2DA1 A;  2DA4 A;  3OSF A;  2X48 A;  3HB9 A;  1A6I A;  3JRG A;  4NDL A;  2L7Z A;  1U78 A;  3BQZ A;  3W6V A;  1A5J A;  1MBF A;  3BR5 A;  5F0H A;  3DCF A;  3HBL A;  5J1U A;  2O9L A;  3NAU A;  1H88 C;  5M5Y J;  1TWA J;  4HNV A;  1FIP A;  3WHC A;  5IOZ A;  1XG1 A;  1JGG A;  3HM5 A;  3BR2 A;  2X6O A;  1VND A;  2JMW A;  1WH7 A;  2HYJ A;  3B6A A;  1EF4 A;  2NVY J;  4M6V A;  1ENH A;  3SFI A;  1NK2 P;  1RKW A;  1BA5 A;  3FK7 A;  2ELK A;  4IHY A;  3HOW J;  3OSG A;  3FIW A;  4XID A;  2I10 A;  1GDT A;  1IJW C;  3ZQL A;  4IHV A;  1IG7 A;  1K83 J;  4Y52 J;  4JYK A;  1F43 A;  2LKX A;  1MSF C;  2O7O A;  4D7N A;  3SJM A;  1R9T J;  1X2N A;  3K2A A;  1QVU A;  4UUS B;  3M3Y J;  5FKM A;  3S15 J;  1RES A;  2EQR A;  1RR7 A;  1T33 A;  3Q3S A;  2HDD A;  4A3K J;  2LK2 A;  5EGO B;  3WHB A;  1X2M A;  5IP6 A;  3G1L A;  5E3L A;  1ZGW A;  3IH4 A;  3HGG A;  1I3Q J;  4C3H J;  2LR8 A;  4QIW N;  2KT0 A;  2CU7 A;  4X1E A;  2XGD A;  2Y2Z A;  3ZQI A;  3JRE A;  5J1R A;  3BR1 A;  1ZR4 A;  2MGQ A;  3GTJ J;  2ID6 A;  4MLO A;  1MBH A;  3ZQF A;  5EZH A;  4BY1 J;  1FJL A;  1QVT A;  1H8A C;  3LSP A;  5E3M A;  2M34 A;  4W97 A;  2TRT A;  1SAN A;  3C2B A;  3CMY A;  2CRG A;  3JRC A;  5J3L A;  4C3I J;  2H1K A;  1WGX A;  4ABZ A;  3BTI A;  1W0U A;  2LLK A;  2VUM J;  3BT9 A;  2L7F P;  1WI3 A;  1NTC A;  1AKH A;  2GLO A; 
#chains in the Genus database with same CATH topology
 2PLY A;  1FC3 A;  3OS1 A;  4XON A;  4I6Z A;  3GXO A;  1HW2 A;  1IV8 A;  5TJJ A;  2G7H A;  2CQX A;  2N8G A;  2KIF A;  1IDY A;  3NWS A;  3OOP A;  3REO A;  2R5Z B;  1VQ5 I;  1JI8 A;  2KRC A;  1LNW A;  5FRM A;  1MGT A;  3M1E A;  5E1X A;  2QQB A;  5DS9 A;  5E79 C;  5BMZ A;  5J8C A;  5DM6 F;  4HX8 A;  4R79 A;  2KIS A;  4EJU A;  4Z2Y A;  4ESF A;  5EDN A;  2RAE A;  3BG5 A;  2RGV A;  1KQ8 A;  4RGU A;  1BW6 A;  1SAU A;  1CQT A;  3PFI A;  2PMZ N;  2LG4 A;  2DA3 A;  4JX5 A;  1ZRE A;  4NB5 A;  1FZP B;  3H5N A;  1QQI A;  1JKQ C;  3IH3 A;  3GW2 A;  3A02 A;  1WSU A;  3L00 A;  1O3S A;  3JRD A;  1KQ9 A;  2X6W A;  1I50 J;  2HOT A;  4HF2 A;  2CUE A;  4OIP F;  4P9U A;  1HST A;  3OYE A;  1JKO C;  4FET A;  3DXJ F;  1E3P A;  1MNE A;  4IEJ A;  3JTH A;  3T1B A;  2Q2E B;  5HLG A;  2HZD A;  3PO2 J;  3W6J B;  1KU3 A;  4DJA A;  2YSR A;  1IF1 A;  3TGN A;  1X4O A;  3S1N J;  2CFX A;  2XSJ C;  1LEA A;  4D5C A;  5ED4 A;  3RPU A;  3S1M J;  2A6E F;  2J5O A;  3I4M J;  2OV7 A;  2JTV A;  1K4S A;  1ETO A;  2ZXW H;  1D1A A;  2PI0 A;  1DP3 A;  3JW4 A;  3LOC A;  3L2V A;  2KRH A;  4P96 A;  5IP9 J;  1V55 H;  2VI6 A;  4IOC F;  1POG A;  3OYC A;  5TRD A;  3FMR A;  2P81 A;  1I39 A;  4IO9 F;  1D3Y A;  2IP2 A;  2C6Y A;  2X85 A;  3D0S A;  2P6S A;  2ZXI A;  1K61 A;  2KZV A;  1IRX A;  4FX0 A;  3CO6 C;  4EEF G;  4BEH B;  2XPU A;  1J7K A;  2OZ6 A;  2K4J A;  4HYE A;  1R1T A;  5HOD A;  2VKD A;  1RIO H;  1OPC A;  2EZH A;  2XB5 A;  1MBG A;  3AG1 H;  1YRN A;  3B02 A;  4A0X A;  2XRO A;  2JRT A;  3KX2 A;  4EM2 A;  1AA7 A;  4AD9 A;  2NOJ B;  2ZSI B;  2MFZ A;  3VOE A;  2O0Y A;  2DA2 A;  4L9V A;  5FO5 A;  5ERI A;  1IGN A;  2E5N A;  1ETW A;  4LFU A;  3ZQH A;  1X1D A;  4PJJ A;  4G9Y A;  2LBF B;  3FMQ A;  5DDG A;  3GLX A;  4HLX A;  2B63 J;  3SZP A;  1MW7 A;  2M5W A;  1OCC H;  3JRH A;  2DOF A;  3JAM K;  1P9Q C;  4N0B A;  1ZTR A;  3TED A;  3LL7 A;  1UEL B;  4F55 A;  3PUB A;  4A3E J;  2FXA A;  5FB2 A;  3W2V A;  1Z21 A;  2I8D A;  3SZT A;  2JVH A;  5JVG F;  3KZZ A;  2BZT A;  3OYL A;  2KRF A;  5J4V A;  4DIQ A;  4HOB A;  3OYK A;  1R5H A;  4OU0 A;  4HBL A;  4HF0 A;  2AXL A;  3DWL E;  3ZGK A;  3DKX A;  2JA2 A;  5BPD A;  4A3D J;  2CJJ A;  4IPA A;  4BBR J;  5FGM A;  2VXZ A;  1MH3 A;  2M87 A;  3CCU I;  3KP7 A;  4F92 B;  4QPQ A;  1MND A;  2L5Q A;  3EYY A;  1P92 A;  2R92 J;  1BI3 A;  3AG3 H;  2OQG A;  3DEE A;  2VQH A;  3QOD A;  3H0D A;  2KIU A;  4YFX F;  2VB6 A;  1FYL A;  3WU0 A;  5GAE J;  3JSP A;  4R8H A;  2PJR A;  3OWT A;  4O6J A;  1TLH B;  2DTZ A;  2HTJ A;  5FLM J;  1OCT C;  4DZP A;  3OYB A;  1S8N A;  2MD5 A;  4PFP A;  1ZG1 A;  1PVE A;  3WGH A;  5M3M J;  3CCS I;  4ENJ A;  5LHH A;  1FT9 A;  4WF2 A;  4HRI A;  1G3T A;  1HKS A;  2VT3 A;  5BPI A;  3ZQG A;  5EG0 A;  5FJ8 J;  1HDP A;  3LFU A;  1R00 A;  3H35 A;  2R7D A;  1S7O A;  1MJB A;  4BL0 B;  4IQ4 A;  3WGI A;  3RI4 A;  1MSE C;  4XNF A;  2ZB9 A;  4LB6 B;  3CTA A;  5EZG A;  3PNY A;  4IHW A;  4B1R A;  4JX4 A;  3QYE A;  4ZH4 F;  2R7R A;  3E97 A;  1R49 A;  3ASO H;  5EF6 A;  3IUO A;  5J47 A;  5CJ9 A;  3BRO A;  1RI7 A;  3KET A;  1W7P B;  3M4O