4Y5VC

Diabody 305 complex with epor
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
215
structure length
206
Chain Sequence
PKFESKAALLAARGPEELLCFTERLEDLVCFWEEAPGQYSFSYQLEDEPWKLCRLHQAPTAGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGQGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tuning Cytokine Receptor Signaling by Re-orienting Dimer Geometry with Surrogate Ligands.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/immune system
molecule keywords diabody 305 VH domain
total genus 40
structure length 206
sequence length 215
chains with identical sequence F, I
ec nomenclature
pdb deposition date 2015-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00041 fn3 Fibronectin type III domain
C PF09067 EpoR_lig-bind Erythropoietin receptor, ligand binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y5vC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y5vC01
4QHUA 3MCKA 1KT2B 3S88H 2GCYB 4MCZB 4OFIA 2N7AA 3R0NA 2C3GA 4FXKB 4BZ2H 4OZGF 3DROB 4RGNC 3BT2H 2P43B 4YO0A 1QYGH 4PRDA 4OTXL 1FZKB 2GCYA 1KIPB 1P7QD 3RQ3A 1JF6A 1MSPA 2F53D 3KPQB 4DGIH 1BFVH 2GFBB 2NY3D 4Q9CA 3BIAX 2IFGA 3R8BB 3FL7A 2V6HA 1NFDB 5JW4M 5C0CD 2R0KH 1K9TA 3ULVD 3WBDA 1MCFA 3ULUL 4J4PD 4C54A 5IB4A 3DV6B 4JFDE 5TE7L 1RAMA 3EFFA 5DJYB 5LWYH 4JPWH 2XACC 1EEQA 4KKBD 4YHLH 4OF3A 1NUDA 1C16B 5SX4I 1LO2H 4X4YB 1GHFH 2B5IC 2V5RA 4NZDA 3S35H 3MR9B 1OAUL 5JNYB 5EORL 4GKSB 3FO2A 4XRCA 4JB9L 3C5SA 4Y4HC 1T22A 1PSKH 5AD0B 2IPKB 2V2WB 3GMNB 4Y4HB 1RUAH 5BVJA 3H42H 1V7NL 3CLEL 4NRYA 3V4UL 3GSWA 3SE8H 2VXTH 4M6OL 4PJXB 5GHWH 2VO5A 2VR5A 1UXSB 3S8WA 1HYRC 5DJZB 4TPRH 2LABA 4HZAA 5C0DA 4XI5D 4JVWA 5I8OH 5C0CB 1MUJB 5DQJB 5DD6B 2XQYG 1DQJB 3QIWD 3TYFB 2LV4A 2XN9A 2NX5B 5AAWA 4KZDH 1CDJA 2DF3A 4MXVF 3DBXB 5BQ7A 3OKLB 2OR7A 4R90H 5BV7C 5DJ2B 3I85A 2V5TA 3UAJD 3U4AA 5FUCE 5E2WL 2EDRA 3TYFA 2F53B 4FXLA 3ARED 3AMLA 1P7QB 4LNVA 4Z7OE 2BNRB 4H1LG 2H3NB 3O4LD 4XCCL 5FUOL 1VENA 1YEDA 1V05A 4S2SB 3EJYD 3VXUA 1CICB 2FECI 4MDIA 4NQEE 2GK0B 4C83B 4S2SA 2FB4L 1M7IB 1MFBL 5HHNA 4YAQB 4HT1H 3MOAL 4JJ5A 2HFTA 4W6YB 1P6FA 3QHZH 4AL8H 4WEMB 1FZJB 5ESAB 1FPTL 3MRMA 4F7TA 4NRXB 3VGBA 3U0WH 4HDIB 3L7EA 5FM4A 1MJ7H 1EUTA 3CFDA 1CDBA 5E94B 1NEZA 4KHXL 5JA9A 1S9YA 1IC7L 3D9AH 4V1DD 4MGXA 4JZOB 5DXWA 4JFOA 1CZ8L 1HKLL 4HGKC 3FT4B 3S96A 3WFEL 1RV6X 2X4UB 1JPGA 3RVTD 1K2DB 2OR9H 2R0WH 5IMOA 1GIGL 4LCIH 4PRIE 1WF5A 4GKOA 3BEVA 5E6ZA 5L0QC 4LSPH 5C2BL 3SE4A 5EIQA 3HFMH 4M7LL 3B2VH 3MRBB 1IRAY 4WO4C 3V5HB 2NTFA 1F58L 2GKIA 3H3BC 2RCSL 5IGXH 2OBGA 4P4KD 3VXRE 2DYPB 1ZANH 1C08B 1IARB 4YBLC 4WW2B 3PWPA 3D69B 1GGBL 2D3VA 4JFED 5FM5M 4OGYH 4JN2A 3O2VL 4OZGB 4J3UA 4M7JL 5GS1B 3G08A 2WZPD 5T33L 5HPMB 2BNRD 4EXPX 4O02H 3EDFA 3SPVA 4HWNA 3Q3GB 1JRHH 2PR4L 3H7LA 4OD2B 4L8BA 3TT3H 3U4EA 2LU3A 4FQQB 3VFRB 4MZ2A 5C08E 3VXUB 1CLCA 5CJOL 4OLUH 3RUGF 2CMRH 4DWHA 3FT3A 4FQCL 3LH2H 4MNQD 2C1PA 3MYJB 4BSWB 4DVRL 1S7WA 3C09B 3MACH 2ERJC 1N6UA 1YEJL 2J1KA 2CPCA 3I3EA 2P7TB 3ES6B 5BV7L 1YMMA 2ZKHH 1E4KA 2NW2B 3A67L 3VXTB 3FMGL 4HIJB 4PGCA 3SE8L 1ORQA 4WW1A 4YEEA 4X4MA 1MEXL 1CXHA 4PV8A 5JOFB 2A9MH 5JXED 4LPWA 1IGMH 4XPAH 3VGFA 4JM2F 2KUTA 1JZ3A 4ZD3H 8FABB 2Y1VA 5KVFH 2AEPH 4WEBL 1FFRA 4QRUA 1M6OB 5I2IB 1GOGA 4KKCC 4JHAL 4NQTA 3BVNA 5DD5L 3C5SB 1JBJA 3B9VA 5DEFA 5EZJB 5JR1L 3FAXA 2GJ6D 1U8PB 2BNRE 5KSAD 4OB5L 4R2GD 5F3HB 3QO1A 2J12B 1UXWB 3G6DL 2V7NB 3QPQC 3F5WA 2O61B 4LHUB 1ORQB 2UWEB 3BD4A 4RMSA 3K4DA 3F65A 2YC1B 3MO1A 1UVQB 5DJ6A 2X41A 5HDQH 1MHPL 3B6SB 3CK0L 5I76A 5IJVB 3ARFC 3OGCA 3P4MA 5D8JL 2EDBA 1LK3H 5MERB 4D0CB 5C7XL 2YS4A 3PHOA 3VWJD 4PGJA 1LE5B 3L5HA 1XZ0A 4FTVA 1WUNT 2YR3A 4XMPH 1R3LA 4BH7B 4NO3A 3RNQA 1GGUA 2J5LB 4QY8B 1JK8A 5ACZB 2A83A 1HXMA 1UT9A 4PJCF 4PJEF 2W1NA 4TSAH 5C1MB 4O51B 3O8XB 3QDJD 2MHAA 3HZVA 3TZVD 4X9BA 1NGQH 2XA8H 4S1RL 4QRRD 4OI9A 3DX7A 2PCPA 3H3KA 5J13B 5EZIL 4XNMB 3C87A 3E6FB 3WFBH 1MJ8L 1YUHA 5CSGA 4W6XB 2YC1A 5EPMB 1A22B 3AXLA 4OB5H 3KYNB 3L7FB 3BP7B 3VJ6A 2RQ8A 3O2DH 2H41A 3QUMB 5DZLA 4K71C 4O9HH 4DCQA 1JZ5A 4JRYE 4YDVA 3BH9B 3KNBB 4R97B 2C4FU 1DBKH 4IIQB 4Q9QL 1BVZA 4MD0B 1J5OL 4XVJL 4UDTA 4MNQE 5E1AB 4Z7WE 5HHXH 4P3DA 3IXTA 1GZQA 4NHCH 4JFFB 3NABH 3DSNA 1JI2A 4K2UH 3FAWA 5TFSH 4LCUA 1HHIA 1L7TL 3QPQD 3HZVB 3DTXA 2VDRH 4KI5F 1ND0B 3LS4H 4BZ1L 4LOUD 5MENA 1MF2L 1PFCA 3GJEB 4KROB 43CAA 4XCYB 3PABA 4MJ6B 4JKKA 2F74B 3HMXH 1EHXA 5E00B 2APWA 3F62A 4ODVH 5MI0B 5HGAB 3NIGF 1IL1A 4TSBL 3IFPB 1DQML 4K7FB 1PKQA 5I66B 5KSBE 3ARDD 4RWYL 5C0BA 3CLFL 1A1MB 5GSVB 4L4VE 5C07E 1A8JH 4NC0B 2BSSB 3QXAB 5DGQA 4PB9L 3HI6H 2EYTA 2NY1B 4JZJC 2G2RA 4WW2F 1FN4B 4LLQA 4ZSOB 2LFGA 3Q5OA 2F74A 1P5UA 3Q0HA 3HC3L 3CCHB 5A16B 1N2RA 4ELKA 5HJ3B 1G7LA 1RZ8B 1MHCA 3FQNA 4QHNB 1A6AA 1OTSD 2NW3B 3MJ7A 2ZCHH 4Z8FH 4AEEA 2I9LB 3GSRB 4W4OC 5DEZA 4XBPB 4K94L 2XV6B 4KHTL 4L8BB 4UTAH 1V3LA 2X7LB 2YN5A 2EIZB 1U8HA 3DARA 4IMKA 5EDXA 4B41A 4NO5A 3MRGB 1FNSL 1G7JB 2DJUA 3VFMB 5SWZD 4JZNA 3L3GB 1T04A 2ENYA 3QXDB 5AG8A 2R8SL 1CK0H 2CIIA 3U4BH 4OM0L 5CGYC 1B9ZA 4JQVC 1EXUA 5CZXD 4L8CA 5LGHH 4OKDA 3UJJL 4KQ4H 4U0RC 4JFZH 2WBJC 1LQSR 1Q9LB 4PJAE 1X4XA 