4Y65A

Crystal structure of e.coli cuta1 c16a/c39a/c79a mutation
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
112
structure length
112
Chain Sequence
MLDEKSSNTASVVVLATAPDEATAQDLAAKVLAEKLAAAATLIPGATSLYYWEGKLEQEYEVQMILKTTVSHQQALLEALKSHHPYQTPELLVLPVTHGDTDYLSWLNASLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of E.coli CutA1 C16A/C39A/C79A mutation
rcsb
source organism Escherichia coli k-12
molecule tags Metal binding protein
molecule keywords Divalent-cation tolerance protein CutA
total genus 24
structure length 112
sequence length 112
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03091 CutA1 CutA1 divalent ion tolerance protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4y65A00
3X3UA 2VD3A 4WK3A 1VFJA 1O51A 1PILA 5D4PA 4NYOA 4RWXA 3O8WA 4CO2A 1H3DA 4E98A 1V3RA 1V3SA 3NCQA 4YB7A 4OZNA 4USJC 2XZWA 4CO4A 2J9DE 3TA2A 5DRKA 3L7PA 1NH8A 4CO5A 2Z0GA 2DCLA 1J2VA 4CO1A 4Y65A 1HWUA 1VHFA 2NS1B 1O5JA 3LF0A 1NZAA 1UL3A 3TA0A 1P1LA 3AH6A 4RWWA 4RLEA 4CNYA 2XULA 5L9NA 1UFLA 4ZK7M 4YB5A 2V5HG 1V9OA 5D4LA 3AA8A 4NYPA 3AHPA 4D3GA 4CO0A 2J9EA 1NAQA 2O66A 1V6HA 2NUHA 2E66A 4R25A 3DFEA 4AFFA 1KR4A 4IYQA 2JJ4D 2O67A 5D4OA 1XK8A 2J9DA 3M05A 4WK1A 1Q1KA 3NCPA 1UKUA 4USIA 4RX6A 3GSDA 2EG2A 1UMJA 1GNKA 3AA9A 3MHYA 4C3MA 3OPKA 2XBPA 1OSCA 1NH7A 2XG8A 3CE8A 3N5BA 4YB6A 5D4NA 3TA1A 2PIIA 2NUUG 2GX8A 3NCRA 1QY7A 2J9CA 4USHA 3HLUA 4OZJA 4CO3A 2EG1A 2RD5C 2GNKA 4C3KA 4OZLA 2ZOMA 3O5TB 5DS7A 4Y6IA 2GW8A 4CNZA 4D3HA 2CZ4A 4C3LA 3BZQA 3T9ZA 2ZFHA
chains in the Genus database with same CATH superfamily
2J6UA 3SSRA 1M1GA 3IRXB 2HG4A 1EKSA 1S6QB 1T9TA 8ATCB 1YTYA 1U45A 4QYZK 2C2KB 1D1UA 2OH2A 3SQGA 5M2RA 3L95X 1LWEA 1UPPA 2CXEA 1CSJA 3HMJG 3HVWA 3JYTA 2ZBQA 4RU9A 1N36F 3ZNUA 4DV4J 1SH3A 3CWJA 3J7ZT 1MW7A 2UZAA 1KFSA 2XI2A 1HQEA 2MQMA 3BGRB 4P2FA 3G6YA 2NXEA 1C1CA 3OFHA 3POTA 3PW4A 4C8LA 2FHOB 2DGWA 3ZZUA 4LF6J 4NCBA 1VQNS 2KU7A 5IT9U 4K4YA 1RA7A 2RRNA 3OL6A 2BJ1A 3W2WB 1VQPS 2C2MB 1D9FA 3BPDA 4ZCMA 4RR5A 1BQMA 2KT3A 2ZITA 4TY8B 3CMES 4QIEA 2LU2A 2XHWA 2DHXA 5KFSA 5D0GA 3QWUA 1CPZA 2R2RA 3W8GA 2ZVIA 2RRAA 2Q66A 2YTCA 1B7YB 2VIHA 3OBIA 5H9EJ 4FXDA 1DLOA 1X4DA 2CQHA 3AT1B 3W66A 4QW9A 4PQAA 3UN3A 4U67Q 3BO2A 1S99A 4K4TA 3PNIA 4I56A 4O4RA 3H5XA 4NRUA 3TUIC 3C6UB 1YIJS 3T5KA 2AD9A 5E33A 3K8WA 1XMQJ 3SSSA 2KI2A 5GAGU 5IWAF 5IM0B 2H65B 2OPPB 1WOSA 1M5SA 4NYPA 1UZDA 1XWLA 2EC2A 3CIMA 1EP4B 2D9PA 3M2RA 4B08A 4RW9B 3MPDA 2IRXA 2X1BA 4G1QA 1VIXA 2G0IA 4C8ZA 4AL5A 4GVBA 2LP4A 3IGVA 2H5IB 2DY1A 4HH0A 2CJXB 4OI6A 4Y34A 5EDWA 4ECYA 3OJUA 1QDUB 1U0HA 3MCSA 4QIVA 3K0JA 2JJ4D 1VC0A 2KZMA 2CPYA 1YX2A 5GAGI 2IBOA 4ED3A 5IC6B 2DH7A 2VG5B 1HPZA 1U1NA 3J7A1 1SV5A 4Y28C 2R8JA 3C15A 3J7YU 2IM3A 4NYZA 4ATNA 2BM0A 2EG2A 5AE2A 2VZ9A 3JSYA 5E41A 3J80U 1R0CB 1UJ5A 1X4GA 3NLCA 4C7QA 4OQJA 3LANA 3OFFA 2U2FA 1AFIA 1KFDA 1R7IA 2RJZA 3LQVA 2ZD1A 1M5VC 1LWCB 4HR2A 2CPZA 2UV8G 3OPKA 3MWBA 4H4MA 3IS9A 1RT3A 2KM8B 4JV2A 1NH7A 1RZMA 1WWHA 2QV6A 1U25A 2HBRB 1CEZA 4NCAA 6FD1A 3HHLB 1K0VA 1RBLA 2QA1A 2NXNA 2E29A 2VG6B 2QL5B 3MCOA 3UO0A 3I55S 1KHVA 4I6AA 4NLSA 4V19J 2ZUAA 2V50A 1BWVA 2M2BA 2GHVC 5F8MA 4DV0F 4C8YA 1TU0B 1WC5A 2XMUA 2CQ1A 3R6LB 2R7OA 2XNRA 4H4MB 2QIFA 3K59A 3LP1B 3MM8B 3NGTA 1DRZA 2K8GA 3QIDA 2IJFA 4HHUA 1N34J 1U6BA 1LEOA 3RAXA 4LFBF 2QYGA 2W4PA 2DY9A 2XMJA 1WG5A 2VODA 3AJ2A 5DQHA 3KK3B 3C15B 3TUPA 2IAJA 4Y6IA 4DG1A 3RB0A 3EZOA 3TARA 5FLXU 2Z8QA 2JRSA 4OX9F 4WU2A 2OKQA 4U6PA 2CJAA 4GO5X 3HM9A 7AT1B 3MFIA 4J9LA 4ECVA 3M8QA 1FX2A 2BE2B 3IG1B 4RW9A 2MZTA 1TKDA 3U1MA 3X3UA 4CH0S 1WKKA 4DX7A 1ZPVA 2RKIB 3DGPA 2C1EB 4GVBB 3MEEB 4L72B 2EFVA 3W7BA 4DL3A 4WK3A 1RSCA 1R27B 1WSVA 3NNHA 4ZOSA 4NI2A 4X66F 3O6QA 5CD4A 3QAEA 3VAGA 3KK1B 1HQUA 4ZPWR 2BXJA 3OR1A 1M1KT 1FWKA 3C6UA 3G87A 2HMIB 4E0DA 1QUPA 1RTHB 5CH7B 4HLBA 3DYAA 3I9V9 4YY3J 1Y5IB 3QRRA 1X4CA 3MECA 3O8WA 2VFTA 4Q45A 3NGUA 4DF4A 5HROA 3CJ0A 2ROPA 2V4RA 3PW5A 4L75A 2ASYA 3D5MA 4N8OA 2KT5A 3GR0A 2EVZA 2PEHA 4ZIWA 5E3RA 3OR2A 4P72A 3OQ2A 5IQQA 3H42A 3A13A 2FTRA 4RW7A 4Y2CA 3EDRB 4DJBA 1IJEB 5K8PA 3KMSA 2FJVA 2FLLA 4C9DA 3Q86A 3TJAA 4DR1F 3H2LA 3DLGB 3MZIA 1HBUA 2A6MA 2OIHA 1NH8A 3AOBA 1XERA 1BQNA 4DZ6A 1WG1A 4F2RA 2ZH7A 5HQMA 4IFYA 5HMZA 4WFAQ 3O1LA 1YJUA 2VB6A 4DR4J 4N41A 4DQSA 1LW0A 1FD2A 2MLXA 5DLFA 3ISNC 5FJ4A 4DPYA 1NXIA 1MNEA 1ROFA 1NLKL 3AH6A 3PYDA 3SQOP 4DFJA 1SJ4P 3FCHA 4ALZA 4RNFA 1BD6A 5KFAA 1GX6A 3AA8A 3H8YA 3M1VB 3GG1A 3M30A 5DO2A 4ZDNA 2DPJA 2J0QD 3SXLA 4FYWB 5A8KA 1FVQA 2HHQA 2VA3A 7FDRA 1F60B 1F6TA 2X1GA 5ETMA 4DSIA 2AYBA 4Q0BB 1TP7A 2H4YB 1N5YA 2YNHB 4F4WA 1KLMA 2CQDA 2DXEA 1JLFB 4CWBA 2I5JA 5B0BA 4DR2J 1S9EA 4CLZA 2QA4S 3AJ1A 4EYIB 2AGQA 4ELUA 2HBQB 1YGYA 4KHRA 3LWMA 2AJ1A 2YPZA 3MEEA 5HMWA 1S9GB 3OD2A 4JV5F 1PBAA 4Q44A 2YKNB 4OFZA 4H54A 2QLBB 3IP0A 1F9FA 2MKCA 3HSGA 1SQGA 2LKZA 1N5TA 3HFVA 3UR0A 3KYLA 3NGSA 4KKOB 4WFNQ 1M90T 1TL7A 1SUQA 5KFOA 3NBPB 3KG4A 4KH1B 5BR8F 3EZUA 3FFIB 2B6AB 4ELTA 1U2CA 1FEEA 2CVIA 4ED7A 4A8FA 1EARA 2EFQA 2ZNYA 3Q8SB 2QGFB 3FBCA 1EX8A 1CG2A 3H98A 3IBFB 1RB0A 1UEUA 1T9UA 3DGPB 4R5PB 5KFWA 2RU9A 3HX9A 5GMEA 3TZWA 