4Y65A

Crystal structure of e.coli cuta1 c16a/c39a/c79a mutation
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
112
structure length
112
Chain Sequence
MLDEKSSNTASVVVLATAPDEATAQDLAAKVLAEKLAAAATLIPGATSLYYWEGKLEQEYEVQMILKTTVSHQQALLEALKSHHPYQTPELLVLPVTHGDTDYLSWLNASLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Divalent-cation tolerance protein CutA
publication title Crystal structure of E.coli CutA1 C16A/C39A/C79A mutation
rcsb
source organism Escherichia coli k-12
molecule tags Metal binding protein
total genus 24
structure length 112
sequence length 112
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03091 CutA1 CutA1 divalent ion tolerance protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4y65A00
4USJC 2JJ4D 3AHPA 1XK8A 1UKUA 4RWWA 3L7PA 3NCRA 2J9CA 1QY7A 4USHA 1O51A 2GX8A 2O67A 4CO0A 4USIA 3NCPA 2J9DE 4WK1A 2CZ4A 1NAQA 2EG1A 5L9NA 4CO2A 3AH6A 3N5BA 3TA0A 4D3HA 4YB7A 1H3DA 4CNZA 4C3KA 2E66A 4OZJA 4CO3A 1PILA 2J9EA 2NUHA 2ZOMA 4RLEA 3OPKA 1V3RA 2XBPA 3M05A 5D4PA 5D4LA 4OZLA 2NUUG 4YB5A 2XG8A 1V3SA 2GW8A 4RX6A 4CO4A 1NH8A 3AA8A 4R25A 4E98A 1V9OA 1VHFA 1Q1KA 4WK3A 4Y65A 2Z0GA 2O66A 4NYOA 4CO5A 1NZAA 4Y6IA 4IYQA 3HLUA 2ZFHA 2GNKA 3TA2A 1O5JA 4YB6A 1UL3A 3X3UA 2PIIA 1HWUA 3DFEA 2DCLA 3AA9A 4C3LA 2VD3A 4CNYA 5DS7A 3O5TB 4NYPA 4ZK7M 5D4OA 2J9DA 4C3MA 3CE8A 3TA1A 4AFFA 1VFJA 5D4NA 3LF0A 3MHYA 2EG2A 1OSCA 1P1LA 1UFLA 3BZQA 1GNKA 2V5HG 3GSDA 1NH7A 2XZWA 2NS1B 3NCQA 3T9ZA 1UMJA 4OZNA 1KR4A 5DRKA 4D3GA 2RD5C 1J2VA 4RWXA 3O8WA 1V6HA 4CO1A 2XULA
chains in the Genus database with same CATH superfamily
4ZVUB 4RZRA 1JLFA 3OTBA 5A8KB 2HQ3A 4LSZB 4KR0B 4KO0B 5HL7Q 4FYWB 4QZVB 2AX1A 3RR7A 4P74A 4PG6A 3GWCA 2JOQA 3H42A 1TKZB 3VGVA 3THVA 4QPTA 2HZCA 4J9KA 3D5MA 3Q8YA 1BQNB 2XMMA 3FRZA 3RAQA 2EWHA 1P27B 1OMSA 2AV5A 1G7CB 3CO9A 3MECB 4ID8A 4ED1A 4CLSA 5E3QA 1N33F 3FBFA 9ATCB 4QU6A 2IM2A 3QFHA 2MSSA 3EPGA 5A2QU 5E3CA 2HAIA 1DLOA 2RQCA 3IRXA 2W4PA 5EWFA 5JXSA 4EBCA 4U9RA 5CD4A 1S12A 3OXGA 2HGNA 4X62J 2CPEA 3CPWR 2O1PA 3UDCA 2CYYA 2ZBIA 1FRKA 2CQ4A 1RWPB 5ETTA 2F5GA 1U1MA 2H5JB 1CJKB 2D7SA 2GVZA 1UKUA 1HNVB 3R5JB 3D1OA 4DQIA 2FJDB 4RBTA 4UW2A 2PDAA 4C3KA 2JZ5A 3H5YA 1S6PB 2DNMA 2VBZA 2DPIA 1SQFA 1N4LA 1KNZA 1V3RA 3G86A 3ENQA 2IFXA 3AD9C 3C46A 2NYHA 3HHKA 2FB0A 2DVIA 3QO9A 5ETOA 3SYZA 3PRBA 3GJQB 3BM7A 1TUWA 1U0SA 1NBEB 4ZPAA 2I1RA 2WVDA 3CD5A 4X4PA 3RRGA 1KWMA 2RUSA 3M2VB 2CWKA 2KL8A 3PIPQ 4OLPA 1FRXA 4OJ3A 2Z56B 2GAGC 2MZRA 2F4FA 2OAUA 1UP1A 4LBPA 1NJYA 1LWFA 2AYGA 2Y3YA 5DDOC 3DDIA 2L08A 2ZBRA 5IV4A 1KBRA 3WZ0A 4DR1F 2CJKA 4Q8FA 3J7YU 2WONB 2YWHA 4K2XA 4ES2A 2GVDB 2LDYA 5IM0A 4DV2J 2RRAA 4OL8A 3BQ2A 1APSA 1O0PA 1K0TA 2ZKTA 4I69A 1RTHA 3A8KA 3FC9A 3RBZA 2WSFC 2V4QA 2HFVA 5BR8F 3IAS9 2AIRB 3VAGA 1SV5A 5HQ8A 3D67A 4IOCQ 1C4CA 4CLPA 2FLOA 2KXHA 3PEJA 3ETMA 1FT8A 4WU3A 2KG1A 2VKRA 4NZ7A 2ACMA 2D3OR 3VTIA 5LM7E 4LR9A 4F2RA 4XDCA 4JI8F 3KUGA 4F0MA 4KHPF 2RILA 3IC1A 3UCZP 5KFDA 4R5PB 2WBRA 3ENWA 5D4NA 2YX7A 4M5LA 4A8MP 1UJ5A 3TNVA 3I96A 3MM7B 3P96A 5KFOA 1MU2A 2W4DA 2CZVC 1W26A 2MLZA 5HK4A 2SXLA 1N0VC 3KLEB 3P6YC 2XYPB 3HDSA 3D9BA 5C2CA 2DHGA 4F04B 4ZIVA 4QIVA 4PG7A 1KVIA 1IKWB 5HLFB 1NSAA 4M94A 3N5BA 1X4DA 1RU2A 1AZSA 3IBCB 4RNOA 1M5OC 2LXUA 3KNAA 3D66A 3F56A 2B6AB 4PYAA 2QT7A 2KT2A 3H98A 2NPFA 3KK1B 4DS4A 1T7PA 3I0RA 1U1NA 1LW2B 2X7IA 3BBFA 3R27A 3ZZOA 1X0PA 8AT1B 1KSPA 1XQIA 3RBXA 3DRYA 2H65B 2XM3A 2WRMA 1N36J 1S10A 3BZQA 2N7CA 2V5HG 2DXEA 1B7FA 3BB5A 3TX8A 1Y9OA 4F4ZA 1NK4A 1B70B 4O4GA 2DNKA 1D9DA 2XNRA 3U27A 2HHQA 5KFPA 2D69A 1YJNS 2HG4A 3K57A 5F41A 3PRVA 1T05B 2JEFA 3ZZZA 2EEYA 4U8VA 4G65A 3QLHB 1TFYA 4USIA 2BQRA 3VHQA 2J0WA 2RIJA 5KG6A 1ITPA 4ENOA 4ERDA 2IDEA 2B9YA 3CJ0A 2HURA 2A3JA 2ZM6J 4DUTA 4DZ6A 1SIZA 3P5TL 2UUAJ 1PC4A 5CYQB 3N79A 2R8HA 2ASDA 3HVWA 2DY9A 4KB7A 1OY6A 4K4YA 4FN5A 2OPQB 1G4CA 2DRAA 1EZZB 4A8XA 1FDAA 4ANDA 4TN2A 4H4MB 3DU5A 1GEHA 3JYTA 2HW3A 2WK4A 4MYUA 1YGYA 1ZAXA 4PQUB 2EKNA 4DOZA 1SJFA 2NS1B 3NCQA 1CJUB 5A76A 4ZJOA 2ROGA 4B3RJ 3IWNC 2DGVA 1EP4B 2NQPA 3B82A 2RU3A 3NLCA 2D74B 4NLUA 3M8ZA 1K73T 1FKAF 2AJ1A 4G6VB 2BJ1A 4W4MA 2OLWA 2G2YA 1SC6A 4OJGA 4K4XA 4X65F 3LGHA 4IG3A 3J7ZT 4F8RA 4OZJA 1D0EA 2ATCB 4XPCA 4DSKA 3M6XA 1QVFR 1HNWF 1WWHA 1M5KC 4C11A 3CCMS 2ZH6A 1X8DA 4CYUA 1E6VB 3PX4A 1N88A 3G6YA 1VQSA 4KH0B 4URQU 4JI5J 3CJRA 2MGZB 5EN1A 4ZVGA 2HQDA 1WHYA 2GS8A 1UPPA 2BACA 1I94F 3T5JA 3GONA 4MFBB 4OQJA 7FD1A 2YWGA 3GV7B 4A8WA 4CLWA 1HYSB 3KJVA 1PC5A 4BCAA 2CPYA 2QLXA 5K8PA 4H54A 2LQ8A 4LFAF 2UZAA 4B9MA 4C0HA 2ZJPQ 1FNXH 4L6V3 1UTAA 1FRLA 2AEJA 3OR2A 1IR0A 1FNMA 1EB0A 2J7UA 4ZKAA 5LMUJ 1ZAWA 1Q7YT 4V1Ak 2GX8A 2FGOA 2HRUA 3N6MA 1U1OA 5HSPA 5HROB 3RW7A 4KRWA 1PILA 1FNOA 1RADB 4NRUA 4WZQA 5D0EA 3DOKA 4B3MJ 2ASJA 3ULHA 2LP4A 2PGCA 1C2PA 4RW7B 3NGUA 4NEZA 2HQGA 4ED5A 2YKMB 1KP6A 5A0YA 3LOUA 4NMXA 4KKOB 2CIMA 1PSDA 1D9FA 5HMXA 2ASYA 2N3LA 2XI2A 5KG2A 2VD3A 2HMIB 3HD2A 4R0EA 1T9XA 1Q8LA 4K50A 2ZWOA 2Z30B 3ENAA 1UFKA 5M2UA 4M95A 3W5XA 4C0OC 4NLGA 1WACA 2CPFA 2BRLA 1C1CA 2DH7A 2VFTA 4DG1B 2C3MA 3O1LA 1D9AA 1KR4A 5DDRC 1RKJA 4K2JA 3NNHA 3LP0A 1RAHB 2ADBA 