3BGMA 1GCFA 3LQZB 4CUCA 5CIPB 4PRBA 4IRJA 4D9RE 4NBZB 4NP4H 4YX2H 2ATKA 1CZ8H 1HKLH 5E56A 3WFEH 1WEJH 2I25N 3RUGB 2FGZA 4MX7A 2AQ2A 4S10A 5ILTH 4GLRH 1VFOA 4KQ3H 2XIDA 4FZ8L 2MPAL 3TCLA 1IFHH 3FFCB 3MRPB 3OB8A 3D2UA 3QR2A 1I1AB 1T22B 4MNHB 4QNPE 1LK3L 3O0RH 4M4RA 1VFBA 4LVEA 4R7DA 1MJUL 1ZGLB 3WIIL 4JRYA 1KXVC 1UFUA 4JAMB 5CJXC 2BHYA 3GUTB 5DUML 3K8KA 1S9VB 5A40E 3LN5A 3BQUC 3QQ4A 2I60L 1CLYL 4G6FD 1P1ZA 1QEWA 5EIIB 4F80A 4MD5A 1XH3B 1BD2B 5HYJA 3IFOB 3IGAB 5EWIL 4ZG1A 4D0BA 3ARXA 4BQCA 2B0SH 3HAEB 4RCAA 3G9VA 2H2SD 3VU2A 2ESVE 2GQHA 3BPLC 1Q38A 4PRPD 5F89B 4XCCH 4N0RA 1DBAH 5LXGL 4ZOAA 4Q9RH 3DROA 5D6CA 3UTZA 3TM6A 1MFCL 2FX8L 5DFVC 2EE6A 1QTYT 4M43H 5EZOH 1KIRA 3RKDD 1HWHB 4HFWA 4QXTB 5IWLA 4U1JB 2Y7QB 2E8YA 4M7LT 2FJGA 3WFHA 1T1ZB 3T4YA 2PNDA 1KLUB 5FCSH 1Y6MR 1S7SB 4UIKL 3T0EB 4EI6B 5HVHC 2RIKA 1DANU 1DEEA 4OF5A 2CKBH 4L9LB 4GAFB 1HI6B 5HYQA 4I9WD 2BSTB 4F37K 2Z4QA 4NO2A 1A2YB 5DJZA 1K4CA 2DI7A 3WD5L 4U6VL 4DGYL 2DI9A 3QAZB 3HG1D 5DA4A 5IMKB 4YAQA 4TOYH 1QUNA 1TNNA 4L9DA 5BZWB 3ZSSA 4MJ6A 2BZDA 5D6DC 5DJAA 2BVYA 1LEKA 3UYPA 1P4LB 4P5KA 4MAYD 5JOPD 1QP1A 2NY4B 4M7ZB 2QHLA 3TP4A 2LQRA 1HHIB 1G9ML 3G5ZA 4R3SA 5B39A 3WO3B 1IE5A 1A9EA 3E8UH 2QSCL 5J57B 1J8KA 2DI8A 5F1NB 43C9B 3ME0A 3ARBB 1PJ9A 1ZS8B 1NDMA 5HPOA 4KUCF 3O6FD 1DEDA 4QRPE 3NOIA 4BH8A 5GZOC 4ZSOE 5SWQA 4KRMB 4YDVB 1JZ7A 4EDXA 1PZ5B 2FCBA 5EN2A 2QEJA 1HNFA 3WXVL 2VLRA 4KUZH 1NSNH 1E0OB 4XCNA 1FGNL 3FQUA 5B8CA 1N5YH 5IOPB 5HHOD 1T5XA 5FGBC 3X11A 1JF5A 1QSEA 1I75A 2G9HB 5DO2D 2ED9A 1JNNH 4WCYH 1FAIL 3GIZH 5C0NC 3MGAA 3VFPA 2AJUH 3W9DB 1W72L 4O2CA 4YIQB 4HC1A 1OP3H 4QNPF 1XGUB 3QIUA 4WWID 3PDOA 1FG2B 2VXVL 1JHTB 2PYFB 3U2SA 4J2XA 5LGJB 2F8VA 4KQ4L 1YEEL 3O6KH 2LE9A 3MRKB 1YA5A 1U41A 4YXKL 1ZKAA 4OIBA 1JNLL 3RBSA 4QRRA 5ESAA 3V52H 5D7LE 4UQ2A 2DQGH 4H26B 4OZHF 1HCFX 4P23D 4ELMB 3VFSB 1DLHB 4WFHD 4DZBB 3U36B 3TC9A 2Y5TB 3FB6A 5DJCB 5F7NC 4ZUTB 4QHMA 4PLJD 3C6LC 3QEUA 4X6BB 3HAEG 5HGBA 1Q1JH 1RUQH 3EO1A 2NZ9D 2Y6SC 3HI1B 3LPFA 1QSFB 5D2LF 1F6AB 3HLAA 1CBVL 3WS6C 1FZKA 4U7MA 1DSFH 3LD8C 4YGVB 4DEPC 2W60B 4O58H 4P9HL 5IVZB 5T1LB 3ROLB 2Y9RT 5FM8A 1MCKA 3VXMD 3ZDXF 4DGVL 2Q6WA 1V3KA 4N90D 5E2VH 1Q72H 1YEGH 2VDQL 4U1HB 3GNML 1HQ4A 4S1DC 1LGVA 3KPMA 4P9MH 1UA6L 5DRZB 1IKFH 3SQBA 35C8L 5ICZA 1QBLL 1F8TH 4OLVH 1NBYB 5E99H 2E8ZA 2IFFH 4OT1L 4MS8D 5E2VL 3DXAA 4JRXB 5IHBA 2BVOB 1R3HA 3SDCD 1WFUA 3V4VL 1D9KB 3VG9B 5GGVY 3QUXB 3ALXA 4PY7B 2C7UA 4GAYA 1CXEA 5B8CC 1NCUA 4NN6B 4E5XA 4RZCB 2D7OA 1JPSH 2DQFB 4M93B 3MOQA 3IFLH 4HF5L 1G7IA 1R3JB 4HPYH 1T7VA 2FATL 4C56A 1F4HA 1A7RL 4N0UE 4MHHI 4CL7A 4RWHA 3MRDB 1KCUL 2D0GA 2L7JA 3MNVB 1I1AD 1JNLH 1NJ9A 2CRIA 3VH8B 1NFDA 2D7TH 1C5DA 2F58L 3IDGA 3B9AA 5E4EC 5IB5A 1FYTA 5HYEA 1X5KA 5ISZE 5KJRH 1EZVX 5TE6H 1S7UB 5BVPL 4LASH 1KIPA 4WHYH 1A6WH 2YKLL 4L1DA 3CPLA 5EZLA 2VDOH 4BZ2L 1IM9B 1FP5A 4M3KB 2N1KA 2VR4A 2EIDA 2X4RB 5JIKA 3MREB 2QADD 3IJSA 3T8XB 3WN5B 3QH3A 4HEME 4JCMA 1WZ1L 2YA1A 4G42B 2Q86B 4Z77A 4HG4J 2AXFA 5HVWA 4P5MB 3WV0A 5EO0A 1CFVH 2HTKC 4G6KL 3NFNB 4HLJA 1A6WL 2PW1B 4HUNB 3GI9L 1QRND 2X5PA 3OAZK 3DECA 1RJCA 5FCUH 4B53A 4GMTL 3GBNH 1UC6A 4P2QD 3S97C 5F6HI 2VXQL 3ZDYF 2B20A 4Z78B 3QHTC 3D39B 4K71B 2H32B 5CP3H 4IS6A 2IWGA 4XP6H 5C3TA 4YC2B 1AXTH 4DUVA 5K33A 3T2PA 4X6DA 5T3ZH 4JHAH 1ACYL 4OFDA 3NFSH 1X4YA 2I26N 5JR1H 2A0LD 2Z91A 3CDYA 4OCSH 1T0NB 1GVIA 3P11H 6FABL 4KTYA 4GLRI 2RAMA 5I18H 5CP3A 4K7PH 4BA8A 5FKAA 2R2HA 5C08A 5TGBB 2ZSVA 4LEXL 1J86A 2IPUG 2BOCB 3MGTA 4MNGB 1IGML 5HI3D 5E6IA 1OT1A 2QQLH 4M61A 1Y6KR 3ARDB 4JG0H 4F33A 3CSYB 5DF0A 3MC0A 1UH4A 2CRMA 2EC9T 4ZPTB 1U8QB 1ZHNB 2ZCLH 4C59B 4XGZB 2DQJH 4XMKL 3VFGH 3TF7C 1QFUH 4PG2C 3IDMA 3I50L 4PB0L 2ATPB 5F97E 5MEND 1IL1B 4PJ7B 3REVB 1U8JB 5KVGL 3FRPA 3ULUD 1INDH 3GSWB 4NQEB 2AW2A 2VDQH 1Q72L 4WY7H 3BWUC 4NZTL 4HS8L 4L5FH 3N1FC 1KPUA 3FB7B 1UCTA 3A6BH 3G5VB 3WE6B 1LEIA 3TH2T 3RZCB 4M5ZH 5C86A 5EBLB 1BQUA 3CDGA 3GO1L 2WANA 1NMCB 4HGWA 3U46A 4OJFL 3MXWH 3PL6A 4M7JH 4PJ9B 1KEGL 4TTDD 1KELL 4V2CB 3MXVL 4JO3H 5IESH 5AZEH 3VGEA 4BK4A 1FDLH 4NKDB 2BRRH 2FX7L 4JAMA 2IAMD 4OD3H 1ZT7B 5L2KD 1RJZB 4Q97A 1J0HA 3CSGA 4G6AC 1E28B 1O7SA 4RGNB 4Y8DC 3MUJA 3EHBD 4HXAL 2HLAA 2IANA 4PJIA 1SMOA 4L3CB 2VXVH 3C8KB 3WL9A 2CKBB 4YX2L 1HH6B 1OM3H 4ELMF 3KWWA 2IALA 5E2TL 4K3DH 4PLKD 4PTUB 5JXEA 2MTPA 3BDBA 5FO7B 3QRGH 5KSAB 3SDCA 4ACPA 4Y4KA 1EHAA 5JPMB 5CEZE 1YQ2A 5I75B 1T7XA 1T2QL 1ZV5A 3WFHB 3BP4A 3K7UA 1WV7T 1W0VA 2Y7QA 4XNYL 1IGCL 3DUUA 5ENWB 2VDKH 2M1KA 2ADIB 4N9GA 3TZVC 1XCQA 4JM2A 1AHWA 3BJLA 3KPLB 3KPPB 3CVHH 3P9WB 4QOKB 2OXHA 2X4PA 3MXVH 4QTIH 1WSST 3PG2A 4QRRE 2BVQB 3EJZC 1MHHA 1IGTB 2GSIA 2CK0L 3TN0A 5I1JL 3HRZB 2QTEA 4KJYB 4PJIF 1QVOA 3BDYL 2XQBH 8FABA 2E9IA 3OZ9L 4DKFH 4NYLB 4P3WA 4U1LA 2IAMC 5DVLA 1P53A 4P59L 4NNYA 4OFVA 4HUWB 4ZQKB 5GGTH 3VFUA 4LKCA 3RDTB 1A6VL 4E41A 3SJVB 1WBYB 3AVEA 4U1MA 3P2TA 2NMSA 1CGYA 4G8IB 3KDMB 1VGEL 4HKZB 3ARQA 1HH9A 3WNMA 5MEPA 2B4CC 1OPGL 4G8GE 4GAGL 3T0EE 4RWYH 1QFWH 3WLWC 4IMLB 2JB5H 4PJGB 3WHXA 2ZZUT 1JGUH 4OF0A 4FXGA 5J6HB 3B8YA 4ENEC 1YMHB 2VLLA 4U1LB 2X4RA 3C6LB 5JQ6H 4I3RH 4XCFH 1KB5B 5F7FA 1VFAA 