4Y6NA

Crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with mn2+, uridine-diphosphate-glucose (udp-glc) and phosphoglyceric acid (pga) - gpgs mn2+ udp-glc pga-1
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
304
structure length
282
Chain Sequence
ALPLDTTWHRPGWTIGELEAAKAGRTISVVLPALNEEATIESVIDSISPLVDGLVDELIVLDSGSTDDTEIRAIASGARVVSREQALPEVPVRPGKGEALWRSLAATSGDIVVFIDSDLINPHPLFVPWLVGPLLTGEGIQLVKSFYRTGGGRVTELVARPLLAALRPELGCVLQPLSGEYAASRELLTSLPFAPGYGVEIGLLIDTFDRLGLDAIAQVNLGVRAHRNRPLDELGAMSRQVIATLLSRCGIPDSGVGLTQFLYTRHTWPVSLVDRPPMKVMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucosyl-3-phosphoglycerate synthase
publication title A Native Ternary Complex Trapped in a Crystal Reveals the Catalytic Mechanism of a Retaining Glycosyltransferase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 97
structure length 282
sequence length 304
ec nomenclature ec 2.4.1.266: Glucosyl-3-phosphoglycerate synthase.
pdb deposition date 2015-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00535 Glycos_transf_2 Glycosyl transferase family 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4y6nA00
3T7MA 4KC2A 2OEFA 2GGQA 2WEEA 5FV9A 2FYAA 4G3SA 1IINA 4EE4A 1HM9A 1VICA 3V90A 2I7BA 2O1FA 1S4NA 1S4OA 5EJ1A 3ZLLA 1INJA 3Q7UA 5AJOA 1WSZA 4EEMA 1G8OA 2W0WA 4KPXA 4Y6UA 1FXOA 2RJ1A 5I1FA 3CKJA 1GA8A 1QGQA 3CKVA 1JV3A 1H7QA 2YC5A 3RMWA 1QGSA 1MP5A 1XZ6A 1G0RA 5CMJA 3GUEA 5FYEA 2Y7AA 3RSBA 1KWSA 3PNNA 2BO8A 1H4EA 4FRBA 5C3AA 2Z87A 1H7TA 1W77A 4FQWA 4EVWA 3OC9A 5C38A 3K8DA 1I52A 5CQNX 3V8YA 2RJ0A 1OMZA 1IIMA 3IOJA 4ASYA 1R81A 2NXVA 2Z86A 1WT1A 3U2UA 1G23A 1VZUA 1YP4A 1ZJPA 1R7UA 5IDSA 5JQQA 2FFVA 1ON8A 4HO8A 2XWLA 2Y4KA 2RJ6A 3U2VA 2RJ5A 1G95A 2AM5A 1FWYA 2YQCA 1H5SC 5C3BA 5AJNA 2APCA 4Y7FA 4M2AA 1OQMB 3E26A 1NWGB 1GX0A 3SPTA 3JUJA 4IRQA 5L6VA 1R7YA 4HO4A 1FO9A 1EZIA 1QWJA 4JD0A 1NMMB 1HM8A 1ZJ0A 4HCQA 3OKRA 2DPWA 2VS5A 3Q80A 2FYBA 4Y64A 5DDTA 2YQHA 5J49A 3DUVA 3KIAA 4L41C 3CKNA 1H7GA 3PKQA 2QGIA 4Y7GA 2OEGA 2FFUA 2P6WA 4Y6NA 4FRHA 1H5SB 4Y62A 4LW6A 4FCUA 1W55A 4K6RA 3JTJA 3D98A 4CJ8A 4LW3A 2BO6A 5FTSA 3SX8A 4M28A 5C8RA 1FZWA 4KRVA 4ZDQA 3I0GA 5CMFX 3QVBA 5FTVA 2VFZA 2RIXA 3SXEA 2RJ8A 1TVYA 3I0CA 1GQCA 1MP4A 4P02A 2UX8A 3SXAA 3T7OA 2V0KA 1GQ9A 3V91A 3SXDA 4Y7UA 1FOAA 2OI6A 1TW1A 4B3UA 1GX4A 4AYJA 4ASJA 5HS2A 1FR8A 4HO2A 5AJPA 1HV9A 4HO6A 4FRAA 2P72A 5L6SA 2WVMA 2ICYA 1G9RA 1R82A 3K8EA 2AE7A 4HG6A 4DECA 2O1GA 1LVWA 1E5KA 2WE9A 1ZI3A 1MC3A 1ZCTA 2JCJA 2OI7A 5C4EA 4HO5A 5DDVA 3U2XA 4D0ZA 3HL3A 1JV1A 4B4MA 3O3PA 5FU8A 2BO4A 5C4CA 4Y63A 4AYLA 1ZDFA 4KC1A 1JYKA 1LZ0A 2VD4A 1G1LA 2FYDB 3OH4A 1JVDA 3R2WA 2AESA 1ZI1A 3OH0A 3I0IX 1ZHJA 2PGVA 2QH5A 2P73A 1VH1A 3D8VA 1NF5B 1VPAA 1H5TB 1LL2A 5CQMX 2AECA 4KNXA 1R7TA 3N9WA 3ZLKA 2XMEA 2AM3A 2ZU7A 5CMHA 1YROB 4MYBA 4D11C 4FRQA 3U0YA 4Y7VA 3CGXA 3NGWA 1K4VA 1H5RA 1H7FA 5CMIA 4HO0A 1ZDGA 4DE7A 4KC4A 4D48A 1JVGA 2I5EA 1Z90A 1HJLA 5C4BA 2GGOA 1ZIZA 3F1CA 4EEOA 4CJCA 4YS8A 1H7LA 1ZI4A 2AH9A 4NALA 1VGUA 5C1HA 4G3PA 4C2SA 3JUKA 2Y6PA 1H5SA 3CKQA 3DK5A 1GWWA 1LZ7A 5C49A 3SX3A 1MP3A 2JCOA 4B4GA 4E1KA 4M4KA 2CU2A 2WAWA 5BXCA 5C36A 2YQSA 4J18A 1G2VA 3I0JA 1H5SD 5C3DA 3Q4SA 3LW6A 3USQA 1ON6A 3ZGGA 1NKHB 4KQLA 4BMAA 4FRDA 1ZJ1A 2XMHA 1QG8A 4G87A 1LZIA 2YQJA 1H4CA 4FCEA 1LL0A 5C47A 2VS4A 3ZGFA 5C4FA 2ZU9A 2D7IA 1V84A 2YC3A 5C4DA 1ZCUA 3SX7A 3RMVA 1XHBA 3V0OA 2RJ4A 4HO9A 2JCLA 1O7OA 3FOQA 1WVCA 4ARWA 2V0JA 3EE5A 4KT7A 4FRPA 1SS9A 2JCKA 3D5NA 4KPZA 4EEAA 5EIYA 1H7HA 1OMXA 1R7VA 4FREA 2YESA 1ZJ3A 4B42A 3OGZA 5IDTA 4EE5A 3IOHA 2Y4LA 3OH2A 1G93A 1YP3A 1O7QA 4BQHA 1VGZA 1TZFA 3V0PA 