4Y89A

Crystal structure of the n-terminal domain of ceacam7
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
109
structure length
109
Chain Sequence
b'AQTNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGIYTLHVIKENLVNEEVTRQFYVF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the N-terminal dimerization domain of CEACAM7.
pubmed doi rcsb
molecule keywords Carcinoembryonic antigen-related cell adhesion molecule 7
source organism Homo sapiens
molecule tags Cell adhesion
total genus 34
structure length 109
sequence length 109
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y89A01
2HTLC 1HQ4A 1KCKA 2NY2B 2E7LC 4JFFA 4R4NC 1LP9E 4YHLH 2EDKA 5FDWA 2YZ1A 2NR6D 2NTSP 3IDXH 5I17B 3MLZH 3RIAF 3RWDA 4DW2L 2C1OA 2W59A 4NBXB 3VGAB 1FO0B 4D9QE 1FZKB 2VQUA 3TV3H 3CSYB 3ZDZE 1BIHA 5TF0A 4LCWB 3BYTA 1CQYA 1LVEA 1C7SA 1QHOA 4KC3B 4G42B 5HHNB 5IW1A 2AVGA 1QLRA 2FJGA 5E6IC 4W4OA 2VZSA 1JN6A 5IW3A 2X4NB 1ADQA 4DAGL 4NRXB 1RFDL 4K3EH 1UACH 3IU4L 2G60L 4NKOB 1ZEAL 4I48B 1T1ZB 1KNOB 2ERJB 4RGNB 4WDIB 3R1GL 4JY5L 4Z8FL 3CSBA 2YPVL 2X44D 1JV5A 5D7SH 3LCYA 3G6JB 2A83A 3NCEB 3V4PL 4Z7WA 3WJJC 5MEOA 3AC0A 1LEIB 3N1MC 5ESQA 4CMMA 3SKNA 5HHQA 4XCCL 3EYVA 2VDPH 1DUYA 3ULVH 1MCFA 1JPST 2BP3A 2YMXL 1DVFD 2R1WA 1J8HE 5AZ2L 5J11B 4NQXA 3TZVD 1T5XB 2EH7H 3BIAX 5B4MD 2EKJA 1A7QH 3MGTA 5SWSB 5IQ9A 3BN9D 3BUTA 5IW6A 4WI9A 4X9FA 4NGHL 1QEWB 3CZFA 5GZOD 32C2B 2KBGA 4ZXBD 3QNXB 2Q6WA 4LVOC 3HUJF 1U3HD 2BZDA 4WEUD 4XNMA 5IHZA 3SDXF 1NAMB 3D1MC 1FVDA 5GRJL 1TZIB 4X6DE 4QXTB 1NH6A 1AC0A 4LP4A 5CEXA 5L2KB 2V2TA 1XIWA 3OJMB 3VXUA 4WWKD 1SJEA 2A2QT 4KVNH 1VDGA 4JO4H 1M7IB 1RJZB 3BIKB 5C0ND 1D9KC 1CFVH 2LVCA 1LNUB 3U4BH 3VRIB 4LSPL 5DI8B 2H9GB 4BZ2L 2YS4A 1RIVL 2FYYB 5D9SB 3TNNB 2FL5B 4M3KB 1NFIA 2EYTB 4WFGD 5ALBL 1I3RA 3BP4A 1G1CA 4Y5VB 1RQ5A 5JTWA 1WAAE 3QJFA 5E4EB 4K2UL 1FZJB 1QR1B 2XV6B 3VFGH 2APTA 5F3HA 4C55A 3I84A 2GTZA 1Q9LA 3QG6A 4GMTL 4ODUA 5F7YC 3TVMC 3T3PF 1JNJA 2CLRA 4PJAE 4H8WL 1YECH 2WZPD 3ULVD 3D39E 1A7NH 3OMZA 3RWGA 2DLFH 5ANMA 3SO3B 5EU7E 4MA3A 1AO7E 3QIUA 4OLXL 4WO4B 4EXPX 1XF2B 2AQ2A 1E27B 5E24E 3FN0H 3MRHB 5CJQL 5I16B 3HE6B 4FFVD 4QF1A 3WDIA 4HKBA 1MAMH 2IBGA 1NC2D 1NGWA 1SBSH 3KYOA 3BRFA 5HDBE 3O45B 1OOAA 1R5IB 1U9KA 3QUXB 3GGWB 3QDME 3IDXL 3B6SA 4IOSD 3MLZL 4CVZB 1JIBA 2HFGH 4MXVE 1JHLL 2FBOJ 3TV3L 2J5LB 3OWEA 3SJVB 3V52H 2XQBH 4CDHA 1UWGL 2P24B 1F00I 5IM7B 5J1AB 1YN7B 5IMLA 2YC1B 3ZTNH 5T1LA 4C56D 2HT3D 1IZJA 3G04B 3VFMA 2FZ3A 3PUCA 3ZYIA 4CMHB 1HH9B 4ELMB 4Q9QH 3QCVH 5EO0A 1L7TH 2JJTA 3QXTA 4QHLB 5I1HH 4K3EL 3V0VB 1JGDB 1UACL 4JFXB 2NXYB 1K2DA 2PXYB 2BCKB 2HT4D 2DQJH 3QEQB 4ZTOH 1AHWC 3W11D 1IC5H 4OCXL 1AD9B 3DV4B 4WFED 4OJFL 5J3HC 1EEQA 4JQVC 1QG3A 1ZSDA 3TBSB 2OZ4L 4L3EB 4OKVB 2XWTA 1EMTH 1NCTA 4LLUB 1IC4H 5FYJH 4Q6YA 3E6FA 1VA9A 5E8PA 2DDQH 3K8KA 4M00A 1KCSH 3MLYH 3CGTA 2IQ9H 3SKJL 2GTWB 1I9JL 1P6AB 2EH7L 4JRWA 1A7QL 1IEBB 3L3KA 2CD0A 3Q3GB 4Q9RL 2ZNXA 4KDTC 1K8IA 1A7BA 3LOWA 3GM0A 5E6IB 5EU5B 1QLEH 1B0WA 5DURD 3IFOB 2EDFA 1UWXK 1YEJL 4NKIH 2F53B 3JWNC 3D9AL 5KSBF 5IMMA 4NO5B 1FVEA 4QHUB 5DC0A 1JZ8A 1EO7A 1SYVB 4KVNL 2FBJL 3F5WA 3GMLA 5F6IC 3V7MA 2HFFB 2XIDA 2QSTA 2XWJA 3S4SG 2ADIB 1CFVL 1Z0MA 4JFDE 4QTHA 3U4BL 2R8SH 1GJIA 3RY4A 3MC0A 3PG2A 4EN3C 1F90H 3EHBC 2EDQA 4EUPB 2C1PB 1ZVYA 3ZKMC 2D31B 2H2SC 4H26A 5JHDE 2IADA 4UQ2A 1T03L 4JDVA 4PLJC 1H3WM 1M7DA 4KAQH 2X4QA 5EOTA 3CFDA 1NDGB 3HG1A 