4Y5VC

Diabody 305 complex with epor
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
215
structure length
206
Chain Sequence
PKFESKAALLAARGPEELLCFTERLEDLVCFWEEAPGQYSFSYQLEDEPWKLCRLHQAPTAGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGQGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/immune system
molecule keywords diabody 305 VH domain
publication title Tuning Cytokine Receptor Signaling by Re-orienting Dimer Geometry with Surrogate Ligands.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 206
sequence length 215
chains with identical sequence F, I
ec nomenclature
pdb deposition date 2015-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00041 fn3 Fibronectin type III domain
C PF09067 EpoR_lig-bind Erythropoietin receptor, ligand binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y5vC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y5vC01
3VGAB 1HHKB 4FRWA 3D0LA 4JKLA 1Y6NR 1RUPH 4N90D 3V4UH 3GKWL 4D0BA 1F3DH 1QSFE 2GQHA 3QEQE 3JWDH 5D1QA 1T7XA 4Y4FC 3HUJF 3RU8L 2IPTL 3G9VA 4X5WA 3TJEH 5JOPD 5AAMA 3WJJA 1RJLB 2IAND 3CLFL 4JFZH 2I5YH 5DI8B 3K74B 3LIZL 3BT2L 1GPOL 2HFEA 3RZCB 3VJ6B 3HI6L 4CDGC 2Q6WB 5HYJA 3RKDD 1QBAA 2EC9T 1ZLUK 1B2WL 1KFAH 5GSVB 5A2IH 5SV4A 4XWGH 3BP7B 1FVDB 4JPIB 2LAGB 5E1AB 3RWJB 1LVEA 4JHZA 1GIGH 5CILH 4JO1L 5CJXC 3MRRB 2LTQC 4XMKH 4JREB 3IU4H 5CUSL 4ODHH 3OF6A 4KRLB 1D5IH 2GCYA 4GRLD 1GGTA 1RFDL 4RZCA 3TFKC 4DOHE 5BS0D 2Z31D 4PJXA 5DC9B 3NCFB 2VN7A 1KPVB 1N3NB 3MFFA 5H2BA 4P4KD 1KPRB 1IC7L 5I1JH 3MO1A 3FQRA 4JZNB 5DDHA 1V7MH 3O4OB 4LSQL 4MNHB 1XCTB 5D1ZB 5IVNA 1QYGL 1RZFL 2NX5E 2HN7A 4N0YH 3SE8H 4FG6C 1PD6A 5IHZA 2J88L 4PJBE 5TJWK 1B90A 4Y8AA 5CIPB 1U8LA 4AENA 4KV5F 3EOTL 3SJVE 4AIXA 1QD0A 3O6FB 1Z0NA 3QUKB 5DJZA 2EYTB 1MCFA 4NQDA 5CFHA 1REIA 3FHAA 2O5XH 4NKMB 4XVTH 1J0ZA 3I50H 4HJ0D 5FEBA 2BSTB 4NRYA 2IEPA 1BIIA 4H25A 4WV1B 1N6QL 4PJEA 1MFCH 2DQDL 3SCMD 3ZE2E 2R2BB 1D6VH 1CFBA 4G9FB 4YHZH 1JGVL 4R90H 4WI4A 1NBYA 1MJ7H 1WJ3A 1PG7H 1EH9A 4TRPL 4RMVA 1H5BB 1FVEA 2EIZB 3QQ4A 5GJTH 2AJYL 4BQ6A 3MOQA 1P69B 5MEPB 1ZHLB 1KTDA 3UJJL 3IXAB 4ZQKA 1TTUA 1YJDH 4UINL 4D8PB 1F5WA 3BIKB 3AXLB 1HZHH 5ETUB 4U3XA 1EHLH 3KYOB 5IF0B 2CJUH 4LEOA 4FTVE 3PWNA 3PGFH 1NFDA 2HWZL 4MDJB 2CR3A 3GSWB 1S7TB 4GW4B 3AGVA 1N2RA 4OLYL 2HRPL 4D9LL 3OZ9H 4FXGB 4NWTH 2KKQA 2FECI 2WV3A 5D7LA 4P5KA 2X9WA 3LEVH 5F89B 1UKSA 2NCMA 1QFUH 3HMXA 3BVNB 4LRNH 4UBDC 3UTPD 5D2LA 2IALB 4MHHG 1JPGA 4I0CC 3TM6A 1OF2B 3MREA 1MFDL 2X1WL 1XZ0A 4C4KT 2NNAB 1C7TA 4PGZA 4UQ3A 2BOCA 4MMZC 3MNVB 1D5ZB 4X7EC 1DN2A 5D7KE 4GS7B 4HXAL 4L1HA 2HLFD 3QA3A 2ZOLB 1QLRB 4KUZH 3QR2A 4NYLB 3ES6A 4Y19D 2AXFB 1P1ZA 4HX1A 4NPYB 4EEEA 1IILE 3F58L 3BZFB 1FVCB 1AE6L 2QQNH 5KJRL 5J56B 2DDQL 4DZBA 4QHKI 3A6BL 4H1LB 4Q0XL 2YD1A 5HBBA 1Q9OA 5MENA 4OLWL 2AEWA 3LKOA 3FOLA 4QHMB 4TVPD 5DR5H 4XVJH 1CQYA 1WIOA 4PG2C 4Y1AD 1IEAA 4JANB 3ZT7A 1JYNA 2EDXA 5ALBH 1MHHA 3V8CA 3KPQA 5ADOL 2C1PB 2DTMH 1HKFA 4YQXH 5I66B 4OZIE 3TWCH 4Z6AT 5FDWB 4PY7A 2BNUB 3GJFK 3EYUL 3GNMH 1BF2A 3HE6D 5C0IA 2LFGA 4J3VA 1HOCB 4O2EA 1N5AB 5D8JL 4XXDA 2VLKA 3NA9L 4ERSL 3T1FB 3KDMB 1F4YL 1KCRH 2R2EB 4PJBF 3ZL4L 2JE8A 3JSSA 3TYGH 3P73A 3U2SA 3VXNB 3C9NA 3DNKA 4R7DB 4ZTOL 3PWJB 3DROB 3ZLQC 3OJMB 5ESAA 3MUGA 3DSNA 1I1YA 4YHYB 4ALAH 2FX9L 1GC1C 5FK9A 1YNTB 5DT1H 2N7AA 2HRLA 4LSSH 4KMLB 3L3GB 3VD3A 4NM4H 1KXQE 1XF2B 3G5VB 4JFDA 4CVXB 3U7WH 3FAWA 4YWGL 3ZE2F 3H9HB 3T08A 2ADJA 1YMMB 2Y5TA 1KBGL 4J3SA 1CTOA 4WJ5A 5C0GA 2H1PH 2AJUH 4GG8B 4FFVD 1YDPA 3LS5H 5I1LA 2HKHL 3GSRB 5A43C 1MQ8A 4XHQA 3OKLA 3U9PH 1U8MB 2XXCB 3DVFA 3BWAA 1GL4B 2AK1H 3T2NH 5LQBH 5DFTA 4XI5D 1F4XL 4Z76A 1ONQB 1D9KC 1NCCL 1YECH 3EO9H 4F3FB 4JFED 4HV8B 2NYYC 4IIQB 4OUUB 4PB0H 4ZUTB 2G2RB 4E41D 1IZJA 4OT1H 2IGFH 4WWKA 3L3KA 1AP2B 2H3NA 3MV01 3BRDA 2X4TB 3EYFB 3VFRB 1SYSA 5ICZB 5LCVL 4F7TA 3KGRA 2FZ3A 3RY5A 3UTTB 1A2YA 1AFVL 4N5ED 4H5SB 1FPTL 5D1ZD 2ORBL 3BZ4B 4ELME 1YEGL 2GAZB 1R3JB 3VWJB 4NZRH 1BZQK 4EBQH 4M8VA 2EDFA 3PIQA 4HUXA 4JRXA 2JB5L 4HPOH 2R15A 1UB5B 5F7DB 5FUZH 4OZHA 3T8XA 3MLZH 2O61B 4JRWA 2Q1EA 4XVUD 1YMHA 1NLDL 1V7NH 4FQXB 3Q2CA 4OIAA 4OZGB 4N0UB 3OAUH 3O6FD 2AQ2A 4FZEH 5DJAA 1ZOXA 4NQSA 5TDPA 5F1NA 4JFQA 3WEXA 1OVZA 5IFJA 3WS3B 4X5XA 1JZ4A 2V2XB 5DUBA 1NCUA 1PVHA 2RB8A 3K80A 1V8HA 5JXAL 1BGXL 3HRZA 2FHBA 2NW2B 4G9FD 3U30B 4PB9H 2R0LH 4RCAA 3KJ4C 1A02N 3FB8B 1JHKL 4C54A 4UAOC 3EFFB 1BVLB 4OFDA 2XQYK 5CMAB 2I24N 5CGYD 4JRYD 2PR4H 3PWLB 1U8JB 3S6CA 4TVSa 4N1HB 4YE4H 4WUKL 2FD6L 5TQ0L 4OZIF 3JTTA 4K8RH 3RTQB 1NL0H 1I1AA 4JVPA 1UJ3A 2D4FA 4ISVA 4KC3B 5A16B 3AREA 4D2NA 4KH2A 5DSCB 1IEBA 3S5LA 1L7TH 4RFEA 4YHML 4P59L 5F9WB 1IBGH 5F7FA 4H26B 4YHPA 5GGTL 5CD3B 1AGDA 3NCMA 4YPGA 1VPOL 2D7QA 1BFOB 4QRQA 4LGPB 1NGXA 3DYPA 3GSNB 4I5BB 4ZPVA 4OM1L 4TSAH 3TVMC 1MHEA 4HWZA 3H3PL 5GS3A 3HNVH 5EBWB 3V6FA 3VFVB 4ZUUB 5ITFA 3PUCA 2Z92B 4KK9C 2L4OA 1G9NH 5JPMA 4KK8D 3AS3A 3RX8A 1N0XL 2UWEA 1OPGL 2BNQA 5E08H 4WHYH 5DVMA 4TULH 1GGBL 2AXGB 5K9QG 2AQ3A 1EUUA 5BO1L 4PJCA 5GJSL 4UT6L 4LSRH 4K3DL 2I9TB 4Y2OA 2Y7QA 4P46D 8FABB 1W0VB 3VFNB 2BOBB 1U93A 3QRFM 2VIRB 4K7FB 1DQLL 2YS4A 