2I2YA 1S9GB 2ZZTA 5IT9Y 1Q8KA 2OEJA 3CDEA 5LSRA 2XC9A 4X4SA 1OPZA 3I5BA 3TRGA 3L3CA 2PMZD 2HVZA 2OMOA 1BD6A 5KFWA 4C8NA 1T95A 3MPWA 1RXOB 3TEGA 2BQ3A 3BPSP 5JVHQ 1RWXB 3H5UA 5J2NA 2Y8YA 2QFJA 1IKVB 5D0HA 4N47A 3NGKA 4A46A 4JV2A 1CJTB 4ICLB 5EHHA 4V19X 1S6OA 2JHEA 2LDIA 1YZ7A 1NDKA 4RL1A 1XN9A 3OQ2A 2R7RA 3HVTB 2VA3A 4UF4A 1X9MA 4HR2A 1RT6A 2K3KA 2KB2A 1UVKA 2CPIA 3NS7B 2MZSA 5GMKa 2PEBA 2XI3A 4X62F 2MZTA 1J5OB 2UU9J 4LUBA 2K7KA 5LJ5Y 1HBOB 2QLWA 2C3PA 3SI8A 2DGUA 2C3OA 4K4TA 4J9VA 2ACYA 2H4WB 1H98A 4USJC 2D41A 1DJ0A 5F8HA 2OHDA 4P2MA 3FCVA 2KHDA 1U1PA 1Z4UA 3HJVA 1V3ZA 2JNJA 3W2WB 1S79A 1RAOA 2P9GA 5IXUA 5AT1B 2W9BB 1N56A 2MKHA 1KFSA 2VV5A 4A48A 4ANEA 4USWA 4A8FA 2HHSA 5JVGQ 1NSQA 2VG6B 3MF5A 3BS9A 1RP5A 1Q78A 2VF3A 4FNIA 1TUVA 3E01A 1FA0A 3OT9A 4NYOA 1JLCA 2W2MP 2C2KB 3MAHA 2VFRA 4WJBA 3RRKA 3TA2A 3PY8A 1Y11A 3PM9A 4HLBA 2AEMA 2HWTA 4RNNA 4C48A 3IM8A 1IBLF 2L48A 2BE2B 2KM8C 3N6NA 3CC7S 3ZFVA 5J2PB 1X9WA 2DTJA 2MLXA 1KHVA 3ENVA 1CG2A 1UA0A 4N56A 2FLLA 4OIXA 4QBUA 4C8YA 3RBEA 4DV2F 3MZIA 4KC5A 3UR3C 2HNYA 3DLEB 3LH2S 3G8TA 3JB9k 3PCOB 1EHWA 3DLHA 4USHA 2UUWA 4CO2A 3AD8C 4LBHA 5A8KA 4KAIA 4WIQA 1DAXA 2JLGA 3LA0A 4KO0A 3T19A 3NBPB 3ZTQA 4J9MA 2GZOA 1MWYA 1NDLA 2KJWA 1I51B 2MB0B 1TKZA 3PVXA 2MYFA 4WCEQ 2W2PP 3NG8A 1BQNA 2QEXS 3PW0A 1SIWB 1OQ3A 2Q6CA 1IUJA 3HPOA 1PJ7A 1VCTA 4ZCLA 2HGLA 1R6YA 1NM2A 4DV6F 4DV1J 2J7KA 2IVMA 3CDWA 2PFDA 3MECA 2X51A 2RHSB 1L3SA 2J5AA 4FXWA 2XEXA 2AJQA 3T41A 4DV7J 2BOPA 4WKRA 1YITS 3V6HA 1HNZJ 1QTNB 3TJ8A 3GIRA 4DX6A 2WZ1A 4R8UB 2H9ZA 2HS4A 1WF0A 4WPAA 3CD6S 2AGPA 3TZWA 2GCFA 5E0OA 2CFXA 1CJKA 3D6HB 3DRXA 1RWOB 2RQ4A 1HNVA 3M8PB 1WF2A 5KFKA 1KLNA 1FDNA 1VQPS 2HLTA 5E33A 1TKDA 1VOMA 2IRUA 4LR7A 1W2IA 5F0WA 3P8BB 2ZH1A 3RYLA 1S6PA 1WC4A 4ED6A 3NGRA 1NHKL 4UOGA 5KG1A 3HJFA 2IDLA 1Y5NB 3TAQA 4KH1B 1OJ4A 1NNDA 4Y2CA 1FJCA 5EGYA 1EKSA 2C3YA 3L95X 4YDDB 1S9EB 1N34F 2CQ2A 3M2VA 2KN4A 3GFYA 1QVGR 3H5XA 5DG9A 1B99A 4TVAB 2MMYA 3BN7A 1YJWS 1F6TA 4J5OA 2OEMA 3U02A 2Q66A 3MCNA 1GTHA 1DURA 3H5SA 3ETOA 2FHOB 4O3QA 5M2RA 1DQ8A 4PAAA 3UDLA 4DBQA 4K0KJ 1UEVA 2CZ9A 3J7A1 2WONA 5L9NA 2GVDA 3SIPB 3E2EA 4QIFA 5DGAA 1Y10A 3Q24A 4ZJQA 1RT7B 1S1VB 5KOXA 1WC6A 3HHEA 3T1YJ 4U67Q 3V4IB 2FTRA 1U1QA 2U1AA 5CYMB 5ADZA 2QE5A 3CC2S 3MCSA 2EFNA 2GW8A 4K59A 4EYHB 2Y0BB 3E8OA 4BC7A 1VHFA 3QFWA 2CA9A 1R6VA 2OMLA 4CDIA 1TL7B 5GAGI 4WWSA 2P2CB 2FZGB 4FBTA 4F0KA 1URRA 4I67A 2KJVA 4H4KC 2L41A 1H2VZ 3HSGA 4TU9A 1PJ6A 1UW9A 2ZBQA 1SC3B 4KY3A 1K9MT 3MEEB 3Q8RB 2B7CB 4JP8A 2P8IA 2C2DA 4R5PA 4AUKA 3IR7B 4ECYA 3W64A 2MEWA 3UN3A 3GSIA 3H4BA 3MM7A 4ZJLA 5KT4A 1FTRA 1YRUA 3C14B 1U6ZA 1UZDA 3KLEA 1U2FA 4F7VA 3T3FA 3TR5A 3R6LB 1GX5A 1IKWA 5HLFA 4P72A 4DCPB 2ZNZA 4DWIA 2BXJA 1RB0A 2ZBPA 1XR5A 5ETVA 2OPSB 2B6AA 4OZ5A 4LFBJ 1WI6A 4G1IA 3U1MA 4WXOA 1EQ0A 4ZP7A 4LVNP 3SSSA 2HIYA 2ZBCA 2EBGA 3GZ7A 5DS7A 3KK1A 1LW2A 3CXCR 4FYVB 2X3DA 1Q82T 1UAWA 1RKIA 3FZ2A 4HL9A 2OTLS 5HMWA 1GAOA 1SJQA 2HZVA 3LQVA 2HS3A 4UOCA 5G0RB 4DLEA 1EIYB 2BUNA 4OI2A 2JVRA 2DITA 4K4WA 4RW9B 1UWAA 2R8JA 4NZ0A 2AJ2A 1AROP 1T05A 3MR2A 1HQUB 3QLHA 4B3MF 4OYIA 5KFHA 1QLNA 2RVJA 3D0GE 5DDQC 4PXDA 1WF1A 3NGSA 1QAIA 1RGVA 2ZKUA 4RX6A 2NXNA 3W1YC 5ETNA 4P71A 3RG6A 1JIHA 3HXMA 4U8YA 2IRXA 3I5AA 3N5FA 4FBUA 4FF3A 5LT5A 3O5TB 5F3TA 2C2RA 5CYQA 4DR7F 1PJ5A 2K8GA 2M0GB 1T3NA 1VFJA 2UXCF 4U7CA 1HL6A 2OPQA 2W4CA 2YX1A 3QWUA 4H4MA 3KHRA 4DL5A 2H54B 3IN5A 4DV3F 2UUCJ 5F8NA 2KI2A 3R5BA 3QJPA 4K4SA 4ECQA 5B09A 4J7CA 1KN6A 4DX7A 4LRDA 4PQUA 4IOBA 4UQGA 3BSOA 3UDEA 3MEGB 2GHPA 1Y5IB 4Y00A 1VQMS 2N3OA 1EP4A 4YN3B 4K5RA 1HBNB 5HQLA 2MJUA 2KZMA 1FTCA 4F3OA 1NJIT 5B08A 1NK7A 4Y2AA 5DJBA 4I0WA 2XG8A 1S0NA 2MDAA 1NB2A 1X5TA 5EWGA 2NXEA 3R97A 4DL2A 1F9EB 2M9KA 3CMQA 3UE2A 1E6VA 1XR6A 2CVIA 2E7XA 4JI1J 5KFCA 2RT3A 2AYEA 1HQEB 4CLZA 2EBEA 4WFXA 3UCUP 2MGZA 2YWEA 3GPAA 2OI2A 3L7OA 5LJ3Y 2HS0A 5HANA 1SKUB 2UU9F 1QTMA 1RYSA 2XZWA 2EK6A 4YQWA 2W01A 4O3SA 1NXIA 4NLRA 4MFBA 1XMOJ 3UR0A 1HYSA 2QV6A 4P73A 2DNPA 3LAKA 1RUSA 4X64F 2W25A 1P8GA 3L09A 2ZH4A 1NO8A 2W1BA 4ZITA 2Y0SD 4DX5A 4OYBA 3HFVA 2LCWA 4LR8A 3MI7X 2IAJB 5L1KA 3CULA 3A12A 3F44A 4EGLA 4OYZA 3EDRB 1HPZB 3FMBA 1DRZA 2LQBA 5KFEA 5HROA 5DQIA 1IJFB 4U96A 2VUGA 4LF7J 4ZVTB 1BUXA 1XMQF 4GVLA 4MAKA 3MMCB 2BJ9A 5E7OB 2UP1A 1U0HB 3AQPA 2VBWA 4RW7A 4X66J 4I6AA 4I6YA 2BR0A 1D09B 1S0VA 1LOUA 1X4HA 3LTOA 3DGPB 4NA3A 4J9PA 2YKMA 2QMWA 1M0SA 4KKOA 1VQKS 4NOHA 4ZLPA 1ZZNA 1UFLA 2I6WA 2HMIA 3IXQA 5J1NA 1HQ2A 2Q43A 3MUVP 2LEPA 1SL0A 4ECXA 2VFVA 5C7PA 3TANA 1I5OB 1IKYA 5DG7A 4DG1A 2QYCA 1FFSB 2R9LA 1S9GA 3JSMB 5KFAA 3BGFA 4BBYA 2QL5B 4EBDA 1FRHA 1AUSL 3GV8B 1TKTB 5EDWA 1WOPA 4DEZA 4AL7A 4ZP8A 4OHZA 4OI1A 1IJEB 2VASA 4X4QA 5C25B 1GMUA 1RWUA 2KXNB 1YSJA 4O44B 4ZVHA 1IKVA 4B9VA 5FIIA 2V67A 2DNQA 3K5LA 1GXUA 4C3LA 1S72S 4RUAA 4M5GA 4DV1F 1CJTA 4ICLA 3MXHP 1YBTA 3ZNJ1 2FD2A 1Q16B 1LEOA 1TV6B 4DV4J 1R0BG 4ZP6A 4GKKF 3PYEA 2BMBA 3HVTA 4FXDA 4M1KA 4DV7F 4JUZA 2CQCA 1GNKA 2YWWA 4EO6A 3DC2A 3ZZTA 1F9FA 4LF8F 2DR8A 5HO4A 3IO1A 1J2VA 4WE1B 5DETA 1J5OA 2CPXA 2F3JA 1HBOA 4ZPWR 3D3BJ 3DRRB 2DHXA 1NJZA 2QSFA 1YJ7A 3G87A 1FE4A 2E1PA 