1NDMA 4FN0A 3VFGL 1F3RB 2PYEB 4ZOBA 4D94A 3TCLA 4LVOB 5DEGA 5JHLH 3FAWA 3X13B 2CIKA 2ZKHH 5E8DH 3VI3E 4MA8H 3KPSB 1S9YA 5GJSH 2FIKB 1SY6A 3DYMA 5F1SA 1YECL 5FYJD 2DLFL 1U3ZA 1KLGA 4GW4B 3HZVB 1TTGA 1DBKH 1KBGH 4ONOA 3ARDD 2W1NA 5FCUH 3FN0L 4YGVA 2VXSH 3B2UC 1TQBC 3U0PB 4U1NB 5D5MA 1MAML 3LN5B 3VWJC 5IEKA 3MLUH 1SBSL 2Q7YA 4Q97A 5HI3C 3QG7H 4DVBB 5FYKU 3I3DA 1LK3L 3ULUF 4X4MA 5DJ8A 4MSWB 5ID1A 2HFGL 5HYSB 2ZP0T 3QH3B 2AK4E 1Q8MA 3BEVA 5D2LF 2V6HA 4U7KA 4Z7OE 5AG8A 3GSWB 2YPLB 4X9HA 4L3AA 4GG6F 1H3TA 2XQBL 2QTEA 3H9HB 4XZUA 4ZPVA 1T0NB 4F3FB 1X7QA 4G6JL 5SWQA 4IOFC 4RQQB 4ONGH 4X80L 4ZUVB 3QUZD 4RA3A 3B2VH 4WTXA 3MV8A 3TVMB 5GZND 4I18C 3SQOL 2QL1A 4Q9QL 3DECA 3QCVL 5ESAB 3WUWB 1L7TL 5J13C 2E9WA 2VUYA 5C0RH 5HYJB 4FQLL 4PJ8C 3G6AB 4U6HB 3VH8G 2ADJA 1X5AA 4BELD 4AQOA 3LQAL 9CGTA 5D7KE 5C0IA 4ZTOL 1EUUA 2LU7A 5BCAA 1EEYA 2HFEA 4LPYA 2FB4H 1IC5L 3VXTB 1HEZB 4DUWA 1WIPA 3S97C 2F54A 3BKJH 2Q86B 5I1CH 3PWNA 4Z0BL 1HHIB 2K3TA 4Y16C 3PGFL 4LEXH 3FZUD 1AD0A 1Y0LB 1QVOB 4I0PC 3NPZB 3MCKA 4LPUA 4WW2A 1H8NA 2DDQL 4PJXA 5DR5H 5EWIH 1KCSL 3EYQD 1P7KA 3TIEB 1XH3B 1T7VA 2IQ9L 2Q76A 2UWEF 3ARYA 3MRFB 3QFJE 3BPLC 3QO1A 3SE8H 5JPMB 3EAKA 1H8SA 2MCPL 4ZO7A 3MGAA 3ARFD 3DYOA 4HFUH 1SEBA 1JNHA 1QLEL 5K33A 4NKIL 1EERB 3DARA 3OKKB 3FO1B 3INUL 3UPAA 4O2FB 3EDFA 4FRWA 4IRSC 2YD4A 4A6YA 1VFBB 2FEDC 3U36A 4JJ5A 3CFKA 2PO6D 4KMLB 1ZHKA 4R3SB 5DD1H 3PP4H 4GRMA 4LKXB 1N3NA 2CDGA 4JRXB 3AREA 1WC7A 1AHWB 3KYNA 4OT1H 1LO5B 3OBAA 3AY4A 3MRQA 2A6DA 5DTFB 1S7UA 4OUOA 4NDMB 3IXTA 4MX7A 5LVEA 4PGCA 3QIWC 1AXIB 4MB5A 4BKLA 2BVEA 1I7UB 4R96B 3QDHA 3FMGL 4NQDA 1HQRA 3OKMB 4L8SC 5MEQB 4OZFB 3IJYA 4PLKC 4GAFB 4R4BB 2GAZA 1BVKB 5DMKB 4PR5B 2ESVB 4KAQL 1BF2A 4RGOL 5CUSH 3CFJB 5AZEH 5KZCB 4JFEA 3DETD 1MIEH 3FO9A 4KTEH 1LQSR 3ZKXC 2PCPB 3C2AL 4X98A 4PJBA 3DGGA 5JHLL 5F7NC 5EBLA 4GW1B 2DS4A 5E8DL 1NEZG 4MA8L 5GJSL 2EDBA 1VEMA 4I8DA 3CFBB 2JE8A 2XKUA 1OF2A 5C07B 5F6IB 5E6ZA 1DBKL 1FFQA 3GSNB 2VXSL 3FAXA 2WAHA 2PYFB 4Y4KD 5ICYA 1X44A 2HKFH 3CDYA 3HRZA 3MLUL 3QG7L 4AJ0A 5EBGA 4EN3B 4XH2B 3LQMA 3NTCH 4ZPTA 5EBMB 3QDAA 2FR4B 3UO1H 4EZMA 5C2UB 2NNAB 4EQ2A 4D9QD 1FP5A 1IVLA 3ARPA 3I75B 4PJHF 1BPVA 1YEIH 1QRNB 4PJFF 1U8IA 1CXHA 3VFPA 3GSRA 1RJLB 1CL7I 3L7FA 4GXUM 2W0PA 3RVUD 5D7JD 1XGTA 3X3FH 1MHPL 2A0LC 3B2VL 3SDXA 4FABH 1V05A 5LJYH 2XZAH 4NKMB 1MCQA 4IHOB 1ZWIB 4AIOA 1O0VA 5C0RL 2I9TA 3ZE1F 4EJ1C 1WWAX 4U6YA 1DEDA 1LE5A 1IAKB 2BNUA 2VDRH 1X5YA 3SN6N 3DV6A 3E6HB 5HPMB 3IKKA 4JRYE 1TQBB 1OAQH 1TNMA 4M43L 4XC1L 1C12A 3VWJB 3PQYE 4G9DA 2F19H 1SQ2N 4ORGB 4X6CA 3ET9F 4RFOH 1TPXC 5CCKH 3BKJL 3GUTA 4FZEH 2RBLA 4HUNB 2N56A 2UVEA 2J2ZA 4GKOA 4TPRL 4LEXL 1EX0A 3ECBA 3QXUA 4P3DB 1B90A 1FLTX 4KMTH 5JW4R 5DR5L 1RMFH 5EWIL 4CW1B 2GYSA 2VUOA 1JFQL 1T1YA 4GUPA 3SE8L 2F5BL 4MAYC 3OKNA 3WFDH 2W0FA 1CE1L 2I26N 4HFUL 2CO6B 3BIBX 5ID0B 4I18B 2NR6C 4TVPE 1U2HA 1UXSB 3U9UB 4ONHB 5J13B 3MRRA 3CVHB 4F7CA 2HLFC 4FTVA 5C0CB 4QNPE 3EO1B 4PJ8B 1NSNH 2B4CL 4L4VE 1CQKA 1TDQA 5CBEA 1JGEB 1FNSH 2D7PA 3L1OH 1TJGH 4PRIE 4DKEH 4UV7H 3LKOB 3TBWA 5FB8A 5HYFA 4JFOA 3WIIL 4OT1L 3KPRB 5J9PA 4PJIE 3TYGH 2GW5A 3W5NA 1B0GA 5JQ6L 4P57B 3MV7E 2FJHB 5BRZE 4J12A 1I85C 1ES0A 4F80A 5I1GL 1A4JA 4PJ9A 2JJVA 2GK0A 4H25B 3RL2A 4Y16B 4LQFH 4ZS6D 3NIDF 4I0PB 2UYLA 1ETZA 5E00B 3GBLA 4QHKJ 4NCC2 3F7PC 1KF9B 5KSBE 2PETA 4AYFA 5EUKA 3BPLB 1XF4B 2Y06H 2VIRA 3B9KD 4IMLB 5AZEL 3BQUD 3A0OA 2P5WD 2B39A 1UCTA 