4Y65A

Crystal structure of e.coli cuta1 c16a/c39a/c79a mutation
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
112
structure length
112
Chain Sequence
MLDEKSSNTASVVVLATAPDEATAQDLAAKVLAEKLAAAATLIPGATSLYYWEGKLEQEYEVQMILKTTVSHQQALLEALKSHHPYQTPELLVLPVTHGDTDYLSWLNASLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of E.coli CutA1 C16A/C39A/C79A mutation
rcsb
source organism Escherichia coli k-12
molecule tags Metal binding protein
molecule keywords Divalent-cation tolerance protein CutA
total genus 24
structure length 112
sequence length 112
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03091 CutA1 CutA1 divalent ion tolerance protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4y65A00
1J2VA 1PILA 2V5HG 3T9ZA 2ZFHA 1NAQA 2XZWA 1O5JA 1QY7A 5D4PA 4USIA 1XK8A 2GNKA 4WK1A 3TA0A 1UFLA 1V3SA 3M05A 4C3KA 5D4NA 5DS7A 4IYQA 4CNYA 4WK3A 3HLUA 4ZK7M 1UL3A 2J9DA 1H3DA 3OPKA 4USHA 1P1LA 4CO2A 4E98A 3AA9A 4CNZA 3MHYA 4AFFA 4Y65A 2PIIA 2XBPA 1NZAA 4CO3A 1Q1KA 2JJ4D 1UMJA 4OZNA 4C3LA 4RWXA 2ZOMA 1VHFA 3AH6A 3L7PA 4R25A 4OZLA 3TA2A 5D4OA 1V6HA 2XG8A 3NCRA 5D4LA 1V9OA 5DRKA 1O51A 3CE8A 2VD3A 4YB5A 4YB6A 4RWWA 3O8WA 4NYPA 2RD5C 1HWUA 1KR4A 1NH8A 3GSDA 4CO5A 4D3HA 3N5BA 1V3RA 2E66A 2GW8A 1GNKA 4C3MA 2Z0GA 4CO0A 3BZQA 2CZ4A 1NH7A 1UKUA 2O66A 2NUHA 2EG1A 5L9NA 2NUUG 4OZJA 4RLEA 2EG2A 2NS1B 3NCQA 3LF0A 3AA8A 4RX6A 4USJC 4NYOA 3DFEA 2DCLA 2GX8A 3X3UA 2J9DE 3NCPA 3TA1A 2J9EA 1OSCA 2XULA 2O67A 4D3GA 4Y6IA 3AHPA 1VFJA 2J9CA 3O5TB 4YB7A 4CO4A 4CO1A
chains in the Genus database with same CATH superfamily
1NB2A 1F3FA 3DM2B 3JQJA 1PILA 2VG6B 3QT5A 3Q86A 2NR0A 4NLOA 2N7YA 1U02A 1HWIA 2D3UA 1S6QA 2GAGC 2YNHB 1RAGB 3SQGA 4P71A 3CJ5A 3A13A 4X64F 2UUCF 4EZ9A 1S10A 3MTKA 3C6TA 5DG8A 1B64A 1N0UA 5DJBA 3C16B 2YWEA 2XC9A 4DHVA 2WTFA 3K0JA 1WG5A 3DLEB 2FC9A 5DDPC 3KJNB 3OVBA 5A8KB 4NASA 1S97A 3PYEA 2XMVA 3D28A 5KFHA 3BBFA 3PV8A 3HVTA 5ADZA 3NL0A 1RTJA 3VTIA 1TTHB 3KG4A 4DV1F 3AD7C 2HBQB 3R6GB 4IG0B 2CIMA 3PO5A 1RLDA 1XTZA 2GZOA 2YKQA 4NX9A 4ZCKA 4RNMA 4MYUA 4B3TJ 3HM9A 2ADCA 4M5GA 2LQ5A 3HSGA 4UY85 4UT4A 1CJTA 2R3VA 3VAKA 3SQGB 3MPWA 5J2NA 3LAMA 3QFHA 4NRTA 1PYTA 3N5FA 1L3KA 4L72B 2E5GA 2Y1JA 2VBYA 1WTBA 2PIIA 1SH2A 2LEAA 4P2SA 3QGPA 4YHHF 3GV5B 2BJ1A 1C1BB 3AJDA 3GIJA 4I6YA 3G82B 4IG3A 2FJWA 1CLFA 1HBUB 2CJAA 3HZGA 2HQ3A 1IKVA 3KXDA 3GQCA 2CPFA 3AH6A 3K7RA 1RWMB 1RADB 4ERDA 4LIWA 4AL7A 1T05A 3BGUA 1HPZA 4ICLB 1XR5A 3MEKA 5FD1A 3SFGA 1C0UB 2XG8A 2YX7A 2F4FA 1TR0A 2DIUA 2IRUA 2QRRA 3ITHA 3CE8A 2BQRA 3W8PA 2BDPA 3KUHA 2FIUA 4F0MA 1BC6A 4YB6A 4C0OC 1RKIA 1TL3B 4OHYA 4NI2A 2JEJA 2G0JA 2IM3A 4USVA 1YIJS 3CCWA 3IG1B 4WBFA 2OEJA 2OPQA 1NXIA 1F60B 3WHIA 3MM7B 3GG0A 4Q7AA 1OQ3A 2F63A 4LT6A 2R2RA 1HBUA 2ZZNA 1UFWA 1H0HB 4A46A 1KHVA 2E5IA 3TYTA 3K17A 3QYYA 1KD1T 1PIEA 1EIYB 4DU7A 5KFIA 2V0NA 1KQKA 6FDRA 2HRYA 2SXLA 4QYRA 4RW8A 1CQNA 1TVRA 2HS4A 5HI7A 2W9BA 1KVJA 2DH8A 2EXUA 4LSLB 1RQ0A 5DO2A 3W60A 1MSWD 4LJMA 4XPEA 4EBDA 5DLFA 1VQNS 1GMWD 3CJ4A 2PA3A 4S0MA 3BN4A 3IS9B 4EMDA 1JLGB 3GFYA 4LF5J 3U27A 3LANA 2BJ7A 3BS9A 3UR0A 2CQHA 3CCQS 3R6LB 2GS8A 4PKDB 2CPHA 3LP2B 4ZVGA 4B9NA 4Z7YA 1RHKB 1SQEA 4JI1F 4DI6A 1LKZA 3DOKA 3QPIA 5L39A 4X4PA 4IRKA 3M8QA 2OD4A 5H9EJ 4AD6A 1SJ4P 1K0TA 3GFZA 1R6YA 4G1QA 3ZZOA 1N88A 2YKNB 3E51A 3I31A 4BCAA 3V5RA 4B08A 4UZCA 1QE1A 3QGHA 5C42B 2XM3A 1PO6A 2FGOA 1KTQA 2CA9A 1Q8IA 3OXGA 4NLRA 2ATLA 2CJKA 1N54B 4IOAQ 2QG9B 3GIKA 2KFYA 4KQZA 1C0TB 2L08A 4OHVA 4J9VA 3ENVA 4WJBA 5JUMA 2HLTA 5DM6Q 1I94J 3K58A 1JWWA 2ZJRQ 2DNPA 2IC3A 4ZPTR 5F8NA 1U0HB 2XSJB 3Q23A 3A3OB 2ZFHA 4PXBA 2I9SA 2HRUA 3ADAC 5M2RA 1GMUA 4DR3F 2DNYA 3CEDA 5D4PA 3IR5B 4RNOA 3OLAA 2RNEA 2WVDA 2F65A 4H4OA 4GC7A 3CC7S 2KI2A 4M5LA 1XWLA 2X7IA 1GMWA 2GMHA 4DR1J 4X64J 4FP9A 1ZAWA 3HD2A 4LF4J 2DNQA 4CT9A 1D0EA 1FX4A 1A9NB 4ZLPA 3V4IB 2QT7A 2ZE2A 4Q2LA 4ED0A 4KGMA 3P45B 2V2KA 5CYQB 3M8PA 1X9WA 2XLKA 2LFVA 1DHMA 2QYCA 1YJWS 2OIHA 2CPIA 1P1LA 3LH2S 3QFWA 2QL7B 1TKXB 1ULRA 2Y0BB 3I0SA 5D0HA 1FEEA 3PZPA 1WEYA 4BS2A 2J6SA 1L3UA 3MURP 5ETMA 3CT9A 2OLWA 3FK4A 4QZVB 2YNGA 4ZLNA 5KFAA 2MLXA 4CLSA 1KLNA 4HR2A 3I6PA 2L9DA 1SI9A 3GZ7A 1RT1B 4QR2A 3N4WA 2VH7A 4C3LA 2ZOMA 1HBNA 2DO4A 2P9GA 4IH5A 3MEDB 3B78A 4CYUA 2N3OA 2QN6B 4K2XA 3EZOA 4Z37A 3DLKA 2W9CA 2EEYA 2H5EA 2MQMA 4OZLA 2V8HA 5ETPA 2VC0A 2FHMA 1T95A 4DL6A 4F3QA 2EPIA 2OMOA 2RQMA 5EHHA 1QUVA 2HHTA 1EQ0A 2ZNYA 3FZBA 4OFZA 7FD1A 1N5YA 2MY7A 5BXIA 1OO0B 1W2IA 4NYPA 4P72A 3I55S 2QIFA 5C24A 4DR1F 2Y0SD 1DFDA 3H42A 4A47A 3DOMB 3W2WB 4DF8A 1NDPA 3EYZA 2ZBRA 4OI6A 4V19X 4CYUB 3DCAA 2K7KA 1F9FA 1Q5YA 1UPMB 2OI2A 3QMQA 5CQGA 5B0CA 1FRIA 4LUBA 1IBMJ 2F40A 3FSIA 1YJ7A 3SZ2A 4ZJLA 1WI8A 1FEHA 2V4JA 1Z4UA 4OYZA 4DN0A 2AEFA 4DV6F 2OAUA 2AX0A 2UUAF 1WSVA 1UEUA 4ZN3A 5E3RA 4FF2A 4B3SF 4C7QA 1YJ9S 1DY3A 1FNMA 2WVEA 3HX9A 3GV8B 4C11B 1Q16B 4KR0B 4EFAC 4I7FA 4B9SA 4JI5J 3MR2A 1UJ5A 4RX6A 2OKQA 4JI8F 2HHUA 1IKWB 3ZZ0A 2MQPA 2BKPA 3DOMA 1TMMA 3I4HX 1Q7LB 3DRPB 3R7NB 5C5JA 1TL7A 3NXZA 1QVFR 1KN6A 2ZH5A 1KOHA 1TKZA 3NOGA 3PFOA 4PWDA 3DYAB 1S48A 2YBVA 2R9LA 2NXEA 3NBPB 4H54A 3WIUA 5A8KA 3G8TA 2ALYB 