4Y5VC

Diabody 305 complex with epor
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
215
structure length
206
Chain Sequence
PKFESKAALLAARGPEELLCFTERLEDLVCFWEEAPGQYSFSYQLEDEPWKLCRLHQAPTAGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGQGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tuning Cytokine Receptor Signaling by Re-orienting Dimer Geometry with Surrogate Ligands.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/immune system
molecule keywords diabody 305 VH domain
total genus 40
structure length 206
sequence length 215
chains with identical sequence F, I
ec nomenclature
pdb deposition date 2015-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00041 fn3 Fibronectin type III domain
C PF09067 EpoR_lig-bind Erythropoietin receptor, ligand binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y5vC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y5vC01
4QWWD 4LSPL 3HR5B 3SN6N 4GAFB 1G7HB 4X5XB 4PGEA 3REWA 4LGPB 2AEPH 5HYJD 1YY8B 5F7UA 1S9XA 2HP4A 4IRSA 5DXWA 2Q3ZA 1LEGA 1S5HB 1TVHB 4JLRB 4MA3B 5I1EH 1MREH 4GMTL 5JHDE 3ULSA 5C0BD 4X7SH 3IT8D 1P2CB 1VGEL 4IRSC 1CICD 2BNQA 4I8DA 3RVUD 3W9EB 1N59B 3AGVA 3HPJB 4MX7B 3SHSA 3VCLA 1JGVH 3JV5A 2DQCL 5D8JL 3RWIA 2UZXB 1SHMA 1T0MA 2CDGB 2VIRB 1QOKA 2EEDA 3MFFB 4M8VA 1ZT4B 3L5WA 2VQ1B 1FVEA 4FTVA 1KPUB 3LKRA 1IGFL 3JWNC 3VXTB 1QO3A 5EBWA 5JUEH 4LQ1A 2X1QA 5DGQA 4FMKA 2YD3A 1HHJA 4U1HB 4TSCL 2C1PB 2CIKA 3MYZA 3MLTB 4UIKH 2BY1A 3K4ZA 3M1BA 1JE6A 1JHKL 4R96B 1KC5L 3BZDA 5IOPA 3GHEL 1IE5A 3QI9C 5I1AA 3N0PB 2ARJB 3H3PH 1U92A 3AXLA 5DURD 4ELMB 2J4WH 1XH3B 4JG0H 3U4BH 3O0RL 1NMCB 2EXYC 1BZ9A 5IJKC 4DGVL 3MJ7A 3GSNH 3RZCB 1BZQK 3QIBA 2OQJB 1EERB 2HTLD 1T4KB 3GB7B 3FONB 2WLZA 4P5TC 5E24E 5HYQB 3L3JB 3H7LA 5TDNB 4M6MH 4LLYA 3TYFA 2YUZA 3DTXA 4CMHC 4DTGH 5AAWA 3NFPA 5FGSA 1N0LA 3O11B 3OKDA 1RZGB 1ZEAL 3ARFD 2O61A 3I02A 3T4AB 1FDLH 1CT8B 3O6MH 1AXSA 1FE8L 4NNPL 4OQTL 3FFDB 3QXAA 1WZMA 4R3SA 3PGDB 4XAWL 1GIGH 1Q9WB 3BKCH 4E42A 3KWWA 2NR6D 1AKJA 3LQAH 3QQ4A 1OSPL 1S3KL 4DVRL 3DVFA 1H3GA 3AM8A 5A43C 4ORGB 5FDWA 4X4XB 4Y2DA 1OW0A 2DM7A 2XNAB 3DV4B 4O2FA 4GW5A 4I48A 4NQSB 3BP5A 1EFXD 2X42A 4J4PD 3TFKD 4XZUA 3PHQB 4CN4A 1KCUL 2EIBA 3AUVA 5IGXH 4X6DA 1A1MB 1BFVL 2Y06H 3GFUA 5J7CC 3BUYA 4BUHA 3K8KA 2RGSA 2JJUA 5KBNC 3U7WH 2OP4L 4DGYL 3VW3L 1WJ3A 5DJ0A 2FO1A 2UY6A 2EYSA 1NUFA 1UH4A 4X5LA 3VXMA 5LGJB 1WK0A 2YD6A 5EA0L 3TBSB 4ZQKB 3FB7A 4F7MA 4P5MB 2WBJA 1D5BB 1KIUA 4JRWA 4JFEE 1CFTA 5T1LA 4NYLB 2CUIA 3U36A 4YGVA 3HI5H 4LKCA 4N1CA 2AQ3A 1YECL 4YHLH 1LMKA 4GAGL 3EHBC 3T0DA 1ZGLP 1JF1A 1ZT7A 5D5MB 2V2TB 1GC1H 1JK8B 3S98A 1WWWX 4RDQG 1P5UA 4XHJC 3T2NL 3U30C 3V7AG 4ISVB 2W1NA 2IF7A 2ZPKH 4LNRA 4P2RB 3MOAH 1GHFL 1N7MH 1P2CA 5JNYA 1VFAA 2YRLA 4K2UL 4W6YB 3TESA 5KJRL 3O2VH 4YHPA 5E99L 2NY0C 4ODXB 1K8IA 1DR9A 1RZKC 4XI5C 5K9QG 1S9WB 4MVBC 1VEMA 1L0QA 4R96A 2XZQL 3WHE0 1UG9A 4EQ3A 4PTTB 2H41A 4PGZA 1CD0A 4BFIB 5BRZB 5IFAH 1SJHA 4KRPC 3WMSA 3MBED 4RAUB 2NY5C 4B7IA 5EZLA 1VGKA 2BMKB 3EYVB 5FYJH 4G3YH 5DMIH 4KKLD 1CL7H 1LO3H 2GSIB 1JHLH 1FVCB 1YY9D 3IJHA 4N8VB 4NQDE 3FO2A 4AEHL 1KLUA 3MJ8A 5AZ2H 5HPMB 4MNGB 2I9LB 1GZQA 2ADJB 1YMMD 5K33A 2P8PA 1DEEA 2JE8A 1RIHH 2DB8A 3WKMH 4YXLL 2ZUYA 3MRKB 4LLDA 4J7RA 1J1OH 3GSNB 3H7BA 2B39A 2GY7B 4I4WA 5JIHA 1JNLH 3NPSC 3DYPA 2XWBA 5DHYB 5J56B 4J3VA 2DI7A 5C0AA 4OCWL 3DVIA 2UWEA 1WIUA 2A73B 3LZFL 1NUNB 2NY6B 5HGDA 1UKTA 1XGPB 1A5FH 1J1XL 1TENA 1QQDB 1R5WA 1NCBH 4MQ7B 2WNGA 1G6VK 2NLJB 2NY4C 5J9PA 2IMMA 3O3BB 3WIFA 1ZXQA 4UQ3A 1DANU 1RHHA 3GJEB 4PRDB 1G7LB 2EO9A 2NY5H 1V5JA 1I7RB 3OKLA 2ERJB 2FO4A 1ZVYA 2O5ZH 4J3UA 2CSPA 3I2CH 4LPUA 5LWYL 3CFDA 4NO2A 5E5UB 4LVEA 3ZKQD 1UB6B 2X4SB 3OKNA 3FT2A 3TIDB 2XWTA 3UROR 3KPPB 2VB5A 1AGBA 4BYHA 4EI6B 5C07E 1NAMH 1UM4L 4Q6IB 4POYA 1NCCH 1KELL 1LE5B 5C09D 2WUCL 4PJCE 3U0WH 1DQLL 5BZWB 6CGTA 4LRNH 1I8MA 3Q1SH 2NNAB 1HNGA 1CIDA 3O4OB 4O02L 4YXKH 4Z0BH 3RVWD 2R8SL 3P4NA 8FABB 4WEBH 4XC1H 4X5WA 4X4ZA 5IHZB 3N1PC 1N6UA 3MCKB 5IUSA 4ALAH 1BM3H 1T1WB 4PR5A 2EC9T 4YDVB 4RNRB 3ARBB 4NHUB 1E28B 3O4LE 1NMAL 1S8DA 2NX5B 4AEFA 1FIGH 3OGCA 3VWKA 2CLRA 3H9HA 2KZ1B 5D2NB 3B5TA 3GSWB 2CLZA 4KRPB 2CDGA 1NMCC 2VIRA 2X4NA 4UILL 2GFBB 5C0GA 1ND0A 3AY4A 5T1MA 1LD9B 1EAJA 2BHYA 1A6UH 2V2TA 3VXUE 4R0LB 4Z7UE 4PJEF 4F37F 2Z31D 1BJ1J 15C8L 1C12B 2B7DT 4GQ9H 5DQJA 2OJEB 4B7LA 2X44D 4PP1C 4M6OL 2A9MH 2XFXA 3W11C 4QWWC 5B21A 1HEZB 2J6EH 3LHPL 3SE8H 4F7PB 4ODSH 5IOPB 1AQDA 4PJIA 3FN3A 1MAML 5C2UB 4BZYA 3QDJB 2ID5A 4BSWB 5T33L 4FQXB 1PDKA 4JFFA 3R1GH 4MNGA 3VFOB 4RISL 1Z3GL 2CXGA 4R4FL 1CLYL 3TCLB 3RPIB 3ILQD 3O81A 4OD3H 4DW2H 3EYFA 2WWMD 3ZDYF 1RIVL 3MRKA 4S1SH 3O41A 5L88H 4JFOB 3MRJA 4LCWD 4PBVC 2X1XR 4JKMA 5D6DC 5HHNB 3LMJL 3KLAB 4K94L 4Z0XA 4H8WH 4P9HC 4YHIB 2XA3A 3KS0H 1K2DA 4PJAF 3ARQA 2Q7YA 1MHHA 4WU5A 3PQYB 1INEL 5L7XH 1VPOL 3MO1B 5ETUB 4JPWL 1TQCC 5F8QC 4HUXA 1NGQL 1G6RA 3EOBA 3BSZL 2DAVA 1ZK9A 4P4KC 4XXCC 3WD5L 4DZBB 3L9RA 4ZUUA 1CGUA 3DROB 1TJIL 3MNZA 1A3RH 1Q9LB 2APXA 3QPQC 4PGDB 1AXTL 3P0VL 5FO7B 3TPUA 3U4AA 4LDOB 3RNQB 4Z78A 3HFML 1RJCA 5BV7L 2CH8A 4KJWC 5HDOA 5DUPL 4JDTH 