1V83A 2E3DA 3V0MA 1ZCYA 3I0LA 1VGTA 1EYRA 2YCMA 1VZTA 1ZJOA 4DDZA 1TW5A 5C1LA 4KNRA 2RJ7A 4HO3A 5CMGX 4AC3A 2WGZA 3TZTA 2A8UA 3SXBA 3V0LA 5CQOA 1O0RA 4HOCA 2ZU8A 1VH3A 5FUHA 2VS3A 4Y9XA 1H5TA 2PX7A 2FY7A 1PZTA 3V8ZA 4B5BA 2WVKA 2VSHA 5IFYA 3CU0A 4M2BA 4JISA 2XWMA 2MZBA 3I0DA 2AM4A 3U2TA 1ZCVA 3OH1A 4XWIA 2VXLA 1JYLA 4AAWA 1LZJA 2FYCB 4NAKA 4B4BA 1LL3A 2A8WA 1YP2A 1PZYB 1VM8A 5CQPA 2X5SA 2OI5A 1R7XA 2X60A 4UEGA 3V0QA 2D7RA 5EJZA 3U0XA 1NHEB 2QKXA 3SXCA 1FGGA 2XWNA 1WT0A 3BCVA 3DJ4A 1INIA 3F1YA 4D11A 2RIYA 2PA4A 3BRKX 2PGYA 1H3MA 3POLA 1NQIB 4Y7TA 3T7NA 4NANA 2X65A 1HM0A 2V0IA 2ICXA 4G3QA 3V0NA 3FWWA 3I0KA 1FR9A 2V0HA 2VSIA 1WT3A 4B2WA 1V82A 1ZJ2A 2D0JA 1G97A 3CKOA 1S4PA 4R7PA 3E25A 4NAIA 4IRPA 2BO7A 4FRLA 1WT2A 3OH3A 3OAMA 4B2XA 4EEGA 1G3LA 1H5RB 1HJJA 1O23B 1W57A 2VXMA 1FO8A 1H4DA 1H7EA 2AGDA 3SX5A 4D0TA 1VZXA 1ZI5A 5FU0A 3U2WA 4P00A 3ST8A 3R3IA 1R80A 2WVLA 2X5ZA 3ZF8A 1VGWA 3PKPA 2Q4JA 4ECMA 3USRA 4MNDA 1FGXA 2RIZA 4FRMA 2RITA 3TQDA 4KXOA 3I0HA 3SXGA 1FXJA 2O1HA 4CVHA 2RJ9A 1GWVA 5C1GA 4CJBA 3I0EA 3I0FA 4GBPA 2W0VA 2I5KA 1FG5N 2V0LA 2E8BA 2Y4JA 2Y4MA 5CQLX 4EE3A 4FROA 1FRWA 5C48A 3IOIA
chains in the Genus database with same CATH superfamily
3T7MA 4KC2A 2OEFA 2GGQA 2WEEA 5FV9A 2FYAA 4G3SA 1IINA 4EE4A 1HM9A 1VICA 4O6MA 3V90A 2I7BA 2O1FA 1S4NA 1S4OA 5EJ1A 4FIXA 3ZLLA 1INJA 3Q7UA 5AJOA 1WSZA 4EEMA 1G8OA 2W0WA 4KPXA 4Y6UA 1FXOA 2RJ1A 5I1FA 3CKJA 1GA8A 1QGQA 3CKVA 1JV3A 1H7QA 2YC5A 4MIXA 3RMWA 1QGSA 1MP5A 1XZ6A 1G0RA 5CMJA 3GUEA 5FYEA 2Y7AA 3RSBA 1KWSA 3PNNA 2BO8A 1H4EA 4FRBA 5C3AA 2Z87A 1H7TA 1W77A 4FQWA 4EVWA 3OC9A 5C38A 3K8DA 1I52A 5CQNX 3V8YA 2RJ0A 1OMZA 1IIMA 3IOJA 4ASYA 1R81A 2NXVA 2Z86A 1WT1A 3U2UA 1G23A 1VZUA 1YP4A 1ZJPA 1R7UA 5IDSA 5JQQA 2FFVA 1ON8A 4HO8A 2XWLA 2Y4KA 2RJ6A 3U2VA 2RJ5A 1G95A 2AM5A 1FWYA 2YQCA 1H5SC 5C3BA 5AJNA 2APCA 4Y7FA 4FIYA 1OQMB 4M2AA 3E26A 1NWGB 1GX0A 3SPTA 3JUJA 4IRQA 5L6VA 1R7YA 4HO4A 1FO9A 1EZIA 1QWJA 4JD0A 1NMMB 1HM8A 1ZJ0A 4HCQA 3OKRA 2DPWA 2VS5A 3Q80A 2FYBA 4Y64A 5DDTA 2YQHA 5J49A 3DUVA 3KIAA 4L41C 3CKNA 1H7GA 3PKQA 2QGIA 4Y7GA 2OEGA 2FFUA 2P6WA 4Y6NA 4FRHA 1H5SB 5D91A 4Y62A 4LW6A 4FCUA 1W55A 4K6RA 3JTJA 3D98A 4CJ8A 4LW3A 2BO6A 5FTSA 3SX8A 4M28A 5C8RA 1FZWA 4KRVA 4ZDQA 3I0GA 5CMFX 3QVBA 5FTVA 2VFZA 2RIXA 3SXEA 2RJ8A 1TVYA 3I0CA 1GQCA 1MP4A 4P02A 2UX8A 3SXAA 3T7OA 2V0KA 1GQ9A 3V91A 3SXDA 4Y7UA 1FOAA 2OI6A 1TW1A 4B3UA 1GX4A 4AYJA 4ASJA 5HS2A 1FR8A 4HO2A 5AJPA 1HV9A 4HO6A 4FRAA 2P72A 4Q7CA 5L6SA 2WVMA 2ICYA 1G9RA 1R82A 3K8EA 2AE7A 4HG6A 4DECA 2O1GA 1LVWA 1E5KA 2WE9A 1ZI3A 1MC3A 1ZCTA 2JCJA 2OI7A 5C4EA 4HO5A 5D92A 5DDVA 3U2XA 4D0ZA 3HL3A 1JV1A 4B4MA 3O3PA 5FU8A 2BO4A 5C4CA 4Y63A 4AYLA 1ZDFA 4KC1A 1JYKA 1LZ0A 2VD4A 1G1LA 2FYDB 3OH4A 1JVDA 3R2WA 2AESA 1ZI1A 3OH0A 3I0IX 1ZHJA 2PGVA 2QH5A 2VK9A 2P73A 1VH1A 3D8VA 1NF5B 1VPAA 1H5TB 1LL2A 5CQMX 2AECA 4KNXA 1R7TA 3N9WA 3ZLKA 2XMEA 2AM3A 2ZU7A 5CMHA 1YROB 4MYBA 4D11C 4FRQA 3U0YA 4Y7VA 3CGXA 3NGWA 1K4VA 1H5RA 1H7FA 5CMIA 4HO0A 1ZDGA 4DE7A 4KC4A 4D48A 1JVGA 2I5EA 1Z90A 1HJLA 5C4BA 2GGOA 1ZIZA 3F1CA 4EEOA 4CJCA 4YS8A 1H7LA 1ZI4A 2AH9A 4NALA 1VGUA 5C1HA 4G3PA 4C2SA 3JUKA 2Y6PA 1H5SA 3CKQA 3DK5A 1GWWA 1LZ7A 5C49A 3SX3A 1MP3A 2JCOA 4B4GA 4E1KA 4M4KA 2CU2A 2WAWA 5BXCA 5C36A 2YQSA 4J18A 1G2VA 3I0JA 1H5SD 5C3DA 3Q4SA 3LW6A 3USQA 1ON6A 3ZGGA 1NKHB 4KQLA 4BMAA 4FRDA 1ZJ1A 2XMHA 1QG8A 4G87A 1LZIA 2YQJA 1H4CA 4FCEA 1LL0A 5C47A 2VS4A 3ZGFA 5C4FA 2ZU9A 2D7IA 1V84A 2YC3A 5C4DA 1ZCUA 3SX7A 4O6NA 1XHBA 3RMVA 2RJ4A 3V0OA 4HO9A 2JCLA 1O7OA 3FOQA 1WVCA 4ARWA 2V0JA 3EE5A 2J0AA 4KT7A 4FRPA 1SS9A 2JCKA 3D5NA 4KPZA 4EEAA 5EIYA 1H7HA 1OMXA 