4Y5VC

Diabody 305 complex with epor
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
215
structure length
206
Chain Sequence
b'PKFESKAALLAARGPEELLCFTERLEDLVCFWEEAPGQYSFSYQLEDEPWKLCRLHQAPTAGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGQGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords diabody 305 VH domain
publication title Tuning Cytokine Receptor Signaling by Re-orienting Dimer Geometry with Surrogate Ligands.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/immune system
total genus 40
structure length 206
sequence length 215
chains with identical sequence F, I
ec nomenclature
pdb deposition date 2015-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00041 fn3 Fibronectin type III domain
C PF09067 EpoR_lig-bind Erythropoietin receptor, ligand binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y5vC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y5vC01
3OAYH 4PGBA 2R56L 4QHNA 2C1OB 4JHAH 1JTOA 2R2EA 4Z7WB 3EDEA 4HJGB 5IMOB 3ARPA 1EIBA 5IW3A 5D7LB 4OZGE 3O6FB 3CUPA 5IM7A 4ZXBD 2D3VA 4ZUWA 5IW6A 1CK0L 2VAAB 4LLUB 2HH0H 2DWEB 1IBGH 5IVXB 3TIEA 5C0EA 4AMKL 4G8EB 4Q0XH 5T1LA 4Z7VF 3UTSA 5DUPL 1PG7W 1QFHA 4ZNCD 2C1OA 4XP1L 5HSFA 5HDOA 4RISL 1J0YA 4H1LB 2B20A 4W6YB 1EAJA 3GK8H 5IMOA 5D7LA 3Q6FB 4OM0H 3QUKA 3L5WB 1FCGA 2MFNA 2VLRD 3O6FA 4XB8A 3QHFL 1R3LB 4NN6B 1ORSB 3V9FA 3BPOB 4JM2B 2VAAA 2DWEA 3O3EB 4DUXA 5IVXA 2FHBA 3A0OA 2FWOB 4UAOB 3MNVB 4G8EA 1GIGH 2PKDA 2NY6B 3BZFB 1M71B 4LHJB 1EO8H 1N0LA 3FCTB 4RFEB 2VABB 1IM3B 2J8UB 1IVLA 4MJ2A 5J3HD 4X5LA 1VGEH 2B4CL 3O2VL 4H1LA 1BFTA 2OJEA 2VLKB 3QCUH 5DI8B 3IKKA 5FO8B 3Q6FA 3L5WA 2D4DA 4R2GD 3IS1X 1A47A 1ORSA 4JM2A 2JJTC 2OL3H 2YEZB 3O3EA 3DXAD 3TJHD 4J23A 1FGVH 4LDLB 1C8PA 5ESAB 2FWOA 1H3WM 2VKXA 2CUMA 1E4JA 3O8XC 1KC5L 1XF3B 3QB7C 3BZFA 1M71A 5FYLD 3MJ9H 4LAQL 1WIOA 3FCTA 3GRWA 1CFVH 3GBNH 2VABA 1IM3A 5DJAB 1MAJA 2J8UA 5HHMB 1CGSH 3TZVB 2XZCL 5CWSB 3VFMB 2EE6A 4TTDD 4R8WH 4C58B 1E4XI 2VLKA 4P3DB 5DI8A 4Y4FD 3VWJD 4LLYB 3LH2L 5DVOA 3RGVB 5ADPL 4KTDL 4E41D 5I1GL 4EBQH 2XICA 3D85B 5ESAA 1J1OH 4JFOB 1BQUA 2SEBB 2HG5B 5B39G 1GOFA 1XF3A 2DBJA 3C87A 1U3ZA 2V7NB 3OBAA 5ID1B 5DJAA 1K4DB 1R3JB 4QKXB 3TZVA 5CWSA 5DYOB 3VFMA 2JJVA 5C2BL 2EIBA 3DWTA 3SDYH 1UB6B 4P3DA 1BQSA 5F7NC 3ARBD 1D5IL 2H32H 2ZUQB 3QDGB 4X4ME 3G6JF 5IQ7L 3TT1L 1UJTA 4LLYA 5KANG 3RGVA 4EN3C 3KG5A 3KPSE 4MCYB 3T65B 3QWOB 3ZSSA 1IGJB 3D85A 4F33B 4JY5H 5HHVH 2YXFA 3LKPB 4JFOA 2SEBA 2FH8A 1TQCC 2HG5A 2YPLD 2Z8SA 3HI6L 2V7NA 2AP2A 4M4PA 5ID1A 1YPZE 1K4DA 3NGBC 1R3JA 2X1OA 3PGFH 5B22A 3CZJA 5DYOA 5AZEH 3KLHC 1GGUA 2ATKB 3GJEB 4M1CC 3WDJA 2BDNH 2AEWA 3QDGA 4HIXL 3D3VB 4UTAH 4OZGF 3LDBC 4N90E 1ZKAA 3T65A 3T77B 4MCYA 3MRKB 3QWOA 1CZ8H 2RIKA 1YEIH 1IGJA 2ESVE 3PNWA 4WFHD 2E7LC 1OAYL 1YEGL 3FQWB 4S1RH 2JJWA 3QI9B 4N8VG 5D72H 5FUOL 3LKPA 2Y4SA 1HWHB 2D03L 3UJIL 3QXAB 4KVNH 4N0CC 1G9EA 1MCOH 1FO0L 1XIWD 5JR1H 2YD1A 1CGWA 1BJ1J 2NR6D 2IQ9H 1GSMA 1OPGH 1TCRB 3LSOB 4GAYB 4LU5H 1RZFH 3S4SG 2ATKA 3GJEA 4LEXH 5AG9A 3UXFA 2DQHH 1F42A 3D3VA 5E4IA 4DKDC 2D2OA 3QCTL 3MRKA 1TNNA 4NC1C 1ORQB 1MJUL 2RJMA 3FQWA 3IRPX 4B0MM 5EOTB 2ED9A 5E9DB 2F15A 3ELAT 2DL2A 3RWGA 3QXAA 1TZGH 3LMJH 4KK5D 1UWEH 4MGXA 1AXTL 4NZTH 1DVFC 2ZUVA 4YHKH 2R2BB 3K3QA 4C59B 1TCRA 3JUZA 4J3TA 3LSOA 4G43B 4GAYA 3ROLB 4BFBD 1X5AA 3RPIB 4ZFGL 5EWIH 1N4XH 5GGQH 1DQMH 4Q97A 5CGMA 2DKMA 1MFEH 3QG7L 1UZ8A 4LPCA 5KJRH 3IFNL 5H35B 3L3HB 5EG6C 1KJVB 4OIAA 5CKGA 5DA0B 4G6KL 1NMBL 3VD4A 3SGKC 1EHLH 3I3EA 5E24E 1ND0B 2DTMH 4R4BB 2IALB 2BMKB 4CMHB 1JFQL 3O2DL 4L8DB 1CFTB 2J5LB 5EOTA 5E9DA 1LDPL 4XP9H 1WFTA 1K6QH 1A9EB 4D3CL 3BX7C 1NUFA 3SDXB 3TA3C 2OI9C 2R2BA 5IIEB 4NBZB 3NIFF 4G43A 3MRCB 1JPST 2ADIB 1DDHB 3HMWH 2QSCL 1NGPH 5H35A 3L3HA 1KJVA 3SCMC 4BZ2H 2FX9H 3CSGA 5TDPB 5A43C 5IVOA 2MHAA 3N1PC 1ND0A 4MA1B 4MD5B 1FDLH 1GH7A 2BMKA 1MCHA 2AJVH 4L8DA 3EFDL 3BPCB 1CFTA 5GRZA 4P46D 2XZQH 4BH8B 4UQ3B 1OSZB 3P0GB 3QJHB 3GO1H 1IZJA 5I1LB 1A9EA 4CVWA 2Z8WC 4DZBA 3SDXA 2YK1H 5F72S 1JHTA 2VC2H 1RUKL 4LSPH 3T2NH 2A1WH 4EI5B 5IIEA 2W0PA 2APFA 4AM0A 3SY0B 3Q0HA 2ADIA 1IAOB 1DDHA 2GUOB 2XN9B 4MQTB 4NJAL 4HS3B 3UBXI 1XR9B 3OAZH 5BZDB 4NC2B 5GGTH 1UENA 5TDPA 2B2XH 1YEHH 1YNKL 2A38A 2V2XB 4FXGB 2WK2A 4MD5A 5DQDH 3BKYH 3BPCA 1TQBB 3MOQA 3KLSA 3Q3GB 1OSZA 1WZ1L 4N1EA 4UQ3A 3QUYC 5I1LA 2NY1C 4LHUB 4FQHB 3MLRL 4WEUD 2AXHA 1Q72H 5IK3A 4EI5A 4UB0H 1V3KA 5DUML 3SY0A 1IAOA 1OQOA 1MFDH 2XN9A 4HS3A 4DKFL 2NXZB 3ARTA 1NGZB 1XR9A 5BZDA 1GC1L 4F80A 2VDPL 4XP5L 4OLWH 4PP1C 5JHDD 3M8OL 1JTPA 1TLKA 4OAWB 4R90L 2V2XA 3CNKA 4FXGA 4PJ9B 2DMCA 4FMFA 4J4PC 4M7LT 3P0YL 5F9JB 4LASL 1AJ7H 2EXWC 3JXAA 3Q3GA 4PJAB 1GRWA 2RB8A 5B4MD 4LHUA 1ZVHA 1UADC 4FQHA 2DI7A 3VFSA 2WBJC 3X3FH 5FFLA 1WT5C 1U58B 2YZ8A 4YDJA 4OCRH 2WMPA 4G80B 5GRJL 1NGZA 2IEPA 4LSUL 1D6EB 1T83C 1WISA 3LAFA 3WNNA 2V17L 3NABH 3DTXA 5D9SB 1OTUD 1W72B 2OYPA 4PRHB 4L8BA 3IDIB 3PWPD 4X9FA 4PJ9A 1L0QA 1E27B 4D9RD 4ZO6A 3AM8A 1WUNT 1N64H 4Z76B 5F9JA 3DUSA 2EC9U 4GLRI 1BIIB 1I3GH 4PJAA 4PGZA 4FQ1H 1QO3B 5EZIL 3KJ6L 4XC1L 1QPXA 1GGCL 2X4OB 4I0PD 3ZO0A 3LIZL 1U58A 5TE4H 2DD8L 3EHBC 