J;  1D1C A;  4M72 A;  4BAY A;  4XLC A;  4I0B A;  4H4K C;  3GTK J;  1MBJ A;  4XKV A;  1VZ0 A;  3KP2 A;  3CCL I;  3LAJ A;  3QQA A;  2LF8 A;  3K4K A;  4RGX A;  4RAG A;  3GTO J;  2MG4 A;  1YHQ I;  4JOM A;  4G8X A;  2TCT A;  2XRL A;  4L5E A;  4RLQ A;  3PIO F;  4BE1 A;  1K79 A;  2DA6 A;  4I76 A;  4RM2 A;  4CZC A;  4LIV A;  4OWR B;  4XOR A;  4O3M A;  2MLG A;  2CGP A;  1P7J A;  3OYN A;  3LNQ A;  6PAX A;  4XK4 A;  5FFX A;  3DV8 A;  2NS7 A;  5LBQ A;  4MIM A;  2IA0 A;  2MH9 A;  1HSJ A;  4BQA A;  2NXN B;  5KVR A;  1ZR2 A;  4BQN A;  5CVJ A;  4Y7N J;  2YR2 A;  1ERD A;  2OC6 A;  4XIC A;  3BZ6 A;  1AU7 A;  2F2E A;  1BI0 A;  4M71 A;  4UB6 C;  3VSK A;  2GA1 A;  4IXA A;  3A0B C;  5FLV A;  2VE8 A;  4KT5 C;  2ZO4 A;  1Y39 A;  1ORK A;  3O8G A;  1T38 A;  2IXS A;  2HDC A;  2HZT A;  4I7H A;  1LFB A;  1GUU A;  2FOW A;  5HLI A;  3T8R A;  2DMU A;  2QGU A;  2IS2 A;  4ZYG A;  1XMK A;  1Z67 A;  4F52 A;  3ABU A;  1X1B A;  1TP4 A;  1VF9 A;  2F5C A;  1PP7 U;  3S14 J;  1G8X A;  5L3C A;  3BC8 A;  2DOE A;  5J1Y A;  1QPI A;  1Z9C A;  1F5T A;  1MDM A;  2L9S A;  4A93 J;  2EFQ A;  4E7S A;  3QP5 A;  4LIT A;  2EFO A;  3H5A A;  2PN6 A;  2FSW A;  1IRF A;  1ETK A;  1U8B A;  5D5W B;  1IRZ A;  3MWM A;  1NH3 A;  2FF4 A;  2ZME A;  4CYD A;  1RR8 C;  4HG2 A;  4XLA A;  2JPC A;  3OS2 A;  1YJ9 I;  1LFU P;  5CVU A;  2COM A;  4YIF A;  1WJF A;  4NHJ A;  2MSY A;  3WTX C;  1YJN I;  2PJR B;  1N25 A;  2F5V A;  4BAC A;  2PQ8 A;  2VKE A;  3HHG A;  2R0Q C;  2CW8 A;  5HNF A;  2STW A;  3CC2 I;  1SEU A;  5DV5 A;  4EJW A;  1FMW A;  1LUJ B;  2QQ9 A;  3FKJ A;  2BY1 A;  3IHU A;  1AKH B;  1WJB A;  3HYI A;  3QYF A;  3TL4 X;  4IVN A;  3A03 A;  3I55 I;  3V7C A;  2FBI A;  1IZ1 A;  1DU6 A;  3K70 D;  1Z7L A;  3ZMZ A;  2CUJ A;  3GTM J;  2IGN A;  2BW3 A;  2IT0 A;  5ILS A;  3CF5 F;  2KQR A;  5JI6 A;  1GVD A;  1GLN A;  2F6C A;  2VQC A;  2ISZ A;  3F9K A;  3FXU A;  1K6Y A;  2ZJP F;  4Y3O A;  2XHK A;  1D8J A;  3A01 B;  3QPH A;  3VYT B;  2K3F A;  3EDP A;  4MTE A;  3RKX A;  2STT A;  2L4M A;  3OMY A;  2JA8 J;  1KU7 A;  1FWZ A;  2EPF A;  3ZOB A;  4C2U A;  2OF7 A;  2ZSH B;  1MD0 A;  3FXJ A;  2PMH A;  1FTZ A;  4KFC A;  1KU2 A;  2QQ8 A;  3GZ6 A;  1TQI A;  3F6O A;  4OOI A;  2Y0M A;  2IS4 A;  4A3F J;  2E5Z A;  2DMQ A;  1T08 B;  4KIT B;  2V9P A;  4MFD A;  2FJ1 A;  3TMO A;  5K7F A;  2WA0 A;  1JKP C;  4CCM A;  2PFB A;  3J7Z I;  2R5Y B;  2K9M A;  1WRJ A;  3ONQ A;  1UMQ A;  2O8K A;  3WE3 A;  2HVQ A;  3A1Y A;  1TT5 B;  5GTH C;  3LSM A;  3L2W A;  3BTC A;  4HV6 A;  3OSF A;  1H9G A;  2R7V A;  1A6I A;  3H9J A;  2K85 A;  3MKW B;  2Y0S A;  2L7Z A;  1V3F A;  4RAZ A;  3W6V A;  2H6C A;  4MHG A;  1MBF A;  3RKY A;  2D1H A;  2WBM A;  2DXI A;  4ZDO A;  4CDG A;  1ZN2 A;  2VBY A;  4AU7 A;  3R0J A;  2VKH A;  3W2W A;  1FSE A;  2DAO A;  4MTD A;  5IOZ A;  3WHC A;  2A6T A;  2QA4 I;  1IN4 A;  4F3Q A;  3FZV A;  5HS8 A;  4FT8 A;  3S3N A;  2JMW A;  1QBJ A;  2JQ7 A;  1MMS A;  3M1C A;  1J0R A;  2UXX A;  2G9W A;  1Z91 A;  3KYC B;  1WH7 A;  3H3Z A;  3E5U A;  3CD6 I;  1SVM A;  3JSO A;  1EF4 A;  5CVI A;  4LLG F;  1ONV A;  1YJW I;  5D4R A;  4RGS A;  2M4K A;  2VT2 A;  4I09 A;  3GME A;  2HS5 A;  2XF7 A;  2FU4 A;  1I1S A;  3C7J A;  2HEO A;  4ZJZ A;  2A68 F;  1DGW Y;  2PJP A;  2GOX B;  1IJW C;  4WXH A;  1NG6 A;  3ZQL A;  2GZW A;  3CLQ A;  3V42 A;  4ZZL A;  1KU9 A;  2FRH A;  2MC4 A;  1F43 A;  2LKX A;  1GHC A;  2LDU A;  4UV9 A;  1H0M A;  4NC8 A;  3GO5 A;  3D5S C;  5FKM A;  3S15 J;  4IJA A;  2DK8 A;  1MIJ A;  1RNL A;  4C2T A;  5CQE A;  4ENK A;  3I58 A;  2OZU A;  2IVM A;  4BQO A;  1RR7 A;  4ENM A;  1S72 I;  4I02 A;  2LK2 A;  1QZE A;  3VOD A;  2L02 A;  4KNY A;  4RB0 A;  3F8M A;  5IP6 A;  3CME I;  2K4B A;  1XX5 A;  1I3Q J;  4C3H J;  4EMS A;  4QIW N;  3ZN1 A;  4PFO A;  3SQN A;  1YQA A;  1YOV B;  1ZR4 A;  4UV8 A;  1R4N B;  4MLO A;  5DUI A;  4LMY A;  1MBH A;  2BY2 A;  1L0O C;  4BQQ A;  5B66 C;  3AFH A;  1H8A C;  4OMY A;  2M30 A;  3SYT A;  3ASN H;  3S93 A;  3C2B A;  3CMY A;  3W2A A;  4ETS A;  2QBY B;  2H1K A;  2RV8 A;  4FAS D;  1WGX A;  3HRT A;  4ABZ A;  5BOX A;  1W0U A;  2LLK A;  4RA2 A;  2VUM J;  1UZC A;  3V8K A;  1NTC A;  2XVC A;  4EV0 A;  1AKH A;  1ZKG A;  4L5J A;  3HOS A;  5DCF A;  2ZCW A;  4BE2 A;  3M07 A;  2DCE A;  1WCM J;  2CQN A;  5CLS A;  2JRM A;  1FP1 D;  3FM3 A;  2HPI A;  1MJ9 A;  5B5E C;  5HS9 A;  3FXL A;  2IAI A;  3J80 Z;  1LDD A;  4BXU A;  2EFW A;  4BHB A;  2HTS A;  3EUK L;  4M9X A;  2R5Y A;  2P5K A;  2XAS A;  4JP0 A;  2JA7 J;  3CCQ I;  3TW7 A;  3MZY