4ZUWB 5JQ6H 3E3QC 4WRLA 4MQSB 4HCRL 3RVVC 2UY7A 4ZTPH 2V9RA 5GS0H 3CFBB 2F53D 2ZCLL 2IPUK 2EH7H 1IRAY 4ZD3L 1BPVA 3MPCA 4WV1C 4LKXA 4DAGL 1FNAA 1YJDL 3NFPB 4C58B 5C0BB 1I1CA 2ZUUA 3SDXB 5DJAB 5EN2B 2QQKH 3IU3B 4GBXD 3IDIA 5T5FL 4YDVA 3VFWA 1WSST 5DJDA 4H25B 4PP1D 1OGAA 4X4YB 3TA3C 2ZUTA 1VSCA 1QLRA 4PJ5D 1CI5A 5T1DH 2IANA 4HUNB 3LKQA 2C3VB 3V4PH 1A6AB 3IU4H 3R1GL 4IMKC 1S7TA 5HHOB 4LLUB 1U2HA 1RZFL 3GMNA 5I75C 3LKOA 35C8H 4M93B 1YNLH 4IRJB 1U3HD 3LD8B 5JOFA 4ONHB 1A14L 4LHUB 1A1MA 4HF5H 4N9OB 3O45A 1ACZA 1HNFA 4UINL 5E8OA 2PCPB 1FLRH 1P1ZB 1R3JB 7FABH 3K8LA 2Q87A 1UZ6F 5FCSH 1H3VA 4HUVB 3PWPB 5ANME 3VFGL 2RAMA 1J0IA 4P4RA 4JANA 3LSOA 5IB3A 4EN3B 3OAZK 1IBGH 1TTFA 1MY5A 5J06A 3JSSA 1D3CA 2JB5L 5SX5H 2I9TA 5D96B 3RI5K 1FYTE 1ZLVH 4HH9B 5CLTA 1M1SA 1EEQA 3MUY1 3KPRA 4LKCB 1Y6NR 5MENA 1CR9L 2V2XA 4NKIL 3O6FC 3DO3A 4YC2B 3BW9A 2V2WB 2EDXA 3PWLA 2MCPH 3B9KC 4RFNB 1UWEL 1UB5A 4LAQH 2XXMB 1P69B 4BSWA 4WO4A 3ARFB 4DK6A 3FT4B 5BZDB 3MLZH 1SY6L 1DVFD 4L1HA 4Q2ZB 3RJQB 5K59E 3U4EA 1YZZA 4QTHB 2PF6A 4X7DC 4J3XA 3O2DL 5C0AB 3MRMB 2NZ9C 4JJ5A 4XNXH 5H8DA 3VGFA 4C56B 1FVCA 3QUYD 3MNZB 4XP4L 1OAXL 3VD4A 2P7TA 5ESAB 1HHGA 3RVXC 4IOIA 5HI4C 3CX5K 1DQQA 1TJGL 2CQVA 2CUMA 3NVQA 4JFFD 2EIEA 2AGJL 3S3JA 5BVJA 2B5IC 2P5WE 4KK6D 3S8WA 1Z9OA 4YFEA 1S9VA 3JV4A 4OI7A 3HC3H 1J1PH 3IJSB 4LCWA 2X70B 2Q1EA 5C92A 1U8MA 2FDBP 3QUMA 4TTGA 1MFCH 2VXQH 1R3LA 3IJHB 4IS6B 1K4CB 2WWKO 2XG4A 4PV8B 4GG6A 5EO0B 4CADB 3QIUB 1BFVH 2Y06L 2NLJA 4YDIL 1U6AL 3DGCR 4OZHF 4AG4H 4Z7QE 3W5MA 4UZGA 1P6AB 4PJDF 1LE5A 5FCUH 1BLNA 3O3DA 1JVKA 4ODWA 3I3EA 1HH6B 1V3KA 3CFCL 5BMFH 1UKQA 3WXVH 5EBLA 3GSRA 2YD1A 4MB4A 5IBLD 4V1DB 5HGBB 3QIWA 2E27H 3FFCD 1S3KH 4W4NA 4ZS7L 1REIA 4DVRH 5D2LA 1UACH 4JN2B 1T20A 2XT1B 1H15A 5T3XE 2B20A 3C5SA 2BC4A 3VI3F 3N9GH 4KK9C 4NO3B 1HI6A 2BNQD 2DKUA 3FQNB 5EU5B 2YPVH 4XCYA 1XR9B 1JYVA 4NZUH 3NZHH 1KTRL 3SBWC 2DDQL 4O58H 4DCQB 2E7BA 2YK1H 3RGVD 4PIRF 5JQHC 1FYTB 1UFUA 1A21A 2B4CL 3OXSA 2HFGH 2P5EE 3QQ3A 4BSJA 1KCLA 3ZDYE 1YDPB 2UVEA 35C8L 3GJFB 4XHJD 2XPGB 4RGMB 2J12B 4YO0A 5I18H 4OCSL 4MVBD 3ARBA 5I1KH 1AH1A 3O0RH 3DXAD 3GMNB 4P2QB 3ULVF 2EICA 3L6FA 3ZE0F 1NEZB 4J8RB 3VMPA 4K2UH 2AEWA 5F97E 3T0AA 2D7MA 3OX8A 1T83C 4OCMC 1R5VA 3TYGH 1J7VR 4GS7C 3REVB 3EUUA 2V5TA 3TF7C 4NQDA 1U8NB 1D7FA 4YAQB 2XG5A 5E95B 1YQVH 2UYLA 1SVCP 1LO2H 3UPRA 1ZT4A 3L5WB 1ZSDB 5F7HA 1C5BL 3ETBF 1ZS8B 4K3GA 4XX1G 4HPYH 3UBXA 1FZJB 1U3HB 2OCFD 5CJOL 4EN3A 4UTAH 5L2KA 1YPZB 1HOCA 3RVVD 4DKDC 4LHUD 3QIBD 3LN5A 2V7HA 4I0CC 1JV5B 3ZT7A 1AC0A 2LFGA 1U8LA 3SKJL 1N2RB 1JWSA 4KUCF 4FQXA 5KSBB 1MHCB 1MJUH 2PYFA 3V0AC 5D7IB 5BXFA 4UI2A 4X8XA 1LEKA 1C16B 3CUPA 1F02I 3B3IA 5IBTL 2BY3A 5FHBL 4EDWH 3PV6A 1E6JH 3WFBH 5B38A 2E5EA 4MLIA 4X7SL 4LPVA 4D9QE 4G8GB 4MAYD 1PZUB 2GKIA 3O8XC 4HG4J 1MQ8A 2VDML 2X70A 4ZXBC 1HXYB 2BSSB 3KPSD 1MEXL 3T3MF 5B8CA 3X13A 4OCYH 3PQYA 4WUKH 1UWXH 1OAUH 5J3HC 3OWEA 3F62A 5C0FB 4BH7B 3UJIH 1AFVH 3BI9X 4RBPH 1OSPH 2A2QT 2C7UB 5KS9A 4NNYB 4NC1C 5C07A 1B0WA 4UNUA 3BH9A 1F3DH 3SEPA 1Y6MR 1D5MA 5EOTA 1EEYA 4PJ5A 3K4DA 5DDHB 2IAND 1RUMH 1T5WB 1PQZB 4C56D 1NGWB 1ZT1A 3GSQA 3HAEG 3HMXL 3NBNA 1G7PA 4NZJA 2FCBA 1H3UA 1M7DA 5I6XB 2EKSB 2GK0B 1NFDF 5DUMH 5D93B 2MQ3A 5IF0A 4FTVE 1FH5L 3ROOA 1SMAA 4ZUVA 1I8KA 3DV6A 1E4XL 1CGXA 4RMQA 1AFVL 4N5UA 4RGMC 2Z0BA 4B5EA 2MHAB 4UDTA 2XQBH 2ESVA 5B38G 1M7XA 4H88L 2QV2A 3C60D 3CK0L 1Q1JL 4WWKA 5I1IH 2Y9RT 5MERA 4PRPB 3JWDH 5E08L 3QBTB 1KEML 5I9QC 1U6AH 3SKNA 5DQDL 1D9KD 1QVOA 4E41A 3FB7B 4F7MB 4KKLC 3RWCB 1M7IA 3OBAA 3BIBX 1G7MB 3L7EB 5DJ8B 2O5XL 1C8PA 3B43A 4YJZL 4GW4A 3D2UB 4QLRA 3TJEL 2EE3A 4DKFH 3G6DH 4JKPL 4ZAKB 2EZ0C 1HWHB 1PW3A 4NQTA 3T1WA 1FO0B 4RQQA 1KPVB 2WM0A 2BDNH 1J8HD 1FZOB 4FZEL 1KPRA 4RX4A 5F89A 2Q8AH 4OGXH 5B4MD 3SO3B 4B0MM 4GRMA 3RWFB 3QG6B 2IGFL 4EIGB 3TA3B 4N0CC 4KQ3L 1UH2A 4X83A 3ZTNL 4WW1B 4S0SD 1P4BH 4OD2A 5T3XH 5C0ND 2ITCB 3DNKA 4QOKA 4F9PC 1TJIH 4NQEB 1Y0LB 2G75B 5IW6B 1S9WA 4PREA 4P3WA 4PJFA 3F7YA 4OV5A 3S35H 1BWWA 1YYML 4OZ4B 3QEUB 2X4OA 5C9JA 1AD0A 3C5ZC 3VG0L 4FQPA 1D5XA 2CIKB 1AO7D 4AIXA 3PL6D 4IIQA 1RK1B 4POUB 2P48B 4X7EC 5I1KL 1MNUL 2ATKA 4YDJA 3MLVL 5J57B 2FLBT 3GSOB 4CN1A 1G7JB 4PJDB 3H9SA 4KHTH 1QA9A 2A6JA 1FL5A 3CZFB 3UZVB 2G2RB 2VQ1A 4YE4H 1CD8A 1H3WM 1S7WA 5TQ0H 4L1DA 2FWOB 2E7MA 2XN9D 4D9QD 1J1XH 5E4IA 2J8HA 5H2BA 4M43L 1IM3A 5DI8A 1EMTH 4HS6B 2VZSA 2FX9L 2IQ9H 3GO1H 3IGAA 4QHKI 4M1GH 1Z0MA 1GL4B 1JGDA 2E27L 3PWLB 3K2MC 4JZOB 4F7CB 2VL5A 1JNJA 3X12A 2VL4A 5HHQB 5LGKA 5JHDB 2W0FA 2X1PA 2Z35B 4YXLH 4ZFFA 2HN7B 3OKEB 4XB7A 4XBEH 4RSVA 4JFZH 2XZZA 3BQUA 5HD8C 1SJEA 3P77A 3T0EE 1JI2A 4NGHL 1F6AA 1AI1L 2RBLA 3DSNA 4ERSH 5IIEA 5HHMB 3V4PL 4PUBH 1EEUA 3IFOB 5ERWB 2CKBH 5E4EB 1RJLB 3IJYB 2BNRD 3KYKL 5EC2A 3FHAA 3ULVE 2OM5A 3KPRE 4L8DB 4RMSA 1U95A 3S3PA 4F2MB 1I9IH 5I1DA 5A1AA 2WINA 3RDTA 1J0ZA 3T3PF 5I1JL 4OF8A 4FFYH 3QDGE 5HTSA 5EDXA 2BFVL 3QIBC 3EGSA 1EAPA 4ZNEA 1MI5E 1W2KT 1I8IB 1CVSC 4JO1H 4NQDD 3DURB 4OLEA 2VR5A 1IAKB 3VG9B 2BZDA 1FFRA 1KCVL 2R0LL 4TSBL 4YDLC 1H15B 4Z7OE 1FZOA 3L1OL 1JPSL 5BRZD 1QBML 5CEZD 2PXYB 3BZFB 5JNYB 5E8NB 4XTRC 2O93L 4WNQB 