4I2QB 4KC5A 4ELVA 4D3GA 3AFGA 5DM7Q 2HWTA 3GWCA 4B3SJ 2FJXA 5HMWA 2HIQA 1KWMA 1XBWA 2VASA 4BWMA 5HQLA 5JMNA 3GJSB 2LQBA 3O5TB 1VGYA 4I6WA 4WU2A 3TAMA 4BBYA 2LA4A 4N56A 2ALZA 1KONA 2OPPB 2WVFA 3PJ9A 2DNLA 3MUTP 2DGXA 3CJKA 2ADBA 3CCTA 5B09A 5ETSA 5J2MA 4WF9Q 1Y00A 3BDPA 4CH7A 3U1MA 1AZSA 3CJ3A 1O5JA 4DUYJ 4ED1A 2HHHJ 1YG0A 4USIA 1SJ1A 3HHDA 3R5AA 3TA0A 1UFLA 2K3KA 3HI9A 5LMNJ 2J5AA 1WDTA 4DX5A 5KFZA 1FXLA 4PR6A 2MZRA 2UUTA 1U26A 3OVAA 1VQ8S 2DH9A 4RNHA 3U1NA 3HPOA 1HPZB 4ICLA 4WK3A 2DY1A 3M32B 3NMAA 1RHRB 5HJYA 1FDDA 3PTWA 4HACB 2HK3A 4RW7B 1Q82T 3H2LA 2ILZA 3ITHB 3AJ1A 1UWBA 3P5TL 2UVVA 1GTEA 1HWKA 2BM1A 4L73A 5KG3A 1RB0A 2I38A 2RRNA 3R7SB 3W2VA 4OMFG 5A6WA 4FXDA 2ZH9A 1ITPA 3UDCA 4DV4F 2M4MA 1NPKA 1S9EA 3EVOA 1Y5IB 2D9OA 1VISA 3I4PA 2KL8A 3UR3C 3L9ZA 2CQ0A 3C6TB 2GHPA 4ATNA 4ID8A 2KXNB 3ICLA 5M2UA 1SV5B 1VQPS 2ASYA 3D6FB 4V1Ak 5D78A 2XGQA 2WBRA 3BYRA 4YHHJ 1PC4A 2G2OA 3Q8QB 2MHEA 1TAUA 3QT7A 1YDLA 4DFKA 1YHQS 3SSQA 3OL6A 4NEZA 4HT5A 1I3OB 2QGFB 2RB7A 2E29A 2VF3A 3L95X 3M32A 4NLSA 3IXQA 4UQGA 2JDJA 3N9UC 2QJ3A 4HACA 1NLKL 1DTQB 1LWCA 5DRKA 5L38A 3PACA 1GX5A 3MMCA 2ZHAA 2WOMA 3HFZB 3I0RB 2QO3A 3V81A 3LWLA 1KLMA 3E01A 1JLCB 2RHQB 3WQPA 3HCXA 4GKKJ 3O8WA 5FLXU 5D15A 2NSBA 3KFWX 5E7OB 2VQFJ 4UY8T 3TR5A 3H5XA 2MXYA 3AQOA 4WFXA 2YKMB 3PKMA 3BGRA 4WE1A 2W7AA 5GAHU 1WACA 1ICEB 3LAKA 2OHDA 3UDLA 2V8VA 3B54A 2ZH4A 4LVNP 1S9FA 2FLLA 4YEAA 2FHJD 4JI6J 5KFWA 1RWKB 3F41A 4BWJA 3GCWP 2KB2A 4G1PA 2IYGA 4CLWA 4O23A 2PFFB 4RBUA 2EBGA 4RR5A 3CO9A 1NH7A 2X1FA 1NSKL 5C42A 3C19A 4DR5F 3CTRA 2GHVC 3M8ZA 4ZA1A 1GAOA 4ZHRA 5D8HB 2BJ8A 3FVYA 1RAFB 2PA8D 3OTOF 2B8QA 4Z2XA 2YNFB 1D9DA 4WFYA 5EWFA 1LQ9A 1UEKA 2EC2A 1AT1B 1ZM4A 5A8RA 2RSQA 4IFYB 2LECA 5ETQA 3HHLC 1UTAA 4PYDA 5F8GA 3KLFB 2AGQA 3IR6B 4HDGA 4OZ3A 2IY5B 3NGKA 2XSJA 4X4RA 1LWFA 3MM5A 3SEOA 5H9FJ 3O3LA 5LL6d 1YBAA 2CQGA 4KY3A 3KLGA 3H20A 5E5NA 3UCZP 1JLAA 3L4BC 2AYGA 4ED2A 2VJUA 4R8UB 1C1CB 3PX6A 2WW8A 4QCLA 3PYGA 2BRLA 4JV2A 1BD6A 2OFHX 2RUSA 3TUZC 4ZVQB 3H40A 5JVHQ 1BQNB 4CRJA 4ZHRB 4AQYJ 1UVKA 4F8RA 4P7VA 3HSJA 2M5YA 1W26A 1PAEX 2MYFA 1Y9OA 3CWJA 3GFXA 3K5OA 3B4DA 4ZPCA 1XERA 1HI8A 1TL5A 2PMHA 3O2IA 1U2CA 4JP8A 1RXOB 3RUBL 4Q44A 2KM8B 3M8PB 4EYHB 3VQSA 2KFZA 3K89A 1JJ2R 2VG7A 1LWEA 2E1MC 2MEWA 3CJ8A 4N77A 4UUWA 1C2PA 4WIIA 3T9ZA 5KFJA 4F50A 4FS1A 3W66A 2VPWB 4LRBA 3NMRA 1WNEA 4IRCA 2KTQA 2K06A 1VQLS 3OSNA 1T9VA 3JYTA 5ETTA 3EPIA 1EETB 2VKRA 3MM9B 5G4DA 1K73T 4B3MJ 5BYSA 1KKHA 2C2ZB 3DGPA 1X31C 4R5PA 3WIVA 1YK9A 4X4QA 1GXLA 3DU5A 2FJEB 5G0RB 5AXMA 3GYGA 2YNIB 2VG5B 4MIAA 4LFBF 3HHLA 2E1AA 1MLAA 2LDYA 3T6JA 3VR1A 5EWGA 2OPSB 1TK0A 1FRMA 2HNZA 2HVEA 4A8WA 2DHXA 1WF2A 3QO9B 4EGLA 5A0YA 1X4HA 1H73A 1M1HA 2EW9A 2MPUA 4ZVRB 3VGTA 3FSXA 5DDQC 2D3O1 4WXOA 2XO6A 4KFBB 2KG1A 1UVMA 2LU1A 3AOCA 1TP7A 2I6WA 3IR7B 1LOUA 1NDLA 1PBUA 1Y7PA 3FQLA 4ITSA 4KT0C 3KLEA 4B3RJ 2V68A 3D3BJ 4PABA 1RBLA 3VZIA 5C7PA 4FF3A 3BREA 2KT5A 1EETA 2LU2A 4O3NA 3FBFA 2QFJA 5GADU 1KS2A 5KFUA 3J80Y 1K9MT 5AXKA 3UPFA 2UXBJ 3M8RA 5G0RA 2BE9B 2CWXA 2VC1A 4TY8A 1HW9A 2R4FA 2GGPB 2Y9HA 3CJTA 4LVOP 4YY3J 3HHLB 2FJDB 1EAYC 5IC6B 2YQ3A 3FEZA 3HVAA 2LQJA 2ZE2B 3KLIA 1N52B 3TA2A 3MECB 3MAAA 4O44B 2K1RB 4YQWA 4NRUA 5HROA 3WX8A 1HD0A 5J2QB 3OTOJ 4HYKA 3AT1B 1OWXA 2HKEA 4KFBA 4DV1J 1NNDA 1RT6B 2P6TA 2R7OA 1N56A 4NLGA 5LXRA 3AOAA 2D9PA 4OLPA 2O3DA 3QT6A 2HS3A 2YNGB 3OR1A 1YWXA 4K5SA 4QIFA 5A6PA 3VV2B 5I4MA 3RB0A 1MU2B 1VRUB 2CQCA 4ANEA 5HMXA 1R8BA 2R8KA 3IMQJ 2NYIA 2XWXA 2KG0A 1KR4A 1TV6A 2ILYA 3OL7A 2I5JB 3GV7B 1YITS 1RKJA 3PX0A 3MFIA 2NZ4A 4DSEA 2V2VA 1HBOB 5F41A 4PCQA 2KH9A 2XHWA 3EXCX 2FHOB 3RYLA 1YJVA 2BXJA 4RPFA 1SKWA 1VHIA 2JOQA 3CCUS 1HNIB 2HYIB 2CXEA 2RQCA 1Y10A 1VRTB 2ASLA 4Q0BA 3SCLE 1ROFA 2H51B 4F4XA 4K4WA 1S99A 5E3QA 3OR2B 2GIFA 3G2XA 2D7SA 2G13A 3QIPB 4UOFA 4JI6F 5KFNA 1NSAA 1F2GA 2E1PA 1PYOB 2BABA 1HL6A 2RQKA 4QIEA 4PAAA 5F3TA 2ZDPA 5B0EA 1U8SA 3TUJC 1F0XA 4DL3A 4JI4F 2JVOA 3SMZA 3CCLS 2KRBA 1HYSA 4NEYA 4JOUA 2G0IA 4K0KF 2LEPA 2JNJA 2IVMA 2V2QA 3CJ2A 1E6YB 3C16A 1T0TV 1JQGA 4DQPA 4NZ6A 4PUOA 5I42B 4F4YA 4OJGA 1CJUA 1QD1A 2MZTA 4NLYA 5FIIA 3CULA 5J2PB 1VRTA 4PYAA 5RUBA 2YQ1A 4YB1P 1WI6A 4NMXA 3JB9k 2FD2A 3OR2A 2BRKA 4DV7F 3MAHA 3MZIA 4DR2J 2JRSA 2BJEA 4C6AA 4XPCA 3SV4A 1HKAA 1VFJA 1RCOB 2FGCA 2IJFA 4A8XA 1V5IB 3TQ1A 4K4TA 4K2JA 2C2KB 1O8BA 4JI1J 3QSIA 2V5HG 2GVZB 3EJMA 3IRXB 2IVFB 2GMLA 1HNXJ 3ET6A 2DTJA 2QA1A 1FWKA 2IA0A 5HN0A 2LEBA 1JLQB 2Q1LA 1AUSL 2EC0A 1DQAA 1RP5A 2V8DA 4KB7A 4ZIVA 1H38A 2MQLA 2W2QP 1B0VA 1Z1ZA 2HBZB 2J0XA 3FRYA 3N28A 2UUCJ 2DBBA 1YQHA 1FJ7A 3NBPA 1ACMB 4TQSA 4U95A 1ZA1B 2D69A 2KKHA 3AJ2A 3ILLA 4TVAB 1RU1A 1VQYA 4RW6B 2FZCB 3D0IE 2R7TA 4DR6F 3RGIA 2CQ1A 3G86A 3M6UA 1R6VA 2RS8A 1KVIA 2NXJA 1PAUB 1IM6A 1DTQA 4RUCA 1D9FA 2VHGA 2PFDA 2HNDB 4RNFA 1M1GA 2PT0A 3S7RA 4CLFA 5KOWA 3D2WA 1APSA 1LW2A 4E98A 4DFPA 3AA9A 4CLKA 5LSRA 1S6QB 4UW2A 3A8JA 2R8IA 4ED3A 4URGA 2UUBF 3HFKA 5D3GA 1FRKA 2W2NP 2W8LA 1OY8A 3VGVA 3S01A 3KK3B 3PO4A 1RE1B 4ZLJA 3IG1A 2B4PA 2GVDA 4CP5A 1NZAA 2KT3A 1MN9A 1YJRA 2DY9A 3TUIC 1Q86T 3CDAA 3FC9A 1N0VC 3M2UA 4OZNA 4DQSA 4FBUA 