1T1XA 5FYLD 1ZLVK 2A6JB 3MRCB 5M95B 2CDFB 4XVSH 1MRDL 1CLOH 5LAXA 3FTGB 5JUEL 3TIEB 1G7JB 1CFVH 1KJ3L 4GBXA 1ED3B 4K9EL 4Y7MA 1RZKH 3TPUB 4UTBH 4HKJB 3RIFK 2I07B 2DLIA 2APVA 3WJLA 3EOAA 3FFCA 3JWDC 5BOPA 1I9JH 3VMNA 2AXJA 2P5WB 4LHJB 3GHBH 1IAOB 5IBUG 1UEMA 4ELMF 3GJFB 3X12B 4OZFB 3DARA 3WSQH 1NPUA 4X8JB 3D48R 1SY6A 3MA9L 5T1MB 3NZ8B 4WNQA 2PTUA 2CUMA 4NQED 2PYEB 1OM3H 1UWGL 2J12B 1VA9A 4ZFZA 4X7SL 3QUYA 1UEYA 3VFTB 1RFDH 4E42B 3OXSA 1N4XL 4LFHD 1JWSA 2B8OT 4I3SH 4OSUL 1GOFA 3H3KA 1IC7H 2VQ1B 3L3HA 4L4VB 5C8JB 1CFTB 1FL3A 1KPUA 1KJMA 1MWAL 1HQ4B 2V5TA 3RVWC 5FM8A 4LSQH 3T0EB 2F74B 3KPSE 1BQHB 4FQQA 4NOFA 5HHMB 3MJ9H 3TA3C 1T04B 1YMMD 5IEKB 1CS6A 1G0YR 3QIBA 1DEDA 9CGTA 2HJLB 2BSSA 5DD3H 3P9LB 1SEQL 2KQNA 2ZCKH 3OB0H 5IP4A 1QP1A 1RIUL 1DBML 1IGFL 1EFXA 5HHVL 3QH3B 4UDUA 1JBJA 3HS0A 1ZT7B 1AO7E 5D93C 5E4EC 1T2QL 4M6OH 1I7ZB 4E5XA 5F7NC 2GY5A 1XR8A 1FNGB 1QSZA 4KK6D 1R3KB 3E6HA 3KLSA 3C6LA 1MCEA 5C07E 4OFYD 5IT2L 2DQDH 2DQHL 2NY3B 3B8YA 3X13A 1I7TB 4HWBA 2FLRT 3UTTD 1EEZA 4L4TA 5EBLB 2QQLL 3EO0B 3Q48A 4TRPH 4X6BB 3KPRE 3CFIC 3CLEH 2AK4E 4KRNA 5DJXA 2DQGL 3VWJD 5E2WL 1NUGA 4TSBL 1A8JH 2O26U 2MMXA 5EN2B 3D0LB 2C4FT 4NHUA 1RHHA 4FQXD 4PYGA 2AERT 4D0BB 3OAZK 1V5JA 1IJ9A 2B5IC 1E27A 2HRPH 3ZKXB 1T22A 3HRPA 4P2RB 1EMTL 4YHKL 3MJ8A 1JF1B 2FDBP 3LB6D 4X5WB 4LP5A 4LNRB 4JG0L 4L3AA 5I75C 5IMKB 2DI7A 4YHOL 2O5YL 4WFGE 4N8VB 3WS6A 2E9IA 3MLXH 5CLTA 2DM4A 1YJDC 3L3JB 4NO2B 5ALCL 1J1OH 5HYJB 1A6VH 1T1YA 2PTTB 3OKKB 4FFZL 3G6JE 3LN4B 5JIIA 3NFSH 5DTFB 4B0MM 3FQWB 2MKLC 2DQTH 5J6HA 3RTQD 5E4IA 4F57L 5EDXA 3TESA 1V05A 3BPLC 1A7OL 5C92A 5KJRH 3IJHB 3WLBA 2F15A 1KJ2A 3N85H 4XPGH 1CG9A 4ODTH 1WT5A 2DDQH 5ESVB 3F5WA 4MXVF 2GCYB 4O58H 2YPKB 4NKDB 4QXUL 1A6PA 2DIJA 5CGMA 3B8SA 2EH8H 3QFJA 1RY7B 3RRQA 4HIHA 3H7BA 1JZ2A 3MFFB 3RHWF 3MNWA 4KWUA 2Y07L 1WFNA 4U1SB 1WWBX 3EJYC 1JVKA 3FQRB 2WBWB 4X4YA 5DDHB 1HQRB 5CJQH 4PJ5D 1JTOA 1RZ8B 2NTFA 4J3UA 3BP6B 5DHVA 1MLCA 3HC3L 2HN7B 2D03L 4PRIB 4PJ9C 5B39G 3DBXA 3G5XA 5I71B 4OZ4B 3NFPA 5IHZB 1HINL 4K23H 1R24A 3VDAA 3NN8A 3GI8L 1U8LB 2FIRT 3NA9H 2ICCA 1QRND 3DVIA 4D94A 5KSVA 4Z0BH 4O4YL 1FYTA 4JFFB 3H9SB 3MV8E 5F7WC 4DUVA 4X7TA 4ZTOH 4IOFC 1GAFL 2BERA 4LMQI 4FXKA 3BJLA 4NKIL 4JPVH 4IBLT 1JRHL 2YPLA 4NRYB 3RI5F 4H25B 1BIIB 1EBPA 2ZPKH 4PJEB 4X9GA 4ZAKC 3T65B 2AXHA 5I8KL 1T7WA 5F1SA 1K8DA 1OAYL 4P23A 2VDMH 1IM3A 2X42A 4M1DH 4AL8H 1FVEB 1Q0YL 3QQ4B 3WFCL 5KSAC 1KBGH 3VW3H 3QDGE 4WUUE 1KTDB 5C0CE 2P5WD 2UZIH 1BPVA 3MOAL 3U1SL 1K4DA 4HCRH 1XFPA 4LEOB 5EORH 5DEZA 3PWNB 1MHPL 3VXRE 4JM2C 2PYED 5TDNA 3DMMA 1DBBH 3NMEA 5HHOE 1NEZA 3EAKA 1M7XA 5D7LB 4P5KB 2JJTA 4JPWH 4KMTL 4F9LC 4YBQD 4FQCH 4XGZA 5LWYL 5E7FA 5KVFL 5D2LB 5DF0A 2NR6D 4NFDA 1JPGB 4ORGA 4U6TA 4DUXA 2L7UA 4L4VD 4XB7A 3MREB 4X6EA 1WBZA 3T0ED 1XZ0B 3RPIB 3ISWA 4X9IA 2ORBH 4JQXC 2Y72A 4UQ3B 1YEGH 5HHMD 1CD8A 2BOCB 3U6RA 1ZHKA 5HHXH 5GS2D 5INDA 4M1GL 4JDZA 5EC2B 4AQOA 3QA3B 3M07A 1MFEL 4ZNEA 4HX1B 1P1ZB 3D85A 43CAA 2DQEH 3CX2A 3G6JF 1HXMA 4MVBD 5FF6A 2Z8WC 4N90E 3K1DA 3OG4B 1CDHA 1CGTA 4NN6C 2IBZX 5HHNA 2X70A 4ODXA 1AH1A 5IUSA 3L3OB 3I2CH 4BK5A 5CP3A 5JOPE 5BZWA 1VGEH 3D25A 5BRZA 2VDRL 1Q9OB 4J6RL 1MFBL 1NANI 4NZJA 1I9IH 5MENB 1MCQA 4GFTB 3UAJD 1PZ5A 4Z7UA 4CN1A 5JXAH 1IEAB 2NY3D 4XP6L 2XZCH 1EIBA 1KV3A 3GMPA 3KPQB 3HCVA 7CGTA 4Y5VA 4YIQA 5HYSG 1PKQE 2VLMD 1ZA3B 4QRRA 3S35X 4XBGB 4PY7B 1X5YA 3WUWG 1IC4L 2YRLA 1E28A 1NFKA 1KG0A 5ACMA 3UBXI 1XT5A 2VSDA 4O2EB 4E9LA 2AKRA 3WIFA 1CN4A 1F11A 3MNZA 4NQXA 4Q9RL 5D1QD 4KKCC 3S9DB 1E4WL 3P73B 3U2SB 3C9NB 2CGRL 5ADPH 3A6CL 1T66D 4DGYH 3RZWA 5JO5B 3MUGB 4NSKA 1DSFH 4KXZI 1BEYL 2HLAA 1QPXA 1CLZH 5FK9B 3EOBA 3TT1H 3BQUC 4K8RC 4JFDB 3NOIA 1MCKA 3L95A 2K7PA 2G9HA 5HYJD 3RUGE 5HVHB 1RV6X 1TVBA 3SE3C 4WW2B 3MRIA 2E9BA 5E2TL 2Y5TB 5EFIA 4HIIA 3QEGH 1TITA 4AM0A 5LGJA 2OK0L 4OTXH 5DMGC 5C0GB 4LSVH 1NH6A 4NRZA 4HHAA 5I1LB 2CH8A 5HPOA 3OKLB 4KQ3H 2NW3A 1QHOA 3BWAB 3QUMA 5I6XC 2P5EE 4YNYA 5I1EH 1JGEB 2EKSA 1MIMH 2W65A 2F54A 3DVNB 1PJ9A 3B2UC 3O3BA 3OF6D 4UNUA 1BJ1H 4Z95H 3B9KC 4WWKB 2N56A 3W2DH 5HI3C 5AG9A 3WNOA 1S7QA 2H3NB 3VDCA 5C09A 5CSGA 1RULL 1SM3H 1SYSB 3CVHA 1G9NC 3RY6C 4K9EH 1KJ3H 4F7TB 2FZ3B 2PW1A 5J9PA 5B38G 2M26A 1H8NA 3C2AL 1QLEL 5J57B 3WNMA 4AIZA 4RAUA 3K2MC 2NY2C 3VRLE 2VDPH 4I3RL 4Y2DA 1AHWA 3HE7C 4OQTH 2ZSVA 4OZHB 4OBRA 3FZUC 2VLRB 4PGJA 4X6DF 5FCUH 1YMHB 3O6LL 3VFGH 4J1UA 5DWUH 2ZSWA 5KW9L 4OLXH 3LN5A 4JFFD 5DJAB 2AGJH 1UWGH 5DYOA 4U1KB 4NQDD 3DOSA 2Z0BA 1BVKA 1S7VA 1RZKC 5EU6A 5TDPB 3WXWL 4JFQB 5IW6A 4LKXA 5DUBB 3TO4C 2B7DT 1FO0H 3EO1B 2AEQL 1MCOH 4LOUC 4XNZC 5KAQF 1NBQA 3HRZB 1HWHB 5ACLA 12E8H 5J1AA 4F7CA 4O02L 4FP8H 1MEXH 1BZ7A 3KYKH 2P8PA 3I3EA 3CFCH 3TV3L 2BVOB 2IG2L 3ULVL 1M05A 2NY1C 4JVWA 4Y19E 2O93L 3UZVB 4Z7WA 1G6RL 1I1AB 3K4AA 4MMXC 5GRYA 4KVNL 1IGFH 1UJ3B 2VWEE 4ISVB 4PJGA 5GRVL 3AREB 1TFHA 3S5LB 1CICA 1T21B 1OAKL 1NC4A 2JIXA 2PYFA 4C56A 1IKNC 4TVPH 4GSDH 1Z9LA 4KQ4L 1X4YA 5CJ8A 1A22B 1P4IH 4YHPB 2IH1B 1AGDB 3ARFC 3QUZB 3BP4B 1FFOA 4TVPE 5D7LD 3IFNH 5IK3A 1BJMA 4WI9A 1OAXH 1NGXB 1B3JA 4OCRH 4P0DA 4XBPA 2IQ9L 2APFA 5I74C 1N5YL 3MGOA 1MHEB 3V6FB 