5RUBA 1U47A 4NLRA 3H5SA 4DDFA 5ETOA 3IO1A 3EZ5A 3ET6B 3VZIA 3AY0A 1VJQA 1X4FA 2PFDA 3CCJS 3ILOA 3MM5A 1JIHA 1TKTA 4WWSA 3D1HA 5ETPA 2C42A 4MMOA 4EYHB 3UCZP 4HVZA 1WTFA 2DD8S 3P3DA 2VBWA 2R2UA 4I1TA 5HQ8A 1VQMS 3MEGB 5J2NB 3ZZTA 3V4IA 1S77D 2KXNB 4OYPA 2EC0A 2DBBA 1GXLA 4YS2A 3HHDA 2DIVA 4ICLA 3GIIA 1S10A 3CDUA 4WTOB 4X2BA 2R3VA 2O01C 1FNOA 2V4JB 4KBIA 4DZDA 2DRAA 4XIUA 2BE7D 4ANDA 2ZBIA 4HDHA 4HDGA 2YH0A 5JJBA 5C5JA 4LIRA 4NA2A 2HK3A 3AD9C 5CZXA 4ZPVR 3DOLA 2BUNA 1TL4A 3TWZA 4IOCQ 4NRTA 2X1AA 3FEXB 2HQ3A 3EUNA 2W8KA 2WW8A 2BQUA 2GZOA 4DV1F 2B0GA 2F4VF 3BN4A 2XM3A 2DR5A 4I6YA 4M94A 1QE1A 2L48A 3QO9B 2OD4A 2CG4A 3CDEA 3SCJE 3GPAA 1SKRA 3PACA 3VAJA 2J76E 1EQ0A 4U7UK 3R7NB 4DR1J 3D7SB 2NCKL 2AIRB 4NLYA 2OTLS 3KLGA 2ZZTA 1WDDA 3GQCA 1SBRA 2WONA 3F56A 3GZ7A 2PGCA 3ILLA 2LQ5A 4NX9A 2XNQA 1SV5B 1X5OA 4HHHA 5HP1A 4NZ0A 3EXCX 1F3FA 2H9ZA 4OX6A 1JLAA 4FP9A 4OYMA 1N5SA 1OQ3A 4QIWD 2VBZA 4RBUA 1RTDB 2B9EA 4ZVEA 3UNGC 4DV5F 4NASA 3FFIA 3RRHA 2MKHA 5EN1A 2HNDB 3MEKA 4I2PA 1PGZA 2PEBA 3D0GE 3TX0A 2JC1A 2KDOA 4YR0A 1D8YA 2GMLA 4WF9Q 5F8JA 4ZPTR 2BW7A 2VG6A 4NL5A 4F3QA 2ZH4A 5J2PA 1C0UB 1D9AA 3MM5B 3ZTPA 4CLFA 5T14A 2W8LA 4TXSA 2EEYA 2AJ4A 2GVZA 3FBEA 4TY8A 5KFCA 1OYDA 1RWWB 2HVHA 2HNYB 3P96A 3R5JB 3JTPA 5DDQC 4ZPCA 1B70B 2V0NA 5HANA 3J7AN 1RISA 4W90B 1ZZFA 3DRSB 3RG6A 4UUXA 4EZ9A 1HPZB 1UEKA 2RUGA 5KFIA 2M5YA 4O4GA 5I3QA 3WQPA 5H9EK 1WF1A 1HHSA 2FJAB 1LKZA 3QBCA 4X84A 3VVUA 4CO0A 4CDIA 4MH8A 2NYIA 4IG0A 1RK8A 1CJUB 2P2CB 4K5RA 4CQ1A 4LR8A 4MKYA 2EFNA 3WIVA 2W2OP 4DFMA 1JXLA 2Z58B 3GIJA 3VGTA 4PXEA 5D4OA 2RF2A 1GQEA 1XK8A 2AX1A 2J9DA 2VPZB 1Q1KA 3QGIA 4PG7A 2XWYA 5KG3A 6AT1B 4J9MA 3GV5B 1D0EA 2CJKA 4QCLA 3TEHB 2I9SA 5KG5A 4B9SA 1YSJA 1CULB 3IBWA 4LBHA 1Y0HA 3AB4B 2JNJA 3Q8UA 3SCKE 5A8KB 1T9WA 5DG7A 5CYQA 2GIRA 1CC8A 4O44B 2UUWA 5K14B 2QMUB 3N9UC 2ZH5A 5LMNF 1XNQJ 4UQGA 3W63A 4ED6A 1WI8A 3PX4A 3OHBA 2K7JA 3A4TA 4JI4J 2JHEA 4J91A 4F3OA 1RA6A 1HA1A 1KOHA 2GJ2A 3CE8A 3R7BB 2BRLA 4LQ9A 5CYQB 5EX0A 1LWXA 2IJRA 3MMBB 4HHJA 3PYGA 5D4NA 4KC5A 5T7LA 1M1HA 1UAWA 3THTA 5DZ7A 4KV8A 2KVIA 1SXLA 4C8OA 5BJRA 3BB5A 4ZCIA 4O3QA 1RTHA 3BDEA 4CT8A 3MM6B 4J9PA 3BKFA 5HVHA 2RMLA 1L3KA 3K7RA 4DV1J 3HZEA 1UVKA 1VQ6S 2ZH1A 2HZAA 1YJTA 3HP6A 5EWFA 4DUZJ 3QSIA 3OW2R 3NKYA 1YKWA 2YNFA 5KFFA 2IC3A 5DDOC 4DV7F 4DL6A 3BGRA 2QFJA 1F5AA 3QIPB 3KJFB 3AFGA 4RPFA 4DEZA 2L08A 3ISND 4X4NA 4K4WA 4C11B 5KOXA 3AOAA 4IRKA 4DV6J 2EBGA 1XNRF 3E01A 4JYAJ 2OEMA 1KDNA 2CPDA 4J7CA 1IBKJ 1G4CA 2WSFC 4NMLA 4M8LA 5A0YB 3UVJB 2C22A 4O3RA 5AXLA 3J81j 3D6HB 1OY9A 4ZITA 3NL0A 2GIQA 1KP6A 1OS5A 2LCWA 3GU0A 4BS2A 3GR1A 3KK2B 3M8PB 3P5BP 1Q8KA 4C8NA 4F4ZA 2FVPA 2KHDA 2NZCA 1IQZA 1APSA 1VFJA 4EMDA 2GMJA 4OYZA 2XYPB 4ZVGA 4NEYA 3K5NA 2XGQA 1PILA 1SPBP 3AAWB 4MIBA 3BREA 2OLWA 1VRUB 5D4PA 2RS8A 1QD1A 3M8PA 5JXSA 4M5JA 3PKYA 2R8GA 4NXNF 4QIGA 1NPKA 1MROA 1BY9A 2QLFB 3PYEA 1ZM3A 2IDLA 2DNYA 2I8EA 1Y4ZB 3BSOA 1RT3B 2HS3A 3WDOA 1U6FA 3QT7A 4ZVFA 2B4OA 1S6OA 3OV7A 3I0SA 3H7HB 1SI9A 2ACMA 2HPUA 1GXTA 2H51B 4WFZA 2YY3A 3A8EA 5B0GA 4CO4A 3PW0A 2MQPA 3R2CJ 3J81Y 4WXOA 4DUYJ 3GYXB 1H2TZ 4DSEA 1YJ9S 4DN0A 2HFOA 4M5MA 4P73A 2VG5A 1DTQA 1BGXT 3ZC4A 3LTOA 4NZ6A 1K9MT 4OHVA 1FX4A 1RT5A 4Y2IA 2HHTA 2J8AA 1JLBA 3MTJA 4EBEA 2JC0A 3HFKA 2G2YA 2WVEA 2WW4A 3UCUP 3DRRA 1YI2S 2Y1JA 3ZZOA 1WC4A 3S01A 4F0MA 1N0VC 1PC5A 2DGUA 3OVAA 1ZM9A 2C3OA 3I96A 3MM7A 3BO4A 3W62A 2DGXA 1ZS6A 3AQOA 4ZK7M 4YB5A 5A8WA 1FDBA 1E6YA 4FVMA 5JVHQ 3UVJA 1FD8A 3SCIE 2Z4PA 4IO1A 1IKXA 3ENVA 4DL2A 1W2BR 1N33F 2B51A 4FYDA 3UDCA 4F8RA 3MAHA 5CYMA 4DR3F 3QWPA 3ZTQA 2Z30B 2VU5A 4U9RA 5J2MB 4LQ3A 5KT4A 3GJRB 4LVOP 1L5UA 5G4DA 3M05A 1JJ4A 4DL7A 4CCHA 4DX6A 9RUBA 1RHUB 1VLOA 2CQ4A 1A7GE 2YX7A 1KS2A 3HHEA 2D3ZA 1JNRB 3JSBA 1FO1A 2PA3A 4RX6A 3QPIA 4B3SJ 2MQQA 3PV8A 2W9AA 1K1QA 2VH7A 3RBEA 1YITS 2A3JA 5IT9Y 2YVSA 4DR4F 4Q7AA 3VAHA 2B8QA 2UUCF 3PXGa 4EWTA 2KFYA 4U95A 1T05A 4KT0C 2CQ3A 4B3RF 4RNNA 1XR7A 4W98A 1IR2A 1C1CB 1P27B 4WFBQ 2R7UA 2CG8A 3PHEA 2IYGA 4C8MA 2J7UA 2QSFA 3HULA 1XTZA 3N4WA 2KZZA 2BVZA 3SBMA 3HVTA 4ZLPA 3D67A 4ED0A 5FDLA 2XS7A 3E51A 3M8RA 3B4DA 2GVZB 1Y5NB 2BEFA 3FSYA 3CGIA 2KYZA 5A2QY 1U24A 3ZXWA 2HQCA 2WK4A 4B17A 1S9EB 1SKSA 2C2OB 3I4HX 4IFVB 4XDCA 1PYTA 5FDLB 2PMZD 4G65A 3CJ3A 3US5A 2G2OA 1AFJA 1F9HA 3NRBA 1IJFB 4IG3A 1ZA2B 2F7VA 4ZJQA 1U0SA 5L39A 3OVBA 2D3UA 2M52A 1DY3A 2P6TA 5K8NA 2HNDA 2RT3A 3P6YC 2R7QA 2ZHOA 5E5NA 4I2QB 4PRFA 4DWIA 5KFHA 4LJMA 1JLQB 3KNAA 4O4GB 4W92B 1X5SA 4IDKB 4GVLA 4M5IA 3RW7A 3TUJC 1LWEB 4OI3A 4YEAA 2A1BA 4B3MF 3R1LA 2RDIA 1S1XB 4V19X 4B9VA 4R8UB 2WZ1A 2OSRA 3MEDA 3CMAS 1RWXB 3PEHA 1U4BA 1NBEB 1JQGA 1FRLA 1BQNB 2DRDA 2HLTA 3BYRA 4WJBA 4PUOA 4AD6A 3Q8QB 2ZUGA 1RT2A 3V6KA 4J9OA 4AUKA 4MTPA 5D3GB 1V5VA 3ITHA 4NEZA 3CSKA 3UD3P 2ZH3A 3LPYA 5AT1B 2PO4A 3HD2A 3GJQB 5CYJA 5KFNA 1RAIB 5LMUJ 3UDVA 4F4XA 2ASJA 4JI5F 4TU8A 2HIQA 3Q0AA 1RT7A 3OTDA 1IKVB 2E9TA 4EO8A 4ZHRA 5IWAJ 3OXGA 1XMQF 3VALA 2MQ8A 1EJ7L 3MMAB 3EVWA 2ZH8A 4B9LA 1REVB 3CJSA 5CAAA 2OAUA 1GMWD 3DMJA 2ADBA 5HO4A 3IR6B 4NLQA 2P5VA 4WE1B 4P74A 1Q82T 3KLHB 1P1LA 3RJMB 3K17A 3N6MA 3VVTA 2XZDB 4C0HA 