1CDGA 5EU3B 4KKAC 1XAUA 5FYKU 4S1SH 3BP5A 2ZPKH 4UT9L 3ZKMD 1JZ8A 3OG6B 4NQSA 2DQUH 4YHYB 4K7PY 2ZUYA 1N26A 4ODBD 1CTNA 3L9RB 5GGTA 4HX1A 4GKZA 4ZAKD 4IDLA 2B4CH 4RIRB 2IC2A 3L3DB 4LSUH 3CVHA 4PTTA 4S1SL 3SDCB 3O41B 1Q0YL 4HZLB 1SJEA 3MV9B 5J11C 3C6SB 3CSBA 3O2DL 5HHOA 3X3GL 4CVXA 3GUTA 4ORGB 5EPMA 4M6AA 1FRGH 1BFVL 4OZFA 4EVNB 1RZIA 4ONGL 1EBAA 4XVTH 3TBVA 1ZGLM 1TLKA 4I18C 4RZCA 4OF7A 2NTFB 5IEHB 1AI1H 1S9XB 3BMWA 2X70A 2O26U 5FXCH 2XTJC 4BSVB 3WIIH 2DD8L 5E8PA 3SDXF 4DZ8A 1MJUH 4CVZB 1SQ2N 1N0LA 3O6FA 1QYGL 3LKRB 2A6KB 1VADB 4BK5A 5J0BA 4XP9L 1LO5B 1G7QB 1S7UA 1TZGL 2FD6H 4I5BA 2WBJD 5BRZA 5FA3A 1FNEA 2V7HB 2EYRB 2XWTA 4RFEB 4JDZB 4PLNC 3GSVA 3BD5A 2VYRE 3WFDL 2DQIH 4HJ0C 1I7ZB 4LEOA 1J0JA 2HT2D 4EDXB 1XGRB 3B5HA 5I9QB 3EGSA 5FB8A 1JWUA 3SDDD 1ED3A 1A4JA 3MA7A 3C2AL 1LD9A 4MXWH 4P23B 5BMFH 3A0OA 3QEGH 1KN2H 4PG9A 2EKJA 2VWEC 4X6DE 2NXZC 2CLZA 3SGJA 1PYWB 1SVZA 2X4TA 4RSVA 1HILA 4XMLH 2HH0H 5IF0B 4PJ8A 3AREB 1LEKB 3PGCA 4ELKB 2YBRB 5IUSA 3DVNA 3OKDB 1YPZA 1R3HB 3MA7B 2R2CA 4NDMA 4KC3B 1ZT1B 1MELA 3KYMA 4XC3H 1NGZA 4AH2A 4DCQB 3SO3B 2IBZY 3BXNB 2QQKH 1MCCA 5HVGB 1BQSA 4TVPH 1ZWIB 2BDNH 2XRAH 1Z3GL 3MRQA 1VEOA 4R4FH 4OFYA 1YN6A 1TQBC 4FFWC 4P5TC 4HH9B 1J1PL 4F33B 3NZ8B 1F8TL 4OLVL 4AY0A 2F54A 4ZFOB 4ZUWA 3OKDA 2AI0H 1KG0A 4EI5B 2OTPA 4P9ML 3P0YH 4JQVA 2FH6A 3FZUD 3LH2L 4KJYA 3SCMB 4I0PD 2PW2B 5D6CB 2G9HA 1MPAH 4I2XE 2OK0L 4OLUL 2GTZB 3RTQA 6CGTA 3D6GA 5I6XB 2WV3A 2M2DA 1CS6A 1GSMA 4PFEA 1GGCL 2FR4A 4G8EA 5CKGA 3RWIB 3CSPA 2AJYH 5DD0L 5J7CC 1CYGA 2UVFA 4LDLB 5I74C 1EEYA 2WAHA 2DDQL 1KTLB 2DM4A 1QR1B 1K5NB 1B0RA 2VUOA 2OMNA 3VMNA 5CJ8A 2GHWB 3LY6A 2VQ1A 5ADPH 3EJZD 3LOWA 5B38A 4EOWH 1R3JA 2HLFD 1G7JA 1TDQA 4L5FL 3VFMA 1X5AA 3OBAA 5KOMC 3RPKA 3DRQA 4OGZA 4P57B 2DWDB 3TN0D 4FG6D 1EFXD 3RZCA 3QDMA 4YUEL 5LCVH 2WLYA 2QHRL 2NTSP 4OBSA 1PW3A 1KF9B 3HPLB 3RL1A 5DK2B 4AT6A 4ZUVA 3LDBB 3F12B 3LDBC 2GY7B 1DUZB 1TJIL 4X7SH 5GJTL 4L4TD 2D9CA 3KG5A 4Z6AT 5K9OA 3ILPB 5FF6A 2Y25A 3BZDA 1FAIH 3WLWD 3ULUE 1L9NA 4Y5VA 4JZOA 1OLZA 3P4MB 1ZT7A 2FBJH 1NUGA 5F3BA 4CVXB 3MBXL 3MJ9L 5DDHB 2P7TA 1K6QL 3MRDA 5DFVD 1MCSA 4K7PL 5CSBA 3L3DA 4RISL 5BS0E 4F9LA 5IBLD 5D5MA 4LKCB 3U7YH 5IFJB 1T1YB 2YD2A 1LE9A 4NKMB 4J1UA 2XA3A 1OAZL 4I4WB 3KS0J 3HZMA 2ITCA 4OD1H 3ZKMC 2ICWJ 4WWKD 4TVPD 3T04D 4H5SB 2EKSA 4TULL 4CNIB 2FB4H 3RWCA 3G6DH 4JO2L 1T1XB 3W9EA 1NFDF 3N85L 1G9MC 2DWEA 2BJMH 4GRMB 1WIPA 2J8UF 3BW9A 5FYKH 2CDEB 4JM2D 3ZKNC 1DLFH 5TDNA 1KSRA 4XPFH 1FSKB 3ESUF 5L2KE 4FABL 5KVMC 5FUOH 2B2XL 3E6HA 1TVHA 4MD5B 1D6VL 1KJMA 3BP4B 4G6KH 5FFLA 1QEWB 1NC4A 4ZOBA 1PX4A 5F88B 4NQXB 3WSQH 3K74B 3EZ8A 2NNAB 2FRGP 4YDIH 1X5LA 5E8NB 3WKNA 4CN1A 4RFEA 5HI5C 4X9GA 4KDVA 3BQUA 2DL2A 3I3BA 4ZFOL 1PEWA 3KLAA 3U83A 2BSRA 1CL7I 1VB9A 5T3XE 3TO4B 4HUVA 3GDBA 4Z7VE 4HD9A 1BVLA 1HCVA 3KJ4B 3MJ9A 3K4ZA 4X7SL 5E7BA 5INDB 4KV5E 3UTTD 5L9DL 2PETA 3EO9H 4IM8A 3T1FA 5HHPB 1FRGL 2X9YA 5MENB 4DTGH 1FL3A 3RNQB 2RB8A 3WUZA 4PJDF 4P2RE 5BJTB 4PIRF 3FT4A 4OCWH 3BE1H 3ECBA 5C0FA 4OZFB 2MCPL 1XF5B 1Q9LA 4NWTL 2B4CL 4X99B 1OT2A 4HBCH 1UM5L 2ITDA 3SKJH 1U91B 4YNYA 4A6YH 2D2OA 1GXEA 1I1CA 4JQXC 4P9HC 3BP7A 3UP1A 3VJ6B 1RHHA 4OZHE 4JM2C 3ESVF 1I9RH 5E4EB 2IGFH 5F1NA 4N8VB 2IALB 3WFCH 2KKQA 3U6RB 3S36L 4LCWD 5E9DB 1F11A 4HIEB 4F37F 4P5TA 2WWKO 1MIEH 1ZLVK 2ICEB 4DGIL 1XGUA 4NJAL 2ILLA 1KPUB 3FB7A 4POZC 4XX1G 3HE6B 1WFNA 1LMKA 5FHAL 3S34L 1AIFA 5HHQA 5HJ3A 5JIPA 5DK0B 1L6XA 2Q7YA 3L3IA 4PJDA 3RFZC 1EHLH 3MLUH 4QRQB 2BNUA 3AU1B 4P2QB 4LSRH 1FN4A 1P69B 4G5ZL 4LLQB 4ZSOA 1DTUA 2BRQA 4IHOA 5INCB 3GNMH 5IBTH 4UB0H 2VL4A 2L0DA 1CFBA 2XZCL 3UTTB 2E6JA 3RY5A 5T5NG 2HFEA 4RA3A 4ZXBC 5T3ZD 1QRNE 4KK6C 1XF3A 1I1YA 4UAOC 4EUPH 2YD4A 3BXNA 3RU8L 3L7EB 3S5LA 4Y4FA 4OI7A 4PGZA 4F9PA 1IBGL 3MRMB 4JDTL 4JPKH 1BAFH 5C0CA 3EUUA 3HN3A 1RIVH 3TIEA 3ARPA 4Y2DA 2HG5B 1A6ZB 3U30C 2C1PB 3MYJA 5JHDD 3GB7A 4U0RB 4G3YL 3GIVB 4YGVA 3AMKA 3AAZA 1AD9A 1HIML 2GI7A 5I8KL 3KR3L 3UO1L 3QJFA 5H37H 2YPKA 4HT1L 5GGUA 4K3JL 1OHQA 4LF3A 3TNMB 1D6EA 1JV5A 4JVUA 5LVEA 3B5GA 4JM2B 4LP4A 4HCRL 1BZ9B 1PBYA 3WLBB 1A4JB 3SKNA 2PTTB 4WHCA 3VFSA 2H26A 3OXSB 1ZA6B 2WBKA 3SY0B 3EFFB 5DJYA 5J3HD 4WI4A 1AGFB 2P5WA 3CFEB 1RQ5A 4POZD 3CFCH 3VWJB 5EO1B 3W39A 4JDVB 4G9FE 4YHOH 3G9AB 3PGDB 2BNQD 1Y18A 5KTEH 4Z0XB 3QNYB 3NCFB 5D7LA 2JTDA 5KSUA 5CEZL 5FYKD 2CRZA 2ADFH 5HTSA 4K07A 4BUHA 2P1YA 4LHUD 4HFWB 1YN7A 2WK2A 3TCLB 1FH5H 3O3EA 3OHXB 1RPQA 4JQXA 5T1LA 4J3WA 4L4TA 4AK1A 3FT3B 3SGEH 1U8IB 4JR9L 1NL0L 4XP1H 4NZUH 1T89A 3EYUH 3HNVH 3D0LB 1Z9LA 3S34H 1EUUA 1MCDA 3GMNA 5CLTA 4IRJB 3O3DA 2B39A 2P8LA 3LQZA 2W92A 1QFPA 2D4FA 1UJ3B 4X7CC 1DN0A 5TE4H 3VH8A 4PJHA 3DNKA 4PRHB 1PZUB 2Q76A 3ULVF 1D5MB 5IB4B 3EDEA 1PGRB 5ISZB 1AO7D 2FO4A 2X4NA 5T1MB 3Q5YA 1G7MA 4Y4FC 5CWSA 1YNKH 4U2YA 4V1DA 4I3RL 4HWBH 3HUJF 3HZKA 4QRUB 4YFLF 2R1XB 3CFJB 3HUJE 1BLNA 3TA3C 4FN0A 3RPIB 3B9KA 4L9LC 5GRZA 1U0QA 2QQNH 1EFXA 3TT1H 2HWZH 2CKBL 3CU1A 3F6IA 3O2WH 4PJ5E 3JV6B 2BX5A 1M71B 1OB1A 3BGMB 4XCNB 2IH3B 4JG0L 1P84K 2ED8A 3BP6A 4GAGH 1YDPB 2BHUA 2HYMA 2AXGA 2ADFL 2NY1C 1Z2KA 5LJYH 5E6IC 1B6DA 1MFCH 2FHBA 5E24E 3QJHB 5C0BD 