1R7VA 4FREA 2YESA 1ZJ3A 4B42A 3OGZA 5IDTA 4EE5A 3IOHA 2Y4LA 3OH2A 1G93A 1YP3A 1O7QA 4BQHA 1VGZA 1TZFA 3V0PA 1V83A 2E3DA 3V0MA 1ZCYA 3I0LA 1VGTA 1EYRA 2YCMA 1VZTA 1ZJOA 4DDZA 1TW5A 5C1LA 4KNRA 2RJ7A 4HO3A 5CMGX 4AC3A 2WGZA 3TZTA 2A8UA 3SXBA 3V0LA 5CQOA 1O0RA 4HOCA 2ZU8A 1VH3A 5FUHA 2VS3A 4Y9XA 1H5TA 2PX7A 2FY7A 1PZTA 3V8ZA 4B5BA 2WVKA 2VSHA 5IFYA 3CU0A 4M2BA 2C0NA 4JISA 2XWMA 2MZBA 2J0BA 3I0DA 2AM4A 3U2TA 1ZCVA 3OH1A 4XWIA 2VXLA 1JYLA 4AAWA 1LZJA 2FYCB 4NAKA 4B4BA 1LL3A 2A8WA 1YP2A 1PZYB 1VM8A 5CQPA 2X5SA 2OI5A 1R7XA 2X60A 4UEGA 3V0QA 2D7RA 5EJZA 3U0XA 1NHEB 2QKXA 3SXCA 1FGGA 2XWNA 1WT0A 3BCVA 3DJ4A 1INIA 3F1YA 4D11A 2RIYA 2PA4A 3BRKX 2PGYA 1H3MA 3POLA 1NQIB 4Y7TA 3T7NA 4NANA 2X65A 1HM0A 2V0IA 2ICXA 4G3QA 3V0NA 3FWWA 3I0KA 1FR9A 2V0HA 2VSIA 1WT3A 4B2WA 1V82A 1ZJ2A 2D0JA 1G97A 3CKOA 1S4PA 4R7PA 3E25A 4NAIA 4IRPA 2BO7A 4FRLA 1WT2A 3OH3A 3OAMA 4B2XA 4EEGA 1G3LA 1H5RB 1HJJA 1O23B 1W57A 2VXMA 1FO8A 1H4DA 1H7EA 2AGDA 3SX5A 4D0TA 1VZXA 1ZI5A 5FU0A 3U2WA 4P00A 3ST8A 3R3IA 1R80A 2WVLA 2X5ZA 3ZF8A 1VGWA 3PKPA 2Q4JA 4ECMA 3USRA 4MNDA 1FGXA 2RIZA 4FRMA 2RITA 3TQDA 4KXOA 3I0HA 3SXGA 1FXJA 2O1HA 4CVHA 2RJ9A 1GWVA 5C1GA 4CJBA 3I0EA 3I0FA 4GBPA 2W0VA 2I5KA 1FG5N 2V0LA 2E8BA 2Y4JA 2Y4MA 5CQLX 4EE3A 4FROA 1FRWA 5C48A 3IOIA
chains in the Genus database with same CATH topology
3T7MA 4KC2A 2OEFA 2GGQA 2WEEA 5FV9A 2FYAA 4G3SA 1IINA 4EE4A 1HM9A 1VICA 4O6MA 3V90A 2I7BA 2O1FA 1S4NA 1S4OA 5EJ1A 4FIXA 3ZLLA 1INJA 3Q7UA 5AJOA 1WSZA 4EEMA 1G8OA 2W0WA 4KPXA 4Y6UA 1FXOA 2RJ1A 5I1FA 3CKJA 1GA8A 1QGQA 3CKVA 1JV3A 1H7QA 2YC5A 4MIXA 3RMWA 1QGSA 1MP5A 1XZ6A 1G0RA 5CMJA 3GUEA 5FYEA 2Y7AA 3RSBA 1KWSA 3PNNA 2BO8A 1H4EA 4FRBA 5C3AA 2Z87A 1H7TA 1W77A 4FQWA 4EVWA 3OC9A 5C38A 3K8DA 1I52A 5CQNX 3V8YA 2RJ0A 1OMZA 1IIMA 3IOJA 4ASYA 1R81A 2NXVA 2Z86A 1WT1A 3U2UA 1G23A 1VZUA 1YP4A 1ZJPA 1R7UA 5IDSA 5JQQA 2FFVA 1ON8A 4HO8A 2XWLA 2Y4KA 2RJ6A 3U2VA 2RJ5A 1G95A 2AM5A 1FWYA 2YQCA 1H5SC 5C3BA 5AJNA 2APCA 4Y7FA 4FIYA 1OQMB 4M2AA 3E26A 1NWGB 1GX0A 3SPTA 3JUJA 4IRQA 5L6VA 1R7YA 4HO4A 1FO9A 1EZIA 1QWJA 4JD0A 1NMMB 1HM8A 1ZJ0A 4HCQA 3OKRA 2DPWA 2VS5A 3Q80A 2FYBA 4Y64A 5DDTA 2YQHA 5J49A 3DUVA 3KIAA 4L41C 3CKNA 1H7GA 3PKQA 2QGIA 4Y7GA 2OEGA 2FFUA 2P6WA 4Y6NA 4FRHA 1H5SB 5D91A 4Y62A 4LW6A 4FCUA 1W55A 4K6RA 3JTJA 3D98A 4CJ8A 4LW3A 2BO6A 5FTSA 3SX8A 4M28A 5C8RA 1FZWA 4KRVA 4ZDQA 3I0GA 5CMFX 3QVBA 5FTVA 2VFZA 2RIXA 3SXEA 2RJ8A 1TVYA 3I0CA 1GQCA 1MP4A 4P02A 2UX8A 3SXAA 3T7OA 2V0KA 1GQ9A 3V91A 3SXDA 4Y7UA 1FOAA 2OI6A 1TW1A 4B3UA 1GX4A 4AYJA 4ASJA 5HS2A 1FR8A 4HO2A 5AJPA 1HV9A 4HO6A 4FRAA 2P72A 4Q7CA 5L6SA 2WVMA 2ICYA 1G9RA 1R82A 3K8EA 2AE7A 4HG6A 4DECA 2O1GA 1LVWA 1E5KA 2WE9A 1ZI3A 1MC3A 1ZCTA 2JCJA 2OI7A 5C4EA 4HO5A 5D92A 5DDVA 3U2XA 4D0ZA 3HL3A 1JV1A 4B4MA 3O3PA 5FU8A 2BO4A 5C4CA 4Y63A 4AYLA 1ZDFA 4KC1A 1JYKA 1LZ0A 2VD4A 1G1LA 2FYDB 3OH4A 1JVDA 3R2WA 2AESA 1ZI1A 3OH0A 3I0IX 1ZHJA 2PGVA 2QH5A 2VK9A 2P73A 1VH1A 3D8VA 1NF5B 1VPAA 1H5TB 1LL2A 5CQMX 2AECA 4KNXA 1R7TA 3N9WA 3ZLKA 2XMEA 2AM3A 2ZU7A 5CMHA 1YROB 4MYBA 4D11C 4FRQA 3U0YA 4Y7VA 3CGXA 3NGWA 1K4VA 1H5RA 1H7FA 5CMIA 4HO0A 1ZDGA 4DE7A 4KC4A 4D48A 1JVGA 2I5EA 1Z90A 1HJLA 5C4BA 2GGOA 1ZIZA 3F1CA 4EEOA 4CJCA 4YS8A 1H7LA 1ZI4A 2AH9A 4NALA 1VGUA 5C1HA 4G3PA 4C2SA 3JUKA 2Y6PA 1H5SA 3CKQA 3DK5A 1GWWA 1LZ7A 5C49A 3SX3A 1MP3A 2JCOA 4B4GA 4E1KA 4M4KA 2CU2A 2WAWA 5BXCA 5C36A 2YQSA 4J18A 1G2VA 3I0JA 1H5SD 5C3DA 3Q4SA 3LW6A 3USQA 1ON6A 3ZGGA 1NKHB 4KQLA 4BMAA 4FRDA 1ZJ1A 2XMHA 1QG8A 4G87A 1LZIA 2YQJA 1H4CA 4FCEA 1LL0A 5C47A 2VS4A 3ZGFA 5C4FA 2ZU9A 2D7IA 1V84A 2YC3A 5C4DA 1ZCUA 3SX7A 4O6NA 1XHBA 3RMVA 2RJ4A 3V0OA 