4MKVA 3JSMA 3PRVA 3J7ZT 2ZJPQ 3HVTB 3HT3A 2HBRB 2HRTA 3GYNA 5E3PA 5IXUA 1HR0J 2FQQB 4YN3B 4HI2A 4DDFA 2GIQA 4WZQA 2QL9B 3M6WA 5IWAJ 4IQMA 2IBKA 4ECWA 4F04B 1VIXA 4MK9A 2HQCA 1VC6A 3T5KA 2H5JB 1S12A 1DURA 1OSDA 4PZVA 4QWCA 3SYZA 2CPZA 4M5NA 1RHMB 4U8YA 3KWMA 2WB4A 5HVFA 5A8RB 2IRYA 3GE9A 1KQGB 2UUWA 1YBTA 4FZVA 2AYMA 3PEJA 3MUVP 4O3PA 5IT4A 1HLWA 3DOKB 4K50A 4I69A 1DARA 3OQ2A 3ISND 3CGIA 2B3TB 2V9KA 4M5DA 2J8SA 1OY9A 3KJVA 1C0UA 1SKUB 2XGPA 4ALZA 4PG5A 4LR8A 5HBMB 2E1CA 4ILMA 1U7LA 1RU2A 1FX2A 1QM9A 1NJZA 1Q7YT 5KFLA 5EX3A 2CDRB 4Y0FA 2ZD1A 2LXUA 2DNGA 1BQMA 1C0TA 4RLEA 5KG0A 4NI2B 4PPDA 2EVZA 1F9EB 3M7VA 2VBXA 1NMEB 4LQ9A 4WTYA 4MKYA 1S79A 1Y3KA 1VQMS 4AL5A 3KMSA 1FK9B 3P3DA 4OI1A 2X1BA 2IMWP 3EE3A 4NE9C 3OXLA 4DR2F 4ECUA 4DFMA 4ZVFA 1ZZNA 1CULA 3GLJA 3TQEA 1G4CA 2RF2B 3NCPA 2ZUGA 3V2UC 4CLYA 2FLNA 3IBWA 1VYAA 3NOCA 1N8RT 4U7CA 2YNIA 1J5EF 1FRJA 1HW8A 2H4YB 2HEKA 4RUBA 1TVRB 3P8BB 3EM1A 3DMJB 3NGUA 4Y6IA 3I82A 5I3UA 1SCJB 3RRGA 1U45A 1FRLA 3DHWC 4ZP7A 2PI4A 4OX9J 3RAQA 4C9DA 4NLUA 1XEZA 1UPPA 3BO3A 3IS9A 2VFRA 4GVLA 2JH3A 4CO1A 1M5SA 2Q6BA 3OL8A 3WX4A 4P74A 3FBCA 2IRXA 2E44A 3PYFA 3CNQP 3NRBA 4AE5A 4ENOA 3CDUA 2HBYB 3HJFA 3QRQA 4LF1A 4ZVTB 1P9QC 5B0FA 4CZCA 3T9NA 1HWJA 3BKTA 1EHWA 4P2XA 3DU6A 1OQ6A 4ZJOA 3KLGB 1KFDA 2HGMA 3M8QB 1XK8A 3QWPA 1HI0P 4R0JA 1JB0C 2VV5A 4F7VA 1FE4A 2ZDOA 4G65A 1QE1B 3UD5A 3PY8A 1UZHA 2DNNA 3V6DB 1U1QA 1EJ7L 5KT4A 4LSZB 2CPYA 3D0GE 1B7YB 1RWUA 1W25A 3EVMA 2E1RA 3NNAA 3KLIB 3T5HA 3RRKA 4XDCA 2VICA 1CQMA 1T3NA 4WP8A 4ZK7M 1HI1A 1F3VA 2EI5A 2X3DA 5IOLA 3W9IA 4J9RA 1N34J 2VA3A 4OL8A 2HHXA 1U6ZA 2IC3B 2M70A 1LWEB 2DXFA 4DPUA 2Q43A 4ED8A 2I8EA 4F0HA 1X9SA 2E9TA 3HULA 5AT1B 3MR3A 3SQOP 4DUZF 4RUHA 1N5YB 1SJRA 2DYAA 4DL4A 4I68A 3WDOA 4AXIA 3OHBA 1LWXA 8RUCA 4A8FA 3K57A 5KFOA 4J9KA 1IBLF 4ECVA 4OJ3A 4R5PB 2V69A 1RSCA 3NAHA 3Q8PB 3W2WA 3I87A 1I94F 1S1WA 1VHFA 3SXLA 3M8WA 2FY8A 5I3PA 2YVSA 4FNIA 5CHCB 3TVZA 5GAGU 4HT7A 3L7PA 5DDOC 2B51A 4YY3F 4DL5A 2FJAB 1RHUB 2IM2A 1S57A 2B6AA 2XZDB 2W8KA 4L74A 3T1AA 1AW0A 5CYMA 1V9OA 2BQ3A 4EZ6A 3AXMA 4NXNJ 1TKXA 2J7WA 4R0EA 4LF6J 3DNCA 3CCMS 3H5UA 3SCJE 1DLOA 4JI8J 4ES1A 2BYCA 4N7TA 2VJVA 1UZDA 2DHAA 2PEBA 4I6AA 3RAMA 3CC2S 4KHRA 3EZ5A 1ZM3A 1VR6A 2KJWA 4PEOA 3FQKA 1N6QB 1S6UA 4YUDA 3ZNUA 2AKWB 1EP4A 1WDDA 2Z4PA 3VCDA 2MHNA 2GGPA 2W2MP 3LP1A 3QIDA 5GVQA 3TJ9A 2NSCA 1G3OA 1G7CB 1NPRA 2E66A 2FLOA 1TL7B 2M8HA 1G6BA 1RTZA 2GQ2A 2HLUA 2QTWA 2VZ9A 2RQ4A 3MMAA 3TX0A 4QR1A 1M1KT 3NGTA 5LMUF 3J7A1 4ELUA 2AEMA 1S1XB 2ACMA 2BA9A 2KYXA 3DDIA 3BQ2A 3CB4A 4I2QA 1BE4A 4F2SA 1N33J 3GP9A 3ISZA 3MEGB 1RT5B 1XNQJ 4CLTA 3CJRA 4O0NA 2NUUG 1FI4A 1HQ2A 1PG5B 1T9XA 2ZM6J 3PYDA 1IR1A 1BLUA 5DG7A 4C8KA 2CPJA 4KPCA 5HL7Q 3Q8SB 2B56A 3PR4A 1S5ZA 4Y2MA 3H4DA 1LEOA 5F8JA 2RUGA 4DCOB 1TZ0A 3KJQB 3HVWA 4QW8A 3C14A 3D3CJ 2J6UA 1HQUB 2BANA 2CAJA 2Y8WA 2H3EB 1WOOA 2QC3A 2D3OR 4OJ1A 1O0PA 1S7HA 3HDSA 4Q45A 3A8KA 2ZEJA 3TJ8A 4Q8FA 1K44A 2E7VA 5HQ8A 2HWIA 2WW4A 2AP6A 1IR0A 1R8HA 2EK6A 1VQSA 2RKIB 3CSKA 2MKCA 3W9HA 3FCWA 5KG7A 1H72C 3H7HB 3HK2A 8AT1B 3AB4B 3M9MB 4P2MA 3CVKA 2IM0A 4JYAJ 4WFBQ 4ID5A 3MEGA 4DMZA 3UCUP 4WZMA 1T03B 2VPZB 3WBZA 4PG7A 4B9TA 3D1OA 3EPGA 4DPOA 2NYHA 1XMOF 2IHR1 5IV4A 4DV0J 5A76A 2KZMA 1S1VB 4X4NA 4RW7A 4DL0C 5A8WA 4A8YA 3RBEA 2B5JB 5KFVA 3QZ7A 1UWBB 2O01C 3FCVA 4USKA 2OFGX 3T1YJ 3CUNA 1ZYQA 2GJFA 1NAQA 1RBAA 2CZVC 2V8GA 1N5TA 3TZZA 1FD8A 3KK1A 2R2UA 1U24A 3ONQA 1B0PA 1QAJA 2OTJS 1E6YA 2MKYA 1KTVA 3UCGA 4PWDB 3AD9C 4QWBA 4DR4F 3TEGA 2B7BB 1XNRF 2KHDA 3CCES 3BGLA 4LFCF 3H98A 1JLFA 3IO1A 3W9JA 2W01A 2HNYB 5KFPA 4W92B 2FJVA 2QLBB 3MM8B 3OFFA 4XTTA 4CNYA 7FDRA 1SUQB 3H8YA 3O44A 1UL3A 5KG6A 1S1VA 1UW9A 2BKNA 2OPPA 5KOXA 4DR3J 3V6KA 5HATA 3RBXA 1NK6A 2MQQA 2E5LF 1TUGB 3V81B 2HPUA 2G9OA 4J9PA 1FHTA 1QDUB 6FD1A 4J37A 3KK1B 3NWGA 1HBMB 1DTTB 1S77D 2ROGA 4KAIA 4TXSA 4DOZA 5HSPA 3MR7A 1JKHA 4KO0A 4TU8A 1WHXA 4O3OA 2YH1A 2FTRA 4KTQA 4J9SA 1LXJA 1CJVA 4TYBA 1U1NA 3D54A 4WKYA 2XQCA 2R7RA 2J0SD 4RW6A 4M5HA 4HKQA 1IR2A 3VAIA 2UXDF 5J1PA 3TZYA 2H54B 1YJNS 1VC0A 1LFWA 4UOCA 1SH0A 1N5QA 2QSWA 4QIVA 1UVJA 1B70B 2AMCB 4WYLA 4QYZJ 1NZ8A 2HVZA 2MLZA 3EGVA 1LW2B 4MIBA 4O4RA 2VD3A 5EX0A 4DS5A 3W64A 4M5MA 4A8MP 1U6BA 4ZLLA 2DRAA 1ZM9A 1S9EB 3M2RB 1FT8A 1RUSA 5LSLA 3DRSB 4DQQA 4IFYA 1F5AA 2AF6A 5LXYA 1UEVA 2BJ9A 1JKHB 3HF5A 1FK9A 4KO0B 2BE7D 3LP2A 1WC1A 3TP2A 3QAUA 5KFKA 3R5DA 3NNHA 1PGZA 2J76E 1JJ4A 2GW8A 1D3WA 4DV0F 5B0AA 2GIRA 3PM9A 1Y0HA 4CO0A 2C3YA 3TZXA 1C4AA 2DB1A 4LBPA 3I96A 2GO9A 4O4GA 3HP6A 4U7UK 3S6EA 3VGSA 2NUHA 4ZJQA 1B7FA 3KG1A 4C8OA 3RR7A 1I1GA 1ZOTA 3K59A 3F56A 1VK3A 1ZTWA 4EYIB 2A10A 1U47A 4NLVA 5LJ3Y 4RBTA 2RS2A 5GMDA 4G1IA 2QSFA 3QWUA 2IA6A 1WC4A 2GA7A 1Y3JA 1BXNA 2MKSA 3MM7A 2KM8C 3TRGA 2LDIA 2RJZA 5IT0A 2W7PA 1IKYB 1F6TA 1X4CA 2FVCA 3DRRB 3NP5A 1WJ9A 2HFSA 3M30B 4ECXA 3D0HE 2VQEF 2BX6A 2MGZA 1MW7A 1N48A 2C2MB 4N8NA 2QA4S 1YZ7A 2DNZA 3NS5A 1S1UA 4M95A 3AOBA 2W2PP 2WVBA 1HHTP 4IO1A 4DWIA 5MLCV 4DV5J 2RRBA 1RWWB 4DV2J 4WXWA 2G1DA 3CDWA 3BPSP 4YB7A 2HG4A 4CI0B 1ZZFA 3MOJB 1VQ6S 4HI1A 3QBCA 3ZZUA 2R2TA 5DZ7A 3R5CA 2DKOB 4MT1A 2QA4G 