4X7DC 3KPSE 5I1LA 3WIHL 5DMKB 3C5ZD 1D5BB 3VI4F 1T4KA 3BDYH 3D3VA 3QDJA 1FV1A 1OY3B 3R1GH 1UKTA 3TIDB 3U30B 1BF2A 3S37X 5C71A 3UTTE 4PJFB 4O4YL 4P4KB 4PG2A 2WIIA 4QHLB 1E6JH 1U6AL 3KYOA 2GUOB 4NFBA 5DRWB 3I02B 4MXQC 1F6LL 1CICA 4NKOA 5F9OL 5FDWA 3QEHA 5L6YH 4KK9C 3CVHL 3F7QA 2XZQL 2P8PA 1R5IB 1J11A 4IBLT 4I3GA 4JVPA 3HZMB 1GGTA 4UOJA 1SVCP 1F5WA 3MX0A 2JIXD 4OAWA 4JRXA 5IFJA 4W81A 3OKOB 1WCBA 1JVKA 3ARBD 3SDAD 2H32H 3B8SA 4MJ5B 2ARJQ 5IW6A 4FOMA 4OLWH 3NMEA 1PG7L 3WCYA 4ZXBA 2VLKB 1JHKL 3HPJB 3IDYC 1F4YL 5K9JL 3PL6C 3T1WA 2PYFA 1AGDA 4KGJA 3UPCA 1AR2A 1ZOXA 1XIWC 4M00A 2DQEL 1KJ3L 4AG4L 4OZIA 3MTRA 5TE6L 5BVPH 5FOJA 4R8WH 4OV6F 1KCSH 2E9JA 3PABB 3BQUD 3AS2A 4U33A 2MCG1 5F1KC 1KB5L 4LQ1A 3SDYH 3S96B 4Y19A 3MV9D 5JW3L 3WIFA 2ZG3A 1R5VA 4FMKA 3QUKA 2XPGA 4YFEA 4WUKL 4TUJB 2BVEA 3W39B 5C2UB 4E42A 1BX2B 4Y2OA 4F9LC 4K3HA 1TNMA 5SWSE 3MQIA 4XBEL 3V5KB 4MXQD 3QXUA 2XTJE 3CDFA 4KHTH 4HH8A 5DFWH 5T33H 1J1OL 1X5XA 1DBJH 2M8XA 3KGRA 4F2MB 1NMBH 2FECL 3DUSA 5GS0C 2VERN 4ZOEA 1A9EB 4X6EA 4HJ0D 4XVUC 2R1WA 3QQ9C 2M26A 3ECBB 3HHRB 3L6FA 1NANH 1ZLWH 2XICA 4PRPE 3FFDB 2NW3A 1ULVA 3D5OF 3KPRE 1AD9B 3GI8H 2CO6B 2Q8BL 3NH7L 1PG7W 1T0PB 4APQB 2UWEE 3F7RA 1RULL 5I30H 3VD3A 2Q3AA 1BECA 1T2JA 1XGTB 3QEQB 3SE3C 1OP5K 5C2BH 3R4DA 1A6ZA 4HAGA 3HR5A 4PJGF 4XNZC 5IG7B 1NGXB 2BDNL 2XRAL 4JREB 3IDNA 3SJVD 3V4PL 3PQYA 3UPRB 5GJSL 3JV0A 1CGSL 1NEZB 5DJ6B 3BN9C 2XT1B 1EXUB 5D7IB 3SJVE 3ARFA 4P2RA 4GMSH 4LHUA 4AH2B 1MHEA 1WAAF 3LRSB 3HCVB 4WTWA 5F9JB 2KQMA 4Q58C 5BS0B 1LO0L 2AKRA 1RK0A 5GGRA 2VOTA 2NY0D 1PLGH 4J8RA 4QOKD 1I9IL 3GMMB 5DURD 3VDCA 6FABH 3DGGB 5EUOE 5D1QB 3INUL 3VXMA 1DUYB 5IQ9B 3IKCB 4L8SC 1DBML 5I2IA 2BSED 1HXYA 3HKFA 3AY4C 1XIWA 1S5IH 4P4RB 4KY1H 1MI5B 4XPHL 3AS1A 4XZUA 1HK6A 4M1CC 2FJHA 3BRDA 5F9JA 3BEWA 3JV5A 5EU5B 1I8LC 2X89A 3BYTA 2YD6A 3TIEB 4QTHB 1NEUA 3R1GL 2ERJB 4OZGA 2AEIT 3HB3D 4YHZH 3QQ3B 5KVDL 2BSTA 1OF2A 3HMWL 1VGKB 1RD6A 3UBXA 2Z93A 2DLHA 2B7DT 4WHTB 3H3PH 3WFDH 1XF5A 5IR1B 1J12A 5GSRB 4ZTPH 4U1JA 4CBPA 4XCEA 4R0LB 3DIFB 1FVEB 3SBWC 1E4XI 4Y8AA 1ZMYA 2R4RH 3WNKA 1M1SA 1SBSL 3CX5K 3PGFH 1IMHC 4JG1H 3TH3T 3VRJA 2FNBA 1CE6B 1KT2A 3CH1B 1I85A 4IJ3C 2IPKA 5IOPA 3EFDL 1LE5A 3HE7A 3MRJA 1B6UA 2QQNL 4H0IA 5EOTB 4K23H 1IC5L 2JJTC 3FQUB 5B8CB 4N8PA 4OZ4B 1IQDA 5DGRA 1RZIB 4WVRA 1LP9B 4FFVD 2R56L 1Z6JT 4LDOB 4X6CA 4LSUL 1IEAB 4H25A 4XWOD 5JHDB 1Q0YH 4MMXC 4K55A 2XNAB 3OKOA 3S35L 2JELL 5I71C 2IAMB 2Z92B 5F3HA 3STLB 3SGKC 2YD3A 2PYEE 1FNGB 3NA9H 3HE6C 4CJ1A 3VW3H 3C9NB 4PJ8D 5B39G 2GJ6E 3QI9B 3RL2B 3P9MA 1LO0H 4PJ9D 4OQTA 1HYSC 3RTQB 3RWCB 5KOVC 3ARGA 3EOTL 1MCQA 5HHPA 1U42A 1N2RB 4N0CD 5E03A 2NXYD 4LMQE 3VXOB 4WENB 5JPNB 1Z0NA 5C0GB 4KK5C 4OFKA 4WWKC 5D96B 1WQVT 2IBBA 4GAJH 3BT2L 5ID1A 5ESVB 5F96L 1A21A 5KZCD 2HKHL 2OI9C 4LCWA 3S88L 2IFFL 1D5IL 3IVKB 3T0EA 2X4SB 4YFLI 3DBXA 1JN6A 1Q9KB 3UBXB 3VMOA 4JZJB 3RP1A 2L7UA 5CEXB 1VGEH 3OR6A 1DQJA 1KPRA 4Z76A 2FJGB 4XAWL 3SY0A 4ALAL 2VWEE 4H8WL 4PJ5D 4J3VA 4R4FL 5LXGH 1AXSB 3SKUD 3N06B 1JZ2A 2VN7A 1GPOL 3OR7B 3P4NB 2PR4H 4D9QE 5C08D 5ICXA 2OL3B 3V0VA 2ID5A 2H1PL 5EO9B 2AVGA 4HIHA 4ZNCD 3C5ZA 4ZO6A 5T3XL 3DO7B 5DUBB 4KI1A 4YBQD 1CDYA 3NZHH 1YEHH 5ERWA 3CCHA 2NYYC 1H3UA 2OS7A 2XXMB 4LVOC 4YBHA 4X4YA 4KI5E 4XBGB 5IBLC 4RRPG 4MD0A 4NJ9L 2E5EA 1A6PA 3MBEC 5B4MC 1KPRB 3G6JE 4JFEE 4Z76B 1HYSD 3X12B 1C1EL 3QDME 4QCIB 1MI5D 4WJ5A 1C08A 3LEYH 5FO7A 3RIFF 2WINA 4LSQL 4G6MH 2VITB 2E27L 4WFFE 5SX5H 3SKOB 1A7BA 1M7DB 4KK5D 2R2BB 1GH7A 3NIDE 5JO5A 1NDGB 2HTKD 1RMFL 4N1EA 5DMYA 3QFJA 3LKQB 1OM3L 2DQIL 1TVBB 2DJ4A 4Y89A 4WV1C 4GW5A 4UAOB 1S7VB 4N68A 2J88L 3N0PB 4XCYA 1KTRL 1QSEE 2XY2A 2CSPA 2FHFA 4MX7B 3HC0B 1EJOH 1FNLA 3O6MH 3D48R 5CMAB 5DLMH 3HPLA 1U2CA 1JNNL 4K9EL 4P23C 4PRBB 1MCWW 2QADB 4TVPE 3QHFH 4JN1L 3CH8A 3OGCB 4RBPH 1BQLL 2DD8H 5L8LB 3QPXH 4YHYC 5FYJD 5JW4R 4NJAH 4X6CE 4S0SD 3MV7B 3VI3E 2EDEA 4X9HA 2WW8A 3NCBB 1MFBH 3SHSA 1MY5A 1KELH 3CD4A 4PBVC 1EO8L 2AV7B 5AZEL 1CFQB 4WW2A 4APQD 5HHVL 4TUKL 4Z8FL 3X3GH 1A14H 4MAUH 5MP6L 1X5YA 1NCWH 2J2ZA 3K46A 4MVBC 3EO0B 1MLCA 3PWVA 3T0EC 1RVFH 4JPVL 1U8HB 4YHNA 5EBLA 2IG2H 4M1CD 4WRLA 2XKSA 5KAQF 4OLYH 4H20L 1E4XH 1U3HD 2XYCA 3LRGA 2EKSB 5D1ZA 1PY4A 3JV4A 4TQEL 3C6LA 1BQHG 3JWOL 2X89D 3DURB 4ODSL 5B21A 3T2QA 3RTQC 1J8HE 4S0TD 1A9BA 3VWKA 3DJ9A 15C8H 4YDJA 1RI8A 2ZCLL 1CR9L 5D7JC 4K3EL 4KTDH 1K8IA 1QFUL 3NCJL 3HTLX 3MO1B 1IAKB 4H0HB 3EYOA 5I1CH 4P2OD 1M7XA 5C0RL 1PKOA 2O61A 4O00A 2NY5H 3QCTH 5D72H 5IW3A 4OAWB 3LPGA 3QUZD 5E6IB 1RJYB 1SHMA 2MMXA 5DRNB 2EYSB 3QIWC 1YNKL 3RVUC 4HWZA 3VXSB 1FG9C 3JV4B 1BLNB 3PP3K 3RVWC 5E8PB 1HINL 3GMQB 3I84A 1JCKA 3TPUB 1UCBL 1R3KA 1BQHB 4PBXA 3RL2A 5CWSB 1DBAL 1S7XA 4YHLL 1DVFA 3OF6D 2VLKD 5LWYL 2AK4A 1ACYH 4NOBA 3JWNC 3SDAA 3G6JA 4JFEA 5GGQH 4KK8D 2DTMH 1E4WL 1BWMA 2ARJB 1G7HB 1MAKA 2H32A 5DFTA 3LV3A 4Z78A 1RHFA 4EQ2A 3T0DA 4K23L 3NN8B 1CLYH 3PHQB 4O5LL 4CMHB 4MB5A 1I7ZA 5DO2C 2VDKL 4D9LH 4TSAL 3GRWL 1QLEL 1H15A 1DQLL 4I18A 2FJFA 5C0CE 2AXHA 3KLSA 1FNEB 4HJGB 5HHMB 5B22A 5AUMA 1WZKA 4K9EH 3LIZL 3HNTL 1BIHA 2SEBB 2HT3D 1VADA 1JNHB 5E2JA 3O4LA 4CADA 5CEZH 1LWRA 1CGVA 5IVNA 3W2DH 