A;  3CDI A;  4F93 B;  1V4R A;  3BG3 A;  3H9Q A;  2CWE A;  2OTJ I;  3DBR B;  5KAF C;  1ZYR F;  2OPT A;  4E7J A;  4DBR A;  1WI9 A;  5EJC A;  1MMN A;  2CW0 F;  2HGC A;  1ITY A;  3GTP J;  2IPQ X;  5LGU A;  2EZL A;  2FMY A;  2K02 A;  1MNM C;  1FMV A;  2EK5 A;  4C3J J;  3CCJ I;  2IA1 A;  3E0J B;  1JKR C;  3CCV I;  1DQU A;  4XLP F;  2QF7 A;  5FFZ A;  1ON1 A;  4CUG A;  1W36 D;  1QPM A;  1Y6I A;  1HLV A;  2UZK A;  1ON2 A;  3PSF A;  3VDX A;  4EQQ A;  1HBX G;  3RZO J;  2IS1 A;  1B9M A;  1SAX A;  3X2Q H;  1XC5 A;  3E6C C;  3DEU A;  5CPR B;  2XAH A;  1EJ9 A;  3BG6 A;  3HZJ A;  2JA6 J;  3KE2 A;  1OFC X;  2DFE A;  2ACJ A;  4ZDP A;  3KP6 A;  4J19 A;  1RKT A;  5LHG A;  2CG4 A;  5BS6 A;  2W7N A;  2XSD C;  4EJT A;  3SFZ A;  2E1C A;  5FD6 A;  2L01 A;  1U5T C;  4CCN A;  4WXD A;  4IRG A;  2A5Y B;  2V26 A;  2M4G A;  4I01 A;  4U0V A;  1HDD C;  1F1Z A;  1HQC A;  5JR3 A;  2AHQ A;  2HQ5 A;  3LA7 A;  5EGO A;  1W5C C;  2W82 A;  1FSH A;  3E3V A;  2Q1Z B;  2VJI A;  1ZK8 A;  2FA5 A;  4CSW A;  3O6B B;  2JJ7 A;  3JCU C;  3I3L A;  2PEX A;  3BPV A;  1TQP A;  1U9N A;  2DDB A;  3ABM H;  3A4C A;  3TW6 A;  2Z16 A;  1REP C;  2E1O A;  4MQ9 F;  4EVI A;  5JFR A;  2HOS A;  3K1N A;  2VXD A;  3ERE D;  2H09 A;  1AHD P;  3OR2 C;  1OCO H;  1PJR A;  3JRB A;  3CZ6 A;  4GXO A;  4EJO A;  4YRV A;  3FXQ A;  2JUC A;  5E20 A;  3S17 J;  4D5F A;  3EUH A;  4RAY A;  1N78 A;  2J5P A;  3OIQ A;  4KT6 A;  3WTU C;  1DDN A;  4FX4 A;  4RB2 C;  5IT9 Z;  1IO2 A;  3L2C A;  2RNG A;  4M3E A;  1FBU A;  5GPA A;  1RUN A;  1A35 A;  2R5Z A;  3HUG A;  2WAQ A;  2P5L C;  2EIN H;  3GZ5 A;  3MCZ A;  3V7S A;  4J00 A;  3DPU A;  2DMN A;  5E17 F;  4PSX A;  4ZYD A;  1W4M A;  5FD5 A;  1ZG3 A;  4LGW A;  1G2H A;  4AIH A;  3DLA A;  2IGK A;  1RPW A;  1Y0U A;  1FBQ A;  1FLI A;  2E1M C;  2NRA C;  1YS6 A;  3TO7 A;  2XGX A;  3ZMT A;  1Y1V J;  3P7N A;  5FRO A;  3KEQ A;  4CZZ A;  2A05 A;  3VYR B;  1SC7 A;  2BHY A;  2MYS A;  2OQR A;  3ZCO A;  2LSO A;  4LK1 F;  2BY0 A;  1OJL A;  5KNL A;  2NOG A;  2WB1 A;  4P9F A;  2AQF A;  3BZC A;  2XKP A;  4HAM A;  4DW6 A;  3F22 A;  2DTR A;  3K4L A;  2OCC H;  3IP4 B;  3R0A A;  3MVP A;  1Q1V A;  2AQE A;  2YUS A;  1I1G A;  3A2K A;  4BJ5 C;  3M8F A;  1VQL I;  4M6X A;  2QSF X;  5D5X B;  1BC7 C;  4M3F A;  5FLX K;  4CGZ A;  1J2X A;  4AIK A;  1ZHF A;  2LYC A;  4P55 A;  1MMA A;  4RMN A;  4M6Y A;  2R3S A;  4L9J A;  4XMY A;  1K6O A;  3CCR I;  1YW9 A;  5J6X A;  3OYM A;  1Q1H A;  2E34 A;  2XF6 A;  4EJV A;  3IAM 2;  5GPC A;  2P0W A;  2D1V A;  3EPZ A;  1XGN A;  3MKY B;  3OR1 C;  4HSR A;  4BE0 A;  2R93 J;  3ULQ B;  4XLH A;  1I6H J;  3H92 A;  4HF1 A;  2F4I A;  3IWF A;  1BC8 C;  1FPQ A;  1ZG5 A;  4ENN A;  2V1U A;  1GV2 A;  4L18 B;  2KPM A;  5E8I A;  2A61 A;  4OAZ A;  4KMU X;  2VBW A;  2CO5 A;  5FLX Z;  5LHI A;  1D1B A;  4BHP A;  3RCO A;  5DCM A;  4M3G A;  3BQY A;  3U21 A;  2Z3Y A;  3OYI A;  1ZLJ A;  4Y13 A;  2HYG D;  4UXN A;  3S2W A;  4U87 A;  1BJA A;  2L54 A;  3BLY A;  3J81 K;  4HDV A;  2O8X A;  1TTY A;  2XF5 A;  2EA4 A;  3Q9V A;  2CQK A;  4LLN A;  2DOA A;  1T98 A;  4KYW A;  4E4H A;  3BCA A;  1IXS B;  3GFI A;  4BXF A;  1XCB A;  1CF7 B;  3FXO A;  4BDZ A;  2MC3 A;  1XCV A;  2E1N A;  5GP9 A;  2XAF A;  1T0F C;  2ISY A;  1MH4 A;  1W5S A;  3ERM A;  4CCO A;  2UV1 A;  2ME6 A;  2MD0 A;  3T8T A;  4X6A J;  1TNS A;  5C44 J;  1CGP A;  1X3W B;  3IV5 A;  3IKV A;  1YO5 C;  2H8R A;  4IRI A;  1DGR M;  1RET A;  2K9S A;  4ZYA A;  1RUO A;  5J40 A;  3CCY A;  4FIS A;  3A01 A;  1IXR C;  3LSH A;  4YG2 F;  1O3T A;  3FXR A;  2VQL A;  4D7M A;  4A3G J;  3H1C A;  2E7X A;  4DGW B;  1MMG A;  1WPK A;  2F48 A;  4A3L J;  3J80 K;  3S2D J;  2Z5U A;  3CMA I;  3RQI A;  1D0X A;  2WV0 A;  4LOC A;  4XSZ F;  4CIC A;  1QZZ A;  4B3A A;  2DW4 A;  5J8F A;  3HDD A;  1OQY A;  3I59 B;  4A69 C;  5JLX A;  4EM0 B;  4BXX J;  1BBY A;  3HUG B;  5E1W A;  2VN2 A;  3JR9 A;  1EH6 A;  4HPQ A;  4ZDL A;  1X4P A;  4BGD A;  4CCK A;  3WTW C;  1FOW A;  2M7A A;  1B72 B;  2K40 A;  3FX3 A;  1FYK A;  2KJB A;  2E2H J;  2GWR A;  4L9N A;  1R22 A;  2HXI A;  4ON0 A;  3ZQC A;  2HNH A;  2DOD A;  4G6Q A;  2P7C B;  5LFA A;  2YPR A;  4AUX A;  1A31 A;  5IT9 K;  2BHZ A;  3HOU J;  3BJO A;  4TV7 A;  2R7O A;  4IX7 A;  3E7L A;  3N05 A;  4B43 A;  3KZY A;  5J4Y A;  5HDG A;  3V8L A;  5HLT A;  4NC6 A;  4CHU A;  1S9H A;  2DLL A;  2ZNY A;  3OL4 A;  2HR3 A;  3JRI A;  2HOA A;  3H9G A;  2JK3 A;  3V8J A;  2E60 A;  3I0T A;  3P9K A;  3FXK A;  4NQW B;  3G4S I;  1Z6T A;  3AL0 C;  3MN2 A;  5L3G A;  1BOA