2QA2A 2PE8A 2UVVA 1H0HB 1UVNA 4A48A 1TFWA 1WEZA 1Q8IA 1R6VA 1XN9A 3NS7B 4HACA 3I82A 4U7CA 1M5OC 5DG8A 3AHPA 4LF8J 2CUYA 3AQPA 5ETRA 4X62F 1QVGR 4LF1A 1K1SA 4LRCA 3RZAA 4CZCA 2ATLA 2MY7A 1GFWB 1Y7PA 4M1KA 3EYZA 4PQUA 5A8WB 3OLBA 3GV8B 2EW9A 1P6TA 3UPFA 5AJ3J 2ZOGA 2K1RB 3K5MA 1NB7A 1KVJA 1Q95G 1Y5LB 4ED8A 3SV3A 3T5HA 1S1TA 1EIYB 5D8HB 1N48A 2AJ2A 1RWMB 3GJTB 3M8ZA 3FMBA 2FZGB 2ZE2A 4Y00A 3AD8C 3GSDA 5D3GA 1GTEA 1YK9A 2DGTA 5L1LA 3O3LA 5L38A 4PPZA 2V9KA 5KFPA 2LA4A 1NPPA 3LP2B 2R9LA 2LU1A 3BEGB 4H4KC 4KQZA 4DX5A 5A0YA 1HNXF 2BZ2A 2VPXB 3GIMA 3BBCA 3FUYA 2LQ8A 3NEKA 4HH1A 4HT7A 3TJ8A 4EK2A 3GYGA 5C42B 2GJFA 1IKWA 2KJWA 3M32A 1T3NA 2HHHJ 2UXBJ 2XYHB 3MR7A 2OFHX 2RIJA 5A6WA 2DNLA 1PIEA 4DU8A 2UV8A 3QMQA 4IH7A 3EWGA 1NDPA 1EAYC 1JLCB 1M5KC 2GVDB 2V94A 4ECUA 2A2CA 1FEHA 3LP0B 4KKOA 4ECWA 3VAIA 4OX9J 5DG9A 4ZVSB 3NCRA 2NREA 2VFSA 2RQMA 1PAUB 2LECA 2QL9B 4ILMA 1JLEB 3KLIA 3M9MB 1FJGF 4KHPJ 2DNGA 1Y9OA 1D3WA 1S9GA 3IFEA 1NK5A 5KFDA 1FNMA 2DPIA 2YQ0A 2AP6A 2KN4A 5FD1A 4L74A 5T7LB 5B09A 3W9IA 4NE9C 1JLGA 2EPIA 2JEIA 3HVTB 2RILA 5L8RC 4CNZA 2W2MP 1UPMB 5EGYA 2RQKA 4YY3F 1H2UX 2FJEB 5L46A 2CQ0A 5L1KA 2EK1A 4DLGA 2BE9B 1WELA 3BZQA 4Q2LA 1WI6A 1TUGB 1KC8T 5DLGA 3DLJA 4LSLA 3VQTA 1IBLF 1IR0A 2OMLA 3TVYA 5CABA 3S6EA 2CNNB 4QPTA 5GMDA 2DYAA 1DTTA 2H1YA 2HGLA 4LSZB 4JUZA 3NWRA 4JI5J 1M0SA 1JLGB 2M7SA 3DLEA 3DU6A 4WP3A 2C3YA 3PYFA 4O23A 1DAXA 2G4BA 2HEKA 4OJ1A 1VQ7S 1KQSR 4ECZA 3JB9k 2JWNA 2ADCA 4N77A 1KHWA 2LVWA 2IMWP 2B43A 1JLBB 1AUSL 5EWGA 1OYEA 2ZOFA 3KG1A 5A76A 4DUZF 1AZSA 3C3LA 1KVKA 1T94A 1YRUA 3DGVA 4USJC 4JI8F 1UFWA 2W9BB 1U6ZA 2POKA 3R8YA 1ZZNA 1C4CA 4Q43A 4P7TA 4PZVA 1KVIA 3EXYA 3I4PA 3EICA 2BMBA 2FPHX 5B0FA 3GFYA 2HNYA 2QE5A 3PY8A 2NR0A 5F8NA 1B64A 1PBUA 2HWIA 1AROP 4CLPA 4IQXA 4LF5J 2HHSA 3JAMY 1P9YA 3I5AA 2VPYB 3W2VA 3UI3A 3WBZA 1S6QA 3BBBA 4WU3A 1HI1A 3S7RA 4AXJA 2DNOA 3OT9A 4WYWA 2Z2YB 3JTNA 4K0KF 3MEGA 1HQUB 5J2NA 1HL6A 1NJIT 5AJ3F 2WVDA 2BR0A 2YNIA 1WC0A 2XULA 1NSQA 4ED2A 5GAHI 3ZZYA 1NJWA 1N8RT 2VKZG 3BQ2A 1NK9A 4N8NA 1RBOB 3V6JA 4HI1A 3HHLC 2Y8WA 1M5PC 3D28A 1G6BA 1WF0A 4TYAA 2HFUA 3ETMA 3A12A 2FY8A 4OZ0A 1SJRA 4PG5A 2LEAA 4WP9A 4ZLNA 4DV4F 1LXNA 4GC7A 3RTVA 3LP0A 3I56S 4FF3A 4IKAA 1RAOA 5KFZA 1W2IA 5KFRA 1NDKA 1TKXA 1N54B 2L9NA 2J0WA 4C97A 4C4WA 2LQBA 4MJKA 3DOKB 4E2FB 2DH9A 3TOQA 4HACB 1C0TB 1RWVB 1TL1B 1DQAA 3R5AA 4H4OB 2HYIB 3G82A 1WHYA 3DDIA 3CD6S 1U0HB 5G0RA 1KQGB 1PG5B 5HBMA 1IWGA 4ER8A 3JQJA 4KFBA 2FQQB 3EGWB 3DMJB 3JQMA 3PKMA 2FGOA 3P4UB 1R0BG 4NZ7A 4PCQA 1JLFA 1CS4B 4C3MA 1R0AA 1RTIB 3MOZA 4N56A 1VK8A 4ILLA 2C3UA 2JOQA 1S4FA 2NZ4A 2V2QA 1HNWJ 3DKDA 1N5VA 5MAOA 2YQ1A 2MLZA 3WX8A 2BQ3A 2CQCA 2CJYB 2FHJD 3OJSA 2DNZA 2CJQA 2W2QP 2XYGB 3B8HA 3JXOA 2MB0B 1NO8A 1JX4A 4U8VA 4DXLA 4N47A 4DUTA 1N4LA 1KWMA 2RQCA 1RTJB 4OI0A 3FQKA 2CQGA 1PKUA 5KFVA 1PCAA 1TKXB 1VQYA 1XBWA 4NA1A 3FRYA 3TEGA 1A9NB 1UFKA 3CMQA 2VQEF 3P49B 4ID5A 3T5JA 3OTBA 4M5HA 2BANB 2WVFA 2R8HA 1X4AA 3LAKA 3JAMU 4K4SA 2WBRA 1Q8BA 3C14A 1OJ4A 2JFDA 3HT0A 1UWBB 2RH3A 2YNFB 3O5TB 4ZVRB 3J7Z5 2W7OA 3GG0A 4Z2XA 2XLIA 3RR7A 1NDLA 4RNMA 4DFPA 4DV2J 2ZNZA 4YOEA 4DPTA 1SH0A 1EP4A 2AJFE 2PI5A 4M95A 1FXLA 2OFGX 2E1CA 5KG2A 1VRTA 3TQEA 1VBXA 2ZC3A 2KHCA 2DEJA 4GRSA 1GXUA 2D74B 1URNA 4MYUA 4XDDA 4LSNB 1S1UA 2FYXA 1Q4RA 4JI8J 1T0TV 4NLXA 1RT4A 2AV5A 2XSJA 5F9LA 3MUTP 3OUYA 3H5YA 3HZGA 1ZPWX 2W9CA 3UDLA 3TAQA 5GADU 1R43A 3ZZRA 3WZ0A 1RWOB 1KOOA 3KK1A 2DNPA 4AYBD 1EETA 5AXMA 3W65A 1DQ9A 1F0XA 1V3RA 4F7VA 2MKKA 1NK4A 1PC4A 3QJPA 4ZLJA 3CDAA 2PT0A 3BR8A 4TN2A 4YB7A 5HK4A 3JQKA 5HSPA 5EX3A 2KTQA 1LFWA 1IBMF 2FZKB 3S8SA 2VOPA 2C2ZB 2OPSB 3NWGA 4IQMA 2UVUA 5GADI 1QM9A 3FEYB 1SJ1A 2Q6CA 1KN6A 4USTA 5F0UA 2YH1A 1YJRA 4U7UD 3UR3C 2AU0A 1MN9A 3D4JA 2NS1B 2U1AA 3D3CJ 3MUMP 5B0EA 2E5LF 4CLSA 1H2VZ 4IFYB 1U1QA 1SJFA 2UU9J 1G2EA 1ZA1B 2XWXA 2BM1A 3A1YG 4IH6A 4L3NA 4LREA 2LXUA 2ZJRQ 1QVFR 3KLGB 3NGKA 1S5ZA 2B9WA 1JWWA 1MLAA 2Q3PA 1KONA 4Z7CA 1YJWS 4EEYA 1OPIA 2XMMA 1TAUA 1FDAA 3G6VA 4ECRA 1RT6B 2LDYA 2MPUA 4D3GA 5KOWA 2VFVA 1RDRA 5KFYA 4JI7J 4TY9A 2I0XA 4MFBA 2GIFA 3ZNJ1 2BRKA 3R1HA 4XPCA 3M9NB 1V3ZA 4OYXA 4GKKF 4QW8A 2UUTA 2OJ3A 2ZD1B 2C28A 3DFEA 1VRTB 2F5GA 2IA0A 4ENOA 5IQ6A 3DLBA 1TL3A 1FE4A 3CCZA 4F2SA 1FKAF 1WDTA 2Y1RI 4KYZA 1TR0A 2IHR1 5GMKa 1BLUA 5IZHA 5L1JA 1S0OA 4QR1A 2GAHC 4LF2A 4KE5A 1J5OB 4ZVQB 2XO7A 3KHHA 1VIOA 1SL2A 1XIQA 4KO0B 4P2MA 5C25A 1KSPA 3QRQA 4YDXA 2RE1A 4CLWA 2QLWA 5F8LA 2DNNA 4ZIVA 1T8EA 1HFEL 5A6PA 5DGBA 2F8MA 4QQBA 3LPEA 2Y0BB 3N5BA 1S72S 1IR1A 4RW7B 4EU0A 4RW4A 2MKJA 4F67A 2RQ4A 3V5RA 1VQ4S 1FRKA 4DR6F 2ILZA 3J7YI 4A8QA 1RT4B 2XSJB 4ID5B 3GP9A 1KKHA 2GJIA 2K06A 1Q86T 1FCAA 5LXYA 4O0NA 3HJVA 4OIXA 2ZHBA 2MDAA 3I32A 1VHIA 2Y3YA 4TU9A 3KFWX 5CCLA 4LVNP 1RTIA 2IY5B 4ED4A 1RLDA 4BC9A 1YRTA 1SJQA 2HSEB 1EB0A 2HQGA 4ITSA 1N32J 1OY8A 2F8EX 3GV7B 4DSJA 2DVIA 4IRDA 3OL7A 2LYVA 2XLKA 4I7FB 5HJXA 1AA1B 2GW8A 2IJNA 1HARA 2XZTB 2FHJA 1IBKF 2BJ7A 4RW6B 4C3LA 2Y9HA 2GCFA 2OUGA 5IXUA 2QC3A 2MLYA 2YNHA 5KG4A 3MEDB 2RAQA 5EUHA 2ZJQQ 1R8CA 3M2VB 5LSOA 2IAJB 1RWKB 2BJ9A 5M2PA 5KT2A 2XY5A 4HTJA 4KR0B 2XC9A 4NWBA 2XY7A 