2DNGA 4JI0J 3J81j 4J9UE 1M1HA 1FDDA 1ZPVA 2J9EA 4PR6A 1TAQA 1RAJA 3C15A 2UXDJ 4OV6A 3W2WA 4MIWA 2V4JB 1DQAA 2W9BA 2QX0A 4CO4A 1HIYA 1HWKA 4E98A 1SI9A 5A8RB 1FXLA 1NZAA 1WJ9A 2LECA 3MMJA 1WKLA 2VG5B 3J80U 2VG6A 2FY8A 3A13A 3BBBA 4OI3A 2HFUA 4EU0A 4PWUA 2F65A 3N6LA 1DFDA 2BOAA 2VPWB 4AFFA 4RBVA 3K8WA 3W62A 2GO8A 3TUIC 2BE2A 1X60A 4QWDA 1V5VA 2BZ2A 4EFAC 1YWXA 5J2PA 2VDHA 2YKNA 2MZJA 4IG0B 3P4UB 4ZOSA 3JS9A 3MR5A 1RHUB 2DT9A 3UD3P 4K0KF 4K4ZA 2RU9A 3SBMA 1SC1B 4O0IA 4ZVRB 1HI0P 4USVA 2YPZA 2PC6A 4HKQA 3WC2A 2JEIA 2OFGX 2DY1A 3DLEA 3W5YA 4X4RA 4M5HA 4HH1A 4FYYB 3QAEA 2J6SA 2IBOA 2MKCA 2G1HA 3NKYA 1S1WB 3W60A 3CJSA 3OL9A 3C6UB 3T9NA 2BQUA 1LV5A 1ZA1B 3W63A 1FD2A 3NBPA 2DH9A 2A10A 4NEYA 1JJCB 4N7TA 2BJEA 4WYLA 4RU9A 1VQ9S 4JYAJ 2VU5A 5GAHI 3PIOQ 3EWGA 3HHDA 1XNQF 2CQ0A 4KGKA 9RUBA 1TL1B 4A47A 2HHHJ 1LWCB 1SB6A 1YK9A 2PN6A 2H5IB 4DR2F 3GFZA 4OZ0A 3HKWA 2W2NP 5L1JA 1VIOA 1UPMB 1U6FA 1KVJA 2A2CA 4LF1A 3HHNB 2X1GA 2D3UA 4B3SJ 4Q44A 4LF4J 2ZH3A 2OH2A 2JJ4D 1PG5B 2WVBA 5CZVA 4C97A 3HFZB 5C24B 2HGMA 1T11A 3UW1A 3MEKA 5A6PA 2XHWA 3KJQB 4R8UA 4YUDA 3D4JA 3I32A 2RKIA 3VCDA 1SXLA 3R7BB 5HI7A 2KDOA 3OPKA 3H2LA 2RNEA 2RE1A 4DU8A 3M8PA 4PEOA 3NXZA 2BW7A 5FDLB 1NH8A 1BC6A 1BQMB 3CMES 5F8GA 3R6GB 4DZDA 3K5OA 2I38A 5CXTA 4ZK7M 1Q8IA 2PI5A 1ZZFA 1NK9A 4HACB 4LIRA 4RUHA 1W25A 2VA2A 1FRJA 2KKHA 4FDFA 3TJAA 3VALA 3UNYA 1GK8A 1NKCA 4CH7A 1S9EA 4XO0A 4GMKA 3A8EA 3OTDA 4ILMA 3T6JA 2ZVSA 1VQ7S 2GMHA 1BQXA 3J7AN 3NWGA 2NREA 4DL0C 2OD6A 3FUYA 2DHSA 1JMTA 2P6SA 2ZOMA 2EC0A 2E7VA 1BWVA 4DSLA 4BWJA 3VV2B 1YBAA 4J9NA 3Q83A 1VLYA 2G0IA 4QJVA 1RT7A 1S1VA 5I42B 2J0SD 3V4IA 5CYMA 2V69A 3PYDA 4RR5A 2QJ3A 3X3UA 4HT5A 4Y2KA 3AA9A 2FVPA 4MKBA 2WSCC 1RBOB 1TL7A 2V9KA 3EE3A 4OYWA 1JB0C 4G1PA 1YJRA 2R42A 5KFXA 1S57A 1WC1A 3QT5A 5D0GA 5M2PA 2ZEJA 4HDHA 3TAMB 1YRXA 4RPFA 3NWRA 5AE1A 3MEEA 2HVEA 2W24A 4ZN1A 5C42B 5CCMA 4ZVOB 5ETLA 4ATNA 1HWLA 2WVFA 1WKJA 3D6TB 5DLGA 1GFWB 5KFMA 2V0NA 4LRFA 2OFHX 4NLYA 3C14A 3IBWA 1PYSB 2HIQA 5ETRA 4NLOA 2RRNA 3H2VE 1NJWA 3KLHB 1HNIB 1CJVB 1VC5A 3W65A 3HSDA 3D0HE 2ZNYA 2XQCA 2V8VA 2UVWA 1WEYA 3FQLA 4IYQA 2LU1A 4QW8A 3OL7A 1Q5VA 1VRUB 1R7IA 2QTWA 5ETPA 2OPSA 2VPXB 4I4BA 5HVHA 1RAFB 1X4GA 3OLAA 2MKJA 1FESA 3W9HA 5KAKA 1FWKA 2VIHA 2N4CA 5EX3A 3W8PA 4WP3A 3WX4A 1SBRA 3CJ8A 2K7JA 3FEXB 4J37A 3WC0A 5MLCV 3LP2B 3KTQA 4L74A 2HQIA 1C0UB 2BANB 1IBMJ 1BLUA 2JC0A 5KOWA 4RUBA 4KSEB 3OSPA 2XZTB 2NLWA 2E7WA 4NASA 1AT1B 3GCXP 2HWIA 5KFYA 3VZIA 5G0RA 2ZH2A 4MT1A 2DHHA 1MROB 4O3OA 2FUG9 3FJ2A 2JL9A 2DGXA 1RBAA 5KFSA 4RW9A 3IG1B 3HHLB 3R7SB 2NUUG 4QW9A 1S1TB 3WQPA 1A6LA 2MQ8A 5JJBA 4DR6F 5J2MB 1HQUA 1QAJA 4JI8J 4NCBA 2IY5B 4KHPJ 5KT5A 2VBYA 1MN9A 2VONA 1XEZA 2FHKA 4TLQA 3FRYA 5F8JA 1R3NA 5KG4A 5ETKA 3PZPA 3DRPB 1BWEA 2KTQA 1HARA 4F02A 4NLQA 2ZVIA 1W7WA 1ROFA 1Q0NA 5K5MA 2DXDA 1FDBA 3IP0A 4OX8A 3IRWP 4DMZA 2YNIB 4Z7CA 1T9UA 1TU0B 5BYQA 5LXRA 3HSJA 2WOMB 5EWEA 1UVNA 1IR1A 2E44A 4CO0A 4ER8A 2K3IA 1OO0B 2R2RA 3TQEA 3MEGA 4TU8A 2YKPA 1N5TA 2BBEA 2A1BA 3AXKA 3SCKE 2FY1A 1HBNA 3US5A 3MFHA 1T9YA 2DH8A 4NXNJ 3P3DA 5B0AA 1NHUA 3EYZA 1BMQB 5IOLA 2AQ4A 4X4VA 4FS1A 3B54A 1T9VA 3CJ3A 1TAUA 2ZD1B 4ECTA 3V6DB 2RMLA 3DXSX 1P1TA 2IJNA 3KK2B 1IBKJ 4I6WA 4FKYA 4MIBA 5KG0A 5K14B 2BRKA 4OZNA 1HQEA 4ZCIA 3TW0A 2XSJB 2Y1LB 5F0UA 4QYZJ 4RWXA 1NUEA 1XJWB 2ROEA 1IN0A 2ZOGA 2YXLA 2FJBB 2HHTA 3UFCX 4TQRA 2OKQA 2KH9A 3S1TA 2R3VA 3EVMA 4DQQA 4JI0F 3M9MB 4CT8A 3FCWA 3LO3A 2XMUA 3GIMA 2Z2YB 4F4XA 2DYAA 2B43A 1URNA 2ZWPA 4I2PB 4X4TA 1BGXT 2AD9A 4GO7X 2IAJA 2L9DA 2QA2A 5CH7B 2YQ1A 1F60B 2XY5A 4AL6A 3TVKA 3OL8A 2VQEJ 1HPZA 3F0NA 2X1BA 2GFFA 2CJXB 3QSIA 3ILIA 4QCLA 2GJ2A 4CP5A 1U0HA 5IC4B 4K4VA 1T02A 4JI4J 3CWJA 3GYXB 3DGPA 2EG2A 4LRCA 2YKQA 4Q8EA 4C9DA 4PQAA 2COLA 3KWMA 1KQGB 3FEYB 1CBKA 2QIFA 3U1NA 1KRPA 1F2HA 3GU0A 4ZPBA 1X5PA 1TK8A 4UZCA 3M9NB 2A18A 3L7UA 3T5LA 2G2OA 3GFXA 3NS5A 3J80Y 3KLIB 4CNZA 3EDQB 2B56A 1RJJA 4USTA 3IBFB 4AD6A 2CQPA 5KFGA 3JSMA 4P7TA 1ZTWA 4DF8A 3EGVA 3A3OB 2ADCA 4JI2J 4P10A 1S4FA 4J9OA 1PGZA 3G6XA 3CUNA 1TKTA 2NXCA 1H7WA 2K1RB 3HZGA 5EX0A 4YR3A 3DHWC 4Q2LA 1ZA2B 5C25A 4NRTA 4DFMA 3R7NB 4O44A 2HHHF 1MNEA 2VJUA 3PW4A 3VVUA 1UVIA 4M5IA 1KEKA 1VI7A 1TV6A 1R31A 3KYLA 3GE9A 3MM9B 4EI2A 3PJWA 2VH7A 1RHJB 1QY7A 2Q1LA 4N8OA 3UQSA 2N7YA 2HVHA 4WE1A 1LFPA 2V2VA 1WTFA 4Y2IA 3U1LA 2UUBF 1LXJA 2HVIA 3DRRA 2C2EA 3C8YA 3DRSB 3CCLS 2QMUB 4PWWA 1RTIB 4KV8A 5IC6B 3R8YA 1K0VA 2YNHB 2C22A 3SCLE 3AQOA 1O8BA 4USMA 3VVTA 3QIDA 2V4JA 1A0OB 2CJQA 4L75A 2EXUA 3UNGC 4WP9A 3H8YA 2HYIB 5D4OA 1N5QA 5A8RA 3KOAA 1HI8A 4DV5F 3N4WA 2VG5A 1FD8A 3AY0A 5KT3A 1L3VA 4I64A 3BR9A 2I8EA 4CLKA 2AJ0A 2D3O1 1FJGJ 3AJDA 2L9NA 5I3PA 3WIVA 2WW8A 4LREA 2CPZA 2GV1A 1BY9A 1H72C 2FIUA 3D7SB 4F4AA 2IVYA 4IG0A 1D3WA 1RBLA 4BC9A 3D6MB 3IR6B 1B4SA 4C8LA 2V2QA 3OSNA 1NK8A 2CVEA 3FNNA 3M9OB 1OIAA 2QRRA 3RBDA 4FPRA 1RABB 5HVFA 1TMJA 5BYSA 5D4LA 4KT0C 4CLUA 3OHBA 3OUYA 1QE1B 5CA5A 5BJRA 3KLFB 2OJ3A 1FVQA 3CJKB 4WIIA 3IGNA 3IFEA 4ZMMA 3I55S 4Z2XA 1S1WA 4RJVA 4J90A 3C6UA 2AW0A 3NAHA 2UVVA 3EXCX 2UXBF 4E2FB 3I4PA 2M88A 1KTQA 4F3MA 1RHKB 3O3LA 4M5MA 3H0PA 3MPDA 4ED8A 