5ACZA 4MD4B 4JPIA 5IF0A 1A6PA 1MI5B 2V2WB 2ZUUA 3REWB 5KSUA 2EDDA 1CXEA 4DKFH 2HMID 5IT2H 4IRSB 1HWGB 3D39D 4JM2C 4JDZB 2P44B 1NMCC 4ETYA 3NIFE 1FV1A 2CKBB 3V6ZB 1OGAD 1AO7D 1AP2A 5IHUH 3TZVC 3RDTC 5FUZH 3OG4B 3UDWC 5F72S 5GZOC 1BD2B 2V5MA 5FM5M 3HTLX 5AYUL 3LKNB 3FB8B 3PP3K 2HKFL 3QIWB 5C86A 1U3HC 5E2VL 3FFCE 2MHAA 5AUMA 1QFWI 1WWBX 4AEIH 1S7TB 2OP4H 3ZHDA 4L8SB 1R5VA 1ED3B 1VCAA 1IM9B 5F96L 3GMOB 1DVFA 3LPWA 1QFOA 3VA6A 3DUHA 1YEIL 5JW3H 1IAII 1K5NA 5EIVA 3ZKXB 3G5XB 2F58H 15C8H 3X3FL 3CMGA 1BFVH 1PDKA 1BZ9A 2SEBA 5I8EB 4UNUA 5GS0H 4FABL 4ZXBA 3QWOA 5EN2B 3HNSL 4G9FA 5EOQH 3P4LA 2HAZA 2W91A 3MUZ1 1YEDB 5I71B 1A6ZA 3IFPA 4JCLA 3ULUE 1U92A 1G9MC 5TE4H 3CZJA 3QRGH 1II4E 5E6YA 5K59E 4PRDA 5DRNA 1SVCP 3EFFB 4PJ5D 4I77H 4Q0XL 4JVUA 4WWKA 4JM4H 1U95B 5D2LE 1KIUA 2PTUA 3AAZA 4GXVH 1OAQL 3U0WL 4OZIF 1A6WH 2D2OA 2VLJA 4GG6E 2DM7A 2EYRA 4Y4HD 1FL6B 4RRPA 4I5BB 2P7TB 3QCTL 1SJVA 2LE9A 2XXCB 3L6FB 1ZVHA 5DJDA 2CSPA 5CCKL 3MLPA 4TSAH 4S2SA 5D7IE 3OKLA 2DQFB 3OGCB 4FZEL 2G2RA 1U91A 1E4XH 4G6KH 3VCLB 3MLTA 4AQ1B 4KUZL 1PY4A 2IPKA 3L5IA 5D1QD 2V7NA 1F3DJ 2H6PB 4KMTL 4Z7NF 3ARQA 5LBSL 3AROA 4ZNCD 5CAYB 1KCRH 3O6KH 2NZ9D 4OQ1A 1Z2KA 3MRDB 1OVZA 2PW1B 1UB6A 4DKAA 3WFDL 2NY1D 3H9SD 1UC6A 4UUJA 1MREL 2IG2L 4LSTL 4F2MB 4GSDH 4YDJB 4XPFH 4BSVB 3VXNB 5CD5C 2BNQB 2XA8L 4QRRB 4YBQC 1EAPA 5EZJA 1RIUH 1G7QB 5I66B 3N85L 3HE7D 3VXRE 1QQDA 1F4AA 1TJGL 4KPHH 4XAWH 5D4QA 4HZLA 3SCMA 4J4PD 4JCMA 5D1ZC 4UV7L 2UWEE 3T04D 2JF1A 3CU7A 3TYGL 1Z5LA 4JFDD 2K1MA 2VDOH 3RWJA 2OQJA 5EBWB 1TPXB 4WI3A 4ZD3H 2OR9H 4UB0L 3MFFB 5GS0D 2NY3D 4JG0L 4G3YH 2AJZA 1J1XH 4XNZC 1S78C 2BSED 4ZNEE 4RGMC 5L88L 3MACL 3MRMA 5D6CA 1H0DB 3IU3A 4RAHA 4MAYB 1W2KT 1HOCA 3STLA 1EJOH 5MERB 1KELH 1WT5A 4Y2DA 5HHOA 3BEWA 3G5YA 4NNXA 1CR9H 3VGGA 4LRIA 3WYRA 1ZLWK 1JZ7A 4IIQA 4N8VG 4MQ7B 4Z7VE 1PZUB 4IRJA 4OLZH 4C56A 1TCRB 5E2JA 4DKFL 1BX2A 2R23B 3SE4A 1N5AB 2MNUA 5K9JL 4LOUD 3RU8L 3PWVB 3DUSB 5I1KH 3MOAH 5IHUL 4HS3A 1LO3H 2DJUA 4HWZB 5FUZL 1Z3GH 3EYFB 4JY4A 4JFPB 4F57H 4QXGH 4U1IA 4MQXD 3FO2B 3P30H 4Y1AE 4MNGA 2DL9A 1B0RA 4G8GD 2EIBA 5E8OB 2QJDA 4KY1H 2ZUVA 3F12A 3T0AA 3T4YA 1CBVL 1ZVSB 1FFNA 4S11A 3V2AR 1ORQB 3DROA 3KJ6H 3ARBD 1YEHH 5JW3L 2YPKB 5DUPH 5KTEL 1F3JB 3EYUL 5KVGL 2DMBA 3RVXC 15C8L 3S5LA 1C5DA 4HWEH 1MFDH 5GS0L 1KC5L 5D70H 4OD3H 5EOQL 4JM2B 3SDYH 3CDFA 1JPSH 1NMCB 4NP4H 4NO3A 4PS4H 3TZVB 3RDTB 4U1SA 5DQJA 3QRGL 1EFXD 4NQVA 1G7LA 4M8QB 2VL5B 3UPRA 3JWDH 3LQAC 4JM4L 4PJHE 1KXVC 4PGBA 4PJFE 3RKPA 4GXVL 3RWIA 4X5XB 3LEVL 2P5ED 1U3HB 2J8HA 3HAEB 1YA5A 5CJXA 3WKMH 4TSAL 3QXAA 4E0RB 1XZ0A 5HI5D 1E4XL 2Z91A 4FQJH 1P4LA 4G6KL 1P2CA 3BPCB 5ERWA 1W0WB 3QFJD 3VD5A 4E41E 1AQKH 3MRNA 4KVCH 1HILB 2ICCA 4QRPB 3O6KL 2OSLB 1ERNA 4JZJA 5I1DA 5E5RB 4HJ0C 1I1AC 5CD3A 3WDJA 3SE3C 2OBGA 3I6GB 4HMDA 5DK2A 3RVTC 4GSDL 3CX2A 4XPFL 1CFNA 4KROB 1D5MB 4P4KD 5GGSY 3V6OC 4HMEA 2VABA 4KDVA 2KL6A 2YUXA 1WFTA 4ZYKB 5C70A 4KPHL 4XAWL 1SYSA 3QUZC 3RUGB 3IYLW 2VDOL 6FABH 4YJZL 1NCDL 3ABZA 5I73C 1TJHH 4LSVL 1MCJA 4ZD3L 4OF5A 4HGWB 2Z31A 3R8BB 4PY8I 3RY5A 5C3LD 4GRWF 4WU7B 2KPNA 1RZ7H 2JCCE 4TSCH 1JWMB 3BO8B 2MCG1 2DYPD 4OCWL 4YHZH 5GGUA 2A6JB 4ZFOB 3NCJH 2EXWD 4G6AC 4HJJL 3BVNA 4PJDB 4F7PB 1I3GH 2X4OB 1NC2B 5IBLD 4LKCB 4YR6B 4R8WL 1FSKC 1E6JH 4OLZL 1KIPB 2VR9A 2APFA 2VISB 3JUYA 1RURH 3FZUC 4F37F 1MCLA 3DRQA 1WBYA 3R06A 5IB1A 3H9ZA 2BJMH 3EYQC 3C5JB 3S35X 3EOTH 3MOAL 1PG7H 3M45A 5D1ZB 