4OI2A 2BA9A 1C0TA 4B9NA 3CIZA 2FY1A 4F25A 3J80Y 4BCAA 4O3PA 1NDCA 1Z4UA 2YX4A 1F5CA 1X4HA 2ATCB 3AODA 3RYLA 3T19A 1SQFA 4ES3A 4OJGA 5AXKA 1IKVA 1T9XA 1VS3A 4DOZA 2GO9A 4NLVA 2DITA 2HVZA 3N28A 4Z37A 2VDIA 4J9RA 4Y2MA 8RUCA 1GEHA 5ETVA 1CS4A 1XQIA 3M6VA 2OTJS 2KO1A 3MXHP 2XMKA 4KSEB 2MJNA 1CLFA 1N5YB 5CZVA 1RT2B 3ZZZA 1JJ2R 3VAKA 5F8IA 1S7IA 2AW0A 3FJ2A 1K47A 2EFPA 1N52B 2YNIB 4NXNJ 3FEZA 5F3TA 5DRKA 2LEBA 4ETZA 4KAIA 1YJVA 2QX0A 3DDNA 3C16B 4O3SA 1RAHB 3R2DJ 1XMOF 4FXWA 2IRYA 3OHAA 5LJ3Y 4C6AA 4MIWA 3NS5A 2RSQA 2B7CB 1I1GA 1VHFA 3RRKA 2CZVC 4LSNA 3TJ9A 1TL5A 2RRBA 2M3DA 3T1YF 3HXMA 2VDHA 3M2UA 4QWDA 3MUVP 4J9KA 2CVEA 2M4MA 2IM0A 2BYCA 3QIPA 4I2QA 2LMIA 3DXSX 1B3TA 2KB2A 1WC3A 2BJEA 3PRVA 1FRJA 5KFEA 2M9KA 3TR5A 1PO6A 4TQRA 3QYYA 2GFFA 3C6TB 2CJ9A 5LT5A 3G8TA 4LT6A 4DR7F 3OFGA 1RCXB 2K3IA 3CCQS 2GC8A 2V69A 4G6VB 1S0NA 3G8QA 4X4TA 1WEYA 4Y2KA 2GHWA 2NXJA 3DLGA 5F8GA 1WHVA 1XR6A 3D2WA 3G6XA 3MMCA 5CYMB 4K4ZA 2AF6A 3T3FA 4B3TF 1CJKB 3PO4A 3MECB 2F63A 2C3MA 4PPDA 5HMXA 3BN7A 2UUAJ 3KTQA 4UY8T 3BYPA 3C66A 1X8DA 4DQQA 4K8RA 1UVLA 3SDEA 4MFBB 2W7PA 1YVFA 4JB8B 3WC0A 2MYFA 3IR7B 3DRRB 5CHCB 2KVQE 3EM1A 3R6GB 3KLIB 2XG8A 1H7XA 3QJLA 4PR6A 2MSTA 3V81A 3L7OA 1UA1A 2IMOA 2ZBRA 3IXQA 4HKQA 4I2PB 1DTQB 4KGMA 2LA6A 3ZZ0A 3DLEB 3U02A 1YBTA 4A8MP 3GLJA 1HNZF 4LFCJ 4O3OA 3CJTA 1NHVA 1ACMB 1S48A 3IMQJ 2IVFB 3FK4A 2EG1A 2MQNA 3DOKA 3IM8A 3KJNB 4LBIA 4USKA 1S1WA 1IKYB 2ZBPA 3DLKA 5ETNA 5KG6A 1QSLA 1TZ0A 1RTJA 3AOCA 5DQGA 4J9SA 5J2QB 3UW1A 5LJ5Y 2R2SA 4X4QA 2MMYA 1FKOA 2DR9A 1MN7A 4RUCA 2NXCA 3W5YA 2Z56B 4MK8A 4ELVA 2IVYA 2KFNA 1HD1A 2FB0A 1QAIA 1VRUA 3ISZA 3H90A 4MKAA 1KBRA 3QGGA 4DMZA 2MKIA 5FIIA 4C0BA 1RHJB 2YWHA 4FS2A 3WIUA 4AL7A 3DLLQ 4LF4J 2DIUA 3KNGA 4KY3A 1B0PA 2A18A 1OPZA 1T11A 1TUVA 5H1SV 4QU6A 1XNQF 5GVQA 1ZAVA 2J5AA 3A3PB 4BLGA 1S1TB 2MZRA 3UDEA 1WORA 2ZEJA 1KEKA 2FC8A 3LGMA 3L9ZA 2GVDA 4FF4A 2L3MA 2FHKA 3DDKA 4ANCA 5I4MA 3UCGA 4JOUA 4RWXA 5KT6A 5KT3A 1U8WA 3CD7A 2VQFJ 3EGNA 2DHAA 4CTAB 1RCOB 3L7UA 1FK9A 1NM2A 2XS2A 4YP3A 1PAEX 2BJDA 3HDSA 3OXFA 4IRCA 2BOPA 3K2YA 2VJVA 2WONB 1V3SA 3WC2A 4NXMJ 1UVMA 1RU1A 3CCUS 4ZLLA 3MURP 3HI9A 2AYMA 2RU3A 3RUBL 2J9DE 2KG1A 3CUNA 1HMVB 4CO5A 2HHVA 2DT9A 1NK0A 2AEMA 3QT8A 3BGOP 2LQJA 5E3PA 5D6GA 5CD4H 4RW8B 2IFXA 4Y65A 4TQSA 2LLZA 3P5TL 4G1QB 2G0CA 4RBTA 4X4PA 3NXZA 4XK8C 2ZJPQ 4DF8A 1UA0A 3CCSS 2B9XA 5KT7A 1DTTB 1UL3A 3LUYA 3RBZA 4Y0FA 4X65J 4U96A 2V4JA 3HSJA 5FLXY 1RT7B 1VQOS 2FLOA 2ZM6F 1A0OB 4CLKA 5K9FA 5IC4B 4QOTA 4LBPA 3HVRA 2UUAF 4OYBA 1TTHB 1RKJA 2I5JB 4KGVB 1YBUA 2Y0SD 3SCLE 2J9EA 1G7CB 2CQBA 2RNEA 4FPRA 4KFBB 4C98A 3L3CA 5THWA 2D3O1 2ERRA 2F9JA 5BXIA 3HO1A 5H9FK 4I6WA 1V6HA 4X66J 2VL1A 2E66A 3V2UC 1RKIA 4JI6J 5JMNA 2FZCB 3D3BJ 4IYQA 1JLEA 5BYSA 1PYOB 3EPIA 4ZPBA 1CJUA 2FUG9 4K59A 4PAAA 1O8BA 2C2NA 1RWNB 3H25A 2AWZA 1WHXA 2HWHA 4YB1P 3GIKA 2JLGA 4LR7A 3GCXP 2E1RA 2MHEA 1UVIA 3CJ8A 1FRXA 2R4FA 2XMWA 1TL3B 2OMOA 4TLQA 4HEA9 3ZTSA 1CJVB 1YQHA 1VGYA 1RHQB 1FJ7A 1VISA 1S59A 2EI5A 2AJQA 1B4SA 1WF2A 2JEFA 3K5LA 2JLEA 2CRLA 3GCWP 4DL4A 2IBKA 4K4UA 3GILA 2FGCA 3ONQA 4I68A 4IG3B 1S7HA 1URRA 3PCOB 4YB6A 3I0RA 2KXFA 4CH1A 4AQYJ 2UXDJ 3TA1A 1R6YA 5A2QU 1Z2LA 1Y00A 5I3PA 4YR2A 2OPQB 1IM6A 2JX2A 1I94F 4Q0BA 4ZJOA 1FF2A 2LDIA 2GX8A 3KWMA 2L41A 2W9CB 4JI0J 1QY7A 4USHA 1HR0F 4JI7F 2GGPA 3DHXA 3MR2A 3VV2B 1U02A 1RT1B 2CADA 3VGVA 4Q5VA 3MFHA 3FBBA 4ECXA 4CO3A 2M70A 2JEJA 5DDRC 2MJUA 5KFJA 2GA7A 2VG7A 8AT1B 1KNZA 4LF7J 2DR6A 3PR5B 4QWBA 2N7CA 4DPWA 1Q8LA 4RBVA 1X4EA 3GE9A 3SV4A 4DSFA 1IUJA 2L9WA 4G3IA 2Q6BA 2HAFA 3N5FA 2R7SA 4D3HA 2OPSA 1HHTP 2HBZB 2Q79A 7FD1A 1REGX 5M2UA 4NLDA 1NNDA 1PYSB 3T9ZA 3VR1A 2ZKUA 4MK9A 3KOAA 1HWJA 2JFKA 3C14B 2H3EB 2WHOA 4M63A 1S0VA 2DEIA 4MKBA 2UUCJ 3HK2A 4KHMA 2VD3A 3W1YC 2BANA 1HBNB 2XI3A 4JI2J 3LWLA 5IT0A 1CVJA 1OMSA 2BKOA 2ACYA 2HFZA 1SQEA 1X0FA 1NJYA 3M8YA 5MLCV 2CDRB 3CTRA 2H4WB 3P8BB 4NLWA 2W25A 3DC2A 1TV6B 4YN3B 3DOLB 3A3NB 3G96A 1WG4A 4U8YA 2FVRA 3ENAA 4R0EA 4PG8A 2BBEA 3NMAA 4M5DB 2O3DA 1MMNA 4NOHA 4DBQA 4DR6J 1NCLA 1RJJA 3H4DA 2LQ9A 2HNZA 2DNMA 2RVJA 2YXLA 3NCQA 2KRRA 1I51B 2QG9B 1JJHA 5BYQA 4ECQA 3T1HF 5D0RA 4CLLA 4B3OB 4RW4B 2ZH2A 5B0AA 1UW9A 4RW8A 3ITHB 1RT5B 3NAIA 1OO0B 3TA2A 2DO4A 4FZVA 1RP5A 1MU2A 4K5SA 2XGPA 1TKTB 3BSNA 2ROEA 3EE3A 2DCLA 1FKPA 1SB6A 1XR5A 3D0HE 3ET6A 4ZN3A 4PXBA 3DOMA 3G82B 3VCDA 1X9WA 2ZBCA 1UEVA 3CW2C 3B78A 3PFOA 4WTYA 4DQPA 1LXJA 3QO9A 1R8HA 1J5OA 4KHPF 1HWUA 2FJDB 4Z7YA 3VZHA 1YDLA 4K2XA 4J9QA 5J2MA 1U1MA 3RR8A 5A8RA 2EKNA 4QJVA 2HURA 4PXCA 3E8OA 2B6AA 4URSA 3UN2A 1FWPA 2MHNA 3D68A 4IR9A 3L4BC 4S0MA 3BSAA 1L3TA 1JXVA 4A8SA 1ZTTA 1WSRA 2B56A 3GFZA 1KTVA 2BJ8A 2WSCC 4DPUA 3TVKA 1R8AA 4JI1J 3CCLS 4F0KA 2JEGA 2YNGB 4DU7A 3CO9A 3GB0A 1H73A 3D0IE 3U27A 3CDWA 4QBUA 3EPGA 2DH8A 2MSSA 1GX5A 4R0JA 1T03B 3NMRA 3KXDA 3SZ2A 4CI0B 4P2XA 2AMCB 4QR0A 1JMTA 1X4BA 4HI2A 3CCVS 1YJNS 4IFVA 2GQCA 1FFWB 2ZHAA 3CJQA 2QYCA 4HT5A 4F4AA 3MTKA 3BKTA 1SJ3P 2WVCA 1HNWF 4QYZJ 2CPJA 5J2QA 1RHKB 2AJ0A 3KLEA 2ZZNA 3D6TB 4ETXA 3BBFA 4X4VA 3I87A 4AQYF 3NCPA 2B7BB 2NXUA 1U26A 2J6TA 1DHMA 3B82A 2H5EA 1UMJA 2JLFA 3Q8YA 