3GM8A 3IKCA 4KGLA 5ITFB 2HA1A 1IKFH 4DCQA 3F7RA 1NCNA 2A6IB 4X4ZA 3RUGF 4OCSL 2UWEB 4HC1H 4JB9L 3UJIL 2NMSA 1FGNL 2EDRA 2YEZA 1P84K 1WFUA 3DURA 5IOPB 2P8LA 4CVZB 2OR9H 1EEUA 3O8XB 4Q7DA 1DBKH 3IJSA 3WFEL 4M7JH 5AYUH 4GAYB 5MEND 1HDMA 1U93B 2VLJB 4LF3B 4YFEA 4R4BB 3BKCH 1KB9K 1T1XB 1WCBA 4MDIA 4P3DA 5IB3A 5LAXB 1FNSH 3QIWB 4ZS6C 3UTSA 5C70A 3O2VH 4GBXB 2EEAA 3HR5A 4UNTA 2FB4H 3TNNB 4R97B 3BN9C 4HUVB 2EZ0D 2CRMA 4KJPC 2V6HA 3D87B 2UY7A 4Y0GA 4PJFA 2XWTA 3FFCB 3MXWH 1GGIL 2AJ3A 4G6AC 2CO6B 4QCIB 4J3WA 2EDOA 3S35L 3O4LA 2QQKL 2XZAL 1A7OH 5FV1L 3VRLF 4WNQB 3W82A 1A3QA 2YD2A 3FOMA 4P2OB 5IJKC 5HI5C 4X8XA 1G7QA 3EJZD 5TE7H 3OXSB 2EICA 3HUJA 4LVOB 3G9AB 5DQDH 2HVJA 2ZUYA 1IAMA 2Y07H 3P0VH 3L3HB 4LLMA 1FL3B 1FSKB 4JFDD 2W38A 1KPUB 3MRDA 3OGOE 5T3ZL 4I9WD 5C0AB 5TE4L 4N0RA 4RMSA 3TIDA 2D03H 3A67H 1EO8H 3MTRA 2QV2A 3VRIB 4KPHL 3VWKC 1HINH 4PD4J 4XH2A 2R1XA 1CDIA 5KTEL 1F13A 4KKBD 4UDUB 5CJOH 3K0WA 3HS0B 3K2UL 2H6PA 1NQBA 2W92A 1AR2A 1QQDA 4E5XB 1GAFH 1G0DA 2FR4B 1P84J 3PXJA 3D3VB 4NKIH 4U1GB 1KGCD 2A6KA 4WWKD 3E6HB 4OFKA 1X6NA 3C6LB 4Y4KA 3UROR 2AI0L 2HMID 3SKOB 4G9FE 1KB9J 4XCEA 5F3BB 4M9OA 1CDBA 3Q1SH 4OCXH 1H3PL 5T33L 1KOAA 2VERN 1RUKL 3CH1A 2OXGA 4L4TB 3SDAC 3JVGA 3TP4A 2KZWA 2YUVA 4KAQL 4G6FB 5DJXB 3UTOA 1Q0YH 3WFCH 4LEXH 2ZP0T 5JR1L 1NGYA 1NBVH 2J8HA 3MODH 1S7SB 4YX2H 5IROA 4JRXD 5D7IA 5D71L 4K3EL 2XT1B 2QSVA 1H3VA 5EO0A 2VLRD 1O7VA 1RHHB 1FIGL 3ILPB 1WK0A 4U31A 2PF6A 3OKMA 1E27B 1T22B 3IRPX 5JORA 4PV8A 1UXSA 3ZE0F 4X7FC 4KMTH 3OKDA 1H8OA 2ESVA 3F7PC 1B6UA 5KVFH 5LWYH 2YKLL 2EH7H 5BW7C 3DUSA 3N06B 3P30H 1V3JA 1IRAY 1KB5L 1S9KC 4RFOL 3WFDH 1DVFC 4U1HA 5ANMB 5F93C 4BELD 4M1GH 5EUOA 4MNQB 4GXVH 3ZE1F 3ZKMD 2OJEA 3EDDA 1MFEH 1OAUL 5GGUA 5J6HB 5JW3L 3LRSA 1I1AD 4RMTA 3V4PH 4NN5C 3WL9A 2JF1A 3ARED 3V0WL 2UVFA 3WLBB 3LEYL 1KJ2B 5FYLH 3H3BC 5I9QB 1CG9B 4LPTA 1JHTA 1QFWL 5DJ0B 1NLBL 4ONFL 1LK2B 3LHPH 4X98A 2B1HH 5FYLE 1EAPA 4MD5B 1DQTA 4TTGA 1TQBC 3QFJB 3PE9A 4HIHB 1IGJA 4WVRA 3QO0A 4G6KL 2JTDA 4NGHL 1R3IH 3BKJL 4B7IA 5E99H 1QBMH 4I4WA 2NTFB 3BUTA 2WWKO 1BFVH 2Z9TA 3DBXB 2MCPH 4P5TA 1R24B 4L4JA 1I1CA 4U6YA 2BNQD 4UV7L 3NN8B 2MPAL 4UT9L 4M6NL 4PY8I 2YK1L 1WEJH 2NY7L 5IMMA 3RKDC 5KSUA 1FYTB 2EDQA 2IPUG 5DGRA 2DQFB 3RVVD 4X7TB 1SBSL 4FXKB 4R96A 4KMQA 2E3VA 3WD5L 3NIDE 2BXZA 2VLJD 2F58L 2YPLB 3SKMA 1OTUD 1ZEAL 3E2HB 1UC6A 1KIRA 1K8DB 3O2WH 5DD6A 5HY9B 4GBXD 4P23B 2Q76A 5B39A 1ZLUH 2IMMA 4DK3A 2H45A 5EIIB 1YMME 4GRLC 4G7VL 2Z31C 2YPVH 1W0WA 4L9LA 2EYSB 3KVQA 5K9OA 3FFCD 3LPWA 3O41B 5EC1B 4R4FL 4P4KC 1E6OH 3IXTA 3QG6A 2HH0L 2V2WA 5JMRA 1K4DB 5JOEA 3M45A 4A6YL 1XGTA 1U3ZA 3WIHA 4P3WA 2AP2A 4PJBA 3LSOA 5IW3A 3GUTA 1XGPB 2A1WH 4BUHA 5SX5K 1NEZB 5KN5B 4KDTC 4JO4L 3T0BA 3S3JA 1RIHL 3SJVA 1Q0XH 4XGZB 2VH5H 5DMIH 4PLJD 1NMBL 2RCSL 3UTTE 4ORGB 1F4WL 1FFNA 3F7VA 3X11A 1LEIA 2APXA 1WBZB 4MLIA 4H0HB 4XC3H 5KVDH 3C2AH 4HJ0C 2HT4D 1QLEH 3U6RB 2VDQH 1QBLH 2WIIA 3RAJH 4LARL 1UCBL 4JDZB 3SCMC 3G5YB 4C57C 4DEPB 4I3RH 1YC7A 4H8WL 3D85B 5DJCB 2RIKA 3MGTA 3KLAB 4OF5A 4ZO9A 3KPPB 4LCWA 4MJ5A 2R56L 4ESKA 3S3PA 1VHPA 5GIRA 3CU1A 4OZGE 4N0UE 3VGBA 4KZEL 4K3HA 1KEGL 5HHNB 2X70B 4PRPB 4ODXB 5DVNA 1NGZA 1NAKL 4KRPB 2DLEA 4K9EC 3T2PA 4NZDA 5BZWB 4JG1H 5JHLH 1GCFA 5BRZB 1NCAL 1M4KA 4MQ7A 1L4IA 3STLA 4X7DC 3C6LD 2QLVB 4FTVA 2D0GA 1W8OA 1PZ5B 1AJ7L 3AROA 5KS9A 2I25N 1MCRA 1E4KA 4UIKH 4DKFH 2CXKA 3HCVB 2O5ZL 4L4TD 4YIQB 3WO4B 2B20A 1HHJA 4ZYKB 5D7JA 1F45A 3OL2A 4G6FD 5E2VL 5KAQG 3ULVH 2DD8L 3SOBL 1OP5K 5L6YH 1KG0B 5CEYB 1G6RH 1H3GA 4QO1A 1KACB 1HYRC 1NGWA 1T2XA 4U6VL 4UT7H 4H20L 4KVNH 2VR4A 1Z6JT 4CRPA 3Q3GA 1PY4A 1K4CA 2YD5A 3U36A 2GTWA 3VFSA 3MNZB 4NQXB 3GSNH 2E7LA 1I8MA 2HLFC 1JGUH 1JTTA 1OARH 4PP2A 5HYSA 4BSVA 5DRXA 2H8PA 3S96A 2IQ9H 1JRHI 3EOBB 3IFOA 4KI1A 4KY1H 3NIDF 5FHBL 5AYQA 3WUWA 2G9HB 3ILQC 1IM9A 2W1NA 4Y16A 4YUEH 5E94A 1DQJA 1RIVL 1P9MA 1TJHL 5DD5L 1TVBB 4X9FA 4HIIB 4AM0B 5LGJB 4MNQD 2FJHB 2OZ4L 3NPZB 4OCSH 2D4DA 4WEBL 1QOKA 1TQCB 3GMRA 3NTCL 3OJDA 2NW3B 2VE6B 3UYOD 5DUPH 4TNWF 4XMLL 4YNYB 2SEBB 1VACA 1QR4A 2EKSB 4F15B 1N7ML 2W65B 4RA0C 4FQJL 3AVEA 3FQUA 3MX0A 2BX5A 1QR1A 3CDGA 3HE6C 3S37X 5DUMH 2W60A 3LN9A 1EEYB 5AZ2H 3SQOH 5GGQL 2XTLA 4NOBA 1HNFA 3QFJD 1S7QB 2CDGB 1A64A 4XP1H 2OSLA 1KIQB 4S2SA 5C1MB 3U4BL 3CVHB 5ACZA 5I1KH 1A9EA 1WC7B 2BVTA 3QQNA 1P6AB 2PW1B 5J9PB 5I1CL 2H2PD 2FX8L 3A6OA 2Z93A 3GJFH 4NWUL 4OZFH 3DRQA 2YXFA 2P5WE 3P9MA 3CSYB 5T5FL 1AGCA 4FFYL 1AHWB 2YC1A 3LKRA 3S35H 4KK5D 4YBLB 2WUCH 2VC2H 2PYEE 4MXWH 1FYTD 3LN5B 4QXTA 4EQ3A 4ZS7L 3WNPA 1UXWA 4OZGF 1P4BL 1BVKB 1KCUL 1S7VB 2BK8A 4FFVC 1P7QA 4ZOEA 2C3HA 3CK0L 5CZXD 2YPLD 2W9LA 2MTPA 2R69L 2Z8VC 2KBGA 5B38A 4F8QA 3IDUA 4L4VE 1X7QA 4XI5C 5GS2H 3T0EE 1DL7H 2CKBA 4AYFA 4MD0B 2XA8L 4P23D 3W9DA 1MY5A 3P3YA 4HAFA 1LHZA 1W8NA 1OT1A 1U9KA 5J1AB 3MJ6A 5HHME 1BZ7B 3SY0A 2P8PB 4IOSD 5BVPH 1M05B 1NCWL 3ECBA 4TQEL 3O3EB 3SGKA 1JYVA 4Q9QH 4KPHH 3B9AA 2R2HA 1C7SA 1FHGA 1T03H 4K94L 4M8QA 2Y5EA 1MSPA 5DO2D 4F58L 4JGMA 4KVCL 3O4OC 1CICB 4N5EC 3GHEL 1NC4B 3K2UH 2DLFH 5D1ZC 2PYFB 1MY7A 4C56B 4JPKL 4NQVA 3SGJA 3TJHD 2MWCA 3AC0A 2DQUL 1IZKA 5DHXB 1MCDA 4FQ2H 