4Y65A

Crystal structure of e.coli cuta1 c16a/c39a/c79a mutation
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
112
structure length
112
Chain Sequence
MLDEKSSNTASVVVLATAPDEATAQDLAAKVLAEKLAAAATLIPGATSLYYWEGKLEQEYEVQMILKTTVSHQQALLEALKSHHPYQTPELLVLPVTHGDTDYLSWLNASLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of E.coli CutA1 C16A/C39A/C79A mutation
rcsb
source organism Escherichia coli k-12
molecule tags Metal binding protein
molecule keywords Divalent-cation tolerance protein CutA
total genus 24
structure length 112
sequence length 112
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03091 CutA1 CutA1 divalent ion tolerance protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4y65A00
2XBPA 2EG2A 3AA9A 3AH6A 4YB6A 4CO3A 4C3LA 4NYPA 3T9ZA 1NH8A 3CE8A 1GNKA 2V5HG 2XG8A 2ZOMA 4NYOA 4RWXA 3TA2A 5DS7A 1NZAA 4YB7A 1HWUA 3N5BA 4OZLA 4USIA 3AHPA 3X3UA 1V9OA 3MHYA 4OZJA 4RX6A 3TA1A 2O66A 1UFLA 5D4PA 1XK8A 4RWWA 4USJC 4CNYA 5DRKA 2GNKA 3L7PA 4WK3A 5L9NA 4E98A 1NH7A 2PIIA 4RLEA 3TA0A 1PILA 5D4LA 3DFEA 3NCPA 4R25A 1QY7A 4C3MA 1J2VA 1Q1KA 3LF0A 4C3KA 1O51A 1P1LA 2ZFHA 4USHA 1NAQA 4IYQA 2J9DA 2J9CA 2O67A 5D4NA 2JJ4D 2XULA 1UMJA 3GSDA 3NCRA 1O5JA 4CO0A 4CO4A 4WK1A 3M05A 3OPKA 5D4OA 1UL3A 4CO2A 2GW8A 3HLUA 4CO1A 4Y6IA 3AA8A 1V6HA 2NUHA 1H3DA 4AFFA 4D3HA 1VFJA 4CO5A 2CZ4A 1V3RA 4ZK7M 2Z0GA 2E66A 1UKUA 2VD3A 2XZWA 2DCLA 2J9EA 1KR4A 3O5TB 4OZNA 2EG1A 4CNZA 1V3SA 4D3GA 4YB5A 2NS1B 2J9DE 3O8WA 3NCQA 1VHFA 2GX8A 2RD5C 1OSCA 3BZQA 2NUUG 4Y65A
chains in the Genus database with same CATH superfamily
2CJ9A 5K14B 1JLQB 2CWKA 4ZN1A 1XIQA 4P10A 1NSAA 1TP7A 3UD5A 4A47A 1DURA 2VBXA 1T03A 1PAUB 2V34A 2F8MA 3NGRA 3GU0A 2M8DB 3Q86A 1HPZA 4NYPA 1GTEA 2MJNA 4EGLA 3J7Z5 3G8TA 2B8QA 3C3LA 1X5OA 1S1TA 1RDRA 4JV0A 4DV3J 1JNZB 3UDCA 3QATA 2Q43A 2WW4A 3VGUA 3K5LA 2KM8C 2QA2A 4OHXA 4RU9A 4MKBA 5IT9Y 3E3XA 2UVVA 2HQGA 3EVWA 4A8XA 2V2ZA 4B3MF 3MPWA 3MMCA 2R2TA 1TMMA 1RT2A 4QIFA 5LL6d 5L38A 1IKVA 2DR6A 1D8YA 1Y10A 2WB1D 5H1SV 4ED6A 2A2CA 4NLQA 4HDHA 4M5MA 3OVSA 1GH8A 1N5YB 3IA0A 1NU4A 3TR5A 2CPHA 1C0UA 2EFNA 2J8SA 3M2RB 4U7UK 2ZKUA 2RT3A 1DQAA 4OJHA 1XMQF 3THVA 3WZ0A 1KQKA 1GFWB 4LVNP 1YZ7A 4BLGA 3I32A 1U1QA 1NKEA 3UQSA 4DQQA 1X0FA 2R7UA 2J8AA 2C42A 2YH0A 4GKKJ 2JSXA 3Q8SB 3AD8C 1AW0A 5KOWA 2VONA 3G9CA 1AA1B 2V67A 1MWYA 1D9AA 2VG6B 3W63A 4UZBA 2M5YA 4FYXB 4KGKA 4UOCA 5HLFA 1M5KC 5KT4A 1FVQA 1HBUB 1NK5A 3GILA 2W2PP 2AGPA 3D0IE 4KT0C 4NXMF 2AKWB 3NY0A 1KOHA 3GV7B 1RT1A 3QT6A 4QYZK 1FFGB 2Y0SD 3DGPA 2E7XA 5KFIA 4A8QA 1YDLA 1VIOA 5DQGA 5AE3A 1I94F 2RQCA 3MXHP 1ZTTA 3F41A 4ICLB 3ENAA 4B02A 2H4YB 1YTYA 4LRDA 2F8EX 1RTZA 2R7RA 1SUQA 2OPPB 3JTOA 8AT1B 4DFJA 1LFWA 4PXCA 4M5DB 4FBUA 2NYIA 2VODA 4IOAQ 4W4MA 4KJIA 1EP4A 3CF5Q 2IBKA 3HVWA 1GXUA 1VI7A 1F60B 1FD8A 1NPRA 1K1QA 1UTAA 4NLWA 5ETVA 3QRRA 2GMLA 1TKZA 3H59A 1S12A 1Q16B 3AOAA 4RJVA 2B56A 2E44A 5KFYA 1DY3A 4F67A 5D6GA 1HNZJ 4WXOA 3GJQB 5H9FK 3CPWR 5M2UA 3UDLA 1TKZB 2OEJA 3CJTA 4CT9A 3HMJG 2KTQA 1GK8A 1XWLA 1Q8BA 2H5JB 2WZ1A 1SC3B 3BS9A 3D4JA 3PJXA 4AT1B 4CDIA 4M1KA 4P7VA 1JXVA 1V3RA 1F6TA 2DNGA 2GS8A 2LQJA 4KIAA 4LBIA 4QR1A 2DRAA 3NGDA 4C4WA 1KTQA 2B9WA 1ZPVA 4DPTA 1OY8A 2LA4A 3QLHA 5KFVA 5F3ZA 2E5GA 4NYZA 1B70B 2HHHF 2ZKTA 3FVYA 2UUAF 1T95A 4OI6A 1K0TA 3PW5A 1WC3A 3BGRA 3TVKA 3CCUS 1U47A 4OQJA 3W7BA 3D1QA 5F0WA 2F4VF 2CPYA 2AGQA 4DV1F 2P9CA 4IDKA 4EK2A 2MLYA 2M70A 2RSQA 4L74A 5CZVA 2RQ4A 2RD5C 3GFHA 1T11A 4WYLA 4C8ZA 1UZDA 1TTHB 2BM1A 5CCLA 3QNWB 4ITSA 5DZ6A 2R7SA 4Y65A 3BBBA 1ZZNA 2DY9A 2AD9A 4NZ0A 1UJ6A 3W1YC 2N7YA 1S1WA 1R89A 2MTLA 3LANA 1PC4A 1G3OA 3SDEA 5K14A 2VQEF 1KONA 1O0PA 4DX5A 1YJRA 4URGA 3SCIE 4G1IA 2UXDJ 1FXDA 2ZUAA 1WD6A 2IPOB 3CUNA 1S6OA 3IN5A 3DLHA 4FNIA 2HG4A 3CJKB 4ZMMA 3HX9A 3OQ2A 2RJZA 3CJ2A 1FDBA 3RJMB 2XMVA 2KJWA 3EVOA 3LPYA 4BHQA 3ZC4A 4RNNA 5A8RA 2XM3A 4DL0C 1JK9B 1R0CB 1DQ9A 4WFXA 4DU8A 2DGUA 1FO1A 1FNMA 2AT1B 3W8PA 4UOGA 4YR2A 2C2EA 2OFHX 4LREA 3HVAA 1JLCA 2KH9A 3C6TB 2E1CA 4DX7A 3GIMA 1FWKA 2KM8B 4X4VA 1EZZB 3PM9A 4QQBA 1U48A 1S0OA 3PJWA 3RRGA 2IYIA 5B7WA 1HQ2A 2MQQA 2EFGA 2ZJPQ 3BR9A 5L9XA 4WJBA 3X1LB 4PWWA 2GCFA 5J2NB 1VK3A 4ECZA 4USJC 1HHQA 4IG3B 5HAOA 5C42B 4ID5B 5HP1B 3CSKA 1S4EA 4RLEA 3IRXA 5GAHU 4EZ6A 3ZXWA 4LMZA 4EYIB 3LP0B 2XMKA 5MAOA 2OPSA 1VQLS 1TU0B 3LP2B 1AFJA 2ZEJA 2DEIA 3UR0A 3P49B 4KKOB 5D4LA 4J9SA 1BUXA 5HLFB 3LWMA 5L1IA 3J7AN 1BQMA 1PKUA 1RBAA 3N9UC 3O2IA 2HK2A 4PG7A 5AXMA 3TEGA 4KO0A 2ZZMA 5ETSA 2GIQA 4CLZA 2N82B 1FXLA 5LMUJ 4I2QA 2R7OA 2GGPB 1HNVA 4OZ3A 3K59A 3ZTQA 5LMNJ 3BGOP 4C11B 4OIXA 4USHA 2ZBIA 2W9CB 2KT5A 2EC2A 2B4VA 1REVA 2FQQB 4JBCA 4KSEB 5C7PA 6AT1B 4LF6F 3SSRA 1C0UB 1KC8T 4C8OA 4FF3A 2Z2ZA 1UMJA 3OVBA 3PNIA 1RTHB 1B0VA 4ETXA 2QA4S 1SQGA 4Y2MA 4HACB 4WTYA 5E0OA 4WK1A 2OP5A 3GCWP 3LALA 4OYXA 3HP6A 1HQUB 3AD9C 4X65J 4UW2A 4ZJOA 4O4RA 3UN2A 3TP2A 5ETNA 4ZN3A 2RU3A 1Q5YA 4WWSA 1UVNA 5K5MA 4LRCA 1RAOA 3AJDA 1M1KT 1J5OA 2XSFA 4KPCA 4GC7A 1FDNA 5A76A 1HNWF 1JMTA 2IDEA 4F4ZA 1PYSB 2UUBF 2NUHA 5KFAA 1RWOB 4ZVSB 1Q78A 3QJPA 2BQRA 5H9FJ 4U7CA 1Q81T 1RABB 1FTRA 5J2NA 3H2LA 3Q22A 4C48A 1OIAA 2AYGA 