4Y7BB

Factor xa complex with gtc000441
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
53
structure length
52
Chain Sequence
RKLCSLDNGDCDQFCHEEQNVVCSCARGYTLADNGKACIPTGPYPCGKQTLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Factor Xa inhibitors: S1 binding interactions of a series of N-{(3S)-1-[(1S)-1-methyl-2-morpholin-4-yl-2-oxoethyl]-2-oxopyrrolidin-3-yl}sulfonamides.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Coagulation factor X
total genus 12
structure length 52
sequence length 53
ec nomenclature ec 3.4.21.6: Coagulation factor Xa.
pdb deposition date 2015-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00008 EGF EGF-like domain
B PF14670 FXa_inhibition Coagulation Factor Xa inhibitory site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 4y7bB00
2VWMK 2XC4L 2XC0L 3N8ZA 1UZJA 3V65B 4O1ZA 2FLBL 3FCSB 4MMYB 1KLJL 5JW1A 1CX2A 1ADXA 2G00L 2YGOA 5CKMA 1PGEA 2KL7A 2P26A 1DQBA 2Y38A 1EPJA 3TK5B 3QH0A 4BTTA 1FF7A 3FBYA 2ADXA 4RRXA 3LAQA 2Y5FL 2PR3B 1XDTR 2XBVL 1MOXC 2P16L 5L30L 1HCGB 2VVCK 1G1TA 3HO3A 2PUQL 2FLRL 4PH9A 1UZKA 2W2OE 1KIGL 1FE2A 3GISX 1J9CL 2VJ3A 1F0RB 4X8VL 3LC5B 4RS0A 2Y7XB 1W7XL 1IQLL 1EPIA 1XFEA 2K2TA 2J2UB 2W26B 4ZH8B 2EI6B 1EQHA 2BOXA 3GCXE 1OB1C 2BQ6A 2WPME 3CS7L 2WPJE 4Y76B 3CENL 2YGPA 2BQ7A 2GD4A 4COXA 1HRFA 3N8WB 2P28B 3HO5A 5IKQA 1KSNB 2VVUL 3NTGA 4LORA 1G1SA 3N8YA 1WU1B 2XBXL 4XL1A 2UWOB 1DVAL 2MHPA 1LQDA 3SW2A 1IQFL 4OTYA 5CKNA 1N1IA 1AUTL 3V64C 1SZBA 2W2QE 4G1MB 1CQEA 2VH6B 1JL9A 2OYUP 1I0UA 3Q7DA 4X8TL 3NTBA 2DDUA 2W2ME 3SOBB 4RRZA 2Y80B 4YT7L 5JBCE 1HAFA 1IP0A 4CUDA 4BTIA 3M37L 2KB9A 2BOHA 3TK6B 3R05A 4D90A 1EAIC 3ZYIB 2P3FN 3N8YB 4JYUL 4O02B 4Y6DB 1EPGA 3U73A 1U8CB 2PHBB 2BOKL 2F9BL 2KV4A 3U7UG 2K2SB 1CCVA 5CISA 1PFXL 1DDXA 3TGFA 2VWNL 1Z6EL 5L2YL 3FFGL 4M11A 3CA7A 1EMNA 1KLOA 4BXWA 1LPKA 4Y79B 1ZAQA 2WYJB 4RRYA 1F7MA 4ISIL 2W86A 1ATBA 3BPSE 1NZIA 5L2ZL 1EQGA 4M10A 1IQGL 2WPIE 4BTUA 1XKBA 2FZZL 5KN5C 2W2NE 6COXA 4ZAEB 1NFXB 2UWPB 3LC3B 4JZFL 3RR3A 2WG3C 1FFMA 2J95B 2P94L 3IJEB 3LTFB 2OYEP 4TGFA 1IGXA 1UZPA 2MGRA 3HS6A 2BO2A 2P93L 1IQML 3LN0A 3C9AC 1B9WA 1EBVA 2CJIB 1ATEA 4Y71B 2RA0L 3N8WA 2XBWL 1X7AL 3TH3L 2VVVL 2FLGA 1IQJL 3KQCL 1IQKL 1IQIL 2I9BA 1K37A 1YGCL 2P3FL 4BXSA 4NA9L 5JB8E 3DEMA 1YO8A 1IOXA 1YUGA 2M74A 1RFNB 5IKTA 4CUEA 1U67A 1Q4GA 4A7IA 1IOEL 1W8BL 1V3XB 5CKQA 2EI8B 1MQ5L 1BF9A 1G2LB 1YUFA 5F19A 2EI7B 4YT6L 2D1JB 2WFXB 1NFWB 1URKA 3KK6A 5JBBE 3H5CB 3KL6B 1LPZA 1HT8A 1KLIL 4ZXXL 3P5BL 3KRKA 5F1AA 5IKRA 4E1GA 1CEJA 1PRHA 1DIYA 2AYLA 1K36A 3QCWA 1L3YA 2B7DL 3HPTA 2WPHE 1ATAA 1TOZA 2P3UA 3IITB 1NPEB 3ENSA 4JYVL 3POYA 3CFWA 3ASIA 1IJQA 1MQ6L 5COXA 4OTJA 1JV2B 2WPLE 1F7EA 2W3KB 4XLWA 3MDLA 4D0EA 1DX5I 3ZYJB 1IQEL 2H9EL 5K0HB 4ZXYL 4Z0KB 2I9AA 1HT5A 4NGAL 3BT1A 1GK5A 5I46L 1IVOC 2XBYL 1TLEA 4JZEL 1WHEA 1P0SL 2Y5HL 4AQTA 1NQLB 3HS5A 4D0FA 4Z6AL 3EGFA 2BMGA 1LMJA 3KQEL 2TGFA 4BDWA 3HO4A 4X8SL 2VWOL 2VH0B 3GCWE 2Y7ZB 1C5MF 3F6UL 3LN1A 