4DKDC 4QHUB 5GGSB 1QRNA 4WI3A 2MKLC 3NCMA 1WEJL 1OQXA 1TJIH 4NFDA 3KLAB 1Q0XL 4Y4FD 4Y5XB 4LU5L 4YHPB 3KS0H 3JZ7A 3DUSB 2D7TL 3U6RA 2J8UA 2NX5D 3LEYL 3QIWB 1QACA 3QWOB 2R4SL 2MFNA 3SE4C 5EO1A 4N0UA 3U4BL 1KPVB 3RVWD 1KCUH 2R8SH 5L88L 5DVKA 3K2UH 2E7LA 3CDCA 3IKKA 4AYFA 1DQQB 2EH7H 4OM0H 5DHYB 4JKPH 1WBXB 1GZPA 3NTCH 1QPPA 4JFQB 1HIMH 3RVXC 3UO1H 4OM1H 1UZ6E 2J6EH 3DRTB 1S7TB 1FYTE 4LAQH 3BP5B 1CGUA 4G8EB 3V0WH 3C09C 2H6PB 3MLXH 3CIQA 4QGTA 4HJJH 5EOCL 2HVJB 3ULVC 3D0LA 2GTZA 1MHCB 4QHNA 4YHKL 2AJYL 5DD0H 1PYWA 4PRAB 1A47A 4ONFL 3QUXA 4NZJA 2H8PB 2XN9D 4YHIA 2BERA 4F7PA 4PB9H 4I1NB 1CQYA 4HBQA 1Q94A 4U3CA 3MACL 4JFDD 5C0BE 2Z31B 2EC9U 1U93B 3ULVE 4RMRA 3P0YL 5I74B 5L2JB 4LLUA 1HHKB 3LSOB 2VXSH 3W0WE 2BK8A 3AS3A 5K9KB 1CLZL 1ZA6A 5I1HL 3D0VA 1SEBB 3RWHA 2VLME 1C5BH 3K80A 1LO4L 4TSBH 4P2QA 1LO5A 3QBTB 4ZTOL 3C8KA 4G8FB 1F3DH 4H0GA 3EYVA 3HMXL 3SOBL 4XC3L 4YXHL 2C4XA 1UZ8B 1OCWH 3H9SD 1YC7A 1GOFA 3C5JA 1DSFL 1T7WA 4M93C 4PGBA 1BD2D 5EBWA 5ELIA 4WO4A 5FK9B 2C4FT 4X83A 5EOCH 2WM0A 1AQDA 4GW4B 4UNVA 4GG6E 1V3JA 5CEYA 4HHAB 5BO1H 4ZDHA 1M05B 1RIUH 2DTSA 1S8DA 3GJFH 1J05A 4GS7C 1CD9B 1IT9H 3E2HB 3BPNC 4HCRA 4F57H 5HYFA 1ZGLP 1SEQL 3OGOE 1I9JH 4Y4KB 4E42B 4PRHA 2YD7A 1I8IA 2Y4SA 2BVPB 1EEYB 3HC4H 3HS0A 3V6OC 4KRNA 1NC4D 1EMTH 4GBXB 4X7TB 4PJXF 1XGYL 2CUIA 3WKML 3QO0A 4E0RA 3FTGB 2X1WL 4UDUA 2VDML 1DUZA 4Q2ZB 3MLYL 2XG4A 3DSFL 3MNZB 2OTWB 5C9JA 2IPUK 1LDSA 2IANB 1QNZL 1F2XK 1V5JA 4JRWA 4OUUA 3P40A 3MRCB 2VLJB 3QDGA 4U1SA 2DWDA 5IJVA 1EZVY 3O6LH 4YH6A 5F7EH 2H9GB 5AZ2H 1I3GL 3DV4B 3MUY1 4XP4H 4LGSB 5E8NA 3RVUD 2HVKA 4WNQA 2CK2A 3LMJL 4QTHA 5DJDB 2ZJSH 3RNKA 1E4WH 2BJML 4N0FB 1JWSA 4XPHH 1OTUC 4FQ1L 3RX8A 4BFIA 3HUJB 5IEKA 5EZJA 1K8DA 1NFIB 2VIRA 2XN9E 4BFEA 2VLRE 2KH2B 3WE6A 1LEIB 3EOAB 5HY9B 3D25B 4E41D 1OAXL 4PJ5B 4HF5H 2X4OB 3OKKB 3LRHA 1REIA 4J1UB 5DJAB 2YK1L 3G5YA 5E8OB 3I3DA 3R8QA 4HUMB 2LVEA 1I1RA 4GMSL 5F7DB 4U1KA 3T3PF 2HJKA 1XGRA 5TF1L 4EBQL 1JGDA 1FIEA 1T21A 2YD8A 2ZKHL 5C9KA 3MNWA 1H0DA 4HKZA 3V95A 1U8QA 2ICWA 1KCVL 1IGYA 4MJ5A 4LLYB 1IVLA 3BFOA 3CLEH 1T3FB 1OGTA 4KROD 3NGBC 1ZT1A 1UXSA 2D7NA 2X1OA 1K4DA 1T20B 1KJMB 4LRNH 35C8H 1I3VA 3S6CA 3AU1A 4L8DA 4YUEH 5LCVL 3JWOH 2FX8H 4TQEH 1BMGA 5KZCB 3H9SE 3ARGB 3BGAA 4PJ8B 5JOPE 2VLRD 3V6OA 2AGJH 2X1PA 5FUCC 3ARRA 3L3KB 3TYGL 4Y1AD 5B3JE 3OZ9H 4DKFL 1J88A 5J12B 1MCWM 3DYOA 1VKXA 5E9DA 4HKJA 3TWCH 2BMKA 1MVFA 4K8RL 1T4KB 1INQB 3OXRB 1I4FA 1I7TB 4D0BB 4U1NA 3H0TA 5CHNA 1D7FA 4P48A 2GSGB 1OTSC 3DV6A 3PQYE 4HPOH 3QIUD 1JMXA 2X40A 5I17B 1IC4L 4WNQB 4CU6A 4FQJL 4QRRB 2ADGB 5L8JB 1XF3B 5MEQA 3M8OH 4WFEE 5AG9A 1ADQL 4EJ1C 4GO6B 3UTTA 3B2VL 1BQLH 3DX9A 3QRGL 1I1FB 1ZVYA 3MODH 5IW1B 1RJLA 3ZE0E 4KVNL 2J88H 1U8OB 3IF1A 4GG6A 4Z7NE 1LILA 4C56E 4DUXA 3W0WA 4U6HA 2XOTA 5IW1A 4R96B 1QSEB 2Y72A 5GGVL 3CFCL 1RUMH 2Q7NA 3NAAH 1RUKL 3PNWB 4Z7QF 5JDJA 5BZDB 1G0XA 5BCAA 2VLKA 5E94A 1CXFA 3LN9A 1HH9B 5DQDL 5FGSA 2ZNXA 4BQ8A 4PD4J 3D2UD 3VWJA 3AB0C 2PF6A 3QT2A 4FFYH 4U1HA 4NQVA 2P49B 3ZKND 5IFHH 3Q6FA 1KNOB 5DD1L 1AGCB 2QL1A 2BRRL 4Z7UF 3TJHD 3UROR 1YEHL 1JRHI 3EYFA 3QXWA 2FLBT 4RAVB 1JFQH 4DK6A 2E9WA 1KC5L 2P8LB 5FO9B 1P84J 3FQRB 1D5ZB 2A6DA 3HZYA 3WEXA 5KANI 4LGRB 2BVQA 4R2GB 3MZTA 1QSFA 1X44A 3Q6GH 4GAYB 4D9RD 1U8IA 3GHBL 4HIIB 3EOBA 4JDTH 4JPKL 4JANA 2JJWA 4I4WA 3KPPA 3M07A 3GB7B 4KPHL 4M48H 1G9MH 2NZ9C 1M4KA 3SGJC 1MHEB 1IM9D 1EX0A 3RUGE 4JFHD 5DHVB 5CSZB 1X5GA 3G5XA 4Q6IB 5E2WH 1S3KH 1C5CH 3FZUC 4Z7VA 3CLFH 5H35A 3WO4B 4JM4L 1WAAE 4IDJL 3TFKC 3LQAH 1LVEA 4H1LH 4XC1L 4L1HA 5F96H 4HWBA 1IC1A 3V0AC 3IDUA 5I66A 5GHWL 3PJSA 3T0AA 2JCCE 3J7HA 1TVHB 2R15A 3RY6C 1GAFH 3ALPA 7FABH 4MQSB 3HB3C 4NYLA 4YHIB 4NRYB 4GRWE 1KIRB 5JMOC 2VDRL 4M6OH 4WUUD 2BP3A 5D7IF 3RL1B 2DBLH 5EZLB 1MF2H 1S5HA 3RWJB 3S35X 2X70B 4LSVH 5CGMA 1BFOA 3QEQD 5EORH 2G5RA 3BPCA 3WS3A 2W65A 3TCXA 1R24A 1A4KA 4F7EB 4MB3A 1OP5H 3GMPB 3EOYG 1MIML 3O45B 4Q9QH 4JY5L 3IGAA 4Y2DB 3QUXD 2D0FA 3P73B 4FG6C 4MQXC 2JKXA 2DYPD 3NFSL 4X6CF 3D39A 2DBJA 3QUYD 3TNNA 1I7UB 2W07A 3L5XH 1J5OH 3EGSB 5FB8B 2R29H 4K8RC 3ZDYE 3QDMD 3IDYB 4TRPL 2QSTA 3FCTB 3GSVB 3HRPA 4QXGL 1S8DB 2F5AH 2H9GA 4P5MA 4HK3N 2J8UB 4OZGE 5L9DH 3GBNL 1FNAA 2C3WA 4S1RH 1HWGB 1QZ1A 1WT5C 1VPOH 2ZSWB 2YUVA 4X0KB 4D0DA 1BF8A 2VZUA 1RY7B 3ARYA 1B3JA 3CGTA 1I1AC 3AY4A 1KTDB 2F54D 5JXAL 1URLA 1FQ9C 1JK8B 5ABDE 1KJ2B 2ATKB 1LP9E 2OJZL 1I8LA 4FXGB 5IEHA 3H9SA 4MMZC 5D8JH 3DXAB 4U7SA 4Z0XA 3BQUB 1N59A 1H15B 1U9KA 3BGFC 3JSSA 1DEEB 1OGAE 1RFDL 1XMWA 1JTOA 4Y19D 1ZVSB 1FVDB 1PQZA 1T21B 1YEKH 2RJMA 1NKRA 5F88A 1EEZA 3ARSA 5H37G 3K0WA 3OWEA 2ZUQB 3LV3B 2AJSH 1NBVH 2VDLL 2NY4C 3QA3B 5DWUL 1GRWA 2R1YB 4MYWB 1OAQH 4PGEA 1IJ9A 5C0FB 2XZZA 1P2CB 3I6LD 4MJIE 3FQWB 3MUGB 5EFIB 5A2KH 1VFAB 5EU3A 1AR1C 1IT9L 2E7CA 3BVNB 5DD5H 1FL3B 2DLFH 1ETZB 1BBDH 2PYEA 1CFNB 5INDA 2UZYB 4XHJC 5ITBH 1TJGH 1YY8B 1I9IH 2IADB 2Z31C 4L3EA 4GXUN 3FB6B 5DJCA 5GGRY 1H5BB 5F6IC 4KMTL 2LU7A 5IP4A 1MI5E 3OF6A 1DLHA 1FORL 1VACB 2IBGA 3QCTL 5D72L 3VI3F 3TJEH 4NQVB 2NY5L 4X4ME 2BCKA 5FUZH 1ZVSA 4ONHA 5DEGB 1XGQB 3EJYC 2F9BT 3UZQA 1T03L 2QSVA 5C0BB 1MRDH 1C12B 4YBQC 3OKYA 3GSQA 