1RISA 4ED1A 2CPXA 1WOPA 2BV3A 4CRJA 1Q8IA 1UEKA 2G0IA 5K9FA 1NB7A 1VR6A 4YY3J 3PRVA 4OX7A 1DFDA 2PSZA 2M0GB 2HBZB 1WACA 2MHEA 4O4GB 3SSSA 4PUOB 2P9EA 3CD0A 1TV6A 2FC9A 4KGZB 4G1QA 4KGVB 4J7CA 3MZIA 2YX1A 4NCGB 3ZZTA 2ASDA 2EG1A 4K59A 4JYAF 1P6TA 4B9VA 1X4EA 1NSKL 2HEKA 2YY3A 4KO0B 2MKIA 1S1UB 4ANDA 4OYIA 4WFNQ 5EWFA 1WEZA 3D68A 3NWRA 4TLQA 1FTCA 2IYGA 3POTA 4X62J 4DCPB 2BKPA 1OSCA 3KNAA 3EGWB 4ZJQA 3M8QB 4JI8F 2C2KB 5HI7A 1HNZF 4HR2A 4JI4J 3KG1A 1JJHA 4LSNA 1NKCA 5GVQA 2R9LA 2HHXA 1K44A 2CQ3A 1SJQA 2DH7A 2L9DA 2FLOA 2XBPA 3PYEA 4M5NA 5CHCB 3MM9B 2VBYA 2V2KA 4FNHA 3MD3A 4LUBA 5A8KA 4QWCA 1QM9A 1LW2B 2LVWA 4Y28C 1NDCA 2DNYA 2VDIA 1G4CA 2G0CA 3P8BB 3PCOB 2B4UA 2Y1LB 4RR5A 3WBZA 3SQGA 2CQ1A 3DU5A 3WC2A 4JI5F 1WG5A 3CDAA 2ZOMA 9ATCB 3MR3A 3GCXP 2O3DA 1E6YA 3LW5C 4W92B 3T6JA 1GQEA 5IV4A 2DXFA 4X4TA 1X4CA 3GIRA 3W5YA 4OYOA 3K5PA 1T3NA 3Q8QB 2UXBF 4IO1A 4ATNA 4ED7A 3I55S 5A2QY 1EETA 3DI6A 2MKYA 2E7VA 3NAHA 1SKWA 1IKWB 2FHOB 1VRQC 1TL7A 4ZOSA 4N47A 3ETOA 4DN9A 1ZH5A 4KHPF 1DQ8A 2RF2B 4PUOA 3M32A 4WIIA 5B08A 4RKUC 3FEYB 2BM0A 1NSQA 4B3MJ 5LXYA 3PG9A 4UQGA 1N8RT 4AQYJ 2RF2A 1VJQA 3C66A 4AQYF 2DO4A 2IC3A 3MM7B 5KAKA 2QL5B 4DPYA 2HRYA 2GIRA 2KHDA 2KVQE 3L7PA 4WK3A 3RBXA 3IGNA 3VWSA 4OZ1A 5AJ3J 4F26A 4CLUA 4DR4F 3BV8A 3H5UA 5IWAJ 3L7OA 3KHGA 2QYCA 1FWPA 1NHUA 4IG0B 3IRXB 2J7UA 1LW0B 5FLXU 5DG8A 2YKAA 2VC0A 4F4YA 2W1BA 4TY8B 4ECVA 1N4LA 4K4SA 1MMDA 1C1BA 1S6PA 3TX0A 4DV0J 1VQ4S 2FJVA 1T9TA 1T9UA 1UVJA 3DLGA 3CJ8A 3LF0A 4G65A 4EO6A 4PQUA 1RHQB 1FJCA 3AY0A 2CNOB 2B8PA 2MGZB 1O6XA 1WORA 1ZPWX 2DKOB 5F9LA 3PR5B 3CC2S 1GMWA 3V81B 2HFVA 4B9NA 2J5AA 2IDLA 2FHJA 2WK4A 4JI0J 1EKSA 2GFFA 3H2VE 3HT3A 4DV3F 5CAAA 1Q53A 2W9CA 3RBDA 2BUNA 4PG4A 3TRGA 4M63A 2JVOA 4FP9A 4C6AA 2CQ0A 4M5GA 3PX6A 5CA5A 3CNQP 3M05A 1TL3A 3HHDA 4TU7A 2DR7A 2NR0A 1SC4B 1RTDA 4QCLA 2HNZA 1QAXA 3SFUA 4I4BA 1N5YA 3CTRA 2FJWA 4CO1A 3OT9A 1VQNS 5MLCV 2BE9B 1QLNA 4ANCA 1RAJA 1SPBP 2YNHB 2YXLA 2ZH4A 2JLFA 2HYIB 4URSA 4ZVOB 2FHKA 3QYYA 3H25A 3H20A 4LT6A 4BDPA 3HHNB 2JX2A 4FYDA 1PYOB 1X4BA 3NLCA 2XB2D 5ADZA 3PW2A 1U02A 1RTIA 4ZVHA 3CJ4A 4ZP6A 1MROB 4HH1A 4MFBB 4DSIA 4C0OC 2R8HA 4LF9F 3QQCD 3HFZB 1CS4A 1RT4B 5FIIA 2C2ZB 4NMLA 1KVIA 5BYQA 3DDKA 3S8SA 4I2QB 1CQNA 2LP4A 4DPUA 5G0RA 2DCLA 5C25B 2AX0A 3KLFA 1FERA 1LQ9A 2GO8A 4PXDA 2MZQA 4XTTA 4DSKA 2LQBA 3H2UB 1UVMA 2B9YA 4FF1A 1S6PB 2XYHB 2WBMA 3H7HB 1MMLA 4LSZB 3QT7A 4LRFA 4QIEA 1KDNA 4ID8A 1UWBA 3DLKA 2OAUA 1FKPB 2HZCA 1GX5A 4J9OA 1N6QB 3CJSA 2CQCA 2L48A 2EK1A 3KMQA 4UOHA 1SKSA 4X4NA 2VG5A 3T1HF 2YNIB 3QSYB 3BGFA 5L46A 3PRBA 5EWEA 2JOQA 2GJFA 3KG4A 4L6V3 3D0GE 3UVJA 4TYAA 4ER8A 1A7GE 2CVIA 3IG1B 3H90A 2QLFB 2V63A 1YHQS 1RTJA 1RT6B 5BYRA 1YBUA 2N4CA 3NGUA 3MF5A 3RAMA 2VB6A 5DLGA 4YFUA 3FDSA 3LH2S 3IRWP 2HQ3A 2W2NP 3F73A 2QTWA 2BABA 1S76D 1QAJA 4NL5A 3R6LB 4KH0B 4LF7J 2D74B 1CJUA 1IUJA 1FEEA 1GAOA 2JZ5A 1BY9A 4DV5J 2A0FB 1R0AA 5KFLA 3DHXA 4K4VA 3JQKA 1RXOB 4AL7A 3L3CA 2B9XA 3EDRB 5D0HA 3RTVA 4J9RA 3T41A 1NUEA 2KVIA 2W2MP 1S99A 2FZKB 2V9KA 5HL7Q 5IXUA 1DZ5A 1D9DA 3ZZZA 3TZXA 1J5OB 1UAWA 4DN0A 3BM7A 1HW8A 1JXEA 2IJNA 3FCHA 3M1VB 1RLCL 3JS9A 4ALZA 1FFSB 5D3GA 1XK8A 2FD2A 1RT3B 2JFKA 4HEA9 2WBRA 4RWWA 1N36J 3WC0A 1TFYA 2Q1LA 2N3LA 3JYTA 1RHJB 4U96A 3TJAA 1M5SA 1NH7A 2C2MB 2MY8A 1BQNA 4M5JA 2W2QP 3H40A 1RWNB 2D69A 1JJ4A 5ETLA 1FJGJ 2B5JA 2BRKA 2A1BA 4ZPBA 2J0QD 1PILA 4IFYB 2KKHA 1RWWB 4DV2J 3HFVA 1QY7A 3CCWA 4Q2LA 2ZD1A 3HSGA 4L73A 1Q1KA 4C3KA 1Q7LB 3R7NB 5HVFA 3RU0A 3TNVA 5IV3A 3CD7A 2XI3A 4BWMA 3KK2A 4ED5A 5HN0A 1L3SA 2KZMA 1GXTA 1DLOB 1NBEB 1Q4RA 3JSBA 3KK1B 3MR6A 3CXCR 4FVCA 1C1CA 3IBWA 1D8ZA 1LWXA 1NAQA 2P5VA 3GONA 4YUDA 3CJ5A 4I64A 4QPTA 2V8VA 3D6FB 3RB4A 1H6KX 4MK9A 2DISA 4N8NA 1X5SA 2B43A 4WIQA 2VOPA 3VAKA 1Q86T 2JC1A 2LDIA 2B6AB 2CQIA 3DOMA 2ROEA 4OHVA 3M8PB 2UUWA 5D4OA 4KQZA 5KFWA 5E3QA 4ECRA 4B9UA 2NREA 4ZCIA 3W2WB 4YN3B 2GO9A 3R1LA 5KFJA 5LJ3Y 2B6AA 5ETKA 3V4MA 2Y8WA 2H4WB 5THWA 3RG6A 5E3RA 3MMAB 3F56A 5KFTA 4DS4A 3U02A 4F4WA 3RB6A 3GZ7A 2C3OA 3KDOA 3Q0AA 1H7WA 3CCQS 2HHQA 5J2PA 2IIHA 4X4QA 2MKKA 1Z1ZA 1BWVA 4F3MA 3LWLA 2RRAA 2ZH5A 4F50A 2KU7A 2ZWPA 3K7RA 3UNYA 1IR1A 2UUCJ 4JI3F 1UKUA 4QOTA 5GADU 4DR1J 1NJXA 3VR1A 2UU9J 3GPAA 2HNYB 3C14A 4R0EA 4BC7A 2ZDOA 2MKJA 5GAEU 2C3UA 2W25A 2ZE2A 1SJ3P 1FX2A 2ZC4A 1BQMB 5JXSA 5IC6B 3PVXA 2DPIA 4XIUA 2ADCA 2DRDA 4DL3A 2MQNA 3DRRA 4GO7X 4JI5J 1WSVA 4B3OA 4MYTA 2EKYA 2X1FA 3KDNA 3VAIA 3TQEA 1FK9A 3BKUA 2QC3A 5T7LB 4NLOA 2V6AA 2LCWA 3N01A 5GAHI 5J2MA 1F3FA 2L08A 4F0KA 4V19X 1B99A 1PSDA 4PXEA 1P9YA 2DNMA 2BJ8A 4OI2A 4P9SA 4WP8A 4KC5A 4PPDA 1X4DA 2PFFB 1J27A 4JOUA 3HO1A 1M5OC 2VFRA 3QPIA 2GQCA 4LBPA 1WJ9A 4DR7J 3D28A 1JJ2R 3MM8B 3A12A 5AJ3F 4DR4J 3PJ9A 2XS7A 3QIDA 1SIZA 3QBCA 3Q89A 4Q43A 1ACMB 1E6VA 3VVUA 5CYJA 1FDDA 1IBCB 3G6VA 2XS2A 5JJBA 2YNGA 4OI0A 1W26A 3GYGA 1SH0A 4ZLJA 9RUBA 1ZOTA 4ZVTB 2VJVA 3O1LA 1LK5A 4F2SA 3DOLA 1IKYB 5D77A 2DGXA 1W25A 2LDYA 1HWLA 1VQSA 4KE5A 2ZOFA 1IBMF 1VYAA 2HIYA 2XI2A 3VGSA 3C15B 5T41A 3TARA 1CC7A 4KGMA 4QU7A 1I3OB 1UFKA 2LQ5A 2VPZB 1OQ6A 4F3OA 4DL5A 2A6MA 5C2CA 2ILYA 1Q7YT 4RW4B 2K1RA 1N34F 1WKJA 