3SOQA 4BDXA 2Y81B 2BZ6L 1O5DL 4RUTA 3MQEA 1IQNL 4MMZB 2FD6A 1APQA 4CUFA 1CVWL 1NFYB 1N7DA 1TPGA 3LIWB 5EGMB 2J38B 4Z0LA 1G1RA 1COUA 1EZQB 1NT0A 4CSYA 2JKHL 3SOVA 2Y82B 2J34B 1FAKL 5FDQA 3KQDL 4X8UL 5KIRA 4FM5A 3QMOA 3BT2A 1F0SB 2XC5L 1NFUB 4Y7BB 2Y5GL 1HREA 4LMFA 3KCGL 2BOUA 2W2PE 5JVYA 1PTHA 1PXXA 4MMXB 2WG4B 3Q3KB 4YZUB 3LTGD 1IQHL 2W3IB 2RHPA 2WPKE 1EPHA 5JVZA 1CVUA 3KQBL 2UWLB 2Q1JB 3ELAL 3K9XA 4ISHL 4RRWA 2P3TA 1HJ7A 3NT1A 5JB9E 3OLTA 5IKVA 3M36L 1L5GB 1WHFA 3PGHA 3F1SB 1EGFA 3HS7A 1G1QA 1EMOA 2J4IB 2WFTA 3TZIA 1JBUL 1UZQA 2P95L 2NPRA 1HZ8A 2MGPA 2BQWA 1CCFA 1LPGA 1A3PA 4NG9L 3OLUA 4XBMA 5JBAE 1APOA 4JZDL 1FSBA 1ATDA 1P9JA 1FAXL 1HX2A 3ZYGA 3N8XA 5E8DA 2RNLA 4Y7AB 3TBDA 1FJSL 2VWLL 1Z6CA 1XKAL 1HAEA 1G2MB 3NJPC 4C16A 4ZHAB 1YUKB 3N8VA 1IGZA 2WYGB 1M1XB 2J94B 1QFKL
chains in the Genus database with same CATH superfamily
2VWMK 2XC4L 2XC0L 3N8ZA 1UZJA 3V65B 4O1ZA 2FLBL 3FCSB 4MMYB 1KLJL 5JW1A 1CX2A 1ADXA 2G00L 2YGOA 5CKMA 1PGEA 2KL7A 2P26A 1DQBA 2Y38A 1EPJA 3TK5B 3QH0A 4BTTA 1FF7A 3FBYA 2ADXA 4RRXA 3LAQA 2Y5FL 2PR3B 2KNIA 1XDTR 2HOXA 2VRSA 2XBVL 1MOXC 2P16L 5L30L 1HCGB 2VVCK 1G1TA 3HO3A 2PUQL 2FLRL 4PH9A 1UZKA 2W2OE 1KIGL 1FE2A 3GISX 1J9CL 2VJ3A 1F0RB 4X8VL 3LC5B 4RS0A 2Y7XB 1W7XL 1IQLL 1EPIA 1XFEA 2K2TA 2J2UB 2W26B 4ZH8B 2EI6B 1EQHA 2BOXA 3GCXE 1OB1C 2BQ6A 2WPME 3CS7L 2YGQA 2WPJE 4Y76B 3S6XA 3CENL 2YGPA 2BQ7A 2GD4A 4COXA 1KKEA 1HRFA 3N8WB 2P28B 3HO5A 5IKQA 1KSNB 2VVUL 3NTGA 4LORA 1G1SA 3N8YA 1WU1B 2XBXL 4XL1A 2UWOB 1DVAL 2MHPA 1LQDA 3SW2A 1IQFL 2HORA 4OTYA 5CKNA 1N1IA 1AUTL 3V64C 1SZBA 2W2QE 4G1MB 1CQEA 2VH6B 1JL9A 2OYUP 1I0UA 3Q7DA 4X8TL 3NTBA 2DDUA 2W2ME 3SOBB 4GU4A 4RRZA 2JJLA 2Y80B 4YT7L 5JBCE 1HAFA 1IP0A 4CUDA 4A94C 4BTIA 3M37L 2KB9A 2BOHA 3TK6B 3R05A 4D90A 1EAIC 3ZYIB 2P3FN 3N8YB 4JYUL 4O02B 4Y6DB 1EPGA 3U73A 1U8CB 2PHBB 2BOKL 2F9BL 2KV4A 3U7UG 2K2SB 1CCVA 5CISA 1PFXL 1DDXA 3TGFA 2VWNL 1Z6EL 5L2YL 3FFGL 4M11A 3CA7A 1EMNA 1KLOA 4BXWA 1LPKA 4GU3A 4Y79B 1ZAQA 2WYJB 4RRYA 1F7MA 4ISIL 2W86A 1ATBA 3BPSE 1NZIA 5L2ZL 1EQGA 4M10A 1IQGL 2WPIE 4BTUA 1XKBA 2FZZL 5KN5C 2W2NE 1LK9A 6COXA 4ZAEB 1NFXB 2UWPB 3LC3B 2BT7A 4JZFL 3RR3A 2WG3C 1FFMA 2J95B 2P94L 3IJEB 3LTFB 2OYEP 4TGFA 1IGXA 1UZPA 2MGRA 3HS6A 2BO2A 2P93L 1IQML 3LN0A 3C9AC 1B9WA 1EBVA 2CJIB 1ATEA 4Y71B 2RA0L 3N8WA 2XBWL 1X7AL 3TH3L 2BSFA 2VVVL 2FLGA 1IQJL 3KQCL 1IQKL 1IQIL 2I9BA 1K37A 1YGCL 2P3FL 4BXSA 4NA9L 5JB8E 3DEMA 1YO8A 1LMMA 1IOXA 1YUGA 2M74A 1RFNB 5IKTA 4CUEA 1U67A 1Q4GA 4A7IA 1IOEL 1W8BL 1V3XB 5CKQA 2EI8B 1MQ5L 1BF9A 1G2LB 1YUFA 5F19A 2EI7B 4YT6L 2D1JB 1V1IA 2WFXB 1NFWB 1URKA 3KK6A 5JBBE 3H5CB 3KL6B 1LPZA 1HT8A 1KLIL 4ZXXL 3P5BL 3KRKA 5F1AA 5IKRA 4E1GA 1CEJA 1PRHA 1DIYA 2AYLA 1K36A 3QCWA 1L3YA 2B7DL 3HPTA 2WPHE 1ATAA 1TOZA 2P3UA 3IITB 1NPEB 3ENSA 4JYVL 3POYA 2WZPP 3CFWA 3ASIA 1IJQA 1MQ6L 5COXA 4OTJA 1JV2B 2WPLE 1F7EA 2W3KB 4XLWA 3MDLA 4D0EA 1DX5I 3ZYJB 1IQEL 2H9EL 5K0HB 4ZXYL 4Z0KB 2I9AA 1HT5A 4NGAL 3BT1A 1GK5A 5I46L 1IVOC 2XBYL 1TLEA 