4P2OD 4CAGA 4U0QB 2JELH 5EU6E 4PRAB 3W39B 4F9LC 1T7ZA 2VZ1A 4Y5XA 3HZYA 3PWUB 4Y4FA 1FDLH 1Z9SA 1U8HA 2ZCLH 1LEKB 1IQWL 4TVPH 1T21B 1G6VK 2BVQA 4KKAD 4LDEB 2YWYA 3UTTD 4MXQC 2PR4H 4XNZB 1E4WH 3BGAA 3V6BR 5ICZB 5MHSE 3VDCA 1R3KA 1MCCA 2PO6C 3KPNB 4KY1L 4RGMB 4W6XB 1FGNL 2FWOA 5J6GB 1NKRA 1E6OH 3P9MB 3MNWB 1N2RA 1YEHL 3CLEH 4QHKI 4QXUH 5C0AA 4TVSa 3C87A 3MNZB 5IBUG 5IR1B 1L0XA 4HWEL 5BOZG 1MFDL 2VO5A 3ES6B 1QP1A 2B1AH 1CFTB 5D70L 4OD3L 1KENH 1KJVA 1JPSL 3GFUA 4NP4L 3KPMB 4XPGH 1JYXA 4YLQT 3KLHC 3ESUF 4W6WB 4KJYA 4P9ML 4U6VH 3WE6B 4JRYD 4QHMB 5K93A 3JWDL 4PV8A 1T22A 2AEPH 4DWHA 1B88A 4WUUD 1JK8A 3DETC 3PQYD 1KYOK 5HXMA 2XN9D 3HI6H 4MMZC 4ODWA 4PRHA 3OX8A 1F4HA 3CH1B 4RFEA 4RDQF 5DURB 3RVVC 4R7DA 4JO2H 1ZS8B 4P59H 5BVPH 3RTQD 4CUCA 1MCPH 3NA4A 1C1EH 3QFDB 1IKNC 1RIHH 1W72H 3PABB 2IC2A 3L95A 3IETA 2C26A 1H5BA 1HXYB 3BWAB 3W0WE 3B5HA 4Z95H 1A1MB 5E5MB 3DTXB 1AGDA 4L1DA 1BLNA 4AL8L 4S1DD 4FXGB 1S7RA 4OZIE 1CTNA 4TVPD 1CICC 4PJGF 5LKNA 1DBJH 2WP3T 1FNGA 4U1HB 5IB4B 4XP6L 4I2XB 1RULL 4B7IA 4X5LA 2B4CC 1NBYA 4PRID 3BUYB 4MB4A 4KZDH 1KN4L 2X9XA 5DHYB 2VZOA 4Z7NE 5FV2A 3RVUC 4H1LG 4JHWL 6FABL 4Y4KA 3HR5A 5FA3B 2ZNWA 5FGCE 1NANI 3KLAB 4UIMA 1VKXA 1T5WA 3S4SA 3ZYOA 1KFAH 4PUBH 5CGTA 1MFAL 2XKNB 3QDJB 2OTUB 4TSCL 5L9DH 3BKCH 1FORL 4JPKH 3CJJA 5A2FA 3P0VH 4YHZL 4G8FB 5GGSA 4D8PA 1MJJB 1TVBA 4MWFA 1FG9C 4XRCA 1MRFH 1MLBB 3NCJL 1MY5A 1I3GL 5CSZB 1I1AB 1HHGB 5E94A 1YMHB 5D7JA 1G7JA 3WLWC 2QKIA 1IGYB 4JN2A 3U4EB 4O2CB 1RURL 4HWBA 1R3JA 4X9BA 1HXMA 1RZ8B 4J3SA 4Q2ZA 4OD2A 3EO9H 1PG7L 4KKBD 4UDUB 2QBWA 2Y9RT 1LMKA 2X4RA 2FRGP 2JELL 5HGBB 3O8XD 3VU2A 3MBEC 3QUZB 4X6FB 1FDLL 5D93C 5DJXB 4LRNL 4PBVC 2BMKB 2ITCA 4TVPL 5I73B 2NYYD 3FFCD 2X41A 3K8LA 1S5IH 5BW7A 1MVUB 2AJ3B 2E27L 2NXZC 4Q9CA 1AGFA 5KVEH 1E4WL 2GQHA 2Q87A 3MJGX 1MWAB 1T4KA 3C08H 1K8DA 1IM3A 1E6OL 1BIIB 1EBPA 3GJFK 3CLEL 1G7MB 4QXUL 4OGAD 1GCFA 5E7FA 2BNRA 3UTSE 1MFBL 4PV9A 2Z35A 3I3EA 2GUOA 3I50H 1FSKB 5I75C 5D2NA 3SBWA 3VJ6A 1F6AA 4GBXD 2HYMA 1YYMH 1TZHA 1CLOL 1KENL 3VWKA 4L9LB 1XF5B 4JREC 3FTGA 1MPAH 3STBA 4XPGL 4WGVB 2PTVA 1OQXA 3EO0B 3BYYA 3PP3H 3PGCA 4HQQH 5F7EH 4U6VL 1MRCL 4K94L 5TGBB 3C5SB 1CDUA 3MLRH 3GJEA 3FB7A 4XXCC 1YNKL 4GMSH 3BQUC 3BZFA 1XCTA 3NOIA 2NY7H 1VFMA 1AR1D 1DQJA 1EPFA 1HQ4B 4KUCD 4JO2L 2EKSB 4P2QE 4JFFB 5FOBB 3S88L 4PYGA 3HS0A 3EOAA 5EU7C 3GIVB 1MCPL 3QO0A 1C1EL 1I1YB 1S7VA 3QEHB 1RIHL 4N0UB 4JQIL 1W72L 5FO7B 2C1OB 1D5IH 5DRXB 4XVSH 1VGEH 1KJ2H 2EYSB 4Z95L 5C6PB 1NC4D 4M48H 4GKSA 2PTTA 3LEXB 1U8KA 3MGOB 4GKNA 3WXVH 2P5WA 3K2MC 4H1LH 2XQYK 4NQEA 2NY5H 1IGMH 2NTFA 1DBJL 1EHNA 3S7GA 3RY6A 4TUKH 4WI8A 3DMMA 4JG1H 3MV9D 1I7TA 4JFYA 3VXMA 1JN6B 3PHQA 4PRNA 5H37G 4A2LA 4KZDL 4HAGA 1OGAA 1EHXA 5F71A 4EVNA 5I1LA 5KS9B 4G7YH 2MSPA 3X11A 3P77A 3QJHA 2ADFH 3CMOL 1QSFB 5L2JB 2VR4A 5A16A 3HZMA 1JV5B 2GFBA 4XI5C 4LP5A 4LLWB 1PFCA 5DD0L 1QSEB 3UROR 4CVXB 3U7YH 3ULUL 5EC1B 2JJSA 3TPKA 2DRUA 4G80B 1KFAL 4Z78A 4J23A 1N0LA 2UY7A 1DUYB 3RZWA 1I9RL 5L9DL 2VXQL 1KCVH 3GMQB 4JPKL 1A6TB 2Z0BA 5AD0B 1XEDA 4NQXB 1QSVA 3UPCA 2VL4A 1MRFL 1CE6A 1LP9B 3BZDA 3I6KB 3OPZH 3U82B 5CBAA 1G7IB 5I15H 1CICB 2G75B 3CZFB 5T5NF 5F6HJ 2FX9H 4JKPL 4RZCA 2Q6WB 3UBXG 5D1QC 3PL6A 1ZK9A 2ZG2A 5FYKE 1OY3B 3EO9L 1URLA 3OAZK 1KTDB 4PJ5A 1NEZA 5ABDE 1I9IL 1S7WB 1VFAA 2DQUH 4KH2A 4CJ0A 2YHGA 3LB6D 4PJ7F 5CJ5A 4Y4HA 5IHLB 1CDCA 4MJ6A 4LLMB 5TDOB 4Y1AD 1KIRB 4MLIA 2YUVA 5CGMA 2WM0A 