1CBVH 4FQHA 4XP9H 1FCCA 3ETBF 3SN6N 5GSRA 5HI4D 5IK3B 3ZHDA 3PP4H 4ZODA 1AI1L 4OIIL 2VDKL 5C3LD 3FB7A 5F9JA 3CFEA 4QKXB 1H3PH 4XBPB 4M3JA 3SDCB 3O6FC 3IDNA 2VLME 1AQDA 4KAQH 4G6MH 1YC8A 2A73A 3BGMA 3HNSL 25C8H 5T1DH 2E7BA 2YD3A 2BZDA 2OCFD 4GMTH 1C08A 3ULUL 4Z7NE 3KYMA 5H37G 1K6QL 3D85D 2Z35A 3N50A 4WGWB 4ODWA 4YXHH 4UV4L 1ZVHA 2AEIT 3MLSL 2YEZB 5CGYC 1A4JA 4P2RE 1MLBA 4TNVF 4YHIB 1T89A 4YXKH 4KRPD 4ZXBA 1ODAA 5BRZD 4CVUA 1T5XA 5ESQA 2Y23A 1JZ8A 2C3XA 3Q5TA 5GGSB 2PUQT 2R1YA 2VITA 3BXNA 2WM0A 5IW1A 4MDIB 4N1EA 3DIFB 5IB3B 4PGDB 2FYYA 1FE8L 3HR5B 5HYJE 3DX7A 1VENA 4DTGL 4QRRD 1OP9A 4UDTA 4BZ1H 1Q9WA 4EXPX 2LU7A 4PJFB 1CDCA 5CJ5A 1UWEL 4EIZC 3BO8A 2XWTB 1LO4L 2J6EA 5HVGB 1XGYH 1SY6L 5E24E 2P7TB 5CINL 3V0AC 2HTKD 3WKNA 3IB4A 3O4LB 5CHNA 4N0FA 4MAUL 3V0WH 1JPTH 5MEOA 4NCDA 4RGOH 4LDLB 4YHLL 4HIJA 4EDXA 2C7UB 5CEZL 1HILA 3FOMB 3OKNA 1G7QB 3BIBX 3MA7A 3ZKND 3AFLA 1FNEB 5CSZA 3GRWL 2ARJQ 2HVJB 1ETZB 1G7IA 3SBWC 2NY6B 3KLHD 2OJZH 1F3DJ 4LLMB 4QY8A 1IAIL 4NC2B 5FOBB 3MRDB 4JJ5B 4P46C 1NAMA 4I18C 4PRIE 4XNXH 3TIDB 1I1FA 4UOJA 3EYVA 2A77L 4BFGA 3CX5K 3O6MH 2V2TA 1CGYA 4P2QA 3RA7L 4XH2B 4M6NH 3LD8B 4UILL 1JZ7A 2NY7H 2J4WH 4JFFE 3H9SE 3I6LD 2FX7L 2H6PB 5J11B 4WI3A 4XZUA 1EBAA 1QQDB 3ARGA 1F2XK 2EE9A 1B4RA 1SBSH 2JJSC 1ZLVH 3OR6A 3WD5H 3F65A 5T1KA 1MRCH 1UKQA 4PJEE 4I77L 1CE1H 1MREH 1EA9C 5IVZA 1LK3L 4Y4KB 2JJVA 3VXPB 4HWNA 1QA9B 4XXCC 1SJXA 5CKGA 4XCEB 5C09D 4DWHA 5J1SC 3LRGA 1ZHNA 5FUCE 3CH1B 3EYQD 4XAWH 3QULA 1RURH 4G7VH 4EI5A 2G75A 5ISZA 4HUKB 2VL4A 3OX8A 2YD8A 1MVUA 4PRNA 2VO5A 3DV4B 3MLRH 5D7IB 3E3QE 5GQBA 3BKML 2YXMA 5DMKB 5FO7B 5EO0B 3ZSSA 4KHTH 5IHUL 2M8XA 3O3DB 2BNRA 4Z7NF 4LAQL 4Z7QE 3HMXH 4CMMA 3OKMB 1DLHA 1E4XL 1NMCB 1X5HA 5D7LE 3QQ3A 2VKWA 5EU6D 1FNFA 3NCYS 5JORB 4LIQE 4PV8B 1UXSB 4HDIA 5A1AA 4EI6A 5I1HH 1M6OA 4GAJH 1AKJA 5D2LE 4MAYA 3MYZA 5EU7E 4EDWL 5IB4B 1DP0A 2YMXL 2VXUL 1UJTA 1YN6A 2W0FB 1F4WH 1XCQA 3DUSB 1BWMA 2XOTA 2FL5A 4IIQC 1EJ6A 3GSUA 5GRJL 4KK6C 4M4PA 4U1HB 1UCBH 1DJSA 5EUOB 5SWSA 3ROLA 4OCWH 1Q9LB 5GGUB 3MLUL 3LRSB 3CX5J 4H8WH 3DUHA 3LCYA 5CBEB 3WL9B 4PS4L 1U3HA 4L8DA 1CICD 5M94B 5SWZA 1NC4D 3VFWA 1KEGH 1UYWL 2JIXD 4C56D 3TNMA 1H15A 1OP3H 4L8CA 2EIBA 3VWJC 3CDYA 2Q3ZA 3D39B 5J6GA 5MENE 5E6ZA 4X98B 1SBBA 5C0RH 1EAPB 4U1IA 2N4IA 3FQNB 2CR6A 3MRJA 5JHDA 4S1SH 3SE9L 4RA3A 4NZUL 3UDWC 3AU1A 1HH9B 4FQXC 2HJKA 1UA6H 2DBJA 4HG4K 1XAUA 2ARJA 3SDCD 2O5ZH 1HHIA 4JE4B 3QIUA 2EDLA 3DV6A 1KN4L 4H1LG 3LB6C 1ND0A 3OBAA 2GFBB 4WHCA 2DD8H 3SOBH 1D7FA 1NGPH 2R4RH 4XNQA 2A83B 1QLFA 1FNLA 2ZKHL 4P5TB 3QDMB 4U6YB 4P48A 1IC5H 2OTWA 4PV9A 3GO1L 5HDLA 2GITA 3PV7A 3S88H 3OAZH 2EDDA 5I15H 5KSUB 2QJDA 3UPCA 5KVGL 4MA7L 4Q9CA 1I3GL 5E5RB 3TO2A 1C16B 4XMPL 4R96B 3RTQC 5DD1L 3ABZA 5DEGA 4Y5XC 3SKMB 1NMAL 1AIFA 3ULVC 1A6AA 1J5OL 1S7WA 1KIRB 2Y6SC 3QUXA 4KTDL 4GH7B 5F9WC 5MP6L 4JFDE 4PJEF 4GKOA 4F2MB 2Q76B 4G8IA 4I9WE 1GGCH 1OWWA 1YYLL 3IDMB 4BH7A 1W0WB 5LKNA 4LFHG 3VG0H 3MLPA 4TUOB 4APQC 3K8KA 1C5CH 2PO6B 5D6CA 3IXTB 3MRNA 1BAFL 2V2WB 1MQKH 4EUPA 3O4LD 4M7KH 3RIFF 2BFVH 5JOFA 5GRZA 3J8F7 3MBEB 1XGTB 4XMLH 2UVEA 2DIBA 5IGXL 4U6HA 1WF5A 4FQJH 3T0DA 2YSSA 1KGCE 2B1AL 3LSOB 3GUTB 1R0AH 1F00I 1MH5A 5FB8A 5GGQH 4FQLL 4HS8H 5EOQL 3LZFH 3U82B 2ERJC 2NY6D 1KLUA 3HI1A 1RZJL 2R8SL 4AEHL 1H3WM 3F7VB 3X11B 1LEIB 2W9DH 2YD6A 5I8EA 1JNJA 2ICWI 2VYRE 3WIIL 3JV4A 1N6UA 3PXHA 2DWDA 4JQIL 1Q72L 5IWLA 2FJFA 5CBAA 1FLRL 4GOSA 4OZHE 2VRAA 2AEPH 4QGTA 4XNUL 3VXQA 4HEPG 2VLRE 3MGTB 4TOYL 4LCWB 3FO9B 5F1KC 5GIRB 5GRUL 2V17H 2ICEA 3LMJH 4HK3J 4S1QL 3QDGA 4ZTPL 1NGZB 1LDSA 3AB0B 1VKXB 4M00A 4PUBL 3NCJH 4MZ2A 3CK0H 3BI9X 2Q8BH 4QRTA 1S7RA 1QFWI 3STLB 6CGTA 1A4KB 2R69H 4Y4KD 5KS9B 5C9JA 4PJHF 3V0VA 4MNGA 4GAGH 5T5NF 1NUNB 2XA8H 3FQTA 4WO4A 5HHOA 1WICA 2WLYA 1HHJB 5D7JB 5T3XL 5DRNA 5I1IL 1FGVL 4YBQC 3QPXL 3GBMH 1DQDH 2JELL 2NR6C 5BV7B 4LASL 4YC2B 4Y5YA 4EVNA 1NGWB 5IBTL 3KWWA 4DAGH 3Q3GB 3BIAX 3T0EC 4DKDC 1K4CB 4JPKH 5B4MD 4X6DA 2IMNA 2DQUH 5AZEH 3MRLB 3VG9C 3B5TA 1YEJL 3FONB 4NT6B 1EO5A 4PP2B 3U79A 1CT8A 1SVZA 2EXWD 3O3UN 4BSVB 5DRXB 4OI7A 2H8PB 3JXAA 3IFOB 4RAVA 3GKZA 4JDTL 5IBLD 5BMFL 2OP4L 1IM9B 4Y16B 1VGKB 5E94B 3INUL 4QHUB 3VGDA 2RAMA 3U9UA 2GEEA 5I8OL 2UWEE 4ZUWB 2BNQE 3EFDL 3UPAA 5J1TC 2NY3C 4WW2F 1PKQA 3GMRB 3OJDB 4C83A 5D96C 1T0PB 4PLOB 1JNHA 1VACB 1AD9A 5HGGS 1D5XA 3D39D 2APBA 3L3IB 2GKIA 2DLTA 1QR1B 5I30L 3CDGB 2Z4QA 2VLJE 3ME0A 5I73C 1PSKL 1JPFA 2W60B 4OGAC 1QPPA 4FQ1H 1S8DA 2YD9A 3RHWK 3AY4A 3BE1L 4AT6A 2OSLB 4KKLD 3B5HA 1N0LA 5H35A 1TMCB 5E1HB 1J0KA 5ACZB 5E5MB 1R5IB 5D1QC 1RUQH 3ZKXC 4HIXL 1QVOA 4U7KA 1OWRM 1R3LA 1JN6A 5CWSA 2Z93B 3QZWG 1T66C 3WJJC 2AQ1A 3FFCE 3LVEA 3C5ZA 1SY6H 2EDTA 3ARDA 3P9MB 2VISA 5F6IC 5CINH 3ZKSD 1AD0A 4P5TD 3QDMD 4IDLA 2YC1B 3LKRB 4Z0XB 4I2XA 3BDYH 3RUGA 2Y36L 1YYML 3IDGA 3X3GL 4OZHF 4HXBL 5DHYB 4P5MA 4QXTB 3H9YA 3PDDA 2RJMA 1UXWB 5JNYA 2ADFH 1P7QB 3RI5K 5F7EH 4YZFF 2IAMB 4OZFG 2P5EA 4LBEA 5LBSH 3V5HB 4M5ZH 4JY4A 1X7QB 5DMYA 4HAGA 3RVTD 3VE0A 2CRZA 1IAIH 4R8WH 3W9DB 2NXYC 5C0AE 3KPTA 1OSPH 3SY0B 4FZ8L 1S9VA 1EVTC 4XPFL 3EOYG 3G6DH 1V3LA 3ECBB 3K4DA 1ZS8A 2XKSA 3ARTA 