A;  3BR6 A;  4KIC A;  4BKX A;  4L0Z B;  1DPU A;  1APL C;  3G3Z A;  1EH7 A;  4OIR F;  2ZME C;  4KJZ A;  1ETX A;  4Y33 A;  1HF0 A;  4UY8 I;  2LH9 A;  3VYS B;  4KIF A;  3A0H C;  3FHN A;  2DA1 A;  2DA4 A;  1YX3 A;  3CES A;  3PL8 A;  3JRG A;  4JBA A;  2Z2S B;  4NDL A;  2V9K A;  1OCR H;  4G6T B;  3WTZ A;  3OYA A;  4XLE A;  5F0H A;  1GXQ A;  2KLO A;  1BIA A;  2HQN A;  3HBL A;  4Z6Y A;  3F8N A;  2HQA A;  3FF5 A;  3E6D A;  2OBP A;  1WWX A;  4DNC A;  4XKB A;  1TWA J;  5M5Y J;  5HLH A;  3HSR A;  1XG1 A;  1IUY A;  3KEO A;  1UFM A;  2MLK A;  1Z7U A;  2FNP A;  4FQG A;  3JTG A;  1G59 A;  3HHH A;  3ZPL A;  3VYU B;  2HYJ A;  1EA3 A;  3HC7 A;  3KZI C;  5L3E A;  2WY7 Q;  2NVY J;  4MGR A;  2GIV A;  1ENH A;  3SFI A;  1SFX A;  4Y15 A;  1BA5 A;  2OUM A;  5EEH A;  5BQT A;  4B48 A;  2PBI A;  4ZZD A;  2CW7 A;  2E1M B;  4PGH A;  4XID A;  1BOB A;  1EH8 A;  1B4A A;  3QP6 A;  3TDU C;  1WHU A;  3RKW A;  4Q48 A;  4WWC A;  3ISP A;  4Y52 J;  4OMZ A;  1Z05 A;  4PZJ A;  1MSF C;  2O7O A;  3K4J A;  3SZG A;  3GFM A;  3K2A A;  5HVQ C;  4XLN F;  2M8E A;  3MMY B;  1W5T A;  1VTN C;  2VBZ A;  1VQ4 I;  3O2P E;  2EQR A;  1R58 A;  1IN8 A;  1X19 A;  1X2M A;  3GFL A;  4XM3 A;  3IH4 A;  1S5L C;  2KFD A;  2Z99 A;  1K4T A;  2ZBK A;  1V5G A;  2LR8 A;  3SXY A;  4HQE A;  2KT0 A;  4X1E A;  2XGD A;  3CJR B;  3RIR A;  3ZQI A;  2X6X A;  2Y75 A;  2VLA A;  1V5F A;  2MGQ A;  3GTJ J;  2ID6 A;  3ZQQ A;  5EZH A;  2YX4 A;  5L3B A;  1QVT A;  5K5R A;  1P4X A;  3CUQ B;  1U5T B;  1ZRF A;  2TRT A;  1VQM I;  3I4P A;  2EJR A;  4I2O A;  3K4B A;  5KAI C;  3BG7 A;  1YX5 A;  2R7X A;  1B6A A;  1VQK I;  4NBQ A;  2EFP A;  4IHT A;  1X1C A;  2L7F P;  4WCG A;  3ZMV A;  1LJ9 A;  2JPB A;  5CYV A;  2GLO A;  2O9L A;  2O3F A;  3DTI A;  1O4X A;  1BL0 A;  1KQ0 A;  3P9I A;  1EKE A;  2IEK A;  2K3P A;  4DYC A;  5L3F A;  1YRN B;  1TWF J;  2L0K A;  2NYX A;  1SFO J;  1S6L A;  2XAQ A;  4I98 B;  3PJR A;  3QPS A;  2ZNZ A;  2GAU A;  3ZMU A;  4GCV A;  1HW5 A;  2DBB A;  1PDN C;  2ZKZ A;  3H5R A;  3G6E I;  1UHS A;  1K78 A;  4MFE A;  3U9G A;  1A6Q A;  3F6V A;  2HDW A;  4CO8 A;  2IBD A;  3CMM A;  1WZ2 A;  2D45 A;  2NVQ J;  5CKT A;  1B59 A;  5F0F A;  1FNN A;  4LG3 A;  1UB9 A;  2ECC A;  4XRF A;  3GTG J;  1I5Z A;  1O57 A;  4HX7 A;  1K7A A;  3F8C A;  2RN7 A;  4BY7 J;  2IGM A;  3TO6 A;  3ZP5 A;  2DJI A;  5C3E J;  3GX4 X;  4JX6 A;  1U9O A;  2Y9Y A;  1LFP A;  1IV6 A;  3C2H A;  2XGE A;  3D1N I;  2FUG 2;  1SMT A;  2W24 A;  1WJ5 A;  1O3R A;  2JSC A;  1SVO A;  4CXF A;  5K5O A;  3ECO A;  1SD5 A;  2B7E A;  1X58 A;  4KIB A;  3TP0 A;  1HA8 A;  3FWE A;  1OKR A;  2HXO A;  1X3U A;  5GAG J;  1T2K A;  2BVM A;  2IW5 A;  2KKO A;  2K5C A;  1JT6 A;  3F21 A;  1JUP A;  4RBO A;  3HOV J;  2M0C A;  3S1R J;  1XSD A;  3DKW A;  2EZI A;  1PUF B;  4UVA A;  3R61 A;  4N4N B;  4HNT A;  3K1P A;  2DT6 A;  1XGS A;  2BOL A;  3CUO A;  4KN7 X;  3NEU A;  3M8E A;  4I0A A;  3HL2 A;  2PX9 A;  3KP5 A;  5CVV A;  3QRF F;  4E7H A;  2XAU A;  4XLF A;  4HEA 2;  2FML A;  5M3F J;  4IOA F;  3CF2 A;  3PNT A;  5GTI C;  3VWB A;  1XSX A;  1YE9 A;  4OIO F;  2KIQ A;  1DP7 P;  2QBY A;  5ILV A;  2GOM A;  1LB2 A;  2JZY A;  3HTU A;  4J01 A;  1Z6R A;  4EGZ A;  3MEX A;  4LJZ F;  2DT5 A;  2LY9 A;  3AG4 H;  1VFC A;  4UVC A;  4KDP A;  2R7Z J;  2QEN A;  3K1M A;  2GQQ A;  4AVZ A;  2DFH A;  3PFY A;  2LKS A;  2BBY A;  4CYC A;  1ETY A;  2W57 A;  2IA2 A;  1XDS A;  1YTY A;  4FHT A;  4GGG A;  4V2G A;  5ICE A;  3LFK A;  4I99 C;  3S3O A;  1TWC J;  1YW8 A;  5FKK A;  2JT1 A;  1DPR A;  1JT0 A;  2XRN A;  3PO3 J;  2ZFU A;  1W7P A;  4C9Y A;  1FY7 A;  3N97 A;  3I54 A;  3KLN A;  2Y0S N;  1SD6 A;  1HOM A;  3O8H A;  5E18 F;  3HKZ A;  4XN3 A;  4CCL A;  1XD7 A;  3DTE A;  4NC7 A;  2Y9Z A;  1WVR A;  5KHD A;  2BVL A;  5H2F C;  1YYV A;  1BR2 A;  2Q2E A;  2ZXJ A;  4UNO A;  2LD5 A;  5LD2 C;  4JK1 X;  2ECB A;  3V7R A;  2HU9 A;  2WB1 N;  1TW3 A;  2OD5 A;  5B1A H;  2XKO A;  3L2U A;  5H6Q A;  1QZY A;  3RQ4 A;  1Y1W J;  2X9D A;  1JXS A;  3G1M A;  4GFB A;  1OR7 A;  3MKZ A;  2DT7 B;  2ZJQ F;  2A5W A;  2X1C A;  4IZZ A;  3DEW A;  3QU6 A;  1ZAR A;  1B72 A;  2V7F A;  3R4K A;  3IL2 A;  5M5X J;  1UHW A;  4RGR A;  4LIU A;  2LVS A;  2EIK H;  1YIO A;  2OTL I;  3LA2 A;  3F8B A;  1ZEL A;  4JQF A;  2EWN A;  2A3S A;  1YLF A;  3G2B A;  1IAW A;  3BTJ A;  3SEZ A;  5E3O A;  5A2Q K;  2Y69 H;  1TC3 C;  1ZAO A;  1JTY A;  5AIP A;  3HPH A;  4A12 A;  3NRV A;  3GF2 A;  2KDO A;  2V6E A;  2QUF A;  3CCM I;  1MMD A;  1XS9 A;  4B3X A;  1Z3Y A;  1OYW A;  