1DLOB 3I31A 1CJKA 2HVDA 3F44A 4A8YA 3UQSA 2VASA 3QAUA 3SFGA 3Q22A 3T41A 2V2ZA 5LSLA 4IDKA 5KFGA 1WC6A 2QJ3A 4A8XA 2AX0A 2ZDOA 3LO3A 3UD4P 4QIFA 2LFVA 2BQRA 1SC6A 2DJWA 2KT2A 1NKCA 5F3ZA 1FFSB 1S6PA 2W2NP 3GFXA 2Y1IA 1ZAXA 3HHNB 3VF0B 3C6TA 3JS9A 1WTBA 3I6PA 2AEFA 1R8BA 2DCUB 2JZ5A 3OL8A 2V63A 5KG0A 3NNAA 3SMZA 4ZPDA 1SL1A 4XPEA 5E3CA 1CJTB 2LEPA 1NJXA 4L76A 1NHUA 4DCOB 1ZOTA 4QR2A 2XY6A 3M8WA 3MMBA 1TK0A 4OHXA 2K3KA 4J5OA 3M6UA 4P75A 3ZZPA 2WB4A 1RT1A 2QTWA 5ETTA 2Q1LA 4WZQA 4USVA 1U2FA 3BF4A 2HGMA 5KFXA 4A8KA 2B4PA 2HRTA 2IA6A 3NP5A 3RB4A 4C0OC 1UZHA 4C8KA 3C16A 5J1NA 3BQ1A 4AXIA 2HVIA 3OXLA 4C48A 1BXNA 4UOGA 2HLUA 2QMWA 1VYAA 3B54A 3H2VE 3M4XA 4F04B 2KM8C 1W25A 5H9FJ 4DQRA 4AL6A 3IAS9 1HYSB 1HBOB 4KGKA 1S6PB 3O44A 2B4UA 2BE2A 4DR2F 4UZCA 2N4DA 5LOQA 2PA8D 4ZVUB 3BH6B 1HBUB 1RABB 1HW9A 1U2RA 2X7IA 4B9UA 4OV1A 4DLEA 1L3SA 2X3GA 3FGVA 2PSZA 4OJ3A 4OYOA 4FBTA 5LMNJ 3PHTA 1Q81T 4JBCA 2NPIA 4FS1A 2QLXA 4ECTA 3JYTB 1IKWB 3M32B 2F1FA 3BGFA 1VQSA 4OZNA 5E7OB 3T9NA 1EHWA 5HROB 2G9OA 4J9VA 3HHLD 3Q8RB 2BKPA 5D15A 3BJYA 4K4XA 1B0VA 2OHDA 1NSKL 1TUWA 2PFFB 3H40A 3PG9A 3L7PA 2MEWA 1JKHB 1R8PA 4I0WA 4FVCA 3NNCA 1Z2ZA 1NEEA 1YWXA 2ZE2B 4CO1A 1Z1ZA 4LRDA 5DJBA 4DCPB 5HN0A 5DDPC 2HFVA 4JI1F 3RW6A 4OV6A 2RKIA 1NK6A 3BV8A 2MZSA 3FSXA 1KRPA 3C2PA 4OZ2A 2CJBA 1O5JA 2A2DA 3D9BA 2UVRA 2GQQA 5ITHA 1I6JA 2GQ2A 4OZ5A 4CNYA 4DQIA 2DNKA 3R7SB 1S76D 1DZ5A 4DR5F 3W61A 1HLWA 2HWTA 2XMVA 5HVFA 2O1PA 5KFUA 2F4FA 1HBMB 1AB8A 3TZZA 1XMBA 1V9OA 2DHSA 4L6V3 5I42B 4Y3CA 3KLFB 4Q8FA 1YBAA 1CC7A 1X5PA 2MKYA 3HKWA 2ZH9A 4FXVA 2HQFA 5HLFB 3CO0P 4NCGA 2O66A 3TNVA 3KLEB 1F5BA 3EGZA 3VGUA 2F4VJ 4X64J 2HHWA 4WIIA 4RUBA 1Y3JA 1KR4A 2NQPA 2ROGA 1RGVA 2B4VA 2VBYA 3M6XA 1J5EF 3W60A 2UUBF 3W8PA 1G1XA 2F8HA 2G1HA 4EFAC 2XMAA 5I3UB 2CPHA 4CTAA 1UKUA 1NZ8A 4WKYA 4KGZB 1K8AT 3W2VB 2FJXA 1U1RA 2QT7A 2KJVA 2ZZMA 5HAOA 3G8SA 2E1MC 2H54B 2HRUA 2VV5A 3AA9A 3SYZA 1SC1B 2V4QA 5EHHA 2K7KA 4YDDB 2ZH6A 1JLAB 1P8GA 4FYVB 3J81U 2I2YA 4WZMA 4K0KJ 2HHHF 1U49A 2L9DA 3AJDA 1UJ4A 5K14A 4BC7A 2ZM6J 2ILYA 1NU4A 3PJ9A 2G1DA 2COLA 3CJKA 2YX1A 2N3LA 3FDSA 3CC2S 1UCNA 4KH0B 2CPXA 1X9MA 2R2TA 4JV1A 1ITPA 3EVMA 3TAMB 4JV0A 2DHGA 3VWSA 1TK8A 1VQLS 2J9CA 1WOOA 2CA9A 2N4CA 3R5BA 5D0HA 4WE1A 3QATA 4PXDA 5LM7E 3EJMA 3BGLA 3TO8A 1S1XA 3U1NA 3POTB 2NSBA 1P9QC 4JI6F 5HI7A 3KHGA 1PJ6A 4EBDA 5GAEU 4X4UA 1ZH5A 2VC1A 5E3AA 5I42A 1YLXA 2VG7B 1HKAA 1WC1A 3R5CA 1OY6A 3NBPA 2AGPA 4ZPAA 1X7VA 1RHRB 1VQ5S 2ALZA 1MROB 2P9EA 1QAYA 1RT6A 1I5OB 1FXRA 1X0PA 2ZFHA 4M5NA 4UOFA 3G9CA 2AHOB 5D77A 2N82B 2I1RA 2YWKA 1DURA 1T9YA 3MMCB 3QLHB 4OYIA 4XTTA 4ZP7A 3ENWA 3MR6A 5GAEI 4B9MA 3NY0A 5B0DA 2K2PA 4JP8A 3OVSA 2Y8YA 2QO3A 3VHQA 4QWCA 1O6XA 3TRGA 2H48B 4RL1A 3P45B 1FXDA 1BQMB 1VK3A 3KK2A 1UWAA 1W7WA 2EWHA 4NYOA 1I3OB 4NA3A 4QU7A 1SH2A 3BS9A 4XAKA 3MAAA 3OUYB 1NB2A 4USUA 2PMWA 2E9ZA 1U1KA 1TFYA 4G1PA 1SUQB 2XEXA 1XJWB 3TP2A 3TANA 3BGUA 2DRBA 3M2UB 1G3OA 1SC4B 1SVDA 4CP5A 3OLAA 2RDJA 5LMUF 1ZBTA 1BQXA 1IVZA 3FVYA 4RU2A 2M8DB 2J8SA 4F3MA 1SKUB 4UW2A 2Z2LA 2W01A 3ILJA 4OLPA 1J2VA 2E5HA 1YRXA 3M2VA 3FZ2A 2IPOB 5HL7Q 2R7WA 1R31A 5U47A 4W4MA 4AT1B 5F9NA 1HBOA 1U7LA 3LF0A 2JL9A 1NZAA 4DN9A 2ZC4A 2E7XA 2IIHA 3F41A 1RTZA 4OMFG 4X64F 1LK5A 4EBCA 4PWDA 2NLWA 3ILIA 4PYDA 5E3QA 4YHHF 3M9OB 1X9SA 4Q2MA 2XMTA 1B99A 3HVAA 3H4BA 4DV3J 1E6VB 1AT1B 2MQOA 4N76A 5KG1A 4ZVPB 4CYUA 1T7PA 3ULHA 1LWFB 4OI1A 4EZ6A 3MM7B 4ZCLA 4OI4A 4WIQA 4CLYA 3TI0A 4X4RA 3QZ8A 1T05B 2NUHA 1ULRA 2R42A 1FVSA 2HS4A 1UJ6A 3QGHA 4NPOA 2Z57B 3UD5A 1H98A 5E2QA 1TVRA 2CNLB 3M7VA 2O67A 1GMVA 3NGRA 3BH7B 3IWNC 3KJQB 2QN6B 4H4KA 4RJVA 2MY8A 4WK1A 5KFTA 2VICA 2AYGA 1B7FA 1Q7LB 2HQDA 1N88A 5C2GA 4JV5J 1N5QA 2PC6A 1ELOA 1YJ7A 2B9YA 3KDNA 2LXFA 3QGPA 4NLPA 4CT9A 4UY85 2DKOB 4DX8H 3PIPQ 1U1LA 3TAMA 1VBKA 1SC3B 5HLFA 1IQTA 2V68A 2QSWA 1VDHA 2V8PA 3AXMA 4L3KA 2MZ1A 4X4SA 1FJCA 3CJKB 3I0SB 1BHNA 3KDOA 2E5LJ 3MM8A 5ADZA 3ETOA 1B0TA 3IA0A 3N6LA 4ED5A 1VBYA 3TZYA 1E6YB 2KFZA 5JUMA 4HYKA 2PIIA 3OR1B 3LP1A 3KMQA 1NK8A 2CIMA 3FZBA 3W5XA 5DQIA 4RUAA 2I6WA 2UXCJ 4JI3F 1QAXA 3LGNA 4QZVB 2V34A 1HNIA 3GYNA 4DV7J 1Y11A 3A8KA 1D8ZA 2PD1A 4TLRA 3RB3A 2EK6A 3T1AA 2FJBB 1MSWD 3IS9B 1VR6A 3JTOA 3VAMA 2ZWOA 3RAQA 2F40A 3T6JA 3PJWA 3MCMA 1N0UA 3VGSA 3T5LA 5DM7Q 1TL1A 4DV6F 1HQ2A 2PN6A 3QFHA 4I69A 3MF5A 1WOPA 3C8YA 1RBAA 4DPXA 4LF8F 1LNQA 2M8HA 2YKQA 3OTEA 1IKYA 2GAGC 1O0PA 1RU2A 2VC0A 4KO0A 5DZ6A 3U7JA 4DCJB 2P8IA 5C25B 1NKEA 4DR7J 2OP5A 2N7YA 3QJJA 4ID8A 3V4MA 1FKOB 3CDBA 3KLFA 4C11A 3BO3A 5BYRA 3V6DA 4DI6A 1V5IB 2FC9A 4CLUA 1QTMA 3PO5A 2D7SA 1D09B 1S1WB 1NRKA 2W4CA 2WAQD 3ENQA 3O2IA 2DNRA 1MWYA 2CPIA 4NLTA 4FNIA 4NXMF 3Q2TC 1FT8A 1RUSA 3K5OA 3A8JA 1QJHA 2A0FB 2MKSA 4M5GA 3TUZC 1O51A 2MGZB 5C2CA 1LW2B 3HD1A 4QPXA 1GH8A 2CQ2A 4LFAJ 3MR5A 2P9CA 1F3VA 2OELA 3BSCA 3RGIA 1HYSA 1ZTWA 1H74A 1HNXJ 2B8PA 2GS8A 2VBXA 3EVOA 3HHKA 4FN5A 4PEOA 4ZCKA 3TVZA 2D1CA 3SDEB 3ICLA 3PX6A 1LWFA 2KL8A 4Q8EA 4OLOA 5IS2A 1JKHA 2X3DA 1R3NA 2E44A 3MI7X 2MZJA 3UFCX 1IXKA 4GKJF 2JDJA 5K20B 2CQPA 1OWXA 2DHHA 3IAM9 3FCVA 4WCEQ 2J7KA 3HFZB 3SEOA 3TYTA 1DJ0A 4J9UE 1FRMA 2LXIA 