4HO9A 2JCLA 1O7OA 3FOQA 1WVCA 4ARWA 2V0JA 3EE5A 2J0AA 4KT7A 4FRPA 1SS9A 2JCKA 3D5NA 4KPZA 4EEAA 5EIYA 1H7HA 1OMXA 1R7VA 4FREA 2YESA 1ZJ3A 4B42A 3OGZA 5IDTA 4EE5A 3IOHA 2Y4LA 3OH2A 1G93A 1YP3A 1O7QA 4BQHA 1VGZA 1TZFA 3V0PA 1V83A 2E3DA 3V0MA 1ZCYA 3I0LA 1VGTA 1EYRA 2YCMA 1VZTA 1ZJOA 4DDZA 1TW5A 5C1LA 4KNRA 2RJ7A 4HO3A 5CMGX 4AC3A 2WGZA 3TZTA 2A8UA 3SXBA 3V0LA 5CQOA 1O0RA 4HOCA 2ZU8A 1VH3A 5FUHA 2VS3A 4Y9XA 1H5TA 2PX7A 2FY7A 1PZTA 3V8ZA 4B5BA 2WVKA 2VSHA 5IFYA 3CU0A 4M2BA 2C0NA 4JISA 2XWMA 2MZBA 2J0BA 3I0DA 2AM4A 3U2TA 1ZCVA 3OH1A 4XWIA 2VXLA 1JYLA 4AAWA 1LZJA 2FYCB 4NAKA 4B4BA 1LL3A 2A8WA 1YP2A 1PZYB 1VM8A 5CQPA 2X5SA 2OI5A 1R7XA 2X60A 4UEGA 3V0QA 2D7RA 5EJZA 3U0XA 1NHEB 2QKXA 3SXCA 1FGGA 2XWNA 1WT0A 3BCVA 3DJ4A 1INIA 3F1YA 4D11A 2RIYA 2PA4A 3BRKX 2PGYA 1H3MA 3POLA 1NQIB 4Y7TA 3T7NA 4NANA 2X65A 1HM0A 2V0IA 2ICXA 4G3QA 3V0NA 3FWWA 3I0KA 1FR9A 2V0HA 2VSIA 1WT3A 4B2WA 1V82A 1ZJ2A 2D0JA 1G97A 3CKOA 1S4PA 4R7PA 3E25A 4NAIA 4IRPA 2BO7A 4FRLA 1WT2A 3OH3A 3OAMA 4B2XA 4EEGA 1G3LA 1H5RB 1HJJA 1O23B 1W57A 2VXMA 1FO8A 1H4DA 1H7EA 2AGDA 3SX5A 4D0TA 1VZXA 1ZI5A 5FU0A 3U2WA 4P00A 3ST8A 3R3IA 1R80A 2WVLA 2X5ZA 3ZF8A 1VGWA 3PKPA 2Q4JA 4ECMA 3USRA 4MNDA 1FGXA 2RIZA 4FRMA 2RITA 3TQDA 4KXOA 3I0HA 3SXGA 1FXJA 2O1HA 4CVHA 2RJ9A 1GWVA 5C1GA 4CJBA 3I0EA 3I0FA 4GBPA 2W0VA 2I5KA 1FG5N 2V0LA 2E8BA 2Y4JA 2Y4MA 5CQLX 4EE3A 4FROA 1FRWA 5C48A 3IOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T7M A;  4KC2 A;  2OEF A;  2GGQ A;  2WEE A;  5FV9 A;  2FYA A;  4G3S A;  1IIN A;  4EE4 A;  1HM9 A;  1VIC A;  3V90 A;  2I7B A;  2O1F A;  1S4N A;  1S4O A;  5EJ1 A;  3ZLL A;  1INJ A;  3Q7U A;  5AJO A;  1WSZ A;  4EEM A;  1G8O A;  2W0W A;  4KPX A;  4Y6U A;  1FXO A;  2RJ1 A;  5I1F A;  3CKJ A;  1GA8 A;  1QGQ A;  3CKV A;  1JV3 A;  1H7Q A;  2YC5 A;  3RMW A;  1QGS A;  1MP5 A;  1XZ6 A;  1G0R A;  5CMJ A;  3GUE A;  5FYE A;  2Y7A A;  3RSB A;  1KWS A;  3PNN A;  2BO8 A;  1H4E A;  4FRB A;  5C3A A;  2Z87 A;  1H7T A;  1W77 A;  4FQW A;  4EVW A;  3OC9 A;  5C38 A;  3K8D A;  1I52 A;  5CQN X;  3V8Y A;  2RJ0 A;  1OMZ A;  1IIM A;  3IOJ A;  4ASY A;  1R81 A;  2NXV A;  2Z86 A;  1WT1 A;  3U2U A;  1G23 A;  1VZU A;  1YP4 A;  1ZJP A;  1R7U A;  5IDS A;  5JQQ A;  2FFV A;  1ON8 A;  4HO8 A;  2XWL A;  2Y4K A;  2RJ6 A;  3U2V A;  2RJ5 A;  1G95 A;  2AM5 A;  1FWY A;  2YQC A;  1H5S C;  5C3B A;  5AJN A;  2APC A;  4Y7F A;  4M2A A;  1OQM B;  3E26 A;  1NWG B;  1GX0 A;  3SPT A;  3JUJ A;  4IRQ A;  5L6V A;  1R7Y A;  4HO4 A;  1FO9 A;  1EZI A;  1QWJ A;  4JD0 A;  1NMM B;  1HM8 A;  1ZJ0 A;  4HCQ A;  3OKR A;  2DPW A;  2VS5 A;  3Q80 A;  2FYB A;  4Y64 A;  5DDT A;  2YQH A;  5J49 A;  3DUV A;  3KIA A;  4L41 C;  3CKN A;  1H7G A;  3PKQ A;  2QGI A;  4Y7G A;  2OEG A;  2FFU A;  2P6W A;  4Y6N A;  4FRH A;  1H5S B;  4Y62 A;  4LW6 A;  4FCU A;  1W55 A;  4K6R A;  3JTJ A;  3D98 A;  4CJ8 A;  4LW3 A;  2BO6 A;  5FTS A;  3SX8 A;  4M28 A;  5C8R A;  1FZW A;  4KRV A;  4ZDQ A;  3I0G A;  5CMF X;  3QVB A;  5FTV A;  2VFZ A;  2RIX A;  3SXE A;  2RJ8 A;  1TVY A;  3I0C A;  1GQC A;  1MP4 A;  4P02 A;  2UX8 A;  3SXA A;  3T7O A;  2V0K A;  1GQ9 A;  3V91 A;  3SXD A;  4Y7U A;  1FOA A;  2OI6 A;  1TW1 A;  4B3U A;  1GX4 A;  4AYJ A;  4ASJ A;  5HS2 A;  1FR8 A;  4HO2 A;  5AJP A;  1HV9 A;  4HO6 A;  4FRA A;  2P72 A;  5L6S A;  2WVM A;  2ICY A;  1G9R A;  1R82 A;  3K8E A;  2AE7 A;  4HG6 A;  4DEC A;  2O1G A;  1LVW A;  1E5K A;  2WE9 A;  1ZI3 A;  1MC3 A;  1ZCT A;  2JCJ A;  2OI7 A;  5C4E A;  4HO5 A;  5DDV A;  3U2X A;  4D0Z A;  3HL3 A;  1JV1 A;  4B4M A;  3O3P A;  5FU8 A;  2BO4 A;  5C4C A;  4Y63 A;  4AYL A;  1ZDF A;  4KC1 A;  1JYK