3T1HF 4P52A 5K8OA 3Q22A 1T94A 3JAMU 1KVKA 3DDKA 4ZCLA 2JLGA 3B8HA 2PSZA 4LBIA 1S1TA 1YRTA 2H65B 2EKYA 1MG7A 2N3LA 2OGUA 1CULB 3BDEA 2AD9A 1SL0A 3I32A 2UUAJ 5DLGA 3T1HJ 3R1HA 4NCAA 4USTA 1NHUA 3HHLD 1S1UB 1UFKA 4P9SA 4NLWA 2PDAA 5ETKA 3U7JA 3UNGC 1S1WB 2H1YA 1M5KC 3HFVA 1AXQA 3C15B 1FFWB 4MFBA 5T14A 3BSOA 1JNRB 2A6OA 1IQZA 2JWNA 3THPA 2ZC3A 2RE1A 4RW9A 4WFAQ 3J81Y 3OUYA 3TI0A 4K4UA 2B6AB 2NCKL 1RWNB 2C42A 2L3MA 4LRFA 1U1KA 1TKTB 4CO2A 4ED5A 5KT6A 5CCMA 2X1GA 4L6V3 2JLEA 2F4VF 3K8WA 4NOHA 3KHRA 4BDPA 5SZTA 1YRUA 2FHJA 2LXFA 1X5SA 4GRSA 1O6XA 1ELOA 1RJJA 2XMUA 4QOTA 2COLA 3MF5A 5HLFA 2DR9A 2Q66A 3G6VA 1N6QA 2X1AA 1OMSA 2ZC4A 5HVGA 1Q53A 2B4UA 1W2BR 1Q1KA 3EZUA 1B4SA 2K2PA 3F73A 2FLPA 1TELA 3KKFA 2EFGA 3ZTRA 4YFUA 1HBOA 1LW0A 2OPSA 1K47A 3AODA 3V4IA 1K8AT 3ENQA 4JUZA 5GMKa 5KFQA 1S1XA 1KFSA 4JI0J 3OFEA 1WC3A 3M9NB 3ILIA 1U1MA 2F8EX 1TKTA 1XR6A 4DXLA 2C22A 4PG6A 3W5YA 3QJPA 5AJ3F 3VAFA 5HLFB 3BSNA 1PC5A 2RDIA 3IWXA 4I7FB 4K8RA 4ECRA 3T19A 1HQUA 2DGUA 4Y2CA 4F36A 1GEHA 2YXLA 1FKOA 2AU0A 1NH8A 1YJTA 3CD5A 1X8DA 3ZTPA 3N5BA 1FVSA 2BR0A 1SB6A 2E7XA 4OYPA 2MKKA 1L3VA 2JSXA 1GNKA 2FZKB 1JLBA 1SKRA 1ZBTA 5M2PA 4OZ5A 2R8GA 1QLNA 2PE8A 5DQHA 1KOOA 2D3ZA 1Y5NB 4DR7F 3MECA 2L9WA 1F5CA 4O44A 3SCIE 5J2PA 5ITHA 3GIIA 1ZPVA 1SPBP 3GIRA 3UVJA 4HDHA 2YQ0A 4B9VA 1X4EA 4JV5J 1GXTA 4DV2F 1NRKA 3ISNC 4IFVB 2IM1A 5E0OA 5IV3A 3MMBA 3HSZA 2DNRA 3LP0A 4DFJA 3PW0A 4LF7J 4K4ZA 2B5JA 3HKWA 1RHJB 3VHQA 3CD6S 2VG6A 1WELA 5LM7E 4NMLA 3HHNB 4U9RA 5T7LB 1U4BA 1RAOA 4DG1B 1KSPA 2CPEA 2XY5A 4DU8A 1MWYA 3X3UA 2CQ4A 4QBUA 2NXCA 1A6LA 1UVNA 4QU6A 3PRBA 4Z7CA 1FJGF 3Q83A 1PKUA 2Q3PA 5B08A 1DZ5A 3FFIA 2OSRA 3CD0A 3PIPQ 4XAKA 1CVJA 2N4CA 3MR6A 2EFNA 3EXYA 2DISA 3W3SA 2KRRA 3OBIA 3DLGB 3SSRA 3GTYX 1BHNA 3H25A 3X1LB 3MM8A 2WSFC 3AHPA 2AJFE 1LFPA 2J9CA 2DEIA 4NCGB 5E2QA 4CT8A 5CA5A 4O3RA 4C11A 3LP0B 2FUG9 2Z2YB 4FDFA 5D6GA 3C14B 1H7WA 1S0OA 3P6YC 2A2CA 1NO8A 3J7Z5 5L1JA 4WP9A 1NSQA 4F3MA 5H1SV 3MXHP 3GIMA 3H5SA 1HYSB 4IDKA 3L7UA 4FYXB 2DNMA 2W24A 1T05B 4DPYA 1WHVA 5K5MA 1RYRA 4JBCA 3BM7A 3BV8A 2JL9A 4WK1A 1WC6A 2DGTA 4P7TA 4C3KA 1U2RA 4GKJJ 3FBBA 4DN9A 2CQPA 3FMBA 2QEXS 2XLJA 4U7UD 2J0WA 4HVZA 3RB6A 1UA0A 3GILA 2C3PA 3IC1A 2CVIA 5DG9A 4C0BA 5F0WA 2YPZA 3ZTSA 2XCAA 3H5YA 1B3TA 5B7WA 3BKFA 4QR0A 2Q6CA 4J90A 4RNNA 1NK5A 1HNZJ 4LFAF 4MKAA 1R8PA 5A8WB 4USHA 3P49B 3DM2A 4DV3J 2NQPA 4IQXA 3IRXA 4KH0B 1KLMB 1V5VA 1LNQA 3E01B 3CCZA 4OZ0A 5J2MB 3J80U 4GC6A 4CNZA 1AZSB 2FC8A 3KLHA 3DRSA 3HVRA 4AFFA 2GQCA 4OYIA 4Q5VA 3DKDA 4L3KA 2WSEC 2JJ4D 3JTOA 3ZZPA 2ZVSA 2HHPA 3BGFA 4MK8A 4ZDNA 3J81U 4CH0S 5JVGQ 3M2VB 3BKUA 3KMQA 4DBQA 4ED6A 1RTJB 4OQJA 1T8EA 1N33F 2A18A 3D1QA 2HHQA 1GK8A 1FDAA 2DRBA 4K4XA 1WOSA 4FF4A 2HHWA 2KFNA 1URRA 3BPDA 1VQ5S 2HHSA 2NREA 2QYGA 1BQXA 1YKWA 2CNKB 5HBMA 3BO2A 2W9BB 2UVUA 4DSJA 4KPYA 4I67A 1TAQA 2QE5A 1MMLA 3FZ2A 3JQKA 3P5BP 3SCKE 2KHCA 3FEYB 4EK2A 4X62F 4Q43A 3G6XA 2F8HA 5J2NB 4Q2MA 2QLXA 2FPHX 5IZHA 3KLHB 1HBMA 1JNZB 1K1QA 2DGVA 2KVIA 1FF2A 3MPVA 1SJFA 4M5IA 4A4JA 3ZZZA 1KNZA 2P8IA 3GONA 4KSEB 2MMYA 3K5LA 1P8GA 2KJVA 4X4OA 3IM8A 3U1LA 2ABYA 1V3RA 2HSEB 4J9OA 3WC2A 3THTA 3WZ0A 4NLPA 2MZ1A 3VQTA 3FNNA 2RU9A 3TAPA 3PJWA 5LSOA 3PW2A 2EKNA 2YKNA 3IM9A 2PO4A 1H74A 3BGOP 3OFHA 4FYWB 3OJSA 2YWFA 3MCMA 4GO7X 1CJKB 2FVPA 1RABB 1UETA 1UWAA 3CMQA 4OX8A 4ZP8A 5AJ3J 2ACYA 2HFVA 3RTVA 2IMOA 4LMZA 4PQUB 4KHPJ 3I9V9 3F0NA 4H4MA 2XNQA 4HHHA 3RW7A 4M8LA 4ZN1A 1I5OB 2DXEA 1N32J 1TL1A 1YRXA 2AEJA 2JX2A 4HHUA 3M6XA 4ZPVR 2DPIA 4LIRA 3ZC4A 1R8AA 1N36J 5CABA 2ZH1A 3NNCA 4NYZA 5KFXA 4N5SA 2XNRA 3SDEA 4NZ0A 3TAQA 2CJ9A 3JYTB 3ENAA 3MR5A 1HD1A 3EMTA 4TN2A 2G0CA 2J9EA 4K59A 1NM2A 5IC4B 3K2YA 1DJ0A 5DZ6A 5KT5A 4X66F 5J1NA 3M9OB 2L41A 2XMKA 3D6MB 3GJRB 1JXLA 2U1AA 2P9CA 2W25A 3OTCA 4DZ6A 2V94A 2B9EA 2HNZB 2Y1RI 4KGZB 3DRYA 5D77A 3Q8RB 2CQIA 1XMQF 1ZH5A 5K8NA 2UU9F 4P75A 3CCJS 4X2BA 3DI6B 1NJWA 5F0UA 5A0YB 4M5JA 4OHWA 1NKEA 2CPDA 2JZ5A 4CQ1A 3EUNA 1VQOS 3MM5B 3MPUB 5CAAA 3P96A 1A7GE 5GAGI 3I56S 3QJLA 4DLEA 2B8PA 3DRRA 1QY7A 2B9YA 4FYYB 1XMOJ 2RF2A 3H2UB 3M30A 3NWRA 1SQFA 4FVMA 4AT1B 1HHSA 4JI3J 4KJIA 1IKXA 1NPPA 2YPYA 5D4NA 3QATA 1FFSB 3MD1A 1BQNA 1FD2A 2GAHC 1ZPWX 2ASDA 1F2HA 3DLKB 1GXUA 1WHWA 2V63A 3IP0A 5C2GA 4DSLA 3KG0A 2ZBCA 4HH0A 5J2QA 1NUEA 2AYBA 2XMJA 1NHVA 2WK4A 3DLJA 2E9ZA 2JVRA 3QAEA 2C3UA 3CMAS 1H2UX 2A6MA 4YMEA 1FA0A 5JJBA 2E9RX 3W5ZA 1FERA 4IRDA 1BUXA 2VDIA 1NEEA 4OZ1A 4LF8F 1YVFA 3NGRA 2IJRA 2R42A 3Q8VA 5BYRA 5J1EB 1SBRA 2N7CA 4B3RF 2OMLA 2XBPA 1QVGR 3MWBA 3DGPB 5FLXY 1U49A 2ZBIA 1IKXB 1GFWB 3R8YA 2UVRA 4K5RA 1TV6B 2DGQA 5FDLA 2BMBA 3BR9A 2MY8A 3N01A 2OSQA 5F8LA 3M4XA 4MFBB 2KYZA 5BR8F 2ZHBA 1S6PB 2DO0A 3ILJA 3J81j 2GO8A 5KAKA 2NXNA 5K8PA 1V6HA 1VBZA 3QO9A 1SC1B 3IBCB 2MZSA 5L1LA 4L76A 3NG8A 1TK8A 4ZIWA 3G6ES 3C8YA 1FKAF 1FO1A 4ILLA 4B9LA 3ETMA 3UVJB 1R7IA 1VLYA 5D0GA 1KDNA 3BH7B 5IS2A 1WWHA 1U1RA 4FKYA 1IBKJ 1HNZF 4B9UA 4K4VA 2X3GA 3DOLA 2VDHA 3JSRA 4IFVA 4KE5A 2RD5C 4OHXA 4QPTA 4ZVSB 2PN6A 4OX7A 5KG4A 4V19J 1K1SA 1U8WA 4OYMA 5K14B 3CPWR 2D74B 1YZ6A 3Q8YA 1CS4A 1VOMA 2M0GB 1IKWA 1FCAA 1RT1A 3W8GA 4RKUC 2OEMA 