3GJSB 3MD1A 1S77D 3W5ZA 3QJLA 1TL1A 2QMXA 1LWCA 2QA4G 2HNZB 1OY8A 2XWYA 2HKEA 1JX4A 3P5BP 1VIXA 3QRPA 2E9TA 4CLYA 3KJFB 2R7SA 1UJ4A 2KT3A 3CDAA 4ZVPB 2VPZB 1CPZA 2KG0A 1HBUB 1X4AA 1SQEA 3A8IA 3M2RB 4ELUA 5C24A 5E3RA 5HATA 3SCIE 2EVZA 3HF5A 5LMNJ 2GJFA 2X3GA 4O4RA 2RDDA 3CCJS 1IBLJ 2E5LF 3CF5Q 3QATA 3FZBA 3GIKA 1U4BA 1FI4A 1SJ1A 3HSZA 5FDLA 2JRSA 4Z7YA 3K5MA 4OYAA 3S7RA 1BQMA 3GG1A 3M1VB 1VQ4S 3QIPB 5B7WA 1Q4RA 3QYYA 3CCSS 2W9AA 4ZLJA 2I5JB 1YTYA 2BVZA 2Z57B 4HACA 4DQSA 1RWNB 4IRCA 4AT1B 3K5NA 4ECWA 1IBMF 1XNRF 4F4YA 3FCHA 3AHPA 4LF9J 2E1CA 1WC0A 5D6GA 2GA7A 1HMVB 4RW4B 2F8EX 3GTYX 4ECVA 1VISA 4C4WA 1H6KX 2JEJA 3JQJA 3M30B 1R0CB 4XK8C 3QZ7A 4B17A 3VR1A 1UZHA 1VRTB 2CJBA 3IM9A 3OVBA 3T1HJ 1U1RA 4NLVA 2FVSA 1KQFB 5E41A 2PMHA 3QO9B 1M5HA 4DV6J 4DSJA 1DHMA 4YMEA 1FCAA 4JOUA 3NOCA 3D3CJ 2B5JB 1YRTA 4Y2MA 5I42A 1D8ZA 1S48A 4QU7A 1U2CA 1Y0HA 1TTHB 4GKJJ 3K59A 4IQMA 3RAMA 3ZZPA 1X4CA 2E1RA 1Y5LB 1EETB 4OYXA 2VZ9A 1Y7PA 4P2SA 4TQSA 2OIHA 1A7GE 5DDPC 3TAMA 1R8PA 3PACA 4CQ1A 4YDXA 5C42A 2BM1A 3K17A 1WG5A 3MCMA 3T5KA 4F50A 1YJVA 4E0DA 2XO7A 1VQ8S 3QT8A 2JX2A 4NXNF 2F9JA 1PO6A 1R43A 3TYTA 2Z0GA 4DSEA 2ZE2B 1N34J 3HULA 2JFDA 3KLHA 7FDRA 1HNIA 1CJVA 1ZH5A 1K1QA 2PMWA 1FE0A 4MIAA 1IBKF 5IFMA 4EUVA 5KFLA 1AFIA 4F25A 2H48B 3EVOA 4KBIA 1VRUA 2HBYB 3HX9A 4F3QA 2GIQA 4UY8T 2CG4A 1X7VA 4BHQA 3MOZA 3KG1A 3KLGB 3EZOA 2OTJS 1KS2A 2HHWA 4LQ9A 2DKOB 2AGOA 3QGIA 4FVMA 3LP2A 3HO1A 1MLAA 2KFNA 1YVFA 1C0UA 4WK1A 2BANA 2KXFA 1H3DA 4O3RA 3NNAA 4IRDA 4CO3A 3DXBA 3OTEA 3Q8PB 2C2ZB 1VBYA 2DISA 1JXVA 4DPXA 1NJXA 2UVRA 3EUNA 4DUYJ 5B0FA 2MHNA 1MROA 5GAHU 3EPIA 2M52A 2HBQB 3J7Z5 2VQEF 3NAIA 2FC9A 3N0VA 4UZBA 3L4BC 3IG1A 3HHLA 3CW2C 2B4PA 5T41A 4IO1A 2HBZB 1S1TA 3H4DA 4EZ6A 5J2MA 2R7OA 3KKFA 4O23A 2EKYA 4ZHRB 4JI4F 4QOTA 3NGTA 3RB6A 1RCOB 1K8AT 2ZH9A 3GR0A 4CRJA 1WELA 2QLBB 4P9SA 1TELA 4RBUA 1U09A 1F1BB 2F63A 4DPYA 1SKWA 4HEA9 1N32F 3DRPA 1HWJA 3CJQA 2KRBA 2HHPA 4WU2A 5JMNA 1GXLA 2R7TA 4I1TA 2MHEA 3BGUA 3BREA 3L7PA 1O51A 2YNIA 1KDNA 2AF6A 2CNLB 4LQ3A 2AYMA 2P6TA 3CIZA 2WOMA 3GR1A 3KMQA 4B08A 4CLTA 1VJWA 2FQQB 4WFYA 1TP7A 4WFAQ 2POKA 2G0CA 3KNGA 4HI2A 4JI2F 1FFWB 4MH8A 3V6JA 3HMJG 1REGX 5IQQA 4NCAA 2APOA 3EMTA 3HLUA 2LKZA 1ACMB 1VYAA 4DQPA 1M5PC 1IKXB 5KG5A 4FVCA 3ZO7A 4WFBQ 1FRIA 2DO4A 1NDCA 3CDUA 2ZD1A 1RLCL 2OD4A 3M6VA 4IDKB 3V6DA 2R8IA 3JTOA 1M5VC 3KK2A 3LWLA 2W2OP 3SZ2A 1T03A 1GMVA 4YEAA 5I4MA 5CQGA 5K14A 2C2NA 2EPIA 2BKPA 2ZH7A 3UPFA 3NCRA 4OMFG 4BS2A 2AKWB 3QGGA 4BDPA 3JQKA 2XSJA 4FF2A 3BSCA 3JXOA 1SCJB 2B8QA 4CWBA 1Z2LA 5KFBA 1UA1A 4O3PA 5KFZA 1RT5B 4WBFA 5C2GA 4URGA 3FSYA 3H2UB 3PYFA 4ZS6A 2HK2A 5D8HB 5D3GB 1KKHA 2GAHC 2MZ1A 1TVRB 5KFNA 2KRRA 4TU7A 1WHVA 4C8KA 1YX2A 4WTOB 4DR7J 4FF1A 1AW0A 1Y3KA 2P9CA 4I2PA 2UXCJ 2ZFHA 4TY9A 1SQGA 2J8SA 3CIMA 1T0TV 4JI7F 3R5DA 5SUHA 2DGQA 1HD1A 3P45B 3PYGA 4IO9Q 4DV3J 2LU2A 2PI4A 4JI3F 3MM6B 5K8MA 5HMZA 1KQSR 2DR6A 3HP6A 4NCGB 2YWFA 4CH0S 3F73A 3Q8QB 4DPWA 1FJGF 1J5EF 1RWKB 5IQ6A 1GMWD 2MY7A 1WD6A 1DARA 2WB1D 3ELHA 2NZCA 2PD1A 3TO8A 1SVDA 3BYRA 4WF9Q 5BXIA 1JLAB 3AOCA 1MMLA 1DQ9A 2NZ4A 2G13A 4FYDA 1YIJS 3KLIA 2KM8B 3C16B 5L1LA 2XS2A 3MR3A 1HBMB 1Q1KA 4CT9A 2H3EB 3A4TA 4TYBA 3W2VB 2M3DA 5CZXA 4OX7A 1S1XB 5F8IA 4X84A 2DR9A 2R4FA 2OUGA 2R7XA 2K1RA 2DD8S 3KJNB 2FHJA 3UO0A 4X64J 4NLDA 1RHRB 4RU2A 1RE1B 3BH6B 4QR1A 2M8HA 4ED4A 2MXYA 1WUUA 3FQKA 4NLPA 1CULB 2RD5C 3FBBA 3X1LB 2V2ZA 2WCXA 1QJHA 4Q0BB 1S9FA 2J0QD 2E1MC 1RCXB 4IH5A 2ERRA 3OVAA 3DMJB 3K7RA 3MM9A 2C2MB 4A4JA 3TWZA 1XMQJ 3BEGB 1PCAA 3ISND 4NI2B 4Y0FA 5LMNF 4M8LA 3WIUA 1JKHB 3DRSA 4OX6A 2CADA 5K20B 2HNDB 3BKTA 3AAWB 1YI2S 1RTIA 2O66A 4B02A 2YNHA 3UWTA 1E6YB 1TQLA 4FP9A 3EGZA 3OJUA 4LF5F 1UVJA 1YDLA 3EICA 1FKOB 4ZCKA 3MR6A 3R1LA 1RTDB 3SSRA 5DO2A 2Y1IA 4KE5A 2QSWA 1NH7A 4GO5X 3CCZA 3EZ5A 1JLGB 2V8DA 5DQHA 2CPJA 4RW6B 4LSLB 4LF9F 3KG0A 2E1AA 1GX6A 1VBZA 4L3KA 5KFRA 3KHGA 4I7FB 1B64A 2O01C 1EARA 1YJTA 1NAQA 1X4EA 2ZH5A 1MWQA 2IRYA 2F4VF 1PIEA 3TJ9A 5KFTA 4ANCA 5L39A 1OSDA 4PG5A 3T1HF 2ALZA 2IM0A 4V19J 3BSAA 2R2TA 3QBCA 4TXSA 3I87A 3IR5B 3I56S 2YNFB 2RRBA 4GKKJ 1X9SA 5KFJA 1QE1A 4IRKA 3KLFA 4NPOA 1JLCB 2RB7A 2UV8G 3CCRS 1LWEB 4CNYA 3CJKA 2D9OA 2PA3A 2VBXA 4LF8J 1H74A 1GMWA 1WI8A 2ALYB 1RISA 2ZC4A 4GKJF 2DEJA 3RZAA 2C1EB 1R8BA 4EYIB 3R2DJ 2HEKA 1HW8A 4IR1A 1S4EA 1S59A 4OHWA 3CJ4A 3D2WA 2ROPA 4D3GA 2C28A 2UVUA 3K2YA 2V6AA 4OX9F 2HQFA 5J2QB 1RWMB 2HNZA 4LF6F 3RTVA 1RAAB 4DHVA 1SJRA 4J91A 1WC3A 4OZ3A 3K8VA 2XMTA 3CT9A 3KK3B 3HM9A 4ZIWA 4DSIA 2YWKA 5ETMA 3UN5A 3QNWB 2H51B 3GYGA 1HBUA 3H20A 2WHOA 3DCAA 3I9V9 3M2RA 4NZ6A 3GV5B 4UUXA 1NK5A 4ZA1A 4Q43A 4C8ZA 1U48A 4QR2A 4I56A 5LXYA 3EGWB 4XPEA 3MPUB 4OZ2A 1FF2A 1NMEB 4MTPA 2RQKA 3SQOP 1P9YA 2EI5A 2NSBA 2JC1A 1F5CA 4NA2A 1SC4B 5L46A 3LF0A 4K7QA 4J9SA 1YLXA 3ONQA 3M1VA 3QIPA 2IYGA 1REVB 4DDFA 2XMAA 1QD1A 1FWLA 3M7VA 1TK5A 5T7LB 4OJHA 2I5JA 3UVJB 4KGXB 3NOGA 3Q2TC 1S6QB 1U1KA 4XDDA 3ZTOA 2DCUB 4UT4A 3AXMA 2KVIA 4FF4A 3QQCD 1HMVA 4RW4A 1U25A 2LQJA 3THPA 1HLWA 2FHMA 3BV8A 4DF4A 4DUYF 3OJSA 1RT3B 3GMGA 2RS2A 2CQGA 3M30A 3C2PA 6FD1A 3JSRA 4HI1A 2J7WA 1VRTA 1XNQJ 1C4AA 4URSA 1VQOS 