4JZEL 1WHEA 1P0SL 2Y5HL 4AQTA 1NQLB 3HS5A 4D0FA 4Z6AL 3EGFA 2BMGA 1LMJA 3KQEL 2TGFA 4BDWA 3HO4A 4X8SL 2VWOL 2VH0B 3GCWE 2Y7ZB 1C5MF 3F6UL 3LN1A 3SOQA 4BDXA 2Y81B 2BZ6L 1O5DL 4RUTA 3MQEA 1IQNL 4MMZB 2FD6A 1APQA 4CUFA 1NFYB 1CVWL 1N7DA 1TPGA 2H9EC 3LIWB 5EGMB 1V1HA 2J38B 4Z0LA 1G1RA 1COUA 1EZQB 1NT0A 4CSYA 2JKHL 3SOVA 2Y82B 2J34B 1FAKL 5FDQA 3KQDL 4X8UL 5KIRA 4FM5A 3QMOA 3BT2A 1F0SB 2XC5L 1NFUB 4Y7BB 2Y5GL 1HREA 1QIUA 4LMFA 3KCGL 2BOUA 2W2PE 5JVYA 1PTHA 1PXXA 4MMXB 2WG4B 3Q3KB 4YZUB 3LTGD 1IQHL 2W3IB 2RHPA 2WPKE 1EPHA 5JVZA 1CVUA 3KQBL 2UWLB 2Q1JB 3ELAL 3K9XA 4ISHL 4RRWA 2P3TA 1HJ7A 3NT1A 5JB9E 3OLTA 5IKVA 3M36L 1L5GB 1WHFA 3PGHA 3F1SB 1EGFA 3HS7A 1G1QA 1EMOA 2J4IB 2WFTA 3TZIA 1JBUL 2BT8A 1UZQA 2P95L 2NPRA 1HZ8A 2MGPA 2BQWA 1CCFA 1LPGA 1A3PA 4NG9L 3OLUA 4XBMA 5JBAE 1APOA 4JZDL 1FSBA 1ATDA 1P9JA 1FAXL 1HX2A 3ZYGA 3N8XA 5E8DA 2RNLA 4Y7AB 3TBDA 1FJSL 2VWLL 1Z6CA 1XKAL 1HAEA 1G2MB 3NJPC 4C16A 4ZHAB 1YUKB 3N8VA 1IGZA 2WYGB 1M1XB 2J94B 1QFKL
chains in the Genus database with same CATH topology
2VWMK 2XC4L 2XC0L 3N8ZA 1UZJA 3V65B 4O1ZA 2FLBL 3FCSB 4MMYB 1KLJL 5JW1A 1CX2A 1ADXA 2G00L 2YGOA 5CKMA 1PGEA 2KL7A 2P26A 1DQBA 2Y38A 1EPJA 3TK5B 3QH0A 4BTTA 1FF7A 3FBYA 2ADXA 4RRXA 3LAQA 2Y5FL 2PR3B 2KNIA 1XDTR 2XBVL 1MOXC 2P16L 5L30L 1HCGB 2VVCK 1G1TA 3HO3A 2PUQL 2FLRL 4PH9A 1UZKA 2W2OE 1KIGL 1FE2A 3GISX 1J9CL 2VJ3A 1F0RB 4X8VL 3LC5B 4RS0A 2Y7XB 1W7XL 1IQLL 1EPIA 1XFEA 2K2TA 2J2UB 2W26B 4ZH8B 2EI6B 1EQHA 2BOXA 3GCXE 1OB1C 2BQ6A 2WPME 3CS7L 2YGQA 2WPJE 4Y76B 3S6XA 3CENL 2YGPA 2BQ7A 2GD4A 4COXA 1HRFA 3N8WB 2P28B 3HO5A 5IKQA 1KSNB 2VVUL 3NTGA 4LORA 1G1SA 3N8YA 1WU1B 2XBXL 4XL1A 2UWOB 1DVAL 2MHPA 1LQDA 3SW2A 1IQFL 4OTYA 5CKNA 1N1IA 1AUTL 3V64C 1SZBA 2W2QE 4G1MB 1CQEA 2VH6B 1JL9A 2OYUP 1I0UA 3Q7DA 4X8TL 3NTBA 2DDUA 2W2ME 3SOBB 4RRZA 2Y80B 4YT7L 5JBCE 1HAFA 1IP0A 4CUDA 4A94C 4BTIA 3M37L 2KB9A 2BOHA 3TK6B 3R05A 4D90A 1EAIC 3ZYIB 2P3FN 3N8YB 4JYUL 4O02B 4Y6DB 1EPGA 3U73A 1U8CB 2PHBB 2BOKL 2F9BL 2KV4A 3U7UG 2K2SB 1CCVA 5CISA 1PFXL 1DDXA 3TGFA 2VWNL 1Z6EL 5L2YL 3FFGL 4M11A 3CA7A 1EMNA 1KLOA 4BXWA 1LPKA 4Y79B 1ZAQA 2WYJB 4RRYA 1F7MA 4ISIL 2W86A 1ATBA 3BPSE 1NZIA 5L2ZL 1EQGA 4M10A 1IQGL 2WPIE 4BTUA 1XKBA 2FZZL 5KN5C 2W2NE 6COXA 4ZAEB 1NFXB 2UWPB 3LC3B 4JZFL 3RR3A 2WG3C 1FFMA 2J95B 2P94L 3IJEB 3LTFB 2OYEP 4TGFA 1IGXA 1UZPA 2MGRA 3HS6A 2BO2A 2P93L 1IQML 3LN0A 3C9AC 1B9WA 1EBVA 2CJIB 1ATEA 4Y71B 2RA0L 3N8WA 2XBWL 1X7AL 3TH3L 2VVVL 2FLGA 1IQJL 3KQCL 1IQKL 1IQIL 2I9BA 1K37A 1YGCL 2P3FL 4BXSA 4NA9L 5JB8E 3DEMA 1YO8A 1LMMA 1IOXA 1YUGA 2M74A 1RFNB 5IKTA 4CUEA 1U67A 1Q4GA 4A7IA 1IOEL 1W8BL 1V3XB 5CKQA 2EI8B 1MQ5L 1BF9A 1G2LB 1YUFA 5F19A 2EI7B 4YT6L 2D1JB 2WFXB 1NFWB 1URKA 3KK6A 5JBBE 3H5CB 3KL6B 1LPZA 1HT8A 1KLIL 4ZXXL 3P5BL 3KRKA 5F1AA 5IKRA 4E1GA 1CEJA 1PRHA 1DIYA 2AYLA 1K36A 3QCWA 1L3YA 2B7DL 3HPTA 2WPHE 1ATAA 1TOZA 2P3UA 3IITB 1NPEB 3ENSA 4JYVL 3POYA 2WZPP 3CFWA 3ASIA 1IJQA 1MQ6L 5COXA 4OTJA 1JV2B 2WPLE 1F7EA 2W3KB 4XLWA 3MDLA 4D0EA 