2H8PA 2DWEA 4P2OC 3SKNB 3D25B 3V5DA 4E41B 3QXAB 1CYGA 5GS3A 4OCXH 1VFBB 4S2SA 4TRPL 1QPPA 1T7XA 2HJFA 4V1DA 5IJVB 4KDVA 1PZ5A 2IAMB 1XF1A 1H8OA 3BN3B 2EDDA 1OPGH 2L7UA 3TN0D 3HTLX 4ZXBB 1KEGL 4WTZA 3BWAB 1SM3H 5IK3B 5DQJB 4NSKA 1LK2A 3NIFF 4LSSH 3CMOL 4WFHE 4HJ0D 1KYOJ 2ITDA 4OZFH 1QSVA 3TO2B 2ORBH 1HILA 3QDAA 4FFZH 3IDYB 2FX7H 2NY7L 2RIKA 4K3HA 1K3ZA 2ATPB 3QEQB 1JGUH 4H8WC 2NY3B 1YDPA 5CJXA 3CSPA 4AM0A 1PYWB 1Y0LA 1VESA 4ZOBA 1SJHB 1I75A 2QQNH 1CF8L 4IRZH 5C6WH 3ULUE 1M05A 2Q8BH 5LCVL 4C4KO 4RX4D 5DVOA 1IKNC 4FQHA 3LKNA 1JF6A 4G8GA 4QHKJ 3L6FB 3ARGB 3HZKB 1MCSA 3FTGB 5D9SA 5HVWA 2GSIA 2XWJB 3X14A 5GZNC 2I60H 1DN0A 5CSZB 5B8CB 3BKCL 2HRPL 4QRTA 4XAWH 4AQOA 1K2DB 1XGUA 3DBXB 5F1SA 3P4MB 2GJZA 2YPLB 3LEVL 1UEMA 4ZFFB 2C26A 3L5XL 4HK0A 1ZEAH 5CP3A 3ZKMC 4OF3A 3QUXC 1MWAA 5CSBA 1OGTB 4TRPH 1A4JA 1W72B 1H0DA 4NUGL 1V8HA 5DJXB 2NY1D 1RULL 4HUXB 3MUGB 3C60A 4CW1B 2YN5A 3EO1A 3T0WA 1BVKB 1B0RB 1L9NA 1ZHKA 4N5ED 3TIEA 3QUYB 4YK4C 3IGAB 4DGIL 3L1OH 5DMGD 5K93A 2PYFB 4D0CB 4MJ5A 4RRPG 1MELA 1K4DA 5GS0L 5CD3B 4OLWH 4KY1H 4Z7UB 5DC9B 2VQUA 4K3EH 4R8WL 4HEME 1JHKH 4OLZH 4WEBL 4XC1L 1EZVY 1ADQH 4I3GA 5C0JA 3PHOB 3B2VL 3QUMH 2VZVA 3GDBA 4MA8H 4AEIL 4BQBA 2A73A 3QUZD 3AREC 3TT1L 4FQ2L 5FHAH 2YWYA 4LHQB 2GK0A 5D1QB 1LP9F 1MAKA 4HJ0C 1WAAF 3MJ8B 1UZ8A 2EE2A 3T1FB 3DX6A 4Z8FL 2A74A 1FZMA 1MWAH 2NX5A 3DMMC 1JGEA 3HZYA 4HKJA 3EO9L 3G5YB 4LVHC 4ONFH 1Z5LA 1S9KC 3OR6A 2O5ZL 4PJ7B 4MD4A 1QSFB 1DANT 3MBEC 4FFVC 2XTLA 3LKQB 4FQIL 4L8CB 4X6BB 4RWYL 3WO4C 4YHYC 4NO0B 1I3RB 2VN4A 5CSGA 4PJBF 1WBZB 4D9RE 1H8NA 1UYWH 3WKNA 1P9MC 1RAMA 2GSGA 3IYLW 5KSAA 2UVFA 3GO1L 4I77H 5E1AB 3L3OA 4R90L 4DZ8A 4WDIA 4K71B 3AAZB 1ORQB 4K7PY 5DWUH 1VEOA 4H88H 4GFTB 4HKZA 2AP2A 4HWBH 3UTQB 4WEUD 1A2YA 1CXEA 3HAEA 1RZKL 4GH7B 1CICB 4JGJA 5DRZA 5I1HL 1DQMH 4G43B 4XMLL 4Y7MA 1S7SA 1X4ZA 2ITCA 4LVNB 1DDHB 1TCMA 3T08A 1DBKH 2VC2H 2XWJA 5DD6A 3SQBA 2BJML 3C08H 2FL5A 1J12A 2VMFA 5IW3A 2UV3A 1I9JH 1SBBA 2WIMA 4PJHF 3PJSB 1MQKL 5IB2B 4QRRE 3PWNA 2AKRA 2BSRA 1TZIB 3MSPA 1KPRB 1AD0B 3C09C 5F89B 4OZGB 5LQBL 1BF2A 5C0CD 1JZ6A 5D96C 5GJSL 2VLJE 3NFSH 4JHBA 12E8L 4QCIA 3GNML 4PJIE 4AT6B 1WICA 4MA8L 4AENB 2XRAH 4L3EA 3KYMB 4FXKA 3SGDH 3SE9H 1MHHB 1EEZB 1I8LA 4U3CA 3UC0H 4R97B 4YXKL 3D3VA 3ZTJH 4NOFA 3WYRA 8CGTA 3SE3C 5DTFB 5CEZE 2NW2A 4KJQC 5IBTH 1A6VL 4YNYA 4HGMA 3QWQB 4F58H 1CU4H 3TO4B 2NCMA 4YGAB 3D85A 2EDHA 4G8GD 2YXFA 1GGCL 5TDOB 1G7JA 1JGDB 1NGYB 2W0KA 5E08H 4IS6A 2EH8H 1N8ZA 4M00A 5J1AB 3Q48A 3WCYA 1JYNA 4X99B 1R24B 2HTKC 5KTEH 2IG2L 3IDXL 4J12A 5ICXA 3UAJC 4P48A 4U1LA 1X5KA 4KMTH 2QKIB 5I1EL 3RAJL 3DETD 5BW7C 3IJYA 5CEZH 5JO5A 4NNXB 4X7CC 4CVZB 4P57A 3D3VE 1KACB 5IVZB 2Q7YB 1B2WL 3FOMA 3PXJA 4PS4L 5KANG 3GRWA 3T4YA 3HNSH 5GGTA 5JR1L 3WHXA 1EUTA 1UADC 3B9KD 5I1DB 3CU7A 3IXTB 3A67L 1BFTA 4Y19E 5F7DB 3FRPG 4IRJA 5H94A 4LF3B 3VDAA 2EEAA 2BVPA 2EC9U 3SBWA 4ODUB 4AMKL 4JZJB 5HGAA 1FZKB 4OT1H 3E6FB 1OOAA 2JJTC 2OSLB 1S7UB 2J8OA 3S4SA 4RWHA 4AEHH 3MRNA 4PG2C 4WHTA 3T2QA 1KCKA 5C0BA 4IOFC 3BZEB 3RPKA 4D0DB 2QR0B 1YNTB 4Y16B 4CKVX 2WSKA 3OG4B 2VLJA 4HGWB 3DX8B 2DN7A 1T0MB 3EYSH 4R26L 4G9FB 4Z5RA 5C0CE 4TVPE 4MQTB 5IMLA 1P1ZA 3RBGA 2Y7QA 1U3YA 4QT5A 4FS0A 4RGOL 5ITFA 3VD5A 4DGVH 3ULSB 3ZKXC 3UTQA 2DOCA 1QBMH 1RIUL 1SJXA 3GMQA 3CPLA 1NJ9A 3PWVA 4P2YA 5KJRH 2A6IA 2P8MB 2APVA 3FT3A 3NIGE 2H9GA 3SDDD 1GJIA 2EDKA 5L8KB 4PJ7F 4KROC 4Y89A 1LE9B 2BX5A 4YX2H 4EUPB 3KJ6H 4U0RC 1JV5A 2HAZA 4ZUTA 43C9A 3MJ9A 4Z7QF 2CK2A 5JDJA 4R0LA 4HUKB 1DQQB 3DI2B 1R3JA 3BQUC 2DQIH 1LO2L 5FV2A 3VXPA 3QNYB 4P23B 3LQZA 3BEVB 5I1LA 1CDGA 1DL7H 1J05B 3K46A 4XPHH 3WS6C 1BJ1H 4Z9KB 1N3NB 1JGLH 3MRGB 4Q0XH 3A67H 5F3HB 1ETZB 1NDMA 1QFWM 3LKPA 1INDL 3JTTA 3MR9B 5J13B 4M7LT 3RY4A 3NGBC 2EEBA 4XVTL 3ARDB 3V6OE 5T3ZE 3D0VA 2GITB 4RGOH 5FYLD 4OFYD 1KULA 4ODHH 3ARFA 3BESR 2ENYA 4KMTL 2X4TB 4NKDB 5GQBA 3RX7A 2BVQA 3H6JA 4JFOA 2EDOA 3WN5A 1U8HB 3PV7A 4UUJA 2AEIT 4AZ8A 3M8OL 4U1HA 5C7XL 4NDMB 2MCPL 4JM4L 4X8JA 1JWMA 2IQ9L 1F4HA 4OZIA 2QHRH 5FUOH 5EZIH 1NAMA 2NY6D 1XF3A 5KAQF 2ICCA 1UXWA 4LEXH 5FXCH 2JB5H 2I07B 4JRYB 3QZWA 2VZTA 5GGRY 4JFPB 4R7DA 1PLGH 2R29H 1C08A 2XA8L 3MJGX 5LBSH 1XZ0B 5HI3C 4NO3A 4HC1L 5C2BH 3OQ3B 4NQVB 3U0PB 1HWGB 1WT5A 2P5WA 1CGYA 2V5MA 5KOVC 4LEOA 4WHYG 5J13C 2WLYA 3GRWH 3PP3H 3THMH 1I7ZB 4Y4HA 1T0NB 4HS3A 3VWKD 3MNVA 4ODUA 3ZE1E 2N56A 5FIEA 4NM8L 4GXUM 1I3UA 4AG4L 2VLLB 3K2UH 1NCAL 3ZDXE 1RMFH 3VXMD 4X80L 3P4LA 3TNNA 4QGTA 2DL9A 4MNGE 1XIWA 5IMMB 4G9DB 2KBGA 1JF5A 4OFKA 4Y1AB 2Z8VC 5C6PB 1KG0A 5I71C 2VO5A 1OM3H 3PHOA 5CINH 1RUQH 1N5AB 4NQDB 3IJSA 4YAQA 2AJXL 1J11A 5IROC 3HUJF 4XXDB 2I26N 1CFVH 4NWUL 1U93B 2IGFH 1YQ2A 4HFUH 4KTEL 4EOWL 5IR1A 4YO0B 1AHWB 1U8KB 1XGQA 5SV3A 2HLAB 1E4XI 1X4XA 2DQIL 3OKMA 4K23L 5C0RH 3V4UH 3U6RA 3NN8B 3ARBD 1FBIH 3WDJA 4Q9QH 5D1XB 1HQ4A 4PGEB 3PL6A 4NQCE 3KJ6L 4DAGH 3HE7A 1ZE3C 1CGSL 4G8GE 5E6IA 3TJEH 2AXGA 2CDFA 5DK0B 2FL5B 1BZ7A 3GSUA 4KTYA 3GBNH 1RI8A 1FSKC 2YA2A 1NUDA 5E1HB 1FFNA 3ZT6A 3E6HA 4ONGH 4M1DH 2IBZX 1ZS8A 1BHGA 2Y72A 1W0VB 1R5IB 1UM5H 1WBZA 1J18A 4TSAL 4ONHA 3G5VB 5LVEA 2WBWB 4HPOH 4XBPA 1CLZH 5CGMA 1EJOH 