4CO5A 2QLFB 2R7WA 4FKXA 1FNOA 2DHHA 2XI3A 3T41A 4C3MA 3N0VA 4DCJB 4LF9J 1RBOB 1Z2LA 2XYGB 4C2MA 4YDXA 1EKRA 4C4WA 1TL4A 2K1RA 4CH1A 2XWYA 1CJUB 3P4UB 4E0DA 2RHSB 5CYMB 1JMTA 1PCAA 1D1UA 2BV3A 1REGX 2XYPB 4Y2IA 5THWA 3TO8A 3HXMA 1TFWA 3MM6A 4GVBB 4URSA 1HA1A 1VI7A 2C2EA 2JLFA 1N4LA 4EUVA 3LALA 4F4WA 2EG2A 3BQ0A 2VL1A 2LYVA 1MU2A 4L75A 4X66J 4RBVA 4ZS6A 1RISA 3AY0A 1TMJA 3DXSX 1U0SA 2HFUA 2DD8S 4TKTA 2DCLA 2BW7A 3KNAA 3NS6A 4IOBA 2ZVIA 1U09A 3MMAB 4PRFA 2V67A 2C2RA 1U1OA 3B82A 5B0GA 4TU7A 2MB0B 4FPIA 1D9AA 1NJXA 2UV8A 4FXVA 3D4JA 1S49A 3EDRB 1HNIA 4K4SA 3DC2A 5HP1A 3G87A 1FTRA 1X4GA 3Q2SC 5CZVA 1J5OB 4NLTA 1TK5A 4DPXA 2HHVA 1FRHA 2HS0A 4WP3A 1Q0NA 2BE2A 3MM6B 4OX6A 4Y34A 2DVIA 3L3CA 1VMBA 4NXMJ 3TVKA 2CQ3A 1HFEL 1VJWA 3MFHA 1B0TA 4F67A 5HANA 3LGNA 2UP1A 2VIHA 3CMES 1J2VA 4WTOB 5HMYA 3W2VB 4TLQA 2N82B 5T7LA 2GC8A 2XO7A 2F9DA 2JFDA 2OTLS 4NA3A 1CPZA 1FJCA 1VDHA 2W9AA 1T11A 5L1IA 1YJUA 3TEHB 5KFBA 3PJXA 3UO0A 3KK3A 1Q78A 1SV5A 1QTNB 2GVDB 2HFOA 3KK2A 2I2YA 1CJVB 1W7WA 2V34A 4ID5B 3MEDA 1CC7A 4KYZA 3PFEA 5CD4A 1SIWB 1RZMA 4OYWA 1U2FA 4CWBA 2XY7A 2IDLA 3DLGA 1VBXA 1HNWF 1WEZA 1RT3A 2L48A 1RT2B 3IA0A 2ZKUA 5DDRC 1PSDA 1FJGJ 2BJDA 1UW4A 2J9DA 3MOZA 5ETOA 3MDFA 1UJ4A 4NA1A 3W63A 1MROB 1RTDB 3I0RA 1QUPA 2CJQA 4HH1A 4OJHA 2BEFA 5BR8J 2V8PA 2CJYB 2GQQA 1TL3A 3LPEA 2M9KA 3IAS9 4JI0F 4G6VB 5KFSA 3UE2A 4FN5A 2DNKA 5CYJA 2GCFA 1KP6A 2YKMA 4TY9A 4Y65A 1N5SA 4RJVA 3DLEA 3BBCA 2JC0A 4DV4J 4NA2A 2YWHA 2GJIA 3NEKA 2ASJA 1NU4A 2M52A 3GG1A 2AJ1A 2BJ3A 3M8YA 4JV0A 1NB7A 3A8EA 3LUYA 1JLFB 3BN7A 4JI2F 4ZCMA 3BQ1A 1L3SA 3VF0B 2VU5A 1XNRJ 4USWA 4PPZA 2MKHA 4IG0A 1C4CA 4DV3F 4JI2J 4I2PA 2XB2D 3Q24A 7AT1B 1EB0A 1RTDA 3JAMY 4RW8B 1SQGA 1S9GA 2HNDA 4FPRA 3PX4A 1NDCA 5LMNF 3GYXB 3CJSA 3CDBA 3FCHA 1S59A 2HMIA 1CJTB 1SC6A 2VUGA 2V4QA 1XNQF 3MPDA 2HWHA 2LQ8A 5HVHA 1QSLA 4N41A 1V3ZA 2FB0A 3Q8UA 2AJ2A 2J7UA 3KJFB 5E33A 3RB3A 3OL9A 2BQUA 3VVTA 1LWFB 2R7UA 3PW5A 4P73A 3OT9A 2CQDA 2F1FA 3FMWA 2CDQA 3QLHB 4PWUA 2CNNB 1UVLA 1IKVB 2EK1A 4F4ZA 2G2YA 1R31A 3M1VA 1JXVA 4R8UA 2XLIA 2AJQA 4G1QB 4U6PA 3V6HA 1VIOA 3B4MA 4KGVB 3D68A 3KHHA 3US5A 1E6VA 2NZCA 4TQRA 4WKRA 1CG2A 3ZZRA 1SIZA 4OZJA 1Q81T 1JLEA 3M6VA 4ZPAA 3OXFA 1N5VA 1T9YA 4FYVB 2HAIA 4HL9A 2XMTA 2YY3A 2V6AA 5C2CA 2KO1A 2KVQE 3CCRS 2VOOA 1CEZA 1PJ5A 1U25A 4WE1B 4Y00A 2AW0A 1XIQA 2NLWA 5FJ4A 3UD3P 1AFJA 4TLRA 2Z2ZA 5IQQA 2B0GA 2ZH3A 4JI5F 4NL5A 3MUMP 2D1CA 2RVJA 5KTQA 2CYYA 1F1BB 2GX8A 5KFEA 4JB8B 3D66A 1YSJA 2JEIA 1FKPB 1H98A 2MDAA 5D0EA 1UVIA 2CG4A 4B3OB 3JTPA 4WFZA 2EFPA 2CWKA 4GO5X 1OSCA 2HQDA 4O4GB 3ULHA 5HAOA 5BJRA 5E41A 3KYLA 1JJHA 1N32F 3A1YG 3ILOA 3V6DA 1L5UA 3CCSS 3T5LA 2IPOB 2YWGA 2YTCA 5E3AA 5EUHA 4ECQA 4H4MB 4RO0A 1BQMB 1JLEB 5DQGA 1NJYA 3THVA 3C66A 2AQ4A 5KFYA 3KNGA 2PMWA 2Z57B 5AE2A 2HZAA 3GJTB 2DCUB 1KQSR 4J9MA 1U48A 3UNYA 2FVQA 3EGZA 1LXNA 2UZAA 3N6LA 3E2EA 4DR7J 5IM0B 5HMZA 4C8MA 1S72S 2H48B 4IH6A 1IWGA 2I1RA 5DQIA 3JQMA 4OYBA 5J1EA 2Y3YA 3OSPA 4G3IA 4DR4J 1FKPA 1UAWA 2GV1A 3UI3A 1GMVA 3CXCR 3W61A 5C25B 4DV7J 2VBZA 2Y8YA 5L1KA 3RBZA 4TY8B 2MQ8A 3I5BA 4P6QA 3TARA 1HBNB 3QRRA 4OIXA 1REVB 1MMDA 3T1YF 4NLXA 4QIWD 4CTAA 2ZHOA 2B4VA 2AIRB 3MAAB 5HROB 2W2OP 2MKIA 1QSSA 3HKZD 3RAXA 4K0KJ 3W5XA 1RTIA 1B99A 1IBCB 1S4FA 2DNHA 3HJVA 3UWTA 3GSIA 1RTHA 1D8ZA 1R0CB 2HQFA 2AX1A 3RR8A 3IFEA 1S0VA 1WF1A 1WSRA 1P6TA 1FWLA 4TYAA 4DF4A 1RGVA 3OR1B 4DLGA 4CM0A 2DR5A 3MHYA 3N79A 1BMQB 1N34F 2UXBF 5EGYA 3R3TA 4HLBA 2PGCA 3OV7A 2ZNZA 3B6BA 4QJVA 4PG8A 1M5PC 2CNLB 2CNOB 3PHTA 1WC5A 3R2CJ 3C15A 2DRDA 2FZGB 3U02A 1WG1A 2CJBA 4OYOA 2MLYA 2WAQD 3JXOA 2A2DA 2BUNA 2VKZG 3IN5A 2HQIA 5KFDA 4CTAB 2JEGA 3W7BA 4RW9B 1FRXA 2AWZA 3BBBA 3GU0A 3OTEA 5D4LA 4WWSA 3NGDA 3R1LA 1JJCB 3H2VE 3I0SB 1SVDA 1WHYA 3UN2A 5AE1A 4MMOA 4DSFA 2IAJB 3KLEB 3G9CA 2K8GA 4MH8A 3SFUA 4ES2A 3BJYA 2BZ2A 1EX8A 4DPWA 4W4MA 2Z2LA 4UOGA 3NGSA 1UJ6A 4LF8J 2ERRA 1M5VC 2P5VA 3GSDA 4D3HA 4USMA 2Z58B 3DRPA 1X0FA 2AHOB 4M94A 2DHGA 2EFVA 3TW0A 1GT8A 3J7YU 4X62J 1ZAVA 2RKIA 2OJ3A 3JSBA 1VS3A 1HNVA 2U2FA 4CLPA 5I42A 1VC5A 3BF4A 1UKUA 4FF1A 2DIVA 4ELTA 2O66A 3MMJA 4KIAA 3ZNJ1 1NK9A 1G2EA 3MEEB 2ATCB 4ZPWR 1LK5A 1HQEB 3J7YI 1DLOB 2GHWA 2GFFA 4X4TA 4DV5F 4ZMMA 1MMNA 1XN9A 4F0KA 4EO8A 1RAIB 3NCQA 3KUEA 2BACA 2O1PA 1P9YA 5SUHA 2ZZMA 5GAEU 2Q79A 5KFRA 5EDWA 4OI0A 1SKSA 3QNWB 5HQMA 5I3QA 2HFNA 3LP1B 5D0RA 1QJHA 1H2VZ 1WD6A 2YNHA 4NLDA 5E3CA 1UCNA 1WG4A 2EFOA 3ZZTA 2RILA 2H5IB 3BB5A 4ETXA 5IQ6A 3H4BA 2FVRA 2UVWA 3FGVA 4TNOA 5KT3A 1SJQA 2XYHB 3QGGA 4UQTA 3KK2B 5KT7A 2OPRB 2AGOA 3MEEA 2XY6A 2M7SA 2IVYA 2R7QA 4WCEQ 1RT3B 4I64A 4NZ7A 4B3MF 4OI2A 2FDNA 3C6UA 2LQ9A 1NKBA 1Z2ZA 2ZOGA 3MMBB 4HEA9 3UW1A 2QMWA 1Y5LB 3LGHA 1MROA 3ENWA 3OTBA 1BWEA 4DUYF 1P1TA 2QMXA 4UF4A 4YR0A 4DR6J 2R7VA 4JI3F 1OJ4A 1HWLA 1TUWA 1R0AB 5D3GB 2RRAA 2QZ8A 1SH3A 2DR7A 1FVQA 1DTTA 3NAIA 4K4YA 3PVXA 5DETA 4PUOB 2MQNA 2G4BA 1HIYA 5HP1B 2MKJA 1FXRA 1R89A 3G82A 3M2UB 4IG3B 5ETVA 2C2OB 2J8AA 4FS2A 1D8YA 4W98A 5K8MA 4J9QA 4IOCQ 1CSJA 3ZTOA 1NK7A 1T03A 3ZXWA 2BE2B 4O0IA 3MPYA 1HNXF 5KFMA 4NCGA 4WPAA 4OV6A 1DQ9A 3I5AA 4X65J 1XJWB 2NPIA 1EQMA 2NXUA 4C0HA 4EWTA 