1S0NA 2OSRA 3NXZA 2VBWA 2VG5B 1HD1A 5B0EA 2KRBA 4USTA 1KBRA 3MUVP 2POKA 4E2FB 1XTZA 3KLEB 3IO1A 5B0FA 3AB4B 1FRLA 2MLZA 1IWGA 2LA6A 3LAKA 2HNDB 3FQKA 1YK9A 3IMQJ 5J2MB 1HMVA 1YZ6A 2WSFC 2CXEA 1RT7B 2D7SA 2DNQA 3THTA 2E1MC 2W4CA 4A4JA 2V68A 2ATLA 1H7XA 1GX6A 2DH8A 2HRUA 2YNFB 3V5RA 4BBYA 3A8KA 4DCOB 3M9OB 2IJFA 3IC1A 3DDIA 4C3MA 2RNEA 2OSQA 1D09B 2XO7A 1WF0A 3DC2A 2XHCA 3AODA 3F44A 5FDLB 2IVYA 3OHBA 4DR6F 3MAQA 3MEKA 3PHTA 3HHLB 3ILOA 4WE1A 4BC9A 1EKRA 3JTPA 1FXRA 2HWTA 2FVQA 2J7WA 5CYMA 1FRIA 1UW9A 4OMFG 2W4DA 3HHLA 2P9GA 3KJNB 1HBMA 1O8BA 3IS9B 4OJ3A 5E3AA 4F4KA 1X5TA 3K5OA 4N5SA 4DR7F 3NCRA 4LBHA 4DX6A 1V3ZA 2XMTA 3ITHA 3DYAA 1G7CB 1X7VA 4AYBD 1CJTB 4NRUA 3R2CJ 2BW2A 1SC1B 4Q7AA 3LGNA 3N28A 5EUHA 3ITHB 4B3RJ 2NXJA 3M8PA 2VICA 2QEXS 3PKMA 1S49A 4B08A 1UVLA 1MNEA 2NZ4A 2PD1A 1T3OA 3OFFA 5B0GA 4FS2A 4YP3A 3RUBL 3M6WA 1CJVB 1QAIA 2HQCA 1JLFA 4LQ9A 4K2JA 3J81U 3G4SS 1TAUA 1VLYA 2FY8A 4H4KC 4DV0F 3CCRS 4OX8A 1RQ0A 3W61A 1T05B 3CCZA 1GT8A 3W64A 3G82B 2LXUA 1VRTB 3M9NB 3C6TA 1W2BR 2P6TA 5IWAF 4IR9A 1NO8A 3MEGA 1QD1A 3MMCB 1DLOA 3Q8RB 3CCSS 1ZETA 4HLBA 4JYAJ 2J0XA 4TY8A 1B0PA 1HBOB 4FYWB 5G4DA 3C8YA 2FZCB 3RZAA 2LECA 3G2XA 2D3O1 1FRJA 4R5PB 3KG0A 5CCMA 3TAPA 1FDAA 3NCQA 2COLA 3HKWA 3BPSP 1M1HA 4PWDA 1EJ7L 1SBRA 2CWXA 1KOOA 3NS7B 3PFOA 3VZIA 4JI4F 4RW9B 3RW7A 3KXDA 1RWVB 3VAFA 2MLXA 3OTBA 1XR7A 2D3UA 4O3SA 2XYPB 1HNIB 1S1VB 3NKYA 3OR2A 3B8HA 4NLRA 3BQ0A 2RVJA 2ZH6A 3D3BJ 2CPDA 3UDEA 5C5JA 4I56A 3D5MA 1YKWA 4NRTA 1HWIA 1ZZFA 2ALYB 4WP9A 6FDRA 2DGQA 1KVJA 3MR5A 1KRPA 3A8EA 2WOMB 1KFSA 5I42A 4LF8J 3DGPB 4PG6A 1B4SA 1QDUB 1RT2B 4WKYA 1VOMA 1E6VB 1BWEA 4QZVB 2RAQA 5LOQA 2ZH2A 4YB7A 2K7KA 1RT5A 4PQAA 3CC4S 1HQUA 3IR7B 3SBMA 1QVGR 1RWKB 1F0XA 3MFHA 3G6YA 2E1PA 1VQ9S 3AHPA 4EU0A 3GTYX 5KFGA 2XGQA 2UXCF 3AD7C 2GHVC 1Z2ZA 3I0SB 3MOZA 5AXLA 3L7UA 3MMJA 4LF7F 3E01B 3PO4A 1SJFA 4O3RA 5LSOA 1SV5B 1S57A 5D4PA 3SXLA 1WTFA 4AXIA 2R2UA 3IAM9 1FJEB 4NCBA 4F0HA 1SB6A 1JJCB 3GG0A 5BYSA 8RUCA 3CJ0A 3PKYA 2DHAA 2E5JA 1Q8LA 4K5SA 2WB4A 1NK9A 5CYQA 1RCOB 3AT1B 1OSDA 3FFIA 4PEOA 3D3CJ 3GYNA 1WNEA 1ICEB 1N5VA 1VISA 4RBUA 2HNDA 4EMDA 4WZMA 4I7FA 4LRAA 2LXIA 4OYAA 1ZA2B 4RO0A 1S1XA 5D78A 1DAXA 3T1HJ 1N32J 2WAQD 3FEXB 2QA1A 4FKXA 4QPXA 5KTQA 2KT3A 4IOCQ 4GVBA 5EDWA 3FQLA 3GV8B 2LEPA 4ECTA 1QUVA 4KGXB 3RRHA 3HI9A 2JEGA 2UXCJ 2DIVA 4OJ1A 5FDLA 1B7FA 3CULA 4DHVA 1FJGF 2RH3A 1SJRA 4DJBA 5EGYA 1JLEA 2O67A 4R8UB 3NGKA 3LUYA 2OJ3A 1TUVA 4F7VA 4P75A 1D1UA 5CYMB 3FCWA 1JLBA 2FUG9 1IBKJ 1FCAA 3RR7A 1FRMA 2CDRB 2A6OA 2UUAJ 4AUKA 3NGSA 2IRYA 3VVTA 3F0NA 2Y9HA 3AOBA 2LEAA 1S6QA 1U8SA 1ZM3A 3IWNC 1MLAA 3BYPA 3LA0A 1S6QB 2VH7A 3M2VB 1V6HA 3N6LA 1U49A 4W98A 5DGAA 3OXLA 1HMVB 3L4BC 1S5ZA 2HGLA 4CO5A 5HVHA 2CZ4A 4P71A 1QAYA 3R7BB 1FE0A 4FZVA 4ZK7M 5KG1A 3JYTB 4OZ5A 1N32F 3KHRA 1RT1B 2LXFA 2RMLA 3K58A 1YI2S 3D6TB 4N76A 3I4HX 4DCJB 2K06A 2E1RA 4FKYA 4QW8A 5LM7E 2HWIA 2KG0A 1M5HA 2L9WA 1YLXA 4DSJA 3R8YA 4CH1A 3O5TB 3P3DA 4ZPTR 4USMA 1EQ0A 2AW0A 2XCPA 4NCGA 1UETA 4UQTA 4QBUA 2NXEA 4QWEA 4ILLA 2X3GA 2QLXA 4OV1A 2HFZA 4B3TF 2KXHA 1GMVA 1CJKB 3BGUA 1WHYA 2C1EB 2CZ9A 4IQXA 1XNRJ 2R42A 3OSNA 5EWGA 3K17A 2BE2B 3H0PA 1K8AT 1DTTB 1YGYA 1VQMS 3AFGA 3B4MA 1HPZB 2E5LJ 4YHHJ 3MAHA 1RAFB 2W7PA 4B9SA 3NNHA 1CC8A 4K4ZA 3R5CA 3EUNA 1N33F 4PQUB 4IH6A 1RA7A 2C2OB 1JLQA 1NSPA 1H2VZ 2ROGA 3FBBA 3VCDA 1AFIA 5JVGQ 1IBLJ 3HD1A 1S48A 2XY7A 2BOAA 4KV8A 1EX8A 1FA0A 1SJ1A 3D9BA 3TA2A 3W9IA 4Q2MA 4AD6A 3R5GA 1CQMA 2CRLA 3FKBA 1N54B 2XLKA 1EQMA 4LF4J 1U1PA 4KBIA 2MZJA 1F1BB 3CIZA 4IUFA 1E6YB 4CLKA 1HBOA 4NXMJ 3B82A 1IVZA 3ILLA 1TKXA 3QAEA 3NAIA 4B9TA 2ZHAA 4U7UD 2YKNB 2RQMA 2XMMA 2LKZA 2KN4A 5IOLA 4X4PA 3R1HA 3W2VB 4Y00A 2G13A 2L9NA 4HI2A 4ZVUB 1NHVA 5ETPA 1IKWA 1UFLA 1NCLA 3PACA 4LF8F 3PR4A 2YTCA 4WBFA 4FN5A 2W9AA 2YPYA 3J80Y 4DV1J 1IR2A 2CPIA 3A4TA 2DB1A 3PEHA 4J90A 2UP1A 1KHVA 1ZTWA 3TANA 3Q2SC 3AQPA 5FD1A 4DV6J 1H72C 1JWWA 1MN9A 5L8RC 3H8YA 4C0BA 4DEZA 4UUXA 5IZHA 2DGTA 2VIHA 4P7TA 4KHPJ 2BE2A 3PW0A 3BB5A 4LFBJ 1VQKS 4CLWA 3MWBA 3OTCA 2PMWA 3CB4A 4USWA 1WEYA 3FFIB 4HHJA 4MK7A 5KFUA 4PG5A 4HT7A 4TLRA 5KFHA 5LMNF 4KY3A 2Y1RI 1FNXH 1EAYC 1O51A 2I0XA 2MZRA 4KH1B 4TXSA 1QTNB 2BQUA 1SL1A 4G1PA 4TNOA 1REVB 1TV6B 2DGVA 1P1LA 3QFWA 2YKQA 4YEAA 3OLBA 1SL0A 3W9HA 1Q95G 1RU2A 3K8VA 3PYDA 5E7OB 3CWJA 1F9FA 3I82A 3NP5A 4NLSA 3U1MA 3V81A 2IY5B 1WDDA 3TO8A 2XULA 4XAKA 3M8SA 4Z2XA 4J9LA 1LWEB 2DGSA 3Q83A 1PJ5A 3DOLB 4M5LA 1IKVB 2CFXA 4QIWD 3BGLA 3NWGA 5D15A 2KFYA 4LSNB 4TU8A 5B0BA 2ASJA 2ASYA 1N5QA 3HLUA 1JLAB 1EARA 3P4UB 2KYXA 4PABA 4Y2CA 5I3UB 4JI0F 1IBMJ 1OMSA 2AQ4A 3T5LA 2AIRB 2EKNA 3FGVA 3GJSB 5E33A 2Y1JA 2FGCA 4ZVEA 2AJFE 4ZCMA 4PAAA 5BR8J 4U95A 1BE4A 2VG7B 3M9MB 3QZ7A 3GWCA 1X4GA 3HXMA 3HKZD 3BBCA 4CYUA 5HBMB 2BKNA 1RHRB 4O3OA 4GKJJ 3DDNA 1F9EB 2M52A 3HPOA 3OV7A 4OX9F 3QJJA 1S9EB 1VCTA 4U67Q 2EPIA 3KMSA 4IDKB 2Y3YA 2UXDF 1LV5A 1HYSB 2WONB 5HANA 2IFXA 2DH9A 4ED2A 2B4OA 3IR5B 2F5GA 4YB5A 4WKRA 4GMKA 1PC5A 2GV1A 3TQ1A 1RTHA 1KN6A 2PE8A 3CMES 5J1NA 3MPVA 3OL8A 2W9BB 2MSTA 1BQNB 3BZQA 1RACB 2M2BA 3MM9A 3S7RA 3K2YA 4CI0B 3KLGA 1HBMB 4ILMA 2BACA 7FD1A 1IN0A 