A;  1LZ0 A;  2VD4 A;  1G1L A;  2FYD B;  3OH4 A;  1JVD A;  3R2W A;  2AES A;  1ZI1 A;  3OH0 A;  3I0I X;  1ZHJ A;  2PGV A;  2QH5 A;  2P73 A;  1VH1 A;  3D8V A;  1NF5 B;  1VPA A;  1H5T B;  1LL2 A;  5CQM X;  2AEC A;  4KNX A;  1R7T A;  3N9W A;  3ZLK A;  2XME A;  2AM3 A;  2ZU7 A;  5CMH A;  1YRO B;  4MYB A;  4D11 C;  4FRQ A;  3U0Y A;  4Y7V A;  3CGX A;  3NGW A;  1K4V A;  1H5R A;  1H7F A;  5CMI A;  4HO0 A;  1ZDG A;  4DE7 A;  4KC4 A;  4D48 A;  1JVG A;  2I5E A;  1Z90 A;  1HJL A;  5C4B A;  2GGO A;  1ZIZ A;  3F1C A;  4EEO A;  4CJC A;  4YS8 A;  1H7L A;  1ZI4 A;  2AH9 A;  4NAL A;  1VGU A;  5C1H A;  4G3P A;  4C2S A;  3JUK A;  2Y6P A;  1H5S A;  3CKQ A;  3DK5 A;  1GWW A;  1LZ7 A;  5C49 A;  3SX3 A;  1MP3 A;  2JCO A;  4B4G A;  4E1K A;  4M4K A;  2CU2 A;  2WAW A;  5BXC A;  5C36 A;  2YQS A;  4J18 A;  1G2V A;  3I0J A;  1H5S D;  5C3D A;  3Q4S A;  3LW6 A;  3USQ A;  1ON6 A;  3ZGG A;  1NKH B;  4KQL A;  4BMA A;  4FRD A;  1ZJ1 A;  2XMH A;  1QG8 A;  4G87 A;  1LZI A;  2YQJ A;  1H4C A;  4FCE A;  1LL0 A;  5C47 A;  2VS4 A;  3ZGF A;  5C4F A;  2ZU9 A;  2D7I A;  1V84 A;  2YC3 A;  5C4D A;  1ZCU A;  3SX7 A;  3RMV A;  1XHB A;  3V0O A;  2RJ4 A;  4HO9 A;  2JCL A;  1O7O A;  3FOQ A;  1WVC A;  4ARW A;  2V0J A;  3EE5 A;  4KT7 A;  4FRP A;  1SS9 A;  2JCK A;  3D5N A;  4KPZ A;  4EEA A;  5EIY A;  1H7H A;  1OMX A;  1R7V A;  4FRE A;  2YES A;  1ZJ3 A;  4B42 A;  3OGZ A;  5IDT A;  4EE5 A;  3IOH A;  2Y4L A;  3OH2 A;  1G93 A;  1YP3 A;  1O7Q A;  4BQH A;  1VGZ A;  1TZF A;  3V0P A;  1V83 A;  2E3D A;  3V0M A;  1ZCY A;  3I0L A;  1VGT A;  1EYR A;  2YCM A;  1VZT A;  1ZJO A;  4DDZ A;  1TW5 A;  5C1L A;  4KNR A;  2RJ7 A;  4HO3 A;  5CMG X;  4AC3 A;  2WGZ A;  3TZT A;  2A8U A;  3SXB A;  3V0L A;  5CQO A;  1O0R A;  4HOC A;  2ZU8 A;  1VH3 A;  5FUH A;  2VS3 A;  4Y9X A;  1H5T A;  2PX7 A;  2FY7 A;  1PZT A;  3V8Z A;  4B5B A;  2WVK A;  2VSH A;  5IFY A;  3CU0 A;  4M2B A;  4JIS A;  2XWM A;  2MZB A;  3I0D A;  2AM4 A;  3U2T A;  1ZCV A;  3OH1 A;  4XWI A;  2VXL A;  1JYL A;  4AAW A;  1LZJ A;  2FYC B;  4NAK A;  4B4B A;  1LL3 A;  2A8W A;  1YP2 A;  1PZY B;  1VM8 A;  5CQP A;  2X5S A;  2OI5 A;  1R7X A;  2X60 A;  4UEG A;  3V0Q A;  2D7R A;  5EJZ A;  3U0X A;  1NHE B;  2QKX A;  3SXC A;  1FGG A;  2XWN A;  1WT0 A;  3BCV A;  3DJ4 A;  1INI A;  3F1Y A;  4D11 A;  2RIY A;  2PA4 A;  3BRK X;  2PGY A;  1H3M A;  3POL A;  1NQI B;  4Y7T A;  3T7N A;  4NAN A;  2X65 A;  1HM0 A;  2V0I A;  2ICX A;  4G3Q A;  3V0N A;  3FWW A;  3I0K A;  1FR9 A;  2V0H A;  2VSI A;  1WT3 A;  4B2W A;  1V82 A;  1ZJ2 A;  2D0J A;  1G97 A;  3CKO A;  1S4P A;  4R7P A;  3E25 A;  4NAI A;  4IRP A;  2BO7 A;  4FRL A;  1WT2 A;  3OH3 A;  3OAM A;  4B2X A;  4EEG A;  1G3L A;  1H5R B;  1HJJ A;  1O23 B;  1W57 A;  2VXM A;  1FO8 A;  1H4D A;  1H7E A;  2AGD A;  3SX5 A;  4D0T A;  1VZX A;  1ZI5 A;  5FU0 A;  3U2W A;  4P00 A;  3ST8 A;  3R3I A;  1R80 A;  2WVL A;  2X5Z A;  3ZF8 A;  1VGW A;  3PKP A;  2Q4J A;  4ECM A;  3USR A;  4MND A;  1FGX A;  2RIZ A;  4FRM A;  2RIT A;  3TQD A;  4KXO A;  3I0H A;  3SXG A;  1FXJ A;  2O1H A;  4CVH A;  2RJ9 A;  1GWV A;  5C1G A;  4CJB A;  3I0E A;  3I0F A;  4GBP A;  2W0V A;  2I5K A;  1FG5 N;  2V0L A;  2E8B A;  2Y4J A;  2Y4M A;  5CQL X;  4EE3 A;  4FRO A;  1FRW A;  5C48 A;  3IOI A; 
#chains in the Genus database with same CATH topology