1BN5 A;  3HEF A;  3WTV C;  3E1S A;  4U0W A;  5F0C A;  2JUG A;  2EIJ H;  3BTL A;  4YFN F;  1TW2 A;  3KYL A;  4UUV A;  1TBX A;  2F5F A;  1UST A;  2H94 A;  2CV0 A;  2JN6 A;  4L9T A;  4BHC A;  4ZYE A;  2OA4 A;  4B8X A;  5B3S H;  2DA7 A;  4MEY F;  1HCR A;  2WAQ N;  3S3M A;  4M3D A;  1VQ9 I;  3DBL B;  2M7B A;  3TBI A;  2LBF A;  4HNU A;  2Z9O A;  1B8I B;  5FKN A;  2LRE A;  5KK1 A;  1QRY A;  2LC2 A;  3RPQ A;  3C18 A;  3MZ8 A;  3K4C A;  2DFI A;  1Y8R B;  9ANT A;  2V9V A;  3GLL A;  3CQZ J;  3PQK A;  2O6G E;  2L2O A;  2BV6 A;  2LFB A;  2EB7 A;  4AID A;  1S7E A;  2DPD A;  4ESJ A;  3AKZ A;  1ZRC A;  5GAH J;  4BYY A;  2ESH A;  3I4N J;  2FBH A;  4U7B A;  1F36 A;  1P4A A;  2HOE A;  4Y4R A;  2GIZ A;  2K86 A;  4XOT A;  3HOX J;  1Z3X A;  1FBS A;  4E6K G;  3F23 A;  4MO7 A;  4M73 A;  3DLL F;  3E6M A;  3Q0U A;  5K7Z A;  3K0L A;  2M45 A;  2M8G X;  4G7O F;  3Q9S A;  2R7S A;  2JWT A;  2CQ7 A;  3KLO A;  3PM1 A;  3WOD F;  5TGT A;  2DMT A;  3DBH B;  3LSJ A;  2WY8 Q;  2FOK A;  2NVU B;  2FE3 A;  5ICC A;  2QWW A;  1ACI A;  1X1P A;  3L7W A;  3E5X A;  3BDD A;  2Q8K A;  4A0Y A;  2R7Q A;  3VFZ A;  3QPT A;  4GYG A;  2O03 A;  1D8K A;  3K6G A;  3H0G J;  2IRF G;  3TOB A;  3HOZ J;  1OCP A;  3V4G A;  2CUF A;  3R6S A;  1W7P D;  5LGN A;  4IHS A;  3LSK A;  3I5U A;  3OIP A;  3TP3 A;  3CP2 A;  1I27 A;  1OMI A;  1Z1D A;  5EG0 B;  4IKF A;  3ML6 A;  4HX4 A;  3TKY A;  1UG0 A;  3K9T A;  2XPW A;  1FEX A;  3CDL A;  5CVR A;  2RQQ A;  1S29 A;  1N75 A;  3HTS B;  4RM3 A;  4LB5 A;  4XBF A;  3U2R A;  3T0Y A;  3ZRG A;  2E2J J;  2DQL A;  1ZH5 A;  4ZC3 A;  4HW0 A;  1E3H A;  1XDU A;  3M7G A;  3QOE A;  2IS6 A;  3DPL C;  3P5J A;  1HKQ A;  2P8T A;  2RRE A;  3CLO A;  4PCQ A;  2KDZ A;  3G71 I;  4KA4 A;  4EGY A;  2V1N A;  2BY3 A;  2X1D A;  1NG7 A;  4L5I A;  3AAF A;  4M3B A;  1T0F A;  5JHF A;  3B6C A;  1V54 H;  5F04 A;  4B09 A;  1I3A A;  2P5V A;  3GFJ A;  1W36 C;  3OOU A;  2HFH A;  4S04 A;  2R7W A;  1R5I D;  4UVB A;  4UUS A;  2VJJ A;  3DPT A;  2DYR H;  2P7V B;  3CC7 I;  4DYR A;  2NVX J;  1Z0X A;  2K9Q A;  2DU9 A;  5AIQ A;  3BJA A;  3SEQ A;  2L4A A;  1MDM B;  5H6R A;  2WAE A;  3FM5 A;  2GBY A;  3RPU D;  2RQP A;  3FIS A;  4XN0 A;  5D4S A;  3CC4 I;  2MH2 A;  4B44 A;  2F5E A;  2O5R A;  4BNC A;  3M9A A;  3FXM A;  2RKH A;  2HKX A;  1LKX A;  1R71 A;  1J59 A;  4HLY A;  1SFU A;  3RYP A;  4WK8 F;  5HDN A;  1BM9 A;  1G6N A;  3UR3 C;  2B9S A;  2F5D A;  3S1Q J;  2M2E A;  4F91 B;  2OCE A;  2P4W A;  1LQ1 A;  1MKM A;  1X3Z B;  3ELK A;  1TZL A;  2RDP A;  3U1D A;  5IYC J;  3BZK A;  1WFX A;  3FKI J;  4G12 A;  2ADU A;  4NNJ A;  4N4O B;  5C4X J;  4ZYH A;  2M9H A;  2XIG A;  1GVJ A;  1OR7 C;  4QTR A;  3IC7 A;  5K7H A;  5DD8 A;  4U88 A;  3HIF A;  4BDY A;  5B1B H;  1LPQ A;  4GDF A;  3KEY A;  2EIM H;  1D5Y A;  2L7K A;  4D9J A;  1IXC A;  2GA2 A;  2L9R A;  4MEX F;  4RDU A;  1OCZ H;  1SVL A;  2BW3 B;  3C1D A;  3IH2 A;  3UKG A;  1IN6 A;  1FOY A;  3OYH A;  1RRJ A;  1DU0 A;  3LQQ A;  3H3V K;  2R7U A;  3GTQ J;  2ELH A;  3KFW X;  1FTT A;  3RTR A;  3ZMD A;  4BBS J;  5AON A;  1P4W A;  2VPR A;  3G73 A;  3L1P A;  2X51 A;  1VQP I;  1D0Z A;  4YII A;  1R23 A;  2W4S A;  2OU2 A;  1FOK A;  2X48 A;  3HB9 A;  2VC1 A;  1C0W A;  2O61 A;  5D6E A;  1WJE A;  3DCF A;  2QVO A;  1R5G A;  5J1U A;  4DBQ A;  2ZJR F;  1YIJ I;  3TQN A;  3I64 A;  1OLT A;  1H88 C;  1QHG A;  1LVA A;  4HNV A;  1JGG A;  3HM5 A;  2PMU A;  2ZJ2 A;  5F6F A;  4ITV A;  1VND A;  2WAF A;  3EUH C;  3HJE A;  5LRS A;  2ICW G;  3B6A A;  1LEB A;  1Y0N A;  4XKW A;  1XMX A;  1P2F A;  3MQ0 A;  1BR4 A;  2BGC A;  1NK2 P;  1RKW A;  3M8J A;  3FK7 A;  1SD7 A;  4P5O A;  2ELK A;  3QOP A;  3OSG A;  3DQV C;  3CUQ A;  4Q5S F;  1J5Y A;  1QNT A;  2EV5 A;  2E71 A;  2V4J C;  2I10 A;  1E2X A;  3KP4 A;  4Q47 A;  1GDT A;  3OYJ A;  2X6Y A;  4WXC A;  1IG7 A;  4PJL A;  4JYK A;  4E7I A;  2YX7 A;  5D6F A;  1P6R A;  1STZ A;  3SJM A;  3CJN A;  3CO7 C;  1QVU A;  4OIQ F;  3GUD A;  2VJ5 A;  1RES A;  3WG9 A;  5ILU A;  1TL8 A;  2VQG A;  3MZH A;  2QQA A;  5A2Q Z;  4YFK F;  2HDD A;  4PUS A;  4A3K J;  4E7Z A;  3I59 A;  3WHB A;  1YW7 A;  3HRS A;  1J09 A;  3IAS 2;  4II3 A;  1J75 A;  4KIS A;  3GCM A;  4LD5 A;  1OYI A;  2VOD A;  3ESW B;  1XN7 A;  3BY6 A;  3S32 A;  4HDU A;  2CU7 A;  2LKP A;  2Y2Z A;  3KYD B;  3HSE A;  2DFF A;  4E7L A;  3LA3 A;  5H20 A;  5D8K B;  4BS9 A;  2V6C A;  3ZR8 X;  5E3M A;  3K10 A;  3P9C A;  4W97 A;  1XGO A;  3DU5 A;  2XUB A;  4AWX B;  3J7A Y;  3JRC A;  1YS7 A;  1KGS A;  4LG0 B;  3WG7 H;  4QLC U;  