4MCZA 4N0YH 5KVEL 1U93B 1X5ZA 2Y7QB 4M1CC 4ZUTA 1EO8H 1HHHB 1M71A 4J4PC 3C08L 3QXWA 2DWDB 3PIQA 2A6IA 4XNYL 4LCWE 5J12C 1VPOL 2G9HA 2ATKB 4X7SH 4YHKL 5BJTA 3ILPA 2YBRA 1NGQH 3OTTA 2LAAA 2WUBH 3H9SA 3I50L 2GTZB 5CJOH 1FPTH 4HH9A 3K3QA 2NY3C 1J8HB 1YYML 3NACL 5CEYB 1Q9WA 3T09A 4OB5L 2AQ3A 3BWUC 4CVUA 1FN4A 2ZCKH 3OKEB 2CRZA 1A14H 1CFSA 1PG7W 2R4SH 4HQQL 5I8KL 5MEPB 4OZ4B 4H20H 5SX4H 3MLRL 3MBEB 4GMSL 5C0FA 5BV7H 4QRUA 4JB9H 4LCYB 2R1YA 5FKPA 1S7QA 4X6DB 1PW3A 4YO0B 3G6JE 3QNYB 1CGWA 1WZMA 2NXZB 4AIXA 1W0VB 4N8CL 4FQHB 1OSZB 2P8PB 5C0GB 2JKXA 4YNYA 4YHPA 1F6LL 3QISA 4YPGA 5GIRB 3ALWA 1YQVL 4YAQA 5H37H 1D5IL 4O2EA 2J8UF 4XVSL 5HJ3A 1VGEL 5F1IB 1KJ2L 1JZ6A 4M48L 4B5EA 5SWSE 1V8HA 3VMNA 3EFDL 5C0DB 5CP7A 4LHUA 3FT3A 4YHOH 4HV8A 2VRAA 5I75B 3WXVL 4MQXC 4WTZG 2IANE 5T1LB 4TUKL 2V5RA 5EO0B 4JREB 5ECJE 1CFQA 2DKSA 4GT7A 2EIZA 3HA0A 1P7QD 3T08A 1A7PL 3UMTA 4G7YL 3BQUB 2OJEB 4MJ5A 2OLDA 2ADFL 1XF3B 5KAQG 1PYWB 4WW1A 5CIPH 1QUNA 3O2DL 1RZFH 3DUUB 4PJAB 1LO0H 5JIHA 4NQUA 1QD0A 5I2IA 4J3UA 3BDXA 5HHME 3RHWF 1AO7B 2JB5H 2NLJB 1BBDL 3SKOB 2XWTB 1J9CT 1YNTB 1DBBH 4G8GA 5ACMA 1JGVH 5I8OH 5E8NB 3OJVC 4MAUL 2M2DA 1S9VA 1OP3K 3ARBA 4ZFGH 1GGIH 3IT8D 5BMFH 3KXFA 3IXAB 3OPZL 3TBVB 4Y0GA 5DMGD 2JJUA 3MJ7A 3QDMB 3FCTA 3QI9A 4P4RB 3MA7A 5H94B 2FX9L 1WBZB 3KPLA 1VGKB 1FJ1A 1X6NA 4O51A 1WFUA 3RKDD 1CGTA 4FQ2H 2VTFA 3RAJL 1FE8L 4PJEA 1K6QH 4CGTA 2V9TA 1DR9A 1FVEB 2WW8A 5EU6D 5BS0D 2ZSVA 4LHQB 4F33B 2X1QA 2DQUL 1INEH 3GRWH 3E8UH 1JNLH 1NGYA 4JGMA 2XWJB 3BH9B 3RWCB 3VFRA 3JV4B 4K8RL 2P5EA 4HFWA 4QTHB 2RFXB 1EAJA 3FO0H 3VG0H 3T1FB 4MDIA 3WJLC 5MHSD 3MV11 5LAXB 4NCC1 3G5VB 3BJLA 1T1XA 3FQTB 3QUYD 4MD5A 2L4OA 5L8KB 1CGXA 1JJUA 3FHQA 4H26B 4LNVA 4KJQD 1BAFL 5FCSH 1F4XL 2XKSA 4LLVB 3UJIH 3RIFF 3MJ8B 3V5DA 1YN6B 2ZOKB 4YHIA 2HRPH 2X4QB 4HC1H 2D7TH 5DFVC 4PJGA 5IK3A 1DQLH 5HDLA 7FABL 3GSXA 3IDNA 3OJ2C 4X7SL 3WN5C 4U49A 5IGXH 1NGQL 2NW2A 5E99L 4HWNA 3TPUB 5E8EA 5CJOL 1HZHH 5DD5H 5DEGB 2NY0D 3VE0B 5HD8C 1DANU 2MQCA 5D1QB 3HMXL 4L3CB 2FD6H 3RWFA 1MIMH 4P4KA 3S37H 1OHQA 1QLFB 1HHJB 3L9RB 2ZCKL 5BZWA 4TUOA 5JW5B 1XFPA 1C8PA 2R4SL 3PHOA 4OCRH 1KG0A 4MHHG 1N7MH 2IQAA 5BV7L 4WUKH 5IG7A 4OF6A 4OM1H 2DIJA 2AQ1A 2YZ8A 2YKLH 1A7OH 4G6FD 5DK0B 2Q7YB 2XNAB 4YXHH 3O9WD 2R15A 3T65B 4M6ML 4JZOB 2C7UB 3O3EB 5DWUH 1YPZF 3CPLA 5K9QI 2V2XA 3H7BB 5LGKA 1D5ZA 2DYPA 4P2OC 2X4PA 3TA3A 4TN9A 5GGQH 4GAGH 5LCVH 4TNWK 5EIIA 2UZIH 5J12B 5FK9A 1XR9A 3O6LH 3RZCA 5DJZA 4KKAC 4YHOL 3C6LD 2BOCA 3WNPA 1A1OA 2FX8H 2NY3B 43CAB 5JHDB 3BE1H 4Z77B 3D3VA 3ULSA 2ZG1A 4ZAKD 1J87A 1PGRB 1Q38A 2YD1A 5K9OB 4ACPA 5FECB 2ARJB 5HHPB 2QSVA 4PTUB 2OYPA 2N1KA 3QA3A 3KYAA 1LK2B 2ICEA 3EJZD 4P0DA 5GSVB 2WBJA 2VSCA 5I0ZA 3FQXA 3KPQB 1EEYB 1BJ1H 4HF5H 4GLRI 1TXKA 3M17A 4ZTPL 2BRRH 1LO0L 3ARGD 1N8ZA 3HNTH 3UTTA 3GI8H 4W81A 4S1SH 2JB5L 3V8CA 3CC5B 1DBBL 3HB3D 1JGVL 1G7PB 4PJXB 5I8OL 2P8LA 5J4MA 1F4YL 5ICXA 3IFNL 4MJID 4M9OA 4OZHB 1JI1A 4ZFGL 1J5OL 5EO9A 4FFWD 3M1BA 1N6UA 5JO5A 3ARSA 3PDOB 1SEBB 5DMYA 1XCQA 1CDJA 5BQ7A 5EG6C 1JE6A 2WMPA 5IFHH 5DEZA 2D0HA 3MNVB 2AK4B 2FHFA 4YBLC 4N8VA 4FQ2L 5ELIA 4TTGA 1OTSD 3TH4T 2XQYG 5H8DA 3DHJA 2IALB 3T8XA 4A6YB 1JTTA 2HA1A 4IDLA 1NAKL 1K6QL 5FV1L 4PP2B 4GRMB 1N3NB 2QV2A 5ESVA 3N0PB 2P43B 3GRWL 3E8UL 1JNLL 4WUUA 4KI5F 2VDKH 4X4ZA 2A6DB 3OAUH 5HDQH 3IVKA 4QTIH 4J8RA 2XN9A 3IXTB 4AENA 3OR6A 3VG0L 5I76A 3G5ZA 5GQBA 3WEXB 3RTQA 2YD8A 1EFXB 4NJ9L 1NCNA 