3T3MF 5C0JB 3GB7B 4ODUB 1BQHG 5DJDA 3D3VE 2MFNA 2X6MA 2OL3L 4U1JB 4WFHD 4FQHB 3HC4L 8CGTA 1OTSD 4HWBH 4JFYB 2F5AL 3IU3B 2CSPA 4LLWA 5JDSA 1LK3H 4IRSB 4YDKH 3SJVD 1URLA 3FFDA 1F8TL 2RQ8A 2QSTA 3FB7B 5F9JB 3CFEB 4L4TE 4EXKA 3S37H 1EHNA 3IDNB 4HLJA 5FGRA 1AQDB 5EO1A 2A73B 3MRPA 2AJVH 1L7IH 3WE6A 2XNAA 3VFOA 1YEHH 3KYMB 1ZLSL 1EERB 2ZNWA 2RFXA 3R1GH 2Z35B 4YK4B 1A7NL 4G8GA 3I6GA 3UJTL 4IS6A 4OFIA 2A2QT 3R0NA 2GW5A 4LCWD 1GC1L 2UWEF 2VXTH 2B39A 3CZJA 1A4JB 1YNLH 1CDUA 2VAAA 5CP7A 1MLBB 3OR7A 3QCUL 1TTGA 5HGHB 3LY6A 1U8OB 4ZXBB 3MPCA 5EZIH 1T5XB 3HA0A 5ESQB 1J7VR 1LO0L 4L8SB 5KSBA 5MEQB 3E3QC 3QCVL 5IW1B 1CYGA 4KZDL 2WLZA 3NACL 3M1BB 5E8NA 4TUKH 1NGQL 2DTSA 5D7JD 1FAIH 4XCCL 4QXWA 5GRJH 5ANME 3CZFB 4NJAH 2HG5A 3G6AA 4MNQE 5F96H 2IPUK 3W9EA 1YPZA 1KJ2H 1J0HA 4N8VG 5EU7C 4NBZB 5FM5M 5D2NB 4P3CH 5MEOB 5DD0L 3P0YL 1CE6A 2CLVA 5IFAH 2FH8A 3QJHA 3GBNH 3WXVL 1IEHA 4HFUL 4FMFA 3BP5B 1HHKA 3BGFB 3L5XH 2XQYG 3OKNB 3MA7B 4ENED 3QFJE 3GIZL 2FEEL 4BZ2L 5CSZB 5ILTH 2YZ1A 5HD8D 4JR9H 3WFZA 5DHVH 1G7IB 4U3CA 3FT3B 5IM7A 1RJLA 4H8WC 3UC0H 3QWOA 5DI8A 1IM9D 3HZVB 4Y16D 4A2LA 1WZLA 1I1FB 3CFJB 1UM4L 3K81A 3EYVB 2D7PA 3PNWA 2V2TB 3RZCA 4P2QB 1GRWA 4J7RA 1QSEA 1BLNA 1YEDB 4NNPH 2E7HA 3GO1H 1Z9MA 1ZWIA 1T0MA 1T6VN 1BQUA 5GSVA 2NY4C 3V79C 1FYTE 1MRFL 4NBYB 2EZ0C 1UM6L 1FAKT 5L7XH 4GMSH 4XZUB 2E5EA 4OD2A 2YD7A 3BP7A 5E00A 1FH5H 2BP3A 2X89A 4N9GA 4LU5H 3TT3L 3KS0J 1NC2B 5ITBL 1LNUB 2YPLE 3OR6B 4UB0L 1L9NA 4KJYA 4NZTH 4M48L 1ZVSA 3FQXA 5FOJA 1J5OH 2OR8A 1IT9H 1ZHNB 3BUYB 4JKPL 1A1OA 3EJZC 5ISZB 2OM5A 1KPRA 3OX8B 5FYJU 1EJOH 1MVUB 1W72L 2R0WL 5C0EA 4PRNB 4HF5H 4D9QE 4JZNA 4PJ7B 1TZHB 2ZUUA 5DURD 3M17B 4MNHA 4OD3H 2X44D 1EXUA 2W9EL 1EAJA 3ALXA 2BNRB 5HVHC 3QXDA 4G80A 4QHLA 4CMMB 2ENYA 2R0KH 4G9DA 1DLHB 5CIPA 1DEEB 3PGDA 2CK0L 2F19L 3DX6A 5MHSD 5DLMH 1P7QD 3IKKA 3BSZL 4HDIB 1F02I 4KDWA 4M62L 4EI6B 5J7CC 1M6OB 1AKJB 4MAYB 4KKBC 1ZMYA 3JWOL 3MUZ1 1CLYH 1YN6B 4NKMA 1XCQB 2BDNH 5E6IA 3SE4A 4AZ8A 4WV1A 3B6SA 1F6AA 4H0GA 1Q1JL 2MHAA 2BVEA 4WWKC 3ZZ1A 2R2BA 2UYLB 4XTRD 1HIMH 3HZMB 4G9FA 5SWQA 3T4AA 3EZ8A 4ZNEE 2EDWA 1CK0H 5SWSB 3ROLB 4FABL 3BPNB 4HKBB 2HMIC 1FLRH 2X4SB 4ONGL 4PBVC 1H5BA 4PP1D 4OD1L 1FORH 5CP3H 2YUZA 5FV2A 5F3HA 4L8DB 4RFNB 5SWZB 4U2ZA 4PRPE 5MEPA 5GZOD 3C6SA 4D8PA 4L8CB 4PTUA 5BRZE 1INDH 3AXLA 5ICXA 5ETUA 5IF0A 4PUBH 4LQ1A 4CBPA 1RUPL 4MDJA 3V4UL 5JHDB 3MRJB 1S7TA 5FYJD 3JWDL 4OGYH 4NP4H 2HJKB 3PG2A 1ZGLB 3TJEL 2ARJB 3P40A 3MC0A 3DV6B 4JFZL 2I5YL 3RVXD 2XQBH 4ZPTA 1FZJA 1G9EA 3L9RA 5T5NG 1QLFB 3B9EA 3UZQA 1VEMA 2OTWB 4PV9B 3MNVA 1KFAL 2AV1A 3R4DA 4JKMA 3NIFE 5L9DL 1GSMA 4PJAB 4NYLA 4R26L 3PWPB 4XWGL 2JKXA 3OKEA 3X14A 2AXFA 4E0RB 4FN0A 3TO2B 1A7BA 4ZXBD 1FVCA 1W2KT 1T7ZA 3ZKMC 2C3GA 1I1AC 3VU2A 1GIGL 4OLZH 5CILL 5DEGB 1UJ3C 2DS4A 4EZMA 3AREC 3V5KB 3DYMA 4XMKL 4JDVB 3WYRA 3SDXB 3IU4L 2VDNH 5DJ8A 4ODHL 4H1LA 1D5IL 2JK5A 5TF1H 4LKCA 1FLTX 4G8IB 4QHMA 4Z18A 1SMOA 3MBXL 2DIAA 3QUMH 4QRSA 3IJYB 3P4OA 2B2XH 4DN4H 1IGIH 1V7ML 5D6CB 3MRNB 2R29H 4EUPB 4XPTH 4HUNB 2FJGB 2BNUA 4N0YL 3I6LE 1F3JA 2R9HD 5JOFB 3SE8L 4YAQA 2DL2A 4U6HB 2ICES 3MJGX 2YSSB 1N5AA 4NO5B 4O00A 4KHXH 5I30H 5DFWH 4K7PH 5INCA 1KEMH 1MH5B 2DB8A 5FB8B 4MZ3A 2WWMD 3KDMA 2NXZD 2R2EA 3T1WA 1E4XI 2GJZA 4PBWD 2OQJA 1KLUB 3HI1B 2E8YA 2O5XL 3B2VH 1TJGL 4XVTL 2VDOH 3I50L 3VD9A 1T4KB 3OKYA 3RVVC 3BD4A 5FYKU 3O0RH 3LDBB 4NM8H 3JV4B 4W4NA 1E0OB 3L3GA 4YHZL 2DWDB 2QTEA 3G5VA 4R90L 1MJ7L 2FJFB 1PG7L 2GJ6B 2Y06L 4P2QD 5CBAB 1RZIA 2LTQB 3RVUD 3VXQB 2AJSH 3H9HA 2VB5A 3GZKA 4GBXC 4JQVA 4HGWA 4R97C 1UQSA 5GJTL 2XY2A 4I48A 1YJDL 4LLQA 5FECA 3WJLC 3BFOA 4GLRH 1HZHL 1EHLL 1NC2D 5D9SB 2CJUL 5HGBB 5T1KD 1UACL 3PGFL 4QRTB 3P11L 3L5WA 4I1NB 1MF2H 2OXHA 1MCWW 3T2OA 4F7PA 3OZ9L 4HV8A 4MNGB 4OUUA 4NWTL 4PREA 3OHXB 3QWQB 1AGBB 4KKAD 1AP2A 4OFYA 2X4TA 1A6UH 2VAJA 3LEVL 1CDGA 1QFUL 1BJ1J 3HKFA 3QUYC 4FZ8H 4LRNL 5DRNB 5HHQA 5E8EA 4EI5D 4XPFH 5ISZD 5ICZA 1EGJA 1UZ8B 2EECA 2FHFA 4HH8A 2JCCA 3JV0A 3VFUA 1UG9A 4H5SA 4Z7OF 4Y5YB 3BZ4A 3V95A 4EVNB 5I18L 1OOAA 2GAZA 1FSKC 2DI9A 4FNLH 4C56E 4WY7H 2BNRD 3LKQB 5IJVB 1BQSA 5AAWA 3FB5A 4KUZL 2HT4C 4X6DB 1UB5A 5SX5H 4MCYA 3QIBC 1H3UA 2O61A 5FYKD 3CVIH 1KC5H 3NIFF 2QQNL 1MFAL 4NJ9H 3CPLB 2XZQH 4PJDA 4LSTH 1AKJD 1I8LA 4MAYD 1MI5A 3S5LG 1XGUB 5HJ3A 3BPOB 5KSAA 1A9BA 1ZTXH 4RAVB 3MCG1 1VFAB 3D5OF 3ZTNH 5DR5L 4XVJL 4U1GC 1RPQA 3QXWA 3U9UB 3C6LC 3PL6A 5ALBL 1S7UA 2HT2D 3Q5OA 1Y6KR 5SWSD 4QXGH 1C1EH 2ZJSH 2DTML 4YQXL 2BCKB 1BVLA 5F1OB 3TWCL 5CMAA 1C5BH 1U3HD 5F7UA 1BVZA 3PWLA 1U8JA 5JW4N 5FXCH 4YO0B 5SWZD 4MXQC 1JNHB 1WZ1H 2OBGA 5L2KB 3BMWA 4CADB 3DVGB 1AD9B 3QCUH 4QLRA 3PWVB 4QWWD 5A16A 5DSCA 4M4RA 2Z4QB 4JFXB 1LO0H 3HPJB 5IMLB 1G84A 2J8UA 1KCRL 1S8DB 2ADGA 5JHDD 1ACZA 4FFWD 4H26A 3TGXA 3TYGL 4KZDH 1BMGA 1I3VA 4XBEH 3HC0A 1TZIA 1IQWH 4NKOA 3TLRA 2VXSH 3QIUD 3KPOB 4AEIH 1NGQH 3MXVH 4BFEA 1QVOB 1R3LB 1JN6B 4ALAL 5LJYH 5CWSB 4PJFE 1Z9OA 1FFRA 1OP5H 5DT1L 3B9VA 3C5ZB 4LSSL 1MCPH 3GK8H 4NM4L 3ARDB 3WS6C 3U7WL 1AD0B 3O4LE 3VFVA 3U48A 1G9MH 1JNLL 3E1F1 5GRXG 4I2XB 5TQ2L 1PBYA 2Z92A 5HXMA 2ZUXA 3I3DA 3IDGB 2H1PL 3P0YH 2AJUL 3V9FA 4AEEA 3LS5L 