5E6ID 1MRDL 4G80A 2WQ8A 5CUSH 2I27N 2HKHL 1D6EA 5GSVB 5HI5C 4XXDB 5T3ZH 3AROA 3SHSA 3HZMB 1GAFH 2IH3B 4PJ8B 5D9SA 1W72A 4POUB 5FB8B 4PRHA 3IDIA 5AG8A 1ZT7B 4NM4H 1E27A 3OB0K 4Z76A 4DVBB 5J12B 2LVEA 1BIIA 3MLTB 1BBJB 1NBYB 1QO3A 3VA6A 3BGFC 3SDCD 4PRPB 2X4OA 3VWKC 1QR4A 1CGYA 1QLFB 7CGTA 1QP1A 4YAQB 3I9GH 1KV3A 1MNUL 3RU8L 4GW1B 4F9LA 5GSVA 4O2EB 1N2RB 1L4IA 3HZMA 2IH3A 3GI9L 4PJ8A 3C6LB 5FB8A 3U48A 4NRZB 3WKNA 3K2MC 1OAUH 1ZT7A 1I1AB 4CMMB 3A6BH 1EO7A 4DVBA 5D6DA 3MLTA 1BBJA 5B21A 4WO4D 1NBYA 1JRHI 4FQIH 2R2HB 4OCNC 5F9DC 5E6YA 1DBBH 4LK4A 3V6ZB 1QLFA 5MP6L 1BWWA 1KPUB 1KB9J 3BP5B 4YAQA 1W72L 4XNQB 3SKMB 2CJUH 2AJZB 4O2EA 1N2RA 5EZOH 1DN2A 4G6MH 1OSPH 3C6LA 4TVSa 4NRZA 1WIPA 3E0GA 1WTLA 1I1AA 4CMMA 2JF1A 3JWOH 3D39B 5CEYB 3Q1SH 4NFCA 4RAVB 4YXKL 3W0WD 2R2HA 4UILH 2RCSH 2J88H 1FGNH 1RZ8B 3V6ZA 3RIFF 3VE0B 2IG2L 3V5HB 5D71L 5TF1H 4J3OC 4D8PB 1KPUA 3BP5A 4XNQA 1FZKB 4OI9A 3SKMA 3GMOB 1YQVH 4OGAC 5CD5C 2AJZA 3ARGA 4FQXC 4MDIB 1NBVL 4HG4K 12E8L 1E4XL 4M4RA 5EBMB 1AFVH 2ERJC 4TQEH 4OZHB 4EUPG 5KS9B 4JFZL 4NM8L 3WXWH 4S10A 1NCWL 3D39A 3TV3H 5ACZB 1U92B 5CILH 4RAVA 4FFWC 2XT1B 1OTTC 3B83A 5GS0D 1CYGA 5D1ZC 5DJCB 1CDIA 1RZ8A 2XTLA 4P59H 3VE0A 3EYOB 3V5HA 4D8PA 5I1HH 1FZKA 4HK3J 3GMOA 1PLGH 4HCRH 4MDIA 5C8JB 4LVNB 2VH5H 5EBMA 1VKXB 1F3DJ 4PGEB 4XAKE 4FHBD 4MNGB 4OZHA 2XG4A 5KS9A 5HD8D 3GSXB 2MCPL 2DF3A 1R5VA 3MODH 4JKLA 4K71C 3WIFB 1CE1L 4NT6B 5ACZA 1U92A 7FABH 4WW1B 3WS6A 1BJ1H 2X42A 4B7IA 3VXSE 4Z7QE 2AJSL 5JO5B 5DJCA 2YUXA 2ADFL 3BE1L 1K9TA 5SWSE 3VGFA 1CIDA 3KPMB 4WU5B 2L7UA 2HMID 3AVEA 1LO2L 1XAUA 2OR9L 3X17A 5I8OL 5C8JA 1NBQA 1VEMA 1X5LA 1VKXA 1YEFL 2XTJC 3A6CL 4PGEA 3UTZB 1HYRC 1X5IA 4MNGA 5EU6D 1KXTB 3GSXA 5F89B 5DJ2A 1VEPA 1DE4B 3TH2T 3WIFA 4NT6A 2A6KB 4MA3B 5FUOH 4WW1A 3DI3B 4LIQL 1QUNA 2R56H 4Y1AB 1DTUA 3QWRD 3C2SA 5JO5A 3HPJB 4ZAKB 3H9HB 1NFDE 4RZCB 2FX7L 1PZUB 1RZGB 4JFHE 2FX8L 3IJSB 3KPMA 4AT6B 5L2KE 4QOKB 5KVGL 5HI4C 3RVUD 5JOPE 25C8L 4WU5A 3RVWD 1CK0H 2EKSB 3U0WL 3PHSA 2HT3D 3F6IA 1J8HE 4JCMA 5MERB 3UTZA 2CUHA 3DYPA 4AMKH 4BM7A 2BY3A 1NC4B 4NO0A 4NQED 5F89A 3P9MB 4RGMC 3PQYB 5EBGA 4MA3A 1HYSC 1BFVL 2AXGB 2YBRB 3BFOA 5DUPH 4Y1AA 5K59E 4XP1H 3HPJA 4I3SL 4ZAKA 5J6GB 3H9HA 4RZCA 1I7UB 1R24B 4RISH 3MLWL 3H3KA 5FK9B 1AO7D 1TITA 3IJSA 4W6WB 2P8MB 4NO3B 1G7LB 1ZHBB 4WHTB 1KXQE 2EKSA 4NIKB 3VA2C 1KCSL 5MERA 3WO4C 4OF8A 1L9NA 3P9MA 4GKZB 3EDJA 4BK5A 3PQYA 1FAKT 2AK4D 2AXGA 1ERNA 3K80A 4AEIL 4M61B 1G0DA 4O5LL 1PGRB 2X7LB 3P11L 2HT2D 3SOBL 4RSVA 5J6GA 3DETC 4NQSB 1R24A 2B4CH 2YXMA 3O2VH 5CJQH 3B43A 4F15C 5FK9A 4ZD3L 3MLXL 2A83B 2XY2A 1TTGA 5KSUB 4PB9L 2DLGA 2I26N 3HMXA 4I18B 2BOCB 2P8MA 4NO3A 5D1XC 3AC0A 1G7LA 3QDJB 2X41A 1ZHBA 1L0XA 3DECA 4WHTA 2HTLD 1NSNL 2XYCA 5ACMA 4C56D 2DYPD 1IGIL 1KC5H 4TPRH 4QWWC 1CE6B 2X44D 4LRIC 3WUZA 3KR3H 4GKZA 4LAQH 5TJWK 1PBYA 2GK0B 4M61A 2CKBB 2X7LA 1CG9B 1LO5B 1ONQB 4NQSA 4Z18A 2LAAA 2F53D 5E99L 2K3TA 2A83A 4AK1A 4I18A 3KYAA 4XHJC 2BOCA 3QDJA 3LH2H 2UV3A 3VXMB 3S97C 4KTDH 4PBVC 5DR5L 5I1GH 1QFWI 1Q94A 5ALBL 4PJBE 5DZNA 1CE6A 1S9WB 1R5WB 2VDML 2GK0A 1NL0L 2YKLL 5LQBH 2VZTA 2Z35A 2CKBA 1CG9A 1LO5A 4Z7QF 1ONQA 2P5ED 3U7YL 1HXYA 5C2BH 2YD3A 1D5IH 3EBAA 1WAAA 3SE4A 5IQ7H 3TT1H 2NY4D 1T1YB 3VXMA 2P45B 5DGRA 5F8RC 3REWB 3ILQD 3BRFA 3BI9X 4YK4C 1CCZA 1FL3B 1GZQB 1CL7I 3BHBB 1U93B 3GRWH 1G0YR 2AGJL 1S9WA 1R5WA 4KJYB 1UKTA 2NZIA 4WI8A 4PJHE 1VDGA 2JJTA 3NCCB 1NFDF 2F74B 2WUCL 3S3PA 4R26H 1DP0A 4HIXH 2EZ0C 4PFEA 3DRQB 4DOHE 1OAYH 1YEGH 1UACL 4PY7B 3H9SD 1GZQA 3BHBA 1HQRB 4YBLC 3HE7D 5ICXB 4N68A 3GMRB 2CKBL 2D03H 3UJIH 4LKXB 1FO0H 4Z0XB 4KJYA 4BJLA 2H26B 1RV6X 2CDGB 3RIFK 3RVXC 2R1WB 2CQVA 5K59F 2VN4A 3RX8A 1PY9A 2F74A 4ZUVB 3UTTB 5HI3D 3ARDC 1KLGB 5HJ3B 2A6JB 3P4NB 3DRQA 1CGVA 4KQ4L 1T5XA 3NGBB 5DZOA 3VMOA 5E94B 3SBWC 1G9NC 1E28B 4NFDA 2MCG1 4PY7A 1HQRA 5ICXA 3GMRA 4LKXA 1MIML 4Z0XA 1D3CA 1AXTH 1MIEH 1I8KA 2V5MA 3TFKD 5BW7C 2H26A 4U1NB 4P2OD 4WUKL 2CDGA 2R1WA 4ZFGH 3R8QA 2D7NA 3QG7H 2Z31D 3IFNH 4K8RD 2NQCA 1C5BL 4ZUVA 4KDVA 3UTTA 4G6KH 1NMBH 1B0RB 2GJJA 3DVGA 5HJ3A 2HA1A 2A6JA 3P4NA 2VR5A 2Z8VC 1JFQH 3RHWK 3O2DH 1E28A 1AR1D 2O61B 4WEBL 1LDPH 3RY4A 4HEME 3V7MA 4D3CH 4PLNC 3SDDD 4WHYH 1IAII 1JVKA 2EE2A 4GUPA 5I66B 5HDQL 1HHKB 4LPWA 2R4RL 4M9OA 4U1NA 4Q2ZB 3Q5OA 3QFJB 4C54A 1ZV5A 5DD3L 1EMTL 1JRHL 4IOSD 2RR3A 3EZ8A 4QXTB 2QSCH 2OR8A 2W07A 2IF7A 5C09B 4E42A 1E6JL 5EUOF 1B0RA 3QIWC 5GZND 4PTUB 5D2LF 4L4JA 1DVFB 4ERSL 4PG2C 1HILB 3GEWB 3Q2CA 2VQ1B 4LFHG 3EFDH 4N9GB 2O61A 1W0YT 3ULUF 1BD2D 1YNLL 2Y5EA 5DEGB 4QRTB 4HC1L 1RUKH 4KRMB 3T2OA 5I66A 1DN0B 2IBZX 2PUQT 1HHKA 4Q2ZA 3LD8B 3QQNA 3QFJA 5I74C 4NJAH 3CXDH 1E4KC 4QXTA 4JFDB 4V1DD 3FOMB 3MFFB 1UH3A 5C09A 4NUJB 2P8PB 3TA3B 2WQRA 4PTUA 1F3DH 1YNKH 1DVFA 4PJ5E 1UCBL 2VQ1A 4X7CC 5DJYB 4JLRB 1MCBA 1WZ1H 4DCQB 5DEGA 4GW5A 4JPWL 3PGDB 4YUEL 1N6UA 3MLRH 1JK8B 1DN0A 1NMAL 2LTQB 2XKSA 4PJHF 5DUMH 5BV7C 4DKFH 4LARL 4HEPG 1QSZA 2XQYK 5IG7B 2AJUL 2XFXB 1GC1H 4GG6B 3FOMA 2VDPH 4KMQA 4XP5H 5EBWB 3MFFA 3M8OH 4NUJA 3QHZL 4NHCH 2P8PA 4UIMB 1S7SB 3TA3A 3TT3L 4R90H 2VR4A 3ARYA 1F58H 3P0YH 4JLRA 3N1MC 4DCQA 4P48A 4X7FC 1ES0A 