3BTI A;  2K27 A;  2QM3 A;  3WTT C;  1WI3 A;  3PQJ A;  1AOY A;  2EV0 A;  4HZF A;  4QPO A;  4V19 K;  2QCO A;  1GT0 C;  2L9N A;  2ZC2 A;  5IP7 J;  3OYD A;  2HI3 A;  1T39 A;  2VPL A;  2W25 A;  2P6T A;  1ETQ A;  3FMS A;  5KCM A;  1B1B A;  5LRR A;  4LK0 F;  3CCE I;  1JJ8 C;  3BPX A;  2PMZ A;  3WTS C;  1Y56 A;  2LF7 A;  3WE2 A;  3GYH X;  1UAA A;  2V1X A;  2X4H A;  4AIJ A;  1TT0 A;  1JE8 A;  4WX9 A;  3I9V 2;  4RB1 A;  5DTD A;  3ZXS A;  1VQ8 I;  1KYZ A;  3ZQ7 A;  3TDZ C;  2AO9 A;  3MD2 A;  2BXZ A;  5D8L B;  2K7L A;  4EAT A;  2K9N A;  4O5V A;  1E0E A;  2WAD A;  4V2F A;  4A5M A;  2DO7 A;  3QWL A;  1BI1 A;  3I56 I;  2DDA A;  1Z77 A;  2KJC A;  5LEK A;  1JUM A;  5HS7 A;  4W1U A;  5K1Y A;  1G4D A;  2DMP A;  2YU3 A;  1QHH D;  3LSG A;  3F0C A;  4AC0 A;  3COA C;  1ZQ3 P;  1O7L A;  1BIB A;  3FBN B;  1R6R A;  4CYC B;  1ETV A;  2M3A A;  2COB A;  1LDJ A;  3ROU A;  2RVC A;  5FKO A;  2G7U A;  1KZH A;  2VIX A;  3OS0 A;  3W6K B;  2H8W A;  3FBI B;  2QSG X;  5IYD J;  2B0L A;  1IN5 A;  4BH9 A;  1KON A;  3QU3 A;  5IPA A;  3KCC A;  5D5V B;  1U5T A;  2WWY A;  1TWG J;  1YFH A;  3MKL A;  1YI2 I;  3HGY A;  1SFK A;  2QZ8 A;  1ODD A;  4QSH A;  2FX0 A;  3NWT A;  4XR6 A;  3VPR A;  5E3N A;  3K70 C;  4IHX A;  4A3B J;  1F4K A;  3ABK H;  4XOP A;  4E70 A;  4E7K A;  4NUB A;  1T56 A;  1F9N A;  3LST A;  1VQ7 I;  1R4M B;  3F3X A;  5E8G A;  1HC8 A;  3W3C A;  1IN7 A;  1R1V A;  4D1Q A;  5IOY A;  5F64 A;  2ETH A;  1WH5 A;  3LQR A;  2EIL H;  1VQ6 I;  2CFO A;  1J9I A;  1R36 A;  1USS A;  2LOO A;  2EV6 A;  4A3J J;  1R7J A;  2L9V A;  3OY9 A;  1JTX A;  4DZJ A;  1GV5 A;  4A3M J;  2LRD A;  2W00 A;  1QGP A;  2ID3 A;  1YG2 A;  5D5U B;  3D5R C;  3AG2 H;  4A5N A;  4A6D A;  4C30 A;  1T6S A;  1G3S A;  4FE7 A;  2F4O B;  3BG9 A;  2BXY A;  1UJ8 A;  1WJC A;  3FDY A;  3Q5F A;  2GXA A;  4B47 A;  4R1H A;  4S05 A;  2M1B A;  3WTY C;  2E36 A;  2M0M A;  1B9N A;  5F1J A;  3RSN A;  4AYB N;  2A07 F;  3DU6 A;  2LTP A;  4KUM A;  1WJA A;  4HQM A;  1DUX C;  2W85 A;  1TWH J;  3OYG A;  3BR0 A;  3HRU A;  4AVP A;  2GM4 A;  3ABT A;  2BE5 F;  4KIG A;  4CCJ A;  2NNY A;  4UB8 C;  4FCY A;  4XRS A;  4A3C J;  2Y48 A;  4K2E A;  4PGG A;  5LGT A;  4PJM A;  4A2U A;  3K7A J;  3QPL A;  1UHM A;  2F4M B;  3VEP A;  4PJ0 C;  1S7A A;  3E5Q A;  5ICG A;  2VE9 A;  2X1E A;  2ELJ A;  1IC8 A;  3ZMS A;  4BJ6 C;  1PUF A;  2DI3 A;  4DYQ A;  3J7A O;  1LE8 A;  3WU2 C;  1G3Y A;  4XRM A;  1WJD A;  4G7Z F;  2QKL B;  4XRS G;  2XC7 A;  5DD4 A;  1P7I A;  2KP6 A;  2DJN A;  2X0L A;  2Y30 A;  3KIO A;  4D0P A;  2XPV A;  2CQQ A;  3B73 A;  3FK6 A;  3KPH A;  5EYR A;  4IRH A;  3J81 Z;  3U1K A;  4LG0 A;  2A69 F;  4RAF A;  3RJP A;  4II2 A;  1U0J A;  3DFG A;  2VKV A;  3C2G A;  1BI2 A;  1IRG A;  4HA8 A;  5C4J J;  3S2H J;  5EEA A;  4ANJ A;  2PG4 A;  2L7M P;  2ME0 A;  2YS9 A;  3EET A;  3QAH A;  3CDH A;  3IRR A;  2QEX I;  3RDI A;  3GEZ A;  3JRF A;  1VQO I;  1CF7 A;  3LSI A;  5DUK A;  2HYF A;  1W0T A;  3GZN B;  2EBI A;  1XPX A;  2NVT J;  3ZN0 A;  2E7W A;  5K5Q A;  3QYB A;  3IWZ A;  5IY5 H;  4M74 A;  4ESB A;  1EV7 A;  2ZFW A;  2E2I J;  4U7D A;  3EUA A;  3L09 A;  5LLQ A;  5F27 A;  2DA5 A;  2DQR A;  1PYV A;  2EA2 A;  3HSF A;  3MAJ A;  1XGM A;  2FD5 A;  3G1O A;  2XAJ A;  3NAR A;  3HPG A;  2CSO A;  4XKC A;  5HDK A;  2EH3 A;  3HKZ N;  3K4N A;  3S16 J;  3RKQ A;  2D5V A;  4G6D A;  4F7Z A;  2CMP A;  2L3D A;  3VB2 A;  3GWZ A;  4XL9 A;  4ASN A;  4Q4Z F;  1SFE A;  5F08 A;  2XB0 X;  5DYM A;  4UUT A;  3H3U A;  4RS8 A;  4ZTJ A;  3LSR A;  1W1W E;  2DN0 A;  3OL3 A;  1WQ2 A;  2DK5 A;  4PDK A;  4RLF A;  3VSL A;  5F1R A;  3FHZ A;  3N4M A;  1JGS A;  4IL6 C;  1JHF A;  2LMD A;  3DKY A;  1GXP A;  1WKM A;  3C3W A;  3GBG A;  4FTH A;  4FE4 A;  2XDV A;  2V1D A;  4A0Z A;  3HOY J;  1TQM A;  3SDB A;  1BW5 A;  4HST A;  2VJ4 A;  2Z1D A;  4RB3 C;  5IYB J;  5M5W J;  1AWC A;  3ECH A;  1S3J A;  1ULY A;  2VL8 A;  4DQ2 A;  5IT3 A;  4BUP A;  2CV1 A;  4G7H F;  2VOO A;  2WV1 A;  1JHH A;  3OIO A;  2VAS A;  2Y31 A;  4B4C A;  3RZD J;  3KP3 A;  2XV4 S;  1VI0 A;  3I71 A;  4C2M J;  2AXT C;  3NQO A;  1I6X A;  4ZTF A;  1XTA A;  3Q0V A;  2W1O A;  3E6B A;  3K2Z A;  1B8I A;  2BYV E;  2VC0 A;  1U3E M;  1LVK A;  2WTE A;  1HXD A;  2NAZ A;  1LDK B;  3BCB A;  2H6B A;  4GO1 A;  5DCM B;  1A36 A;  2KMU A;  4AYB A;  3JRA A;  1SMY F;  1NK3 P;  2DPU A;  1FYM A;  3WU1 B;  2XGC A;  2AS5 F;  2ESN A;  2LY2 A;  1T8I A;  3CJQ B;  2LY1 A;  2HPM A;  3PUF A;  3T5X A;  3L2R A;  3CP8 A;  1ZGJ A;  1N77 A;  1A04 A;  1IW7 F;  2BEO A;  