2CMRL 3BYTA 5JXAL 3OX8B 1N2RA 2IADA 4Q7DA 2VLJD 3NCYS 4N5EC 4X9BA 1IARB 4X6CE 4U6VH 3BGMA 4FQXD 3SDAA 5DEGB 2A6JB 5JXEC 4DUXA 1TZIA 4ONFL 3U9UB 4XPTL 3T65A 5TE6H 5MENE 3OSKA 4OQTA 3X3FH 1GGCH 3BZ4B 3VXRD 3GSNA 5TDPB 4M7KL 1MWAL 1IGIL 2NY2C 5DHYA 2ED9A 4F58L 5DD0L 2VLMD 4S10A 3O8XA 2H2SD 5FYKL 4DK3A 3KLHD 5IVXA 1UT9A 5JIIA 3CNKA 4HAGA 1V7ML 3FO2B 3NTCH 3VE0A 4ZFZB 1KN4H 3ARFC 3VGAB 1R24A 4QTHA 4FABH 1TJHL 2ZCKH 1CDCA 5CJ8A 2XZCL 5FF6A 5EZLB 3BJLA 1A3QA 4JJ5B 3VH8G 3GNMH 5B39A 3IFLH 3QWRA 3LKSA 5C6TH 3IAPA 1HN1A 1N4XL 3U1SH 1IQWH 5MP6H 1G84A 4Z7VA 3QQ9C 2IG2H 2KL6A 1GGIH 5DA4A 5HVFB 4JE4B 4QXUH 3CXDH 4JRXB 2JCCB 3TVMA 1J8HB 3SCMC 4GW1B 4UU9B 5FYKU 1XH3A 1BQHA 1AGBB 3C08L 1XCTB 4MXQD 4OQ1A 5DD1L 3QHTC 5DJ8A 4OF7A 4PYGA 4Q9BA 3KJ4C 2F58H 2PO6A 4W4OC 5EU7C 1CQYA 5TE7H 4JFEB 4GSDL 1G1CA 3MRNB 5L6YL 4F15C 3OKDB 4HQQH 2PO6C 3NIGF 3E8UH 4W4OA 4LCIL 3U9PH 5IESL 1BM3L 1NMBH 1MRCH 3GM8A 2E6PA 3GJFK 4MJIE 5J4MA 1D9KA 25C8L 4OLZL 1OLZA 3MBXH 4UT6L 1EV2E 2GTWB 3QUXB 3GSWA 1O7VA 3WNMA 4G6KH 5D7SL 1CFNA 1U3HC 2OTPA 2OBGA 4FN0A 5T1MB 4PRIE 2UUDK 1QP1A 2P45B 1PZ5B 1T83A 4DUWA 3ARYA 1EFXA 4J4PA 3S5LA 3X3FL 4JQIH 3CDGB 2OR8A 1HYSC 4HEPG 3L7EA 3QDMD 3BUYB 4JFHE 4C55A 2P8LA 2Q86B 1ZV5A 1KJMA 3WFHA 5FOBB 4OFYA 1QTYT 1H8SA 1FL6A 3NABH 4M1CC 1E4KA 3RTQC 3CAFA 5J8OA 4MQXD 3MA7A 4FNLH 5DFVD 4IHOB 3BDBA 5ESQA 3OB0H 3H2WA 3SE4A 2VLME 4MA1B 4PJXA 5C0EB 2J3SA 1NGZB 5F7YC 1JUFB 3IVKB 4HIHA 2F15A 1E28A 4LMQE 2DLFH 1A9BA 2X89D 4FQCL 4Z7NF 4YDJB 1BQHG 1YUHB 1AD9B 4P3CH 3LS5L 4M5YH 3NACL 5CSZA 4GQ9L 1UYWL 4XNQB 5FA3B 3MUZ1 5DFWH 1CDUA 5KOMC 2GT9B 3L7FB 3QUKA 4MJ2A 5ETUA 3RY6C 1LDPH 3QFJB 3BAEH 1SEQL 1NC4A 4JQVC 4GRMB 4LHJB 5C70A 4X9IA 3TCXA 5HYEA 2JIXB 4FFWC 3SPVB 1GXEA 2AV7B 2WIIB 1FIGL 4WW1A 4RIRA 4WJ5B 4OLXH 2YXMA 1MY7A 4MHHG 1K85A 1NEUA 4UNVA 4JVPA 3EYUL 1QRNB 2GY5A 5E6YA 2AGJH 1RU9H 4JFFB 3L5JA 5E8EA 1IEAA 1XIWD 1RZ8A 1WAAA 2A0LC 4D0CA 3EOYG 4XAKE 1G1YA 2OTUA 4PLJD 5F7KC 1D6EA 5D72H 4JGUA 1I7TA 1MCWW 4JKKA 4KTDH 2P5ED 1LEIA 4NKQB 4LCUB 1FQ9C 1OAQH 3FRUB 4PTUB 2IAMD 4YHML 4KMLB 4WFFE 3UO1H 2AQ2A 3F7VA 3VI4F 5F21B 5C0IB 3IF1A 2H8PB 3LN9A 3T2NH 1QRKA 3DXAA 2VLKB 3VGGA 4O5LH 2D31A 4FFYL 4FXGB 5EPMB 5F1OB 5EZOH 1EAPB 3TJHD 3B9AA 1CR9H 4KGJA 3L3DA 4OZIB 2H26B 4CUCA 2A1WH 4LEXL 5GS1C 5GGVH 5F3BA 1MFEL 3KYKH 3NABL 5GGTH 1U8KA 1XGQB 3DUHA 4PPTA 1SJVA 2XYCA 3O3BA 5FYJU 1T6WA 2I25N 1CFBA 3RL2A 3LKOB 3RA7H 4U1MB 4EI5D 4X6CF 5I74C 4OCNC 4MA7H 3VW3H 2WUBL 1VA9A 3PHSA 3KPNA 1GH7A 4QRPE 1U58B 1I1FB 4XVSL 4GRWH 3NH7H 5ERWA 3OKNB 2NY4D 1U3JA 1OP5H 4TQEH 4Y2OA 4ZUSB 4NQEE 3KYOB 3OF6D 4NUJA 3ZKND 1VKXB 1JGUL 5K9KB 1AC6A 3IU4L 1TXKA 1QSEB 1QZ1A 5K9JL 3G04A 4G6AC 1GPOH 1T7YA 3OXRB 5D6CA 5HHMD 5DMIL 4MYWB 2X2YA 4MAYA 4LOUC 3MNWB 3KPRD 3C87A 4KPHH 1W0YT 3E8UL 3SDAB 1RVFL 5CCKL 2CRZA 2Y36H 3S34H 4XNZB 1PYWA 2OZ4H 3BRDA 5DC0A 1Z9MA 2OJEA 5F6HI 4LSRL 4NP4H 3OPZH 2GAZA 3BWAA 2HT4C 4WUUE 4LRIA 4PUBL 3C5JA 3BGFC 1N59A 3QA3A 1ZHNB 4KKAD 2X4NB 2F54E 3O2VL 2CDFB 4Y0GA 5C3LD 1TQBC 3FO9A 4XBEL 1LD9A 5JA8B 4WV1A 3LN4A 4UV7L 4PLNC 2OTWB 5I1AB 1KUMA 1T04A 1JYWA 5DO2C 1MCEA 5ISZB 4NJAL 3WHE1 1W0VA 4HV8A 4NRZB 1OGTA 4WWID 1HINH 4HCRA 2B0SL 4MNHB 4XVUC 4G7YH 4MJ4A 5B3JE 3ARBC 3I9GL 5I1CL 4XNUL 2QTEA 2DQEL 1TJHH 4DN3L 1D5IL 1FO0H 3DVNA 4GG6E 4NM4H 4M62H 3FFCE 1HXMB 2BNQE 3N06B 4OCRL 3V8OA 3L3JA 1T3FB 1HILB 1GC1C 1MCOH 5DS8B 4F7TB 5ESAA 3ZZ1A 1E4KC 3RTQA 2GJZB 1H5BA 1L7TL 2GEEA 4RFOH 4QHUB 4U1SB 2D7TL 1JN6A 4M7KH 3G5YA 2R2CA 4KVNL 4L29B 1GGYA 5DQDH 1BGXH 2FYYB 3FTGA 1TQCB 3W9DB 4D0BB 4NJ9H 1WC7A 4YUEH 5JHDA 3VGAC 5DR5L 2VISA 4N0YL 5I1IL 4YZFF 5TDNA 3CSYB 3A6BL 1BQHB 1OTUC 3BQUB 5BV7C 1KIRB 3D39B 3T4AA 3UTTE 3N1GC 1TITA 3NZ8A 3SKMB 1NCTA 4X6DE 4KGLA 1F6AB 1NCDH 3ARGD 3V5HA 3GSXB 4O51A 3SGKC 4TSAH 4TNVF 3WJJA 3AY4C 4UMGA 1HDMB 3SDCD 3LY6A 1FYTA 1A7NH 4OZFB 1B4JL 3BPOB 3FZUD 2JCCF 3MV7A 3R06B 3BPCA 3UTZB 3IB4A 3TNMB 4ZFOL 4LDLB 1FDLL 4CRPA 5DJAA 4L4VA 5EN2A 1W8NA 1QACA 1OT1A 3MCG1 3L3KA 3JUZA 4P5MA 3T2PA 4XPBL 1X44A 1UM6L 2XY2A 2ZUVA 4MCYB 2ICWB 1TPXB 2VNCA 4U1KA 4KKCD 2ICEB 3A0OA 5C08E 1GGIL 3HNVL 2R4RL 1BD2A 4OZIE 2IALA 1BAFH 1AE6H 1ACYH 5IB2A 1S7TB 3OJMB 2IPTH 5SWZE 5ACZA 1S9YA 1MIEH 3GJFA 4R0LC 1QKZH 3PWPD 4NO0A 3DRTB 3FMGL 3S35L 4BM7A 4OTXL 1EGJA 4ZDHA 1JZ5A 4Z7VE 5HDBE 5FUCC 3HPJA 3GBML 1FNFA 5DJDB 3TO4D 1BEYH 5D7KD 5L2KD 1FC1A 1UJ3A 3BDYL 1D5ZB 3G04B 2WZPD 4M93C 4ODXA 1JRHH 2VRAA 2R2HA 3MV7E 2JJVA 2HG5A 3C8HA 2HH0L 3BP4B 3GIVB 2G9HA 5ILTL 2D7OA 3I75B 2LAAA 4MNQB 1HK6A 3Q6FA 1CN4A 1CE6A 3DPBA 3MX0A 4ISVA 2DQDL 2FNBA 4G6AD 4HV8B 3KPOB 1QEWB 3CGTA 5E94B 5CFHA 4ZO6A 1VFMA 3PWUA 3F7PC 4XPGH 3DSFL 1H3PH 4HPYL 5DMGC 4PRPE 1NCDL 1K8IB 1DFBH 1NGPH 2PCPA 5EBGA 4L9LC 5T1KA 3I85A 5A3ID 1XGYL 4M48L 4PGBA 4YDLB 5SWSD 5I66A 2B2XL 5IHLB 3MLWL 3LPWA 2XXCB 4UAOC 5BMFL 3JWDL 4IHOA 5FUOL 3UPRB 1OD9A 3B9KB 1YA5A 2VLKE 1R0AH 4RGNC 3KYNB 4YBQC 4KAQH 1F13A 2VN7A 4Y4HD 1OF2B 2GW5A 1FN4B 2QSQA 5C0NC 1NGWA 1JPFB 1ZT1B 1NGYA 2R69H 4O9HH 4WVRA 2VOTA 1QFOA 4XPGL 1AGDB 1ZTXL 4NQED 1JPST 4IOIB 5F8RC 2Q6WA 1HH9A 4M4RA 3V52H 3ABZA 1GGUA 4XBGB 1MLBA 4PJGE 2B4CH 5ID1B 