3MRJB 3PGDA 5FCUH 1CXLA 1JK8A 4OUOA 1OAQL 4FTVD 5I16B 1I3RB 2E27L 4OJFH 1NGXB 4L9LB 4Q9QL 2FECI 4LF3B 4LSUH 5IG7A 5HXMA 2XFXA 2C9AA 5D70L 3CC5B 4GG6A 1QBLL 2Q76B 5T3ZE 5EBWA 3S34L 2V17H 3BESR 4DN4H 2NY1B 4OIBA 1NGYB 1S7SA 3NOIA 4UIMA 2V9TA 3L6FB 1FNFA 3TN0C 1YEJL 1TVHB 1L0YA 3QT2A 1DQDL 1OAZL 3GB7B 1T0NB 3WJLA 4XTRC 1CFNA 5EZIH 3KJ6H 4XC1H 1A1OB 3MRJA 1RJZB 4WI9A 5I16A 1I3RA 3LIZH 4YWGL 3S37X 1NGXA 4P5KA 4L9LA 4G6AD 1MRDH 4LVOC 2P46B 4JRXE 2P24B 5JQ6L 4LF3A 2HKHH 4O2CB 2CDEB 5J8OA 3ULVD 3CC5A 1BAFL 2Q76A 2VAJA 3K0WA 5E2TL 4Y8DC 2G60L 1ZT4B 1Q9OB 1NGYA 3DO7A 5JW4Q 3RWJB 3L6FA 2HJLB 2VDOL 2AABL 4Y2DC 3G9AB 1WBXB 3GB7A 5D5MF 4WFFD 5D8JL 1T0NA 4ODSL 1RJCA 1CDUA 2VDNL 1DANT 2QADD 1A1OA 1QKZL 3AREC 3OAYK 1RJZA 3S3SA 4FRWA 4U2ZA 5IHUL 2D7OA 4KKLC 1SBBA 3JUYA 5SV4A 2A77L 2P24A 5DC9B 2CDEA 3RU8H 3X12B 3UTPD 4RGNC 4G8GD 5GS1C 3GMQB 1JHKL 3GI9H 1ZT4A 3RWJA 2HJLA 3EUUA 3I6GB 3PXHA 4MXQC 3U9UB 1KCKA 3NN8B 2VLRE 1HI6B 1WBXA 1O5DT 4LSDA 4K3HA 1KEML 3FRPG 4ZO7A 1QSED 1PKQE 2HN7B 3FO9B 5J9PB 1G1YA 1QBML 5MP6H 4M1CD 5T3XL 1MAKA 2H6PA 1W72H 4P2YA 3KDMB 2X4RB 3X12A 4KAQL 4LSQL 4OFDA 1V5JA 3GMQA 3WUWG 4KTYA 2E6JA 3ZYOA 3VWKB 3AAZA 3KGRA 2YWZA 3I6GA 1NH6A 3U9UA 1XH3B 4G6FD 3NN8A 4ZS6C 1BFOB 3QEHB 1Z2KA 1HI6A 4U1KB 4BQBA 1RFDL 1I9RL 2ENSA 2GSIB 3DXAE 2WANA 1G7MB 2EDOA 2HN7A 3FO9A 3I2CL 3WNMA 5J9PA 3V7AE 5DS8B 3BDXA 2IG2H 5D71H 5FYLE 2IC2A 5CBAA 1O0VA 3KDMA 1BIHA 2X4RA 5GGVY 4PD4K 5MEQB 4BZYA 3CDFA 1NBVH 4PR5B 4HPYL 12E8H 1E4XH 4JVPA 1K8DA 3AFLA 4PJ7B 3VWKA 3RUGB 4JFZH 4NM8H 1XH3A 4M5YL 1BFOA 1NCWH 3QEHA 4U1KA 1V3LA 4J1UB 1QFWL 5E03A 1KJ2B 1MCPL 4J3SA 2GSIA 4E41E 3E2HC 1G7MA 4YBQC 4WUUB 5JA8B 3RBSA 4YPJA 2QQLL 5DS8A 4TUOB 5E5UB 4R9HA 5F71A 5DSCB 1JPGB 3WFHB 1IAKB 2V2TB 5MEQA 2H3NB 1PEZA 2NW2B 3S37L 4PR5A 5LXGL 4WTZA 3OR6B 1A21A 4PJ7A 1MFNA 2E3VA 3RUGA 1FJ1B 5D96C 5L88H 3QIBC 2MCPH 4IIQC 1KBGL 1NCUA 1CE1H 4J1UA 1KJ2A 4G7VL 1K5NB 2R4SL 5L6YL 5FUZL 3W82A 1CL7L 4FQXB 2AJSH 4WUUA 4RIRB 4NN7C 2ADFH 2HFGH 3BE1H 4TUOA 1UXSB 2YPLE 2R0KL 4U1SA 5DSCA 1JPGA 3WFHA 4RGOL 1IAKA 2V2TA 3G6AB 2H3NA 1LO2H 4U7MA 3FMGH 2NW2A 2OR9H 5I8OH 2X10A 2ZG3A 2UYLB 1YEFH 2FR4B 2X9YA 1FJ1A 2CDFB 1KYOJ 2KQNA 1ZTXH 1TPXC 4WWKC 4O51B 2Y6SD 3F8UB 1NCBL 4L5FL 1FSKB 1K5NA 4LIQH 4FQXA 5DJ6B 4KY1L 3MRHA 4G7YL 4WFHE 4RIRA 1SM3L 2PW1B 4EEEA 2FX7H 4LCWD 5HGDB 1UXSA 2FX8H 4G9FA 1I7ZB 5KVGH 4Z6AT 25C8H 1P6AB 2PXYD 3G6AA 4K71B 5HYIA 4P2QD 3G08B 2WWMC 3O2WL 1Y0LB 2UYLA 4P2RD 3U0WH 1LE5B 4GRMB 2FR4A 4GXUM 1Z9LA 1NANI 4ONGL 1KJ2L 2CDFA 4Z0BL 3VGHA 3QUYD 1ZAGA 3MXWL 3W5MA 1KPRB 5F7LB 5FV2A 5CZVL 3SKJH 4O51A 3BWUC 4I3SH 1NC2B 4UNTA 2PW1A 2XA3A 3MLWH 2BSTB 3MRRB 1MH5B 5HGDA 2ZUSA 4PP1D 1I7ZA 3CDGA 4TNVF 1YEKL 5DJXB 2WP3T 3G08A 1ZHLB 4WI4A 4D9LL 1Y0LA 5KANI 1KCSH 4RNRB 4GRMA 1LE5A 2YA2A 2EXWD 1EH9A 1CQYA 3RTQC 3OXSB 1KPRA 1IQWL 3QNYB 1ADQL 2WBJD 5F21B 1EPFA 4X4XB 1AY1L 3M17A 4AEIH 4E0RB 4JQIL 4O5LH 5CGTA 3SOBH 1NC2A 4MNHB 3VH8G 3MRRA 1CXFA 4ZD3H 1IAIL 1MH5A 3MLXH 1U3HC 2BXYA 1RZ7L 1J86A 3NA9L 1YY9C 3GSRB 1OT2A 1F13A 5DJXA 5FKPB 1XZ0A 3BDBA 4ALAL 1ZHLA 2IBBA 4RNRA 1NSNH 4P99A 5SX4H 5T1LD 2E7BA 4Z8FH 1IGIH 5KSBE 2DQTL 1AHWC 4I2XE 1VEOA 3UTSD 2PO6D 3OXSA 4KRPD 5EU5B 2X1PA 3QNYA 1YEEL 4X4XA 1TXKA 4KKBD 4E0RA 5IB1B 4WFGD 3EHBD 4OI8A 1Q0XL 2DAVA 3IDMB 4MNHA 1XR8B 1TZHB 1FBIL 5E99H 3K4ZA 4ENEC 1ZVSB 3ZDZE 3GSRA 2BSRB 4NQDD 3NZHL 5T1MB 5FKPA 3ROOB 1JPFA 5DR5H 4XNXL 3IDUA 2DIBA 3DUUB 5ALBH 2X1QA 4HAGA 1UGNA 2APBA 4XCNB 3LB6C 4Y19D 4JGUA 5HYQB 1J12A 5C07B 1MRFL 5D1XB 2VDMH 4MQ7B 1OF2B 2YKLH 2YZ1A 5IB1A 3TO2B 4EDXB 1HHIB 2R0LL 3ZHLA 3IDMA 1XR8A 2IFFL 3U7YH 1TZHA 5B8CB 2P5WB 1ZVSA 3MCG1 2OBGA 1QNZL 1FYTB 2BSRA 4AG4L 1S9XB 2ARJB 3FFCB 4Q6IB 5T1MA 4M7KH 2HKFL 3GKZA 1OP9A 3ROOA 5E2UL 5IB4B 1NUDA 3DUUA 3MNZB 3QAZC 3BP6B 4NKOB 3TPKA 4XCNA 5HYQA 5JHDE 2AGJH 5E2VL 5C07A 1JI2A 2EDJA 5D1XA 4DFIA 5KVMC 1QFOA 4MQ7A 4BFIB 1OF2A 3TO2A 4EDXA 1HHIA 5I8KL 1CICC 5B8CA 1T22B 2P5WA 2WUCH 3Q6GL 1FYTA 1JPSL 1DSFL 3GSVB 2IANB 4HFWB 2ARJA 4LRIA 4Q6IA 5DTFA 2FCBA 3DUHA 4YPGB 2FECL 5IB4A 1MY7A 3G6JB 3LKSB 2VXQL 4BA8A 1UACH 3MNZA 4K7PL 3BP6A 4NKOA 2V5YA 1H3TA 2CKBH 4KZDL 3B9KC 2OXGA 4BFIA 1KN4L 3PWPE 1ITBB 1YZZA 4GLRH 3HZVB 2EEAA 5F3BB 2BHUA 4YK4B 1BLNB 1D7FA 5CD5D 2NX5B 5E8OB 5A40E 3RGVD 4XP6H 4HFWA 3GSVA 2IANA 3E3QC 4ZNEA 4RAHA 5AYQA 1NCCL 3G5ZB 5CZXC 4QRQB 2DQFB 4YPGA 4KQ4H 4OV6F 4Z7UE 1K4CB 1PKOA 3LKSA 3CJJA 4MJID 3FQXB 3PUCA 3P30L 3BVNB 1U8JB 2YHGA 1MIMH 2AEPL 1WWBX 1INDL 4Y5XC 3IDNB 4WUKH 1IE5A 4M8QB 5F3BA 3QDGD 1UQSB 1BLNA 2D0GA 2NX5A 5E8OA 2EH7L 1RUML 4JRYE 1T5WB 5CIPH 4KGLA 4CU7A 1DBAL 3RPKA 3K46A 3G5ZA 4FZEL 4MAYD 4NP4L 1A6UL 4QRQA 2DQFA 1EK3A 4HUMB 1K4CA 3RY6C 4WU7A 4WEBH 2D31B 3FQXA 3OKYA 2BNRE 5LGJB 5EIVA 5KSBF 3BVNA 2VZUA 1U8JA 1WTGT 4M7LL 3ARUA 5J89A 2IMNA 3HE6B 4HUUB 2ZWLT 2R4RH 3UYRL 3IDNA 3T0EC 4M8QA 5DD3H 1EMTH 1UQSA 1JRHH 2EIZB 2PF6A 3SPVB 3QFDB 4LLQB 4XCYB 2FO1A 1E6JH 4FN0A 5LG1A 2AEIT 2XTJD 3ULUC 2OMBA 5FYKD 3UTQA 1Y18B 3I85A 2ZUWA 1D9KB 4ERSH 3DIFB 1IGML 3T4YB 3V6BR 3V0WL 3SQOL 3RKPA 1YNLH 5LGJA 2ZG1A 1NGQL 4U0RB 4H8WC 4YDLC 1CD9B 3HE6A 4HUUA 2W60B 1BM3L 