5HVWA 4MHHI 4WCYH 4JHAH 3NAAH 3U9PL 4MLSA 5JNYB 4F8TA 2CKBL 3G04A 3GIZH 2AK1L 3T2NL 1ZT4A 4BZ2H 5LQBL 4LCCC 2FEDD 4LBEB 4XAKD 2VZSA 1YECL 3EO9L 4QHKJ 1F2QA 2XWJA 3QZWA 8FABA 3VFNA 4PB0L 5I9QC 2BOBA 1WT5C 4OT1L 2IGFL 4K7FA 3EKCA 4QT5B 2CDFA 5IHBA 1S9VB 3QXVA 1WGOA 3FTGA 1G7JA 3C09B 4DFHA 15C8H 4N8CH 3TPUA 1CZ8H 5FGCB 1U58A 4FXLA 3PF2A 4JY6A 3IYLW 2BRRH 1ZS8B 4W6XB 1WIUA 4EBQL 2H2PC 3BKYH 3QISA 3UYPA 5JQ6L 4Y88A 4HPOL 5DJDB 3X12A 1XMWA 3OGCA 4J2XA 5FUZL 3TT3H 3MLZL 4X8JA 1V3MA 2G5BB 3WNNA 1YA5A 1V7NL 4M48H 4AEFA 4LLWB 3NZ8A 3VMPA 5JDSB 1JZ3A 3OAUL 4V2BA 4KI5D 4KK5C 3FFDB 4LQFH 3VFTA 5AEAA 1JWUA 1CR9L 3WKMH 3O3AA 1J8HA 3AMLA 5FUOH 5EO1B 4DKAA 1TJIH 3MRPB 1J1PH 2XNAB 5CZXC 3VFOB 2V7HA 5DZNA 5D7IE 5HPMA 3QFDA 2DI8A 3E2HC 2GJ6D 5GGVY 3F8UB 1YQVH 2VKXA 2F74A 2RFXB 5CGTA 3H42H 3I6GB 1T04A 3FRPA 5IEKA 2PR4L 3RNKA 2HJLA 1BJ8A 4YE4L 2IQAA 1B9ZA 2VAAB 1I1RA 4M6AA 3NCYP 3HPLA 3BD3A 3OR7B 1JPSH 2F19H 4WFED 1PG7W 4LPYA 3QH3A 2EIEA 1L7TL 3BSZH 1ZT7A 3RNQB 5KSBB 4O5LH 5C71A 1OW0A 4M62H 1IBGL 3NCCB 3JWOH 3GMLA 5DO2C 3UTZB 3EJJX 2OYPA 2A74A 1NCBH 3N1PC 1T1WA 4ONHA 5E8PA 3CXHK 4OGXH 5EWIH 3ZMRA 2J6EL 4FG6D 4WO4D 5HHOD 5E8NB 3DMMC 2HJFA 3IF1A 4M7LT 4KFZC 5D6DA 5E2JA 5HI4C 1CL7I 4I0PA 2JJTC 2HG5B 3G6AB 5EUOE 5IIEA 2I26N 4L8BA 4OF7A 4TSAL 1UWXK 4U3HA 3W9EB 1YPZB 5EBLA 3HNVL 4PJFF 43C9A 3I02A 1ES0B 2HAZA 3QB7C 4XCFH 4QTIH 1G9NL 3D39E 5SX4H 1GZQA 2CLVB 1LP9A 3QJHB 5E08L 5IB5A 3FL7A 1GHFL 3MRKB 5EN2A 1HCFX 4TULL 4R0LA 4HD9A 4R9HA 3KJ4B 2E9JA 3KXFA 1U8QA 5BXFB 1OAQH 3V6OA 4P2RA 4LSRL 5JPNB 2CO7B 4F9PA 1JF1A 1NCDH 5IM7B 4LNRA 3MV11 1YNKH 1KF9B 1TIUA 2C1OA 3DX9A 4OFVA 5IMKA 1OTTD 3QWOB 5FKPA 4N8VA 4XVSL 1CLOL 1I3RB 4JFPB 1S5IH 3L3JA 1CFVL 3PNWB 4NO2A 3QDME 3MLTA 1RZKL 4L9DA 1QSEB 1BLNB 1CIUA 4UTBL 2D7NA 3RJDA 1ZWIB 2PTTA 3OKKA 2W0PA 1EHXA 1T0MB 3LN4A 4Y5VC 4TNWK 5ELIA 3TBSA 3BAEL 5DTFA 5L9DH 5TFSH 3K46A 1M1SA 3FQWA 5EZOH 4R26H 5L2KD 1I9JL 1GH7A 3UBXA 3GHBL 4OD2B 5E00B 1IQDB 4N9GB 3WO3B 5DGQA 3WSQL 3IJHA 5D4QA 3TH2T 1J10A 2HTKC 5C08B 3TVMB 4KJYB 1JFQL 1ZVSB 4WHTA 3FQXB 5ESVA 3DXAA 4C4KO 2DL9A 1OM3L 2I60H 1TCMA 4L1DA 1TXKA 3OKOA 4MQSB 2YPKA 4NKDA 5EG6C 3NABH 3CXHJ 1DANT 4I3SL 2C26A 1T1ZA 5A3ID 1RJZA 4MS8D 3MBXH 1A1OB 1IVLA 2BJMH 1EK3A 4NO0A 2ATPB 3ZKNC 2H9GA 5F7HA 5H8DA 5C0EB 4U1SA 3C5ZD 3ARDD 1HQRA 4Z8FH 3WIHH 3GSOB 4J23A 1RZ8A 3TBVB 2OTPA 3BP6A 1EXUB 3MJ9L 5D7IF 1J11A 4PRIA 3ZYIA 4QYOB 3GGWB 1FRGH 5EO9A 3QXDB 4G80B 4OZ4A 5DD3L 4QHLB 4WFHE 4NRXB 2ZCKL 4G9DB 3PGDB 3DX6B 4Z7VA 1ACYH 4IDJL 5GS1A 4M6OL 4JFFA 2P5ED 3H9SA 1FP5A 4HQQH 1YN7B 5L0QB 4M43L 5FAAA 5B8CA 1TJGH 2DJSA 2PTVA 5E6IB 4F15C 3TCLA 4ORZC 5J06A 3EGSA 3B6SB 4UU9B 1F6AB 4OKVB 3T65A 4L3EA 1VFUA 1NEZG 3VFMA 2MHAB 5K9QI 5SWQB 3T4AB 2DKSA 4DQOH 3ZYZA 2Y06H 5F9AC 2V7NB 1PY9A 1KTKE 4LCWE 2WMPA 3CLEL 1P6FA 3V4VH 5EUOF 3EYQC 5F3HB 3R8BB 1LGVA 3KJ6H 5DK0A 5FHAH 3C6SB 4LDEB 3ARYA 2V5MA 4PTUB 3MYJA 5ICXB 2E27H 3MSPA 1UACH 4Y2DC 1AHWC 3P11H 3V52H 2R23B 5KS9E 5J89A 2FEEI 4XC1H 3IRZA 3D9AH 5BV7H 1OSZA 1K5NB 1JV5A 3PGCA 2X1QA 3MLXL 3JV6B 4ZPTB 1FZJB 3VXMA 3D18B 1DDHA 3L9RB 5E4EB 1J1OL 4RMQA 3RPIA 4FOMA 4QRUA 5I18H 3DI3B 1A6VL 2EIDA 4G8GD 4WU5B 2WNGA 4DJMA 3VD4A 2XKNB 1OQOA 2AV1B 2B4CL 4GJTB 3NFSL 4TNVK 5EC2A 2DQTL 2H26A 3OKEB 4GXUN 3X14B 1LEKA 3QHZL 1MFAH 1A7PH 4LPVA 1T3FA 2X4PA 1TLKA 3N85L 4XPGL 3L3OA 2BHUA 2BVPB 4ODTL 1CICC 1S3KH 3FB6B 5DJ8B 3SGEH 1A47A 2JK5B 1T0NB 4LKCB 4XPAH 4O58L 4DFIA 1IL1A 4PJHA 4R3SA 3U7AA 1HYSD 2EH8L 2X09A 4F7EB 2MCG1 2ID5A 1YUHA 2WINA 4ZUSA 3C87A 4LDOB 5D5MA 4QRSB 1UT9A 3P4OB 5CJQL 1ZA3A 3FO0H 1IMHC 1GZPA 3DHMA 4XBGA 1ZSDB 2B5IB 2Q7YB 2NY0B 3OV6A 1F3JB 3HNTH 1B6DA 3MV7B 4YAQB 4K23L 3BHBA 2VXVH 1LO3L 1YY9C 1A6ZB 5INCB 3UZEA 3S97C 3WLWD 3FO1A 2FHCA 4NQCA 4Z0BL 1XF1A 2GJZB 1J1XH 3HLAA 5JXEA 2OQJB 5HDQL 1WFTA 2DN7A 3C8DA 4OCYH 4JAMB 4JPVL 2OMNA 5JO5A 4RAHA 4XWOD 2ZPKL 3T2QA 4RQQB 4TTDD 3WBDA 5J12B 4JZJC 3RZCD 1FDLH 2VDML 1QSED 3I75A 1QKZH 4M1DL 4AL8L 1RZIB 1JNLH 3N1GC 1CVRA 5TQ2H 4HGWB 4WW2A 1UQSB 1UH2A 4JN1H 3JV5A 3VW3L 1ORQA 2WUBH 4I48B 2A9NH 3RWIA 1T83A 3NA4A 2UZIL 4LLQB 5MHSE 5FECB 2X89D 1DANU 4HCRL 2CKBH 5EORL 1JGEA 1OLLA 3L5WB 3CMOL 2R1WA 1UENA 3QNYA 1DBBL 3DVNA 4F7PB 3GFUA 4PJ9B 2FNBA 3CFDB 4PREB 4Z77A 5KS9F 1G9MC 4JPWL 4CNIA 5DJYA 3S34L 3K8LA 4ZO6A 4FQCL 3UYRH 3PHSA 5HHQB 5E8EB 4OJFH 1KN2H 2JCCB 4ZO8A 5EU4A 3VFUB 4M6MH 1F3RB 1MPAH 5HHXL 5I76B 4M93B 4K3JL 5JQ6H 5E70A 4XP5H 3FB5B 5FYJH 5HDOA 4K7PY 3DRTB 4MCYB 1ZT1B 2DQEL 1A5FH 3SGDH 4GG6B 3EDFA 2VLRA 3C5SB 4Q2ZA 4GW1A 5FYJE 1DLFH 1RMFL 4PJDB 1DUYA 3FKUS 3VXUA 2DLHA 4AH2A 1MI5B 3WHXA 3I2CL 4U1KA 1ZE3C 2DBLL 3GIVB 1U6AH 1VGEL 5HJ3B 5KSAB 1A9BB 1CR9H 2AABH 2EE3A 5E6ID 3IS0X 1I9IL 4XCNA 5GGTA 4IEFB 4LSPH 3EO1A 1VERA 3MRBA 1XIWC 2QKIA 2VN4A 1GJIA 2XZCL 2IC2A 3PL6B 1S7UB 4Y4KC 1A6TA 4DGIH 2VABB 3QDAA 2BVOA 3JVGC 3U7YH 3P4LA 2FWOB 3L3DA 5F88A 5CCKL 2DM3A 4ZFGH 1KCSH 1O5DT 5IROC 2IFFH 4AY0A 1XF4B 1T21A 3S7GA 2VDLH 4U0RC 2NTSP 2J8UB 1T2JA 3O6KH 2FRGP 3T0VA 3NGBB 2ADGB 3BGAA 3ZT5A 5J13C 2IH1A 3QUZA 3BP4A 2AJXH 3DUUB 5IB1B 2DQIL 3HC0B 5ADPL 1J18A 1TZIB 1XGRA 2J6EH 4NKOB 3PHOA 