5TIS C;  1OYY A;  2KHM A;  2CYY A;  3L2Q A;  2NS8 A;  2TDX A;  3MFK A;  4IF4 A;  5BNG A;  1NHA A;  2EZK A;  2GXG A;  3LAP A;  4A3I J;  1QA6 A;  3GTL J;  1IUF A;  1UG2 A;  4M9Z A;  4PJN A;  3SDG A;  2G0E A;  4PK4 A;  4L0Y B;  2QLZ A;  1MBE A;  3L9F A;  3EQL F;  3HOT A;  3LWF A;  1MBK A;  3BR3 A;  4P1W A;  3F72 A;  4S0H B;  2W48 A;  1D0Y A;  5CQG A;  1JUS A;  4NQW A;  1BJZ A;  1H89 C;  1IDZ A;  2MW8 A;  4KMF A;  3SHF A;  2ZME B;  1HKT A;  3BOQ A;  2IGO A;  4XSX F;  3CUQ C;  5E1Z B;  1ZRD A;  3F8F A;  1LE8 B;  3I53 A;  5GAD J;  3AL0 B;  2QSH X;  4MQV A;  1KA8 A;  2R4G A;  1E3O C;  4A6E A;  1L3L A;  3H36 A;  3BJ6 A;  2JVG A;  2YU9 J;  1RZ4 A;  3PIP F;  4OAY A;  1Y8Q B;  4IQJ A;  1O7F A;  1T95 A;  2WC2 A;  1PP8 F;  2D2W A;  3J7Y J;  4UHT A;  2QKM B;  1PUE E;  1E17 A;  2LP0 A;  1YIT I;  5JHU A;  1FX7 A;  4M9S A;  1JJ6 C;  2FQ4 A;  5HOO A;  1KYW A;  3Q0W A;  1SD4 A;  4U0Y A;  3DTK A;  4X0G A;  3HXL A;  1FIA A;  5FKL A;  1QO0 D;  2A6H F;  2CS3 A;  4H0E A;  2FEZ A;  5EEG A;  2UWM A;  3BWG A;  2JA5 J;  3IKT A;  4GRI A;  1UCR A;  3O3K A;  3OV8 A;  1FP2 A;  3D5L A;  2E19 A;  5JLW A;  3LMM A;  2CUZ A;  1U2W A;  1X1A A;  1O3Q A;  2K9L A;  3TO9 A;  4BU2 A;  1XMA A;  2I5U A;  3WGG A;  2VOP A;  4YEL A;  1U78 A;  3BQZ A;  1A5J A;  3BP8 A;  2HKO A;  3BR5 A;  2E35 A;  3JAM Z;  4Y17 A;  1OIS A;  2OAZ A;  3NAU A;  3UNG C;  2FBK A;  2VON A;  1MJA A;  5ICF A;  3ABL H;  3TOA A;  2W84 A;  1FIP A;  2V79 A;  2R7T A;  3BR2 A;  4YIR X;  1FOX A;  2VBX A;  2Q0O A;  2Z33 A;  5HNH A;  2X6O A;  1XB4 A;  3RYR A;  2HVR A;  4XQF A;  1K78 B;  4M6V A;  5DM7 F;  5DEQ A;  1D5V A;  4AM3 A;  1G3W A;  4DOZ A;  3DF8 A;  1XSV A;  1TNT A;  1ZGA A;  4G94 A;  3HOW J;  4IHY A;  3FIW A;  2CH0 A;  2HWV A;  2XAG A;  3S8P A;  2NNN A;  2NS0 A;  1QU3 A;  5JVT A;  2FQ3 A;  4IHV A;  2HVS A;  1K83 J;  4HV5 A;  4BEH A;  2FNA A;  4QWQ A;  2LNB A;  4EM1 A;  4D7N A;  2RNJ A;  1R9T J;  1X2N A;  4UUS B;  3M3Y J;  1H9T A;  2MBF A;  2KIM A;  3IRQ A;  4PSW A;  1T33 A;  1BR1 A;  2MAB A;  3Q3S A;  4N9H A;  4OIN F;  3HRM A;  3DP7 A;  4GYI A;  5EGO B;  4BJT A;  3R60 A;  2JSP A;  3K4M A;  4LLL A;  3G1L A;  5E3L A;  1ZGW A;  4N9I A;  3OYF A;  3GVA A;  3HGG A;  5FRN A;  1U6G A;  4YEJ A;  2KZG A;  2UXN A;  4CA0 A;  4MNU A;  2EFN A;  2KL4 A;  2OJE D;  4KN4 X;  3EYI A;  2DYS H;  1RC9 A;  3PSI A;  3JRE A;  5J1R A;  3BR1 A;  2IJL A;  1M1E B;  2R7F A;  5LEJ A;  1U8R A;  1R1U A;  2GXB A;  3ZQF A;  4BY1 J;  1FJL A;  3K69 A;  3LSP A;  2RC4 A;  2M34 A;  2HQR A;  2H1L A;  2CV2 A;  1SAN A;  2ZXH A;  2CRG A;  3PNV A;  1V5E A;  5J3L A;  4CH7 A;  1MZB A;  4C3I J;  1HW1 A;  5L3D A;  1ZLK A;  2MA3 A;  3CJT B;  2UUZ A;  1VQN I;  2H27 A;  3BT9 A;  2QYO A;  3HG9 A; 
#chains in the Genus database with same CATH homology
 1ZKG A;  1O4X A;  1BL0 A;  2QCO A;  1GT0 C;  4DYC A;  5IP7 J;  2IEK A;  4I6Z A;  2HI3 A;  1YRN B;  1TWF J;  2L0K A;  1WCM J;  1ETQ A;  2CQX A;  2N8G A;  1SFO J;  1IDY A;  2R5Z B;  3QPS A;  1JJ8 C;  2IAI A;  5DS9 A;  2R5Y A;  1UHS A;  4MFE A;  5EDN A;  2RAE A;  4JP0 A;  3BG5 A;  2JA7 J;  3TW7 A;  1BW6 A;  1CQT A;  2IBD A;  2PMZ N;  2DA3 A;  4JX5 A;  2NVQ J;  5F0F A;  5DTD A;  3BG3 A;  2AO9 A;  2ECC A;  3IH3 A;  1JKQ C;  3A02 A;  3GTG J;  2OPT A;  2K9N A;  3JRD A;  4V2F A;  1I50 J;  2HOT A;  2CUE A;  4BY7 J;  1JKO C;  5C3E J;  1Z77 A;  1ITY A;  4JX6 A;  3GTP J;  4IEJ A;  1JUM A;  1U9O A;  2EZL A;  2Y9Y A;  1IV6 A;  3PO2 J;  2XGE A;  4W1U A;  3D1N I;  2DMP A;  1MNM C;  3LSG A;  3F0C A;  4AC0 A;  4C3J J;  1ZQ3 P;  1X58 A;  1JKR C;  3S1N J;  3TP0 A;  4D5C A;  2HXO A;  2QF7 A;  3S1M J;  4CYC B;  1ETV A;  3I4M J;  2COB A;  1HLV A;  1ETO A;  5FKO A;  1JT6 A;  1JUP A;  4RBO A;  3HOV J;  3LOC A;  2M0C A;  3S1R J;  1PUF B;  2EZI A;  3RZO J;  5IYD J;  1XC5 A;  5IP9 J;  2VI6 A;  5IPA A;  1POG A;  2JA6 J;  1TWG J;  2P81 A;  3MKL A;  3HGY A;  1OFC X;  4QSH A;  2FX0 A;  3VPR A;  5M3F J;  5E3N A;  4IHX A;  4A3B J;  4J19 A;  1K61 A;  1RKT A;  1T56 A;  4EEF G;  2XSD C;  2XPU A;  5IOY A;  5HOD A;  1WH5 A;  2EZH A;  2LY9 A;  2XB5 A;  1MBG A;  1HDD C;  1VFC A;  1YRN A;  2R7Z J;  2AHQ A;  2HQ5 A;  5EGO A;  4A3J J;  1ZK8 A;  1JTX A;  2DA2 A;  4DZJ A;  4CYC A;  1ETY A;  1GV5 A;  2JJ7 A;  4A3M J;  1IGN A;  2ID3 A;  1ETW A;  3ZQH A;  1U9N A;  4V2G A;  4FE7 A;  1TWC J;  3BG9 A;  3TW6 A;  5FKK A;  1JT0 A;  3PO3 J;  2E1O A;  2B63 J;  5F1J A;  2Y0S N;  2HOS A;  1HOM A;  3JRH A;  3O8H A;  1AHD P;  3TED A;  1ZTR A;  4AYB N;  2LTP