2E5IA 5KT5A 4J9NA 3E2EA 3OTCA 4JYAF 1KQFB 1WNEA 3MD1A 1IN0A 1A6LA 2VQEJ 1UP1A 1HWLA 3CB4A 2IC3B 3QZ7A 1WKJA 4NLOA 4DV0J 4LF6F 1NMEB 3ZFVA 3LH2S 3I9ZA 4DL5A 3QNWB 1FESA 1X60A 2V6AA 4I64A 2YKMB 4TVAB 3M2RB 3QFWA 3RRGA 1TVRB 1LW2A 1VOMA 3NOCA 2EFGA 4A46A 1TELA 2GHPA 4IG0B 1N34F 4LFBJ 3BDPA 2F3JA 4MK7A 1KD1T 1X31C 4TNOA 4E8UA 1Q78A 1WD6A 1EETB 2PDAA 2I38A 4IH5A 1LK7A 1HQEB 3ADAC 1CQMA 4FKYA 3R9LA 2KKHA 4DG1B 2D3OR 4IR1A 3DRSA 4UZBA 2DXFA 1NKBA 2UXBF 2IVMA 3PIOQ 1PSDA 3CD0A 1S79A 1MWQA 1BUXA 1M5HA 2A10A 1Y10A 2CWKA 2P6SA 4PWUA 5LXRA 3OTOJ 3FBFA 4LSLB 4MAKA 4R25A 1HHQA 4DS5A 1YZ7A 4P2SA 2KH9A 1YHQS 3Q24A 3VAFA 4LRAA 1GMUA 5J1EB 3CCMS 2WTFA 5LL6d 4GO7X 2DO0A 4OJHA 1F2GA 4ZVOB 2C3PA 5J2PB 1IWAA 2HMIA 5E0OA 1Q0NA 2MGZA 4FBUA 3D54A 2YQ3A 2RF2B 1I94J 3GSIA 1K73T 1T03A 5DETA 1GNKA 3PZPA 3HHLA 3TZXA 4LF9F 4K4VA 1AW0A 3DI6A 1S1VA 3N01A 3W5ZA 1JLCA 2QRRA 2K1RA 2B3TB 3N6NA 1OSCA 4RKUC 3RU0A 3FNNA 2B5JA 2VF3A 4K7QA 1S12A 3T1YJ 1N6QB 2R7TA 4QWAA 3R27A 3PFEA 4A8WA 2FIUA 2IYIA 1U1OA 2HBYB 1FHTA 3QQCD 4UOCA 2G0JA 3SQGB 4CIOA 4PG6A 3PR4A 4HTIA 2J6SA 4TKTA 2XCAA 2KRBA 3LP2A 1C4AA 2NSCA 1GAOA 4USMA 1RWPB 3HLUA 2OSQA 1RAFB 3R5DA 2EXUA 3HKZD 5C42A 3KHRA 3BPSP 4LUBA 3CT9A 2JH3A 3KLVA 4C3KA 3CCWA 2H5JB 2YWFA 1MWZA 4WBFA 4A47A 3IBCB 4A8OA 2RUSA 5KG7A 3OSPA 3HJFA 2QLJB 1S0MA 1L3UA 3DRPB 2FVQA 3RBDA 2YBVA 4OYAA 3G2XA 4FKXA 4QYRA 4ERDA 4DFKA 1SKWA 4L73A 2HFSA 2DTJA 2OPPA 3F0NA 1HNIB 2JVOA 2M0GB 4YUDA 4B3MJ 1PJ7A 1S1UB 3JSRA 1UTAA 1Y3KA 5KFMA 4FYXB 1FDDA 4DV2F 2E9RX 2OEJA 2DR7A 4BWMA 4EUVA 3E01B 3DYAB 4I4BA 4N7TA 5LSRA 1F9EB 2QL7B 2DGQA 3LOUA 5DGAA 3IWXA 4ZVHA 4OHYA 1U09A 3G86A 4O3NA 2BV3A 5JVGQ 1NHKL 3TAPA 3HF5A 4OL8A 1H6KX 1X5TA 2ZDPA 4DL0C 3KJVA 3JSMB 5CCMA 1HBNA 2VPWB 4RO0A 2VFRA 1RYRA 2CNOB 4CO2A 3QRPA 1H3DA 3IG1A 3DOMB 5IV3A 1RXOB 2W4DA 4UUWA 1DARA 4E98A 2MQLA 5IV4A 1FJEB 2CKWA 2PMHA 1RYSA 1QE1B 3FCWA 1AXQA 1SIZA 2QZ8A 1MU2B 1HI0P 2VHGA 1FE0A 4URQU 3RAMA 4R8UA 1EKRA 1NPRA 2OPRB 4KJIA 3KK3A 2XS5A 3CJ2A 3CC4S 1FK9B 4YFUA 1REVA 3OL9A 3MGJA 1XMOJ 2GV1A 2Z0GA 5IM0A 1WEXA 1VBZA 3CPWR 1E6VA 2DGOA 1JK9B 1VCTA 2CPEA 1GMWA 4KGXB 2ZVSA 2XO6A 1VRQC 2BX6A 3D66A 1U1PA 4LF4F 2AYEA 5IOLA 2HIYA 1CJTA 4LF7F 1TKZB 2DR8A 2DGVA 2QA4G 4JI4F 2EKYA 2VFUA 3TA0A 2FD2A 4FPIA 3F73A 4YR3A 2W9BA 3DRPA 5K5MA 3GONA 1RQ0A 1JXEA 2UU9F 2XB2D 5L9NA 1C1BA 2RDDA 4PUOB 3KUGA 5J1EA 2WSEC 5CA5A 2QEXS 2VUGA 1RACB 2BACA 4URGA 1HI8A 3MAQA 3K58A 4WKRA 3K89A 2G13A 2IRUA 3MPUB 3DHWC 1CQNA 4CLTA 4PABA 4K50A 2HHXA 4GC6A 4YQWA 1RWUA 1QAJA 3EGVA 3LW5C 2HRYA 2NYHA 4KPYA 4FDFA 3LAMA 4GKKJ 5AE1A 2DB1A 4BWJA 3VQSA 4OHWA 2CFXA 4WYLA 2QMXA 3THVA 1XNRJ 1IM4A 1DBDA 1TMJA 2YWGA 1S1VB 1AYEA 4OYWA 4ES2A 3I5BA 3MDFA 3Q89A 1WKLA 3MAAB 4TYBA 5B0CA 1UVJA 4PKDB 1SL0A 1HW8A 2AZ1A 3EDQB 2W24A 3GTYX 3K8VA 3K57A 2DNQA 2XQCA 3V81B 2E5GA 4G1IA 5SUHA 1KLMB 2V9WA 1FTRA 1GK8A 4CH7A 3H59A 5CXTA 5F41A 2XBPA 2OI2A 3OR2B 3HSZA 4GKJJ 3PTWA 4YHHJ 2E1PA 1BE4A 5C24B 3KUEA 3M30B 3M1VA 4YMEA 4ANEA 1JNZB 1WUUA 3C19A 4XO0A 1N36J 2NUUG 2CYYA 2KYXA 3CD5A 1W26A 3GJSB 2C2RA 4PQUB 9ATCB 3FKBA 3MOJB 3CEDA 3QT5A 3QSYB 3W3SA 5F8HA 4IUFA 5HMYA 3CVKA 4OZJA 4OZ3A 5KAKA 1LW0B 2FVSA 3SIPB 2FDNA 5J1PA 4B3SF 4AE5A 3TW0A 3DRXA 1NSAA 3B4MA 1DFDA 1NUEA 2HHPA 4WFYA 4F4KA 1EQMA 2YKMA 1IBCB 3M8QB 4KIAA 1T9VA 2ZOMA 2WOMA 5DS7A 4EI2A 3HPOA 2HZCA 1N32F 2HW3A 1C1BB 2WCXA 5KFLA 3JSMA 2CZ4A 2YWWA 4ILRA 1ICEB 4WFXA 3GWCA 2HQIA 3OTOF 1IBLJ 4NCGB 3G4SS 1IKXB 2WBMA 3Q83A 4PG4A 4PWWA 5ETSA 4OHZA 2J7WA 2YPYA 3BM7A 3ZTRA 5GAHU 2HNZB 3V6HA 3IR5B 3H2UB 4KTQA 4UQTA 2BOAA 2C2EA 3IM9A 2YKOA 2W7AA 3Q8VA 1VQ9S 2OO4A 4M5DA 3PX0A 1RE1B 3ZTOA 1ZYQA 3Q23A 4LR9A 1VMBA 1VJWA 2VQFF 2D9OA 1S6UA 1VC6A 1VQKS 3FRZA 3IC1A 3LA0A 3SFUA 5K8MA 3G71S 1N33J 2UXCF 1CBKA 2OPRA 2HZVA 2HK2A 4EGLA 3HCXA 1QTNB 2R8IA 4N5SA 1RAGB 3PM9A 5D0EA 1HMVA 1H7WA 3D6MB 1BMQB 5L9XA 2XCPA 2BDPA 2APOA 1FDNA 3CJRA 1LWCA 5AXNA 3R3TA 5AE3A 3CCES 4ED1A 1FI4A 1KTQA 2DNHA 2D41A 3A3OB 4Y2AA 4R5PA 3KJVB 2E5JA 3FSIA 1GT8A 2FJWA 1UW4A 3W9JA 3IN5A 5L1IA 2AGOA 2AKWB 3M8SA 1XC9A 4ZP9A 3IRWP 3THPA 4H4OA 2AT1B 2ASDA 1LQ9A 1Q7YT 3FQLA 1Q79A 3MD3A 1F2HA 4B3RJ 1FA0A 1FTCA 4FF2A 4DHVA 1HBMA 3R5GA 3I5CA 1ZM2A 1WHWA 1C2PA 3DXBA 3DI6B 4P71A 4RWWA 1MMDA 5KFBA 1LOUA 2OEKA 3H5UA 4ZS6A 2D69A 3M6WA 4V1Ak 4CM2A 1R0AB 1J5EJ 1U8SA 4LMZA 5IFMA 3NOGA 4RW6A 5B7WA 3DRYA 2V5HG 3D1OA 4X4OA 1UETA 1YG0A 2E1AA 4I7FA 1S9FA 2AZ3A 2ZWPA 1QUVA 1JB0C 4M5LA 3H0PA 2FHMA 2M88A 3MM9A 3RBXA 3PRDA 2CWXA 2V8HA 4LRBA 4P7VA 2BW2A 1NAQA 5ETQA 2P9GA 3AB2B 3TQ1A 4FF1A 2Q43A 2G2ZA 4FYYB 4BBYA 4CYUB 5IT4A 3FC9A 1Q5YA 3NG8A 1CJVA 6FDRA 3HT3A 3PRBA 4O44A 3DN9A 4P6QA 3R97A 2R7RA 3C46A 1Q5VA 1FERA 4B3TJ 1RAEB 4USIA 5EWEA 3MR3A 1ZETA 2B5JB 1N6QA 1HIYA 4MIAA 5CQGA 3CJ4A 2XLJA 3MMJA 3NS6A 4F50A 2GMHA 2BABA 1NJZA 1AZSB 3MHYA 1HD0A 3E3XA 3GIRA 4M5KA 5C7PA 1H38A 2VJUA 2WB1D 1Q53A 4BHQA 4UF4A 2J0XA 4F02A 3MM6A 4ZN1A 4B3OA 2DXDA 2ZKTA 1IBMJ 3N0VA 2BKNA 4JI0F 4ZHRB 4IOAQ 1HR0J 2RB7A 4ZJLA 4DUYF 2QFIA 3DM2B 1FRHA 3PW7A 1AUDA 2V67A 2NPFA 4P10A 1GTHA 4RZRA 3B6BA 3KHLA 2Z2ZA 1N56A 1HNZJ 1VI7A 2RD5C 3KG0A 1QSYA 2J0SD 1NSPA 