1HYRC 3OAUL 3QH3A 4JFFE 5H94B 2N4IA 1U91A 5A2JH 3B5GA 4Z95H 4DN3H 3GSXA 5L2JB 2YPVL 4I3RL 5DUBB 5CJOH 5GGQL 4D9RD 1R3LB 4IIQC 1UACL 4PRAA 3W0WE 5CINL 3HMWL 5TFSL 2FHFA 4ELMF 4EUPH 2BOCA 1CT8A 4K8RD 2BVOA 4Y4KD 1LO0H 5ADPL 5BVJB 1HHIA 3UAJD 2MKWA 4LF3A 4M6NL 3KGRA 3WXWH 3KAAA 3SDDB 2W9DL 3I3DA 3HE7D 1F4XH 2LVEA 1EA9C 1ULVA 5DJ2A 5D2NE 3AMKA 3SY0A 1KJ3L 4Y2DD 2HT2D 4DQOL 5F3BB 4JM2A 2PTTB 2BNUB 3V0WH 2LQRA 4LLYB 3BPCB 4OCSH 1MCWM 4WU7A 4CVZA 5T3ZL 3OPZL 2BC4B 1V7NH 1JPTH 3QXUA 3D39E 4HULB 3OKMB 1IBGL 3IDJA 3GMLA 2XA8H 2RQ8A 5ICXB 4D9LL 3O9WC 4CNIB 3K7UA 5K9JH 4YBLC 5F7EL 1URLA 3QIWD 2YEZA 4PY7A 3N9GL 4P46A 3NIDF 3QDJE 5D1ZD 3QRFM 3C60C 4XMKL 2LTQB 4U7KA 2EDYA 2HRLA 3TN0B 4HWEH 3QZWG 4GOSA 5EU4B 1RUPH 4AY0A 4WWKC 3U0TA 1LGVA 4FFWD 3QA3B 4OZGE 3O3AB 4MA7L 4PJCA 4LP4A 3FQWB 4L3EE 3O8XD 3N85L 1KF9B 2J8UE 1WUNT 2V7NB 1ZSDA 1YMHB 2Y6SC 4KJPC 1WFUA 1X6NA 3GIVA 2HFEB 2DQJL 3VFOA 1L7TH 3WSQH 1EH9A 5HHPB 4P3DA 3T77A 1FRGL 1Q9OB 2VITB 3MRQB 4U3XA 1KN2L 3B4NA 3ARSA 4PJGB 4ZPTB 1NQBA 4LPCA 4J6RL 5KSAC 3QWRD 2MNUA 4IMLA 4P9MH 2ZWLT 3F58L 5GGRA 4Z5RB 1YN7A 5DZLA 4NNPH 2MCG1 2HN7A 3DX7B 5HYSA 5KVMC 4R2GC 2YPKB 3T0EA 5IFHH 3PV6B 1NGXB 3QFJD 4JZNB 1BX2B 1JTOA 4JDTL 4Y16D 2XWBB 4D8PA 4F33A 3W0WD 5IB5B 1IGCL 3QDME 5GS2D 5FF6B 4NCC2 2GUOB 4HS6A 1DBJL 1XCQA 1WC7B 5DJZA 5DVMA 4KRLB 2J6EA 3DUUA 4KK5C 3EYSL 5KSBA 1BEYL 1KJ3H 3DMMB 4NO5A 2I9LA 4MQ7A 4PRAB 3WFZA 4X7TA 3GBMH 3WFDH 2XACC 4Z77A 2NY0D 2G60L 3WJLC 1UH3A 4NBXB 3H3PL 5KN5A 1U2CA 5E9DA 3ZHKA 1D5MB 1IZKA 3ZE1F 1LDSA 5L8JB 3V2AR 4XNYL 3HRZA 5FKAB 4N9GA 1CGTA 1DN2A 3N1MC 1UEYA 5TFSH 1YEKH 3ULUC 5EUOF 1F42A 4X98A 4NO2B 5JW4M 1SYSB 4R7NB 3CU1A 1NFIB 2AERT 1Q94B 4OT1L 4HUUA 5HDBF 4JKLA 1JL8A 4ERSL 1U0QA 1ZOXA 2WP3O 2EDWA 1TNMA 3KR3L 3PQYE 4PJ9D 1FORL 1UWXK 2XTJE 4KJYB 3W11D 4ZD3H 5BQ7B 5ITBH 4X6FA 3P4OA 5D5ME 3QSKB 5C8JB 3QDMA 1NBYA 4O00A 4QRUA 3MNVB 5T1LD 4KUZH 3QP3A 5D8JH 5HDQH 2A77H 4WWKB 3KS0J 3HLAA 5GRXG 4M1GL 3ULVD 1QHPA 1NCWL 2VLLA 3EYOB 1EHLL 3Q5TA 5C86A 1MIMH 4L4VB 4ZDHB 1OARH 1BVZA 1A9EA 3C9NB 3KPPA 4FQQB 1LO5A 1FG2B 3KPMB 1KTDB 1KIPA 2DL2A 4NSKB 4GKSA 4R90H 5I8CA 3VXRB 4I77L 2MHAA 4P2QE 4UDTB 3UXFA 5C0GB 2A1WL 2RR3A 3WDHA 2AXFA 3TH3T 4MNQA 1JIBA 4PY7B 3MLRH 2A9NL 2AJSH 2MWCA 3MV11 2A83B 3DECA 3UX9B 1YJDH 1E0OB 2MOVA 1QLEL 4JANB 1ITBB 1I3GL 4L4TA 4Y4FB 1P7KB 3BKML 2E9JA 2AK4E 1NAKL 3MRLB 2DQDH 4HGWA 3VWKB 4NPYA 5DJ6A 4HIHB 3S9DB 4CU7A 2VXUL 3IDGB 3TO2A 4PJCB 5DUPH 5GPRA 1X5AA 1B6DA 1N5AA 25C8H 3O45B 4GKZB 1TIUA 3QNXA 2B0SH 3KPQA 1JRHL 4OGAD 1MRFH 2J1KA 1U93A 1WCBA 3QFDA 4OIIH 1T5XA 5GJSH 5LAXA 2J88L 2XN9B 5HSFA 2J2ZA 2P47B 1WEJL 4XHQA 3V0VB 2EDFA 4MSWA 2GJ6D 3BSZH 5T1DL 5TE7L 3VRJB 5GSRA 1T89A 1K3IA 2E8ZA 4KKBC 4F9LA 5IB5A 5E03A 3O8XB 4P59H 1PKQE 4XH2A 1DP0A 4WU5B 1S7VB 1KB5H 2PW2B 5LWYH 2VZUA 3K0WA 4DGIH 1FFOB 3EDEA 1JFQL 5F9JA 4OZHB 3S7GA 5ADOL 4XPAL 1LDPL 3U9UA 4TVPH 4ORZC 2J5LC 4XRCB 3O41B 5KN5B 3PP4H 3NPZB 4HKXA 1KB5L 4XPBH 1RZKH 5TDPA 5ID0B 1T66C 4I18C 4F80A 4M5YL 3MRMA 1QA9B 1ES0B 3CK0H 3PDOB 1YEGL 3CX5J 5I6XC 4Q97A 5IT2L 1NL0L 3ROLA 4LCUA 4Z0BL 3TBWB 5DYOB 3FQTA 2EYRB 1E4XH 4U1GC 2QQLH 3M17A 3MA9L 1UXSB 2ERJC 4IM8A 4RMVA 1P7QB 2FGWL 3IF1B 2XIDA 3LHPH 3KLSA 2BVYA 3ARGC 1RJZB 1K8DA 1U8IA 4YBQD 1NH6A 2JF1A 1B4RA 1T2XA 5IB1B 2WAHA 4G5ZH 4EKXA 1NGQH 5EC2B 5ITBL 1C7TA 4MXWL 4PV8A 2NY6C 4GBXC 2ORBL 3UJTH 5D7LD 5A2LH 3UJIL 3O4LD 4HKBB 4PJAA 2GQHA 2MJWA 5E9DD 1G6RB 1Q38A 3O9WA 4DCQA 3DRQA 3SDCB 2PO6B 5EBMB 5FAAA 3FO0L 1MEXH 2ZNWA 2D0GA 3RL1B 4S1QL 4I5BA 2Q76B 3PNWB 4CVXA 1AGFA 3W39A 3OB8A 2NW3A 2NZIA 3ELAT 4G7VL 4WNQA 2YA1A 1KJ2H 2Y07L 4L8SB 1VFUA 1LO5B 1XCTA 3EFDH 3QPQD 2WUCH 4LMQI 3GUTA 1QLRB 2DI8A 4NPYB 1X5FA 4UV7H 1I7UB 3DURA 5IJVA 4G6JH 1RUPL 2EDNA 2APFA 4RGNB 3MRPB 3MRBB 1EGJH 3ARXA 1ZLWH 2WMPA 3ZDZF 5HXMA 2DD8H 1NGZA 1WBYA 4KK8D 4U6YB 5F6IC 3ZLQC 3KXFE 1U8PB 2AJXH 3W0WA 3MROB 2DIAA 1HYSD 2B1AH 3CDGA 1A9BB 4R4ND 3ULUL 5L2KB 1T1ZA 4ZNCD 3BP6A 3IRZA 5MEQB 2OI9C 3GM0A 3RWJB 2HRPH 1OAKL 3IKKA 5IEHB 3KXFD 1CTOA 4YQXH 3D3VB 2BERA 4GKZA 2Z92A 2O26U 1QO3B 5EBWB 3O6LL 3TH4T 1F5WA 4DN4L 4H20L 2GHWB 5CIPB 4OCWH 4O02H 4OF0A 1OL0A 5DRXB 3Q1SL 3J8F7 2IADB 2AV7A 1MJ7H 2VDPL 4MMXC 4HIIB 2HVJB 3QNZB 4CMHB 3QQNA 1R3IL 2VWEE 3ARDD 1DE4A 4N0UE 4N8VA 4PJ9A 1YEIH 3CDFA 2YK1L 3LQAL 4LVOC 2HT2C 1YEJL 5DD5H 3WLBB 2Z31C 1SM3L 5HJ3B 4JPVL 2Y25A 3V4VL 4XP1L 3C6LA 3LDBB 4Z76B 2D7QA 3TEUA 1RJZA 1KB9K 1S7XB 2GJ6A 5F9OL 3CFKA 3QWOB 1F45A 3MV7D 1F90H 5F7LB 3IETA 5SWQA 5I0DA 1HSAA 5D7LE 5IV2A 3O6FD 4MD0B 4KVCL 4JN1L 5MEOB 3IFNL 3STLB 2BXYA 3BH8A 1HCVA 1A8JH 3O6KL 4DQOH 4X99A 4XVTH 1R3KB 4GG8A 1PEWA 4I1NB 2DLEA 1NFDA 4XWOD 3CJJA 1VDGA 4Y4FC 4Z7VB 1JGLL 5DVKA 2X10A 2OR9L 3EYQC 4LIQH 3N1FC 2PKDA 5BS0E 4E0RA 3HNTH 2ZPKL 4UV4H 1G7PB 4OGAC 2DLHA 3WLWD 5GJTH 4AYFA 4RGNE 1FG2A 4NO0D 3AREB 2GJ6E 3VGHA 1Y6KR 4GAYA 2HT3C 2ZG1A 4GAGH 3V6BR 2G5BA 1HCFX 3HN3A 4UOW1 2IQAA 2W91A 5TF1H 4HDIA 1MVFA 1FNEB 2IH3B 4I3RH 4RMRA 3UCRA 3OR6B 3IKCA 1U8JA 4G3YL 3KDMA 1KB9J 1RUAH 1ZAGA 3BO8B 1AGCB 4G80A 1KFAL 4OSUL 1TETL 1OSZA 1WZLA 4FQXC 4YPGA 4YK4B 1UZ8B 3T1FA 5IHZA 3CPLB 2AK4D 3MBEB 