1RACB 1KHWA 3GR0A 3OPKA 4HHJA 2XS2A 3MMCB 1U1LA 4OX9F 3W62A 4IO9Q 1BWVA 2UXDJ 3Q2TC 1EZZB 4KKOB 4PWWA 3VALA 4N76A 2HW3A 3MTJA 1JLQA 3TVYA 2DPJA 2V50A 4RU9A 1PYSB 1Q95G 1VBKA 2BBEA 4XIUA 5ETLA 2KXHA 2VBWA 1ZS6A 2ZJQQ 4A8QA 4OYXA 3D6HB 4ZP9A 4B3TF 5LJ5Y 1RT7A 4FNHA 4RWXA 5EN1A 3QLHA 5B0DA 1H6KX 1VJQA 2QX0A 2YH0A 1DRZA 4LF7F 4ED4A 2ZBPA 4R25A 3O6QA 1L3TA 5IT9Y 1T9WA 3D1HA 1RT2A 5F8MA 3D5MA 1RWVB 4F4AA 2E5LJ 3GB0A 2JHEA 4C98A 3AAWB 4RZRA 3VAGA 4OLOA 4DX6A 2PI5A 1WKJA 2KU7A 4OI3A 4QWAA 4DQRA 3BSAA 3C3LA 2Z2MA 4YB5A 1VRQC 4WIQA 2ZD1B 2HVIA 2HVDA 1EARA 3IGNA 2C2DA 1VQKS 3LPYA 4N8OA 4GKKF 4XDDA 2WHOA 1IM4A 1HWUA 1NCLA 4P2FA 3Q89A 1HMVA 3MAQA 4A48A 2MZQA 4X65F 3BO4A 2J0QD 2FYXA 3JSMB 3QQCD 3SDEB 3I5CA 5F8IA 3S8SA 1QAYA 1X60A 1JLAB 4DZDA 5CD4H 3KOAA 2APOA 1C1CA 2C2NA 3G8QA 3LWMA 4ILRA 3UDEA 1M5OC 3DXBA 4QPXA 4IR1A 2WSCC 2Y1LB 1LWCB 2HVHA 1S9GB 3C2PA 2AYEA 1X4FA 3K8VA 3DMJA 1H7XA 3PIOQ 3PW4A 1ZETA 4QIGA 4ED7A 2P9EA 4DSKA 4LF9F 2DK2A 2HMIB 4USUA 3KUGA 2Z56B 4ECTA 2IBOA 3M2RA 4FVCA 4UOHA 1URNA 1CC8A 2KDOA 3HO1A 4MJKA 3HMJG 4USJC 1SC4B 1HHQA 3OJUA 4IH7A 3KDNA 4X4UA 3LW5C 1U6FA 2X51A 4OHZA 2DH7A 1JXEA 1IUJA 1X4BA 2D41A 3LQVA 2J9DE 2BOPA 3UD4P 2J6TA 2UXCJ 1KEKA 4O3QA 3SBMA 3ZZYA 3OVSA 1MWZA 4EBEA 3KJVB 1M90T 4KH1B 4WYWA 2KT2A 3G71S 1E6VB 1CJKA 1PJ7A 2QA2A 3FDSA 5ETNA 3KTQA 3KLVA 3PG9A 1NBEB 2XI2A 3BSCA 2LP4A 2YNFA 4ZVPB 3JTNA 4CLLA 2HHHF 4ZVHA 4Y2AA 5CYQA 2FY1A 1Q8LA 1XR7A 5ETRA 2XTJP 2IJNA 4DUTA 5DGAA 4FXWA 2F8MA 2W1BA 2POKA 3TX8A 3N6NA 5LMUJ 2R8HA 2OUGA 2RH3A 4M63A 5CCLA 3TANA 1IXKA 2KXFA 3V6JA 1I51B 1X9MA 1NK0A 1MNEA 3G4SS 2KZZA 2GNKA 2K3IA 4ZCIA 4B9MA 3PRDA 2MGZB 2QMUB 2VPXB 3NLCA 4JV5F 5MAOA 1HNWJ 1DQ8A 3IAM9 2W4DA 3VAJA 5CXTA 2C3MA 2HZVA 4JI7J 3RZAA 4I0WA 1X4DA 2WB1D 3K5PA 5F9NA 5I3UB 4ES3A 1X5PA 2XCPA 4J9UE 1F9HA 2QLJB 1Q79A 1OYEA 1NDKA 3HLUA 1S0NA 1UP1A 2XHCA 1H3DA 5K20B 4OZ2A 1SJ3P 2MTLA 3EICA 3SSSA 1QAXA 2R7SA 2P2CB 1BY9A 5F8HA 3PHEA 1F5BA 1S1TB 4GMKA 4KHMA 3W65A 2LCWA 2DR8A 1OY6A 4H4OB 1CS4B 5C25A 5A2QY 1EP4B 1EKSA 1PBAA 4FBTA 1IBLJ 2UU9J 3QGIA 2IYIA 1NK4A 3PNIA 4OYAA 1Q5VA 2R8JA 5CZXA 4AL6A 3F44A 2V4RA 1IVZA 4MKBA 3DLLQ 4JI4J 1WKKA 4QU7A 3OUYB 3A8IA 4PXEA 1Q4RA 3LO3A 3SI8A 4LBHA 1R8CA 2V4JB 3O1LA 3EDQB 1RTHB 1JIHA 9ATCB 2XEXA 4DEZA 2ROPA 2W4PA 2WBMA 4GVBA 3V4MA 1XMBA 2WRMA 3GFHA 1KC8T 2R7XA 1SC3B 2O5DA 1D09B 2DGSA 2F3JA 2YKAA 3OD2A 1FJEB 1RWXB 2DXDA 3MD3A 2BANB 3FUYA 3LA0A 4LSNA 3UQSA 1VCTA 2C3OA 3QZ8A 4DL2A 5IT9U 3POTA 4ECYA 2YWWA 3OFGA 5FDLB 4DSIA 3R5JB 4KHPF 2Z0GA 1FDBA 3L7OA 2VA2A 5H9FK 4IR9A 2RMLA 3AD8C 2DHSA 3K5NA 1S0MA 1FXDA 1FFGB 5HK4A 2A1BA 4DCPB 2XS7A 1J5OA 3HZEA 1IJFB 1RT4B 4NLQA 2B43A 4F2RA 1KRPA 2VQFF 1RT6A 2N4DA 3PCOB 1TKDA 2IFXA 4MK7A 3MCNA 4MAKA 3HSDA 5GMEA 3ZO7A 3BH6B 3UFCX 4Q8EA 3IWNC 3LTOA 1GX6A 3J7AN 4ZP6A 4NCBA 1RAAB 2G1HA 3N6MA 2DGOA 4KGKA 4CLUA 5KG5A 1IBKF 4NYOA 4C8NA 4H4KC 5IFMA 2BOAA 2YKOA 3ET6B 3FJ2A 4C8YA 2I5JA 1YGYA 4YR3A 2AJ0A 1TUVA 3UDVA 3CDEA 1DBDA 1RWOB 2YX4A 3GPAA 1RAJA 2I0XA 4RW4A 3TA1A 4CIOA 2CKWA 4DR5J 1X4AA 1HNVB 2Z30B 2F4VJ 3VAHA 2XULA 3AQPA 1FE0A 2O67A 4WU3A 3RBDA 1GTHA 2CQBA 3EGWB 5HJXA 3VAMA 4X4VA 4KRWA 3G96A 2RIJA 4ZPDA 3QIPA 1RLCL 4BHQA 2BM0A 2VQEJ 2J7KA 2VPYB 1G1XA 4JV1A 4LFCJ 2E7WA 5HO4A 3D6TB 2A0FB 4J7CA 4KKOA 3TNVA 3K5MA 2XZWA 4DG1A 1OIAA 2LKZA 4LFBJ 2PD1A 3DN9A 4ANDA 2WZ1A 3RJMB 2W7OA 3KDOA 4ER8A 2KN4A 4E8UA 4TU9A 1IJEB 1JX4A 2ZWOA 3DYAA 4PQAA 1YTYA 1R0BG 1V3SA 4RUAA 3FFIB 4MYTA 4C8LA 2B7CB 4IUFA 1WEXA 4QQBA 2WCXA 5CH7B 3RB4A 4IYQA 1TFYA 2AZ3A 3H59A 1QTMA 5BYQA 3NS7B 4IKAA 1AA1B 1ZA2B 1YX2A 1Q8BA 2C1EB 3C6UB 3T5JA 4LF6F 2BKOA 2OELA 3R5BA 1NK8A 3TAMB 1TU0B 3JSYA 4I2PB 1AUDA 1YBUA 4E2FB 2AZ1A 3H90A 3ELHA 4KGXB 4ECSA 2WOMB 3R7BB 4ETZA 2HFZA 1FTCA 3EGNA 4KV8B 3CJKB 5IWAF 3OLBA 1JLCA 4LQ3A 1K0VA 5L46A 3EX7B 4JYAF 1OS5A 3PW7A 4LR9A 3TZWA 3RRHA 4EI2A 4C8ZA 2LA6A 2L9NA 3HHEA 5AXNA 2HAFA 4DJBA 3FBEA 4CO3A 3E8OA 1M0SA 1UMJA 3ETOA 2ZOFA 4F26A 2C28A 1TQLA 1NHKL 2UV8G 3I9ZA 1AFIA 4DX8H 1VLOA 2HURA 4DUZJ 3M1VB 3T6BA 3CF5Q 2CJXB 2OEKA 4J91A 4LREA 4M5DB 3HHKA 3RU0A 5GADI 1QAIA 5D4OA 1RDRA 2UUBJ 3NCRA 1HARA 4QYZK 1RA7A 3ZTQA 3FKBA 2GMJA 1O51A 2HQGA 2F9JA 4KV8A 3R5GA 1WTFA 1RA6A 2HGLA 1SL1A 1H2TZ 2B4OA 5A2QU 3PKYA 2XMWA 4LF2A 2YWKA 1JLGA 2PEHA 3JS9A 4EU0A 3TJAA 4NWBA 4WFNQ 4X4SA 3KLFA 2ZM6F 3CD7A 5AXLA 2OO4A 1SXLA 1C1BA 5K9FA 1RT7B 2CADA 1IBMF 3IRWP 1VK8A 1GQEA 1ZTTA 3HD1A 1RCXB 1IKYA 2DEJA 1RAHB 1OPIA 2MSTA 3A4TA 1X7VA 3M2VA 3LGMA 3R97A 3W1YC 5AE3A 1UA1A 4ECZA 4B3OA 1RAEB 3IWLA 1P27B 1WORA 2MJNA 2AT1B 2XSFA 2HIYA 4ANCA 5KG2A 2AJ4A 4ZVEA 1XC9A 1IN0A 1NKCA 1VQ9S 2CRLA 4MIWA 2LLZA 3FSYA 3AB2B 2HK2A 3GCXP 1YI2S 4QWDA 1VQ7S 2DGWA 3FEXB 2HZCA 5L9NA 3KHLA 1FESA 4P10A 2CFXA 2XMAA 4N47A 1AROP 4M1KA 2VFVA 3OW2R 5KFFA 2B9WA 2ZUAA 1J5EJ 3DI6A 1LV5A 1R43A 1AB8A 2DJWA 3LF0A 2ZH8A 3AA8A 2GJ2A 3BGRB 5KFTA 2OPQB 4J5OA 1HMVB 4CM2A 4AQYF 4CCHA 4URQU 1MN7A 2QL5B 2ZKTA 3DGVA 1FNXH 1T3OA 4NXMF 4F02A 1WF0A 3CO0P 4U96A 2WVCA 4U8VA 1RWPB 4DX7A 2XZTB 4DV6J 2VOPA 4BLGA 1X5OA 4HTJA 3T3FA 1KQFB 4C48A 4UTGA 2VFSA 1ZAXA 4F3OA 3E3XA 1X0PA 2FHKA 3MGJA 4XK8C 4DPTA 