4QR0A 4DR2J 4A8QA 3MEDB 3K0JA 2JLFA 2M5YA 4DPTA 2AMCB 3ISZA 2DPJA 4AXJA 1T9WA 1OSCA 2B5JA 1KVKA 5A8WB 1JXLA 1ELOA 3GSDA 3JAMU 1MMDA 2BKNA 4ZCMA 2AJ4A 3POTB 1WSRA 1IQTA 4A8YA 5T14A 5FD1A 1Y00A 5HMYA 3CTRA 5GADI 3KFWX 3OR1B 3VAFA 3ITHB 5F8LA 1U26A 1B7YB 1X4BA 1EETA 1EX8A 3AH6A 3BN4A 2JLEA 4WZMA 4DLGA 1AA1B 3PKYA 5IZHA 2BKOA 4B9NA 3VWSA 4YY3F 3ZZRA 3G96A 1Q95G 3KG4A 4NXMF 1JJ4A 3MUTP 4J9LA 1JWWA 2O3DA 3E3XA 1V9OA 1AYEA 2QGFB 4HTJA 3CDBA 3OFFA 2Q6BA 2WVEA 8RUCA 5H9EJ 1Q8BA 3HZEA 3GILA 1K47A 2ZE2A 1X5SA 2VJVA 4DX8H 3AOBA 1H38A 1HR0F 4TNOA 1IM4A 3BYPA 4C98A 2NPIA 1FJEB 4N41A 2KZZA 1SH2A 3QZ8A 1BXNA 2OELA 4LBIA 4NE9C 4ECRA 1H7XA 3DLKB 3KMSA 4FKXA 1SKRA 3DLLQ 5KTQA 1XBWA 1VMBA 3KLGA 4TY8B 2R7VA 5L38A 2K06A 5GMEA 3NCPA 2HQCA 1H2UX 3SV3A 1RTJB 1HFEL 2KYZA 3QT6A 4A8OA 3TP2A 1YZ6A 1NEEA 3R5CA 2QA1A 4F26A 3S8SA 1T9TA 4DL3A 2VC0A 3ISNC 4A8SA 2AWZA 4XTTA 4RKUC 1FEEA 2MZQA 2EFPA 3FMWA 2GQCA 2ZUAA 2OSRA 2Z58B 1SUQB 4DPUA 2KU7A 2G4BA 2CUYA 4DR4J 3PW7A 4ED3A 4IUFA 3DLGB 4YR2A 3SMZA 4IFVB 4CCHA 1CJUA 2IJFA 2M7SA 4ZHRA 1NPPA 2V8PA 4ZVSB 1NHVA 4OHVA 1U8SA 4J9RA 5DGBA 1FEHA 5FLXU 1B0PA 1K44A 4NX9A 4C0BA 4CLLA 2LA6A 1G1XA 2HRYA 2U2FA 1PKUA 3VQTA 4DV0J 4DPOA 1ZETA 3KUEA 3TOQA 3TA0A 3ET6B 2XHCA 1G2EA 2LEBA 2E66A 2HFNA 1L3UA 1WG1A 1JLEB 4QIEA 2HLUA 1BHNA 2VG7B 1JLQB 4PWDB 4KQZA 3PHEA 3C6TB 3MFIA 3DLJA 5DQGA 4DR5F 1KQKA 2DNNA 1FWPA 5DM7Q 4NA1A 3M4XA 2WB4A 4YFUA 2MKIA 2RDIA 2A6OA 4UUWA 2C2OB 4F2SA 2YTCA 3V6KA 2OPRB 3BO4A 2CG8A 1ICEB 2I9SA 2HRTA 2MKYA 1OYEA 1IKXA 1IXKA 1HHTP 2FJXA 4USKA 2QL9B 3T9ZA 3KDNA 4G1QB 3OTOF 3BKFA 4IDKA 2VODA 1V6HA 2PT0A 4AQYF 2AT1B 1YG0A 2RF2B 4M5KA 4U6PA 1LW0B 3R5AA 2CNNB 2XTJP 4LF2A 3I0SB 3LANA 4DR6J 3Q8VA 4LVOP 2F9DA 2QN6B 2X1FA 1S76D 3BO2A 1WEZA 4HTIA 2E9ZA 3MURP 3HVAA 3GCWP 3VAMA 2DNRA 4LT6A 1WC5A 3KXDA 1RT5A 2QLJB 2A6MA 3AODA 2AZ3A 5D3GA 4FPIA 3FFIB 5BYRA 3PKMA 1TVRA 4NLXA 2H4YB 2IPOB 4WTYA 3C66A 3PFOA 3PR4A 1XMBA 2VHGA 1NU4A 4Y34A 2WBMA 1MN7A 3N28A 2GO9A 1DY3A 5KFQA 5EUHA 2FZCB 2P9EA 3HCXA 3AFGA 3MDFA 4ES1A 3MM6A 3GFHA 1RT1B 4W92B 4I2QB 4NCGA 4UTGA 4QQBA 1NKBA 4PUOB 2MQOA 3H90A 1WG4A 1XTZA 1SH0A 5AXMA 2VC1A 1LWXA 4P6QA 1YJ9S 1N5YB 1U7LA 4C6AA 1Q5YA 2QZ8A 1NZ8A 1U2RA 5B0GA 6FDRA 4KPCA 1QAYA 1JLAA 2YX4A 2XY6A 5HAOA 1PBAA 3TZXA 4DL6A 4NYZA 5ITHA 1IQZA 1L3TA 4DR3F 3TEHB 2B3TB 2PIIA 2VKZG 3AB4B 1AXQA 3C16A 3FDSA 2ZDPA 1HBMA 3DDNA 2G0JA 3W2VA 5K8OA 3BDPA 2A2DA 4K4UA 2AP6A 1OWXA 1VR6A 1S1XA 2XWXA 3M8RA 4BLGA 1QSLA 3CB4A 2DGTA 2MQLA 3I9ZA 3VGSA 5HBMB 4QIGA 1IKYB 3TARA 2DHAA 4Y3CA 2O67A 1CULA 3ZTPA 4K8RA 1N54B 4H4OB 4ZLLA 1UVMA 1UEKA 2R2SA 2CJAA 4Q0BA 4ES3A 2VL1A 1JNZB 5E2QA 2EFVA 5F8MA 1RDRA 3DMJA 1BE4A 3A3PB 3OXLA 2X1AA 4NI2A 4R25A 1R89A 2NXUA 2DO0A 3B4MA 3PEHA 2D3ZA 2G9OA 1RAIB 1UL3A 1JKHA 3MM5B 2CQ3A 2HNDA 3GG0A 1C0TB 3SEOA 5HP1B 3QGHA 5AJ3J 4ZP9A 4Q2MA 3I5CA 1E6YA 4NLSA 2DR5A 4J9QA 1KLMB 3EX7B 1FKOA 3M8SA 3MTKA 1RTDA 3HFKA 4KYZA 1RQ0A 2XMKA 2IMWP 3MAAB 3WHIA 2DRDA 3VF0B 1JLGA 4LRAA 1R8AA 3V2UC 4RW6A 4LSLA 2R2UA 1NK6A 1UFWA 5K9FA 2QLFB 1I6JA 4ZLNA 4I7FA 2NUHA 4RLEA 3LP1B 3KUHA 1OQ6A 4YB5A 1HKAA 2CQHA 1QUPA 3C15B 4N77A 1N6QB 3CCTA 5GVQA 3JTNA 4OYPA 3VAIA 1LK7A 3H7HB 2CJ9A 4HDGA 2M70A 5A2QY 1ZYQA 1NPKA 3K5PA 2HHVA 2NYIA 3M6UA 2Y9HA 1F3FA 3GYNA 3QRRA 3W3SA 1TMMA 1UVLA 4JI6J 2YNFA 2NR0A 4B3OB 1FXRA 5KFFA 2CQ1A 4LJMA 1LWEA 2EFGA 1VC0A 3BKUA 3RGIA 4FYXB 2Q79A 3GQCA 2IC3B 3FBCA 3I82A 3VQSA 2HBRB 2Y1RI 2UUBJ 3ZZUA 4CI0B 2YQ0A 4PXBA 2YKNB 4F36A 4P2XA 1VQYA 2M2BA 2R8KA 3H40A 3OBIA 3CEDA 2QG9B 2CQDA 3SQGB 1DBDA 1MW7A 1R8HA 1RT4B 4U7UD 3IWXA 4DCOB 3DOMB 3CNQP 3BGRB 5J2QA 1H0HB 2GJIA 1FK9B 1JNRB 3HK2A 3VZHA 3S6EA 5I3QA 1U02A 1VQ6S 1GH8A 1V3SA 3RW6A 4DFJA 3KK3A 3BDEA 2LMIA 1QAXA 5GAEU 3JAMY 4KGMA 4DV5J 4JV5J 1RHMB 5J1EB 2IM1A 1X0FA 4H4KA 4AXIA 1NK0A 2PA8D 2B9XA 2B4UA 3KDOA 3PX6A 1NB7A 3MR7A 4ELVA 3RR8A 4NLWA 2YQ3A 1T8EA 5D15A 2D9PA 2OO4A 1WOSA 3ILOA 1M1KT 2RSQA 2BJ7A 4ETXA 3DOLB 3T5HA 4PPZA 3FSIA 2HAFA 3OD2A 1RT2B 1TR0A 3UD5A 2GMLA 4IFYB 4IH7A 4YHHJ 3OFHA 1JQGA 3QRQA 2ABYA 2XYHB 4USUA 4B9SA 2O5DA 3SDEB 5KG7A 2AU0A 1REVA 4YOEA 2J8AA 3RB0A 3AT1B 5DZ6A 4G3IA 1B0VA 5T7LA 2UV8A 3UVJA 4D3HA 2GGPB 5B0CA 5AXKA 1S6QA 2Y8WA 5L1IA 2RKIB 5CCLA 3FSXA 2QFIA 3F41A 4KPYA 3RUBL 4MYTA 1PAEX 4OLOA 2UXBJ 2DGSA 4ZVQB 1G6BA 1P6TA 1RT3A 2UUTA 3DKDA 1O6XA 3EXYA 3M8QB 3PXGa 1KHWA 1HWUA 4DR4F 2DEIA 1HNXJ 3ILLA 4Q45A 2P5VA 1FXDA 3PR5B 2B7BB 4PABA 2VDIA 5IV3A 2EC2A 3MEDA 4X2BA 2E5HA 4UQTA 4HH0A 4OI4A 4ID5B 1RA7A 2AYBA 1UCNA 1F5AA 1VK8A 1U45A 4WFNQ 2ILZA 1JK9B 3OFEA 1R27B 2VOPA 5A8WA 1N36F 1T94A 1OYDA 4DV0F 1DTTB 5KG3A 3POTA 1KD1T 1RK8A 2QA4S 3KHLA 1Q7LB 4QIWD 4PG4A 2CQIA 3OR1A 4MK7A 3OV7A 4ILLA 2PO4A 3ITHA 1N5VA 2XO6A 2E5LJ 1YQHA 4ZPCA 2BYCA 2DB1A 4RUCA 1QM9A 2KVQE 4WKYA 3ZZ0A 4MK8A 4B9TA 1U24A 2GQQA 3W9JA 5FLXY 3BF4A 5B0DA 1MWZA 2ZM6F 5CABA 2FLNA 4TKTA 5H9EK 2CKWA 1OPIA 1NDPA 2W8KA 2UUAF 3RAXA 1VGYA 2RJZA 5L8RC 3CE8A 1TKXB 2XSFA 1XNRJ 3OXFA 3G4SS 2AEFA 3P49B 2ZUGA 3M8YA 2V2KA 3OFGA 2EFOA 4P2FA 4PKDB 2KHCA 1N52B 3BO3A 3R3TA 2B8PA 2XB2D 3G2XA 4L76A 2HK3A 2XMVA 3TI0A 3DLKA 3U7JA 4RW8B 3Q8UA 3T1AA 3IGVA 