1DX5I 3ZYJB 1IQEL 2H9EL 5K0HB 4ZXYL 4Z0KB 2I9AA 1HT5A 4NGAL 3BT1A 1GK5A 5I46L 1IVOC 2XBYL 1TLEA 4JZEL 1WHEA 1P0SL 2Y5HL 4AQTA 1NQLB 3HS5A 4D0FA 4Z6AL 3EGFA 2BMGA 1LMJA 3KQEL 2TGFA 4BDWA 3HO4A 4X8SL 2VWOL 2VH0B 3GCWE 2Y7ZB 1C5MF 3F6UL 3LN1A 3SOQA 4BDXA 2Y81B 2BZ6L 1O5DL 4RUTA 3MQEA 1IQNL 4MMZB 2FD6A 1APQA 4CUFA 1CVWL 1NFYB 1N7DA 1TPGA 2H9EC 3LIWB 5EGMB 2J38B 4Z0LA 1G1RA 1COUA 1EZQB 1NT0A 4CSYA 2JKHL 3SOVA 2Y82B 2J34B 1FAKL 5FDQA 3KQDL 4X8UL 5KIRA 4FM5A 3QMOA 3BT2A 1F0SB 2XC5L 1NFUB 4Y7BB 2Y5GL 1HREA 4LMFA 3KCGL 2BOUA 2W2PE 5JVYA 1PTHA 1PXXA 4MMXB 2WG4B 3Q3KB 4YZUB 3LTGD 1IQHL 2W3IB 2RHPA 2WPKE 1EPHA 5JVZA 1CVUA 3KQBL 2UWLB 2Q1JB 3ELAL 3K9XA 4ISHL 4RRWA 2P3TA 1HJ7A 3NT1A 5JB9E 3OLTA 5IKVA 3M36L 1L5GB 1WHFA 3PGHA 3F1SB 1EGFA 3HS7A 1G1QA 1EMOA 2J4IB 2WFTA 3TZIA 1JBUL 1UZQA 2P95L 2NPRA 1HZ8A 2MGPA 2BQWA 1CCFA 1LPGA 1A3PA 4NG9L 3OLUA 4XBMA 5JBAE 1APOA 4JZDL 1FSBA 1ATDA 1P9JA 1FAXL 1HX2A 3ZYGA 3N8XA 5E8DA 2RNLA 4Y7AB 3TBDA 1FJSL 2VWLL 1Z6CA 1XKAL 1HAEA 1G2MB 3NJPC 4C16A 4ZHAB 1YUKB 3N8VA 1IGZA 2WYGB 1M1XB 2J94B 1QFKL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VWM K;  2XC4 L;  2XC0 L;  3N8Z A;  1UZJ A;  3V65 B;  4O1Z A;  2FLB L;  3FCS B;  4MMY B;  1KLJ L;  5JW1 A;  1CX2 A;  1ADX A;  2G00 L;  2YGO A;  5CKM A;  1PGE A;  2KL7 A;  2P26 A;  1DQB A;  2Y38 A;  1EPJ A;  3TK5 B;  3QH0 A;  4BTT A;  1FF7 A;  3FBY A;  2ADX A;  4RRX A;  3LAQ A;  2Y5F L;  2PR3 B;  1XDT R;  2XBV L;  1MOX C;  2P16 L;  5L30 L;  1HCG B;  2VVC K;  1G1T A;  3HO3 A;  2PUQ L;  2FLR L;  4PH9 A;  1UZK A;  2W2O E;  1KIG L;  1FE2 A;  3GIS X;  1J9C L;  2VJ3 A;  1F0R B;  4X8V L;  3LC5 B;  4RS0 A;  2Y7X B;  1W7X L;  1IQL L;  1EPI A;  1XFE A;  2K2T A;  2J2U B;  2W26 B;  4ZH8 B;  2EI6 B;  1EQH A;  2BOX A;  3GCX E;  1OB1 C;  2BQ6 A;  2WPM E;  3CS7 L;  2WPJ E;  4Y76 B;  3CEN L;  2YGP A;  2BQ7 A;  2GD4 A;  4COX A;  1HRF A;  3N8W B;  2P28 B;  3HO5 A;  5IKQ A;  1KSN B;  2VVU L;  3NTG A;  4LOR A;  1G1S A;  3N8Y A;  1WU1 B;  2XBX L;  4XL1 A;  2UWO B;  1DVA L;  2MHP A;  1LQD A;  3SW2 A;  1IQF L;  4OTY A;  5CKN A;  1N1I A;  1AUT L;  3V64 C;  1SZB A;  2W2Q E;  4G1M B;  1CQE A;  2VH6 B;  1JL9 A;  2OYU P;  1I0U A;  3Q7D A;  4X8T L;  3NTB A;  2DDU A;  2W2M E;  3SOB B;  4RRZ A;  2Y80 B;  4YT7 L;  5JBC E;  1HAF A;  1IP0 A;  4CUD A;  4BTI A;  3M37 L;  2KB9 A;  2BOH A;  3TK6 B;  3R05 A;  4D90 A;  1EAI C;  3ZYI B;  2P3F N;  3N8Y B;  4JYU L;  4O02 B;  4Y6D B;  1EPG A;  3U73 A;  1U8C B;  2PHB B;  2BOK L;  2F9B L;  2KV4 A;  3U7U G;  2K2S B;  1CCV A;  5CIS A;  1PFX L;  1DDX A;  3TGF A;  2VWN L;  1Z6E L;  5L2Y L;  3FFG L;  4M11 A;  3CA7 A;  1EMN A;  1KLO A;  4BXW A;  1LPK A;  4Y79 B;  1ZAQ A;  2WYJ B;  4RRY A;  1F7M A;  4ISI L;  2W86 A;  1ATB A;  3BPS E;  1NZI A;  5L2Z L;  1EQG A;  4M10 A;  1IQG L;  2WPI E;  4BTU A;  1XKB A;  2FZZ L;  5KN5 C;  2W2N E;  6COX A;  4ZAE B;  1NFX B;  2UWP B;  3LC3 B;  4JZF L;  3RR3 A;  2WG3 C;  1FFM A;  2J95 B;  2P94 L;  3IJE B;  3LTF