1J0ZA 4ZQKB 5F1KC 1ACYL 4CN6A 2GJ6D 3RVTC 5HI4D 2B5IB 1KXVC 2EIZA 3SPVA 4XX1G 3QFDA 4LLQA 5EZJB 5FF6A 3W0WE 1JF1B 1F4WL 4PGJA 1CFBA 1OGAE 3OKKB 2XQYG 1Y18A 1D9KA 3DIFA 3T4YA 3HR5B 1MF2L 1FFNB 2BCKB 2EDQA 5HGAB 4PYHA 1HYSD 1DQJB 1P2CB 4F7TB 1A6AB 3RIAF 4XCCL 3SDAD 4IJ3C 3ARVA 3TO4D 4JPWH 4RMWA 1GGBL 2EDTA 3BP7A 1WZLA 2R15A 1NMAH 2W60A 1DR9A 3IS0X 2LU3A 4LARH 3UTOA 3U2SB 2R29H 2EDEA 2AJUH 4FFYL 2AVGA 5EZJA 1M7XA 1JF1A 4KKNA 5BJTA 3QHZH 3OKKA 3TT3H 5JW5A 3TEUA 3HR5A 2BCKA 2ED7A 5HGAA 1DQJA 1P2CA 5H2BB 4F7TA 1A6AA 4OGYL 2VWEC 3DETD 1U8OB 4TOYH 4NQVB 1G9NL 1OAQH 2WM0A 2BVOB 1N5YL 2G5RA 4P9MH 2GJZB 2F5AL 2AJXL 4Q9QH 4M48L 3BPNC 4M6OL 3U2SA 5D70H 1YPZB 1C08B 3F7QA 3S34H 5TDNB 2ORBL 5B3NA 5F70A 1QR1B 5IEHB 2NLJB 1YEJH 3B5TA 4YEEA 4X4MA 4Z7UF 3S98A 4RMSA 5BV7B 1OAZH 5H2BA 2ESVB 5IJKA 4H25B 1U8OA 4NQVA 2XN9D 2BERA 4YWGH 2BVOA 5JORB 3IAQA 4J8RB 2GJZA 3DO3A 2X40A 2WV3A 1JYNA 1BAFH 1DJSA 1YPZA 5E2TH 1C08A 4U6XB 1PYWA 5TDNA 4WHCA 5J11C 1QG3A 5E70A 2A6DB 5IEHA 4KI1A 2VDOH 2AABH 2NLJA 1CF8H 4CJ1A 1MCCA 1G0XA 3GSNB 4LHUD 5IUSA 5KVEL 1I9IL 2Y9RT 5D8JH 4JJ5B 2CSPA 2I24N 4LRNL 4X83A 5I2IB 1F5WA 2VDNH 1D5BB 2ESVA 5CJXC 4OFYA 1QKZH 3VXOA 1EFXB 2E6PA 2UWEE 4K9EC 5IHUH 1SYSA 4FG6D 1UVQA 5JORA 3BOVA 1RURL 5J1AA 1NCAL 4J8RA 3TN0B 5IFJB 4NQEE 2VB5A 3HUJA 2A77H 1OGTB 5ILTL 4B53A 1G7HB 4U6XA 5EFIB 4PJ9D 1JHKH 1U8MA 4OCLC 3RA7L 2Y36H 2A6DA 1AO7E 3MLZL 5J13B 3F7VB 4M7JL 4LNRB 3GSNA 1SMOA 4LVOB 5CJOL 4JJ5A 1KB5L 2MKWA 5I2IA 4KDTC 3QP3A 3PDDA 5C0BD 1D5BA 1EFXA 1UWGH 3MUHL 1GOGA 1QBMH 4X6CE 1NMCC 1HZHL 5T3XH 3TN0A 1DANU 1I1YB 1WBYA 5IFJA 1D5MB 4I9WD 1I1RA 4FZ8L 1I75A 1OGTA 5DRWA 4KAQH 4PRHD 5SV3A 1FG2B 1KTKE 3MRPB 4LSQH 2Q7YB 1G7HA 1AR2A 5EFIA 3MOBL 2BOBB 2P49B 5BV7L 3BAEL 1IARB 3BIAX 3F7VA 3O6ML 4LNRA 1OB1B 3QQ9C 4NQCD 3AY4A 1NDMB 5T33L 1RFDH 4OTXL 1I9RH 4DEPC 5TH2B 4N0YL 3RVXD 2GI7A 4HULB 3I2CH 3G6DL 3ZMRA 5AD0B 1MCIA 4C56E 5FYJD 4F8QA 1I1YA 1U0QA 1D5MA 5GGRY 4HWZB 4MD4B 1FG2A 2Q7YA 2XZAL 3MRPA 4HPYH 2I25N 1JL8A 4MVBC 2BOBA 3GSNL 2DDQL 2Q7NA 1KACB 2F53E 5IVZB 1IGFL 1EBAA 4IRJC 1JGEB 1NDMA 2ZSWB 4URTB 1QFWH 5TH2A 1MOEA 3WFDL 4OZFH 1MCPH 2COQA 5D1QB 4APQD 5AD0A 1OCWH 4PLKD 3ZDXE 3EO9L 2QQLH 2Y07L 1B4JL 1NLDL 3ARSA 2HYMA 3TGXA 3NMEA 2YD6A 3S36L 4HWZA 4XMKL 1FVEB 3NTCH 3EO0B 4OQTL 3S37H 1DUZB 4HAFA 5INDB 5SX5H 3RAJL 5LXGH 4HLZH 2P5EE 2E8YA 1P7QD 8CGTA 5IVZA 4DAGH 1BZ7B 2PTUA 1JGEA 2ZSWA 3AS3A 1KBGH 3DHMA 2EXYD 2JIXD 1MCKA 4G7VH 4DFHA 1TETL 2R4SH 5L6YH 5FUZH 1WK0A 1CL7H 5D1QA 4XPBL 1UC6A 1RK0B 5HGHB 3ZE0E 3U83A 4G8FB 5C86A 3C5ZD 4K7FB 2R0KH 3ARGD 2J6EA 4RGOH 3VG9C 3CLEL 1ETZB 4UMGA 3RRQA 3EO0A 1DUZA 3CK0L 5INDA 3VI4E 6CGTA 1NAKL 1B90A 3E2HB 4ZXBC 2W0KA 2HVJB 5FA3B 3PP4L 1SQ2N 3LKNB 1BZ7A 4DKEH 1Z5LB 3C9NB 4GAGL 4GXVL 1CTOA 1NCBH 1C5CL 1TDQA 2Z9TA 4L5FH 5A2LH 4XP4L 1TJHL 4KY1H 4G7YH 1JPTL 4PJDE 4YH6A 4AQ1B 1RK0A 1SM3H 2XKNA 3ZT7A 5IMLB 3H9SE 5HGHA 2YRZA 5ICZB 2UWEF 4G8FA 1QFWM 5D96B 4K7FA 1NCNA 4YE4L 3ES6B 1ETZA 3GBMH 3WXVL 4GRLC 3KWWB 3O2WH 5IWLC 1D5XB 4MQSB 5IBLC 4CDHA 5I71B 4IS6B 2HVJA 4ONGH 4Z0BH 1KJ2H 4U6VL 2YRPA 5FA3A 1DQLL 3LKNA 3NPSC 4EQ3A 3MXWH 2D4FA 1Z5LA 4WENB 3C9NA 5CZVH 1TVBB 5DC0A 3W39B 2EDXA 4KWUA 5IR1B 1LVEA 5FO9B 5I1AB 3DYOA 5IMLA 1PEWA 5ICZA 1XF5B 3BUYA 4X6CF 4LLAA 4EKXA 3S5LG 1RVFL 1YEKH 5J3HC 4QTIL 3ES6A 2E9WA 4N9OB 1X7QB 3KWWA 3PWLB 4LSVL 4D9LH 2W9LA 1D5XA 1P7KB 4R2GC 4IS6A 3B2VL 4ELKB 5IHZB 1YQ2A 3TJHC 3KPTA 4OFPA 4UZGA 3CDCA 4L4TD 1BECA 1TVBA 3W39A 1AY1H 4JQIH 1IKFL 2XI9A 4UTBL 2HT4C 5I1AA 3G5XB 2YSSB 3C60C 1HH6B 5HHQB 2W9DL 1XF5A 3GHBL 3NA9H 1KB9K 3NFSL 4NQXB 5FDYA 4M02A 4TTDC 2X05A 1FNSL 1FP5A 4TNWK 1X7QA 3MGAA 3PWLA 4HH9A 1GGYA 4NO0D 3VWJC 1P7KA 1ZLWK 1MJJB 1U8PB 2I60H 3P4LA 4P3WA 3FB5B 4XTRD 2NXYD 3MOAH 4ELKA 5IHZA 3ZDYF 3CX5J 3MLYL 5BVJB 2AJYL 1YEEH 1G6RL 1Q0XH 2FLBT 4M3JA 2YSSA 1FBIH 1HH6A 5HHQA 1KUMA 5TQ2L 3ZDXF 1BD2E 3RTQB 4NQXA 5JOFA 3N1QC 4P0DA 1EHXA 2BSED 3S35X 4FS0A 4EVNA 5HVHB 4JDVB 4Y2DD 4NBYB 1MJJA 1CWVA 1U8PA 1WGOA 4OZIF 3PQYD 3FB5A 4V1DE 1RJYB 3P4MB 3ZTJH 1F02I 5KSAB 3ARED 3KS0J 3UMTA 4GBXB 1MRFH 5BVJA 3SN6N 3MRFB 4LOUD 1VFMA 2IQAB 5EORL 1CDBA 1FPTL 2IFFH 3IVKB 5KAQG 1QNZH 4RGND 3RTQA 4H5SB 2X70B 3FQNB 4AG4H 3ZZ1A 1F6FB 2HKFH 3JSSA 2JB6B 5E2UH 1IAIM 1UZ6E 2OK0H 4JDVA 4NFBA 2KKQA 3INUL 1MAML 3P4MA 3GGWB 4ELME 5KSAA 5E2VH 4GBXA 1ZSDB 3MRFA 4L4VD 5INCA 4BKLB 2B1HL 3OXRB 5I8KH 4OD2B 1KGCD 3QH3B 4PV8A 1XIWC 2I5YL 4PJDF 2BVTA 2NR6C 5CSBA 2Y06L 3Q6GH 1JPSH 4H5SA 2X70A 3FQNA 3VXSB 1SY6A 2H2PC 4FTVE 2JB6A 5SWSB 2PYEE 4R0LA 1LDSA 2VXQH 4M93C 4ZS6D 2DKSA 5I19H 4K7PH 3BQUC 4RBPH 3Q5YA 2GEEA 4PRDA 2ADJB 3VGGA 1H3GA 1DBJL 5GJTL 3QUZD 1KULA 1ZSDA 1EZVY 4FMKA 1KN4H 4NOBA 1IJ9A 4X8JB 4BKLA 5DVNA 3OXRA 2YD8A 4OD2A 3FZUD 3QH3A 3MZTA 1JMZA 4HGMA 4HIEB 4WCYL 1EXUB 4BZ1L 2ILLA 3VXSA 2C3XA 3O3AA 1NFDB 3NZ8B 4S1QL 5I17B 1NCCH 1A0QL 1OD9A 5SWSA 5DFVC 1XMWA 5L2KB 4K23L 3RI5K 5GQBA 1J87A 2AQ2A 4WW2F 3GJFK 2VMFA 4KHTH 2ADJA 3ULVE 3P30H 1PFCA 1QSFD 1U2CA 4WIQA 5DJ0B 4YBQD 1QVOB 2AEPH 3TESA 2DM4A 1INDH 1J8HB 4JVUA 3E1F1 3OR7B 4X8JA 2WP3O 1IKNA 5H8DA 1SY6L 2ENYA 1FFPB 3V6OC 4HIEA 2NW3A 