1G7PA 1QLFA 4FHBD 4ZOCA 5F72S 1CR9H 4Y5XC 5MHSD 2RBLA 4IHOB 1P4BH 3MBEA 1CDHA 5HD8C 3AFLA 2YRLA 2I5YL 4PJAF 4YIQA 4XHQA 5EU6B 3NH7H 2H8PA 1C5CL 3O6FB 1WTGT 3F12A 3ZE1E 1DQMH 1JHLH 3LKOB 5H2BB 4HIIA 3E0GA 4I0KA 1OAKL 4NKIL 1ORSB 1D5ZA 1FDLL 1UQSA 2VZ1A 1EHNA 5FYKE 2DQDL 5E5UB 3C08L 4HMDA 4PRHD 4NNPH 3VE0B 3HG1E 3CJJA 1L7TH 3U36A 1MFNA 4X4XB 3G08B 4UQ3A 2EE2A 2J8HA 1AFVL 1U91A 4KH2A 4LFHG 3BH9A 3BX7C 3K1KC 3ABZA 3IDJB 3O8XC 3NTCL 4PBWD 3QWRD 4X99A 1NAMH 1DN0B 5DD1H 4XHJD 3B9DA 4NZTH 1RZJH 1JWMB 3TVMD 2DQFA 5IGXL 4RRPA 32C2A 1NUFA 2XWJA 4U1SB 4XXDA 5MEOA 1FAKT 3VXNA 3HFML 1YECH 3S7GA 4IRSA 2YEZB 1UKQA 4B0MM 3TBTA 4AT6B 1AHWC 1RUML 3RVXD 5CILH 4APQC 4LP5A 3VFTA 5CBEB 1IILE 1KG0B 4JHWH 4Z95H 1A5FH 2ESVD 3QXTA 3DI3B 3PHOB 5HHOE 3DRQB 3QG6B 5EH1A 2HKFH 2VITA 2E27H 4BQ9A 3QUZA 5DHXB 5GSVA 1EV2E 4MA8H 4QRTB 1RIHH 4NCDA 1B0GA 3EDDA 4NC1E 4RGNE 5CJQH 5F7MC 5GQBA 1VGKA 1NSNL 4M6NH 1D6VH 1IQWL 4HV8A 2VH5L 1NAMA 1KCRL 4H88H 4KU1A 1JGLL 2C5DC 1G6VK 5L6YL 1TQCB 1OARH 2A73A 1I3UA 4LLWB 4LSTH 3JVGA 1KB5A 5J3HC 1TVDA 3BAEH 4XBPA 4WI2A 4JKLA 3QFJE 1J8HB 5GGQL 4PGBB 2ORBH 2C7UB 3GMQA 3FQXB 3UXFA 1UENA 1OP3K 4KV5F 2FYYB 1KJ2L 1RFDH 5F71A 1T66C 3G04B 4P23A 1HZHH 1RZGA 4RDQF 1KNOA 1NMAH 1ZEAH 2Z0BA 3ZTNL 4YLQT 2AEPL 4M03A 3DX8A 5D7LD 4A6YA 5IHUH 4NRZA 3MBXH 3N9GL 5F1SA 3NBNA 2FBJL 3VG0L 4GH7B 3FOLA 5J1SC 3GSXB 1XR8A 4JY6A 1JE6A 1MAJA 3QCVH 2FH8A 3U9UB 1KLUA 3IB4A 5DD6A 5CSZA 1KCVH 2EDJA 1HH6A 4BSWA 1FO0H 1NGWA 4AEHL 4P46A 2W9EL 3RJQB 2Y07H 3WHE1 2AJXL 1KOAA 1VPOL 3MRPA 1L7IH 1X6LA 5LAXB 4CVZA 1NEZG 3OJVC 4Y2DD 5I1GL 4ONGH 2A83B 3OKKA 1G1YA 2FX9L 2YEZA 3WUWG 4BSVA 1AJ7H 2WWKT 3MRHA 3PIQB 3EOAA 5HY9A 4UTBH 2BXZA 2ICEA 4JB9H 1S9XA 3FTGA 3ZHLA 1I1FA 3FO1B 1AGEA 1MOEA 3M17B 2A74A 2V2TA 2FEDD 3CFKA 4M43L 5EZOL 4XNXL 3TBYA 2E7BA 4GKSA 4KZEH 5D9SA 3ULUC 2FJFB 4EOWL 4XX1E 3T3PE 2ADIA 2OP4L 3QULB 1ZHBB 3VWJC 3OKNB 2FATH 1H3PH 5IQ7H 3AM8A 5FYLH 1LO2L 4KJQD 4IIQA 3VWKC 4BUGA 1F3JA 1SJHA 2AK4E 2VISA 4X9IA 5LQBL 4N0UB 4X6CB 4U2ZA 4RMWA 2OZ4H 5D93B 1YUHB 3MJGX 5JQ6L 5SX4H 4F8QA 2FR4B 1OD9A 3OAUL 4Y5XA 2W38A 1CGTA 1FZOB 1KJVB 4OIIH 3HR6A 3SDDA 1CG9B 5JIIA 3C60B 3O6LL 5F7EL 1U3JA 3FB8A 1NBZA 3PGFL 3O0RL 4FS0A 1TMCB 4L4JA 4NQUA 1DN2A 3UZEA 1KCKA 1UA6H 3MRNB 3RGHA 4KVCL 3O6ML 1GIGH 3JVGC 3QP3A 4JFOB 4LCIL 3RVVD 5L8KB 1RZKC 4PJBA 5ICYB 2W9DL 1NMAL 3GSNH 3OR6B 5KTEL 1ZHNA 5DRZA 3R0MA 2ADGA 3N1PC 4QCIA 3D3VD 2VZSA 3V6BR 2VC2L 5F7DA 1ZLUH 3JWOC 1U8MB 2QKIA 1F2QA 4G6ML 3LZFH 1YPZB 4ZFZA 1QO3A 3BWAB 4JJ5B 4G7VH 3GSNA 1FSKC 1UWGH 3PP4L 4BKLB 3MLSH 3CDGB 3MV11 4M9OA 4F7CA 1P7KB 2VZVA 3WNOA 1L4IA 3DO7A 4IOFD 4NJ9H 5I8KH 5T1DH 1ZLSL 2DKMA 2I9LA 3GSRA 4QOKE 3HI1A 4AIXA 4F7CB 1GGIH 1CE1H 2EEAA 2DKUA 1A7OL 4ETQB 3O8XD 3QDJB 4BYHA 1JNJA 3FN0H 1CI5A 3GSNB 1Z5LB 4UIMB 4U6XA 4OF6A 2C1OA 2KBGA 4MXVE 4ELMA 4WWKB 5D96C 1B0GB 4WFFD 1KGCD 1KGCE 3F7VB 3SN6N 3JWDH 1IBGH 3REWB 4ZTOH 2G75A 4XH2A 2EE9A 2HN7A 1HQ4B 1UJ3C 5I1HH 1PDKA 3LB6C 1WBYA 3FONA 5D2NA 1X7QA 1RURH 1Q94B 2FGWH 5BOPA 3I2CL 3QIUB 1XF1A 1I1AA 4MNHA 4NC2B 2ZCKL 4OZFH 1N6QH 1YY8A 5FV1L 3AB0B 4FP8L 1IM9A 1R5WA 2BOBB 3C60A 1K2DA 3PWPE 5D1ZB 1A64A 4OD3L 4RFNC 4FFWD 3T3ME 1R3LB 4UINH 3M8OL 1IAOA 4MD4B 5FECA 2P5WD 3ISWA 3KHQA 3U7WH 2ICCA 3V4UH 4HPOL 2XFXB 1MRCH 4KROC 4NUJA 3LKSA 4I0PC 4JFDB 3S36H 4TUOA 1I8IB 1KEGH 1WBZA 3H9ZA 3I6GB 4JO1L 4JO4H 3IJYA 2X42A 5TDPB 4K8RH 4HS6B 5L2KA 4J12A 1LNUB 4OIAA 4K7PX 5T1LD 3D69A 1GL4B 3K2MC 1JGEA 4LSSH 5L0QB 5CD5C 3RWIA 4AIOA 4I0PB 4LVNC 2G60H 4P4RA 3WDHA 3GMOA 4E5XB 1KTKE 1T66D 3ETBF 3MRHB 2AQ1A 1OWRM 3PXJA 5JORA 1N7ML 4YWGH 5IMMB 3RGVC 1Q0XH 3F7YB 4I77L 2P5EB 3STBA 4OQ1A 1NGQL 2XA8L 3UTQA 2AJXH 2V5SA 2YWYA 4R97C 1OTUD 1QFWL 4JG1L 3VXRA 3ULUF 4D0CA 1SBSH 1QLRB 4XVSH 4L4VD 5C07D 2V17L 4POYA 3HS0B 1KUMA 2JJUA 3DMMD 1L6ZA 2NW2A 2WP3T 3PHQA 5BQ7B 3VG0H 4POUB 5KAQG 1ZEAL 3C8HA 5ID1B 5C6PB 3RX7A 1UH3A 1UXWA 5M94B 4GFTB 2IADA 1SY6L 3BJ91 5IJKA 1AKJB 3MLVL 2B2XH 1CFSB 4KI5D 3MRFA 5I16A 4F58L 3KPOA 4EDWH 3MFGB 1TCMA 1UB5B 5HI4C 5HGHB 3GMRB 2FBOJ 4HWEL 5DEFB 4D94A 4EXKA 1OARL 3MLWH 3OL2A 4CVUA 4GW1B 3SDDC 1O0VA 3GMRA 2VXQH 4ODXB 4XAKD 4HFUL 1S5IL 2HRPH 1YEDB 3ZLQC 1EVTC 2XTJB 1TZIB 1MCRA 5DRNA 4J3OC 1DJSA 4M6NL 2NXZD 1JWUB 5I1EL 3QJHA 4PP2B 4HEPG 3TBWA 1RUPL 4XPGL 2HVKB 4OKVA 4XPAL 2WBJA 3KYKH 5CJQL 4LLDA 1LK2B 1DFBL 3ES6A 5DTFA 3T4YB 4IRJC 4G7YH 2G5BB 4M61B 3QUYC 1GGYA 4EN3A 3FMGH 3BKMH 3VD4A 4MWFB 5C0GA 3W9DA 3GKZA 2HWZL 5FKAB 2EDYA 3V8OA 2N7BA 5JHLH 2WNGA 5EU6E 3VRIB 4X0KA 3ARTA 1NDGA 3UC0H 3BKJH 32C2B 3BIKA 5F9WB 2W0PA 2H2SC 3ZDXE 2HTLD 1M7DA 4KAQL 1S7TA 1CWVA 5GRUL 3T0ED 1BWWA 3BPNB 3UYOD 3O3BA 3TPKA 5IK3B 2EO9A 3FO0H 4CW1A 1WZLA 3RJDA 4GRLC 4QGYA 1FNSH 12E8H 1FZJA 4UQ2B 1NCWL 2FIKA 4C58B 25C8L 2F5BL 1AQKH 1CD0A 3PWPB 4LSVL 1NDMB 5EOQL 1I8MA 3KXFB 2K7QA 1A0QL 2XI9A 4N8VG 3IDIB 4TUJA 4X98A 2D9QB 5GRWA 4XT1C 1RZ7H 4NT6B 2A9NH 3WIFB 1QRKA 2ZUVA 3QXVA 4ZAKB 3U7WL 4ZAKC 4PREA 3C5JB 4LVNB 3OJDA 1A6AB 3QUXC 1RU9L 2OK0H 4M4PA 4NZUL 2AJZA 3GMMA 2HAZA 1INEH 3BN9D 3IDXH 4PJCE 5JW3H 1JPGB 3I2CH 1OTTD 4NBXB 4UT7H 2FGWL 2IPTL 3TBSB 4PJIE 4HK0A 2DMKA 