1WDTA 2BABA 4JV0A 1MMNA 4HT7A 4B3RF 2N4DA 2R7QA 2ZH8A 4YP3A 3PW5A 2Z8QA 1RHQB 4TY8A 4OI6A 2KYXA 2IYIA 2XBPA 4NL5A 1HHSA 3VAHA 1RTJA 1JXEA 3ZC4A 4RNMA 3DNCA 4O3NA 4LRBA 2GMJA 2CDRB 4MMOA 5IWAJ 3CMAS 4HHJA 1R0AB 2BW2A 5HVGA 2DXFA 2J6TA 2W9CB 1WDDA 5ETQA 1U49A 4PZVA 2MLYA 3UCGA 5E5NA 4CM0A 1SUQA 4R0JA 4EZ9A 2YPYA 4YB1P 1G3OA 3M32B 4JI5F 3LGNA 4RNHA 6AT1B 3BPDA 1IVZA 1UEUA 3DLGA 3IAM9 5ETSA 3D1QA 4IFVA 3KLVA 2A0FB 1WNEA 2XNQA 1NLKL 1HWIA 3LALA 2LYVA 4ECZA 2BDPA 2EG1A 2W7OA 3MPVA 1KOOA 4ECUA 1YKWA 3QMQA 5I3UB 3PFEA 4LSNB 5LMUF 2QL7B 1L5UA 1T3OA 2ZHBA 3PJ9A 1GTEA 3ET6A 4IOAQ 2GHWA 3IMQJ 1QDUB 1A9NB 4CIOA 1JLEA 2XZDB 2VG7A 1JLQA 4PWDA 2ZHOA 5AE3A 4C2MA 3C6TA 4WFZA 3A1YG 4W98A 2JEGA 4NYPA 2MQNA 1KFDA 3MM8B 5E3PA 3MOJB 3TA1A 1VJQA 4DJBA 2G2ZA 1P9QC 3DM2B 1C1BB 1VQLS 2OPRA 3WBZA 3G71S 4GVBB 3FEZA 2MQMA 3V4MA 1CC8A 4MKAA 4DFPA 3LGMA 1WHWA 2CRLA 4DQRA 2V63A 4DI6A 2LXFA 3IS9B 4U7UK 4G1QA 3MMAB 3BJYA 3C19A 4E8UA 4P52A 3GLJA 1KC8T 3NY0A 4XIUA 4FS2A 3NS6A 5J1PA 2J6UA 2RF2A 1LW0A 1IR2A 1CS4B 1TZ0A 2R8GA 3I0SA 3MMCA 4N5SA 2BJDA 2XY7A 3W66A 3AJ2A 1VK3A 2ZZMA 1X5OA 3AA8A 1B3TA 2VQFJ 2RHQB 2IBKA 1M5SA 5D78A 3O44A 3SCJE 3DYAB 3PTWA 5SZTA 1UWBB 5DZ7A 5GMDA 2QYGA 1OY9A 1S1UB 1F3VA 2GIFA 5AJ3F 1N32J 3FFIA 2Q3PA 3GB0A 3BGLA 5GADU 2XGPA 1JLBB 5F3ZA 3G9CA 2HHXA 3HT0A 3TZYA 4PXCA 5F9LA 3TQ1A 5K8NA 3ZXWA 1LNQA 4WP8A 1XR7A 1VS3A 2XCAA 1FKPB 4RNFA 3AOAA 1VQ5S 5CAAA 3D6FB 4N8NA 1WKKA 3FGVA 1TL3B 4P7VA 4P75A 2FJEB 2V4RA 1RT1A 4I2QA 4L73A 4B3TJ 2AX0A 4PUOA 3G82B 1LXNA 3Q8SB 1U8WA 1TK0A 2LVWA 2DIVA 2BJ8A 4EBEA 1N5YA 3DN9A 4NLTA 2PFFB 1RU1A 4FXVA 4KFBB 4KHMA 2AGQA 3ZTRA 2DR7A 2LXIA 1W2BR 4RO0A 2BV3A 2V8GA 2PE8A 3PG9A 4JI6F 3OHAA 3NRBA 4M5DB 2FZKB 4C8MA 2FYXA 3W9IA 2DK2A 3SSQA 4Z37A 3THTA 2F40A 5KT6A 1FVSA 2EK1A 3CJ5A 2MKSA 1WHXA 3RRHA 3UDVA 4RWWA 3J81U 1SKSA 2OGUA 1F0XA 1S6UA 4ED0A 2Z2ZA 3VAJA 1UW4A 2KFYA 4YB7A 2ASLA 5D77A 4OZ1A 4PPDA 5HBMA 3AB2B 2NXJA 4NMLA 4ZN3A 2OEKA 3J7YI 3W8GA 1GQEA 2FVQA 2YVSA 5H9FJ 3G6VA 4EK2A 4H4OA 4JI7J 2JWNA 3AJ1A 3GP9A 1WORA 4JV5F 2KO1A 3WDOA 3LPYA 5AXLA 4DCJB 2CPHA 3IWLA 4JI3J 1TL5A 2MQPA 3MCOA 2GNKA 1O5JA 3S01A 2DCLA 2OPPB 1J5EJ 4UOFA 1EQMA 3MM5A 3D1HA 3EGNA 1JJ2R 1C0TA 5HP1A 3C3LA 3M2UB 4YHHF 2VICA 2JSXA 2W7PA 2V50A 1HW9A 2B9WA 2CAJA 3MMBB 5LL6d 4CTAB 3OLBA 4QYRA 1KLMA 2W7AA 3DI6B 4O0NA 1KOHA 2QC3A 1N0UA 4M5NA 2LA4A 3HT3A 2B4OA 4KGZB 2MTLA 1X4FA 3MAAA 1AUDA 1HNZF 2YNGB 3QPIA 2V68A 3CCWA 1F2GA 4X4UA 4ILRA 3QWPA 2MJNA 2ZITA 3RB3A 2ILYA 1DTQB 4QPXA 3CCQS 4ED2A 3ILJA 3B78A 2YKOA 3V81B 1S0MA 1ZBTA 3AD7C 2FVCA 4KV8B 3LP1A 4YR0A 4WK3A 3PDNA 3DLBA 2K2PA 1RA6A 2B51A 2DNYA 3LWMA 3BH7B 4OV1A 1HNXF 2GIRA 1N6QA 4TYAA 3DFEA 1R8CA 2V94A 1KONA 5L9XA 3BSNA 2HHUA 4N76A 4DN0A 1YJUA 2XCPA 2YY3A 3TUPA 2R7UA 1VBKA 3CGIA 1Y4ZB 3CJ2A 1JLFB 2F8MA 3CCUS 2Z2LA 4B9UA 4B3OA 3D54A 3QAUA 2FGCA 3OTCA 4DSFA 2VFSA 3FBEA 2IC3A 4EWTA 1TL4A 5DG8A 4Q7AA 4K5SA 3Q89A 1I3OB 4C8OA 3PO5A 1RAGB 2E5JA 1QUVA 4QWCA 1RWWB 1VC6A 2DNLA 5B0BA 1D8YA 2FLPA 2WW4A 4ZPDA 4DUZJ 3SQGA 1VHIA 4LF5J 1HI1A 2DNHA 1RT4A 3DOMA 5CYJA 3HHLD 3BGRA 3OUYB 1GT8A 1FK9A 1DLOB 4OJ1A 2AHOB 3CD7A 2J0XA 3IRXB 2XLKA 4QWBA 3T1YF 3SFGA 2B9EA 3V5RA 4OHYA 1PYOB 2DNOA 1UETA 2BA9A 3GIJA 5J1EA 4B9LA 2CJYB 2E9RX 3PW2A 1N8RT 2W2QP 5KT7A 3BQ0A 3G8QA 3MHYA 1CEZA 1UJ6A 1TUGB 3EZUA 2GVZB 4DL7A 2DRBA 4Q5VA 2KFZA 2V9WA 3TUJC 3SV4A 5G4DA 4LMZA 3M6WA 2FC8A 2KT5A 5IS2A 3DOLA 2F4VJ 1CLFA 1CSJA 2B4VA 3PHTA 1RT2A 4IFYA 2M8DB 1PBUA 2EFQA 2J9DE 2E29A 4PRFA 3SDEA 2HFSA 1MG7A 2YBVA 3R9LA 1RACB 2GGPA 2CWXA 4ZPVR 4ECSA 2I0XA 1RAEB 2C42A 2BE7D 1VQNS 5LSLA 4ITSA 2CNOB 3RU0A 5IWAF 1RYRA 3TUZC 4YB6A 2BX6A 4WYWA 3D0IE 1LWFB 2NCKL 1ZS6A 1Z1ZA 3FK4A 4LFBF 3H25A 2J9DA 5B0EA 2MKKA 2RH3A 2DIUA 3M8QA 3B8HA 4YS2A 2MQQA 2XMJA 4AL5A 2DBBA 4LFCJ 2G1DA 3UD4P 5IM0B 3N9UC 2IA0A 4OX9J 3O2IA 5FJ4A 4LF6J 5DRKA 1VLOA 1LK5A 5U47A 4U95A 1RTHB 4ID5A 3DU6A 4UY85 1YHQS 1NSPA 4HVZA 4X4OA 2DGWA 3D68A 1KTVA 2E5GA 3CCES 3UI3A 1SV5B 3A3NB 3NMRA 1DTTA 1U47A 1ZM2A 2D1CA 2GC8A 1RI7A 4HYKA 4F0HA 2C3UA 2WTFA 2JH3A 2N82B 3Q86A 2Z2MA 2ATLA 3BBCA 1SPBP 2F1FA 1XIQA 4BWMA 1U1LA 5HJXA 1FHTA 2WAQD 1IWAA 3TVZA 3PO4A 5C5JA 3NP5A 3I6PA 1Q81T 3N01A 1N33J 1MU2B 4EEYA 1XERA 1HHQA 4CM2A 1ZTTA 4ETZA 3GIIA 4ALZA 3ZNUA 4PYDA 4ZDNA 2CNKB 2MY8A 1TKXA 4M63A 1QSSA 3MWBA 2HSEB 3QT7A 3E51A 5A6WA 1AZSB 1GXTA 1WSVA 3OVSA 3MGJA 4Y28C 4CH1A 3QGPA 3H59A 1CQNA 2IJRA 2UUCF 3R2CJ 3IA0A 2BM0A 2BJ3A 4GC6A 4DS5A 3RJMB 2OSQA 1XWLA 2WSEC 4RW8A 1RSCA 1S97A 2IIHA 3CC4S 2H1YA 1U6BA 3I0RB 5AE2A 2CXEA 2VQFF 1OS5A 3NEKA 3K58A 1PAUB 1ZM9A 3JTPA 1J27A 3JQMA 2DGOA 5JUMA 2GQ2A 3QJJA 1LQ9A 3VAKA 2V34A 2IVFB 4DFKA 3K89A 3JSBA 1VDHA 3ZTSA 1R0AA 1SL2A 4KTQA 1FX2A 4O4GB 2FHJD 4GC7A 3W61A 2W9CA 1EJ7L 5HQMA 5HJYA 1Q86T 3BGOP 5HN0A 4HHUA 4JI1F 3M32A 4FNHA 2W8LA 4DR1J 1ZPWX 2Z4PA 1S5ZA 1F9HA 2MSTA 2J9CA 2XLJA 4B3TF 1ULRA 4F4WA 4YY3J 1PYTA 5LSOA 2HVDA 2LEAA 1XMOF 4IH6A 1FJ7A 4NXMJ 1S99A 5CD4H 4AE5A 2VOOA 3TVYA 1M90T 5BR8J 1IWGA 4OZLA 1IBCB 2ZHAA 1S49A 2RQMA 3UN2A 1EAYC 4ELTA 5I3UA 4EO8A 1XC9A 1L3KA 1N5SA 1Z2ZA 2VFUA 3BR8A 4LSNA 4JB8B 4MJKA 4CO5A 4GRSA 4ZPTR 