3ZT5A 1EXUA 4WFFE 1MHCB 1FHGA 2O5ZL 2NY2B 1RUMH 4OF6A 3PDGA 5L9DL 2DQCL 3BEWB 5ERWA 1DBAH 3NZ8A 1AD0B 5I17A 1MCWW 3B9KB 4FZEH 1A6UH 2RGSA 3KXFA 1U95B 2X9WA 1HHGA 3SO3B 4NZRL 4TULL 1ZT1B 1OP3H 3OB0H 3UTPE 4M7LH 4G8GE 1QVOA 3CZFB 1J8HA 4P46C 3DGGB 4LCYB 1BOGB 3OR7A 3UYRH 2EDLA 3P4OA 1LO4H 4U31A 2KQMA 3MZGB 4HGWB 3FN3A 1FFPA 1JNJA 3TBWB 3LRHA 4CAGA 5FHBH 1MHCA 3QIUC 3HHRB 3BIKB 3BDYL 3BEWA 1QSEE 5JIKA 3HAEH 3D2UB 1AD0A 3B9KA 3CVHL 3D48R 1W0WA 2OQJB 4N8CL 1ZLVH 1U95A 1IGMH 4ETYA 4JHWL 1JMXA 1SEQL 5GS2D 3V0WH 3SQOH 3UJJL 5CD3B 1NBZB 5I8EB 2GSGB 1ACZA 3CZFA 4JY6A 3DGGA 4HD9A 4LCYA 5IV2B 1BOGA 5FOJA 1BM3H 1RIUL 1A22B 2ICES 1ACYH 4MNQD 1P9MC 4HGWA 3VXUD 4QTHB 2ZUYA 1IRAY 1CGUA 1T7VA 3TBWA 4K3DL 2WWMD 1XCTB 3BIKA 3MFGB 3MV8A 5DQJB 1F4WH 4CU6A 4MCZB 3D2UA 5IFHH 4M6NL 1P53A 2OQJA 2PCPB 1NGWB 1NUGA 1UZ6F 1MF2H 2QLVB 5HPOA 4PUBL 5CD3A 2EE3A 1NBZA 4XCCH 5I8EA 4NC1E 4ELMF 1DLHB 4Q74A 2GSGA 1GGBH 5IV2A 1FZOB 4XXCA 4GSDL 4PJBB 4QTHA 4PB0L 4FFYH 3HCVB 3U82B 1XCTA 4POZC 5DQJA 5E8EB 5C7XL 3O0RL 4MCZA 5L0QC 2VDQL 1UM6L 1NGWA 4YHLL 4J7RA 1OTUC 3QUXB 1SBSL 1F00I 3U36B 1NJ9B 4Q9RL 4OGZA 1MWAL 4HZAA 4D94A 5E7FA 1DLHA 1U8KB 4X6DF 3V52H 1G9NH 1FZOA 1U3HD 1N5YH 3CU1A 1DBML 4PJBA 3PWJB 4LSTL 2F5AH 2AJXH 4NSKB 5AEAA 4M48H 4M6OH 3L95B 1PX3A 1UH2A 4PJHB 1K8IB 2B1AL 3HCVA 4RMRA 1BQHB 5E8EA 2ORBH 5BQ7B 2BC4B 1P69B 2KL6A 1CD0A 4UT9L 4ZDHB 4QT5B 3QUXA 3P0VL 4QEGA 3U36A 2VR9A 5GGUB 3WKML 3O9WD 1YMMD 3ULVF 1U8KA 1CU4L 3OGCB 2F8XC 3HNTL 4MMZC 5FGBA 4NPYB 2DQEH 1INQA 4NSKA 3SDCC 3WEXB 3L95A 4PJHA 1K8IA 5CINL 5CLWA 3HC3L 3MBEB 1BQHA 3ARRA 5I18H 4LCWE 3TBVB 5I1KL 2QSTA 5BQ7A 2BC4A 4IOIB 3GKWH 4ZDHA 1QTYT 4QT5A 3NFNA 3V95A 5KVEH 1I9IH 5GGUA 3ULUL 4LVHC 5GISL 4P2QE 3QO0B 2MMXA 1D6VL 1UT9A 1NANH 2UVFA 3ZSTA 1VESA 2JCCE 4O00A 4P2RE 1T80A 4PJCE 1MJ7L 5FIEA 5GGSB 2FO4A 3ZKXB 1RURH 1OP5K 1NCAH 2DOCA 5CEXB 3WEXA 4H8WL 4RX4A 4YHYB 3JVGA 1NAMB 2LAGB 4X4YB 5ILTH 4XBGA 1T6WA 3MBEA 4MJ5B 3RA7H 3TBVA 4L3AA 1II4E 4IOIA 3MLZH 4M7JH 3WL9B 3VI3E 4KU1A 2DRUA 4X4ZA 5CJOH 1KB5H 1U41A 3N1GC 4HHAB 2AV1B 2EE9A 3QO0A 4D0BB 5F1NB 5GGSA 3KNBB 1Z6JT 1VGKB 4RRPA 1MI5D 1HZHH 3RZCA 5CEXA 1JZ8A 4FZ8H 4NCDA 2YA0A 1NAMA 1T04B 3MA7B 2ZNXA 4OFVA 4X4YA 3Q48A 1SJEB 4MJ5A 4WV1B 3HRZB 5BV7H 1FG9C 3BAEH 1BQLL 2MQ3A 4CUCA 3O6MH 3WL9A 5D7IF 1C5DB 3KS0H 5T33H 4OTXH 4HHAA 2AV1A 4U3XA 4N0YH 1WFUA 3GMMB 5F1NA 4D0BA 2A9NL 4OLVL 3KNBA 5D93C 2DIAA 4ZOAA 3S9DB 3EYFA 2AQ3A 4Y5VB 4HQQL 5GS0C 5E7BA 5MEPA 1A7QL 3MV01 4ZFOL 4UNUA 3MA7A 1A4KB 1RHHB 5HYJB 1SJEA 4WFGE 3GSNH 2D0FA 2DDQH 4WV1A 1P4LA 4CN4A 3WFBL 4QGYA 1IGFH 1NMCB 5GGTA 5ITFB 1I85C 1C5DA 2DLFL 4NQDE 3RJDA 2GTZB 5TDOB 4M9PA 4PJ5B 5HD8C 4NOFA 5BMFL 1YJDC 3SGJC 3KLAB 3GMMA 1NAML 3EIFA 5A3ID 3EO9H 1DQQB 2Y07H 1B4JH 3NCJL 4H1LG 4Y5VA 4Y16B 4Y19E 1UJ3C 3CSYB 2YR3A 4I0KA 3S36H 4XMKH 3NIGE 1R3KB 1A4KA 4DEPB 1RHHA 4OQTH 5HYJA 3RAJH 3OKDB 1B0GB 5EC2B 5L8KB 2HMIC 1I7TB 3GMPB 4JO1L 1V3JA 2GTZA 5TDOA 3T0ED 4PJ5A 4FQCL 4XPBH 3KLAA 1IM9D 5DMYA 1DQQA 3KLDA 3PWUB 1S7WB 2P7TB 4DGYH 4Y16A 3ARFD 2XNAA 2CRYA 3CSYA 3CLEH 2DQIL 4K9EL 4NHUB 4QYOB 1JWSB 3CK0H 3L7FB 1G7QB 3EDFA 3OKDA 1NAKH 1B0GA 5EC2A 3U1SL 3RVWC 3ZE2E 1FIEA 3BKJL 3V5DB 3LVEA 1I7TA 3OKOB 1HXMB 3GMPA 4P5MB 5T1KD 2HT3C 4UDTB 2ZCKL 3LV3B 5C9KA 4GAGH 1QPPA 4GXVH 2OJZL 3W2DL 3C6SB 4XP4H 1OAXL 1TJHH 5I15L 3B8SA 4AEEA 3RVTD 5FM4A 4QO1A 3D0VB 4LLMB 1A2YB 4PJCF 3PWUA 1S7WA 5JIIA 1A6PA 2P7TA 2Q6WB 1R0AL 4AENB 3SE9L 4LEOB 1BBDL 4I3GA 3L3DB 1NUNB 3WXVH 2HWZL 4NHUA 4QYOA 1JWSA 3L7FA 1G7QA 1LE9B 5LGHL 2VXTL 3V5DA 4U6VH 4MWFB 3SE3C 4PJGE 1DQLH 3OKOA 1HXMA 2CH8A 4P5MA 2BP3A 4UDTA 3R06B 3LV3A 3VI3F 1ZA6B 3C6SA 1P5VA 1AQKL 4KQ3L 2J6EH 3AU1B 3LN9A 4Z7OF 3D0VA 4LLMA 1A2YA 4P23A 4MJIE 2UUDH 1GPOL 2HJKB 3MRMB 2Q6WA 2HT2C 3EJYD 1RVFH 4QTIH 4X7TB 4EQ2A 4LEOA 1NEZB 3L3DA 4QHUB 4O02L 4LSVH 3MBXL 4ZUUB 3C09C 4XNZC 2B39A 4MWFA 1N7ML 2QQQA 5C9JB 1JNNL 5CS7A 1FORL 3R06A 1X5HA 1ED3B 2GT9B 1ZA6A 2OTUB 5FKAB 1GHFL 1IKFH 1QZ1A 3WIIL 5CEZD 4UTBH 3K4AA 4CGTA 3AU1A 4G9FD 2VLRB 2M1KA 2W9DH 1RPQA 3GHBH 2IGFL 1QRND 2HJKA 3WN5C 3NPSB 1PKQB 1CR9L 4X7TA 5E95B 5ISZA 3HI1B 4O4YL 2R9HC 1NEZA 1FNSH 3LS5L 4QHUA 3T4AB 1U36A 1HCVA 4X6BB 4UOW0 4ZUUA 4KI5D 1N5AA 1PY4A 4CN1A 3H3PL 1I9EA 1TMCB 2EH8L 4Z5RB 1CDCA 3N9GL 5C9JA 3MLYH 2AJYH 2XTJE 3DYMA 1ED3A 2GT9A 5FYKE 2OTUA 3N1FC 5FKAA 4PRBB 4JO3H 2VRAA 3HA0A 2VLRA 4R2GB 5DHVB 5DMIH 5TQ2H 4GAJH 1XGRB 1PKQA 3HI1A 4LLDA 4NN5B 4YDKL 4EXKA 5IT2L 5E4EB 3NIGF 2V2WB 4RMUA 4X6BA 4BK4A 2GJ6E 2APVA 2X4SA 2NY4C 5I1DB 2A0LC 1KCUL 5J1SC 3ILQC 4IM8A 3EO1B 4Z5RA 4Z7VE 5EUKB 3V0AC 1FL6B 4JM2F 4KHXL 2FJHB 5JIHA 1NC2D 4LGPB 1CXEA 5EORH 2JELL 4PRBA 4HMDA 4Y4FB 1FPTH 3VWJB 1MCJA 2IAMD 4JPVL 5DHVA 5FGCE 4E41B 1XGRA 1VFUA 1B2WL 4DGIL 1SMAA 4UDUA 1PQZB 4PRIB 1HQ4B 2V2WA 2OXHA 3BSZH 4LFHD 3T04D 3INUH 1MAMH 5I1DA 1EBPA 1MUJB 2JJUA 4HCRA 3ZE2F 4ZTOL 5J4MA 3EO1A 2AQ1A 5EUKA 4I4WB 1FL6A 2FJHA 1AKJB 3HNVH 3RZWA 3ZL4L 2Q1EA 2B1HH 1Z3GL 3TNMA 3ARBB 4Y4FA 3TH4T 1IC4L 3VWJA 4N8PA 2I5YH 3CDYA 4I3RL 1FVDB 2Y06H 3T2QA 4E41A 3R4DA 5F9WB 2J8OA 4QHKI 1PQZA 3O41B 4PRIA 2FB4L 5E5MB 5I75B 1P4BL 1HQ4A 3VFWB 