B;  2OYE P;  4TGF A;  1IGX A;  1UZP A;  2MGR A;  3HS6 A;  2BO2 A;  2P93 L;  1IQM L;  3LN0 A;  3C9A C;  1B9W A;  1EBV A;  2CJI B;  1ATE A;  4Y71 B;  2RA0 L;  3N8W A;  2XBW L;  1X7A L;  3TH3 L;  2VVV L;  2FLG A;  1IQJ L;  3KQC L;  1IQK L;  1IQI L;  2I9B A;  1K37 A;  1YGC L;  2P3F L;  4BXS A;  4NA9 L;  5JB8 E;  3DEM A;  1YO8 A;  1IOX A;  1YUG A;  2M74 A;  1RFN B;  5IKT A;  4CUE A;  1U67 A;  1Q4G A;  4A7I A;  1IOE L;  1W8B L;  1V3X B;  5CKQ A;  2EI8 B;  1MQ5 L;  1BF9 A;  1G2L B;  1YUF A;  5F19 A;  2EI7 B;  4YT6 L;  2D1J B;  2WFX B;  1NFW B;  1URK A;  3KK6 A;  5JBB E;  3H5C B;  3KL6 B;  1LPZ A;  1HT8 A;  1KLI L;  4ZXX L;  3P5B L;  3KRK A;  5F1A A;  5IKR A;  4E1G A;  1CEJ A;  1PRH A;  1DIY A;  2AYL A;  1K36 A;  3QCW A;  1L3Y A;  2B7D L;  3HPT A;  2WPH E;  1ATA A;  1TOZ A;  2P3U A;  3IIT B;  1NPE B;  3ENS A;  4JYV L;  3POY A;  3CFW A;  3ASI A;  1IJQ A;  1MQ6 L;  5COX A;  4OTJ A;  1JV2 B;  2WPL E;  1F7E A;  2W3K B;  4XLW A;  3MDL A;  4D0E A;  1DX5 I;  3ZYJ B;  1IQE L;  2H9E L;  5K0H B;  4ZXY L;  4Z0K B;  2I9A A;  1HT5 A;  4NGA L;  3BT1 A;  1GK5 A;  5I46 L;  1IVO C;  2XBY L;  1TLE A;  4JZE L;  1WHE A;  1P0S L;  2Y5H L;  4AQT A;  1NQL B;  3HS5 A;  4D0F A;  4Z6A L;  3EGF A;  2BMG A;  1LMJ A;  3KQE L;  2TGF A;  4BDW A;  3HO4 A;  4X8S L;  2VWO L;  2VH0 B;  3GCW E;  2Y7Z B;  1C5M F;  3F6U L;  3LN1 A;  3SOQ A;  4BDX A;  2Y81 B;  2BZ6 L;  1O5D L;  4RUT A;  3MQE A;  1IQN L;  4MMZ B;  2FD6 A;  1APQ A;  4CUF A;  1CVW L;  1NFY B;  1N7D A;  1TPG A;  3LIW B;  5EGM B;  2J38 B;  4Z0L A;  1G1R A;  1COU A;  1EZQ B;  1NT0 A;  4CSY A;  2JKH L;  3SOV A;  2Y82 B;  2J34 B;  1FAK L;  5FDQ A;  3KQD L;  4X8U L;  5KIR A;  4FM5 A;  3QMO A;  3BT2 A;  1F0S B;  2XC5 L;  1NFU B;  4Y7B B;  2Y5G L;  1HRE A;  4LMF A;  3KCG L;  2BOU A;  2W2P E;  5JVY A;  1PTH A;  1PXX A;  4MMX B;  2WG4 B;  3Q3K B;  4YZU B;  3LTG D;  1IQH L;  2W3I B;  2RHP A;  2WPK E;  1EPH A;  5JVZ A;  1CVU A;  3KQB L;  2UWL B;  2Q1J B;  3ELA L;  3K9X A;  4ISH L;  4RRW A;  2P3T A;  1HJ7 A;  3NT1 A;  5JB9 E;  3OLT A;  5IKV A;  3M36 L;  1L5G B;  1WHF A;  3PGH A;  3F1S B;  1EGF A;  3HS7 A;  1G1Q A;  1EMO A;  2J4I B;  2WFT A;  3TZI A;  1JBU L;  1UZQ A;  2P95 L;  2NPR A;  1HZ8 A;  2MGP A;  2BQW A;  1CCF A;  1LPG A;  1A3P A;  4NG9 L;  3OLU A;  4XBM A;  5JBA E;  1APO A;  4JZD L;  1FSB A;  1ATD A;  1P9J A;  1FAX L;  1HX2 A;  3ZYG A;  3N8X A;  5E8D A;  2RNL A;  4Y7A B;  3TBD A;  1FJS L;  2VWL L;  1Z6C A;  1XKA L;  1HAE A;  1G2M B;  3NJP C;  4C16 A;  4ZHA B;  1YUK B;  3N8V A;  1IGZ A;  2WYG B;  1M1X B;  2J94 B;  1QFK L; 
#chains in the Genus database with same CATH topology