3JYTB 1HR0J 3R5GA 5RUBA 2F7VA 4WXWA 3O6QA 5LOQA 3PRDA 4DL4A 1CQMA 2HFZA 3EJMA 2YH0A 4LF7F 2AJFE 4QYZK 2XS7A 1CVJA 1TFWA 4X66F 2RS8A 4OYMA 2LQ5A 1NCLA 1B0TA 3MM8A 4JBCA 4EMDA 2B0GA 1YBUA 2CQBA 4NWBA 3DM2A 2XLIA 1C1BA 2FDNA 4XAKA 2XYGB 2LFVA 1XK8A 1WTBA 4IG3B 3OW2R 4GVBA 3TX0A 2J76E 3NNCA 3PJXA 2IMOA 5CHCB 2R7WA 3IS9A 3TAPA 3MMAA 4C11B 4CZCA 3Q22A 2ZC3A 2WVCA 4CYUB 5KFUA 3MPYA 1ZAVA 1D1UA 2FJWA 1DZ5A 1CS4A 2IM3A 3R1HA 3CO0P 4L3NA 1FERA 5GAEI 4OYOA 2H5EA 1F5BA 3PX0A 4KIAA 3HHLC 3OL6A 3J81Y 3KJVB 3FVYA 4I68A 3WX8A 2HFOA 3DYAA 4FZVA 4C3MA 2AZ1A 3D28A 3EM1A 2ZZNA 1NRKA 4C7QA 3LAMA 1NSKL 1UWBA 1S7HA 4S0MA 3G8SA 8ATCB 2HPUA 2DNZA 1S1UA 3MUMP 3SFUA 1M1GA 3OR2B 3ADAC 1X31C 4JV1A 3LUYA 3B6BA 2F8HA 2M4MA 1JLBA 4M5JA 2L3MA 4DV4F 1RTZA 2EW9A 4OFZA 2OP5A 1T03B 1ZM4A 2ZJRQ 2PSZA 2NSCA 2CDQA 4HHHA 4OHXA 4W90B 2HZAA 3HKZD 2PEHA 1FKPA 2XGQA 2CZ4A 3CVKA 3DOKB 2IA6A 3Q2SC 2CPDA 3I4HX 1S7IA 1TL3A 3HI9A 4DR5J 3LW5C 3NMAA 3GJRB 4PXEA 2JFKA 3FKBA 3RB4A 5A0YB 3Q23A 5IT0A 3G82A 3SXLA 3CSKA 7AT1B 3HD1A 3ZZYA 1Q79A 2FPHX 2RUGA 1ZOTA 2HWHA 4UOHA 2UXDF 1HA1A 5GAGU 3MTJA 4KFBA 3LPEA 1MSWD 2E5IA 3OTOJ 1C1CB 2FJVA 3BQ1A 1V5IB 4DU7A 4F4KA 4KJIA 2ZJQQ 1WOOA 1I1GA 5MAOA 4AQYJ 3LP0B 1WEXA 4M5DA 1SH3A 2RAQA 3I31A 1VRQC 4QWEA 5H1SV 1FO1A 1FRMA 4LIWA 1HD0A 2LLZA 1NPRA 3MAQA 1VBXA 2VPYB 3GJTB 5F9NA 3KHHA 1RZMA 2BE9B 1SJ4P 4MKYA 5AXNA 1S0OA 5KFIA 5J2NB 1SL1A 4AYBD 4X4NA 4X65J 4PG8A 3NL0A 1FX4A 1LKZA 5D4PA 5H9FK 4DUZF 1RWVB 2FJAB 1HNWJ 5DM6Q 1IM6A 4OI0A 5KT2A 1NKEA 2XMWA 2BEFA 5D0RA 1RT6B 4IR9A 3DHXA 3CCVS 2V8HA 3VGUA 3MD3A 4MK9A 3VGTA 1I94J 3PV8A 4IQXA 4F67A 2ZOFA 4L72B 3PNIA 2OPPA 1FFGB 4JYAF 1UMJA 2XS5A 1QSYA 3L9ZA 4LFAJ 1JJHA 3G6ES 3W7BA 4CO1A 1LFWA 2XULA 1EKRA 4TLRA 3M2UA 2Y1JA 4KHRA 4CLFA 1Q53A 5KFVA 1N48A 4ZVEA 4A8KA 3MMBA 1Y3JA 2JVOA 4CTAA 3NGDA 4B3SF 2GHVC 3QSYB 4LF4F 1AFJA 4ED7A 3DI6A 4ZVFA 3TZZA 3ICLA 3CJTA 1K1SA 2JDJA 2IHR1 3E01B 3M05A 4PCQA 4DR3J 2YKAA 4IKAA 2QO3A 2YNGA 2RDJA 2DJWA 5IT9U 1SJ3P 1H2TZ 2FVRA 3T6BA 4Y65A 5E3AA 1RLDA 1ZM3A 3B4DA 5DLFA 4Y6IA 2LQ9A 1DTQA 2YH1A 3V81A 3CD0A 3Q0AA 1H73A 2L9WA 2ZDOA 4QWAA 3M8WA 3DGVA 4LFCF 3A8JA 1AB8A 1P1LA 5THWA 2HNYB 4MKVA 3DDKA 3HVRA 5IT4A 1CC7A 2VB6A 4DN9A 2MPUA 3JSYA 3EVWA 3O8WA 4DXLA 4KGVB
chains in the Genus database with same CATH topology
1N36F 1T94A 4RZRA 4I1TA 2MHEA 1JLFA 3BGUA 3BREA 4DG1A 4DV0F 3L7PA 3OTBA 5A8KB 1DTTB 2HQ3A 5KG3A 3POTA 1KD1T 1RK8A 1O51A 2YNIA 2QYCA 2QA4S 2AF6A 4KR0B 4LQ3A 4KO0B 5HL7Q 2AYMA 4QZVB 2P6TA 2R9LA 2AX1A 3CIZA 1S9GA 2WOMA 3GR1A 3KHLA 3RR7A 1Q7LB 3KMQA 4QIWD 4B08A 3JSMB 5KFAA 4PG4A 2CQIA 3OR1A 3BGFA 4MK7A 4PG6A 4BBYA 3OV7A 4EBDA 2PO4A 3GWCA 3ITHA 1FRHA 4ILLA 1VJWA 1N5VA 2JOQA 4WFYA 1TP7A 1TKZB 4WFAQ 2POKA 3THVA 3GV8B 2G0CA 4QPTA 2HZCA 4J9KA 1TKTB 3KNGA 5EDWA 4AL7A 4DEZA 3D5MA 1BQNB 4HI2A 1YQHA 2XMMA 4ZP8A 4ZPCA 3FRZA 4JI2F 4OHZA 3RAQA 2BYCA 2DB1A 4OI1A 4RUCA 1QM9A 1IJEB 2EWHA 2VASA 4X4QA 4WKYA 3ZZ0A 4MH8A 5C25B 1RWUA 1P27B 2AV5A 4MK8A 3V6JA 3HMJG 1G7CB 5IQQA 4B9TA 1U24A 4NCAA 2APOA 2GQQA 2KXNB 5FLXY 3BF4A 3HLUA 5B0DA 2LKZA 1YSJA 4O44B 1MWZA 4ZVHA 1IKVA 2ZM6F 3CO9A 4B9VA 4DQPA 5FIIA 3MECB 2FLNA 4ID8A 2DNQA 3K5LA 4ED1A 1M5PC 4TKTA 1IKXB 5KG5A 1GXUA 4FVCA 5E3QA 2CKWA 4C3LA 1N33F 4WFBQ 4RUAA 1S72S 4QU6A 2IM2A 2MSSA 3EPGA 4DV1F 5E3CA 1FRIA 1OPIA 2HAIA 4ICLA 1DLOA 3MXHP 2RQCA 2DO4A 2W8KA 2UUAF 3RAXA 1VGYA 2W4PA 3IRXA 2FD2A 2RJZA 3CDUA 5L8RC 2ZD1A 1Q16B 5JXSA 1TV6B 5EWFA 3CE8A 1TKXB 2XSFA 4ZP6A 2OD4A 3M6VA 3OXFA 4IDKB 4U9RA 4EBCA 4GKKF 3V6DA 3HVTA 3OXGA 2R8IA 4FXDA 4M1KA 4DV7F 3JTOA 1M5VC 4JUZA 3G4SS 2CQCA 3KK2A 1GNKA 3LWLA 3P49B 2ZUGA 2HGNA 4EO6A 2CPEA 3DC2A 3ZZTA 3CPWR 2V2KA 2O1PA 3UDCA 3SZ2A 2CYYA 3OFGA 1F9FA 4LF8F 2DR8A 2EFOA 2ZBIA 5HO4A 1FRKA 3IO1A 4PKDB 2KHCA 2CQ4A 1T03A 1N52B 4YEAA 3BO3A 3R3TA 5I4MA 1J2VA 2XB2D 4WE1B 5CQGA 1U1MA 5DETA 2D7SA 1J5OA 5K14A 2CPXA 1UKUA 1HNVB 2EPIA 2XMVA 2F3JA 2ZH7A 1HBOA 3D1OA 3UPFA 3NCRA 4OMFG 4ZPWR 4BS2A 4DQIA 3DRRB 3TI0A 2DHXA 1NJZA 2FJDB 3QGGA 3DLKA 3U7JA 4RW8B 4BDPA 2QSFA 2XSJA 4RBTA 3T1AA 4UW2A 3IGVA 4FF2A 3BSCA 2BABA 4JV0A 1MMNA 4HT7A 2PDAA 4B3RF 2N4DA 1FE4A 1Z2LA 2R7QA 2ZH8A 4YP3A 5KFBA 4C3KA 2DNGA 1UA1A 2JZ5A 4O3PA 1S6PB 5KFZA 3H5YA 3PW5A 2Z8QA 2DNMA 1RT5B 2VBZA 4URGA 1FDDA 4TY8A 1ZPVA 3FSYA 4OI6A 2J9EA 3H2UB 2DPIA 4ZS6A 2KYXA 4PR6A 1N4LA 2IYIA 5D8HB 1TAQA 1RAJA 5D3GB 1KNZA 1V3RA 2XBPA 3G86A 3ENQA 2IFXA 4NL5A 2MZ1A 3C46A 1HHSA 3HHKA 1RTJA 1TVRB 3W2WA 3VAHA 4MIWA 2FB0A 1JXEA 2V4JB 1DQAA 3ZC4A 2W9BA 2DVIA 3QO9A 4RNMA 3SYZA 5KFNA 2KRRA 4TU7A 3PRBA 4CO4A 3DNCA 1WHVA 4C8KA 1HWKA 4E98A 4O3NA 1SI9A 3BM7A 4FF1A 4ZPAA 1AW0A 2GMJA 5A8RB 2I1RA 4MMOA 1FXLA 1Y3KA 1NZAA 3CD5A 3CMAS 2P9CA 4HHJA 4X4PA 2LECA 1R0AB 2BW2A 3MMJA 4I2PA 2ZFHA 2VG5B 3RRGA 4TY9A 2J6TA 3M2VB 3CIMA 4JI7F 3R5DA 2VG6A 2W9CB 5SUHA 2DGQA 4OI3A 1HD1A 4EU0A 3PIPQ 4OLPA 4IO9Q 4PWUA 1FRXA 4OJ3A 2LU2A 1U49A 2PI4A 3N6LA 4JI3F 3UCGA 5E5NA 2MZRA 1DFDA 1SUQA 4R0JA 3MM6B 4EZ9A 5K8MA 2VPWB 4AFFA 1G3OA 2OAUA 4YB1P 1UP1A 3M32B 5HMZA 1KQSR 4JI5F 3HP6A 4RBVA 4NCGB 3LGNA 1NJYA 3K8WA 1LWFA 2AYGA 2GO8A 2YWFA 4RNHA 4CH0S 1UEUA 3TUIC 5DDOC 3DLGA 