2ICWI 2YPLB 3STBA 1MUJA 1DBJH 3RP1A 4GMTL 1IILE 5GJTH 4PJGF 4I4WA 4PV9B 1AKJA 3E8UL 3DARA 1JWUB 3QO1B 4P49A 3ARBA 3QA3B 2VUOA 3ESUF 2ZSVA 4WCYH 1FVDA 4M1GL 3TFKC 1U3JA 4M7ZC 4MVBD 4WW2C 4S1QH 5FYLL 4CU8A 3CFIC 2XN9E 1BX2B 1A0QH 2Z31C 5E5MA 4K8RC 1JZ5A 1S9KC 1FZMB 3VFWA 4K23H 1MLBB 5C07D 3GHEL 1I8LA 4JKPL 3FN0L 1CDGA 1AR1C 4LHUG 3MROB 4LQ1A 3OSKA 2BVQB 1JWUA 3QO1A 5EO9B 3KPRB 3QA3A 1FYTD 1F3JB 1SY6H 5FGRA 4CRPA 3KHQA 4GS7C 2O5ZH 5L9DH 1X5JA 3FTGB 3QCVL 2DQCH 3KHOA 1BX2A 1U91B 2EDNA 1DBKL 2ITCB 1CS6A 1RD6A 4NZRH 8FABB 3OTTA 1MLBA 4TULH 5DD0L 3BRDA 3U9PH 5EOCL 4QNPE 3S35H 3MROA 1AGDB 2BVQA 5AWNL 1ZGLB 4DZ8B 3IXTB 4UBDD 5EO9A 3KPRA 1F3JA 4PRAB 1KTLB 4JFQB 1K2DB 5HHOE 3FTGA 4RMVA 5C0BE 3BDYH 3OV6A 3PV6A 3GM8A 4HKBB 2Y25A 4HXBL 1U91A 4N8CH 3U4AA 1KIRB 2ITCA 3JZ7A 4JHWH 8FABA 3JTTB 1SEQH 4I9WE 3UJJH 3MX0A 5IB5A 2ZOLB 1W8OA 4N0RA 1AGDA 1S7XB 1ZGLA 4DZ8A 4OSUL 1RIUH 3IXTA 2R0WL 5KSBB 1M7IB 4TVPD 5DHYB 4I2XB 2NX5D 4MD0B 4YC2B 4PRAA 1KTLA 4NQCE 4Z7WA 1R3IH 3V4VL 4JFQA 1K2DA 4K3DH 4F9PC 3I84A 4GRLD 2X4UB 4HJGA 5SWZD 5KTEL 3MV9D 2R1YB 4F3FB 2Q3ZA 5A16B 5GGVL 2FZ3B 4HKBA 4M6NH 5IBLD 4XGZB 4P46B 4LLUA 3QQ3B 5FYJE 1FYHB 1KIRA 1A6VL 1A7RL 3JTTA 4PUBH 1FAIL 2FBJL 1OOAA 3GSQB 1RY7B 1XGPB 5HYSB 2ZOLA 1HSBB 2D9CA 3HC0B 2DICA 4JQXA 1WEJL 1YN6B 1TJIL 2V5TA 3O4OC 5KN5B 2RAMA 1S7XA 5HDBE 1FVCB 1KCVL 1M7IA 4GSDH 4I2XA 4MD0A 5DHYA 3VRJB 4PB0H 2BJML 4UINL 5C6TL 1VFAB 3FL7A 1EHNA 4F7PB 3SDXF 1DEEB 2X4UA 5AUMB 1D5ZB 4CJ0A 5C7XH 2R1YA 3O0RH 4F3FA 1T89A 2VDQH 3VFTB 1R3LA 3CX2A 5A16A 1UM6H 2FZ3A 3PJSB 4J3VA 4XGZA 4HX1B 4P46A 2FH6A 4JANB 3QQ3A 3BUTA 1KTDB 2NYYC 5I73B 1SBSH 1IC1A 3MNVA 4Q9RH 3GSQA 1XGPA 5HYSA 1HSBA 1FIGL 1YN6A 2HT4D 3O81A 3PF2A 1X5XA 3C60D 5KN5A 4RFEA 3NIFE 4MYWB 1FVCA 1DBMH 1FH5L 1E6OL 3QHTC 3VRJA 4LSTH 5JHDB 1FO0B 4ONFL 1VFAA 4F7PA 2PETA 2B1AH 2APWA 4FQQB 2P48B 5AUMA 4S2SB 1D9KD 1D5ZA 5FO8A 4BFEA 1J8KA 4G6AC 2WBKA 3F5WB 3VFTA 5HDLA 5SX5K 3KVQA 4HX1A 2YEZA 3ULVC 1ZXQA 4L9DA 4JANA 3TVMB 5I76B 4UT9H 2GCYB 3RGHA 5IQ9B 3P0VH 4OF3A 3WKMH 1NQBA 3EYUL 1CU4H 3V79C 5F7MC 4MX7B 5BXFB 5L0QB 2QADC 4ZG1A 2BVEA 2MTPA 3TYGL 5JHDA 1FO0A 4FP8L 4WEMB 5CFHA 1TTUA 4U1GC 4XMPL 3PWPB 5CINH 4FQQA 1KELL 2NY3C 2HLFC 4Z9KB 1OLLA 4S2SA 3HC3H 3MPCA 3T0AA 4MLSA 3TP4A 5I1KH 3I75B 2ZNWA 2D7PA 4W4OA 3TVMA 2F54B 4PTTB 4RA0C 3K8KA 5I76A 4FXKB 2GCYA 4M43L 5IQ9A 3L9RB 5EOQL 1CGXA 3ULUH 2IFGA 5GISH 4I0PB 4TRPH 1D6VH 5EC1B 4Z7UB 5E6IB 4QNPF 4MX7A 1MJ7H 5BXFA 1WBZB 3GDBA 4H8WH 3JV6B 4PJAF 2R1XB 5EU7C 5EU3B 1UB6A 1NEUA 3ARZA 4YX2H 2BX5A 4HUVB 5F6IB 3WE6B 3WD5L 3I75A 4JREC 2P8LB 2F54A 4PTTA 4JRYB 5DVLA 4PS4L 4F33A 4Y4KC 3SDCB 1KFAL 4ZYKB 4I0PA 5EC1A 2CO7B 3O2DA 5I8CB 3D0LB 4Z7UA 4JQVC 5E6IA 1KN2L 1RULL 2BNRB 1S78D 3RWIB 3JV6A 2H2PD 2R1XA 4L4TE 5EU3A 4LVHB 1YN7B 1PX4A 3RDTC 1R3HB 2I9TB 3N50A 4HUVA 3BQUD 3WE6A 3IKCB 3T77A 1X5YA 2P8LA 4TN9A 3KJ4C 3BN9C 3JWNC 1BQLH 4N90D 4WO4B 4JRYA 4V2CB 4QRRE 2D7MA 3QI9A 4YIQB 5MHSD 4ZYKA 2DBLL 5EOCJ 3GNML 5E56A 1U2HA 3DNKA 5I8CA 3D0LA 2E9BA 5AAWA 2A9NH 4OLVH 3FB6B 3T0VA 2BNRA 3PWNB 5HDBF 5L7XL 4HQQH 4NUGL 3RWIA 2XACC 1A7QH 3IAGC 5C2UB 3MLPA 1YN7A 3WIHA 4D9QE 3SJVD 5DFVD 3S6CA 1R3HA 3MR9B 5GRWA 2I9TA 3W11D 4ODUB 3QEQB 3IKCA 4R6UA 2KPNA 3WFBH 1T20B 3KYMB 5CGYD 1ORQA 1AH1A 3FRUB 4WO4A 4JY4B 3W0WB 2DLFH 1XGUB 4YIQA 1OGAB 1VB9A 3RFZC 4TTGA 3H7BB 3TBSB 4HPOL 4HWBA 5BMFH 4FFZH 1MFBL 4P4KB 1NAMH 5LAXB 1BZQK 3PQYE 3FB6A 3NCJH 5TE7L 3B3IB 3ROLA 3RPIA 1I8IB 4PY8I 4MQXD 2UY7A 1H15B 3MR9A 3QEUB 4ODUA 1AD9B 3Q5TA 1EA9C 3QEQA 2ZCHH 5D7JC 3KYMA 4R4BA 2IALA 3FRUA 4RGNE 4JY4A 3W0WA 4JO1H 1F97A 1H8SA 1XGUA 1OGAA 4GRWE 3TBSA 2C26A 3H6JA 4FQCH 1MCLA 3GJFB 2ED8A 4P4KA 2CRMA 2R23B 2Y6SC 5LAXA 4KROC 1FRGL 1YC8A 3QIUD 3WIHL 2EDWA 1G7IB 3B3IA 1HHJB 3MRCA 3NPZB 4P4RB 2DQIH 4K9EH 4L4VE 1DZBA 4JFED 2NCMA 2NY0C 2RQ8A 1H15A 35C8H 3RL1B 1KGCE 1U8QA 3U1SH 2PXYC 3R0NA 3BKJH 4L8SB 3V8CA 5HVFB 2XA8L 2KUTA 4DUWA 1F4AA 4HWBL 2HFFB 2ZCKH 2FATL 4ODXB 4BH8A 2OJZH 3QJHA 2VZSA 3FHAA 3W2DH 4F7EB 1JZ6A 1OAXH 1C1EL 1GJIA 4B5EA 3GJFA 2OX5A 1H5BC 2VYRE 4XCFL 4JDZB 1VFBB 2R23A 5DC4B 4D0CB 2GFBB 1G7IA 4ODVL 1HHJA 1Q8MA 2G9HB 4OKDA 2GUOA 1A7PL 3SE9H 1BBDH 4NZJA 3QRGL 2HWZH 3LPGA 3WFCL 1OM3L 3PWVB 3VFUB 4NC0B 3RL1A 5CJ5A 4OCWH 2VXTH 3MRLB 1UM4L 4L8SA 3DSNA 4RBPK 2HRLA 2HFFA 2F8OA 4GMSL 2IPUK 4F7EA 4I0CC 3LEVL 1AQKH 4JDZA 1VFBA 2H2SD 3CFDB 5ANME 2N7AA 4D0CA 2GFBA 5BO1L 5IESL 1GPOH 2G9HA 1QSFE 4POZD 4ODWB 3HTLX 1U6AL 5GIRB 5ACLA 1CFQB 4KK8C 4O02H 5E1AB 2ZUXA 3PWVA 4NQEB 3VFUA 3IF1B 5CJBA 5GS0L 2W0LA 3SKNB 4OAWA 3MRLA 5HHXL 1JIBA 4MJ6B 1JNNH 3QWRA 1W0VB 2ADGB 1FORH 4OBSA 1MCQA 2JK5B 2XPGB 4YO0B 2W91A 4L3ED 4C4KO 1AO7B 1GHFH 2PO6C 4KRPC 3WIIH 2O5YL 1JNLL 2NTFB 3CFDA 3WYRA 3DMMD 3QXTA 4KKBC 3WLBB 5H94B 3DX7B 4ODWA 2CLVB 1CR9H 4O4YH 1YJDL 5GIRA 3LS5H 5K9JL 1IEAB 4X6CB 1CFQA 4OQ1A 4QHLB 5E1AA 4NQEA 3IF1A 5ID0B 3SKNA 4Q9BA 4EXPX 3H3PH 1QQDB 2EH8H 2DLIA 4MJ6A 1OP3K 1PG7X 2DS4A 3A67L 3N9GH 1W0VA 1HE7A 2ADGA 3TLRA 3V4PL 2JK5A 2XPGA 4YO0A 4B50A 2VXSL 5C0JB 4MB5A 1WZKA 1AO7A 1YYLL 3VFOB 4JFFD 1UYWH 2NTFA 3U4EB 3BYYA 4XNZB 1VENA 3WLBA 5H94A 2R69L 3DX7A 