 3T7M A;  4KC2 A;  2OEF A;  2GGQ A;  2WEE A;  5FV9 A;  2FYA A;  4G3S A;  1IIN A;  4EE4 A;  1HM9 A;  1VIC A;  4O6M A;  3V90 A;  2I7B A;  2O1F A;  1S4N A;  1S4O A;  5EJ1 A;  4FIX A;  3ZLL A;  1INJ A;  3Q7U A;  5AJO A;  1WSZ A;  4EEM A;  1G8O A;  2W0W A;  4KPX A;  4Y6U A;  1FXO A;  2RJ1 A;  5I1F A;  3CKJ A;  1GA8 A;  1QGQ A;  3CKV A;  1JV3 A;  1H7Q A;  2YC5 A;  4MIX A;  3RMW A;  1QGS A;  1MP5 A;  1XZ6 A;  1G0R A;  5CMJ A;  3GUE A;  5FYE A;  2Y7A A;  3RSB A;  1KWS A;  3PNN A;  2BO8 A;  1H4E A;  4FRB A;  5C3A A;  2Z87 A;  1H7T A;  1W77 A;  4FQW A;  4EVW A;  3OC9 A;  5C38 A;  3K8D A;  1I52 A;  5CQN X;  3V8Y A;  2RJ0 A;  1OMZ A;  1IIM A;  3IOJ A;  4ASY A;  1R81 A;  2NXV A;  2Z86 A;  1WT1 A;  3U2U A;  1G23 A;  1VZU A;  1YP4 A;  1ZJP A;  1R7U A;  5IDS A;  5JQQ A;  2FFV A;  1ON8 A;  4HO8 A;  2XWL A;  2Y4K A;  2RJ6 A;  3U2V A;  2RJ5 A;  1G95 A;  2AM5 A;  1FWY A;  2YQC A;  1H5S C;  5C3B A;  5AJN A;  2APC A;  4Y7F A;  4FIY A;  1OQM B;  4M2A A;  3E26 A;  1NWG B;  1GX0 A;  3SPT A;  3JUJ A;  4IRQ A;  5L6V A;  1R7Y A;  4HO4 A;  1FO9 A;  1EZI A;  1QWJ A;  4JD0 A;  1NMM B;  1HM8 A;  1ZJ0 A;  4HCQ A;  3OKR A;  2DPW A;  2VS5 A;  3Q80 A;  2FYB A;  4Y64 A;  5DDT A;  2YQH A;  5J49 A;  3DUV A;  3KIA A;  4L41 C;  3CKN A;  1H7G A;  3PKQ A;  2QGI A;  4Y7G A;  2OEG A;  2FFU A;  2P6W A;  4Y6N A;  4FRH A;  1H5S B;  5D91 A;  4Y62 A;  4LW6 A;  4FCU A;  1W55 A;  4K6R A;  3JTJ A;  3D98 A;  4CJ8 A;  4LW3 A;  2BO6 A;  5FTS A;  3SX8 A;  4M28 A;  5C8R A;  1FZW A;  4KRV A;  4ZDQ A;  3I0G A;  5CMF X;  3QVB A;  5FTV A;  2VFZ A;  2RIX A;  3SXE A;  2RJ8 A;  1TVY A;  3I0C A;  1GQC A;  1MP4 A;  4P02 A;  2UX8 A;  3SXA A;  3T7O A;  2V0K A;  1GQ9 A;  3V91 A;  3SXD A;  4Y7U A;  1FOA A;  2OI6 A;  1TW1 A;  4B3U A;  1GX4 A;  4AYJ A;  4ASJ A;  5HS2 A;  1FR8 A;  4HO2 A;  5AJP A;  1HV9 A;  4HO6 A;  4FRA A;  2P72 A;  4Q7C A;  5L6S A;  2WVM A;  2ICY A;  1G9R A;  1R82 A;  3K8E A;  2AE7 A;  4HG6 A;  4DEC A;  2O1G A;  1LVW A;  1E5K A;  2WE9 A;  1ZI3 A;  1MC3 A;  1ZCT A;  2JCJ A;  2OI7 A;  5C4E A;  4HO5 A;  5D92 A;  5DDV A;  3U2X A;  4D0Z A;  3HL3 A;  1JV1 A;  4B4M A;  3O3P A;  5FU8 A;  2BO4 A;  5C4C A;  4Y63 A;  4AYL A;  1ZDF A;  4KC1 A;  1JYK A;  1LZ0 A;  2VD4 A;  1G1L A;  2FYD B;  3OH4 A;  1JVD A;  3R2W A;  2AES A;  1ZI1 A;  3OH0 A;  3I0I X;  1ZHJ A;  2PGV A;  2QH5 A;  2VK9 A;  2P73 A;  1VH1 A;  3D8V A;  1NF5 B;  1VPA A;  1H5T B;  1LL2 A;  5CQM X;  2AEC A;  4KNX A;  1R7T A;  3N9W A;  3ZLK A;  2XME A;  2AM3 A;  2ZU7 A;  5CMH A;  1YRO B;  4MYB A;  4D11 C;  4FRQ A;  3U0Y A;  4Y7V A;  3CGX A;  3NGW A;  1K4V A;  1H5R A;  1H7F A;  5CMI A;  4HO0 A;  1ZDG A;  4DE7 A;  4KC4 A;  4D48 A;  1JVG A;  2I5E A;  1Z90 A;  1HJL A;  5C4B A;  2GGO A;  1ZIZ A;  3F1C A;  4EEO A;  4CJC A;  4YS8 A;  1H7L A;  1ZI4 A;  2AH9 A;  4NAL A;  1VGU A;  5C1H A;  4G3P A;  4C2S A;  3JUK A;  2Y6P A;  1H5S A;  3CKQ A;  3DK5 A;  1GWW A;  1LZ7 A;  5C49 A;  3SX3 A;  1MP3 A;  2JCO A;  4B4G A;  4E1K A;  4M4K A;  2CU2 A;  2WAW A;  5BXC A;  5C36 A;  2YQS A;  4J18 A;  1G2V A;  3I0J A;  1H5S D;  5C3D A;  3Q4S A;  3LW6 A;  3USQ A;  1ON6 A;  3ZGG A;  1NKH B;  4KQL A;  4BMA A;  4FRD A;  1ZJ1 A;  2XMH A;  1QG8 A;  4G87 A;  1LZI A;  2YQJ A;  1H4C A;  4FCE A;  1LL0 A;  5C47 A;  2VS4 A;  3ZGF A;  5C4F A;  2ZU9 A;  2D7I A;  1V84 A;  2YC3 A;  5C4D A;  1ZCU A;  3SX7 A;  4O6N A;  1XHB A;  3RMV A;  2RJ4 A;  3V0O A;  4HO9 A;  2JCL A;  1O7O A;  3FOQ A;  1WVC A;  4ARW A;  2V0J A;  3EE5 A;  2J0A A;  4KT7 A;  4FRP A;  1SS9 A;  2JCK A;  3D5N A;  4KPZ A;  4EEA A;  5EIY A;  1H7H A;  1OMX A;  1R7V A;  4FRE A;  2YES A;  1ZJ3 A;  4B42 A;  3OGZ A;  5IDT A;  4EE5 A;  3IOH A;  2Y4L A;  3OH2 A;  1G93 A;  1YP3 A;  1O7Q A;  4BQH A;  1VGZ A;  1TZF A;  3V0P A;  1V83 A;  2E3D A;  3V0M A;  1ZCY A;  3I0L A;  1VGT A;  1EYR A;  2YCM A;  1VZT A;  1ZJO A;  4DDZ A;  1TW5 A;  5C1L A;  4KNR A;  2RJ7 A;  4HO3 A;  5CMG