1CZ8H 1SHMA 1SMOA 5ITFA 3C5ZD 4RAUB 1XGPA 4WV1A 3UJIL 1MAKA 5F7LB 3O11B 3P73A 3UTSD 2GJ6A 4HC1L 5ISZE 2D7TL 1DQLL 5GGRY 4HG4J 5DFTA 2J4WH 4JFEB 5IGXL 3FO9B 5E1HB 4K71C 3MRJB 2D7OA 1R6VA 4QRQA 3HPLA 3ARTA 5DJAA 4PJ7E 1HZHL 3BZEA 4ZUSB 1JF6A 4J1UA 2CIIA 1NBVH 2FD6L 4HIXH 3QFJB 1QSZA 1U8LB 4UQ3B 3S37L 4WJ5A 5F6HI 2FJFB 4K55A 1N59B 3F7VB 5HYJE 5CINH 1VEOA 2I07A 1MHHA 4K94C 4JZNA 3OKDB 1N7ML 5MENE 5HVWA 3RX8A 3IDIB 4RIRB 4WUKL 4OM1L 4P2QD 5SWZE 3ARVA 2V17H 5EO1A 4D0DB 5ALCH 3HRZB 5GRYA 2F8VA 2VLLA 4AH2A 4Y19E 4V1DE 4DK6A 3VXQA 1MOEA 1N5YH 3X14B 4BH8B 4PGEB 1GIGH 3SGDH 4OBSA 1KCUH 2RR3A 4UT9L 1I1FB 2X09A 1KXQE 3LD8C 4L9DA 2R1XB 5GGQL 1Y18A 3CSPA 3K74B 2F9BT 3WN5B 1WTGT 5KSVB 3O6LL 3RNKA 2YN3A 1J0JA 3HUJB 2IBBA 2IH3A 4JFQB 2FX8L 4UI2A 3SDXB 1DSFH 4J2XA 4OV6F 4RMSA 5TJWK 3DX7B 1DN2A 1RJYA 1ZA6A 1WJ3A 2E3VA 5GGTH 3CK0H 3HRPA 1G9NH 4JGJA 4F7TA 1VFUA 3TT1L 4L8DB 4FP8H 4NYLA 4BFEA 1LE5B 4OGAC 2Y5TA 3VXSB 4OV5A 2BNUB 1FYTD 4P2RE 5D7LA 3O8XA 5DDHB 1CGSH 1ZHLB 4HF5L 4NC0B 3B9EA 1TTUA 4NZUL 1MQKH 3FFCA 4D9RD 2BRRL 1T0MA 3ULUC 5EUOE 2X89D 5JOEA 3GUTB 1CLYH 3GI8L 5IJVB 1MJ7H 2DMKA 2AGJH 4P2OB 5DA0B 4M4RA 4GOSA 1BEYH 4ODTH 1PZ5B 4K9EH 4QT5A 4GUPB 1M4KA 1CDBA 3GHBL 3N1PC 1A0QH 2WK2A 3OKNB 2RB8A 2C9AA 4R0LA 3L7EB 5DT1H 3SGKC 3VG9C 4IIQC 5F7WC 5E03A 1ZV5A 5IFHL 2C5DC 1TZGH 4GBXA 4IRJC 2ITDB 2W60B 1R24A 2VR5A 5C08B 4MNQE 1PEZA 2LFGA 4LLDB 4WU5B 1HYSC 5IB3B 3RQ3A 4OQTL 3BOVA 1CXIA 4NO2A 3AFLA 3RNQA 3SDDD 4LSQL 3OAUL 5HDQL 4QTIL 3FFDA 3T4AB 1NAMH 1MFNA 3QHTC 4OZGF 1UEMA 1A4JB 5E9DB 2IGFL 3D6GA 5HI4D 2GK0B 4FQQA 4OTXH 4UT7H 2UYLB 5GJTH 1UWEH 4UT6H 1FIEA 2J8UA 4JRYB 1CZ8L 1J7VR 3LKQA 2NW3B 1X5LA 2DICA 3WUZA 1FYHB 4LCWD 3OQ3B 3TJEH 5IKCB 3UCRA 1QRNE 4LEOA 4BQBA 5C0EA 3HCVA 1NC4A 1NFDF 5HGDB 3S36L 5E5UB 4ODXB 1JPGA 1FNFA 1WVZA 2OK0H 4X5WA 3OAZH 1NBVL 4S1RH 4YBLB 3UZVB 4AT6B 1V3JA 4P46C 2XZQL 1LO2H 4HIXL 3MV9A 1KT2A 1F97A 4LLYA 2WANA 1FV1B 5H35A 1MVFA 2OMNA 1KJMA 1UVQA 4WHTB 5H2BB 3HKFA 5JW4N 4LQ1A 5B22A 1MRDL 1T1WB 1BVLA 4OCYH 3MBXH 5IJKC 4EUPG 1OW0C 4JDTH 2V17L 3DXAE 1QZ1A 1EV2E 2MPAL 5IHBA 1RUML 2BC4B 4L4VB 4ELKA 5GGRA 3JWOH 2MHAB 5FYKL 3F6IA 1BFTA 4P5KB 3VGFA 1AGCB 4BSWB 2KQMA 1FFOB 4PJIB 5ETUB 2Y23A 3VFTA 1XGYL 1LE9B 4YHML 3MV7B 4HKJB 1QNZH 5BRZB 5SWSD 1AC6A 1Z9LA 1IGJA 2AEQH 5INCB 2BY2A 2C4XA 4XPBH 1MCOH 4HLJA 3LB6C 1K5NB 1RUAH 3BHBB 2IAND 1JRHI 2FHCA 4LFHG 4LPXA 3EYOB 5EZLA 2YOCA 1DN0A 2B0SH 1OTTD 3GSQB 1TIUA 3RP1A 1DSFL 5HYQB 1NBZB 3BKYL 4C59B 5F1KC 5KSBB 4G9FB 1HDMB 3ARWA 5IV2A 2BVYA 3IAPA 4JR9L 1A6ZB 5L2KD 2A1WH 5GGTL 3OV6A 3CK0L 3MROB 1G9NL 4GFTB 4F7MA 3KYMA 1B6DA 4PRDB 4FP8L 3ROOB 3S9DB 3KPRE 1KV3A 2VLJB 3KDMB 1GGYA 1MH5B 2P1YA 1DQQA 3VFOA 1MQKL 2HWZH 3SY0B 4ZUUA 2WWKO 2BFVH 5HHMD 5HYSG 4U1KA 4Y1AA 5DHVB 2G2RB 1CLYL 3P4OA 5T1KA 4TQEH 1A6VL 1MJ7L 2HJLA 4HS8H 3MJ6A 3CNKA 5C9JA 3TT3H 4YC2C 1I8KA 3LD8B 4GG8A 3T0EE 2ZCHL 4POZC 4ODTL 1BEYL 3LV3A 4K9EL 4OCLC 2WQRA 4PRPE 1L0QA 4U7SA 1GOHA 3JTTB 1A0QL 4YH6A 2X4SA 1UB6B 4K7PX 2DBJA 3WUWG 5DT1L 4JANA 3TYFA 1OD9A 1XGRA 2R4RH 1ZT4B 4JE4B 2IFGA 3ALXA 1UB5B 1FC1A 2R29H 3NFNB 1E4KA 4YBHA 1SMAA 2VDQH 4WO4D 1QQDB 1EUTA 4NRZA 1T7WA 2Y6SD 2X4TB 3HE6D 4KJPC 3HI1B 2YR3A 4LCIH 4NO0B 3D85B 3QQ4A 4F8QA 2NQCA 2R2BB 4K8RC 5C0JA 2OQJB 4J3OC 4NNYA 1I8IB 1NAML 2HLAA 4M61A 5M94B 5SX5K 1I8LA 3JVGC 3QUXD 3O4LA 2W65B 1OP3H 1NLBL 2COQA 4HIEA 4OTXL 12E8H 1S8DB 4UT7L 5GJTL 3SDAD 1JPTH 1UWEL 