1MLCB 2CLVA 5JXAL 4YDKH 5I0DA 4NN6C 4X6CA 5IT2H 3BPOC 4JM2C 2DYPB 2M26A 1JHLL 4MNQE 4QHLA 4XXDA 5EDXA 1ZLVK 1FNHA 4OCYL 3RX5A 3VXUE 5ID0A 3K7UA 5JMRA 1KCUH 4W70A 4C83B 1QQDA 4OKVB 3AB0B 4KHXH 3VXRD 2WNGA 3LZFL 5C0JA 2F53B 5JNYB 3VFOA 2DQGL 4GRWF 5F96L 4PRPA 1EGJL 4PBWD 4I48B 4JPVH 3U4EA 4MHHG 1MLCA 1B2WH 4XH2B 4DGIH 4X7SL 4Q0XL 4P3CL 5IBTL 2JLLA 5D6CB 4GW1A 1AC0A 2WBWB 3QXVA 5CSGA 4JKWA 1LEGB 3MJ8B 4C83A 1RZJL 4ZTOH 4FXLA 3REVB 3BZ4B 5JZ7D 4OKVA 4LMQE 2IBZY 3ZL4H 2P5EB 4OM0L 4WY7L 2X4TB 1V7ML 2F53A 5JNYA 1Z3GH 1A3LL 4Y4HB 2WSKA 3BH8B 5LWYH 1IC4H 5A2KH 2LFGA 3QDMD 3T0XA 5MI0B 4I5BB 3TZVC 2X89A 4I3RH 5B38B 2DM7A 1GIGL 4XH2A 2FB4H 3HG1D 5D6CA 1P4BH 3RGVC 3QR2A 3L3KB 3LN4B 2O93L 3DROB 4GMTH 3REVA 3BZ4A 4BUGA 5CEYA 4O58L 2P5EA 5DHVH 3UAJD 2GIYA 2X4TA 3E8UH 4XPTL 3D6GA 4Y4HA 1ZMYA 2OL3L 3BH8A 2FIKB 5IFAL 4I5BA 4M1GH 5B38A 5IBUB 1TNMA 1NPUA 1YMME 3OB8A 4PJDB 1YDPB 5FYLH 4ZFZB 3H9SB 3MJ9L 2W0FB 3UYOD 3ZE1E 3HE7B 3NFPB 5KSAD 3LPWA 3L3KA 1ZS8B 2G2RB 5KVDL 4ESKA 3LN4A 4QHKJ 3GHEH 4MAYC 1P7HL 3DROA 4JKPH 4PJEE 4R8WL 2AXFB 3FN0H 2ICWJ 2ID5A 3SKUD 4X99B 3O4LD 2V9RA 5T5FL 5C0AD 2EDBA 1H8NA 4OT1L 4DN3L 3JWDC 2FIKA 2HTKD 1Q38A 1PG7L 4BFGA 5IMKB 3H0TB 4LVEA 2C3GA 3EYOA 3QCVH 1FE8L 4PJDA 1YDPA 4LPVA 4ZFZA 3WNOA 4F37F 3MCLL 4KUCD 3H9SA 1GL4B 2W0FA 3HE7A 4JDTL 1DBKH 3NFPA 4GG6E 1ZS8A 2G2RA 2A9ML 2Q20A 4Q6YA 1ZK9A 5DD0H 2Q87A 2YS4A 2AXFA 4P2OB 5EOCH 1MCWM 4X99A 3RWCB 4ZMAT 1A6ZB 4Z78B 3PL6D 3UDWA 4QRPE 5I6XB 3OPZL 4MXWL 4U6YB 1UH4A 3BN3B 4P5TD 43C9B 5IMKA 3H0TA 5H37G 3AGVA 5KOVC 5SWSD 5FDWB 4MA8L 2AKRB 4HXBH 2VLMD 4E5XB 3I3BA 3SO5A 1MI5E 4H88L 4OB5L 3SDDB 2EKJA 4LCIL 4RFNC 5IGXL 5EIIB 3CX5K 3UBXB 4GS7B 4A2LA 4P2OA 1DE4A 2BNQE 3RWCA 1A6ZA 4Z78A 2R8SL 2A6KA 3MV7D 3W9DB 4OSUH 4YHPB 4CW1B 2R0WH 4W68A 3SDAC 3TO4C 4U6YA 1OVZA 2UVEA 43C9A 1RZGA 3V4VH 2YD7A 1J0JA 4PJIE 5KTEH 1JYWA 1N26A 3KXFD 4AT6A 5FDWA 4QOKA 5LKNA 3FAWA 4FNLL 3QHFH 2AKRA 5GGVH 4YHZL 3DURB 2E7MA 3IDYB 1KG0B 3OZ9L 2QEJA 1A6VH 3FQRB 1A7RH 2IQ9L 3SDDA 4CMHC 3E3QE 1OPGL 3U0PB 1FAIH 2F8VA 1P4IL 4LU5L 2FBJH 5EIIA 1NC4A 3UBXA 1LQSR 4HFUL 4IHOB 1WEJH 1TJIH 1JN6B 3GMNB 3W9DA 2YBRA 4YHPA 4CW1A 4V1DB 3VXPB 4F7CB 3J7HA 4OZFG 4UINH 1I7UA 4CDGC 3KPOB 4ZUSB 3T1WA 3U46B 1IAMA 1T1WB 4R96B 3DURA 1TCMA 1KG0A 3O3BB 4YDIL 4NZTL 5HPMB 3FQRA 5GSRB 3VGAC 3U0PA 3B4NA 5E1HB 4JO2L 1FIGH 4K8RL 2BVPB 1WJ3A 4IHOA 2RHEA 1JN6A 3GMNA 1S8DB 1BHGA 5ETUB 4HUXB 4V1DA 3VXPA 4ELMB 4F7CA 5C0GB 1FH5H 1E6OH 2A2QT 2XZCH 4ONFH 3QZWB 3MV8D 3KPOA 2R9HD 3D2UD 2W59A 5EA0L 4ZUSA 5KSUA 3U46A 1KTRL 4YLQT 3T0EE 5EUOE 5D2LE 1T1WA 2APTA 4R96A 3O45B 5JTWA 5ADPH 2N56A 3O3BA 3HZKB 1KCRL 3ZE1F 5GSRA 4HUWB 3B6SB 3ULUE 1TQBC 1IQDB 2YPVL 1ZWIB 3EYUH 2BVPA 2PYEB 4PJEF 1H3UA 1NGPL 1S8DA 1H0DB 1FFQA 4HUXA 1RIHL 4ELMA 5C0GA 3TYGH 2ARJQ 4GKNB 3QZWA 4FP8H 1MVUB 2NXZC 4FG6C 4XMPH 4HMCA 4CVUA 1KELH 2P42B 2BXZA 2XZQL 3O8XB 4WTZG 5KZCD 2A0LD 3O45A 4WI7A 3HZKA 4PJ9C 4CVZB 5CIPB 1J88A 2A1WL 3L3OB 4HUWA 4M43H 3AM8C 4GG6F 5EOQH 1HWGB 1IQDA 1UEYA 1ZWIA 4EIGB 3RUGE 5JW4N 5F7FA 1J1XL 3T08A 2PYEA 3HI6H 5BOPA 1H0DA 3IFPB 1V8HA 2B8OT 2B2XL 4MS8C 1ZGLM 4NNPL 3MRQB 3QPXL 4GKNA 3QNXB 3FHQA 1UKSA 3IYLW 5F1OB 3O8XA 1YMHB 1MY5A 1RUPL 3QUXD 1T1YA 4PP2B 3WD5H 3REWA 3RVVC 3MCKB 3I6LD 5CIPA 4CVZA 4PS4H 3L3OA 1FL3A 1KFAH 1U93A 2D9QB 4OLWL 1KN2H 1RULH 3BPLC 3UZEA 4EI6B 4EN3B 2VWEE 3MRQA 2UUDK 4G8GB 5J6HB 5E6ZA 1I3UA 3UCRA 3QNXA 3FT3B 2EEBA 1TQCB 4PJIF 3OKEB 5CEZE 3PHOB 3L5IA 3WNPA 4G9FE 4PP2A 3QCTH 1S7TB 3GI8L 3MCKA 1RQ5A 1MJUH 1QRNE 1QSEB 2X1XR 5D6DC 5J12C 3HB3D 3S8WA 2DBLH 3GNMH 5DWUL 4MSWB 5F7WC 3F12B 3LDBB 4KI5E 4U1LB 4EI6A 2FJGB 3F7YB 4EN3A 5L7XH 4IDJL 4APQC 4NUGH 4G8GA 4HC1A 5J6HA 3MQIA 1DUYB 4PLKC 4HH8A 5HVWA 3LQMA 3OKEA 3PHOA 1KT2B 2Z0BA 1B0WA 4FQ1L 3RQ3A 4G6FB 1X9QA 1KLGA 1I7RB 3C6LC 1S7TA 1Q9KB 1ZLWH 5E94A 5DJ8B 1EEZB 1QSEA 5D5ME 5F8QC 1QFPA 2C3WA 4HPOH 3ULVL 2AEQL 4MSWA 3RZCD 1J9CT 2P43B 1MFBH 2EXYC 3F12A 3QULB 4U1LA 3VRLE 2FJGA 3F7YA 5FYKU 1CVRA 5TE7H 5D4QA 4QRSB 3X13B 2E7LA 1DUYA 4X9BA 3C5ZC 3ARGC 4XBEL 3STZB 5IVNA 1MEXL 4KMTL 4C55A 4JQVA 3TNNB 1KSRA 1HH9B 1Q9KA 4WGWB 5FAAA 5DJ8A 1EEZA 4LCCC 1NDGB 4HLJA 3EFFB 3K8MA 4X6EB 3VD5A 1CXHA 1JWMB 3B2UD 1FC1A 3QULA 1FRGH 2QBWA 3WIHH 4BUHA 4QRSA 4JPKL 1OAUL 1ULVA 3K2UL 3ZKMD 3QG6B 3X13A 3OF6A 2O5XL 4XZUB 5KVFL 3STZA 4Z95L 4FQIL 3ULSB 3TNNA 2OI9B 1HH9A 3TCLB 2XA8H 1HILA 2WINB 1ZLSL 4K94C 4HWBH 4N9GA 4G9DB 1NDGA 2FATH 4H20L 1AQDB 3EFFA 4X6EA 1C1EH 4I13B 3WS6C 3BJLA 4XCFH 3RUGF 4QRTA 3SCMB 1HNFA 5CZKA 3SGKA 3T3MF 3VMPA 2E6QA 4ODVH 3FO2B 4DVRL 4HUKB 5HYJD 1A7PH 3QG6A 5C0DB 4JFDA 3QRGH 5C0FB 5D2NE 1OM3H 1X4ZA 4LVNC 2AV7B 1A7BA 3ULSA 3HFML 4O9HL 5CCKL 1UM4H 3IAPA 3TCLA 1CN4A 4HKZB 1HDMB 2WINA 1GGTA 5GRYA 3TPUB 4G9DA 4LASH 2VQTA 3L3JB 5DJYA 4GMSH 4LCWB 1CLCA 1AQDA 3LEVH 3SCMA 4Y16D 2BSSB 5C07E 4PJXE 3ZKNC 2PXYB 4KKCD 5BO1H 1GYAA 5IESH 4P2QB 5IROC 4KJQD 1MFCL 3FO2A 4BQ6A 4TQEL 2PNDA 4GQPH 2JCCB 3MREB 5GRJH 4ORZC 4PJCB 5TFSL 2E7CA 5C0FA 3QUYB 4HXAL 2NYYD 4XPFL 1FYTE 2AV7A 5GS0H 1J0IA 3MACL 2XXMB 3EJZD 5HHXH 4HKZA 2V5SA 1HDMA 3GJFH 4P59L 3BW9B 3TPUA 5EO0B 4LCWA 1Y6NR 4JPIB 