4P2QA 3BHBB 1AXSB 5GGSA 5KVFH 3AAZA 4HT1H 2A6KA 2IPUG 1IJ9A 1NCAH 1MFBL 5EPMA 2R23B 2ZUWA 1UWEH 4LAQL 3SGKA 1DBBH 3QNXB 5C6TL 4ZUTB 3QQ3B 3RWJA 2PW1B 1BFOA 3MTRA 4LFHG 4P3CL 3HAEB 2JJSA 1WWBX 2D9QB 1CE1H 3H42H 5IVNA 4PRPD 4J3WA 1SQ2N 4UIKL 4U1JB 3FQNA 5EU5A 4LQFH 1ORQA 3RUGA 1M71B 4PRID 4WO4C 4Z7WE 4JFQB 5FOBA 3HI5L 4JO3L 3WFHB 3FQUB 2VWEC 5C09E 4UINH 2R4SL 3S96A 2VDQL 3SOBL 3MA7B 2G2RA 1IEHA 1MNUH 1FLTX 2Y7QB 1WQVT 3BPNB 2Y23A 4XPTH 3ARVA 1VGKB 4I4WB 4EN3D 1CXIA 4GUPB 3CH8A 1YPZA 2VXVL 2AJYH 5E9DE 3QCUL 1D6VL 4QHLA 3MRRB 1DSFL 1CFTB 3PUCA 3DYOA 1R5VB 1FVEB 1KLGA 4DOHE 2CXKA 5E6IC 5HBBA 1IAOB 1JPFA 3AS0A 3MJ6A 4S0TD 4PJ9C 5B22A 4PJFE 4Y5VA 1GGTA 4XPHL 4NRXB 2EH8L 1R3HB 4NJ9L 1T5XB 5C0BE 1KCSH 2C7UA 2P5WD 4X9HA 3RWGA 1MFDL 1T5WA 4LSPH 1IM3B 1KJVA 4KXZI 2HVKA 2BRQA 5F71A 1RZIB 3KPSA 4MAUH 4L8BA 4LLVB 3SJVA 3CFKB 1HXMA 4Z7VF 5EU3A 5L6YH 4MAUL 1INQB 5AYUL 2R0KL 4Q74A 3M07A 4NKMA 5AYQA 1U41A 3GI9L 4GRLB 3RNQA 1UENA 3IFPA 1IL1A 2ENSA 1CCZA 2DQEH 1NC2D 5DD1H 5DJYB 1UKSA 5C9KA 2DQCH 3NCCB 4YXHH 1EO5A 3MV7B 1JYXA 5CWSA 1A3RL 1QBAA 3S88H 5IM7B 2Y5EA 2XQBL 2FHBA 3F7RA 3FOLA 2FD6H 4YPGB 3NIFE 1N64L 4LL9A 4X4MA 1MIEL 4OGZA 2X09A 1NEZG 4Q6IA 5IMMA 4ZOCA 3BMWA 1KB5B 2H32A 3ZMRA 3RDTB 1MCJA 4OLUL 3ZKMD 2AXGB 5SWZD 4XMLH 1GAFL 5EBMA 2R1WA 3EGSB 4DEPB 4FG6C 3MJ9L 5C08B 1A3LL 3PNWA 2Q76A 5AEAA 3THML 2HLFD 2B4CC 1M7DB 4FQJH 4XVJH 5CCKH 4M1CD 1MRDH 4S1SL 3CH1B 1UVQA 4NN6B 3NZHL 4CDGC 1NC4D 1GPOL 5CZXD 4OD1H 3NOIA 4OD2B 3SDDC 2VSDA 1UJ3B 1ERNA 4NT6A 3T2OA 3EDJA 5HYFA 3W82A 1R6VA 3M8OH 3OHXB 4PG9A 1RZ7L 1OW0C 1VGEH 2HTLC 3IS0X 1QNZL 4FQIH 4K3JH 3LS4H 4DUVA 3BJ91 5INDA 4IIQB 2AK4A 1QEWA 4LCWE 4Y16A 5FKPA 1T1ZB 3AS2A 1MJUL 4OSUH 4LAJH 3BN9C 3LEYL 3LV3B 1JP5A 2G75A 4QRTB 3EO0A 2D7TH 4MB3A 4NN7B 2R0KH 1MFEH 1DBMH 3WLWC 1TFHA 2VH5L 2F5AL 2R0ZL 1B88A 5JHLH 3BISA 5I8EB 3D9AH 2CPCA 2WV3A 5F9AC 3C6LB 1FNHA 3B6SA 1MWAB 1DQJB 4ZO9A 3RX5A 1P7HL 1Q0YL 5E94A 3VGBA 1BIIB 3HI6H 1D5IH 4EI5C 1G6RL 5IBUG 5J11B 3P30H 3TBTB 4C56A 3EOAB 3D69B 2Z35A 3VXPB 1MCKA 3MO1A 1TVBA 4F7EA 4EDXB 5ESVA 1RIUH 5TPWH 1CE6B 1CS6A 3LIZL 1N3NA 5EOCL 1KTLA 5D72L 3VGEA 4I0PB 4OUUB 5EUOA 4KRPD 3MR9A 2XFXB 1A02N 1KCRL 1J0HA 5I30H 3GMPA 1UA6H 5L0QB 2WBKA 5TJWK 4X0KB 5DF0A 1GGBL 3WUWA 3QAZC 5I66B 1NPUA 3BDXA 4NP4L 3RGHA 3IDIB 1RZJL 4GW1A 3G6JE 4BK4A 1BF8A 2VLKD 1N5YH 1QLFA 1UJTA 4Y1AD 3UTSE 3FQRA 5IG7B 4JFYA 4ZS7H 5CILH 3L9RB 3NCYP 4PRHD 3LKSB 4JFEA 3VWJC 4LLMB 4G8FA 1CK0H 7FABL 5LCVH 1Q9LA 2CRMA 2LU3A 4FXLA 5EZIL 5HGBA 4MD0A 2VDPH 5JXED 1IC4L 4HFWB 1RHHB 1GYAA 1MVUB 2XI9A 4PJ8B 2GIYA 1C5DB 3TH2T 3STBA 4UU9A 2EDTA 2ZZUT 2EE9A 3NCFB 1A6TA 1FZMB 5KSAB 2JTDA 3WKML 2JKXA 4P23C 3LB6C 1EO8H 2QL1A 3R06A 3DIFA 5IIEB 3TV3H 4F37K 2WUBH 5DJ2B 5FO9A 4OI9A 5GRJH 1FL6B 4XNMA 2AS5M 2R1WB 3V6FB 1IQDB 2XWTB 5EZJB 4P4RB 1RU9L 4CU8A 3WUZA 1INDH 4MD5A 4NC1E 4YHNA 4I2XE 4BKLB 3P2TA 2BOCB 4PJGA 2YRPA 4OLXL 1A6WL 4EVNA 1DL7L 5E7FA 4LSTL 5INCA 2VXTH 2ESVD 4GRWB 3D87B 3C5ZD 3GMOB 4U6HA 1I85A 4U2YA 5AD0A 4MB5A 3JXAA 5F7WC 5EUKB 4ZNEE 4G6JL 5EU6B 3BKYH 1FP5A 3EO0B 3MCLH 4XMPL 5I0ZA 5I1GL 5I73B 4Y4KB 3RTQD 1KT2A 2EH7L 2GT9A 3L7FA 3QUKB 4JFXB 5AZEL 5IK3A 5I19L 3S36X 3C2AH 1FFPB 5FGBA 3R8QA 4JFDA 1JNNL 3MLZL 1DQJA 3SE9L 3X14B 2X7LA 2F53B 2V5YA 4PJEA 2F8OA 5F93C 3O2DA 1BZ7B 2APWA 2OL3L 5GRVK 5HYJA 3MRDA 3QULA 1HZHH 5GGSY 1IGTB 3IFNH 4MLSA 5GISL 1XF4B 2HYMA 1AXIB 3G9VA 2NY4B 4NUGH 5FYLL 3ARUA 2ADIB 5E2TL 3WD5H 3LRSB 3WE6A 5ESQB 2L7JA 4L4VE 4U6TA 1J0YA 1H0DB 4GQPH 4R4BB 2YHGA 4AJ0A 1D6EB 3IVKA 4N0RA 1RZIA 3ET9F 4U3HA 4J3OC 2VQTA 4K9EH 1VERA 3WO3B 3O3AA 4LARL 4V2BA 4Y5YC 3CVHB 3ZYIA 1INQA 4FP8L 3P73B 3C6LC 2C5DC 5GGRB 4JPIB 4QXUL 5LXGH 5DMJB 2HKHL 4JRXD 4NRXA 4ELMA 3ARED 2FH6A 4PG2A 4LP5A 1VADB 5GZOC 3RWGB 1FHGA 2YWZA 3WNOA 3Q6GH 3OR7B 1NBYB 2V9TA 5EO9A 1YMME 1Y18A 3BH9B 4R4FH 1JWUA 4X98B 2V2XB 2W92A 2MKLC 2W9EH 2EDJA 1MHPH 2ZKHH 3DTXB 3DMMA 4NO5B 2I5YH 1FCGA 1NLDH 1MAMH 1HHGB 2NYYC 1LQSR 4HX1A 2LE9A 5SV4A 1ZGLA 5FUZH 3IXTA 1RV6X 5JW4Q 3B2UC 2A9ML 4ZG1A 4I2XA 3DXAB 1IGIH 2B1AL 4MS8D 3QUXD 3ULVH 3KPNB 4JREB 3T3ME 1T4KA 1FCCA 5FO7A 4E5XA 3RVXD 5KSBF 5DA0B 1IGJB 4UAOB 5JA9A 1I3RA 1E4WL 2HFTA 1A9EB 3U30B 5HGHA 4YC2C 5EOCH 2XQYG 4PJ7E 1WZ1H 2HKFH 1JPSH 2AV1B 2BRRL 3P9MB 4ZODA 1F3JB 3VXUA 1QVOB 1N0XL 3IFLL 3OXRA 1V3MA 2VLKA 5D6CB 1A6VH 1J0JA 3IDMB 4P49A 3QDMB 2K7QA 4PRHB 2Q3AA 4HK3N 3VFNB 2ZSWB 1L4IA 2OL3H 2IC2A 2X4QA 4DFHA 4KJQD 2D0HA 4UT6H 3JWDC 3WS3B 3QHZL 1ZVSA 5CGYD 1YYLL 3C9NA 1N6QL 3GBNL 3JV0A 3MGOB 4K8RH 1L6ZA 3NFSL 5AYUH 4JPWH 4HQQL 2X4RA 4QNPF 1I3GH 1MHEA 2CKBA 1OGAB 2HKFL 1XMWA 5ICZB 1CXKA 3VFVA 5CP7A 3FJTA 2O5XH 1HSBA 4X6DB 4XH2B 2ZG3A 3W81A 5GSVA 4K23H 1FNGB 5IROA 3BP6B 5MEQA 3B83A 3MLYH 2XTJC 5C08A 5BVPL 2BSRB 3QIUD 2P46B 2IBGA 4HXBH 2XPGA 1KTKE 4JQXA 2B1HH 5ISZA 2C4FU 5ENWA 2RJMA 4RAUA 2VR4A 1EDQA 2Y5TA 4RMUA 1HKFA 3AU1A 3VXRA 4P2RE 1I9RH 1S9XB 3RUGF 4OLYL 2P24A 2X7LB 3BD4A 4YGVB 5GRYA 4PJAE 2GCYB 4URTB 3OXSB 5KSVB 3VXOB 4GKOA 1JNHA 2W9EL 4TULL 5HDQL 4PJDA 4IDJL 1JF1B 1ZT7B 5D5MA 5IHUL 2NW2B 3EHBD 5DUML 4OZHA 2EYRA 4M43H 2CO6B 4KXZH 3U7AA 4MMZC 4CL7A 