5CIPA 4R9HA 1AH1A 2VL5A 3C6LD 5JZ7D 1AR1D 3ARGC 5KANG 5E9DE 3X14B 3RDTD 3T4AA 2LU4A 1OGAD 3KDMA 4PUBL 3A6OA 2XTJD 1F90H 4YHOL 4LLDB 5LBSH 5SWSD 1PKQB 1KULA 1G9NC 1VACA 3G5XB 1A9BB 1YYMH 3VWKB 3LS4L 2C1OB 2PTTA 4NO0B 3GGWA 1XR9B 1E4KC 4TNVK 3NPSC 4JFHE 3RKDC 3PDDA 1F4WL 2IH1B 5TPWL 2FEEI 1FPTH 3EOBB 1YPZF 4OUOA 1ZT4A 4GUPA 2GJ6A 1A7OH 2X7LA 4LDEB 4GRLD 2HFFA 1BOGB 3TFKD 3VFRA 1H3TA 1TQCC 4S11A 1M6OA 4KKBC 5IQ9A 4OZHA 3VFVA 1DBKL 5A1AA 2XXCB 3EYVB 3P4NA 1AP2A 4HWZB 3VXSA 1EAPA 3IFOA 3IETA 4XP5L 1RJYA 2F19L 2R4SH 5DMKA 1LE9B 3VGAB 2VC2H 4NFCA 2D03H 1T89C 1YEEH 3O4LE 2C9AA 1RZKL 5FA4A 3V5KA 5J13C 4JHBA 1YEFH 2CQVA 2C3VB 3LN5B 4M5YH 3JUZA 3LPWA 1SY6H 4IJ3B 2CLVA 1K3ZA 4NSKB 4RGMB 4ZO9A 1FBIL 2ZOKA 3DYMA 3PXHA 1EGJA 4D8PA 5I8CA 3RGVD 1IAIL 1UWEL 4GJTB 4UB0L 3D2UB 3UJTL 2J8UE 3BKYH 4LARH 4ZMAT 5IJKC 4PRDB 2ZP0T 3GHEL 2AK1L 1EK3A 4LLAA 4OQTL 5H8DA 4TPRL 2YKLH 1UWXH 2R1XA 3CFJA 2PXYD 1RZFL 3M45A 4D9LL 2UY6A 4RGOL 3QO0B 4E0RB 4R0LA 2VABB 1FVCB 4LVHC 3GMOB 5DRXA 5I8CB 3KJ6L 1I9EA 2VKWA 1JTPA 5F1IA 3Q3GA 3RX5A 3FCTA 2F5AL 2CLVB 1PSKL 4C57C 1I9RL 1SBBA 5HD8D 4DW2L 4L29A 2QSCH 3QQ4B 1FC1A 1P5VA 1QPXA 3QUMA 5KSBF 5IV2B 2OP4H 4OLZL 3AXLB 1U3HA 1QR1A 1ZS8A 3UJIH 5J4MA 4LIQL 2X44D 4J6RL 3E6FA 4JFDA 4KUCD 2AGJL 2Q20A 3RTQD 3BSZH 1G84A 4RA0C 1MIMH 3QUKB 5B39B 4OGXH 3QI9D 4NQED 3P0VH 1R3KB 4NQCB 1AJ7L 4PJHF 3BI9X 4PJFA 4UTBL 5A3ID 2YA2A 1UM6H 5C0RH 3RUGA 2WP3O 5LAXA 1SMAA 3OKMA 1AKJA 1NGYA 4UI2A 1HHGB 3VXQB 4ODWA 4UIKH 4YQXH 4MAYA 1FO0L 3IDMB 1NL0H 3X3FL 4XNZB 1YEJH 4P2QE 4YC2C 4B7IA 5IR1A 3W82A 2ICWB 3H6JA 4WHTA 5A43C 2ZCKH 2A0LC 1YDPA 5EN2B 4IDJH 2EECA 4JM4H 4K7FA 2IH3A 4K9EC 5DMGD 4DGVH 5C0DB 1FBIH 5TQ2H 5TQ0L 2AV1A 4NUGL 3KPRA 1Z5LA 4FQIL 2Y06L 5DT1H 2IG2L 5HHNB 2VRAA 1EERB 4ZUUA 4PRAA 4X5XA 1M7IA 4UUJB 1BFTA 1KB9J 5ANMA 5HSFA 3FT2A 3DTXB 3LEXB 3ZYOA 1YC8A 3MJ7B 2DQTL 3K8LA 4ZAKA 1RUQL 4XRCB 5ANMB 1G7LB 1JGLH 2UUDK 2VN4A 2P47B 2QLVB 4QHMB 5E1AA 4I3SH 5T1MA 1KCRH 1X5IA 4W4OA 1IGCH 1YNTB 4JFFE 1ERNA 1MREL 3QFDB 1KPVA 1B4JH 4P99A 4FFZH 3L95A 2WUCH 5C0AA 1II4E 3RA7L 4CRPA 1DL7L 4W6WB 4QT5B 1RIVL 5F7UA 3O3BB 3U2SB 1NCAL 5BZDA 4XNUL 3WHE0 3TEUA 2PO6B 3UYRL 1TCRB 4YPGB 3TO2A 3P77A 3JV6A 5GXBB 1W72H 2RGSA 5DA0B 2ADJA 4Z7UE 4U6HB 1XGTA 3FFCE 4QRQA 3VFPB 1SYSB 5IMOB 3UPAA 5J56B 1WIOA 4AM0A 5CZVL 1YECL 1NCAH 4TSCL 3D9AL 2DIJA 4B50A 2HVJA 2X4UA 4KHXH 3UJJH 2O5ZH 1ZTXH 4G43B 3MODL 5DMGC 5MEOB 4X7FC 4NT6A 4ZUSA 3DI2B 3WXVH 2ZOKB 5HYJD 5MHSE 4WI6A 5HPMA 3QG7H 3UCRA 1K3IA 3QDGD 4ERSH 5CD3A 1Y6NR 5A2IH 1JGVH 2CIIB 2DQCL 3HG1A 1BVKA 4UOW0 1T1WA 3RZWA 5SV3A 4WI5A 5E70A 2P4AB 3QIWA 3E8UL 3SKMA 1CIUA 3BHBB 2FEDC 1AQDB 1Q9WB 3BIKB 4YGAB 1NCTA 3T0XA 5I19H 2J7LA 2MQ0A 4H5SA 5GRUH 4J8RB 5DD3H 3BKJL 3UBXI 1TJHL 2R0ZL 5BS0A 4YDLC 3QFJB 3QQ9D 2I5YH 3NIFF 2IMNA 2O5XH 2AEQH 3CXHJ 5CBAA 3L3OA 3P0GB 4L8SA 3TA3A 1DZBA 1WJ3A 3B6SA 4B7LA 3B9KC 4L9LA 1ZWIA 4JGJA 1S7SA 1V7ML 5C0AB 1A7PH 4D3CH 3IS0X 4OSUL 2YPLB 3AGVA 4KMTH 3QQ3A 3RAJH 1VSCA 2DJSA 3DX8B 3TJEL 3L5IA 3QCVL 4A6YB 2YK1H 2OTUB 4W68A 4YHKH 4WO4D 1PG7H 4KXZI 1QSFD 4OLWL 1TZIA 3NCCB 1J9CT 1NCBH 2P5EA 3B9KB 4EUPG 3A6CL 2OSLA 2X4OA 1A1OA 3KPSB 3FB8B 4OCSL 1J0ZA 2Y5EA 4JEGB 4UT6L 2DKSA 3HMXA 3VXMB 4XNQB 3F58L 3VCLB 3EO0A 5DK3A 2APTA 1XCTB 2X4PB 2NY0C 5EWIH 1MRFH 4G8GD 4GRLA 5E5RB 3QA3A 2OTUA 2VQ1B 4HV8B 5D5MB 3C2AH 2E7LC 5JHDA 1ED3B 1Z0MA 2AJSL 2YPLA 3FHQA 5CD3B 1DQDH 3P9LA 4L29B 4PJBE 3ZO0A 5DC0A 3OPZH 3RGVB 2GYSA 1S9WA 4CW1B 4TYUA 2YXMA 1WT5A 3RIAF 1W0WB 1S7WB 2AK1H 5ANME 2QQQA 1QBML 2QJDA 3BKYL 4LARL 3B43A 1TZGH 2FD6L 5DMJB 3ZKSD 3HNTH 3MLPA 4FQ2H 3SGEI 1WZ1H 1AKJD 3FKUS 1S7QB 3V5DA 5DK0A 2AABH 3WJLA 3OB0K 1MHPH 3B2UD 1QR4A 3HE6A 3BPOB 3X11B 3H3PL 3BUTA 4BM7A 3T2NH 2PKDA 4GSDL 3PL6D 3GBMH 4YE4L 4EN3B 1F11B 4HIEA 3ET9F 3W0WD 4JFYA 3BPLB 5JXEC 5D1QD 4QF1B 2D03L 4G80B 4P3CL 3BISA 5EUOA 4PJ7F 1SEQH 2G75B 3QDHA 1I7RA 3UTPE 3NA4A 2F8OA 2NQCA 2UY7A 4Z7WA 1YJDC 4PP2A 4PRHE 2FZ3A 1MY7A 3OX8B 1JYVA 2IEPA 1B2WL 1ZVHA 2Z9TA 4ISVA 5SWSB 2AXJA 5DC9B 4HPYL 1R5VB 2DM3A 4R2GC 3G5ZB 4R3SB 5T1KD 2A74B 3M17A 2V2TB 5EBWB 1U92A 2Z8VC 1ACZA 2CIKB 4XCFL 5FYLE 3KPOB 4NO3B 3KPRB 5I1CL 3QAZC 2W0KA 2D0HA 5T3XD 4HLZH 5HI4D 4ZFZB 9CGTA 1JI1A 2UUDH 1JGUL 3WDJA 4A2MA 4HH9A 5CD5D 2F53A 1AE6H 5C0ND 5DR5H 1S9YB 1VEPA 2EH8H 1FL5A 2GAZA 4WJ5B 4X7EC 4LEOB 5GRJH 4JDVA 1QBLH 1KFAH 1T6VN 2ZG2A 1IKFL 5GS3A 3SQOH 5IW6B 1AGFA 2P5WB 1RSFA 2EIBA 5DJXA 2AS5M 5I71B 2FHCA 3KYMB 3GI8L 4KPHH 5FHBL 1Z3GH 4F7PB 1MNUL 3D18A 1H5BA 4J3TA 1T03H 3MRLA 5D1XB 2YPVL 2FYYA 3CVIH 3GHBH 2JB6A 3MA9H 4ETQA 4LLMB 5KSVA 2WBWB 1AC0A 4JANB 5K9QG 1J7VR 1HDMA 4O58L 2HP4A 1N5AB 1A3LH 4PREB 1MCOH 5I1JH 3VXNB 2CK0H 1NLDH 3TV3L 1KC5H 4UV4L 1JFQL 4HJJL 3ZKXC 4QOKA 2CR3A 4WV1A 3MUHL 2IH1A 2YPLE 4BKLA 1UH2A 4PG9B 1XH3A 3RWGA 3BN3B 2EH7L 5IVXE 5EIIA 1BP3B 3DUUB 4O9HL 2CD0A 4MA3A 4JN2B 4KWUA 4ENED 1K5NA 2HTLC 4ODTH 5HVHB 1OLLA 3G6JF 4OGAD 4ZPVA 2VDLH 4I13B 3NACL 4X8JA 5DQDH 1BAFL 5F1IB 1RUKH 1FGVL 5IMLB 1WICA 2VLKE 5I9QC 3CFKB 4WI8A 5D7SH 4GSDH 2Z8SA 4KXZH 2XWBB 1DCLA 4LU5H 1IAOB 4LRIC 4MD4A 3B4NA 4JPIB 1EJ6A 5CBEA 4L3CA 4WW2C 2Y36H 2PW2A 