2NXYC 2H1PL 3N85L 4HKJB 2O5YH 1JNLH 3MNWB 1GGCH 3HZYB 2BSSA 4ZAKC 3K1KC 4Q7DA 1P6FA 4MA7L 2DD8H 4KI5F 1HCFX 4P2QA 2FIRT 3WNKA 4J3UA 2JCCA 2Q3AA 3MREA 1YJDH 4PJCA 5BCAA 5K9JH 1RZKC 2MJWA 3GSWB 2EYTB 3QUYA 7FABL 5T3ZD 5A2FA 2CLRB 2WBJB 3M1BB 4G3YL 3A67H 3EYSL 1WVZA 4U33A 1TVHA 1BJMA 3BW9A 4N5EC 5M95B 1EFQA 2WW8A 4KRNA 5EO0A 2VXSH 1Q9LB 4JPIA 4P23D 4WTXA 1YYLH 1L7TL 4HKJA 5I9QC 3MNWA 3HZYA 4I1NB 4LOUC 4OZFB 2NY3D 3VRLF 2HLFD 2R69H 1CLZL 4J4PA 5JXAH 2J12B 1MNUH 4O2CA 3T0WA 1JHLH 2EYTA 2N7BA 3GSWA 2QHLA 4TVPE 2NX5E 2N1KA 2PO6B 3KYKL 4HIJB 4KRPB 4OCYH 1Q9OA 2CLRA 2WBJA 4FFVD 2K1MA 3M1BA 2K9UA 5SWZE 1WT5A 5IP4A 3D5OF 3MV9E 3L5HA 4F58L 2LV4A 1WIUA 1SJHB 3H3BC 3SKOB 3LZFH 3QUKB 4NZDA 4JHBA 1Q9LA 1Y6MR 5DURB 4HT1L 5IHBA 1T83A 2DQGH 4KJPC 3C8KB 5F96H 2ARWA 1EGJH 4NQDB 3L3GB 4XPGL 5ISZD 2MQ0A 4OZFA 1DLFL 1F45A 4I18C 4X7SH 4P3CH 4WFED 5IBTH 2WWKT 1J10A 2QSVA 3EZJB 2PO6A 4HIJA 4Y19B 3BGFB 4Y4KD 3VXQB 4MB4A 4DKAA 2VLJD 1RZJH 5FYJU 2OJEB 1SJHA 3SKOA 4WY7H 4YXKH 1V7MH 4S0SD 3DX8B 1A3LH 3OG6B 3C8KA 3QUZC 3PG2A 3RBGA 1KENL 3ALXA 2L7JA 4NQDA 3L3GA 4YXLL 2Q8BL 4KK9C 2DQUL 1S7UB 3TM6A 1VHPA 1IMHC 3RDTD 3FZUC 4NKQB 3SE4C 1KJ3L 5BS0D 1M6OB 1F90L 5JA9A 3BN9D 4Y19A 3MRBB 5EZLB 1LP9E 3TC9A 3MJ7B 3A6OA 3VXQA 5CJQL 1KLUB 3L7EB 3MRDB 4IRSD 4XNMB 5HGGS 5C0ND 2OSLB 4O58H 4N1HB 4XPTH 3DX8A 4RMTA 5LCVL 3D87B 3FQUB 4XPAL 4ZFFB 1O7VA 5IFAH 1MCFA 1URLA 1FNEB 4GT7A 2XQBL 2F9BT 4TSBL 3BIBX 3FFDB 4PJXF 1S7UA 4TPRL 2VDLL 2QHRL 1M6OA 3KR3L 3DI2B 3MRBA 5EZLA 3VCLB 5KVDH 1A1MB 1RUQL 3MJ7A 3T3PF 3NBNA 3BXNB 4YGAB 1KLUA 3L7EA 3MRDA 4XNMA 4J2XA 2OSLA 3LS4L 1XGQB 5T5FH 1IEHA 4OT1H 3MXVL 4PJGB 4DN3H 4I8DA 3BD5A 4LAJH 3FQUA 1PG7H 4ZFFA 1FNEA 2QL1A 2ERJB 2KZWA 3FFDA 4PRID 3LQAC 3WFEL 1FE8H 1QLEL 3MCLH 4MZ3A 5D7JD 1SJVA 4MJIB 1N8ZB 3C08L 3CH8A 4JDTH 1EEYB 3OR6A 1XF1A 4KUZL 5LQBL 5BRZD 3VCLA 5D1ZB 2A9MH 3A6CH 4WI2A 1A1MA 2J8HA 4NZUL 1XF2B 1AKJD 3BXNA 4ETQB 3IU3B 3IFLL 4CVXB 4KROD 1XGQA 2UZYB 4PJGA 4CBPA 1A9BB 3OPZH 4MXWH 1ADQA 3PNWB 1OP5H 2Y7QB 4MAYB 3IB4A 3GRWL 2NY0D 1X44A 4MA8H 1JBJA 3HC4L 4MJIA 5JXED 1N8ZA 3H9YA 4H88H 1EEYA 4OB5H 3D9AL 5D1ZA 4LCIH 3WJJC 1JGUL 4NO5B 4QHMB 2GK2A 5IGXH 5MEND 1P84J 1XF2A 3G9VA 4ETQA 3SGEI 3IU3A 4R26L 4ZOEA 4CVXA 2R8SH 1BFVH 3AS0A 4Y2OA 3K74B 1A9BA 5DJ6A 3VW3L 2LU4A 2XTJB 3OJ2C 5MHSE 2Y7QA 3MYZA 4PJFE 4MAYA 1B4RA 1LK3L 4K7PX 5C0CD 4FNLH 3RWGB 4LKCB 4YHZH 3HUJE 4F8TA 5C3TA 3OZ9H 3OKNB 4LSRL 4XRCB 5C08B 1P4IH 4NO5A 4QHMA 1JYVA 5FEBA 3SJVE 1UZ8B 4HFUH 3KPRD 2GJ6B 5JLZB 3P11H 4Z7VB 1JNHB 2BSTA 1Z9MA 4RFNB 4PB9H 3V0VB 4KK8D 4JN2B 1T03L 5E5RB 4LKCA 4RGMB 1JTTA 3V6OE 3OKNA 4YDIH 1TFHA 2G75B 1MIEL 3QBTB 2XWBB 5FGCB 3SDAB 2GW5A 4XRCA 3TO4B 5C08A 1LP9F 4JO2H 5DK2B 2DMBA 3BJ91 4LCUB 4K8RH 5ECJE 1A14L 2GJ6A 5JLZA 1EO5A 3DVIA 4KJWD 4XVTL 3ZHKA 2MHAB 3O9WC 2VLLB 4Z7VA 2CUIA 1JNHA 1HINL 5D7LD 3LD8C 3TJEL 3O6FD 1WWAX 5FECB 4AQOA 5EA0H 1LNUB 3V0VA 3WO4B 4JN2A 5F97E 2ZKHL 3JWDL 4YEFA 5JDSB 1AI1L 4DZBB 1JHTB 2G75A 4U7SA 2XWBA 1KCRH 1CT8B 2Z93B 4HW6A 3SDAA 1C12B 2AJ3B 5I1IL 3TO4A 4AM0B 4YHNB 3PXJA 2YPVH 5DK2A 4F15B 4LCUA 4JFEE 1TENA 5K9KB 4BSVB 5EU5A 5SX4I 1L7IL 1C16B 1NL0H 5E2WL 4KVCL 5FYKL 5FHAL 1RIHH 2VDKL 2BVYA 2VLLA 2LTQC 3CXHJ 5DQ9B 4ORGB 3VGAB 5FECA 1LNUA 5A2IH 4JM2D 3CIQA 3WNLA 4JG1L 4ZO8A 1BZ9B 2VISB 1I8MB 5JDSA 2EYSB 1J7VR 1ZANL 3DOSA 3DBXB 2RFXB 4LP4A 1CT8A 2Z93A 4L29B 5IK3B 1LEIB 1C12A 2AJ3A 2NY6D 4JEGB 1MCDA 4YNYB 4YHNA 4JR9L 4YR6B 3L1OL 3WJLC 3CXDL 1J1XH 2IH1B 5K9KA 4BSVA 1C16A 1SVZA 3T0BA 5DMKB 3OHXB 5GZOC 2VLKD 4NNPH 2WLZA 5DQ9A 3QPXH 4ORGA 4L9LC 3NCFB 1XCQB 4HWEL 3EOTL 4C57C 1IL1B 1BZ9A 1RUPH 1S9XA 2VISA 1I8MA 2EYSA 3FFCA 5C70A 3VFSB 3DBXA 2RFXA 4L29A 1LEIA 4YDJB 3HAEB 4YNYA 1YPZF 4YR6A 1XGYL 4LDEB 4LQFL 2NY5C 3CH1B 2IH1A 3CFKB 2YWYA 1J5OL 5HHMD 3TZVD 5DMKA 3OHXA 4JFPB 1EUTA 3DTXB 1UXWB 4KPHL 4NHCL 3F62A 2NMSA 4L8BB 3MMEB 4XMLL 4D9RE 1E4WL 2YA1A 1NKOA 4HMEA 1XCQA 1T22A 1F58L 5FM5O 3VFNB 3DUSB 4NGHL 4L3EE 4PJFF 1IL1A 3TVMD 3D85D 3V6FB 2YD9A 4XWGL 1IC7L 2OTPA 1GOHA 3GI8H 3HUJF 5FCUL 5HHOB 3G6JA 3THML 4OJFL 5C0BB 2C5DC 4OZGB 3EYQC 3HAEA 3GIZL 4JKKA 3CH1A 5DWUH 3RY5A 3CFKA 3CMGA 4DN4L 4JFPA 1UXWA 2YUVA 2R2CA 3HZVA 4IDJH 1VACB 3MMEA 4R3SB 4G42B 3BGMB 3ALPA 5A3IC 5GRVL 3VFNA 1C5BH 4Y88A 4YBLB 4ZSOE 4JFFE 2F54D 3V6FA 1QA9B 4NQCB 2FD6L 4F57L 2AW2A 5HHOA 3BPLB 2ZP0T 5C0BA 4OZGA 4JM4L 5HY9B 1RSFA 2E5EA 4KMLB 3ULVH 5J06A 2AEQH 3ARDB 5HDQH 3W9EB 4XI5C 5E2JA 2UY6A 1VACA 4U0QB 4R3SA 2GITB 4G42A 4N1CA 3BGMA 1DQTA 3D3VD 3VXRE 1B6UA 2QJDA 5A2JH 1KEGL 1T3FB 2CR6A 1T5WA 4XBEH 2BY2A 2P1YA 3ARFC 5FA4B 1MEXH 1QA9A 4JRYD 4KMTH 4NQCA 1TVDA 4DW2L 3QI9D 2XZZA 3UROR 4NBXB 4G6JL 2HAZA 4APQB 1T66D 1LEKB 5HY9A 3K1DA 2XXCB 3OL2A 2D31A 2EECA 4PLJD 2BNRD 3UPAA 4HC1H 2X2YA 3PE9A 3ARDA 2VZ1A 3U7AA 4S11A 4Q9CA 3W9EA 4JPKH 1TIUA 3K2UH 2GITA 1W8NA 3SBWA 2O5XH 3LEXB 1P7QB 1R5IB 4R7DB 5M7QA 4TUKL 1T3FA 4XCYA 5KVFH 3QRFM 1CD1B 2VXVL 5GRXG 2ZZUT 1I4FB 4Z95H 5FA4A 5KBNC 3QDME 5E9DD 1H9VA 2JIXB 4XX1E 1UCBH 1ZLSH 5BW7A 4APQA 5LBSL 1LEKA 4X0KB 4H20H 3HG1E 1JGLL 3C5ZB 3ARGB 4YUEH 2FDBP 3QIWB 4ZQKA 3MUJA 3DSFL 1EEUA 4K07A 5DO2C 4DVRH