4A8YA 4FPIA 5KT6A 3EMTA 4OHWA 4ZIWA 5DM6Q 1SKRA 1HHTP 1M5PC 4JV5J 3M2VA 1T9WA 3W66A 4CO3A 4QU6A 3HF5A 4USKA 5HVGA 3UCGA 2AZ1A 1S7HA 1LKZA 5GAEI 1NH8A 1PIEA 4DUYJ 3J7ZT 2EBGA 3DLJA 4QYZJ 1BXNA 1NK6A 5L1JA 1C4CA 2XY5A 2OIHA 2LYVA 4DR1F 3RAXA 2XG8A 4YY3F 3ILJA 4RWXA 4C8YA 1ROFA 2CQPA 3DM2B 5A0YA 4C8MA 5GADI 3NNCA 4MTPA 1HNXF 1AYEA 5FLXY 4QIVA 3GFZA 3LGHA 3TJ8A 3CJKA 4C0HA 2YWFA 2OKQA 3ULHA 3BPDA 5KFDA 4ZJLA 2DVIA 5IS2A 1T05A 4ZLLA 1TZ0A 3CD6S 1HBNB 2XWXA 3EM1A 4ZPCA 5KT5A 2ZJRQ 1C4AA 1X4HA 2HHPA 2I9SA 5LMUF 2MJUA 1G1XA 3MTJA 2XY6A 2QJ3A 3WX8A 2BJ7A 2QL7B 4IG3A 3ZZPA 3WHIA 4L3KA 5J1EA 5HP1A 2D9OA 2D41A 2WVFA 1KLNA 3Q23A 3HCXA 2W4PA 5KG0A 1WG1A 2B7CB 5K8MA 1ZM9A 3KHHA 4QYRA 1RAIB 3QSIA 5I3PA 2N3OA 2EEYA 4PCQA 2R8JA 2BXJA 2WVEA 3MM5B 4H4OB 2HBYB 5H9EJ 3UD4P 1JLGB 1J5EF 3N6NA 1T0TV 2QV6A 1UCNA 3R3TA 1WF1A 4GO5X 4H54A 4IKAA 1JIHA 1NJWA 3HD2A 5A2QU 1T8EA 2RS8A 3M6XA 3A3PB 3UDVA 2C3YA 4DUZF 4LFAF 2W8LA 2XQCA 3GR0A 4Q8FA 3PEJA 4Y2AA 5KG7A 1M5VC 3JSYA 1RP5A 1VBKA 4ENOA 1U25A 5DQHA 2G2OA 1U24A 1YRUA 5SZTA 2RUSA 1T9VA 4P6QA 3QAUA 4B17A 1PGZA 1QSSA 2KXFA 3A3OB 2FJXA 1K47A 2FB0A 2K3IA 4Y2IA 1UWBB 2FJAB 2FYXA 5KFKA 3GSDA 1NZ8A 2B9EA 1KWMA 3CJ3A 3OW2R 2YBVA 1DTQB 1O5JA 2VL1A 3ISND 2Z57B 4MKVA 1UPMB 2QE5A 4CO0A 3QT5A 1WELA 2HS0A 3BDEA 5K8OA 3MCMA 3IBCB 3HVTB 5KFBA 1LWEA 5M2PA 1U2RA 1X8DA 2GVDB 1WEXA 2HFNA 2V2VA 3ZTSA 4RNHA 2QSWA 3OTDA 2KT2A 4A8SA 2YNGB 5L1KA 2LEBA 4ED3A 3OL6A 1RT6A 3DOKB 2KB2A 3KJVA 4RW8B 2CQ2A 4KRWA 4ZIVA 2MQPA 4RUHA 3SYZA 1H74A 4S0MA 2ZVIA 4O3NA 5C24B 5HMXA 1CS4B 1RT4A 2ZHOA 1XEZA 2BJEA 4KFBB 3I5CA 1X4FA 2G1DA 5A8WA 4UY8T 2P6SA 1HARA 3AJ1A 5F41A 1FNOA 2A2DA 1ELOA 2KO1A 1RGVA 4GRSA 2F9DA 2B51A 1ZA1B 4ICLA 1RAAB 3KJQB 2IA0A 5B0DA 1TK5A 1UEVA 3KWMA 4N7TA 5I4MA 2UV8G 4LQ3A 3KUGA 1TL1A 3D2WA 4Q0BB 3M8QA 2PGCA 3OTOF 2AYMA 1GMUA 2J9DE 2AJ0A 4A8OA 3BSCA 4CLLA 3QGGA 4P52A 2DXDA 3BEGB 4LFCF 2ERRA 4URQU 2WVDA 4EI2A 4DSFA 1S1UA 5DO2A 2DGOA 2NUUG 1TAQA 1K73T 2JHEA 3NBPB 2G2YA 2HBQB 4Q45A 4DPWA 1HLWA 1CULB 1JKHB 1JLBB 5AE1A 2BJ3A 3LGMA 4JV1A 1HIYA 4OFZA 2AP6A 2MZ1A 1FKOB 3MEEA 3K5NA 2VQFJ 3MDFA 4DV5F 4CT8A 1RBOB 1PCAA 4IO9Q 1XERA 1OS5A 1U0HB 2GVZA 3I0RB 1R7IA 1EHWA 1RTIB 5E41A 1N36F 3OL7A 1KP6A 3QIPA 1WUUA 2MZSA 1HWJA 1C0TA 2EBEA 2I8EA 2Z4PA 5LSLA 2LU2A 2FTRA 2XLJA 1Q82T 3KJVB 2E1AA 3TUPA 4AXJA 2I2YA 4N77A 1QSYA 3CMQA 2KG1A 2YQ1A 4JV5F 1TL5A 1R0AB 4FYVB 2NLWA 1YIJS 2I1RA 4RX6A 4EBDA 2P2CB 4DL4A 2JVRA 3E8OA 2UXBJ 3IBFB 3UE2A 1WKKA 4NE9C 5LSRA 1EETB 1I5OB 1DBDA 3DI6B 2Q79A 4G1QB 2IM3A 1BLUA 3R9LA 1JLCB 1A0OB 2AZ3A 4LR9A 2DNLA 2J6UA 2F7VA 4CLSA 2DK2A 3DMJA 4DMZA 4M5HA 2VU5A 2YVSA 4K8RA 3OVAA 1P1TA 4DL7A 3E51A 1XNRF 2IM2A 2GNKA 4MAKA 2I38A 2XMUA 4CLTA 4DPOA 5DDRC 3G6XA 3OR1A 1S4FA 4J91A 2VQFF 4V19J 2H3EB 4WU2A 4CZCA 2IRUA 4C9DA 2HQDA 4Z7YA 3SMZA 4J9VA 3T3FA 1FRKA 1KQSR 4Q44A 4LR8A 1FJ7A 1TR0A 2DRBA 5BXIA 2V2QA 2YWEA 1JLGA 3DNCA 2ZBQA 5A8KB 3EPGA 1U1OA 4CTAA 3KK1A 2KFNA 4WFBQ 1RWMB 5LXRA 1TKDA 2KZZA 1WC4A 3V6JA 2CJAA 1XR5A 3SQGB 4DR2F 4K7QA 3BSAA 4CTAB 1U0HA 2IBOA 5M2RA 4IYQA 2CQHA 1D9FA 2ACMA 2J9CA 2MGZA 4WE1B 1IBLF 3KLIA 3ZZRA 4B9MA 1WI8A 2E9TA 4WU3A 5ETQA 4JI1F 3OD2A 4DLGA 3CW2C 1Q0NA 3NS6A 5EX0A 1L5UA 2M7SA 2OHDA 3FRYA 2BKOA 3OFHA 4LSLB 4C7QA 1D3WA 5D0GA 3K8WA 4ZHRA 1HD0A 4DBQA 3EGNA 3NL0A 2J0SD 4ZDNA 1UL3A 1MMNA 4EUVA 2GW8A 2YNHA 2YWKA 2M9KA 1XMQJ 3RYLA 1T9XA 4EO8A 3J7YI 5C42A 5KFFA 2ZITA 1RAEB 2DR5A 1FRXA 4K50A 4NLXA 4YS2A 2VPYB 4L75A 1SL2A 1H3DA 1LWFB 1IQZA 2PMHA 3LQVA 1LXNA 3MAAA 4X4OA 4OJGA 2OPSB 1J5EJ 4Q8EA 2RKIB 3DMJB 2IJRA 3U1LA 1VBZA 3CJRA 2V0NA 4X66J 5D8HB 3DLEA 1REGX 5CD4A 2RKIA 3G86A 4JI2F 3U7JA 5KFNA 2DNHA 3BO2A 3TUJC 3NGTA 3FCVA 2HVZA 4J9KA 1VQYA 3RRKA 2GGPA 4IG0A 2X1GA 4I6YA 4DL2A 4DFMA 3VZHA 4P73A 4RUBA 1VGYA 2J9EA 3KFWX 2LLZA 3T9NA 1B64A 3EGVA 4OZNA 4ZA1A 3QO9B 4D3GA 4WF9Q 1FHTA 4AL6A 2XEXA 1FKPA 1V5VA 4NLGA 3SCLE 4I2PA 5T7LA 1TUWA 3P45B 2CQ4A 3FRZA 2UUBJ 3C6UA 1AB8A 1LOUA 3M6VA 4CP5A 3PHEA 4I2PB 4RNOA 1BGXT 2FLLA 3CO0P 4RPFA 2RUGA 1L3VA 2HQIA 3R6GB 4NPOA 1T03B 1HA1A 2ZNZA 2IAJB 3VALA 1WOSA 1R43A 1WOOA 4LIRA 3TOQA 2C28A 2YKOA 2ABYA 4C8NA 2GJ2A 3LP1B 4YB6A 4CLFA 2G2ZA 4ED0A 4EZ9A 1JKHA 2Z2LA 4K4XA 1HNIA 1S1VA 3OR2B 1CBKA 1PJ7A 2B7BB 4P74A 4RW8A 5KFMA 3V4IA 4O0NA 3C2PA 3MGJA 3WX4A 1JLAA 5I3UA 1R8PA 4YR3A 1C2PA 2VA2A 4FVMA 5DDQC 2V4JA 1UEUA 1HI1A 3WIVA 2IMWP 1LWFA 2BJ9A 4PWUA 2BR0A 1NMEB 5F8IA 3OBIA 3T6BA 3KK3A 1TUGB 4LF6J 3V6DA 3O6QA 4DUZJ 1S77D 1H2TZ 3B78A 3G8SA 2ZE2B 2D9PA 3MR7A 4USIA 2H9ZA 4FS1A 4QWBA 4MFBA 5BR8F 4NXNF 1L3UA 2ZH7A 3J81Y 2OTLS 2ZM6J 2DXEA 5KFEA 2CYYA 3KJFB 2D1CA 2CJXB 3D54A 1S72S 2F65A 4RBVA 3KLFB 1KQGB 1SJ4P 1MG7A 3U27A 4P2SA 1R3NA 2BE7D 4U8YA 2IM1A 2VKRA 3NBPA 3W62A 3ZZYA 1U26A 2HURA 3RGIA 4J9PA 2QMXA 5GAGU 2ACYA 5F3TA 5L9NA 1WI6A 2NXUA 4RUCA 2QIFA 3HULA 4QJVA 2HW3A 4ES3A 4DSEA 5E3CA 3PX0A 2GQQA 1S10A 1RWUA 5RUBA 4EBEA 2CAJA 1KNZA 2I6WA 4XPCA 2ZJQQ 1P8GA 2KRRA 3ILIA 4R25A 2B5JB 3EJMA 3LP1A 2QYGA 3VHQA 1DRZA 4DOZA 2VZ9A 3G96A 3C16B 3QLHB 4DV2F 4RW6A 2KL8A 2Y8YA 1TK0A 2QMWA 2I5JB 3G8QA 7AT1B 4NXNJ 2YWWA 1UVIA 2J9DA 3NOGA 4RUAA 2OI2A 3EZOA 