2OPQA 4LFCF 1K0TA 2DGSA 4DR5J 1TAQA 2MTLA 2F65A 1FWLA 3KUHA 4OZLA 5C24A 4ZVTB 3I0RB 4KPCA 4NI2B 4NMXA 5F0WA 3ZO7A 4IO9Q 2UVWA 4PWDB 1CULA 2XTJP 4ZA1A 2W2PP 3S1TA 3UE2A 4TU7A 1L3VA 5B08A 5HJYA 1JJCB 1PJ5A 4F26A 3PJXA 3QLHA 3CF5Q 4ECSA 5ETKA 3T6BA 2N3OA 1ZAWA 4B02A 1FFGB 4ZP6A 5ETLA 2CZ9A 3L09A 4JI2F 4OX7A 3W64A 3NGDA 4NLGA 1FNXH 2UUBJ 3ELHA 1S49A 2HAIA 2Z2MA 1VLYA 3H20A 3UN5A 1QLNA 3V6DB 1YZ6A 4MKVA 1T95A 4J90A 1FRIA 4P52A 3LALA 3D6FB 1NK7A 1HWKA 1RTDA 3W9HA 4RUHA 3N79A 4F4YA 3U1LA 2RS2A 2MZQA 4ZKAA 1Q16B 2GGPB 4X62J 2V2KA 4QWEA 2RHSB 4WP8A 1QSSA 4DSKA 3CULA 2CQIA 4LRFA 2BJ3A 3BKUA 2UP1A 1C0UA 2V8GA 4OX8A 3IRXA 3T1HJ 5KFKA 3MPYA 1LFPA 2HFNA 3KKFA 2RHQB 4UOHA 3BQ0A 3K5PA 1WJ9A 1TMMA 1HNVA 3CJ5A 2GO8A 4GMKA 4EO6A 2AQ4A 3TX8A 1VC5A 1OQ6A 3CC7S 2XZWA 1U48A 5HVGA 3SSQA 2VONA 1BC6A 2WRMA 2CNKB 1S97A 4I67A 3PW2A 1F1BB 3CCTA 3NAHA 3CXCR 2FVCA 2ABYA 2XSFA 3AXKA 3GFHA 2YNGA 4USWA 3Q8PB 4CM0A 5BR8J 2OGUA 2VKRA 2YKPA 3DM2A 1T3OA 3HSDA 4OZ1A 2HS0A 3DLKB 5K8OA 3LGHA 4DSLA 4LF5F 3X1LB 2PI4A 4J37A 4LF9J 2HKEA 2V2VA 4RLEA 1TK5A 3WHIA 1HWIA 4KRWA 1TV6A 2CAJA 4DS4A 3GMGA 2CPFA 2VA2A 1UFLA 3EMTA 2HGNA 4B9TA 3UNYA 4KB7A 2IM2A 1MMLA 4WXWA 1FKPB 1S4EA 5A8RB 2MXYA 2Y1LB 3CNQP 5D4LA 3MPVA 1RADB 5T41A 1H72C 1UWBA 3KLHA 3SI8A 2R7VA 4F0HA 2O5DA 2YWEA 1SIWB 3DNCA 3WX4A 3QT6A 5HP1B 4C2MA 1SCJB 1EZZB 1TKZA 4K2JA 2VOOA 3DCAA 4O0IA 4LIWA 1FJGJ 4AFFA 4RNOA 2V8DA 1T02A 4ZP8A 2F9DA 2XHCA 1KLNA 1BWEA 2C2DA 1ZM4A 1RHMB 3Q2SC 4MT1A 4ICLB 2OD6A 1TL7B 4IOBA 3PVXA 1D9DA 4A4JA 2DISA 3AD7C 4P9SA 3MM9B 4JI3J 1RAJA 4DR3J 2YKNA 1DQ8A 4RNHA 3IWLA 5I3UA 1HNVB 5HATA 1OIAA 3V4IB 2AEJA 1J27A 2SXLA 2X51A 3PDNA 2KXHA 2W1BA 3CCRS 2DK2A 5D78A 5DM6Q 3RB6A 3OFEA 3W2WA 2FLPA 5HQLA 1WACA 3BR9A 2FLNA 1XEZA 5G0RB 2JVRA 2WOMB 4PYAA 4WPAA 2JSXA 3UWTA 3D1QA 4UT4A 5HBMB 2UXDF 3MCNA 1KQKA 4CRJA 1R89A 2WVBA 1RI7A 2EFOA 2IDEA 3MMAA 4MYTA 4F36A 2HVEA 1JLQA 4NLUA 5KFQA 4X65F 3DU5A 4KV8B 3A8IA 2ASLA 2R8KA 4DV5J 1VQ8S 2EBEA 2YKAA 4FNHA 4HL9A 2IM1A 1S57A 4ES1A 1RAAB 4UTGA 2KG0A 1P1TA 5SZTA 2CDQA 2GNKA 3G6ES 1OSDA 2HHUA 1MG7A 4DPOA 4DV3F 2A6OA 3VTIA 2V8VA 2E7WA 2X1FA 1RLCL 1TQLA 2ALYB 2E7VA 3FMWA 3OSNA 3IGNA 5KTQA 3EX7B 4LFAF 2R7XA 1K44A 3DLHA 1LV5A 4BDPA 3MPWA 4ZMMA 3PEJA
chains in the Genus database with same CATH topology
2J6UA 3SSRA 3IRXB 2HG4A 1S6QB 1YTYA 1U45A 1D1UA 2OH2A 3SQGA 5M2RA 3L95X 1LWEA 3HMJG 1CSJA 3HVWA 3JYTA 4RU9A 1N36F 1SH3A 3CWJA 3J7ZT 1MW7A 2UZAA 1KFSA 2XI2A 1HQEA 2MQMA 3BGRB 3G6YA 2Q66A 1C1CA 3OFHA 3POTA 3PW4A 4C8LA 2FHOB 2DGWA 3ZZUA 4NCBA 1VQNS 2KU7A 4K4YA 1RA7A 2RRNA 3OL6A 3W2WB 1D9FA 1VQPS 4ZCMA 1BQMA 2KT3A 2ZITA 4TY8B 3CMES 4QIEA 2LU2A 2XHWA 2DHXA 5KFSA 3QWUA 1CPZA 2R2RA 2RRAA 2YTCA 3OBIA 5H9EJ 4FXDA 1DLOA 1X4DA 2CQHA 4QW9A 3BO2A 4PQAA 3MOJB 4U67Q 1S99A 4K4TA 3PNIA 4I56A 4O4RA 3H5XA 4NRUA 3TUIC 3C6UB 1YIJS 3T5KA 2AD9A 5E33A 3K8WA 3SSSA 2KI2A 5GAGU 5IWAF 5IM0B 2OPPB 1M5SA 4NYPA 1XWLA 4B08A 3CIMA 1EP4B 2D9PA 3M2RA 4RW9B 4G1QA 2IRXA 2X1BA 1VIXA 4C8ZA 4AL5A 4OI6A 5EDWA 3IGVA 4Y34A 4HH0A 4ECYA 3OJUA 3MCSA 4QIVA 3K0JA 2JJ4D 1VC0A 2KZMA 2CPYA 4ED3A 5GAGI 2IBOA 2DH7A 2VG5B 1HPZA 1U1NA 3J7A1 1SV5A 4Y28C 2R8JA 3J7YU 2IM3A 4NYZA 4ATNA 2BM0A 2EG2A 5AE2A 2VZ9A 3JSYA 5E41A 1UJ5A 1X4GA 3NLCA 4C7QA 4OQJA 3LANA 3OFFA 2U2FA 1KFDA 1R7IA 2RJZA 3LQVA 2ZD1A 1M5VC 1LWCB 2CPZA 2UV8G 3OPKA 3MWBA 4H4MA 3IS9A 1RT3A 2KM8B 4JV2A 1NH7A 1WWHA 1CEZA 2QV6A 1U25A 4NCAA 6FD1A 3HHLB 1K0VA 2QA1A 2E29A 2VG6B 3I55S 1KHVA 4I6AA 4NLSA 4V19J 2M2BA 2GHVC 5F8MA 4DV0F 4C8YA 2XMUA 2CQ1A 2R7OA 2XNRA 4H4MB 2QIFA 3K59A 3LP1B 3MM8B 1DRZA 2K8GA 3QIDA 2IJFA 1U6BA 3RAXA 4LFBF 2W4PA 2XMJA 1WG5A 2VODA 3AJ2A 5DQHA 3KK3B 2IAJA 4Y6IA 4DG1A 3RB0A 3TARA 2Z8QA 2JRSA 4OX9F 4WU2A 2OKQA 4U6PA 2CJAA 4GO5X 3HM9A 3MFIA 4J9LA 4ECVA 3M8QA 3IG1B 2BE2B 4RW9A 2MZTA 1TKDA 3U1MA 3X3UA 4CH0S 1ZPVA 2RKIB 3DGPA 3MEEB 4L72B 2EFVA 3W7BA 4DL3A 4WK3A 1R27B 3NNHA 4ZOSA 4X66F 3VAGA 3O6QA 2R7VA 3QAEA 3KK1B 1HQUA 4ZPWR 2BXJA 3OR1A 1M1KT 3C6UA 2HMIB 4E0DA 1QUPA 1RTHB 5CH7B 4HLBA 3DYAA 3I9V9 1Y5IB 1X4CA 3MECA 3O8WA 2VFTA 4Q45A 4DF4A 5HROA 3CJ0A 2ROPA 2V4RA 3PW5A 2ASYA 3D5MA 4N8OA 2KT5A 3GR0A 2EVZA 2PEHA 5E3RA 3OR2A 3OQ2A 5IQQA 2FTRA 4RW7A 4Y2CA 4DJBA 5K8PA 1IJEB 3KMSA 2FJVA 2FLLA 4C9DA 4DR1F 3H2LA 3DLGB 3MZIA 1HBUA 2OIHA 1NH8A 1XERA 1BQNA 1WG1A 4F2RA 2ZH7A 4IFYA 5HMZA 4WFAQ 3O1LA 1YJUA 2VB6A 4N41A 4DQSA 1LW0A 1FD2A 5DLFA 3ISNC 5FJ4A 1MNEA 1ROFA 4DFJA 3AH6A 1SJ4P 3FCHA 4ALZA 4RNFA 1BD6A 5KFAA 1GX6A 3AA8A 3H8YA 3M1VB 3GG1A 3M30A 5DO2A 4ZDNA 2DPJA 2J0QD 3SXLA 5A8KA 1FVQA 2HHQA 2VA3A 7FDRA 1F60B 2X1GA 4DSIA 4Q0BB 2AYBA 1TP7A 1N5YA 2YNHB 4F4WA 1KLMA 2CQDA 1JLFB 5B0BA 2I5JA 5EN1A 2AGQA 1S9EA 2QA4S 4EYIB 3AJ1A 4ELUA 1YGYA 4KHRA 3LWMA 2AJ1A 3MEEA 4JV5F 5HMWA 1S9GB 4Q44A 2YKNB 4OFZA 4H54A 1F9FA 2MKCA 2LKZA 1N5TA 3UR0A 3KYLA 4KKOB 4WFNQ 1M90T 1SUQA 5KFOA 3NBPB 3KG4A 5BR8F 3EZUA 3FFIB 2B6AB 4ELTA 1FEEA 2CVIA 4ED7A 4A8FA 2EFQA 2ZNYA 3Q8SB 3CD6S 3H98A 1CG2A 4R5PB 5KFWA 1UEUA 2RU9A 3HX9A 1U47A 4NLRA 3H5SA 4DDFA 3EZ5A 3IO1A 3VZIA 3AY0A 1X4FA 3CCJS 3MM5A 1JIHA 1TKTA 3D1HA 2C42A 4MMOA 4EYHB 3UCZP 4HVZA 1WTFA 