3F73A 3IAM9 2L08A 3Q8QB 2BE2A 1FJGF 4QWDA 3D1QA 2BZ2A 4IFVA 4EFAC 3KLVA 1J5EF 1YWXA 3WZ0A 5LSLA 4DR1F 2CJKA 5J2PA 1WNEA 2XNQA 4Q8FA 2YKNA 2MZJA 3J7YU 4IG0B 2WONB 4ZOSA 5IQ6A 2YWHA 4K2XA 1HWIA 4ES2A 2LDYA 5IM0A 2MY7A 3LALA 3MR5A 2RRAA 1WD6A 1DARA 4OL8A 2WB1D 2DT9A 3BQ2A 3UD3P 4K0KF 1APSA 1O0PA 1K0TA 2ZKTA 2LYVA 4K4ZA 2RU9A 4I69A 2PD1A 3TO8A 4ECZA 4O0IA 1RTHA 1HI0P 2BDPA 2EG1A 4WF9Q 2W7OA 3MPVA 1KOOA 2PC6A 4HKQA 3WC2A 4ECUA 2JEIA 2OFGX 2WSFC 3DLEA 1JLAB 4X4RA 3QMQA 5I3UB 2V4QA 3PFEA 4HH1A 5BR8F 1MMLA 4LSNB 5LMUF 1L5UA 1T3OA 3QAEA 3IAS9 2ZHBA 2J6SA 2IBOA 1DQ9A 2NZ4A 2G13A 2MKCA 4FYDA 3VAGA 1GTEA 1YIJS 1SV5A 3KLIA 4IOAQ 2GHWA 3NKYA 5HQ8A 4IOCQ 1A9NB 1S1WB 2KM8B 3OL9A 4CIOA 3C6UB 1C4CA 5L1LA 2FLOA 2KXHA 3PEJA 3MR3A 2XS2A 1HBMB 1JLEA 3T9NA 2BQUA 1LV5A 1Q1KA 4CT9A 2VG7A 1FT8A 4WU3A 1JLQA 1FD2A 3NBPA 4PWDA 2DH9A 4TYBA 2A10A 3W2VB 2M3DA 2KG1A 2VKRA 2ZHOA 5AE3A 4C2MA 5CZXA 4NZ7A 4OX7A 3C6TA 4WFZA 2D3OR 3VTIA 3A1YG 4F2RA 2BJEA 4XDCA 1S1XB 2JEGA 4JI8F 4WYLA 4RU9A 1VQ9S 4NYPA 4KHPF 2MQNA 5F8IA 5GAHI 2RILA 3PIOQ 4X84A 3IC1A 3UCZP 1KFDA 3MM8B 2R4FA 5KFDA 2DR9A 3HHDA 1XNQF 2CQ0A 4KGKA 4R5PB 5E3PA 2R7XA 2K1RA 2WBRA 2DD8S 3ENWA 3MOJB 1TL1B 3TA1A 4A47A 4DJBA 1LWCB 1SB6A 2FHJA 2YX7A 2PN6A 5D4NA 4DR2F 1P9QC 3DM2B 3GFZA 4A8MP 4OZ0A 1C1BB 3HKWA 4NLDA 4RU2A 1UJ5A 5L1JA 1VQLS 3TNVA 1VIOA 3I96A 2OPRA 4QR1A 2M8HA 3MM7B 3P96A 5KFOA 3WBZA 3G71S 1U6FA 3FEZA 2MQMA 3V4MA 2A2CA 1MU2A 1CC8A 2W4DA 1KVJA 3HHNB 2CZVC 2X1GA 4MKAA 2MXYA 2D3UA 4DFPA 3FQKA 3LGMA 4Q44A 4NLPA 1WHWA 2CRLA 4DQRA 2RD5C 2ZH3A 2SXLA 1N0VC 2OH2A 3X1LB 3KLEB 3P6YC 2LXFA 2JJ4D 3HDSA 2WCXA 3IS9B 4U7UK 1QJHA 4Q0BB 5CZVA 1S9FA 4G1QA 3MMAB 2DHGA 2J0QD 2E1MC 3BJYA 4QIVA 4IH5A 4E8UA 4PG7A 4C97A 2ERRA 1KVIA 1IKWB 5HLFB 3OVAA 1KC8T 3DMJB 3K7RA 5C24B 4XIUA 2HGMA 4FS2A 4M94A 3UW1A 3N5BA 3NS6A 5J1PA 1X4DA 3MM9A 3MEKA 2J6UA 5A6PA 2XHWA 2RF2A 4A4JA 4R8UA 4YUDA 4RNOA 3BEGB 1LW0A 3I32A 2RKIA 3ISND 3VCDA 2LXUA 1M5OC 3KNAA 1TZ0A 3F56A 2R8GA 1SXLA 2B6AB 5HI7A 2KDOA 4Y0FA 3OPKA 3H2LA 2RNEA 2RE1A 5LMNF 3I0SA 4M8LA 3MMCA 4N5SA 3M8PA 2BJDA 2XY7A 2QT7A 3AJ2A 1JKHB 1VK3A 2KT2A 2ZZMA 1X5OA 3DRSA 5FDLB 1NH8A 3AA8A 3H98A 4OX6A 1BC6A 2IBKA 2HNDB 1M5SA 1BQMB 3AAWB 3CMES 1YI2S 1RTIA 5D78A 2NPFA 2O66A 3O44A 3SCJE 3KK1B 4DS4A 1T7PA 5F8GA 4B02A 3I0RA 1U1NA 3DYAB 1LW2B 5SZTA 2YNHA 3R27A 3UWTA 1E6YB 1TQLA 2I38A 3K5OA 4FP9A 3ZZOA 1UWBB 3EGZA 3OJUA 1X0PA 4LF5F 1KSPA 1S1UB 5CXTA 4ZK7M 1UVJA 5AJ3F 1Q8IA 2PI5A 1ZZFA 1FKOB 1NK9A 3FFIA 4ZCKA 2Q3PA 3MR6A 3R1LA 1RTDB 3SSRA 5DO2A 4LIRA 4RUHA 3DRYA 3GB0A 3BGLA 5GADU 2Y1IA 1W25A 2WRMA 2VA2A 4KE5A 2XGPA 1JLBB 1FRJA 5F3ZA 3G9CA 2HHXA 2KKHA 3VALA 2QSWA 3BZQA 2N7CA 1S10A 2V5HG 1B7FA 3BB5A 4PXCA 1NH7A 3TX8A 4GO5X 3CCZA 1NKCA 5F9LA 4CH7A 3EZ5A 1Y9OA 3TQ1A 1JLGB 5K8NA 1S9EA 2V8DA 5DQHA 4F4ZA 1NK4A 1XR7A 4O4GA 1VS3A 2XCAA 4XO0A 2DNKA 2CPJA 4RW6B 1D9DA 4LSLB 1FKPB 4RNFA 2XNRA 4LF9F 4GMKA 3A8EA 3KG0A 1VQ5S 2E1AA 3U27A 2HHQA 5KFPA 3OTDA 1YJNS 1GX6A 2HG4A 5F41A 3K57A 1VBZA 4ILMA 4N8NA 1T05B 3FGVA 2JEFA 3T6JA 1TL3B 3ZZZA 4P7VA 2ZVSA 5KFRA 1VQ7S 3KHGA 2GMHA 3QLHB 2FJEB 4I7FB 2V4RA 1B64A 1RT1A 1BQXA 1TFYA 3NWGA 2O01C 4USIA 4I2QA 2BQRA 1YJTA 1NAQA 2AX0A 4PUOA 2NREA 4DL0C 1LXNA 3Q8SB 2J0WA 1X4EA 2ZH5A 2RIJA 5KG6A 2IRYA 2OD6A 2F4VF 1TK0A 2DHSA 1JMTA 5KFTA 2LVWA 2P6SA 5L39A 2ZOMA 2EC0A 4ERDA 2DIVA 1OSDA 4PG5A 4EBEA 1N5YA 2B9YA 3CJ0A 3DN9A 2A3JA 3T1HF 4DSLA 4NLTA 4BWJA 2PFFB 1YBAA 4J9NA 2ALZA 1SIZA 4FXVA 1VLYA 2IM0A 4KFBB 4QJVA 3BSAA 3P5TL 2R2TA 4V19J 4KHMA 2AGQA 1RT7A 1S1VA 4TXSA 5I42B 2J0SD 1PC4A 3V4IA 5CYQB 3I87A 2DR7A 5CYMA 2LXIA 3IR5B 3I56S 2YNFB 1W2BR 2RRBA 3N79A 2R8HA 1X9SA 5KFJA 1QE1A 4IRKA 2ASDA 3HVWA 4KB7A 3X3UA 3KLFA 4K4YA 4HT5A 2BV3A 4FN5A 2V8GA 2PE8A 4NPOA 1JLCB 4Y2KA 2OPQB 2RB7A 2UV8G 3AA9A 3CCRS 1LWEB 4CNYA 3CJKA 2D9OA 2DRAA 4A8XA 2PA3A 1FDAA 4JI6F 3OHAA 2FVPA 4TN2A 3NRBA 4H4MB 4M5DB 2VBXA 3DU5A 4MKBA 3JYTA 4C8MA 2WSCC 2HW3A 2V9KA 1WI8A 1RISA 2DK2A 3SSQA 2ZC4A 4Z37A 4GKJF 3RZAA 3THTA 2WK4A 1JB0C 1YGYA 4MYUA 1ZAXA 1R8BA 4G1PA 4EYIB 4PQUB 1YJRA 5KFXA 1HW8A 4IR1A 4DOZA 2F40A 2NS1B 3NCQA 1SJFA 5KT6A 1FVSA 5M2PA 4OHWA 3CJ4A 4HDHA 3TAMB 2EK1A 1YRXA 3CJ5A 3D2WA 2ROPA 4D3GA 5AE1A 2C28A 2ROGA 3MEEA 3IWNC 2DGVA 2W24A 2MKSA 2UVUA 1EP4B 3K2YA 1WHXA 2NQPA 3RRHA 3B82A 5C42B 4RWWA 5CCMA 2RU3A 1SKSA 3NLCA 2D74B 4NLUA 4ATNA 1K73T 1HWLA 1FKAF 4OX9F 2AJ1A 4G6VB 2OLWA 1F0XA 1S6UA 4ED0A 5J2QB 2HNZA 4LF6F 3RTVA 3VAJA 4DHVA 1SC6A 4OJGA 1UW4A 4K4XA 1SJRA 2KFYA 5DLGA 4X65F 4YB7A 2ASLA 4IG3A 3J7ZT 5D77A 4F8RA 4OZ1A 4PPDA 5HBMA 3AB2B 2V0NA 5KFMA 4NMLA 3K8VA 2OFHX 4NLYA 4OZJA 3IBWA 2XMTA 3CT9A 3J7YI 3KK3B 1D0EA 1GQEA 2HIQA 3HM9A 2FVQA 4XPCA 2YVSA 4DSKA 3M6XA 1QVFR 4NLOA 5H9FJ 3G6VA 1HNWF 4H4OA 1WWHA 2RRNA 3H2VE 1NJWA 4DSIA 1M5KC 3KLHB 4C11A 1HNIB 2JWNA 2YWKA 3CCMS 2ZH6A 3AJ1A 1VC5A 1X8DA 1HBUA 4JV5F 2KO1A 3H20A 3WDOA 2WHOA 3D0HE 3LPYA 3DCAA 1E6VB 2ZNYA 2CPHA 3I9V9 3IWLA 3M2RA 5AXLA 3PX4A 1TL5A 2MQPA 4NZ6A 2V8VA 3GV5B 2UVWA 1N88A 3G6YA 4UUXA 1WEYA 3FQLA 4IYQA 1NK5A 4ZA1A 4Q43A 4C8ZA 2LU1A 4QW8A 3OL7A 1VQSA 4URQU 2GNKA 1VRUB 1R7IA 1O5JA 4QR2A 1U48A 2MGZB