3KOAA 1NDKA 1U6FA 3C15A 2VJUA 3JSMA 1FX4A 2HMIA 1W2IA 3V6DB 1R0BG 4NA3A 1Y4ZB 1UW4A 1UPPA 1VMBA 8ATCB 3OPKA 1U6ZA 2Z2YB 3MR2A 2AF6A 3IGVA 4CO2A 1ZBTA 1A6LA 5KFOA 2DBBA 2W24A 4ZVFA 4ZLPA 1KD1T 2HMIB 4OHYA 1APSA 4P2MA 3IM8A 3DOMB 3HHKA 2BJDA 2OMLA 3ZO7A 4XO0A 2OO4A 2R8IA 1KSPA 2FVSA 5DQIA 4D3HA 2QFJA 4WPAA 2X3DA 2E29A 3GIKA 1IKXB 3BF4A 3GQCA 1RT3A 4MYUA 3OSPA 1Q79A 1QUPA 1P9QC 2ZOGA 2V8GA 1IKXA 2BX6A 1XBWA 4HTJA 4B3RF 1IM4A 2YKNA 4HTIA 1HWKA 4Y34A 3UPFA 3VGTA 4HH0A 1H98A 3O44A 3UI3A 4ECSA 3DLBA 3I96A 4J9MA 4P2FA 3BQ1A 4Y0FA 4LF9J 3B4DA 3DRPA 3KLHB 2DR8A 4CNZA 1TKTB 1FWLA 2YWGA 1SIWB 3ADAC 2GZOA 3PDNA 4JI1J 2LQ8A 4JI7J 2OMOA 2EFPA 2OFGX 3SEOA 3CD5A 3R5AA 5K8PA 1KEKA 1MWQA 2XGPA 1RYSA 4PWDB 4FDFA 4ED4A 4O0IA 3O8WA 3G71S 3HHLD 2J76E 3G87A 1JQGA 1VHFA 2GX8A 3AXKA 3DYAB 4GVLA 2VV5A 4ZHRB 4DF4A 2PT0A 4JI6F 3OTEA 3DU6A 3PZPA 3ET6A 2M88A 1KKHA 4X2BA 2UVRA 2VKZG 3A8IA 1RKJA 1VDHA 2FY1A 2RILA 1AZSA 3M8WA 3KTQA 2RIJA 1YJ9S 2O5DA 2M4MA 4Y3CA 1GMWD 3OTOJ 3MAAB 1S7IA 4PRFA 1JB0C 1QSLA 1NB2A 1RZMA 4OV6A 3T9ZA 4MKYA 3ENWA 1K0VA 4KKOA 1WG4A 1YBAA 4YR0A 1VC0A 1G6BA 1KTVA 1UVKA 3NEKA 3P96A 1RAGB 4TU9A 2HZVA 4GC6A 2FJBB 4CCHA 4QWDA 1UJ4A 4TY9A 2CJKA 1W7WA 3MURP 1N0VC 3EWGA 2OLWA 4DWIA 4UT4A 2N4DA 3LTOA 2MDAA 3JQMA 5D0EA 4JI8J 3H5XA 3AB2B 2XMAA 4FPRA 3KK3B 2BVZA 4DQPA 3QO9A 5BJRA 1LNQA 3RBZA 3DRSA 1U0SA 4NI2B 4CM0A 4O44B 3W3SA 4CO4A 1N5SA 1SV5A 1HR0J 4C98A 2JEFA 5HROB 4CQ1A 2XTJP 2RS2A 2PA8D 3GYXB 3VAGA 1BC6A 2MQLA 4XDDA 4YB1P 2VG7A 3M1VA 2VOOA 1XMOF 3CDEA 4K4WA 3Q8YA 2YX4A 3LO3A 5HBMA 4CYUB 4DQIA 4LF5J 4USVA 2MEWA 1HBUA 1IBKF 3TUIC 4I1TA 4MJKA 2RB7A 2K8GA 2OEKA 3ELHA 3ET6B 4LJMA 3GE9A 3HHEA 3OJUA 1S1XB 4B3SF 2HLUA 3D6MB 2VG6A 4A8KA 3H4DA 3UN3A 4ELTA 3EXCX 3R5DA 1J2VA 2JLGA 1NK4A 1VK8A 3HSZA 1BHNA 1T94A 1Y3KA 2HKEA 4JI6J 4DQRA 4ETZA 2EK6A 3AXMA 3FSYA 2ZBRA 3M2UA 4PYAA 3C16A 2EWHA 3FC9A 4N8OA 2ZFHA 1SQEA 2DIUA 1BMQB 1VC6A 1NDLA 4F3QA 2Z58B 2A18A 4DZDA 1ZAXA 3KLGB 4DV7J 4UY85 3HJVA 3MD1A 2AJ4A 4DV4J 4DUTA 2G1HA 2PDAA 5KG4A 3UO0A 1MU2B 1N34J 3RB3A 2K3KA 3MPDA 4EFAC 2KI2A 5IQ6A 2EFOA 3JSRA 1DTTA 1EP4B 2MHNA 2CUYA 2EC0A 1UA1A 1KLMB 1CJTA 1OY6A 4ELUA 2AEFA 2CPZA 2W01A 2DNKA 2ZH3A 3PYGA 5EHHA 2MQOA 4AFFA 3PO5A 1IWAA 5ETTA 2R8GA 3J7A1 3HZEA 2V4QA 3H5SA 4HL9A 2QGFB 2U1AA 3G82A 5F8HA 1R6VA 1X5PA 1AUDA 4WFZA 4DXLA 4EWTA 3KLEA 2M8HA 2XZTB 1F5AA 2QZ8A 2Z8QA 3MCOA 4K2XA 6FD1A 5J2PB 3SI8A 1QTMA 5C2GA 1KS2A 4NMXA 2PEBA 2VD3A 2OGUA 1PAEX 5GAGI 2I5JA 3GV5B 5FJ4A 3HM9A 2OH2A 5JVHQ 1K1SA 2QX0A 1TFWA 1TKXB 5DZ7A 3OFEA 3DXSX 2W7OA 2HFUA 4RW9A 4EBCA 1YITS 1OJ4A 3VAJA 2F4FA 3UN5A 1NJYA 4HHHA 1KHWA 4ZVGA 3BSNA 5DM7Q 3PYFA 2V8DA 1XC9A 3LP2A 5HMZA 3BN7A 3NOCA 1RWXB 4ZP9A 3GJTB 3LPEA 3MUMP 3CJQA 4DFKA 4WZQA 3AA9A 1GXLA 2QRRA 4LSLA 5ETOA 1L3TA 3AH6A 3IP0A 2FIUA 3N5FA 5JUMA 1WSRA 1OY9A 3W65A 1Y00A 2OPQA 2BQ3A 4BWJA 2CDQA 5B0AA 2IRXA 3V2UC 5CABA 1S79A 4K4TA 3SCKE 2YKMB 1R27B 4X64J 2VFSA 5B09A 2BA9A 4LIWA 2BANA 3SCJE 3W5XA 1T9YA 3DLGB 3HSJA 3GB0A 4RNFA 2KJVA 2YKMA 5JMNA 4DL6A 1YJUA 2V8PA 4M94A 1URRA 5D0RA 3PW7A 1HWUA 2GIFA 3K89A 3M30A 3DM2A 1SCJB 5I42B 1N33J 2HHVA 4QIGA 5KG3A 4RZRA 3BQ2A 1KVKA 2MYFA 3W5ZA 4RW7B 4ZP7A 2ZWOA 3M32B 1WC1A 1S97A 1UJ5A 1HBNA 3I31A 4M5IA 2C2NA 4YDXA 4TVAB 2AYBA 4M5KA 3UWTA 4ECWA 2B3TB 3V6HA 1AUSL 3ZTRA 2KXNB 5C24A 4YOEA 2R2RA 3FZ2A 4DI6A 3B54A 3MMBB 2BMBA 2H65B 3C6UB 1VQ8S 2MKCA 1QVFR 3TA0A 4GKJF 2HHTA 1OYEA 3D6HB 1XNQF 4ID5A 4KYZA 1VQOS 3DLLQ 2DEJA 3NMAA 3DXBA 2QO3A 3NCPA 2XZDB 1RUSA 2FZGB 2RHQB 3L09A 4BS2A 1NDPA 1R31A 2FHMA 5L1LA 2OPQB 1R8AA 4OLPA 3A3NB 4R8UA 3I4PA 4Y2KA 5SUHA 4DDFA 5T14A 3V4IB 3TI0A 1NXIA 2H48B 1TQLA 3FBFA 4OLOA 4M5DA 1XQIA 2Q66A 4ZCKA 5H9EK 1PYTA 2R7VA 1HNVB 1IJEB 2J6SA 2HRTA 3J80U 5CZXA 1HI8A 1SQFA 3M2RA 2Q3PA 1SVDA 3W2VA 2HNZB 4CH7A 5IQQA 3MI7X 2VDHA 1X9MA 1LK7A 4X64F 4ECYA 1XMOJ 4LF5F 4DX8H 4CWBA 2HLTA 3FSXA 3PRDA 3VF0B 4NZ6A 4MK8A 4KHRA 1S0VA 5F8GA 2CIMA 2CVEA 5IT4A 2J6TA 2HHSA 2BYCA 1CG2A 4JUZA 1MN7A 4Y6IA 2DT9A 3AA8A 3GIIA 2K7JA 3UCUP 4F4AA 2CPFA 1ZM4A 2WVBA 3JAMY 2PFDA 1DARA 2FLNA 2XMJA 2Q6BA 2R4FA 4O4GA 2AEJA 1H2UX 3ENQA 1ZS6A 5GMDA 4IRCA 4FXWA 2XYGB 3CCTA 1F5BA 2F40A 2G0JA 2ILZA 2VASA 3FEZA 5ETMA 2V8HA 1B7YB 4J9NA 2R8KA 2VFTA 1P27B 4NZ7A 7FDRA 3CCVS 3DHWC 2LU1A 2NSBA 4O23A 3PY8A 2MQ8A 2H54B 4ZPAA 5HO4A 5J2QB 1V3SA 1TMJA 3GG1A 3POTB 5HMYA 3BGRB 5DDOC 4N56A 1CJKA 1U45A 1R8CA 5IT0A 1NNDA 2IC3B 2OD6A 3MM7A 1YQHA 3BKFA 3TEHB 3H4BA 5A6WA 1ULRA 1TL1B 2B4PA 2GQ2A 3AOCA 3BDPA 4NLYA 2HGNA 3EX7B 1VC5A 4J9UE 1S1WB 5KFZA 4C2MA 4NLUA 5E5NA 3EZ5A 2QLBB 3M7VA 1R8BA 4R0JA 3SDEB 5F8JA 4DR5J 1S1TB 4CLPA 1VRUB 3E2EA 2E7WA 2G9OA 1UFWA 3UW1A 4NOHA 1F2HA 4NA2A 2ZDPA 4C3LA 2PI5A 3VAHA 2JRSA 1M90T 2PN6A 2FGOA 1GNKA 2AX1A 3SSQA 4V1Ak 3OHAA 3T5KA 4JI2J 2V5HG 3QGHA 4MIWA 4U9RA 4A46A 3OJSA 4DR2J 4YQWA 4ELVA 1YRXA 2CZVC 2NYHA 2OUGA 4IR1A 3TVZA 3PXGa 2PO4A 2UV8A 2G4BA 1OWXA 5DG9A 3BO3A 2UVWA 2ZC3A 1RB0A 2ZUGA 3ISNC 4MH8A 4OZLA 3KUHA 4UTGA 1KFDA 5ETRA 3ZNUA 3K57A 2H51B 2WONA 3D66A 4OI1A 1FT8A 1EB0A 4DQSA 2J0WA 4WYWA 4ECXA 3IWXA 1WC6A 3GIJA 4W90B 1WF2A 1HNWJ 1TK8A 3Q8PB 3DRYA 3I0SA 1UA0A 