2DD8S 3P3DA 2VBWA 2R2UA 4I1TA 5HQ8A 1VQMS 3MEGB 5J2NB 3ZZTA 3V4IA 1S77D 2KXNB 2EC0A 2DBBA 1GXLA 3GIIA 3HHDA 2DIVA 4ICLA 1S10A 3CDUA 4X2BA 2DRAA 2O01C 1FNOA 2V4JB 4KBIA 4XIUA 5C5JA 2ZBIA 4HDHA 4HDGA 2YH0A 5JJBA 4LIRA 4NA2A 5CZXA 4ZPVR 4IOCQ 3DOLA 2BUNA 1TL4A 4NRTA 2X1AA 3FEXB 2HQ3A 3EUNA 2W8KA 2WW8A 2BQUA 4DV1F 2B0GA 2F4VF 3BN4A 2DR5A 4I6YA 4M94A 1QE1A 2L48A 3QO9B 2OD4A 2CG4A 3CDEA 3SCJE 3PACA 3VAJA 2J76E 4U7UK 4NLYA 2OTLS 3KLGA 3GQCA 1SBRA 2WONA 3F56A 3GZ7A 2PGCA 2LQ5A 4NX9A 2XNQA 1SV5B 1X5OA 5HP1A 4NZ0A 3EXCX 2H9ZA 4OX6A 4QIWD 1JLAA 4FP9A 1RTDB 1N5SA 1OQ3A 4RBUA 2VBZA 4ZVEA 3UNGC 4DV5F 3FFIA 3RRHA 2MKHA 2HNDB 3MEKA 4I2PA 1PGZA 1D8YA 3D0GE 4YR0A 2JC1A 2KDOA 4WF9Q 5F8JA 2GMLA 4ZPTR 2VG6A 4NL5A 4F3QA 2ZH4A 5J2PA 1C0UB 1D9AA 3MM5B 5T14A 2W8LA 4TXSA 2AJ4A 4TY8A 5KFCA 2HVHA 2HNYB 3P96A 3JTPA 5DDQC 4ZPCA 2V0NA 4W90B 1RISA 1ZZFA 3DRSB 4UUXA 4EZ9A 1HPZB 2RUGA 5KFIA 2M5YA 4O4GA 5I3QA 1WF1A 1HHSA 2FJAB 1LKZA 4X84A 4CO0A 3BQ2A 3OTOF 2R7XA 4MH8A 2NYIA 4IG0A 1RK8A 4K5RA 4CQ1A 4MKYA 2EFNA 4DFMA 1JXLA 3GIJA 4PXEA 5D4OA 2RF2A 1GQEA 1XK8A 2AX1A 2J9DA 2VPZB 1Q1KA 3QGIA 4PG7A 2XWYA 5KG3A 4J9MA 1D0EA 3GV5B 2CJKA 4QCLA 2I9SA 5KG5A 4B9SA 1YSJA 3IBWA 1Y0HA 3AB4B 3SCKE 5A8KB 5DG7A 5CYQA 2GIRA 1CC8A 4O44B 2UUWA 5K14B 3N9UC 2ZH5A 5LMNF 4UQGA 4ED6A 1WI8A 3PX4A 2K7JA 2JHEA 4F3OA 1RA6A 1HA1A 1KOHA 2GJ2A 3CE8A 4LQ9A 2BRLA 5CYQB 5EX0A 4DL4A 4HHJA 3MMBB 5D4NA 4KC5A 5T7LA 3THTA 1UAWA 4KV8A 2KVIA 1SXLA 4C8OA 5BJRA 3BB5A 4ZCIA 4O3QA 1RTHA 3BDEA 4CT8A 3MM6B 4J9PA 2RMLA 1L3KA 3K7RA 3HZEA 1UVKA 2ZH1A 1YJTA 3HP6A 5EWFA 3OW2R 3NKYA 5DDOC 2YNFA 5KFFA 2IC3A 4DV7F 4DL6A 3BGRA 2QFJA 1F5AA 3QIPB 4DEZA 2L08A 3ISND 4X4NA 4K4WA 4C11B 5KOXA 4IRKA 2EBGA 1XNRF 3E01A 2CPDA 2WSFC 4NMLA 4M8LA 5A0YB 2C22A 4O3RA 5AXLA 3NL0A 2GIQA 1OS5A 2LCWA 4BS2A 3GR1A 3KK2B 3M8PB 4C8NA 4F4ZA 2FVPA 2KHDA 1APSA 1IQZA 1VFJA 2GMJA 4ZVGA 3K5NA 2XGQA 1PILA 3AAWB 4MIBA 3BREA 2OLWA 1VRUB 5D4PA 2RS8A 3M8PA 5JXSA 3PKYA 2R8GA 4QIGA 1MROA 1BY9A 1ZM3A 2DNYA 2I8EA 1Y4ZB 3BSOA 1RT3B 2HS3A 3WDOA 1U6FA 4ZVFA 2B4OA 1S6OA 3OV7A 3I0SA 1SI9A 1GXTA 2HPUA 4WFZA 2YY3A 3A8EA 5B0GA 4CO4A 3PW0A 2MQPA 3J81Y 4WXOA 3GYXB 1H2TZ 4DSEA 1YJ9S 4DN0A 2HFOA 3ZC4A 2VG5A 1DTQA 1BGXT 4NZ6A 1K9MT 4OHVA 1RT5A 4Y2IA 2HHTA 2J8AA 1JLBA 3MTJA 4EBEA 2JC0A 3HFKA 3UCUP 3DRRA 1YI2S 2Y1JA 3ZZOA 3S01A 1N0VC 1PC5A 2DGUA 3OVAA 1ZM9A 2C3OA 3I96A 3MM7A 3BO4A 4NXNF 2DGXA 3AQOA 4ZK7M 4YB5A 5A8WA 1FDBA 1E6YA 4FVMA 5JVHQ 1FD8A 3SCIE 2Z4PA 4IO1A 1IKXA 3ENVA 4DL2A 1W2BR 1N33F 2B51A 3UDCA 4F8RA 3MAHA 5CYMA 4DR3F 3QWPA 5J2MB 4U9RA 4LQ3A 5KT4A 4LVOP 1L5UA 5G4DA 3M05A 1JJ4A 4DL7A 4CCHA 2CQ4A 1A7GE 2YX7A 1KS2A 3HHEA 2D3ZA 1JNRB 3JSBA 1FO1A 2PA3A 4RX6A 3QPIA 2MQQA 3PV8A 2W9AA 1K1QA 2VH7A 3RBEA 1YITS 2A3JA 5IT9Y 2YVSA 4DR4F 4Q7AA 3VAHA 2UUCF 3PXGa 4EWTA 2KFYA 1T05A 4KT0C 2CQ3A 4B3RF 4RNNA 1XR7A 1P27B 1C1CB 4WFBQ 2R7UA 3PHEA 2IYGA 4C8MA 2J7UA 2QSFA 3N4WA 1XTZA 2KZZA 2BVZA 3HVTA 4ZLPA 4ED0A 2XS7A 5FDLA 3E51A 3M8RA 3B4DA 1Y5NB 3FSYA 3CGIA 2KYZA 5A2QY 1U24A 2WK4A 4B17A 1S9EB 1SKSA 3I4HX 4IFVB 4XDCA 5FDLB 2PMZD 3US5A 3CJ3A 1AFJA 3NRBA 1IJFB 4IG3A 3OVBA 2F7VA 5L39A 2D3UA 2M52A 2P6TA 5K8NA 2HNDA 2RT3A 3P6YC 2R7QA 2ZHOA 5E5NA 4I2QB 4PRFA 4DWIA 5KFHA 4LJMA 1JLQB 3KNAA 4O4GB 4W92B 1X5SA 4IDKB 3RW7A 3TUJC 1LWEB 4OI3A 4YEAA 2A1BA 4B3MF 3R1LA 2RDIA 1S1XB 4V19X 4B9VA 4R8UB 2OSRA 3MEDA 3CMAS 3PEHA 1U4BA 1FRLA 1BQNB 4PUOA 2HLTA 4WJBA 3Q8QB 2ZUGA 1RT2A 3V6KA 4J9OA 4AUKA 4MTPA 5D3GB 3ITHA 3CSKA 3UD3P 2ZH3A 3LPYA 2PO4A 5CYJA 5KFNA 2ASJA 4F4XA 4JI5F 4TU8A 2HIQA 3Q0AA 1RT7A 3OTDA 1IKVB 2E9TA 4EO8A 4ZHRA 1XMQF 3OXGA 3VALA 3MMAB 4B9LA 1REVB 2OAUA 3DMJA 2ADBA 5HO4A 3IR6B 4NLQA 2P5VA 4WE1B 1Q82T 3KLHB 1P1LA 3N6MA 4C0HA 2QA2A 2PE8A 2UVVA 1H0HB 1UVNA 4A48A 1TFWA 1WEZA 1Q8IA 1XN9A 3I82A 4U7CA 1M5OC 5DG8A 3AHPA 3AQPA 4X62F 1QVGR 2ATLA 1K1SA 3RZAA 4CZCA 2MY7A 1Y7PA 4M1KA 3EYZA 4PQUA 5A8WB 3OLBA 3GV8B 2EW9A 1P6TA 3UPFA 3K5MA 2ZOGA 2K1RB 1NB7A 1KVJA 1Y5LB 4ED8A 3SV3A 3T5HA 1S1TA 5D8HB 1N48A 4Y00A 3FMBA 2ZE2A 3GSDA 5D3GA 1GTEA 2DGTA 5L1LA 3O3LA 5L38A 4PPZA 2V9KA 5KFPA 2LA4A 3LP2B 2R9LA 2LU1A 3BEGB 4H4KC 4KQZA 1HNXF 5A0YA 2BZ2A 2VPXB 3GIMA 5C42B 4HT7A 4HH1A 4LF9F 2KJWA 1IKWA 3M32A 1T3NA 2OFHX 2RIJA 5A6WA 2DNLA 2UV8A 3QMQA 4IH7A 1JLCB 1M5KC 2V94A 4ECUA 2A2CA 1FEHA 3LP0B 4KKOA 4ECWA 3VAIA 5DG9A 3NCRA 2NREA 2VFSA 2RQMA 2LECA 4ILMA 1JLEB 3KLIA 3M9MB 1FJGF 2DNGA 1Y9OA 1D3WA 1S9GA 3IFEA 1NK5A 5KFDA 1FNMA 2DPIA 2AP6A 2KN4A 5FD1A 5T7LB 5B09A 1JLGA 2EPIA 2JEIA 3HVTB 2RILA 5L8RC 4CNZA 2RQKA 4YY3F 1H2UX 2FJEB 5L1KA 2CQ0A 4DLGA 2EK1A 1WELA 3BZQA 4Q2LA 1WI6A 1KC8T 5DLGA 3DLJA 4LSLA 3VQTA 1IBLF 1IR0A 2OMLA 3TVYA 3S6EA 4QPTA 1DTTA 2HGLA 4JUZA 1M0SA 1JLGB 2M7SA 3DLEA 3DU6A 2C3YA 4O23A 1DAXA 2G4BA 4OJ1A 1VQ7S 1KQSR 4ECZA 3JB9k 2JWNA 2ADCA 4N77A 1KHWA 2LVWA 2IMWP 2B43A 1JLBB 5EWGA 3KG1A 2ZOFA 4DUZF 3C3LA 1T94A 1YRUA 4USJC 4JI8F 1UFWA 2W9BB 1U6ZA 2POKA 1ZZNA 1C4CA 4Q43A 4P7TA 1KVIA 3EXYA 3I4PA 2FPHX 5B0FA 3GFYA 2HNYA 2QE5A 3PY8A 2NR0A 5F8NA 1B64A 2HWIA 1AROP 4IQXA 2HHSA 3JAMY 3I5AA 2VPYB 3W2VA 3UI3A 3WBZA 1S6QA 4WU3A 3S7RA 1HI1A 4AXJA 2DNOA 4K0KF