2ZH7A 2RU3A 1NSPA 2A3JA 1OPZA 4XO0A 2AGPA 2RDJA 2M3DA 2VG5A 2ZH2A 3DRXA 2XMMA 5U47A 3PR5B 4PG4A 1VQ4S 1Q8KA 4LSLA 4NPOA 1S7IA 4EEYA 4PQUA 4F4KA 1CBKA 3QJJA 3UN5A 1S4EA 2B9XA 5L9XA 2MSSA 3MCSA 1XQIA 4CO4A 1TL1B 2E5JA 2JEFA 1NJIT 3A12A 4OV1A 1RTIB 4H4KA 2MJUA 2XS5A 3QSYB 1T02A 1MWQA 4MTPA 5T41A 3OTDA 2YKPA 2YX1A 3GR1A 3S1TA 3DLBA 1KBRA 4LF4F 4Y28C 4U67Q 4LFAJ 3ZFVA 4EO6A 4AUKA 2DT9A 1X5TA 3Q0AA 4CDIA 3M8SA 3VWSA 4BC9A 4LR7A 4YOEA 1RHQB 1J27A 1WKLA 2JFKA 3M05A 1DAXA 4LRCA 5KT2A 3BEGB 3CIZA 1IQTA 2ZBQA 1R3NA 5DS7A 2ZH6A 3SV3A 3CC4S 2ZITA 4DQIA 4GKJF 2VONA 2W9CB 5GAHI 1S6PA 2CG8A 5GAEI 4YDDB 2EFQA 5F9LA 5LOQA 2AV5A 3GMGA 5DGBA 4I1TA 2OH2A 5KFCA 2ZZTA 3NY0A 1WC0A 3R9LA 1WUUA 2VG7B 1AYEA 4A8KA 1U0HA 1OYDA 5L8RC 1HR0F 1RYSA 4O3SA 4X84A 3D9BA 3SIPB 9RUBA 2OD6A 1LK7A 3FRZA 4HTIA 1IWAA 5IM0A 3KHGA 4RU2A 3DOLB 1PJ6A 4RL1A 6AT1B 4I56A 5C24B 1JK9B 3CJQA 1WOPA 2V2ZA 3CW2C 3PEHA 3MM9A 4ZVOB 3QT8A 4ZVUB 4B02A 5K14A 2EBEA 4M5KA 3BR8A 4LSNB 4ZKAA 2Y1IA 2PC6A 1I6JA 3VZHA 4L3NA 3POTB 2NPFA 3IBFB 1U1PA 4NXNF 2BVZA 4C97A 2F5GA 8ATCB 3DHXA 4A8OA 1JLBB 1REVA 5EWEA 4J9LA 3MI7X 2Z8QA 1VBYA 4W90B 2OP5A 2LVWA 2LXIA 4PXCA 2G2ZA 3VVUA 5F3ZA 3D7SB 4YR2A 2QV6A 2H9ZA 3CJ0A 4LRAA 4Y3CA 1RT4A 1GH8A 3BYPA 1RT5A 1QSYA 2R2SA 2JC1A 3D67A 4I4BA 2CQ2A 1S76D 4ZPBA 4ZITA 2FJBB 4RWWA 2VODA 1Y4ZB 2M88A 3NKYA 4K7QA 5JXSA 3G6YA 3PXGa 3RG6A 4YS2A 3CCVS 2FVSA 2M2BA 4YP3A 1RI7A 4ZOSA 3VGUA 4DS4A 3EWGA 4UZBA 5KG1A 3C46A 1RK8A 5H9EK 3WC0A 4OI4A 1LW0B 2K7JA 2P6SA 2PMZD 1TKZB 3DLHA 4RW4B 4AXJA 2WONB 2ROEA 1M5HA 2CZ4A 2EWHA 3BZQA 4CLZA 2RT3A 4EBCA 1T9TA 2H4WB 2HGNA 3L09A 2OPRA 1A0OB 2DNOA 2VB6A 2EG1A 2LMIA 4F25A 3MCOA 1Y11A 2IAJA 3RW6A 2UXCF 4UUXA 4LRDA 2CPXA 4KBIA 5KFGA 5B0BA 2QLWA 3EVWA 2RAQA 2NS1B 1ZM2A 2MQOA 3R2DJ 4FYDA 3TWZA 3H0PA 1VRUA 3IGVA 5LT5A 3DFEA 3TUPA 1T9UA 2GVZA 1FKOB 2W4CA 4LF5F 1XMQJ 4QW9A 4AYBD 1T7PA 1R0AA 2IIHA 3R27A 4IDKB 2CVEA 2VFTA 3UN3A 1S6OA 1FDNA 3GJQB 1SL2A 2DR6A 2CZ9A 4Y2KA 1BGXT 2CUYA 1YLXA 2WONA 3OHAA 2QFIA 4DL7A 3DDNA 2IDEA 1FWPA 3QRPA 4BC7A 1R27B 2E5HA 4B17A 3PDNA 4Q0BB 2MZJA 3TOQA 4A8SA 3LOUA 2DITA 2M8DB 3G8SA 1HQEA 3HT0A 2V9WA 4J9NA 2HNYA 2VFUA 3CIMA 2F7VA 1SUQA 2BW2A 3AXKA 3A3NB 1N36F 4PXDA 3A3PB 2ZWPA 4JI7F 2RDDA 4QWEA
chains in the Genus database with same CATH topology
3DM2B 1PILA 2VG6B 2NR0A 4NLOA 2N7YA 1HWIA 2D3UA 1S6QA 2YNHB 4X64F 3SQGA 2UUCF 4EZ9A 3CJ5A 2HHXA 1S10A 3MTKA 3C6TA 5DG8A 1B64A 1N0UA 5DJBA 3K0JA 2YWEA 2XC9A 4DHVA 2WTFA 1WG5A 3DLEB 2FC9A 5DDPC 3OVBA 5A8KB 1S97A 2XMVA 3D28A 5KFHA 3PV8A 3HVTA 5ADZA 3NL0A 1RTJA 3VTIA 3KG4A 4DV1F 4IG0B 2CIMA 3PO5A 1XTZA 2YKQA 4NX9A 4ZCKA 4RNMA 4MYUA 3HM9A 2ADCA 2LQ5A 4UY85 3VAKA 3SQGB 3MPWA 5J2NA 3LAMA 4NRTA 2Y1JA 3N5FA 1L3KA 4L72B 2E5GA 1WTBA 2VBYA 2PIIA 1SH2A 2LEAA 4P2SA 3QGPA 4YHHF 3GV5B 1C1BB 3GIJA 4I6YA 4IG3A 1CLFA 1HBUB 2CJAA 3HZGA 2HQ3A 1IKVA 3GQCA 2CPFA 3AH6A 3K7RA 4ERDA 4LIWA 4AL7A 3BGUA 1HPZA 4ICLB 1XR5A 3MEKA 5FD1A 3SFGA 1C0UB 2XG8A 2YX7A 1TR0A 2DIUA 2IRUA 2QRRA 3ITHA 3CE8A 2BQRA 2BDPA 2FIUA 1BC6A 4YB6A 4C0OC 1RKIA 1TL3B 4OHYA 2JEJA 2IM3A 1YIJS 3CCWA 3IG1B 2OPQA 1F60B 3MM7B 3GG0A 4Q7AA 1OQ3A 4LT6A 2R2RA 1HBUA 2ZZNA 1UFWA 1H0HB 4A46A 1KHVA 2E5IA 3TYTA 3QYYA 1KD1T 5KFIA 2V0NA 1KQKA 6FDRA 2HRYA 2SXLA 4QYRA 4RW8A 1CQNA 1TVRA 2HS4A 5HI7A 2W9BA 1KVJA 2DH8A 4LSLB 1RQ0A 5DO2A 1MSWD 4LJMA 4XPEA 4EBDA 5DLFA 1VQNS 3CJ4A 2PA3A 3BN4A 3IS9B 1JLGB 3GFYA 3U27A 3LANA 3BS9A 3UR0A 2CQHA 3CCQS 4PKDB 2CPHA 3LP2B 4ZVGA 4B9NA 1SQEA 4JI1F 1LKZA 3DOKA 3QPIA 5L39A 4X4PA 4IRKA 3M8QA 2OD4A 5H9EJ 1SJ4P 1K0TA 3GFZA 1R6YA 4G1QA 3ZZOA 1N88A 2YKNB 3E51A 3I31A 4BCAA 3V5RA 4B08A 5C42B 1QE1A 3QGHA 1PO6A 2FGOA 1KTQA 4IOAQ 1Q8IA 3OXGA 4NLRA 2ATLA 2CJKA 1N54B 3GIKA 2KFYA 4KQZA 1C0TB 2L08A 4OHVA 4WJBA 3ENVA 5JUMA 2HLTA 5DM6Q 3K58A 1JWWA 2ZJRQ 2DNPA 2IC3A 4ZPTR 5F8NA 2XSJB 3Q23A 2ZFHA 4PXBA 2I9SA 2HRUA 5M2RA 4DR3F 2DNYA 3CEDA 5D4PA 3IR5B 4RNOA 3OLAA 2RNEA 4H4OA 4GC7A 3CC7S 2KI2A 1XWLA 2GMHA 4FP9A 1ZAWA 1A9NB 2DNQA 4CT9A 1D0EA 4ZLPA 3V4IB 2QT7A 2ZE2A 4Q2LA 4ED0A 4KGMA 2V2KA 5CYQB 3M8PA 1X9WA 2XLKA 1YJWS 1DHMA 2QYCA 2OIHA 2CPIA 1P1LA 3LH2S 1TKXB 1ULRA 3I0SA 1FEEA 3PZPA 1WEYA 4BS2A 2J6SA 1L3UA 3MURP 3CT9A 2OLWA 4QZVB 2YNGA 5KFAA 1KLNA 3I6PA 2L9DA 1SI9A 3GZ7A 1RT1B 4QR2A 3N4WA 2VH7A 4C3LA 2ZOMA 1HBNA 2DO4A 2P9GA 4IH5A 3MEDB 3B78A 2N3OA 4K2XA 4Z37A 3DLKA 2W9CA 2H5EA 2MQMA 4OZLA 2V8HA 2VC0A 2FHMA 1T95A 4DL6A 4F3QA 2EPIA 2OMOA 2RQMA 5EHHA 1QUVA 2HHTA 2ZNYA 3FZBA 4OFZA 7FD1A 1N5YA 2MY7A 1OO0B 1W2IA 4NYPA 3I55S 2QIFA 5C24A 4DR1F 2Y0SD 1DFDA 4A47A 3W2WB 4DF8A 3EYZA 4OI6A 3DCAA 1F9FA 2K7KA 3QMQA 5CQGA 5B0CA 1FRIA 4LUBA 2F40A 3FSIA 3SZ2A 1WI8A 1FEHA 2V4JA 1Z4UA 4DN0A 4DV6F 2OAUA 2AX0A 2UUAF 1UEUA 5E3RA 4FF2A 4B3SF 4C7QA 1YJ9S 1FNMA 3HX9A 3GV8B 4C11B 1Q16B 4KR0B 4EFAC 4I7FA 4B9SA 3MR2A 1UJ5A 4RX6A 2OKQA 4JI8F 2HHUA 1IKWB 3ZZ0A 2MQPA 3DOMA 3I4HX 1Q7LB 3DRPB 5C5JA 1QVFR 1KN6A 2ZH5A 1KOHA 1TKZA 3PFOA 4PWDA 3DYAB 1S48A 2R9LA 3NBPB 4H54A 5A8KA 3G8TA 4ELVA 4I2QB 4KC5A 4D3GA 5DM7Q 2HWTA 3GWCA 2FJXA 5HMWA 2HIQA 1XBWA 2VASA 4BWMA 2C28A 2ZHBA 3O5TB 2LQBA 4I6WA 1VGYA 4WU2A 4BBYA 3TAMA 