2IA6A 1TL7B 2HVDA 3HK2A 1CSJA 3ZZ0A 5E3PA 3JXOA 2CQGA 2BOPA 4C8LA 4IRKA 2AHOB 3L9ZA 3N4WA 1X0PA 4PYDA 3SQOP 1IR0A 4IFVA 4CNYA 3PW4A 3RAQA 2HHWA 2DD8S 4X4SA 1X9SA 1FI4A 5HSPA 3DOKA 3NNAA 1HQEA 4DU7A 1XN9A 2IHR1 1RAHB 3QZ8A 2KFZA 1RLDA 2CJYB 5CYQB 3MM5A 4H4OA 4L76A 2E5HA 2WSEC 1VQ5S 2XLIA 4ES1A 1XMBA 2W2OP 3Q8UA 3T5HA 4PXBA 2C3MA 1SC6A 4A48A 3CDBA 3QGPA 5E2QA 5HK4A 2V9WA 1L3KA 2LQ9A 1WHXA 1S9FA 2UVUA 1HW9A 2FJEB 2ZNYA 4LRBA 4LFCJ 3AJ2A 4PR6A 3U1NA 4EYHB 3B6BA 3ZNJ1 2RHSB 4C11A 4JI7F 3NRBA 3TAQA 5DLFA 1TVRB 5HQ8A 4OX9J 2OD4A 2HS3A 3BBFA 3FBEA 4OYMA 2GVDA 1Y3JA 1Q5VA 3BREA 3TYTA 1YWXA 2MPUA 3FJ2A 3HDSA 2CJBA 2HQFA 3EVMA 1I94J 4ZCLA 1X31C 4HDGA 1U1MA 3TZWA 1TL3B 4TKTA 5K8NA 2GMHA 2XHWA 1F9HA 3I5BA 3SIPB 2U2FA 1FF2A 1VFJA 1OO0B 2WVCA 3V6KA 1F2GA 2DYAA 1S9GB 4IFVB 5IC4B 1Y11A 3BN4A 4JV2A 4KB7A 5HMWA 2E66A 2EW9A 4I6WA 1S9EA 5HQMA 4ECUA 4X62F 2L41A 3QRQA 3T1AA 2F3JA 5A6PA 2AU0A 4I69A 4KFBA 1S9GA 4OYBA 1H0HB 5F9NA 2C2DA 2XZWA 3I5AA 4GVBB 2AJQA 2ZH8A 1PO6A 1R8HA 2IM0A 4MIBA 4DG1B 1PG5B 4DR3J 2BZ2A 1N5TA 1DHMA 4MT1A 3ZZUA 2VQEJ 2Z2MA 3FNNA 4F8RA 2ZVSA 1HYSA 2DY1A 2RRBA 4F4XA 2CQDA 4HACA 2YX7A 4OZ2A 3UFCX 1SH2A 1M1GA 2K1RB 1PBAA 2RE1A 2QMUB 3D1HA 4O3QA 3VTIA 2WRMA 5KFQA 1RTJB 1SXLA 2VUGA 3QWUA 2R7XA 2P8IA 3OFGA 2EVZA 4LFBF 3MTKA 2CNKB 2QFIA 4MIAA 3NG8A 1JXLA 3P6YC 3TJ9A 2ZHBA 2YNIA 1CULA 2E5IA 1Z2LA 2FVCA 3AQOA 3EYZA 4C8KA 1OPIA 1VRUA 4F36A 2KYZA 5LT5A 1JX4A 3DKDA 3JB9k 3QGIA 1CPZA 1Y5LB 2JC0A 2N7CA 3PIPQ 1C1CB 4P72A 3WIUA 1U6BA 1F3VA 1U1LA 3MM6B 3W60A 1C1BB 4OI4A 4Z37A 2W8KA 3CCES 3ENVA 2CG8A 4RBTA 5DETA 5HJYA 3T1YF 5IM0B 3ETMA 4KV8B 2E9ZA 5DS7A 1NZAA 1Y5NB 1HKAA 5AT1B 4DLEA 4FF4A 4GKKF 5KG2A 2V94A 1WHWA 3AAWB 1CJUB 3GSIA 3JQJA 1YJ7A 3FUYA 4HVZA 1IXKA 5IM0A 5J2QA 2ASLA 4RNMA 3SFGA 2X1BA 3W8GA 3WQPA 2XSJA 1WWHA 2SXLA 4H4MA 2YPZA 3GMGA 4OZJA 2CPJA 5F0UA 3R7SB 4XDCA 4M95A 1IQTA 2QN6B 3TAMA 2FJDB 2O66A 3M8YA 3PTWA 2F4VJ 2XSJB 2GJIA 1HL6A 1RCXB 1VS3A 3GP9A 1U2CA 1H73A 4ZS6A 5AE2A 3TAMB 4I68A 5A0YB 2JL9A 2HVEA 2O1PA 4O3PA 3O3LA 4E8UA 2WHOA 2ZZTA 5CD4H 1H38A 2HWHA 1PJ6A 2Z30B 5KFXA 3UR3C 2C3PA 1YBTA 1FVSA 5EX3A 2PIIA 3US5A 4E98A 4NCAA 1QE1B 4G6VB 1NK8A 3MCNA 1U7LA 2J7KA 2XWYA 2OPRA 3IR6B 4I6AA 2MKSA 3KNGA 3ONQA 5KG6A 3OUYA 3MFIA 4HYKA 4A8FA 3R2DJ 2EFQA 4LFAJ 3KLHA 2CKWA 1TKTA 4KAIA 4U6PA 3MOJB 3DLEB 4ZPDA 2F63A 1RU1A 3OUYB 1KQFB 1NJZA 2Y0BB 2FPHX 3RW6A 3M4XA 1D0EA 2MZTA 2R7QA 2MSSA 3HVRA 2NSCA 3KLIB 3J81j 1XNQJ 3EGZA 2MXYA 1N52B 3BYRA 4KPYA 4JB8B 1NPPA 2HAFA 4FYYB 2H5IB 4LF2A 4IH5A 4DV4F 5F8NA 1WDTA 3TWZA 2F9JA 1RWPB 4DV6F 3QRPA 2HS4A 3FSIA 1RYRA 1TL4A 2R3VA 4M8LA 2NCKL 1YJNS 3C46A 4LVOP 3R5BA 3H42A 4HI1A 2BJ1A 4H4MB 3TW0A 3MMAA 4X84A 2ZBPA 4E0DA 4CIOA 1B0TA 4DZ6A 1NJIT 3N79A 1RTDB 2DR9A 1RBLA 3HVTA 3ZZOA 2EXUA 4MMOA 3OR1B 4XPEA 1WHVA 2YQ0A 5J1EB 1HQEB 2Z56B 5DGBA 1LFPA 1MROA 2JWNA 1YSJA 4IH7A 4USUA 4C97A 3ZTPA 1YJVA 2DTJA 2LMIA 3VQTA 1U4BA 2Z0GA 3R27A 1I6JA 1CEZA 2HAIA 5KFPA 3EDQB 3FZBA 4UZCA 3TVYA 1U1NA 1IJFB 5C25A 3BR8A 3PV8A 1RA6A 3HSDA 1TELA 2HVIA 4O44A 1T02A 4CH0S 3EPIA 4K5RA 3HFKA 4IRDA 5A8WB 4G3IA 1VQ6S 1SI9A 2OPRB 2M3DA 2QT7A 4F04B 3DRRB 1GTHA 1VLOA 3GFXA 3CCJS 1VHIA 1KR4A 3FK4A 2MY7A 4ECQA 4FXDA 1HHSA 1RHUB 2V69A 1T7PA 4IQMA 3TX8A 5KOXA 1Y0HA 2DGWA 3QT8A 2NS1B 1FESA 1TVRA 3DRPB 3K5MA 1VBXA 1CVJA 2NQPA 2VBZA 4L72B 4UOFA 2GA7A 4Z7CA 2CA9A 3CDUA 3IXQA 4F25A 4B3OB 1X9WA 3I6PA 5D3GB 5F8LA 3GLJA 2UU9F 1I1GA 2DNNA 2DNPA 2QSFA 4J9QA 4OHZA 2DNOA 5CXTA 1LW2A 3RBEA 3T5JA 2CPEA 2IMOA 1XJWB 2ZM6F 1FEHA 4J5OA 2ROPA 3A1YG 1LXJA 4LR7A 4U8VA 5GMKa 4DFPA 2D3OR 4HT5A 4NLTA 1S0MA 3BO4A 3OXFA 2QLWA 1VQPS 2DCUB 4IOBA 4OX6A 4I67A 3THPA 3NS5A 2RRNA 2RDDA 2A3JA 3MPYA 4NEYA 2QLJB 5F8MA 2QA4G 2XMWA 2ZD1B 4OYPA 5IT9U 1R6YA 3SZ2A 1IKYA 1RI7A 4MKAA 4Q0BA 1U1KA 2GVZB 3I0RA 5G0RB 2V4JB 4DV7F 4PG8A 1ZAWA 2BBEA 1MU2A 1LEOA 1NPKA 1ZM2A 1OYDA 1Y9OA 1YVFA 3I87A 2BW7A 4TN2A 3VGVA 4DG1A 5KT7A 1NK7A 3X3UA 4XK8C 3I9V9 1YX2A 2HHUA 1V9OA 3MHYA 1LWCA 3E01A 3TA1A 1V5IB 1IM6A 1RKIA 2X51A 2FVRA 2DITA 3H98A 4FBTA 3CCMS 2NXCA 3DRSB 4J37A 4NEZA 4NI2A 2AGOA 1N88A 2HBRB 1M0SA 2HPUA 3LAMA 3D7SB 1CJVA 3N0VA 2ATCB 4K0KJ 2KHCA 4QR2A 1FD2A 2IAJA 3HJFA 2F8HA 4PKDB 4FF2A 4K0KF 1K9MT 3VQSA 2CNNB 3UVJB 1RT7A 4AE5A 4ZITA 2IVFB 4YDDB 3I56S 2BEFA 2UUTA 4NWBA 4A8WA 2EI5A 3EZUA 4IFYA 2PC6A 4I7FB 2HHHJ 4OL8A 5KFSA 1AXQA 3DGVA 3MEGB 1QE1A 4K4UA 2O01C 3LOUA 1SH3A 4OI3A 4KTQA 1NM2A 3KKFA 3MM6A 2AV5A 4ZVQB 3S1TA 2CJQA 3M8RA 2XNQA 3CDWA 2MKHA 3HHLC 1F5CA 1FKOA 1RHKB 3M6UA 3MEEB 4ANEA 3Q2TC 2WCXA 3IS9A 4ES2A 2Y1IA 3IM9A 1FKAF 1S59A 3KK2B 2OTJS 2YH1A 2ZH9A 4RW6B 2XO6A 2YQ3A 4HKQA 2IVMA 3M2UB 2JJ4D 5D4NA 2OEMA 1QJHA 4LF1A 2KDOA 5LJ5Y 2HGMA 4X4RA 1AT1B 4OYWA 3OLAA 2R7TA 2JH3A 2APOA 3MECB 3IAS9 3EICA 4KR0B 3W2WA 1MW7A 1YJWS 5KFRA 4WCEQ 3FBCA 4ZVRB 2L3MA 1VJWA 3P5BP 1FFWB 2HIQA 2FVPA 2JLEA 3QFHA 4CM2A 2K2PA 4B3TJ 3UNGC 4QR0A 4DR5F 1GEHA 2AJ1A 2X1AA 5B0CA 2ADBA 4L3NA 4DR6J 2DJWA 3MM8A 2PI4A 3NMRA 5IFMA 2YWHA 4F02A 1MSWD 3HT0A 5KFCA 4QWAA 2D3ZA 4PPZA 1MWZA 2R7WA 3TZZA 5U47A 1NHKL 2GMJA 4HHUA 4RW7A 3IWLA 1JLFB 3Q8VA 2NPFA 4WXWA 1RE1B 3S01A 4ERDA 