 2VWM K;  2XC4 L;  2XC0 L;  3N8Z A;  1UZJ A;  3V65 B;  4O1Z A;  2FLB L;  3FCS B;  4MMY B;  1KLJ L;  5JW1 A;  1CX2 A;  1ADX A;  2G00 L;  2YGO A;  5CKM A;  1PGE A;  2KL7 A;  2P26 A;  1DQB A;  2Y38 A;  1EPJ A;  3TK5 B;  3QH0 A;  4BTT A;  1FF7 A;  3FBY A;  2ADX A;  4RRX A;  3LAQ A;  2Y5F L;  2PR3 B;  2KNI A;  1XDT R;  2HOX A;  2VRS A;  2XBV L;  1MOX C;  2P16 L;  5L30 L;  1HCG B;  2VVC K;  1G1T A;  3HO3 A;  2PUQ L;  2FLR L;  4PH9 A;  1UZK A;  2W2O E;  1KIG L;  1FE2 A;  3GIS X;  1J9C L;  2VJ3 A;  1F0R B;  4X8V L;  3LC5 B;  4RS0 A;  2Y7X B;  1W7X L;  1IQL L;  1EPI A;  1XFE A;  2K2T A;  2J2U B;  2W26 B;  4ZH8 B;  2EI6 B;  1EQH A;  2BOX A;  3GCX E;  1OB1 C;  2BQ6 A;  2WPM E;  3CS7 L;  2YGQ A;  2WPJ E;  4Y76 B;  3S6X A;  3CEN L;  2YGP A;  2BQ7 A;  2GD4 A;  4COX A;  1KKE A;  1HRF A;  3N8W B;  2P28 B;  3HO5 A;  5IKQ A;  1KSN B;  2VVU L;  3NTG A;  4LOR A;  1G1S A;  3N8Y A;  1WU1 B;  2XBX L;  4XL1 A;  2UWO B;  1DVA L;  2MHP A;  1LQD A;  3SW2 A;  1IQF L;  2HOR A;  4OTY A;  5CKN A;  1N1I A;  1AUT L;  3V64 C;  1SZB A;  2W2Q E;  4G1M B;  1CQE A;  2VH6 B;  1JL9 A;  2OYU P;  1I0U A;  3Q7D A;  4X8T L;  3NTB A;  2DDU A;  2W2M E;  3SOB B;  4GU4 A;  4RRZ A;  2JJL A;  2Y80 B;  4YT7 L;  5JBC E;  1HAF A;  1IP0 A;  4CUD A;  4A94 C;  4BTI A;  3M37 L;  2KB9 A;  2BOH A;  3TK6 B;  3R05 A;  4D90 A;  1EAI C;  3ZYI B;  2P3F N;  3N8Y B;  4JYU L;  4O02 B;  4Y6D B;  1EPG A;  3U73 A;  1U8C B;  2PHB B;  2BOK L;  2F9B L;  2KV4 A;  3U7U G;  2K2S B;  1CCV A;  5CIS A;  1PFX L;  1DDX A;  3TGF A;  2VWN L;  1Z6E L;  5L2Y L;  3FFG L;  4M11 A;  3CA7 A;  1EMN A;  1KLO A;  4BXW A;  1LPK A;  4GU3 A;  4Y79 B;  1ZAQ A;  2WYJ B;  4RRY A;  1F7M A;  4ISI L;  2W86 A;  1ATB A;  3BPS E;  1NZI A;  5L2Z L;  1EQG A;  4M10 A;  1IQG L;  2WPI E;  4BTU A;  1XKB A;  2FZZ L;  5KN5 C;  2W2N E;  1LK9 A;  6COX A;  4ZAE B;  1NFX B;  2UWP B;  3LC3 B;  2BT7 A;  4JZF L;  3RR3 A;  2WG3 C;  1FFM A;  2J95 B;  2P94 L;  3IJE B;  3LTF B;  2OYE P;  4TGF A;  1IGX A;  1UZP A;  2MGR A;  3HS6 A;  2BO2 A;  2P93 L;  1IQM L;  3LN0 A;  3C9A C;  1B9W A;  1EBV A;  2CJI B;  1ATE A;  4Y71 B;  2RA0 L;  3N8W A;  2XBW L;  1X7A L;  3TH3 L;  2BSF A;  2VVV L;  2FLG A;  1IQJ L;  3KQC L;  1IQK L;  1IQI L;  2I9B A;  1K37 A;  1YGC L;  2P3F L;  4BXS A;  4NA9 L;  5JB8 E;  3DEM A;  1YO8 A;  1LMM A;  1IOX A;  1YUG A;  2M74 A;  1RFN B;  5IKT A;  4CUE A;  1U67 A;  1Q4G A;  4A7I A;  1IOE L;  1W8B L;  1V3X B;  5CKQ A;  2EI8 B;  1MQ5 L;  1BF9 A;  1G2L B;  1YUF A;  5F19 A;  2EI7 B;  4YT6 L;  2D1J B;  1V1I A;  2WFX B;  1NFW B;  1URK A;  3KK6 A;  5JBB E;  3H5C B;  3KL6 B;  1LPZ A;  1HT8 A;  1KLI L;  4ZXX L;  3P5B L;  3KRK A;  5F1A A;  5IKR A;  4E1G A;  1CEJ A;  1PRH A;  1DIY A;  2AYL A;  1K36 A;  3QCW A;  1L3Y A;  2B7D L;  3HPT A;  2WPH E;  1ATA A;  1TOZ A;  2P3U A;  3IIT B;  1NPE B;  3ENS A;  4JYV L;  3POY A;  2WZP P;  3CFW A;  3ASI A;  1IJQ A;  1MQ6 L;  5COX A;  4OTJ A;  1JV2 B;  2WPL E;  1F7E A;  2W3K B;  4XLW A;  3MDL A;  4D0E A;  1DX5 I;  3ZYJ B;  1IQE L;  2H9E L;  5K0H B;  4ZXY L;  4Z0K B;  2I9A A;  1HT5 A;  4NGA L;  3BT1 A;  1GK5 A;  5I46 L;  1IVO C;  2XBY L;  1TLE A;  4JZE L;  1WHE A;  1P0S L;  2Y5H L;  4AQT A;  1NQL B;  3HS5 A;  4D0F A;  4Z6A L;  3EGF A;  2BMG A;  1LMJ A;  3KQE L;  2TGF A;  4BDW A;  3HO4 A;  4X8S