1CLCA 3NVQA 4HT1L 4UT6L 5D2LB 4GG6B 4WCYH 4KKLD 3MRMB 3SJVD 3BGMA 2DQEH 3TJEL 3CDGB 3IU3B 3STZA 1WIOA 2E6PA 2OXGA 5D7IB 3AMLA 5CHNA 3BD4A 2CDFA 2GSIA 3VG9B 4LU5H 4IIQB 3GM8A 1NJ9B 1EEUA 2X2YA 4IRJB 4EUPH 5IFJB 4S1RL 5JZ7C 1NMBH 1NUGA 4QXWA 1MLCA 2VE6B 1LO2L 3IDJA 1GC1C 4CDGC 2X70B 4PB0L 2F8XC 3L3HA 3BP7B 3FONB 1NGZB 1IFHH 1R3IH 1JZ3A 2PXYD 2VSDA 1AFVH 1U8MA 3REVA 4B0MM 2R9HC 3L3IA 5BV7C 2HTLD 3QUKA 3O6FA 4NZDA 2OI9C 3MBXL 4NN7C 1ONQB 3D2UD 4JDTL 4TTDC 3NFPA 1J0IA 3TO2A 5D71L 3VXRB 4L3ED 4OZFG 3JWOL 2AABH 2ZUQC 2DLEA 4HHAB 43C9B 2ED8A 1XGUB 1B0RB 1UH3A 2WP3O 3SPVB 3ZHKA 1V5JA 1LEGA 2UWEB 5DUBB 4NM8H 5DJ2A 1QNZL 2HH0H 4GAYB 2AEQL 3DRTB 3IKCB 4XPBL 1WICA 3B3IA 3OL2A 3TBTB 3PGDB 1RUAL 1I7RA 1D7FA 2BHZA 2B0SL 5E6ID 3OKOA 4MA1B 4D9LH 4P46B 3TIDA 3J8F7 2GCYA 3QUYC 2BNQE 3CFIC 4LCCA 1QFPA 1YDPB 3NBNA 1INDH 1INQB 2Z8SA 5LWYL 1Q0XL 4OIAA 1NGXA 1RZKC 4RCAA 5CZVH 5BS0A 4WENB 4IS6B 3CUPA 4TRPH 4U3HA 1JL8A 1L0YA 5K9KA 3EUUA 3KLSA 2HWZL 1N0XL 2BFVL 3MYJA 3MZTA 4OLWH 3TO4C 4DCQB 4X99A 1HI6A 1FG2A 1ZGLM 4G8IA 2VITA 5DD6A 3QB7C 2MOVA 4TQEL 1P4LB 4HS8L 4L4JA 4X7TB 5ERWB 3QWQB 1KJ2B 4NBYB 4JEGB 3PWPA 2MFNA 4ZS7H 1S5HA 1F2XK 3K81A 1FL3A 2PYED 5CD3B 5I1JH 4XXDA 1NCBL 5CIPA 3O9WC 5DK2B 3MLWL 1DQMH 2JIXB 2R4RL 1UJ3A 3W81A 3KPSD 4C58B 1Q94B 2CJUH 4P23A 1FQ9C 1KN2H 1DUZB 5T1MA 2VDQL 1EIBA 3GI9H 5KW9L 3L3DB 3L3GA 3RBGA 1F4WH 5IMOA 1F11B 1JHTA 1K4CA 4AEHH 1SVZA 4LCIL 4Z7UF 3U30C 3O41B 1WBXA 1IKFH 3DLQR 2X1OA 4UOW1 5A2JH 4X6EA 4NUGH 2I24N 8FABB 3GMRA 4XBGA 5IEHA 1IRAY 4B41A 5FEBA 1JPTL 4PJHB 1K9TA 4YC2B 4PJFB 4M5YL 3PJSB 1DDHA 5GGUB 5ISZD 5HVFB 2DQEL 2EEBA 2DQDH 3N1FC 3BVNB 4YDIL 3CXHJ 2AK1H 4LU5L 1F58L 3C6LA 4Z5RA 4IOIA 3TVMD 4UTAH 4RMRA 3A6CL 1IAIM 3TN0A 3MRPA 2H26B 3DO7A 4E41B 4ZAKA 4HS6A 4OZFH 5HYJD 4ODVH 1JUFB 5IQ7H 1HINH 4YHNB 2HG5A 3BX7C 3JXAA 4QRSB 2VZUA 3QXDA 4QO1A 5MEND 2H2PC 4HUKB 3C9NA 2DTSA 1FCGA 3IJSA 4WFHD 4FFWC 3LIZH 4PREA 5IESH 5SWZD 4ZQKA 5IB5B 1NFDE 4V1DD 4WGWB 5IWLC 3KPPB 3FQNB 3LN4A 3OB0K 4I9WE 5I1AB 2P46B 1P9MA 3VFUB 2AABL 1I1RA 4NNPH 5EB9A 2BVOA 5IMKB 1P7QB 5DXWA 1C5CL 3O2VL 2XY2A 4NM8L 4L8CA 1PBYA 4N1HB 1U8OA 3VFWA 1D5XA 2OCFD 1R3HB 3GSNH 2HH0L 4QRPE 5C0AB 2XFXA 4MJIA 4OD1H 2RCSL 4N0FA 4EOWH 4N68A 3ALPA 3DBXA 5C0BE 4Z7WF 5DRWB 2JCCB 4KQ3H 1WIUA 3LHPH 3PDGA 5IFAH 5B8CA 2C4FU 1AKJB 4D9LL 1C16A 3DMMC 3FOMA 5I74C 3U6RB 5EC2A 3B43A 5EDXA 1UADC 2Z4QA 3GMMA 5BV7B 2C3VB 2OI9B 1AXSA 4NQCE 1CK0H 3O3BB 3S34L 4NN7B 4S0TD 3O4OC 2L7UA 4OZGA 1BBJB 4TRPL 4PRHB 5J3HD 2JK5B 1PX3A 4DGIH 3HC4L 4XWGL 3VI4F 2ZUQB 4PGJA 3AM8A 2NY4D 1QHPA 4GRLC 3IB4A 5EU6B 4JFZH 3H0TB 5EFIA 4HUXB 1QO3A 2ESVD 5J0BA 5IVXF 1WCBA 3IETB 4U1JB 1HIMH 5KZCD 1RUQH 3QHZH 5CZXC 5I1JL 1S7RB 4NZRH 1I1CA 3BFOA 3PWLB 3QUYB 1CD0A 4UINH 5A3ID 3MRGB 3QQ9C 2CJUL 2B1HL 5FGBA 2BVUA 4KWUA 1KN2L 4WI7A 1EHLL 2H8PA 2X5PA 5TH2B 4PLOB 2FH6A 1F4WL 1NUFA 5I1IH 4HAFA 1W0YT 1DZBA 2R0LH 2N7BA 1IKFL 3QCUL 4K07A 4P2QA 5T3ZE 1JF1B 5FUCE 3HR5B 2X7LB 4EN3D 1HE7A 3EHBD 5F3BB 3TO4B 2Q20A 3CFCL 4UIMB 1TQCC 3CVHH 3MUGA 1ZHBA 1L9NA 1PQZB 3PV6A 4NUGL 3C6SB 1A64A 3ZKMD 1RSFA 4Z76B 1CT8A 2H2SD 2BDNL 4M1DH 3UBXB 4PP1C 3NA9H 5C09E 4KV5F 1JVKA 2ZUTA 4HUWA 3VFNA 1QRND 4ZOAA 1AGEB 3Q0HA 4XRCB 3EKCA 4D0CB 4FNLH 2DQDL 3VMOA 1X5GA 3D69A 4BH7A 4ZSOB 3UC0H 2AK1L 3O9WB 5KVDH 1G7JB 1JI2A 2CUIA 3UZEA 3ZL4L 1JMZA 4JPWH 1L6XA 3X12A 4P3WA 2WIMA 3W0WB 1R3JB 1MUJB 3WHE1 2CK0H 4ODVL 5IQ7L 