3UD3P 1UP1A 3IFEA 1LW0A 1S6UA 3Q24A 3KHLA 2HVHA 2AJ2A 1OPZA 4DUYF 2FDNA 3PX4A 2BDPA 1A9NB 4TYBA 4A8MP 5DDPC 1N56A 2HFSA 1N6QA 1B3TA 1U09A 3FMBA 1RSCA 3MCSA 1BD6A 4ILRA 3A8JA 3H5YA 3D1OA 1DTQA 2NZCA 2NPIA 1FE4A 5HQLA 3LP0A 4Q5VA 3TUZC 1U8WA 4WFAQ 1Y7PA 2HFOA 5K20B 1NKBA 2GHPA 5DG7A 4RL1A 2EG2A 4NLVA 3BH6B 3L95X 1WTBA 2DHHA 2GC8A 1DJ0A 3ISZA 2BRLA 2WTFA 1AZSB 4ZLNA 4X4UA 1NK0A 1YRTA 2HSEB 1CLFA 4JP8A 3PFEA 3QWPA 3OL9A 3CE8A 3DRXA 2R2SA 3D67A 4AL5A 2C2RA 1URNA 5CQGA 4NYOA 4BCAA 2DO0A 2CADA 4CLYA 1NLKL 2MQMA 5KT2A 2PEHA 2JEIA 3EXYA 3EE3A 1WC0A 3D0HE 4ZPWR 4NA1A 3W9JA 3QIPB 2VHGA 2BANB 1C0TB 2WOMA 2WSCC 1ZAVA 3QJLA 3N5BA 1SKUB 1YJTA 2V50A 5DJBA 1SUQB 2OPPA 4WP3A 1UWAA 4QW9A 3RB0A 2FLPA 3GJRB 5J1PA 1Y5IB 2VF3A 4LF4F 1RJJA 1HI0P 4DF8A 2Q6CA 4DPXA 4RW4A 2RDJA 1OQ3A 5AXKA 3CEDA 2ZH1A 3DCAA 4DR3F 2RQKA 4I0WA 2X7IA 4X65F 3ICLA 5HROA 3ZTOA 1NRKA 1KLMA 1N0UA 2PA3A 3A13A 2CQBA 4P2XA 5CH7B 5DRKA 2GAGC 3DLKB 3R97A 2RDIA 3JTNA 2GHWA 1YG0A 4F0MA 4ZPVR 3TZYA 3CGIA 4X66F 1NEEA 2ZZNA 1FRHA 2YNFA 2CNLB 4YHHF 3MMBA 1RHMB 2H1YA 3GFYA 1VIXA 3DFEA 2V4RA 1Z4UA 2QL9B 2RU9A 3R5JB 2DNRA 3C19A 2WW8A 4OYZA 3M8ZA 3IG1A 3N6MA 4OZ0A 3G6ES 2OELA 2AWZA 3I9ZA 4H4KA 3P5TL 1UZHA 1VRTA 1HFEL 1WKLA 2HK3A 2VPWB 3K0JA 1G2EA 1JLEB 4F2RA 3VAMA 1Q8KA 4YMEA 2B0GA 4UF4A 4K4YA 3HZGA 2AYEA 4FXVA 2AEMA 5I3QA 2FC8A 4NASA 3BJYA 1HNXJ 1LWCB 3DN9A 1XR6A 3CCLS 3BKTA 4KHMA 2DPJA 1RADB 2F1FA 5EN1A 3T1YJ 2MB0B 4WTOB 4EEYA 3KLVA 2W9BA 4RU2A 1BQXA 2UUCF 4JI3J 3GR1A 1X60A 2MMYA 4DSLA 3CT9A 2VC1A 4ZKAA 2QG9B 4UUWA 3FMWA 3T19A 3WDOA 4PZVA 2XS5A 2NXNA 2JDJA 3VV2B 1HR0F 1ZYQA 4NLPA 3CMAS 4ZVPB 5AXNA 3S6EA 2CG4A 3ZFVA 3JAMU 2VA3A 1JNRB 2UZAA 2XCAA 1N48A 4B3SJ 2VFVA 2PMZD 3MEDB 2AMCB 2A10A 3SV3A 2DHSA 2XC9A 3MUTP 1RK8A 2HNYA 3C14B 3KUEA 3UCZP 2VFUA 1U2FA 3QMQA 4WFYA 3MEDA 3KYLA 1VQ7S 2DHXA 4TQRA 2LFVA 2JEJA 1ITPA 3MPUB 2GAHC 2XNRA 2VPXB 1RT5B 4TQSA 2JNJA 4NX9A 3SV4A 4NLDA 2DHGA 3M30B 2EFVA 5L39A 4ED8A 4DS5A 5A8RB 1VBYA 3RR8A 3BSOA 4B9LA 2E9RX 3CIMA 1FK9B 1WC5A 5HJXA 5ITHA 1I51B 3J7YU 2JFDA 2ALZA 2FHJD 1EIYB 2H5EA 5KT3A 1PBUA 3CC7S 2DNZA 3CO9A 1AROP 2C22A 2ZBCA 4N41A 2HZAA 3MECA 4R5PA 2E5LF 3CVKA 1X4AA 5GMEA 5KG5A 3OXGA 3PIOQ 1U1RA 4ZP8A 2YKPA 3BH7B 2W7AA 5HATA 3JSMB
chains in the Genus database with same CATH topology
2CJ9A 5K14B 1JLQB 1T03A 1TP7A 4A47A 1DURA 2VBXA 2F8MA 2M8DB 4NYPA 1HPZA 4EGLA 1GTEA 2MJNA 3J7Z5 3G8TA 3C3LA 1X5OA 1S1TA 1RDRA 4JV0A 1JNZB 3UDCA 2Q43A 2KM8C 2QA2A 4OHXA 4RU9A 4MKBA 5IT9Y 3E3XA 2UVVA 4A8XA 4B3MF 3MPWA 3MMCA 2R2TA 1RT2A 4QIFA 5LL6d 5L38A 1IKVA 1D8YA 2WB1D 5H1SV 4ED6A 2A2CA 4NLQA 4HDHA 1GH8A 3OVSA 1N5YB 3IA0A 1NU4A 3TR5A 2CPHA 1C0UA 2EFNA 3M2RB 4U7UK 2ZKUA 2RT3A 1DQAA 4OJHA 1XMQF 3THVA 3WZ0A 1KQKA 4LVNP 3I32A 1U1QA 1NKEA 3UQSA 4DQQA 1X0FA 2R7UA 2J8AA 2C42A 2YH0A 2JSXA 3Q8SB 1AW0A 5KOWA 2VONA 3G9CA 1MWYA 1D9AA 2VG6B 2M5YA 4KGKA 4UOCA 5HLFA 1M5KC 5KT4A 1FVQA 1HBUB 1NK5A 3GILA 2AGPA 3D0IE 4KT0C 4NXMF 1KOHA 3GV7B 1RT1A 3DGPA 2Y0SD 2E7XA 5KFIA 4A8QA 1VIOA 5DQGA 5AE3A 1I94F 2RQCA 3MXHP 1ZTTA 3F41A 4ICLB 4B02A 1YTYA 2F8EX 2R7RA 1SUQA 2OPPB 3JTOA 4DFJA 1LFWA 4PXCA 4M5DB 4FBUA 2NYIA 2VODA 4IOAQ 4KJIA 1EP4A 3CF5Q 2IBKA 3HVWA 1GXUA 1VI7A 1F60B 1FD8A 1K1QA 4NLWA 2GMLA 1TKZA 3H59A 1Q16B 2B56A 2E44A 5KFYA 4F67A 5D6GA 4WXOA 3CPWR 5M2UA 3UDLA 1TKZB 2KTQA 4CT9A 3HMJG 1XWLA 5IQ6A 1Q8BA 3BS9A 3PJXA 4M1KA 4P7VA 1V3RA 2DNGA 2LQJA 4KIAA 2DRAA 4QR1A 3NGDA 4C4WA 1KTQA 2B9WA 1ZPVA 2LA4A 5KFVA 3QLHA 5F3ZA 2E5GA 4NYZA 2HHHF 2ZKTA 3FVYA 2UUAF 1T95A 4OI6A 3PW5A 3BGRA 3TVKA 3CCUS 1U47A 4OQJA 3W7BA 3D1QA 5F0WA 2F4VF 2CPYA 2AGQA 4DV1F 2P9CA 4IDKA 2RSQA 2M70A 5CZVA 2RQ4A 2RD5C 3GFHA 4WYLA 4C8ZA 2BM1A 5CCLA 4ITSA 2R7SA 4Y65A 1ZZNA 2AD9A 4NZ0A 1UJ6A 2N7YA 1S1WA 1R89A 3LANA 1PC4A 1G3OA 3SDEA 5K14A 2VQEF 1KONA 1O0PA 1YJRA 4URGA 3SCIE 4G1IA 1FXDA 1WD6A 3CUNA 1S6OA 3IN5A 3DLHA 4FNIA 2HG4A 3CJKB 4ZMMA 3HX9A 3OQ2A 2RJZA 3CJ2A 1FDBA 2XMVA 2KJWA 3LPYA 4BHQA 3ZC4A 4RNNA 5A8RA 4DL0C 1JK9B 1DQ9A 4WFXA 1YJWS 2DGUA 1FO1A 1FNMA 4YR2A 2C2EA 2E1CA 2FLPA 2HHVA 2OFHX 3HVAA 1JLCA 2KH9A 3C6TB 3GIMA 4X4VA 2KM8B 3PM9A 4QQBA 1U48A 1S0OA 3PJWA 3RRGA 2IYIA 5B7WA 2MQQA 2EFGA 2ZJPQ 3BR9A 5L9XA 4WJBA 3X1LB 2GCFA 5J2NB 1VK3A 4ECZA 4USJC 4IG3B 5C42B 5HP1B 4ID5B 3CSKA 4RLEA 3IRXA 5GAHU 4EZ6A 4LMZA 4EYIB 3LP0B 2XMKA 5MAOA 2OPSA 1VQLS 3LP2B 1AFJA 3UR0A 3P49B 4KKOB 5D4LA 4J9SA 5HLFB 3LWMA 5L1IA 1BQMA 4PG7A 3O2IA 3N9UC 5AXMA 4KO0A 2ZZMA 2GIQA 2N82B 1FXLA 4I2QA 2R7OA 2GGPB 1HNVA 3K59A 4C11B 4OIXA 4USHA 2ZBIA 2W9CB 2KT5A 2B4VA 1REVA 4JBCA 4KSEB 4LF6F 3SSRA 1C0UB 1KC8T 4C8OA 4FF3A 1UMJA 3OVBA 3PNIA 1RTHB 1B0VA 4ETXA 2QA4S 4Y2MA 4WTYA 5E0OA 4WK1A 2OP5A 3LALA 3HP6A 3K5LA 1HQUB 2RU3A 4UW2A 4GKKF 4O4RA 3TP2A 1UVNA 5K5MA 1M1KT 1J5OA 2XSFA 4GC7A 1FDNA 1HNWF 1JMTA 4F4ZA 2UUBF 2NUHA 5KFAA 1Q78A 3QJPA 2BQRA 5H9FJ 4U7CA 1Q81T 1FTRA 5J2NA 3H2LA 3Q22A 1OIAA 2AYGA 1RISA 4ED1A 2CPXA 2BV3A 1Q8IA 1NB7A 5K9FA 4OX7A 1DFDA 2PSZA 2M0GB 1WACA 2MHEA 4O4GB 3SSSA 4PUOB 2P9EA 3CD0A 1TV6A 2FC9A 4DL4A 4G1QA 3MZIA 2YX1A 4NCGB 3ZZTA 2ASDA 2EG1A 4K59A 4JYAF 1P6TA 1X4EA 2YY3A 2MKIA 4KO0B 1S1UB 5EWFA 