5B4MC 2DMBA 1FC1A 4WEMB 3QCTH 4X80H 4DGYL 1NMCC 1DSFL 1KSRA 1YEFH 1CLZL 3TT1L 4X9BA 3VH8B 4B41A 2EXWC 1H8SA 3MR9B 1KCVH 3HN3A 5D2NE 1FJ1B 4LLVA 4Y4HC 2XTJC 1HHHB 5IBLC 4MJ2A 1B4JL 1J05A 2A6IA 3JWOC 3QEGL 3CJJA 4OTXL 4LSVL 1ROWA 3FO2A 2XKUA 4JEGB 4FQIH 2M1KA 3NCBB 3FMGL 1GHFH 4KQ3L 1QNZH 3IAGC 3G04B 4ZUVB 1ZT4B 5I1EL 4KROB 1J12A 5K93A 1NAMH 1MIML 1P53A 2ZUQB 5IOPA 2D3VA 4RMRA 2XWJB 4LL9A 4CVZA 3QZWB 4LVEA 2UY6A 4Z95L 3O8XA 1RVFH 4GAYA 4AMKH 2VLJA 4LF3A 3W2DL 4R4BA 3UMTA 3RDTA 1SM3L 3QIWA 1PLGH 5C0ND 4P2QE 2YUXA 4WTWA 3DO7A 3TNNA 5IVXB 4KKLC 3MGAA 1U58B 4HUVA 2MQ0A 4JY6B 3QP3A 3RL1A 5GGSY 2NY0D 2YHGA 3WDJA 2X5PA 1MWAA 3BAEH 4BUGA 1T7YA 3S4SA 3LV3B 1MNUH 4QCIA 2VDPL 3ULUF 4OQTL 3OGCB 1IGCH 3LOWA 4KJWD 4MXVE 4RGMB 4P49A 4P5TC 5FCUL 3QSKB 3H0TA 3VFGL 1JFQH 1GGYA 5DWUL 1B0RB 4OLXL 4P2OA 2AGJL 2D9CA 5JMOC 4KTEH 4CGTA 3VA2C 1JWUB 3O3AB 1J8HB 3MCKA 3CFBB 1X5LA 4R7NA 5E95B 1NJ9B 1QO3B 1FO0L 5ISZE 1MCOL 2WAHA 4IJ3B 3BEVB 5C0BB 3RPKA 2V7HB 5BZDA 4PJ7E 5HPMB 3QFDB 2ARWA 12E8L 1J88A 4FP8L 4HFWA 5C86A 3RVTC 1MEXL 32C2A 3KYKL 4OB5H 5C0AA 1QACA 3CFCL 2BNRE 2D0FA 3RNKB 3VRIA 2IQAB 1AC0A 3ZTJH 3HPLB 4MSWA 5FYKE 4L9LC 1U2CA 2H2SD 5F7KC 2MQCA 4IDJH 4PFEA 2ED8A 4TVPL 4GSDL 1LO2H 5F21B 3THML 3ZDXE 3GMLB 1P4IL 3C08H 1U91A 2A74B 4M43H 2FR4A 1T1WB 4ONHB 4YFLF 3D3VA 5E8PB 4DUWA 4WI6A 4PJ9D 1RJYB 3IFNL 2HJFB 3IF1B 4MB3A 4URTB 2NY2B 1OAXL 1OTSC 3HE7B 3SKOA 5F3BA 2LV4A 4OCRL 6FABH 1YEKH 4I0PB 5SWSE 2Y4SA 3OAYK 5IIEB 4L8BB 3LKSA 1A3LL 3VI4E 4I13B 43C9B 3I02B 5CLWA 4YH6A 5SWZE 1IKFL 1S7SA 1MCIA 1L0XA 1K8IA 5HDBE 2E6JA 1GZQB 3TO4B 1LP9B 5LGKA 3MCLH 5CZKA 5IB5B 4XNZB 4HC1L 3ZO0A 2PXYA 4DKEL 3ALPA 3P77B 5JHDE 4R0LB 3ILPA 3ARUA 3KXFB 1CGSH 1U8QB 4HS6B 4YXLH 2UUDK 1U95B 1MI5D 4TSCH 4MYWB 5ID1A 3VCLA 2ITCA 2XN9A 3EDKA 5KSAD 2OR9L 2J7LA 5B21A 2NY1B 5CZVH 1DBKL 3ZKQD 4M7JL 3DX9B 5AYUL 2C1OB 2X1PA 3AB0C 3BKCL 3KR3L 3HMWH 3KLDA 3D0VB 1RAMA 5FKPB 3QAZB 2VUYA 4PPTA 1FNSL 4D3CH 4NCC2 3PL6D 4LCIH 3O2VL 5ERWA 3MLTB 2FB4L 2GSIA 3X3FH 1E4KC 4KGJA 3ARFB 1CU4H 4BSWA 4PJAE 3TBSB 2B4CH 5ANMA 3PWPE 5C7XH 5D7JC 3KS0H 3MXWL 4D9RD 3LH2L 4MNQA 5JW5A 3W5NA 5DS8A 3UBXB 2AV7A 2P46B 1INQB 5ICYB 3BH9A 4GW5B 3QHZH 2QR0A 1FQ9C 3V6BR 5BV7C 3VMOA 4XAKE 2QEJA 3TZVA 4WI8A 4U7MA 4WHTB 3SDXE 1M7IA 1A1NA 5F7LB 3DXAB 4UIMB 1MAKA 5DJ0A 4LSUH 3I9GH 3QXUA 1LK2A 5F44A 5TE7L 3OKOB 5EZLB 2ZUTA 4MD5A 4XCYB 1JK8B 2E7LC 4BYHA 5DQDL 1ZGLM 1T1ZB 1RJZB 1XF3A 4EUPH 4O9HH 4DZ8A 3LQAH 4NO0B 2H9GB 3PP3K 3P0VL 1INEH 5HD8C 3BZEB 2DOCA 1M7DB 4HUMB 4IMKA 4N0CD 3RBGA 4PJ7F 1TNMA 1BFSA 1DFBH 2OS7A 3A67L 1EO8L 1BBDH 2XZZA 4PJ8A 5EO9B 4Y16C 2P1YA 1LQSR 4DGVH 1P9MC 5I2IA 3EYOA 3V6ZB 1LO3H 4Z7VB 5CJOL 4HK3N 4ODSH 1TPXC 4BSJA 5GS1B 4KI5E 3SDYH 5KZCB 1I9RH 3KYNA 2VZ1A 4M02A 4KROD 5GGRB 2DQFA 5IFHL 2EDJA 5HDQH 2P45B 5B8CB 4D0CA 4HLZH 2YWYA 3OB8A 3TCLB 3ZDXF 4PRDA 3EGSB 4QNPE 1ERNA 4L3EB 3F7QA 3VFMB 3FN0H 3Q1SL 4OCXL 5HY9A 4P2CG 2GJ6E 1K2DA 4CU6A 3ZHLA 1JGLH 5EIIA 4DK6A 2R39A 2X4RA 4LEXL 5EZJA 2EYSA 1NBVL 3MODL 4YX2L 2MKWA 5DK0B 2C4XA 3VI4F 3O41A 5EC1A 1YEIL 1JZ6A 4WFEE 3MYJB 4HJGA 4ZNCD 1QRKA 2HFTA 4OLUH 2Q20A 3ARBA 4K8RD 5HDBF 5K9JH 1S9XA 4R6UA 5DQ9B 1N59A 1P5VA 3D69A 3CMOH 4CUCA 4MNGE 2CPCA 3Q5YA 1XGPA 5KN5A 2OR7A 3HFML 1J8HD 4LPXA 5GHWH 1ZVYA 3S34H 1OSZB 1JV5B 3PGCB 2EH7L 3VXMB 1DDHB 1MFNA 3P30L 5DMJB 2FBOJ 1MOEA 4QRUB 1OD7A 5TPWH 5HVFB 3WFDL 1A0QH 4JCMA 4WIQA 3IDXH 2E9WA 4K3JH 1V3KA 4X6DE 2YOCA 4GXVL 5HI3D 3G5YA 2H26B 3HB3D 1QG3A 2ZG1A 5DJCA 4XTRC 5CSBA 2BMKB 3KLAA 3V4PL 4F37K 1I7UA 3KPPA 3SGKC 1LEKB 4XXCA 4PJAF 2BY2A 1KUMA 5AWNH 3F62A 4PP1C 1RMFH 4O51A 1N8ZA 3TCXA 4YDIH 1T3FB 2X4PB 4PRPA 5FYLL 4W6YB 4J3TA 2DBLH 5GZOC 2XYCA 3LHPL 1CL7H 1H9VA 2B1HL 3SGJC 1IL1B 4PJHB 2P49B 4R3SB 3SDXF 1DE4A 4PJIB 4J4PA 3STZB 2NY2D 3CXDL 4P4RA 4NDMA 1YUHB 4I0PD 2WINB 4ZUSB 5D5MB 3IDYC 4P99A 2W0KA 3MRMA 3QRGH 4ZYKA 1R3IL 2F53B 1GZPB 1QBML 5E99L 5FKAB 4BK4A 3HAEA 1BFVL 4Q6IA 2Q86B 5L2KE 3RVXC 5CEYA 4V2CB 4CMHB 2MCPL 1RK0A 1WLHA 3A0OA 4Z78B 5CCKH 4O2CA 2EXYD 3BHBB 4K71B 5DRZA 1L0YA 1WEJL 3FO1B 2X7LA 4NQCB 3KXFD 4X6CA 3HLAB 4P2RD 1XGQA 2CLZA 1CFNA 2DQIH 4KI5F 4POYA 1T89C 4ZXBC 5GISH 3QHFH 5DZLA 4ZFFB 4NN5B 4HPYH 4NN7B 3O2WL 1JI2A 3K1KC 1TTFA 4MA1C 4CAGA 4QNPF 3I75B 4I2XE 2D31A 1R5WA 1KLGA 2YPVL 1BD2A 1B4JH 1FC2D 4JZOA 1ORQB 4OUOA 2FJHA 3RWIB 1E6OL 3FMGH 4YDJA 5D7SH 1RI8A 5TE6L 4X4MA 1BBJA 3RGVA 1ZLWK 2R4SH 2DRUA 2VE6A 3DSFL 1RK1A 1IGMH 1G1CA 2DQJH 2SEBA 1MJUH 2R1WB 3DXAD 3MOBH 3QNYB 4CDHA 1KCLA 2EDNA 2IANB 2A1WL 5E56A 3WNLA 1EEYA 4Z77B 5GZND 1EDQA 2CDGA 1PEWA 1VFBA 5DJYB 4CNIB 1PQZA 1Q0XL 2ED7A 1KIQA 2VH5L 3O9WA 1JI1A 2WWMC 2NXZC 5DMIL 4NO0D 4U6XA 5FGCE 1WC7A 1G7HA 4S0SD 5EU4B 3VXTB 3KNBB 4XC3L 5KVDL 4PRID 2VDQL 3JTSA 1QBLL 3RAJL 2BC4B 3GMNA 5JA9A 1LE5A 3CSYA 2F8OA 1WBYB 5B3JE 4RGNB 4LSDA 5MI0B 3SKJH 2HTLC 2EO1A 4ZS6D 4Q2ZB 4R2GB 2UZXB 2H32A 4GW1B 1MIEH 3U4AA 4L5FH 3RVUC 3VXUB 5HHPA 5KZCD 1DUYB 1A1MA 4AH2B 3H9SD 3WHXB 3RWCB 3HI5H 2GT9B 2C5DC 4GRLB 4JG1L 5BS0B 2Z31B 2IH3A 5JHLL 3ZYOA 2BY1A 5I17B 4XCNB 3ARGC 3G5ZA 3RJQB 3TF7C 1Z3GH 1UZ6E 3MRBB 4L3ED 2QKIB 3QBTB 4U1LA 1L9MA 3P4MA 