4APQA 1S9KC 5JORB 3HZKB 4IRSB 1FVEA 1UG9A 4ZFFB 4Q0XL 3P77B 3QDMB 1BZQK 5D4QA 1U95B 2C26A 4HIXH 4S1QL 3WHXB 4H8WC 3SKOA 2XWJB 4J4PA 5A2FA 3SKMB 1OSZB 2P5EE 3GK8L 5EU4B 3BZEB 3ZYIA 5HDQL 1XIWD 3CXDL 2YUZA 4GRWH 4BJLA 4X5WA 3RGVA 4FQPA 1I85C 2H45A 1O7VA 3F6LA 4F7MB 5EUKB 4Z5RA 2HMIC 5E8DH 1QD0A 4NRZB 1Y0LB 5HYSB 3WFCL 5FGRA 2OJEA 5J1AB 3PWJB 3JWDC 3G04A 3NCEB 1R0AH 4CDHA 1UJ3A 5SX5K 5LQBH 4NQSB 3R06B 3GO1H 2R29L 2YSSB 4M8VA 4C83A 1NBQA 3BW9B 1OW0A 3HRZA 5JA8B 4MLSA 3VRIA 1J18A 3PIQA 4NWTH 1S5HB 3RWJA 4ZD3L 2A73B 3TIDA 3BH8A 1ZHKA 2XKNA 5I16B 3EYSH 4LRNL 4DGYH 2VE6A 1F3DJ 4KI5C 2I9TA 2YD9A 5BXFB 3EO9L 5I1DA 4XVSL 4OSUH 4IMLA 3X3FH 3RWFB 1CD8A 3D85A 1DVFC 4JY6B 3VXTA 4ZS6C 5BV7H 3TH4T 1GC1L 2HT4D 3WDIA 2EXYC 4I77H 2LAAA 2NY2C 4CN4A 1SY6A 1YNTA 3O4OB 4ZYKB 4Q6IA 3VXRB 3CSYA 2R69L 4CN6A 1I3RA 5D7JD 1XF2A 1EPFA 5DD3L 2Z35A 3F7YA 3L3IB 3SEPA 2AJ3B 4ODSH 3BSZL 1A6VH 3MOBH 2DWEB 4R7NA 1W0YT 4Q9RL 2QV2A 3QNXB 5EBMA 2AERT 5GIRA 2X9XA 4JPVH 2B0SL 4IRJD 2XY1A 5F44A 3TBVB 1FV1B 4LRIA 4OLYL 3IXTB 3HUJA 5ALCH 5IEKB 5C0IB 1D5BA 1WISA 3IFNH 4RQQA 4DW2H 3STLA 4IS6B 2KZ1B 4IIQC 4KKNA 1HSBB 4PY8I 4ORZC 1CXKA 2FIRT 1D5MA 3N1GC 1OAZH 1QG3A 2KL6A 3EFDH 4R4NC 4RGOH 4U4BA 3IS1X 3OKNA 4JY4A 4JFYB 5I15L 3SCMC 5E08L 1J8HD 2XPGB 3QHFL 5C6TH 2EYRA 1T2QH 4HSQA 3RHWK 5KN5B 3W5NA 4PJXA 3ZE2E 5DLML 4Z0BL 5B4MD 4MNGE 5IFAH 3H7BB 3VG9C 4Y0GA 2FSEB 3ULVH 5HHQB 4F15C 1KN4L 4DZ8B 4FZ8H 1CN4A 2HLAB 4F15B 1UADC 3OJDB 3FFDA 3K3QA 4NQEA 4KJWD 2EXYD 1BGXH 4NQCA 4M7KL 2VDMH 4D0DB 5CAYB 3SDCC 3QI9C 1T5XB 3JWDL 1EMTL 5D7SL 1BREA 3U9UA 3WKMH 4YHZL 1G7PB 1QLFB 1YN6B 3NCYP 3W11D 4ODTL 2WINB 4C4KO 2W0FA 1KV3A 3KXFA 2WUCL 2F15A 2F19H 4MQ7A 4AL8L 1NC2A 1UJTA 1BX2A 5E8EB 1HQRB 1ADQH 3QUYA 1MWAA 4M6MH 1IM3B 1FIGH 1RIUL 4UIMA 3S3JA 4LCYA 5ACLA 5TGBA 3V6FB 1R5IA 3ARGD 1AFVH 4MA1C 4JO3L 5TPWH 1NANI 3W81A 5CEYB 5IESL 3TN0B 1OCWL 3I02A 1DUYA 3QJFB 1YZZA 2OL3A 3VGDA 2GJ6B 1C7TA 2YD5A 3P30L 4GXUM 4O2EB 3LKOA 5H2BA 1X9QA 2BY1A 4YXHH 3KPLA 5TQ0H 1F90L 1T0MA 1UEMA 3H9HB 5KS9B 1U8LB 2DLEA 2HFGH 1FO0B 1JF1A 3HE6D 4HS8H 3GMLB 2NY7H 4DOHE 3SQOL 4X80H 5FAAA 3U0TB 3MGOA 1KFAL 3HPJA 3MRQB 2VXSL 2OQJB 1D5IH 4QEGA 3P4LA 1I8KA 2AI0L 2OR8A 2VDPH 3OAZH 4N90E 1YJDL 4C4KT 1H8NA 4G8IA 3VXRD 3F7VA 5GRJL 1INEL 3IDXL 5K93A 5HBBA 1CDCA 2EH8L 1OD7A 3MJ6A 5FA4B 1QKZH 3ZMRA 3HR5B 4E41B 2B8OT 2DQJL 4Y88A 4QHKI 2DM7A 2CDFB 5KS9A 4L3AA 3G5YB 1EAPB 4IMKC 5F9DC 5EU6D 5TF1H 4LVOB 4WU7B 2QBWA 4EIZC 5IHLB 5JIHA 1J1XL 1IGTA 4OCNC 5H94B 4WHDA 3GM8A 4G9DB 1TPXC 1X6NA 1BBJA 4LBEA 4NQDB 3AAZB 2ITCB 3V0WL 1A7NL 1H8SA 1KEMH 4LPTA 3ZDZE 3IDGB 4NHCL 1XCQB 3U9PL 1BJ8A 4JFQA 3VW3L 4OM1L 4NO0A 3GSUB 4KKLC 3FO0L 1B2WH 1T1YA 5CZKA 1W0VB 5TE7H 2R2EB 3O41A 4KMLB 2WWMD 4KAQH 4OZIE 4XP6L 3BE1L 4PJHB 3FQTB 3KVQA 4GKZB 4P2CG 1QA9B 2COQA 4OCLC 4OZ4A 2XFXA 1MJ8H 4Y5VB 1A6UH 4HKJB 2EDWA 5TH2A 3BPCB 4AQOA 1TZHA 4OTXH 3UTSA 1ZSDB 3LKNA 3CX5J 5IM7A 3PV6B 4O2FB 4ZUVB 4FQ2L 1YYLL 2UYLA 4MCZA 3LN4B 1JHKH 3BIBX 1D9KA 1KBGH 3FB5A 1UKSA 3NIGE 2ZSWA 4MCYB 5DTFB 5JXAH 4UU9B 4AENA 2VDOL 5I15H 3L95B 2WBJB 4LPVA 2NNAA 1KJ2H 2OQJA 3VDAA 1BJMA 1XGYH 5B3NA 3LHPH 1LHZA 2HJKB 3CZFA 4MAYC 5FYKL 2F58H 4N0YH 3BZFA 5E95B 1Q8MA 1KENL 4LSTL 1K85A 4FNLL 4OCXH 3SDAB 3TGXA 1VCAA 1CU4L 5CINH 3QEHB 4GRMA 4Z9KB 3LS5L 2EIZA 3FO1A 2ENSA 5D2LE 1BQHA 4M02A 4KDWA 4LHJB 3MOBL 4PJAB 1PLGL 3L5WB 1F4WH 2D7PA 1K6QH 4LLMA 3E1F1 5D2NE 2P44B 2OYPA 1MQ8A 2N4IA 1D5XB 4PY8J 4UILH 1NCBL 3CC5B 4TOYL 3W5MA 1I3RB 2E6QA 2YOCA 1XF2B 1DR9A 3D18B 4G6AD 4UNUA 3QUYB 5DVNA 3VGHA 3MFFA 1G6RH 1MVUA 3KLDA 2MQ3A 1LO3H 7FABL 1KB9K 3TESA 3NCJH 5D1XD 1TTGA 5T1KA 3TVMB 2NX5A 4ZPTA 4OKVB 5EO0B 4RAHA 2QADC 4OT1H 3TBWB 5I1DB 3MRNA 5INCA 5ADOH 2VLJA 4ZS7L 4U6XB 4DVRH 4O2CB 5ETUA 4L3ED 4FTVE 5F9AC 1IGFL 5E2UH 3S5LG 3FJTA 1ND0A 2GT9A 5TJWK 1FZOA 1KJVA 1HILB 1FYTD 4YHMH 3FOMB 1CGWA 1IKNA 1U92B 5I19L 2XQBL 4LCUB 3GIVA 4M8QA 1ITBB 1EVUA 5HGBB 4JHZA 1IEBB 1QO3B 3BWAA 1R3IL 1LD9B 4PJ7E 5DHYA 5HHVH 4HZLA 2L4OA 1PZ5A 1EEZB 5SV4A 5DZOA 1F3JB 1SJHB 2DQDH 4Y4FB 1UM4H 4WEUD 1JGVL 2DQCH 3PL6B 2EDTA 3QULA 3VGGA 3LKSB 4M6ML 3F8UB 1SYVA 3QDAA 2YUXA 3EDJA 3SO3C 4GXVH 2BMKB 4I0CC 4P49A 3ALWA 3QZWG 4KK8C 3DVGB 4N5ED 1KB5H 4M7ZC 2H2PC 4GG8A 4YZFE 2AP2A 3DLQR 3WL9B 3EYQC 5IB1A 2P8MA 4K3DL 3JTTA 5HHME 4PD4K 2K9UA 2NY3B 1FYHB 5DK2A 4HQQH 1RMFH 2Y36L 4RAUA 4S1DD 3ZE0F 4DVBA 2SEBA 4UDUB 1F02I 3GFUA 1U8JA 4XXDB 1X7QB 2QQKL 4HULB 5KSUB 2AAVA 5JO5B 1JIBA 3QIBD 4XXCA 4GBXA 2APXA 5IT2H 5MEPB 2BFVH 4PRNB 1MAMH 3KYKL 3V6ZB 2D7MA 5GRYA 5EA0L 3FN0L 4FQXC 4Z7VB 3S3PA 4WWKA 1FGNH 5DSCB 1N5YL 4QXWA 4L4VA 5C07A 4K3JH 3UTPD 1B0RB 4KKAD 1JF1B 1FO0A 5LKNA 1FHGA 2DLFL 3N1MC 1WVZA 3QXDA 4YR6B 5I73B 5FYJE 1T0MB 1J05B 4O5LH 4FQHA 4WI7A 1FLRL 2MNUA 2VXUL 1KIUA 1O5DT 4ZFGH 1M05A 3MLRH 3MRGA 4HXBL 3B9KD 3VFVB 2W65B 3MLWL 4NM4L 4GW4A 3UTZB 4AMKL 4UV4H 3QNZA 4UOW1 5B3JF 5JQHC 1L0YA 5EO9A 1OQOA 3TPUA 3HZYB 4K94H 5AYUH 4GUPB 5K59F 3UDWA 4M5ZL 7CGTA 3HAEA 5KSVB 1A1OB 3KPSA 4EZMA 4QYOB 4C55A 4WUUA 2EYSA 4NZRL 4JFPB 3A6BL 2F54B 4KTEL 5C0AE 5FHBH 3G6AB 4LK4A 2QR0A 3C5ZC 1TFHA 3O4OC 4XAWH 4PGCB 5HYQB 1ZHLB