4WFNQ 1WEZA 4TLQA 1FTCA 2IYGA 3POTA 1OSCA 3KNAA 3EGWB 3M8QB 4JI8F 5HI7A 1HNZF 3KG1A 1JJHA 4LSNA 1NKCA 5GVQA 2R9LA 2HHXA 2DH7A 2CQ3A 1SJQA 2L9DA 2FLOA 2XBPA 5CHCB 3MM9B 2VBYA 2V2KA 4FNHA 3MD3A 4LUBA 5A8KA 4QWCA 1QM9A 1LW2B 2LVWA 4Y28C 2DNYA 2G0CA 3WBZA 2B4UA 3WC2A 4JI5F 3SQGA 2CQ1A 3DU5A 1WG5A 3CDAA 2ZOMA 3MR3A 2O3DA 1E6YA 3LW5C 4W92B 3T6JA 1GQEA 4X4TA 1X4CA 1T3NA 3K5PA 3Q8QB 2UXBF 4IO1A 4ATNA 4ED7A 3I55S 5A2QY 1EETA 3DI6A 3NAHA 1SKWA 1IKWB 2FHOB 4ZOSA 4DN9A 4N47A 4KHPF 3ETOA 1ZH5A 1DQ8A 2RF2B 4PUOA 3M32A 4WIIA 5B08A 4RKUC 3FEYB 2BM0A 5LXYA 4UQGA 1N8RT 2RF2A 3C66A 4AQYF 2DO4A 2IC3A 3MM7B 5KAKA 2HRYA 2GIRA 2KHDA 3L7PA 4WK3A 3IGNA 3VWSA 4OZ1A 4DR4F 4F26A 3H5UA 3L7OA 3KHGA 2QYCA 1NHUA 4IG0B 3IRXB 2J7UA 1LW0B 4F4YA 5DG8A 2YKAA 2VC0A 4TY8B 4ECVA 1N4LA 4K4SA 1MMDA 1C1BA 1S6PA 2FJVA 1VQ4S 1UVJA 3DLGA 3LF0A 4EO6A 4PQUA 1FJCA 3AY0A 2MGZB 3PR5B 3CC2S 1ZPWX 5F9LA 3V81B 4B9NA 2J5AA 2FHJA 2WK4A 2GFFA 3H2VE 3HT3A 4DV3F 1Q53A 2W9CA 3RBDA 2BUNA 4PG4A 3TRGA 4M63A 2JVOA 4FP9A 2CQ0A 3PX6A 5CA5A 3M05A 4TU7A 1TL3A 3HHDA 2DR7A 2NR0A 4QCLA 1RTDA 2HNZA 1QAXA 3SFUA 4I4BA 1N5YA 3CTRA 2FJWA 4CO1A 1VQNS 5MLCV 1QLNA 1RAJA 2YNHB 2ZH4A 2JLFA 2HYIB 4URSA 2FHKA 3QYYA 3H25A 3H20A 4LT6A 4BDPA 3HHNB 2JX2A 4FYDA 1X4BA 3NLCA 2XB2D 5ADZA 3PW2A 1RTIA 4ZVHA 3CJ4A 4ZP6A 1MROB 4HH1A 4MFBB 4DSIA 4C0OC 2R8HA 4LF9F 1KVIA 1RT4B 5FIIA 4NMLA 5BYQA 3DDKA 3S8SA 4I2QB 1CQNA 5G0RA 2DCLA 5C25B 2AX0A 3KLFA 1FERA 1LQ9A 2GO8A 4PXDA 2MZQA 4DSKA 2LQBA 3H2UB 1UVMA 2B9YA 4FF1A 1S6PB 2WBMA 1MMLA 4QIEA 4ID8A 1UWBA 3DLKA 2OAUA 1FKPB 2HZCA 1GX5A 4J9OA 1N6QB 2CQCA 2L48A 2EK1A 3KMQA 1SKSA 4X4NA 2VG5A 3T1HF 2YNIB 3BGFA 3PRBA 5EWEA 2JOQA 3KG4A 4L6V3 3D0GE 4TYAA 1A7GE 2CVIA 3IG1B 1YHQS 1RTJA 1RT6B 5BYRA 5DLGA 2N4CA 4YFUA 3MF5A 3RAMA 2VB6A 4X4SA 1SJ3P 3FDSA 3LH2S 3IRWP 2HQ3A 3F73A 2BABA 1S76D 1QAJA 4NL5A 2D74B 1IUJA 1FEEA 1GAOA 2JZ5A 1BY9A 1R0AA 5KFLA 3DHXA 4K4VA 4AL7A 3L3CA 2B9XA 3RTVA 4J9RA 2KVIA 1S99A 5HL7Q 2V9KA 5IXUA 1DZ5A 1D9DA 3ZZZA 1UAWA 4DN0A 3BM7A 1HW8A 1JXEA 2IJNA 3FCHA 3M1VB 4ALZA 5D3GA 1XK8A 2FD2A 1RT3B 2JFKA 4HEA9 2WBRA 4RWWA 1TFYA 3WC0A 2Q1LA 2N3LA 3JYTA 1M5SA 1NH7A 2MY8A 1BQNA 1JJ4A 3H40A 2B5JA 2BRKA 2A1BA 4ZPBA 2J0QD 1PILA 4IFYB 2KKHA 1QY7A 3CCWA 4Q2LA 2ZD1A 1Q1KA 4C3KA 1Q7LB 3RU0A 3TNVA 3KK2A 3CD7A 2XI3A 4BWMA 4ED5A 2KZMA 5HN0A 1L3SA 1GXTA 1DLOB 1Q4RA 3JSBA 3MR6A 3KK1B 3CXCR 4FVCA 1C1CA 3IBWA 1D8ZA 1NAQA 2P5VA 4YUDA 3CJ5A 4I64A 4QPTA 2V8VA 3RB4A 1H6KX 4MK9A 2DISA 4N8NA 1X5SA 2B43A 2VOPA 3VAKA 1Q86T 2JC1A 2LDIA 2B6AB 2CQIA 3DOMA 2ROEA 4OHVA 3M8PB 2UUWA 5D4OA 4KQZA 5KFWA 5E3QA 4ECRA 4B9UA 2NREA 4ZCIA 3W2WB 2GO9A 3R1LA 5KFJA 5LJ3Y 2B6AA 3V4MA 5THWA 5E3RA 3MMAB 3F56A 5KFTA 4DS4A 3U02A 4F4WA 3RB6A 3GZ7A 2C3OA 3Q0AA 1H7WA 3CCQS 2HHQA 5J2PA 4X4QA 2MKKA 2RRAA 1Z1ZA 4F3MA 3LWLA 2ZH5A 4F50A 2KU7A 3K7RA 4JI3F 1UKUA 4QOTA 5GADU 1NJXA 3VR1A 2HNYB 4BC7A 4R0EA 2ZDOA 2MKJA 5GAEU 2C3UA 2W25A 2ZE2A 2ZC4A 5JXSA 1BQMB 3PVXA 2DPIA 4XIUA 2ADCA 4DL3A 2MQNA 3DRRA 4GO7X 4B3OA 4MYTA 2EKYA 2X1FA 3VAIA 1FK9A 5T7LB 4NLOA 2LCWA 3N01A 5GAHI 5J2MA 2L08A 4V19X 4PXEA 1PSDA 2DNMA 4OI2A 4KC5A 4PPDA 1X4DA 2PFFB 4JOUA 3HO1A 1M5OC 2VFRA 3QPIA 2GQCA 3D28A 1JJ2R 3MM8B 5AJ3F 2XS7A 3QIDA 1SIZA 3RB3A 4Q43A 2XS2A 1E6VA 5CYJA 1FDDA 3G6VA 5JJBA 2YNGA 4OI0A 1SH0A 1ZOTA 3O1LA 1LK5A 4F2SA 3DOLA 1IKYB 5D77A 2DGXA 1W25A 2LDYA 1HWLA 1VQSA 4KE5A 2ZOFA 1IBMF 2XI2A 5T41A 3TARA 1CC7A 4KGMA 4QU7A 2LQ5A 2VPZB 1OQ6A 4F3OA 4DL5A 2ILYA 1Q7YT 4RW4B 2K1RA 1N34F 1S0NA 2OSRA 2VBWA 2VG5B 1HD1A 5B0EA 2KRBA 3MUVP 2POKA 3KLEB 1XTZA 3IO1A 5B0FA 3AB4B 1FRLA 2LA6A 3LAKA 2HNDB 3FQKA 5J2MB 1HMVA 2WSFC 3THTA 1RT7B 2D7SA 2DNQA 4A4JA 2E1MC 2W4CA 2ATLA 1H7XA 1GX6A 2DH8A 2HRUA 2YNFB 3V5RA 4BBYA 3M9OB 2IJFA 3IC1A 4C3MA 2RNEA 2OSQA 2XO7A 1WF0A 3DC2A 3F44A 5FDLB 3OHBA 2IVYA 4DR6F 3MAQA 3MEKA 4WE1A 3HHLB 4BC9A 3JTPA 1FXRA 2HWTA 2FVQA 2J7WA 5CYMA 1FRIA 4OMFG 2W4DA 3HHLA 2P9GA 1HBMA 1O8BA 3IS9B 4OJ3A 5E3AA 4F4KA 1X5TA 3K5OA 4N5SA 4DR7F 3NCRA 1V3ZA 2XMTA 3ITHA 3DYAA 1G7CB 1X7VA 4AYBD 4NRUA 2BW2A 4Q7AA 3LGNA 3N28A 5EUHA 3ITHB 3M8PA 2QEXS 3PKMA 1S49A 4B08A 1UVLA 1MNEA 2NZ4A 2PD1A 1T3OA 3OFFA 5B0GA 4FS2A 4YP3A 3M6WA 1QAIA 1JLFA 4LQ9A 3G4SS 1TAUA 1VLYA 4H4KC 4DV0F 3CCRS 4OX8A 1RQ0A 1T05B 3CCZA 1GT8A 2LXUA 1VRTB 3M9NB 3C6TA 1W2BR 2P6TA 5IWAF 4IR9A 1NO8A 3MEGA 3CCSS 3MMCB 1DLOA 3Q8RB 1ZETA 4HLBA 2J0XA 4TY8A 1B0PA 1HBOB 5G4DA 3C8YA 3RZAA 2LECA 1FRJA 4R5PB 3KG0A 5CCMA 3TAPA 1FDAA 3NCQA 2COLA 3HKWA 4PWDA 3VZIA 1SBRA 4JI4F 1KOOA 3PFOA 4RW9B 3RW7A 3VAFA 3OTBA 1XR7A 2D3UA 1HNIB 1S1VB 3NKYA 3OR2A 3B8HA 4NLRA 3BQ0A 2RVJA 2ZH6A 2CPDA 5C5JA 4I56A 3D5MA 4NRTA 1HWIA 1ZZFA 6FDRA 2DGQA 1KVJA 3MR5A 1KRPA 3A8EA 2WOMB 1KFSA 5I42A 4PG6A 1RT2B 4WKYA 1VOMA 1E6VB 1BWEA 4QZVB 2ZH2A 4YB7A 2K7KA 1RT5A 4PQAA 3CC4S 1HQUA 3IR7B 1QVGR 1F0XA 3MFHA 3G6YA 2UXCF 1VQ9S 3AHPA 4EU0A 2XGQA 5KFGA 2GHVC 1Z2ZA 3I0SB 3MOZA 5AXLA 3MMJA 4LF7F 3E01B 3PO4A 1SJFA 4O3RA 5LSOA 1SV5B 5D4PA 1FJEB 3SXLA 1WTFA 4AXIA 2R2UA 3IAM9 4NCBA 1SB6A 3GG0A 5BYSA 3CJ0A 3PKYA 2DHAA 2E5JA 1Q8LA 4K5SA 2WB4A 1NK9A 5CYQA 1OSDA 3FFIA 1WNEA 3GYNA 1N5VA 4RBUA 2HNDA 4WZMA