L;  2VWO L;  2VH0 B;  3GCW E;  2Y7Z B;  1C5M F;  3F6U L;  3LN1 A;  3SOQ A;  4BDX A;  2Y81 B;  2BZ6 L;  1O5D L;  4RUT A;  3MQE A;  1IQN L;  4MMZ B;  2FD6 A;  1APQ A;  4CUF A;  1NFY B;  1CVW L;  1N7D A;  1TPG A;  2H9E C;  3LIW B;  5EGM B;  1V1H A;  2J38 B;  4Z0L A;  1G1R A;  1COU A;  1EZQ B;  1NT0 A;  4CSY A;  2JKH L;  3SOV A;  2Y82 B;  2J34 B;  1FAK L;  5FDQ A;  3KQD L;  4X8U L;  5KIR A;  4FM5 A;  3QMO A;  3BT2 A;  1F0S B;  2XC5 L;  1NFU B;  4Y7B B;  2Y5G L;  1HRE A;  1QIU A;  4LMF A;  3KCG L;  2BOU A;  2W2P E;  5JVY A;  1PTH A;  1PXX A;  4MMX B;  2WG4 B;  3Q3K B;  4YZU B;  3LTG D;  1IQH L;  2W3I B;  2RHP A;  2WPK E;  1EPH A;  5JVZ A;  1CVU A;  3KQB L;  2UWL B;  2Q1J B;  3ELA L;  3K9X A;  4ISH L;  4RRW A;  2P3T A;  1HJ7 A;  3NT1 A;  5JB9 E;  3OLT A;  5IKV A;  3M36 L;  1L5G B;  1WHF A;  3PGH A;  3F1S B;  1EGF A;  3HS7 A;  1G1Q A;  1EMO A;  2J4I B;  2WFT A;  3TZI A;  1JBU L;  2BT8 A;  1UZQ A;  2P95 L;  2NPR A;  1HZ8 A;  2MGP A;  2BQW A;  1CCF A;  1LPG A;  1A3P A;  4NG9 L;  3OLU A;  4XBM A;  5JBA E;  1APO A;  4JZD L;  1FSB A;  1ATD A;  1P9J A;  1FAX L;  1HX2 A;  3ZYG A;  3N8X A;  5E8D A;  2RNL A;  4Y7A B;  3TBD A;  1FJS L;  2VWL L;  1Z6C A;  1XKA L;  1HAE A;  1G2M B;  3NJP C;  4C16 A;  4ZHA B;  1YUK B;  3N8V A;  1IGZ A;  2WYG B;  1M1X B;  2J94 B;  1QFK L; 
#chains in the Genus database with same CATH homology
 2VWM K;  2XC4 L;  2XC0 L;  3N8Z A;  1UZJ A;  3V65 B;  4O1Z A;  2FLB L;  3FCS B;  4MMY B;  1KLJ L;  5JW1 A;  1CX2 A;  1ADX A;  2G00 L;  2YGO A;  5CKM A;  1PGE A;  2KL7 A;  2P26 A;  1DQB A;  2Y38 A;  1EPJ A;  3TK5 B;  3QH0 A;  4BTT A;  1FF7 A;  3FBY A;  2ADX A;  4RRX A;  3LAQ A;  2Y5F L;  2PR3 B;  2KNI A;  1XDT R;  2XBV L;  1MOX C;  2P16 L;  5L30 L;  1HCG B;  2VVC K;  1G1T A;  3HO3 A;  2PUQ L;  2FLR L;  4PH9 A;  1UZK A;  2W2O E;  1KIG L;  1FE2 A;  3GIS X;  1J9C L;  2VJ3 A;  1F0R B;  4X8V L;  3LC5 B;  4RS0 A;  2Y7X B;  1W7X L;  1IQL L;  1EPI A;  1XFE A;  2K2T A;  2J2U B;  2W26 B;  4ZH8 B;  2EI6 B;  1EQH A;  2BOX A;  3GCX E;  1OB1 C;  2BQ6 A;  2WPM E;  3CS7 L;  2YGQ A;  2WPJ E;  4Y76 B;  3S6X A;  3CEN L;  2YGP A;  2BQ7 A;  2GD4 A;  4COX A;  1HRF A;  3N8W B;  2P28 B;  3HO5 A;  5IKQ A;  1KSN B;  2VVU L;  3NTG A;  4LOR A;  1G1S A;  3N8Y A;  1WU1 B;  2XBX L;  4XL1 A;  2UWO B;  1DVA L;  2MHP A;  1LQD A;  3SW2 A;  1IQF L;  4OTY A;  5CKN A;  1N1I A;  1AUT L;  3V64 C;  1SZB A;  2W2Q E;  4G1M B;  1CQE A;  2VH6 B;  1JL9 A;  2OYU P;  1I0U A;  3Q7D A;  4X8T L;  3NTB A;  2DDU A;  2W2M E;  3SOB B;  4RRZ A;  2Y80 B;  4YT7 L;  5JBC E;  1HAF A;  1IP0 A;  4CUD A;  4A94 C;  4BTI A;  3M37 L;  2KB9 A;  2BOH A;  3TK6 B;  3R05 A;  4D90 A;  1EAI C;  3ZYI B;  2P3F N;  3N8Y B;  4JYU L;  4O02 B;  4Y6D B;  1EPG A;  3U73 A;  1U8C B;  2PHB B;  2BOK L;  2F9B L;  2KV4 A;  3U7U G;  2K2S B;  1CCV A;  5CIS A;  1PFX L;  1DDX A;  3TGF A;  2VWN L;  1Z6E L;  5L2Y L;  3FFG L;  4M11 A;  3CA7 A;  1EMN A;  1KLO A;  4BXW A;  1LPK A;  4Y79 