4N56A 2LA4A 2ALZA 1KONA 2OPPB 2DNLA 3MUTP 2DGXA 3CJKA 2ADBA 3CCTA 5B09A 4WF9Q 5J2MA 1Y00A 3BDPA 4CH7A 3U1MA 3CJ3A 1O5JA 4ED1A 1YG0A 4USIA 1SJ1A 3HHDA 3R5AA 3TA0A 1UFLA 2K3KA 3HI9A 2J5AA 5KFZA 1FXLA 4PR6A 2MZRA 2UUTA 1U26A 3OVAA 1VQ8S 2DH9A 4RNHA 3U1NA 3HPOA 1HPZB 4ICLA 4WK3A 3M32B 3NMAA 1FDDA 4RW7B 1Q82T 3H2LA 2ILZA 3ITHB 3AJ1A 1UWBA 3P5TL 2UVVA 1GTEA 1HWKA 2BM1A 5KG3A 3W2VA 2RRNA 2I38A 4DV4F 4FXDA 4OMFG 5A6WA 2ZH9A 3UDCA 2M4MA 1S9EA 1Y5IB 2D9OA 3I4PA 3UR3C 4ATNA 2KXNB 2CQ0A 3C6TB 2GHPA 4M94A 4ID8A 3ICLA 5M2UA 1SV5B 1VQPS 2ASYA 5D78A 2XGQA 2WBRA 1PC4A 3Q8QB 2MHEA 1TAUA 4DFKA 1YHQS 3SSQA 3OL6A 4HT5A 2RB7A 2E29A 3L95X 3M32A 4NLSA 3IXQA 4UQGA 2JDJA 3N9UC 1DTQB 1LWCA 5DRKA 5L38A 3PACA 1GX5A 3MMCA 2ZHAA 2WOMA 3I0RB 2QO3A 3V81A 3LWLA 1KLMA 3E01A 1JLCB 3O8WA 4UY8T 2NSBA 3KFWX 5E7OB 3H5XA 3TR5A 2MXYA 3AQOA 4WFXA 2YKMB 3PKMA 3BGRA 4WE1A 2W7AA 5GAHU 1WACA 3LAKA 3UDLA 4EZ6A 2V8VA 2ZH4A 4LVNP 1S9FA 2FLLA 4YEAA 2FHJD 5KFWA 3F41A 4BWJA 2KB2A 4G1PA 2IYGA 4O23A 2PFFB 4RBUA 2EBGA 3CO9A 1NH7A 2X1FA 5C42A 4DR5F 3CTRA 2GHVC 4ZA1A 5D8HB 1GAOA 4ZHRA 3FVYA 3OTOF 2PA8D 4Z2XA 2YNFB 1D9DA 4WFYA 5EWFA 1LQ9A 2VOPA 2FJWA 2LECA 1ZM4A 5A8RA 2RSQA 4IFYB 5F8GA 3HHLC 3KLFB 2AGQA 3IR6B 4HDGA 3NGKA 2XSJA 4X4RA 1LWFA 3MM5A 3SEOA 5H9FJ 3O3LA 5LL6d 1YBAA 2CQGA 3KLGA 3H20A 5E5NA 3UCZP 1JLAA 2AYGA 4ED2A 4R8UB 1C1CB 3PX6A 2WW8A 4QCLA 2BRLA 4JV2A 1BD6A 2OFHX 3TUZC 3H40A 5JVHQ 4F8RA 1BQNB 4ZHRB 1UVKA 4P7VA 2M5YA 3CWJA 3K5OA 2MYFA 1Y9OA 4ZPCA 3GFXA 1T7PA 3B4DA 1XERA 1HI8A 1TL5A 2PMHA 3O2IA 2MB0B 4EYHB 2KM8B 4Q44A 3M8PB 3VQSA 2KFZA 1JJ2R 2VG7A 1LWEA 2E1MC 4UUWA 4N77A 4WIIA 5KFJA 1C2PA 3T9ZA 4F50A 4FS1A 1U1QA 2VPWB 3NMRA 1WNEA 4IRCA 2KTQA 1VQLS 3OSNA 3JYTA 3EPIA 1EETB 2VKRA 3MM9B 5G4DA 1K73T 5BYSA 3DGPA 4R5PA 4X4QA 1GXLA 3DU5A 2FJEB 5G0RB 5AXMA 2YNIB 2VG5B 4MIAA 4LFBF 3HHLA 2E1AA 2LDYA 3T6JA 3VR1A 5EWGA 2OPSB 1TK0A 1FRMA 2HNZA 4A8WA 2DHXA 1WF2A 3QO9B 4EGLA 5A0YA 1X4HA 2EW9A 2MPUA 3FSXA 5DDQC 1UVMA 4WXOA 2KG1A 4KFBB 2LU1A 1TP7A 3IR7B 1LOUA 3FQLA 1Y7PA 4ITSA 4KT0C 3KLEA 3VZIA 4FF3A 3BREA 2KT5A 1EETA 2LU2A 4O3NA 1K9MT 2QFJA 5GADU 1KS2A 5KFUA 3J80Y 5AXKA 3UPFA 3M8RA 5G0RA 2VC1A 4TY8A 1HW9A 2R4FA 2GGPB 4LVOP 3HHLB 2FJDB 2YQ3A 3FEZA 3HVAA 2LQJA 2ZE2B 3KLIA 1N52B 3TA2A 3MECB 4O44B 4YQWA 2K1RB 5HROA 4NRUA 5J2QB 1HD0A 4HYKA 1N56A 1OWXA 4KFBA 4NLGA 1NNDA 1RT6B 2P6TA 5LXRA 2D9PA 4OLPA 2O3DA 4QIFA 2HS3A 2YNGB 3OR1A 1YWXA 4K5SA 5I4MA 5A6PA 3RB0A 1MU2B 1VRUB 2CQCA 5HMXA 2R8KA 1R8BA 2NYIA 2XWXA 2KG0A 1KR4A 1TV6A 2ILYA 3OL7A 2I5JB 3GV7B 1YITS 1RKJA 3PX0A 3MFIA 2NZ4A 4DSEA 5F41A 1HBOB 2KH9A 4PCQA 2XHWA 3EXCX 2FHOB 3RYLA 1YJVA 2BXJA 1SKWA 2JOQA 3CCUS 1HNIB 2HYIB 2RQCA 2ASLA 1VRTB 4Q0BA 3SCLE 1ROFA 4F4XA 4K4WA 1S99A 5E3QA 3OR2B 2D7SA 2G13A 3QIPB 5KFNA 4JI6F 1F2GA 2BABA 1HL6A 2RQKA 4QIEA 5F3TA 5B0EA 2ZDPA 3TUJC 1U8SA 4DL3A 1F0XA 4JI4F 2JVOA 3SMZA 3CCLS 2KRBA 1HYSA 4JOUA 4K0KF 2LEPA 2IVMA 3CJ2A 1E6YB 4DQPA 4NZ6A 4PUOA 5I42B 4F4YA 4OJGA 2MZTA 4NLYA 5FIIA 3CULA 5J2PB 1VRTA 4YB1P 1WI6A 3JB9k 2FD2A 3OR2A 2BRKA 4DV7F 3MAHA 3MZIA 2JRSA 2BJEA 4XPCA 3SV4A 1VFJA 2FGCA 2IJFA 4A8XA 3TQ1A 4K4TA 1O8BA 2V5HG 3IRXB 2IVFB 2GMLA 2DTJA 2QA1A 2IA0A 5HN0A 2LEBA 1JLQB 2Q1LA 2EC0A 1DQAA 1RP5A 2V8DA 4KB7A 1H38A 2MQLA 1B0VA 1Z1ZA 2J0XA 3FRYA 3N28A 2DBBA 1YQHA 1FJ7A 3NBPA 4TQSA 2KKHA 3AJ2A 1VQYA 4RW6B 3D0IE 2R7TA 4DR6F 2CQ1A 3G86A 3M6UA 2RS8A 1KVIA 1D9FA 4RUCA 1DTQA 2HNDB 4RNFA 2PT0A 3S7RA 5KOWA 3D2WA 1APSA 1LW2A 4E98A 4DFPA 3AA9A 5LSRA 4ED3A 1S6QB 4UW2A 2R8IA 2UUBF 5D3GA 4URGA 3HFKA 1FRKA 2W8LA 3S01A 3KK3B 3PO4A 3IG1A 2B4PA 1Q86T 1NZAA 2KT3A 3TUIC 1YJRA 3CDAA 4OZNA 1N0VC 3M2UA 4DQSA 4FBUA 3JSMA 3J7ZT 2ZJPQ 3HVTB 3HT3A 3GYNA 5IXUA 5E3PA 4HI2A 4DDFA 2GIQA 4WZQA 3M6WA 4IQMA 2IBKA 4ECWA 1VIXA 4MK9A 1VC6A 3T5KA 3SYZA 1DURA 1OSDA 4QWCA 2CPZA 3KWMA 2WB4A 5A8RB 2IRYA 3GE9A 1KQGB 2UUWA 4FZVA 2AYMA 3PEJA 3MUVP 4O3PA 5IT4A 3DOKB 4K50A 4I69A 1DARA 3OQ2A 3ISND 3CGIA 2B3TB 2V9KA 4M5DA 3KJVA 1C0UA 2XGPA 4ALZA 4PG5A 5HBMB 2E1CA 4ILMA 1U7LA 1QM9A 1NJZA 1Q7YT 5KFLA 5EX3A 4Y0FA 2ZD1A 2LXUA 2DNGA 1BQMA 1C0TA 4RLEA 5KG0A 4PPDA 2EVZA 2VBXA 4LQ9A 4WTYA 4MKYA 1S79A 1Y3KA 1VQMS 4AL5A 3KMSA 1FK9B 3P3DA 4OI1A 2X1BA 3OXLA 4DR2F 4ECUA 4DFMA 4ZVFA 1ZZNA 3V2UC 2RF2B 3NCPA 2ZUGA 2FLNA 3IBWA 1N8RT 4U7CA 2YNIA 1J5EF 1FRJA 1HW8A 1TVRB 4Y6IA 3DMJB 3I82A 5I3UA 3RRGA 1U45A 1FRLA 3DHWC 4ZP7A 2PI4A 4C9DA 3RAQA 4NLUA 1XEZA 3BO3A 3IS9A 2VFRA 4CO1A 2JH3A 1M5SA 2Q6BA 3OL8A 3WX4A 2IRXA 2E44A 3NRBA 4AE5A 3CDUA 1P9QC 5B0FA 4CZCA 3T9NA 1HWJA 3KLGB 3DU6A 1OQ6A 1KFDA 2HGMA 3M8QB 1XK8A 3QWPA 1HI0P 4R0JA 1JB0C 2VV5A 1FE4A 2ZDOA 3PY8A 1QE1B 2DNNA 3V6DB 5KT4A 2CPYA 3D0GE 1RWUA 1W25A 2E1RA 3NNAA 3KLIB 3T5HA 3RRKA 4XDCA 1CQMA 1T3NA 4ZK7M 1HI1A 4J9RA 2EI5A 1B7FA 2VA3A 4OL8A 1U6ZA 2IC3B 2M70A 1LWEB 1X9SA 2IMWP 2Q43A 4ED8A 2I8EA 2E9TA 3MR3A 1N5YB 4DUZF 4RUHA 1SJRA 4DL4A 4I68A 3WDOA 4AXIA 3OHBA 4A8FA 3K57A 5KFOA 4J9KA 1IBLF 4ECVA 4OJ3A 4R5PB 3NAHA 3Q8PB 3W2WA 3I87A 1I94F 1S1WA 1VHFA 3SXLA 5I3PA 2YVSA 4FNIA 5CHCB 3TVZA 5GAGU 4HT7A 3L7PA 5DDOC 2B51A 4YY3F 4DL5A 2FJAB 2IM2A 2W8KA 2B6AA 3T1AA 1AW0A 5CYMA 1V9OA