3IAQA 3BH8A 4UIKL 1CXHA 4DKFL 4MD0A 4N1CA 2CUIA 1A6TB 4G8GE 1UM5H 5FGBA 1S5HB 3EW3B 4HBCH 3O3EA 2D7TH 1JWMA 5L6YL 4HMEA 4BFIB 3WNKA 5KANG 3L3DB 5F88B 4EI5C 2W91A 3PJSA 3DJ9A 1FL5B 4UT7L 3OXRA 3OPZH 5KSBE 4PYHA 3QG7L 5D70H 2CIIB 1X5IA 1EEQA 5FM5O 3THMH 1UGNA 3OMZA 3GSNL 3VGHA 5H37H 1O7SA 4UNVA 1JGUL 1XGRB 4ZFOL 3PHOB 2NY5L 4PLKD 1OARL 4HZLA 1IC1A 1NDMB 4HIEA 3SCMB 5BQ7A 2P4AB 4BA8A 2A9MH 4YHNB 1YPZE 3T3PE 4KY1L 3SDCA 4MAYC 3VXMD 1A3LH 3WMSA 1CD1A 2ZUVA 4YUEL 3WDIA 4LLVB 2ZCHH 3RBSA 5DVKA 4DW2H 1J05B 1QFOA 5KG9B 1HEZA 3BJ91 3FO2B 5EBMB 2CUHA 2HT2C 4Q97A 7FABL 3BPNC 4DKEH 4HGMA 5IB2A 5DUPL 4GAFB 4NUGH 3ZE0E 1TETL 1U3HC 4YHIA 4QOKA 4FA8A 4RFNC 3EYSH 5DUML 5GGSA 3W0WA 3UO1H 4S1DD 5AZ2L 2EDHA 3SQOL 1X9QA 3KR3H 1P5UA 3RDTB 2VXQH 1G7MA 4M7LH 1KNOA 3DIFA 4XP1L 3GI9L 4PGDA 5IQ9A 3C60A 1WTGT 4M7ZB 5I1KL 1WZMA 4X9HA 3DO7B 1QSEE 4FFWC 4V1DA 2XFXB 3ZE1E 1C8PA 3O11A 3RL1B 4ZD3H 5J4MA 4Q74A 3Q6GL 3QIUC 1TZGH 1M71A 1MWAB 1TVHB 4M5YH 3LH2H 4Y19B 3V2AR 1GYAA 3BEWA 2DM7A 3S4SB 2P7TA 4J3OC 1Q94B 2Y9RT 4GRWB 1H0DB 2J5LB 3H0TB 4NQCD 2WUCL 5B3JF 2VC2L 2C7UA 4MXWL 2X1XR 2Z91A 5JXED 1CF8H 3AUVA 2V5SA 4X99A 1R5VA 3MCKB 4Y1AB 2YRPA 1FNEA 5C6TH 4R7NB 1ETZA 1X44A 2B4CC 2DLGA 2VNCA 5BZDB 2FEDC 1DL7L 1B0GA 4G42A 1UZ6F 5FOBA 4HFWB 1FN4B 3Q0HA 3QUXC 4JJ5A 3V8OA 1ITCA 32C2B 5CIPH 3GSQB 5BVPL 3HE6B 4Q9QL 2EKJA 1K9TA 1T5WA 4XPBH 3O2DA 4EQ2A 3V7MA 4MSWB 1T03L 1RUMH 1MCJA 1YY8A 2DLFL 5BJTA 5DEFA 1T20A 3DLQR 3LQAC 5IFHH 4XNYH 1U91B 5KSBF 1BOGA 4FQ2L 1CBVL 1OAZH 4XP9L 5F9OH 4JY5H 2D2OA 1JHLH 3IVKA 3PP4L 1FBIH 4ZO7A 3VXPA 2R0ZH 1QA9A 3D1MC 3WUZA 3T0XA 1OL0A 3W81A 1J0JA 3GMMA 3LKSB 4KI5C 4U1NA 3ZTJG 2ZOKA 4P9MH 1IE5A 1Y0LA 2HFGL 4G6ML 2ICWA 1YPZF 2KUTA 3T3PF 4L3CA 25C8L 5T1DL 1KB5A 3DV4A 3WHE0 3LDBC 4TPRL 4GMTL 1YEIH 1K8IB 1PGRB 4RGND 5DMKA 5FO7A 1Y18B 4BH8B 4YXHL 5IWLC 2PXYB 3O3DA 4R2GD 3VXUD 1DQMH 2CD0A 4JFEB 1AXSB 3EUUA 4YXKL 1I7RA 5ID1B 4DVRL 1J0YA 4E41B 3SDDA 4C58B 3VCLB 2ITCB 2XN9B 4JO2H 3TN0A 4HGKC 4AG4H 4JFHD 3HFMH 2MNUA 4W70A 5IB4A 4XP4L 5GS0D 3NPSB 1NKRA 1MUJB 5J3HC 2W0FA 5A2KH 3I85A 5ERWB 3KPNA 4WW1A 5KBNC 2DWEB 2GSIB 4BZ1L 5FGSA 4QHNA 4WO4C 3PQYB 5F9DC 5IVOA 4BSWB 3X17A 5GRWA 1MCLA 4IRZL 1XGYL 5JW5B 5DS8B 1Q9LA 1HH6B 2ZG3A 1AY1H 2AV7B 5H94B 5CBEA 1K85A 1IGYA 5B22A 3BH9B 4H1LH 2GSGA 2QR0B 3CAFA 3L1OH 1JPTL 1BIHA 3ESVF 3HG1A 4Y5YC 4W68A 4RGOL 3TZVB 4G8FB 1WQVT 1M7IB 1A1NB 1NSNH 3D39A 5IKCA 3QUZD 2W0LA 4HUUA 2KPNA 4IRJA 3GMQB 3MLVL 5F1IB 3FQNA 4BQBA 3IAPA 1XF3B 3CXDH 4H88H 4DZ8B 1UWXH 1HH9A 1QEWA 2DM2A 2GI7A 2OJZL 4WTZA 4G5ZH 1P2CA 1H3TA 2PN5A 3BPOC 4JRYB 3CU7A 3ORJA 3SEPA 4XNXL 2GFBA 4N5UA 5FO9A 1OTTC 2EDBA 3MV7E 2A83A 4PJ8B 3O6ML 4G7YH 4YEFA 2F8VA 3QDMA 5I2IB 3EYOB 3RQ3A 4RWHA 4MA3B 2A6DA 4XT1C 1E6JH 5GRVK 1KIPA 2D9QB 2J4WL 3KYNB 4EUPG 2GTZA 1C16A 1FCGA 1HKLH 4YGAB 4A6YA 5JDJA 1RSFA 2BHYA 3W39A 5IG7A 1T80A 4D0CB 3O8XD 1MRCL 1Q8MA 1CE1L 1MREL 1JF5A 3O81A 5FIEA 4PRDB 1SJHA 3RDTD 4N9OB 4X5LA 3QHTC 3QIWD 5BOZG 4F2MA 1K2DB 3AY4C 3QXAA 4G8EA 4XAWL 2NQCA 4RWYH 1RURL 3DETD 3IDMA 35C8H 5E2UH 2X4RB 4C55A 4PGBB 5EZJB 3MZTA 1PYWA 4TUOA 5A3IC 3KG5A 3MLRL 4MS8C 4X83A 2PO6A 4J8RB 2QBWA 3U0TA 5EBGA 2MOVA 3CC5B 4HUWA 4YEEA 1WISA 3C5ZC 4HJGB 5TE6H 4HLZG 4KHTL 3ARDC 4IHOB 3DSFH 3MBEA 3ARBB 3I84A 1S9XB 2G5RA 1S9WB 4LIQL 1N59B 3D69B 1OGTA 3HMXL 3ILQD 5E8DH 2XICA 4P46B 4P2OD 4I18B 1N64H 5EA0H 2C3VB 4O2FB 1EGJH 5CEXA 5I16B 2G60H 1WWCA 1HSAB 1IFHH 5I1HL 1F6LL 4GAJL 2X9XA 2IBGA 2JCCE 3VGGA 3L7FA 4FHBD 4GQ9H 4JO3H 1J86A 1J9CT 5C0AD 3WN5A 5KVEH 3L5IA 4S1RH 3BISA 4U0QB 1JUFA 4CJ0A 3I6KB 4OCWL 1U3YA 4GG6E 3C09C 1U36A 1I7UB 2ADIB 5TGBA 3LKNB 3FO9A 3B83A 4PJDE 1FG2B 3U0WH 4NQEB 1MI5E 1N8ZB 4O51B 2Y1VA 4RRPA 4OLVH 1VKXA 4JVUA 5J0BA 1A7QH 2EC9U 3L5JA 3D3VD 1AC6A 3GJEA 5EUKA 5F7MC 1FFPA 4IMLB 1D6EA 4X6FA 5C0RL 3S36H 1A4KA 1DE4B 2QSCL 1ZK9A 4S1SL 4P4RB 1GXEA 4NDMB 1UA6L 2P44B 3MRMB 5CD5D 4WTXA 5L88H 3HAEB 4Q6IB 4D9RE 1NGPL 1DQQA 1CDYA 2R4RL 4M9PA 2D0HA 1RK0B 4O2CB 3QI9A 3OG6B 1IC5L 4EJ1C 5DRZB 3QG7H 4PG9A 4JM4H 2PXYD 3S88L 2J8UE 1CQKA 2OZ4A 3WFBH 2X7LB 5I15L 3F12B 4EN3A 2AJZA 4X6CB 3MRLA 4CN6A 5DQJB 1XGQB 2CLZB 1UH3A 1CFNB 1AGEB 2XN9D 4W4OA 1WAAA 2NY5H 1VEOA 2CDEA 3FONA 4MJIA 4NT6A 3U4EA 2V9QA 2VWEC 3UTQB 1FZMB 3QO1A 3IETB 3K7UA 3MMEA 2GK0A 5I1AB 4RISH 1GGCL 2VZOA 1EO7A 3QNZA 1VGKA 2D31B 5I19H 4QHUA 1R5WB 3PQYD 1D5MA 1KLGB 1BD2B 4JZOB 1HYSC 5F8QC 3VG0L 1CGVA 4ZUWA 4WENB 1C5CL 1MJ8H 3QPQD 4YDJB 1MQKL 4M7KL 1BBJB 3RGVB 7FABH 2UZYB 2BFVL 3CSGA 2IADA 1RK1B 4OF6A 3TZVD 1UH4A 1TETH 3L3IA 2IPKA 1N26A 1R0AL 2GYSA 1U92B 1WSST 3RL2A 3CD4A 1B0WA 5E5UB 3MROA 4HEME 5F97E 4HS8L 3VGAC 1VFBB 1PQZB 3GI9H 3WLWC 3O9WB 3LZFL 2NZ9D 5IVXE 5E5MA 1R5IA 4U6XB 2DKUA 1G7HB 2W9DL 3K8MA 3K3QA 2JCCF 1A7RH 4ACPA 3Q6GH 3AS0A 3JTSB 4XWOC 1MAML 1FNHA 3GMNB 4PJ8D 3BZDA 1LE5B 4TTDC 4EKXA 4Y5XB 5DK2A 2AEPL 5DXWA 4QRPA 4Z0XA 4HMCA 3RZCC 3IT8D 2MSPA 2V17L 4NFCA 3TH3T 1G6RB 2F5BH 2H32B 4QGYA 3CCHA 4WEUD 3LMJL 5HHPB 1X5XA 4GG6F 1A1MB 1XH3A 5DHYA 5GS0L 3T77B 4G3YH 4LMQE 3QJFB 3DYOA 1KELH 4PJDF 4DN3H 4U33A 2IH3B 3GBLA 1J8HE 3BOVA 1BECA 1RZ7L 3NCJL 3VA6A 4APQB 2Q8BL 2IAMA