X;  4AC3 A;  2WGZ A;  3TZT A;  2A8U A;  3SXB A;  3V0L A;  5CQO A;  1O0R A;  4HOC A;  2ZU8 A;  1VH3 A;  5FUH A;  2VS3 A;  4Y9X A;  1H5T A;  2PX7 A;  2FY7 A;  1PZT A;  3V8Z A;  4B5B A;  2WVK A;  2VSH A;  5IFY A;  3CU0 A;  4M2B A;  2C0N A;  4JIS A;  2XWM A;  2MZB A;  2J0B A;  3I0D A;  2AM4 A;  3U2T A;  1ZCV A;  3OH1 A;  4XWI A;  2VXL A;  1JYL A;  4AAW A;  1LZJ A;  2FYC B;  4NAK A;  4B4B A;  1LL3 A;  2A8W A;  1YP2 A;  1PZY B;  1VM8 A;  5CQP A;  2X5S A;  2OI5 A;  1R7X A;  2X60 A;  4UEG A;  3V0Q A;  2D7R A;  5EJZ A;  3U0X A;  1NHE B;  2QKX A;  3SXC A;  1FGG A;  2XWN A;  1WT0 A;  3BCV A;  3DJ4 A;  1INI A;  3F1Y A;  4D11 A;  2RIY A;  2PA4 A;  3BRK X;  2PGY A;  1H3M A;  3POL A;  1NQI B;  4Y7T A;  3T7N A;  4NAN A;  2X65 A;  1HM0 A;  2V0I A;  2ICX A;  4G3Q A;  3V0N A;  3FWW A;  3I0K A;  1FR9 A;  2V0H A;  2VSI A;  1WT3 A;  4B2W A;  1V82 A;  1ZJ2 A;  2D0J A;  1G97 A;  3CKO A;  1S4P A;  4R7P A;  3E25 A;  4NAI A;  4IRP A;  2BO7 A;  4FRL A;  1WT2 A;  3OH3 A;  3OAM A;  4B2X A;  4EEG A;  1G3L A;  1H5R B;  1HJJ A;  1O23 B;  1W57 A;  2VXM A;  1FO8 A;  1H4D A;  1H7E A;  2AGD A;  3SX5 A;  4D0T A;  1VZX A;  1ZI5 A;  5FU0 A;  3U2W A;  4P00 A;  3ST8 A;  3R3I A;  1R80 A;  2WVL A;  2X5Z A;  3ZF8 A;  1VGW A;  3PKP A;  2Q4J A;  4ECM A;  3USR A;  4MND A;  1FGX A;  2RIZ A;  4FRM A;  2RIT A;  3TQD A;  4KXO A;  3I0H A;  3SXG A;  1FXJ A;  2O1H A;  4CVH A;  2RJ9 A;  1GWV A;  5C1G A;  4CJB A;  3I0E A;  3I0F A;  4GBP A;  2W0V A;  2I5K A;  1FG5 N;  2V0L A;  2E8B A;  2Y4J A;  2Y4M A;  5CQL X;  4EE3 A;  4FRO A;  1FRW A;  5C48 A;  3IOI A; 
#chains in the Genus database with same CATH homology
 3T7M A;  4KC2 A;  2OEF A;  2GGQ A;  2WEE A;  5FV9 A;  2FYA A;  4G3S A;  1IIN A;  4EE4 A;  1HM9 A;  1VIC A;  4O6M A;  3V90 A;  2I7B A;  2O1F A;  1S4N A;  1S4O A;  5EJ1 A;  4FIX A;  3ZLL A;  1INJ A;  3Q7U A;  5AJO A;  1WSZ A;  4EEM A;  1G8O A;  2W0W A;  4KPX A;  4Y6U A;  1FXO A;  2RJ1 A;  5I1F A;  3CKJ A;  1GA8 A;  1QGQ A;  3CKV A;  1JV3 A;  1H7Q A;  2YC5 A;  4MIX A;  3RMW A;  1QGS A;  1MP5 A;  1XZ6 A;  1G0R A;  5CMJ A;  3GUE A;  5FYE A;  2Y7A A;  3RSB A;  1KWS A;  3PNN A;  2BO8 A;  1H4E A;  4FRB A;  5C3A A;  2Z87 A;  1H7T A;  1W77 A;  4FQW A;  4EVW A;  3OC9 A;  5C38 A;  3K8D A;  1I52 A;  5CQN X;  3V8Y A;  2RJ0 A;  1OMZ A;  1IIM A;  3IOJ A;  4ASY A;  1R81 A;  2NXV A;  2Z86 A;  1WT1 A;  3U2U A;  1G23 A;  1VZU A;  1YP4 A;  1ZJP A;  1R7U A;  5IDS A;  5JQQ A;  2FFV A;  1ON8 A;  4HO8 A;  2XWL A;  2Y4K A;  2RJ6 A;  3U2V A;  2RJ5 A;  1G95 A;  2AM5 A;  1FWY A;  2YQC A;  1H5S C;  5C3B A;  5AJN A;  2APC A;  4Y7F A;  4FIY A;  1OQM B;  4M2A A;  3E26 A;  1NWG B;  1GX0 A;  3SPT A;  3JUJ A;  4IRQ A;  5L6V A;  1R7Y A;  4HO4 A;  1FO9 A;  1EZI A;  1QWJ A;  4JD0 A;  1NMM B;  1HM8 A;  1ZJ0 A;  4HCQ A;  3OKR A;  2DPW A;  2VS5 A;  3Q80 A;  2FYB A;  4Y64 A;  5DDT A;  2YQH A;  5J49 A;  3DUV A;  3KIA A;  4L41 C;  3CKN A;  1H7G A;  3PKQ A;  2QGI A;  4Y7G A;  2OEG A;  2FFU A;  2P6W A;  4Y6N A;  4FRH A;  1H5S B;  5D91 A;  4Y62 A;  4LW6 A;  4FCU A;  1W55 A;  4K6R A;  3JTJ A;  3D98 A;  4CJ8 A;  4LW3 A;  2BO6 A;  5FTS A;  3SX8 A;  4M28 A;  5C8R A;  1FZW A;  4KRV A;  4ZDQ A;  3I0G A;  5CMF X;  3QVB A;  5FTV A;  2VFZ A;  2RIX A;  3SXE A;  2RJ8 A;  1TVY A;  3I0C A;  1GQC A;  1MP4 A;  4P02 A;  2UX8 A;  3SXA A;  3T7O A;  2V0K A;  1GQ9 A;  3V91 A;  3SXD A;  4Y7U A;  1FOA A;  2OI6 A;  1TW1 A;  4B3U A;  1GX4 A;  4AYJ A;  4ASJ A;  5HS2 A;  1FR8 A;  4HO2 A;  5AJP A;  1HV9 A;  4HO6 A;  4FRA A;  2P72 A;  4Q7C A;  5L6S A;  2WVM A;  2ICY A;  1G9R A;  1R82 A;  3K8E A;  2AE7 A;  4HG6 