3QCVH 2Q8BL 4JDVA 1KLFA 4R9HA 2BVQB 3FL7A 3HMXH 1A4KA 3NTCL 1W0WA 2BOBB 3G5XA 1VFAB 1CGSH 2WQ8A 4JFDD 4PLJC 4JO3H 2X4UA 4I0KA 3RVTC 4KHTL 4XCCL 3MODH 1DUZA 4WW2C 1CFSA 5C2BL 1UQSA 3V4UL 1UXWB 5FECB 1J86A 3Q3GA 2V9QA 5DS8A 4F7TA 1G9EA 1L7IH 2X41A 1CFVL 3MUHL 4BH7A 3BX7C 3MMEA 4WI3A 1BZ9B 4XAKD 3HG1A 1WF5A 2VDMH 1FZJA 3H8NA 5F9DC 5DJCB 5EC1B 4LCYA 4TOYL 1NFDB 2DQGH 1JWUB 1KOAA 1AO7E 5HYIA 3X17A 2XQYK 1DBJH 1X6LA 2JJWA 2NXZB 4JY4B 1S7QB 1T22A 1K6QH 1MCPH 5KVGH 3INUL 5F1IB 3AREA 1P5VA 4LFHD 1YJDC 4N9GB 4LEOB 3JVGC 5ID0A 4MDJA 2PYEA 1MCDA 3UTPE 1GHFH 3VFPA 1GCFA 3MCLL 2CLVA 3UTZA 3S37H 4OCLC 3WS3A 5I17B 4XWGH 3PQYD 1AQKL 1MJ8H 3W39B 4H26A 4Z7OF 3NA9L 3JVGA 3RL2B 5GJTL 3QJHB 5J1AA 5JHLL 1F4WH 1RURH 4NWUH 1M7IB 2QADC 2C3WA 2BCKA 3ROOB 4TUOA 4E42B 4MCYA 4UIMB 4HK3J 4NOBA 2AV1A 3BFOA 1PFCA 4JDZA 3QO1B 3QDHA 5DD3L 4PJ5B 1T80A 3RWEA 4RFNC 3HUJE 2ZUXA 4N0UB 3CIQA 3I75A 1P6FA 5I18L 2R0WH 1EVTC 4HWUA 3A6CL 2NW3B 3T0VA 1VKXA 1X5XA 4U1IB 3R8BB 3RHWF 5H37H 3B8YA 4PB0H 3U6RB 1XGRB 3MLPA 2W38A 5F9OH 3CXHJ 5GRUL 1CLOL 2JLLA 2CJUL 5EUKA 5MEPA 4IDLA 4H5SB 5GSVB 5I76B 4JPVH 1X7QB 4TNWF 3VWJD 2CGRL 1C5CL 4XCEA 2YR3A 2IBBA 3MOBH 5CLWA 1VFOA 3JZ7A 1IC1A 1YEIL 4QRSA 2E6JA 3B2UD 5EIIB 2QJDA 5D7IE 4U1GB 3CFCH 4GUPA 4OCYL 2QHRL 3AROA 4EUPA 4N1EA 3RIFF 3BUTA 2VL5B 1WAAE 3V8CA 1NBVL 2YD8A 5IMLB 3NAAH 5MEOA 4LVNC 4HJGA 2FWOA 2UZYB 2W9DH 5GS1B 5DEFB 4ODHL 5HJ3A 1R3KA 2ESVE 3PABA 3VJ6B 4WUUD 3GSNL 1OAKH 4YHPB 1IGCH 1LO0L 5ADPH 2H9GB 4Z76A 2XKNA 2HTKD 4P2OA 3RGVA 3DROA 2R0LH 3GEWB 4LCYB 2PYEE 4L3CB 4Q0XL 2W65A 5HDLA 4YHLL 4WV1B 1FL5B 3CZFA 4YEFA 1XZ0A 3ULUF 2R2BB 4MNQE 4PREB 2BHUA 5HHME 3MLYL 5HVHC 2OYPA 5GRWA 4L5FH 4UUJB 3FB6A 1C5BH 5K59F 4TSCH 3ZHDA 1JWMB 1I9IL 4QF1B 4M7ZC 4Y8AA 3G6DL 2R0ZH 3NFNA 1RJYA 4QY8B 3CVHA 4K9EC 3EFDL 2OP4H 3FB5A 4DGYH 5J3HD 3MXVH 3BPLC 1WISA 2ADJA 2PR4L 4NGHH 4P4KD 1BJMA 3N85H 1MUJA 1VADA 4HGKC 2K3TA 3VFWB 5IVOA 3I6KA 5F7MC 3H0TB 1SJEB 2M2DA 1M4KA 4R26H 2FO4B 5EO9B 4JDZB 2B8OT 3EJJX 2W07A 3CLEL 4N90D 4PJHE 4QXTB 2PW1A 4A6YH 3IFOA 1ZVSB 5EU6D 4N0UA 1HSAB 3DSFH 4M8QB 4DOHB 2GI7A 4F7CA 3RIFK 4X6EB 4X6BA 5CJBA 1I8KB 4HXAH 3O4OC 4C57C 4U1KB 3VXUB 1YC7A 1WWCA 2VAAA 5E6IB 1WBXB 4K55A 4L9LB 3OKKB 1PJ9A 4KH2A 4I0PC 1BOGA 3SDDA 2D7NA 4PJFF 4C83A 2MSPA 1ZA6B 4YE4L 4DFIA 1ZANH 3ULVC 5KANI 1RZFH 4NKOA 4XNZC 4LKXB 5F9WC 1XF5A 5FOJA 1Q9KA 3LOWA 4RNRA 4P23D 1GOFA 4I18A 4X7FC 5C0EA 4HIXL 1G0DA 4TULH 5E8PB 3VFVB 2A6DB 3MV9D 1IKFH 3Q6GL 4P5TB 4OM1H 4W6WB 1MFCL 2ZSWA 3HRPA 3BIAX 1OTSD 3PP4L 2DLGA 5LQBH 4KQ4H 3OKYA 5ACZB 1ED3B 1I1AD 3F5WB 3HNVH 1UWGL 3QI9A 5KVFL 4ZTOH 3FT4A 1BBJB 4ODTH 5L9DL 2DQTL 4YEEA 1XGTB 5EU4A 5HHPA 3NN8A 5CIPH 4F9PA 3C8DA 1TJGH 3QFJA 4NCC1 1QBLH 4ZS6C 1RD6A 3JWOL 5CP7B 3QB7C 4P59L 2Q8AL 3VXME 4F7PA 1IGFH 5E2UH 2XOTA 1A7PL 4M03A 1JNHB 2K1MA 4LPXA 5EOQH 4JRYD 4U7SA 1CXFA 1A7NL 2XTJD 3F12A 4Y19B 4HLZG 4QTIL 3QG7L 3VMNA 4YBHA 3R0NA 2M8XA 4NZDA 5FA3A 4HWBL 1KJ2L 2Y07H 5FGBC 4CBPA 3MRJB 4FQ1H 5IB3B 5B39B 3GMRA 2PYED 4UV4L 5ANMB 2FEDD 3L3GB 2AI0L 4OBSA 2JB6B 4OLWL 1DUYA 3RY6A 5DR5H 4M7JL 1DE4B 5BS0A 5J12B 2E3VA 3ESVF 2V2WA 1RZGA 1NDGB 1NGPL 1DFBL 3UDWC 2F5BH 5BV7B 3O6KH 3DWTA 1FYHB 1SEBB 4U0RB 5H2BB 2Z93A 2P44B 5KS9F 1XT5A 2R1XA 2X9WA 3O3DB 2GJ6B 4Y5XC 1QSFA 4YHIA 2FJHA 5L88L 5FA4B 5HY9B 4L8BB 4LLVA 3SJVB 5EO1A 3LEVH 1QRND 1HH9B 1FO0L 1Q94A 2AEQL 3EYOA 4JY4A 2P7TB 5EO0A 5F70A 4NQCB 4RISH 3FRUA 4PTUA 2NXYC 3DLQR 4FQ2H 5FHAL 2BVEA 1T6VN 4GG8B 4EXPX 1Q8MA 1NLBL 4ODSL 2C4XA 2GJJA 4XZUB 5E9DB 4YWGH 3C5ZA 1AP2B 2P5EB 4OUOA 2FR4B 5JPNA 5SWZA 4G8EA 3HS0A 3C60B 4CW1A 1MFNA 1XFPA 3HC4L 3ZT5A 3QIWC 3FN9A 1IC4H 4JAMB 4XNMB 5FCUL 5FDWB 1FAIH 2AJVL 5BJTB 2GK2A 2AW2A 2BXZA 5B8CC 5INDB 1JMZA 4KI5C 4ZUWA 4XX1E 1P7KA 2H3NA 5JMRA 1IL1B 1BQUA 3REWB 4UILH 4K3DL 4WDIB 3ZYJA 4NYLA 1JFQH 3R4DA 1BVLA 4XNYH 2CO7B 1RFDH 4OIBA 5FK9B 2CLVB 4DKEH 3OAYK 5F96L 2K7PA 3L5XH 3ZL4L 4ALAL 3VXSB 2VJXA 4NZRL 1SY6A 1UJ3C 4MHHI 1JUFA 2E6QA 3HFMH 5BV7H 3DX6B 5SX4I 4TNWK 1LVEA 4PJXF 3X3GL 1F4YL 2VYRE 3FRPA 3VH8A 3HZYB 4KZEL 2FBJH 1CXHA 1CICC 1TTUA 5IWLC 4XTRD 1KELH 1JWSB 1BFOB 1ADQL 2RCSH 5A16B 3DI3B 5JW3H 1B9ZA 1KPUA 3LKRB 1HQRA 3HI1B 2ICWJ 2P49B 3BEWB 1OTSC 4BFIA 4U1IA 4H1LA 1Q72H 5LGHH 2DM4A 4JHAH 2FJFB 4W70A 3MLSH 4BQCA 3I2CL 3ESUF 1MFAL 3WE6B 2E9IA 3SKOA 4Y4FA 2WIIA 1P4LA 2H32H 5C0AD 3BP7B 3IXAB 4PJCF 3M1BB 3K8MA 4AENA 4OM0H 1TTGA 5GIRA 3DUSB 1CFQB 1FNSH 3K1DA 2DKSA 5C0AE 3PIQB 4WI2A 1KN2H 1A6WH 4GLRI 1CLCA 5FYLE 1RZ8B 1JZ8A 3TZVB 3G6AB 4D3CL 4Y16C 2P4AB 2MQCA 3RX8A 5BRZA 5JW5B 3QFDB 3PDGA 1CLYH 4QHLB 3GKZA 1NC4B 4L3AA 4IJ3B 1O7SA 1KXTB 4IMKA 3TA3D 2OQJA 4OCXL 4NN5C 1RUKL 4TTDC 1PEZA 1HOCB 1OAYH 4QOKE 2UWEB 2COQA 1HIML 3TO4C 3MRIA 4MJIB 3G6JF 2ARJA 3LV3A 1YNLL 5BZDA 4I9WE 2EE6A 1F4YH 1BQLH 2YUWA 4UTBH 1A4JB 3WIFB 5C0CA 2YSSB 4JM2F 3U0PA 1S9VB 1EMTL 1CG9A 3EO1B 1T2JA 3FQRB 4H20H 5EUOB 5IG7A 3H9ZA 2GUOA 3NCMA 1H5BC 2C3HA 4PD4K 5HGAB 4OZIF 1U8MB 3QUMB 1HKLL 4HBQA 5JPNB 1JTPA 4KJWD 1MRDL 4L3ED 4CN6A 1YN6B 3IDUA 4HBCH 3CC5A 1JPTL 2OXGA 3D69A 3DV4A 3VRLF 4WO4D 5T3ZD 2QR0A 2QQKL 2ZJSH 1RZJH 2QBWA 4S11A 4KV5F 1EJ6A 2D7PA 