A;  3JRB A;  4A3E J;  2Y9Z A;  1TWH J;  3S17 J;  3BR0 A;  4D5F A;  2GM4 A;  2LD5 A;  2ECB A;  2WB1 N;  4FCY A;  4XRS A;  4A3C J;  4M3E A;  5GPA A;  1Y1W J;  2X9D A;  2R5Z A;  3G1M A;  4GFB A;  4A3D J;  3K7A J;  3QPL A;  2CJJ A;  4BBR J;  2DMN A;  3DEW A;  1MH3 A;  1IC8 A;  1B72 A;  1PUF A;  1G2H A;  4DYQ A;  5M5X J;  1LE8 A;  2R92 J;  1RPW A;  4XRM A;  2LVS A;  4XRS G;  1P7I A;  2DJN A;  1Y1V J;  2Y30 A;  1HF0 A;  2XPV A;  2CQQ A;  3FK6 A;  5EYR A;  2DTZ A;  1OCT C;  5FLM J;  4DZP A;  3BTJ A;  5E3O A;  1TC3 C;  5M3M J;  1JTY A;  2VKV A;  1OJL A;  2NOG A;  3ZQG A;  1XS9 A;  5EG0 A;  5FJ8 J;  3HEF A;  5C4J J;  3S2H J;  1HDP A;  5EEA A;  2L7M P;  5F0C A;  2ME0 A;  2YS9 A;  3BTL A;  4DW6 A;  1MSE C;  3JRF A;  2JN6 A;  2ZB9 A;  1W0T A;  5EZG A;  3MVP A;  2EBI A;  4IHW A;  1Q1V A;  2DA7 A;  4B1R A;  2YUS A;  1HCR A;  2NVT J;  4JX4 A;  2WAQ N;  4M3D A;  5EF6 A;  1B8I B;  5FKN A;  2E2I J;  1QRY A;  4M3F A;  3M4O J;  5F27 A;  2DA5 A;  3GTK J;  1MBJ A;  2FD5 A;  3G1O A;  3QQA A;  9ANT A;  3GTO J;  3NAR A;  3CQZ J;  2LFB A;  2MG4 A;  1S7E A;  2EH3 A;  2TCT A;  2XRL A;  3HKZ N;  4L5E A;  3S16 J;  3RKQ A;  2D5V A;  5GPC A;  3I4N J;  2DA6 A;  4I76 A;  1F36 A;  3HOX J;  1P7J A;  3LNQ A;  4MO7 A;  2R93 J;  3Q0U A;  5F08 A;  2XB0 X;  4XK4 A;  5K7Z A;  4UUT A;  2NS7 A;  4MIM A;  1I6H J;  2M8G X;  3LSR A;  2JWT A;  1ZR2 A;  3PM1 A;  2DN0 A;  2DMT A;  4Y7N J;  3LSJ A;  1GV2 A;  4XIC A;  1AU7 A;  5FLV A;  3GBG A;  4M3G A;  4FTH A;  4FE4 A;  3BQY A;  1ORK A;  3O8G A;  3HOY J;  1LFB A;  1GUU A;  3H0G J;  1BW5 A;  3HOZ J;  1OCP A;  2DMU A;  2CUF A;  5IYB J;  3TP3 A;  5M5W J;  5EG0 B;  1VF9 A;  3S14 J;  1FEX A;  2XPW A;  3CDL A;  5J1Y A;  1QPI A;  2E2J J;  2WV1 A;  4A93 J;  3OIO A;  2Y31 A;  4B4C A;  5GP9 A;  3RZD J;  1MH4 A;  1VI0 A;  4C2M J;  2ME6 A;  1ETK A;  1U8B A;  1IRZ A;  3Q0V A;  2KDZ A;  4X6A J;  1B8I A;  5C44 J;  3IV5 A;  2H8R A;  1LFU P;  1RET A;  2K9S A;  4M3B A;  3JRA A;  2MSY A;  3CCY A;  4FIS A;  1NK3 P;  2XGC A;  3B6C A;  3A01 A;  5F04 A;  4D7M A;  4A3G J;  2VKE A;  2R0Q C;  1WPK A;  4A3L J;  3OOU A;  4UUS A;  2NS8 A;  3S2D J;  3RQI A;  4LOC A;  1AKH B;  5BNG A;  2EZK A;  3GTL J;  4DYR A;  4A3I J;  3A03 A;  2NVX J;  1Z0X A;  4B3A A;  1IUF A;  1UG2 A;  2K9Q A;  3SDG A;  2G0E A;  3HDD A;  1MBE A;  4A69 C;  5JLX A;  1DU6 A;  2GBY A;  4BXX J;  1MBK A;  3FIS A;  3BR3 A;  4S0H B;  2W48 A;  3JR9 A;  3GTM J;  1JUS A;  1IDZ A;  1BJZ A;  1H89 C;  2MW8 A;  1B72 B;  1GVD A;  2K40 A;  1LE8 B;  3S1Q J;  2M2E A;  2E2H J;  3A01 B;  5IYC J;  2JA8 J;  2HXI A;  1E3O C;  3ZQC A;  3ZOB A;  3FKI J;  4G12 A;  2OF7 A;  2YU9 J;  4AUX A;  5C4X J;  3HOU J;  2M9H A;  1FTZ A;  4QTR A;  5K7H A;  3E7L A;  2LP0 A;  4A3F J;  2DMQ A;  1D5Y A;  3JRI A;  2HOA A;  1JJ6 C;  2FQ4 A;  2JK3 A;  2L9R A;  4MFD A;  4RDU A;  3Q0W A;  3IH2 A;  2FJ1 A;  3UKG A;  1DU0 A;  5K7F A;  1JKP C;  3H3V K;  3MN2 A;  1FIA A;  5FKL A;  3GTQ J;  2R5Y B;  3BR6 A;  4BKX A;  1FTT A;  1APL C;  4BBS J;  1UMQ A;  2O8K A;  2VPR A;  2JA5 J;  1ETX A;  3L1P A;  3BTC A;  2E19 A;  5JLW A;  2DA1 A;  2DA4 A;  3OSF A;  2X48 A;  3HB9 A;  1A6I A;  3JRG A;  4NDL A;  2L7Z A;  1U78 A;  3BQZ A;  3W6V A;  1A5J A;  1MBF A;  3BR5 A;  5F0H A;  3DCF A;  3HBL A;  5J1U A;  2O9L A;  3NAU A;  1H88 C;  5M5Y J;  1TWA J;  4HNV A;  1FIP A;  3WHC A;  5IOZ A;  1XG1 A;  1JGG A;  3HM5 A;  3BR2 A;  2X6O A;  1VND A;  2JMW A;  1WH7 A;  2HYJ A;  3B6A A;  1EF4 A;  2NVY J;  4M6V A;  1ENH A;  3SFI A;  1NK2 P;  1RKW A;  1BA5 A;  3FK7 A;  2ELK A;  4IHY A;  3HOW J;  3OSG A;  3FIW A;  4XID A;  2I10 A;  1GDT A;  1IJW C;  3ZQL A;  4IHV A;  1IG7 A;  1K83 J;  4Y52 J;  4JYK A;  1F43 A;  2LKX A;  1MSF C;  2O7O A;  4D7N A;  3SJM A;  1R9T J;  1X2N A;  3K2A A;  1QVU A;  4UUS B;  3M3Y J;  5FKM A;  3S15 J;  1RES A;  2EQR A;  1RR7 A;  1T33 A;  3Q3S A;  2HDD A;  4A3K J;  2LK2 A;  5EGO B;  3WHB A;  1X2M A;  5IP6 A;  3G1L A;  5E3L A;  1ZGW A;  3IH4 A;  3HGG A;  1I3Q J;  4C3H J;  2LR8 A;  4QIW N;  2KT0 A;  2CU7 A;  4X1E A;  2XGD A;  2Y2Z A;  3ZQI A;  3JRE A;  5J1R A;  3BR1 A;  1ZR4 A;  2MGQ A;  3GTJ J;  2ID6 A;  4MLO A;  1MBH A;  3ZQF A;  5EZH A;  4BY1 J;  1FJL A;  1QVT A;  1H8A C;  3LSP A;  5E3M A;  2M34 A;  4W97 A;  2TRT A;  1SAN A;  3C2B A;  3CMY A;  2CRG A;  3JRC A;  5J3L A;  4C3I J;  2H1K A;  1WGX A;  4ABZ A;  3BTI A;  1W0U A;  2LLK A;  2VUM J;  3BT9 A;  2L7F P;  1WI3 A;  1NTC A;  1AKH A;  2GLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...