A;  4DEC A;  2O1G A;  1LVW A;  1E5K A;  2WE9 A;  1ZI3 A;  1MC3 A;  1ZCT A;  2JCJ A;  2OI7 A;  5C4E A;  4HO5 A;  5D92 A;  5DDV A;  3U2X A;  4D0Z A;  3HL3 A;  1JV1 A;  4B4M A;  3O3P A;  5FU8 A;  2BO4 A;  5C4C A;  4Y63 A;  4AYL A;  1ZDF A;  4KC1 A;  1JYK A;  1LZ0 A;  2VD4 A;  1G1L A;  2FYD B;  3OH4 A;  1JVD A;  3R2W A;  2AES A;  1ZI1 A;  3OH0 A;  3I0I X;  1ZHJ A;  2PGV A;  2QH5 A;  2VK9 A;  2P73 A;  1VH1 A;  3D8V A;  1NF5 B;  1VPA A;  1H5T B;  1LL2 A;  5CQM X;  2AEC A;  4KNX A;  1R7T A;  3N9W A;  3ZLK A;  2XME A;  2AM3 A;  2ZU7 A;  5CMH A;  1YRO B;  4MYB A;  4D11 C;  4FRQ A;  3U0Y A;  4Y7V A;  3CGX A;  3NGW A;  1K4V A;  1H5R A;  1H7F A;  5CMI A;  4HO0 A;  1ZDG A;  4DE7 A;  4KC4 A;  4D48 A;  1JVG A;  2I5E A;  1Z90 A;  1HJL A;  5C4B A;  2GGO A;  1ZIZ A;  3F1C A;  4EEO A;  4CJC A;  4YS8 A;  1H7L A;  1ZI4 A;  2AH9 A;  4NAL A;  1VGU A;  5C1H A;  4G3P A;  4C2S A;  3JUK A;  2Y6P A;  1H5S A;  3CKQ A;  3DK5 A;  1GWW A;  1LZ7 A;  5C49 A;  3SX3 A;  1MP3 A;  2JCO A;  4B4G A;  4E1K A;  4M4K A;  2CU2 A;  2WAW A;  5BXC A;  5C36 A;  2YQS A;  4J18 A;  1G2V A;  3I0J A;  1H5S D;  5C3D A;  3Q4S A;  3LW6 A;  3USQ A;  1ON6 A;  3ZGG A;  1NKH B;  4KQL A;  4BMA A;  4FRD A;  1ZJ1 A;  2XMH A;  1QG8 A;  4G87 A;  1LZI A;  2YQJ A;  1H4C A;  4FCE A;  1LL0 A;  5C47 A;  2VS4 A;  3ZGF A;  5C4F A;  2ZU9 A;  2D7I A;  1V84 A;  2YC3 A;  5C4D A;  1ZCU A;  3SX7 A;  4O6N A;  1XHB A;  3RMV A;  2RJ4 A;  3V0O A;  4HO9 A;  2JCL A;  1O7O A;  3FOQ A;  1WVC A;  4ARW A;  2V0J A;  3EE5 A;  2J0A A;  4KT7 A;  4FRP A;  1SS9 A;  2JCK A;  3D5N A;  4KPZ A;  4EEA A;  5EIY A;  1H7H A;  1OMX A;  1R7V A;  4FRE A;  2YES A;  1ZJ3 A;  4B42 A;  3OGZ A;  5IDT A;  4EE5 A;  3IOH A;  2Y4L A;  3OH2 A;  1G93 A;  1YP3 A;  1O7Q A;  4BQH A;  1VGZ A;  1TZF A;  3V0P A;  1V83 A;  2E3D A;  3V0M A;  1ZCY A;  3I0L A;  1VGT A;  1EYR A;  2YCM A;  1VZT A;  1ZJO A;  4DDZ A;  1TW5 A;  5C1L A;  4KNR A;  2RJ7 A;  4HO3 A;  5CMG X;  4AC3 A;  2WGZ A;  3TZT A;  2A8U A;  3SXB A;  3V0L A;  5CQO A;  1O0R A;  4HOC A;  2ZU8 A;  1VH3 A;  5FUH A;  2VS3 A;  4Y9X A;  1H5T A;  2PX7 A;  2FY7 A;  1PZT A;  3V8Z A;  4B5B A;  2WVK A;  2VSH A;  5IFY A;  3CU0 A;  4M2B A;  2C0N A;  4JIS A;  2XWM A;  2MZB A;  2J0B A;  3I0D A;  2AM4 A;  3U2T A;  1ZCV A;  3OH1 A;  4XWI A;  2VXL A;  1JYL A;  4AAW A;  1LZJ A;  2FYC B;  4NAK A;  4B4B A;  1LL3 A;  2A8W A;  1YP2 A;  1PZY B;  1VM8 A;  5CQP A;  2X5S A;  2OI5 A;  1R7X A;  2X60 A;  4UEG A;  3V0Q A;  2D7R A;  5EJZ A;  3U0X A;  1NHE B;  2QKX A;  3SXC A;  1FGG A;  2XWN A;  1WT0 A;  3BCV A;  3DJ4 A;  1INI A;  3F1Y A;  4D11 A;  2RIY A;  2PA4 A;  3BRK X;  2PGY A;  1H3M A;  3POL A;  1NQI B;  4Y7T A;  3T7N A;  4NAN A;  2X65 A;  1HM0 A;  2V0I A;  2ICX A;  4G3Q A;  3V0N A;  3FWW A;  3I0K A;  1FR9 A;  2V0H A;  2VSI A;  1WT3 A;  4B2W A;  1V82 A;  1ZJ2 A;  2D0J A;  1G97 A;  3CKO A;  1S4P A;  4R7P A;  3E25 A;  4NAI A;  4IRP A;  2BO7 A;  4FRL A;  1WT2 A;  3OH3 A;  3OAM A;  4B2X A;  4EEG A;  1G3L A;  1H5R B;  1HJJ A;  1O23 B;  1W57 A;  2VXM A;  1FO8 A;  1H4D A;  1H7E A;  2AGD A;  3SX5 A;  4D0T A;  1VZX A;  1ZI5 A;  5FU0 A;  3U2W A;  4P00 A;  3ST8 A;  3R3I A;  1R80 A;  2WVL A;  2X5Z A;  3ZF8 A;  1VGW A;  3PKP A;  2Q4J A;  4ECM A;  3USR A;  4MND A;  1FGX A;  2RIZ A;  4FRM A;  2RIT A;  3TQD A;  4KXO A;  3I0H A;  3SXG A;  1FXJ A;  2O1H A;  4CVH A;  2RJ9 A;  1GWV A;  5C1G A;  4CJB A;  3I0E A;  3I0F A;  4GBP A;  2W0V A;  2I5K A;  1FG5 N;  2V0L A;  2E8B A;  2Y4J A;  2Y4M A;  5CQL X;  4EE3 A;  4FRO A;  1FRW A;  5C48 A;  3IOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...