B;  1ZAQ A;  2WYJ B;  4RRY A;  1F7M A;  4ISI L;  2W86 A;  1ATB A;  3BPS E;  1NZI A;  5L2Z L;  1EQG A;  4M10 A;  1IQG L;  2WPI E;  4BTU A;  1XKB A;  2FZZ L;  5KN5 C;  2W2N E;  6COX A;  4ZAE B;  1NFX B;  2UWP B;  3LC3 B;  4JZF L;  3RR3 A;  2WG3 C;  1FFM A;  2J95 B;  2P94 L;  3IJE B;  3LTF B;  2OYE P;  4TGF A;  1IGX A;  1UZP A;  2MGR A;  3HS6 A;  2BO2 A;  2P93 L;  1IQM L;  3LN0 A;  3C9A C;  1B9W A;  1EBV A;  2CJI B;  1ATE A;  4Y71 B;  2RA0 L;  3N8W A;  2XBW L;  1X7A L;  3TH3 L;  2VVV L;  2FLG A;  1IQJ L;  3KQC L;  1IQK L;  1IQI L;  2I9B A;  1K37 A;  1YGC L;  2P3F L;  4BXS A;  4NA9 L;  5JB8 E;  3DEM A;  1YO8 A;  1LMM A;  1IOX A;  1YUG A;  2M74 A;  1RFN B;  5IKT A;  4CUE A;  1U67 A;  1Q4G A;  4A7I A;  1IOE L;  1W8B L;  1V3X B;  5CKQ A;  2EI8 B;  1MQ5 L;  1BF9 A;  1G2L B;  1YUF A;  5F19 A;  2EI7 B;  4YT6 L;  2D1J B;  2WFX B;  1NFW B;  1URK A;  3KK6 A;  5JBB E;  3H5C B;  3KL6 B;  1LPZ A;  1HT8 A;  1KLI L;  4ZXX L;  3P5B L;  3KRK A;  5F1A A;  5IKR A;  4E1G A;  1CEJ A;  1PRH A;  1DIY A;  2AYL A;  1K36 A;  3QCW A;  1L3Y A;  2B7D L;  3HPT A;  2WPH E;  1ATA A;  1TOZ A;  2P3U A;  3IIT B;  1NPE B;  3ENS A;  4JYV L;  3POY A;  2WZP P;  3CFW A;  3ASI A;  1IJQ A;  1MQ6 L;  5COX A;  4OTJ A;  1JV2 B;  2WPL E;  1F7E A;  2W3K B;  4XLW A;  3MDL A;  4D0E A;  1DX5 I;  3ZYJ B;  1IQE L;  2H9E L;  5K0H B;  4ZXY L;  4Z0K B;  2I9A A;  1HT5 A;  4NGA L;  3BT1 A;  1GK5 A;  5I46 L;  1IVO C;  2XBY L;  1TLE A;  4JZE L;  1WHE A;  1P0S L;  2Y5H L;  4AQT A;  1NQL B;  3HS5 A;  4D0F A;  4Z6A L;  3EGF A;  2BMG A;  1LMJ A;  3KQE L;  2TGF A;  4BDW A;  3HO4 A;  4X8S L;  2VWO L;  2VH0 B;  3GCW E;  2Y7Z B;  1C5M F;  3F6U L;  3LN1 A;  3SOQ A;  4BDX A;  2Y81 B;  2BZ6 L;  1O5D L;  4RUT A;  3MQE A;  1IQN L;  4MMZ B;  2FD6 A;  1APQ A;  4CUF A;  1CVW L;  1NFY B;  1N7D A;  1TPG A;  2H9E C;  3LIW B;  5EGM B;  2J38 B;  4Z0L A;  1G1R A;  1COU A;  1EZQ B;  1NT0 A;  4CSY A;  2JKH L;  3SOV A;  2Y82 B;  2J34 B;  1FAK L;  5FDQ A;  3KQD L;  4X8U L;  5KIR A;  4FM5 A;  3QMO A;  3BT2 A;  1F0S B;  2XC5 L;  1NFU B;  4Y7B B;  2Y5G L;  1HRE A;  4LMF A;  3KCG L;  2BOU A;  2W2P E;  5JVY A;  1PTH A;  1PXX A;  4MMX B;  2WG4 B;  3Q3K B;  4YZU B;  3LTG D;  1IQH L;  2W3I B;  2RHP A;  2WPK E;  1EPH A;  5JVZ A;  1CVU A;  3KQB L;  2UWL B;  2Q1J B;  3ELA L;  3K9X A;  4ISH L;  4RRW A;  2P3T A;  1HJ7 A;  3NT1 A;  5JB9 E;  3OLT A;  5IKV A;  3M36 L;  1L5G B;  1WHF A;  3PGH A;  3F1S B;  1EGF A;  3HS7 A;  1G1Q A;  1EMO A;  2J4I B;  2WFT A;  3TZI A;  1JBU L;  1UZQ A;  2P95 L;  2NPR A;  1HZ8 A;  2MGP A;  2BQW A;  1CCF A;  1LPG A;  1A3P A;  4NG9 L;  3OLU A;  4XBM A;  5JBA E;  1APO A;  4JZD L;  1FSB A;  1ATD A;  1P9J A;  1FAX L;  1HX2 A;  3ZYG A;  3N8X A;  5E8D A;  2RNL A;  4Y7A B;  3TBD A;  1FJS L;  2VWL L;  1Z6C A;  1XKA L;  1HAE A;  1G2M B;  3NJP C;  4C16 A;  4ZHA B;  1YUK B;  3N8V A;  1IGZ A;  2WYG B;  1M1X B;  2J94 B;  1QFK L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...