3PHQA 1DVFA 5TGBA 4EI6A 5E8DL 5C8JA 3H0TA 1UA6L 4HKBA 5CBAA 1T21B 2IH1A 5ACLA 4EXKA 1FZKA 1DLHA 3EDKA 1U8IB 3ARPA 4NFDA 4MXVF 4ORGA 1BD2B 1V3LA 4HMCA 3RI5F 3ZDZE 4ZFOA 3MRBA 3VXSA 1HHHA 4P46D 1FGNH 3D39D 2PXYD 3WHXB 3O2DH 5I8CB 3HMWH 1WBYB 5FFLA 1NLBH 4NQXB 4KZEH 4EI5A 4Y5YB 2QEJA 1C7SA 4XC3H 1KYOK 4IBLT 1SY6H 3E1F1 4Q6YA 4QYOA 2XN9E 3VH8B 3DIFB 1ZHBA 2ICEA 3SQOH 2AEQH 2CIIB 1TZGL 4ZAKA 3OAUH 4WFGE 1TCRA 2EIZA 1RSFA 4QRQB 5GGTL 4M02A 5DHVB 2WK2A 3L3IA 3OJ2C 4CVWA 1JZ7A 2GAZB 2NY5L 1DZBA 3C09B 4JFXA 4DKFL 3DYMA 4ZSOA 5IFJA 4D0DA 4R6UA 4XCYB 4U6YA 4F15B 3LRGA 5ALBH 3UJJL 4TYUA 4K8RC 3MLRL 1NANI 5DRNB 5ABDE 3FO9B 4O4YH 3GMOA 3QULB 4JHAL 5AD0B 1D5ZA 2BSTA 5B3NA 2GITA 3UBXG 4XVUD 2P24B 1FAIL 2AJVH 1UZ6E 3HPLA 5DK2A 2SEBA 1XR8B 3S97C 4PJGF 4WHCA 1MCHA 1OAQL 1Q1JH 3QNYA 4NKDA 3UBXB 4U49A 4ELKA 4M9OA 3BE1L 4OZ4A 3CD4A 2WBJB 2O5YH 5GRZA 3QG6A 3MA9H 5KSBE 5AZ2L 3QCUH 3RWDB 3U7YH 3HE6C 3OAYH 3MV8E 3F7QA 2AK1H 1D9KC 4HIIA 1T3FA 1NL0H 4UT7L 4U6HB 1TMCB 2MTPA 4PJIB 4UOJA 3KPQB 2N7BA 1YEFH 3PIQA 4WCYH 1H5BB 1LP9B 2KQMA 2EXWD 4ZFZA 1XGTA 1XF2B 2NXZC 3QH3B 4Q9RH 1BBDH 1U8QB 1IM9D 3L3GA 3LN5B 3BAEL 2ZG2A 5L2JA 4YDKL 1EUUA 2DTML 3MYJB 1PY4A 1RPQA 2XY1A 3EDDA 3H9SD 1QQDA 4JQVA 3SO3C 5F9JB 4LBEA 2I27N 4OM1L 3DHJA 3DARA 4CVUA 4M6NH 4HLJA 4O51B 4NRZA 2YBRA 3KPSE 4Y4HB 4MJ6A 2IH1B 4BH8B 3LH2H 2FJGB 5EORL 1FL3A 3CVIL 3K80A 4FMFA 4LOUD 2HLAA 4PP2A 1CDBA 1DQTA 4PGDA 5AUMB 3BMVA 1U95B 4F3FA 4P0DA 3S4SG 2BDNL 1H9VA 4AQ1B 5IQ9A 2X4TA 3UMTA 1QR1B 2X4PA 1JN6B 5TE6L 3OF6A 1QBLL 4UT7H 3HE6B 3LQMA 1HHIB 1YNKH 3JWOC 4P9ML 5TQ2H 2GTWA 5DT1H 3HS0B 4U6VL 2AJSL 2YEZB 4GRWE 4W68A 4JAMA 2DJUA 4RZCB 2VISB 1IGML 1OAUL 3FT2B 1KCSL 4P2RD 1KENH 2EDBA 3WSQL 4ZSOB 5IFJB 1KENL 3MACL 4LHUG 3UZQA 2G5BB 4I3SH 4Y5XB 3MBXL 3UYRH 5I8KL 3T8XB 4H25A 32C2A 1DSFH 1MF2H 1I1YA 4TPRL 1JNLL 3FZUC 1MH5A 1FAKT 1FFNB 1I1AC 4LLQB 4S1RL 1TCRB 2EIZB 3TIDA 5BCAA 4YHKL 4L8SA 2HFGL 1JPGA 4LLWB 3UPAA 3AU1B 1EVUA 1HEZA 3PL6B 4HHAB 4GW4B 5GGSB 1ITCA 5GIRB 1O0VA 4P2OD 5DLML 2CDEB 2C1OA 5MENB 2JK5A 3VFRB 3WIHL 4W6XB 2FH8A 4KU1A 5FK9A 3DVGA 2G9HB 3QIUC 5FYJL 2BVUA 8FABA 3EW3B 3QEUA 4Y5VB 2OJZH 4X6CB 4KQ4L 3MQIA 4TVPD 2CD0A 4FZ8L 3TVMC 3U1SL 4WI8A 1LILA 3S6CA 3KLAA 4Z0XB 3U48A 3VWKC 3GHEH 4CAGA 2HVKB 1CGWA 4KKAC 2MMXA 2Z91B 4U7MA 4JHZA 5CEYA 2RFXA 4PY8J 9CGTA 4JFED 4DN4H 5DK0A 3SJVD 5JMOC 1ZWIA 3HI1A 4XCFL 5IVXE 5EH1A 2CR6A 4DKAA 1T22B 3DX9A 4LSRH 3ALPA 2X4OB 1N7ML 3HZVA 5DFTA 5FYKE 1LP9A 4P4KA 3G08A 4J23A 3QUZC 4XXCA 5KSUB 3HC3L 3F65A 2DKMA 4O2EB 3OJVC 4LU5L 3HRZB 4XPFL 5FKAA 4XBPB 4U33A 3WIHH 2HWZH 4BH8A 4JPIA 3BXNB 5J11C 4BA8A 1QFPA 4TQEL 3D48R 3QJHA 4X7TB 3MLXH 1F11A 1A7OL 5JW5A 5C0CB 3T04D 5ALCH 1T7WA 4HK0B 5KVDH 3CLEH 2GTZB 5AG8A 2J5LB 4X8JB 4M7ZB 5JPMA 4PY8I 1QFUL 4OJFL 5D7LA 5DRWB 1BMGA 3V6OA 2DQJH 4UT9H 1MF2L 5EUOE 3PXHA 1KJVB 1PBYA 4ZFOB 2UZIL 3ILQC 5EWIL 1C1EL 1J9CT 2YMXL 3GHBH 2UZIH 3TZVC 3MACH 2BVOB 3MXWL 4UT9L 5IBUB 5ALBL 4X6EA 2RHEA 4FHBD 4H1LH 1J1OL 4KVCH 3WNLA 4BQ9A 2OLDA 3L3OB 3P4OB 1FGVL 3IKCB 1E27B 5C0JB 2C3VA 3SDXE 4QRUB 4QRPD 4NZUL 3VFGH 1I1YB 2IEPA 3MZGB 3RRQA 4A2MA 3EDFA 4HFUL 4EOWH 4XP6H 1Q72L 3QI9D 5J89A 5LGJA 1CICA 3P9MA 4XP4H 1G9MH 3OG6B 4JY6B 4CMMB 1MJJA 3C5SB 1UVQB 4MX7A 1RY7B 2DQUH 1NEZA 3RQ3A 2BSTB 2X9XA 2DMBA 5DMKA 4X80H 3H9SE 3RWEB 3HR6A 3CFJB 5HVHB 4XCFH 2C9AA 1F3DJ 4RRPA 4NZTH 5SWSB 5BO1H 2AKRB 4L4VD 4RAHA 1BWMA 4JG0L 3U4BL 3HE7C 4NZRH 1OVZA 5E8NA 4OF5A 3GMMB 2BNQB 4GRWF 1A64A 3DJ9A 3O4LA 3S36H 2I9TB 1IM9A 1ONQB 3SPVA 2FEEI 2VXQL 3HR5A 5DVNA 5E1AA 5MI0B 3FAXA 4HW6A 2P8LB 1AD9A 5JZ7D 1A7QH 4IRSB 4KPHL 1KBGL 4Y4HC 1EEZA 3MOBL 4XPAH 4JO4L 1AR1D 2CGRH 1JBJA 5D93C 4LASL 4R97C 4X6DF 1T04B 1F58L 4LVHB 1EGJL 4D8PB 4F33B 3TO4A 4POZD 1OAXH 2EYTB 5HYJE 3S5LB 1VB9A 5C7XH 2OL3B 5KG9A 1A14H 4KK8C 2Z8SA 4P99A 4G42B 3CSBA 1G0XA 1MCNA 2OK0H 4MA1C 3QDJD 5DD6B 2J8UB 5DC4B 1S7VA 3F7VB 4OLYH 4RBPK 1A22B 3QJFA 1A6ZA 3TZVD 5I9QB 3PWNB 3UYRL 2ZNXA 4KJPD 1KCUH 4ENEC 5KZCB 3ISWA 2QSTA 3D18B 3LKNB 5GGUA 3VXUD 1OAZL 5EIIA 4LCWB 3CXHK 2JIXA 2MPAH 3FO0H 4XB8A 1FL3B 1ZHKB 1QSEE 5FYKD 1F4WL 1UQSB 2R56L 3DUUB 1NFIA 2AEPL 1QLEH 3FB5B 5D7JC 3QUZB 1F2QA 1KXQE 1YUHA 1DBAL 3L3HA 3SGDI 4U6XB 5CBEB 1TVDA 3BKJL 3KHOA 4TUKH 1FPTL 4XNQA 6FABL 1EXUB 1X5HA 3CSGA 3IFPB 5TQ2L 5IQ9B 4Z7UA 5F7DA 1R5WB 2YPKA 1G7IA 2OI9B 5D1ZC 1FLRL 2ZOKA 5GRVL 2ICES 5DJXA 4A6YB 4BZ2H 3O6ML 3UYPA 3IAQA 1VENA 2D03H 1Z2KA 3GB7A 5HGGS 3MYJA 5IEKA 1G9NC 5JW3L 2DF3A 4FQ1L 5C08D 3FFCA 4JFHD 4G8IB 4IDJH 1DQDH 4GLRH 1AGFB 3GIZL 4LCIH 3JTSB 1J88A 3QDGD 4EEEA 4TOYH 4NRYA 2IFFL 1YEDA 3P11H 4QRRD 4TTDD 2D31B 4CGTA 4M6OH 4MQXC 1F8TL 1JK8A 3FONA 2VLRE 4HG4K 4M5ZH 3CFJA 3U2SA 1DBKL 5BVPH 4GG6B 3T0EC 4AIZB 1ZVHA 1CWVA 1AR1C 4Y4KA 3IDYC 3FOMB 1SEQH 3GGWA 2APBA 1UWGH 5DMYA 3O3UN 3FO1B 1JGEB 1C5DA 4AMKH 3RGVC 1UM6H 2OZ4L 3RZCD 1ZLSH 1TQBB 2YA0A 3MV9A 1N4XH 2E7LC 2ZCLH 2JK5B 3VFRA 1AGEB 4YIQB 4BUGA 4QXGL 1ZA6A 4KK9D 4QOKB 1SVZA 2H26A 5CEXA 3J7HA 4KRNA 5DWUL 2Z92B 5CEZL 1YPZE 4AK1A 4HSQA 3F8UB 4H0IA 5IQ7L 3BEVA 1QYGH 2DIJA 3AMLA 3RJDA 3GBLA 1LWRA 4C56E 1I9RL 1X5IA 3A6OA 4I48B 3QPXL 2VERN 1CIUA