2DJ4A 1HINL 2CLVB 6CGTA 1PX4A 5FDYA 4OZIB 2X4RB 3VWJD 1CDYA 3U30B 5IESL 1AI1L 2AAVA 1FYTA 3MREB 4UV4L 1G6RA 1DLHB 5HI3D 3DXAD 4JGUA 4UILH 2A6KA 1AH1A 2NY6D 1CIDA 4XCFH 3THMH 2X89A 4NNPL 3VGDA 2CKBH 4U1MA 2AJUL 2VXUH 4JY6B 4EDXA 1OGTB 4DKDC 1KGCD 1ZGLP 3TBYB 5F1NB 1K8DB 1IM3B 4P3CH 1JBJA 1ZTXH 4IOFD 4EXKA 5FGCB 3SDDC 4NHCL 2O5YL 5E95B 4ZDHA 3NH7L 1CXKA 4EOWL 3L5HA 2QADC 2DQTH 3W9DB 5JORB 4KQ3L 5D1XC 4OGXL 3LHPL 5HI4C 5IFAL 3N9GL 3DX8A 3AS3A 3O0RL 5KG9A 2DQHH 5DEFB 1FBIL 4PBWD 5C0CD 5CWSB 4PJ8D 1EEZA 1P1ZA 1BOYA 3BP6A 2G5BA 3BP5A 1ZMYA 5C8JA 5J6HB 5F97E 4I4WA 3KPRD 5DFWH 2Q7NA 1D6EA 3DURB 3FB7B 3NZHH 2DMCA 1U3JA 3TFKC 2EE6A 4YHYC 1MCKA 1CS6A 4CU6A 3K80A 3BSZH 3IDMA 4Y16D 4I0PD 1GGCH 4N90E 1YMME 1WFNA 3EZJB 2CDEB 1J1OH 4Y88A 5I17A 3T0ED 3MSPA 4M5ZH 3UTPE 3KLDA 3QO0B 4JFZL 2XPGA 4LMQI 4NWUH 5JXAH 5HGHB 2AEIT 1FO0A 4GW5B 4NRYB 1RUKH 5DMIH 1Y6KR 3NCFB 1T2QH 1NBQA 5DVLA 4LCWA 3PWJB 3KPOB 4GKSB 1RUQL 3QHZL 2ZPKL 4G42A 5HHNA 4GKNB 4UBDC 5KVMC 1GRWA 4YXLL 3UTOA 2VLME 1JPFB 1IAOB 2NTFB 1M6OB 4IRSD 4U1LB 4YUEL 3DMMB 5EZOH 2X4NA 2FEDD 4M93C 3QDGA 4NRXA 3H3KA 5I74B 3Q5YA 4NKOA 3G08B 3P9LB 4IM8A 1T1ZA 1KNOA 1CG9B 4HXAL 4WDIA 4XP1L 5IIEB 4H88L 5I1IL 1BD2D 2NX5E 3O4OB 4BK4A 4PPTA 3BD3A 2WLZA 2R0LL 3QIWD 5A16B 1A3LH 3MOQA 3G6JA 1PKQE 4PGZA 4YQXH 1LEIA 1Z9MA 3IU4H 4GRLB 1E0OB 1XMWA 5FYJU 1IM9D 1ZA3A 5DQ9B 4M1DL 3NA9L 1BOGB 3R1GH 4Z8FH 1TVDA 4C54A 2YPVH 4QY8B 1YEEH 2ED9A 2VWEE 1T5XA 3DO3A 4DQOH 3L3OA 4FNLL 4CJ1A 1CE6B 1G0XA 3GMPB 2HFTA 3T2PA 1QEWA 32C2A 4I0CC 1QFWL 4Z7UE 2VXTL 2AP2A 3VFVA 3QNXA 3E3QE 3RL1B 4QXTA 3PL6B 4M6OH 1X5JA 4Y7MA 2DD8L 5L2KA 2C3WA 4F9PA 5GRUH 1IAIL 2EO9A 4NGHH 5SV3A 1M7IA 5AWNH 1RJZA 4IDJH 1AE6L 5SX5H 5B39A 3BIKA 4HJGB 1YZZA 2ID5A 4XAKE 2EDRA 3MO1B 1LNUA 1QA9B 1FNEB 3VRIA 4K7PY 5DI8A 1Y6MR 1TQCB 2H9GA 2VQTA 5DGQA 4JFFE 3LS5L 1Q9OB 3THML 4I1NB 3TNNA 4O02H 5D9SA 3MRKB 4C4KO 1QBAA 2FL5A 2CKBL 2VXUL 2Z93B 1MHCB 4WO4C 4XMKH 1GH7A 4Y5VA 3OKYA 4P3CL 1ZTXL 1BVZA 1X5IA 2A6IB 2Q1EA 1HCFX 4LSPH 4BZ2H 4NSKB 1FZJA 2E8ZA 1QR1A 4ZUWB 1NQBA 3PDDA 1RIVH 5BJTB 2DQTL 3BI9X 1F13A 3Q6GL 3VRLF 2BNQD 3KPTA 5ALBH 4QRRD 1N64H 2EECA 3SDAC 4Z7QF 3CX5J 4WW2F 4NZJA 1RV6X 3RWHB 1IMHC 1CFSB 1J1PL 1Z9OA 3UP1A 4EI5C 2N4IA 3ZKSD 1XF2A 5M7QA 1E27A 5J1TC 3MRHA 5EU4B 5I16A 3HE6A 1T89A 3ZDXF 2WBJC 4ZMAT 5JIIA 1FHGA 3SQBA 1YEKH 4GRWB 5DJ0B 1O7SA 5TDPB 2ZOLB 3BSZL 3GJFB 4Z7WE 5E2UH 1F45A 1R5IA 1GGCL 3QUXA 3GGWA 4U4BA 2E7CA 1U8PB 1J1OL 4CVZA 3OXRB 4YHPB 3EW3B 4J6RH 1SJHB 4JQXC 4MAYD 1KPRA 1BFOB 3M07A 3SDDB 1T2QL 4NN6C 3SJVA 3D25B 5DSCB 3T3MF 4Y2OA 2HJFB 2P24A 4GAJH 4OUUA 5J1AA 2EEDA 3GZKA 2QADB 3W9EB 1A9EB 4LHUB 3HAEH 4OFDA 2YC1A 3WHXB 5D1XB 2D7MA 3G04A 2HVJB 4FQIL 3UTZB 4DEPC 1HH9A 4ELMA 2HLFD 4K3DL 1M05B 1JHLH 2H32B 4XCNB 5EZOL 3VI4E 4MXWH 1BP3B 5EIQA 1UQSB 4QHLA 1CLZL 2M8XA 4X8JB 1JGDA 4JFXA 1UWGH 2EIZB 4MD0B 1GZQB 3NN8B 3VXUE 2PXYA 5IROA 4C57C 2BCKA 3QEQA 4XNXH 4YHYB 1A3LL 2E7LA 5A40E 3TH2T 4PJBF 3LRSB 1AD9A 4JKKA 3DV4A 4YQXL 1G9MH 3TBSA 4L3EA 4OKVA 4LLUA 4X7EC 4X4YB 4U2ZA 1A3QA 1YEEL 3FRPG 2GTWA 4OCXH 2LQRA 4DQOL 5JXED 4KHXH 1IEBA 4OJFH 3Q3GA 2OTWB 5E08H 2OZ4H 3V7AE 5EU5A 2XXMB 1YJDH 4JM2D 2Z92B 4OCMC 4M93B 3WBDA 2F53A 2E7MA 3ZLQC 3SKJH 4M6OL 3RDTD 1I9JH 3KJ4C 2X40A 1OT2A 4NO5A 2QSCH 4CNIA 2DIBA 1SYVA 2GJJA 5GRUL 4Q9RH 2EXYD 3S8WA 2IANB 3IS0X 4MVBC 5AWNL 4IDJL 4WEMB 2HFFA 2X1PA 1OAKH 1YEJH 1FRGL 1MFCL 4I9WD 3WJJA 4XVTH 3WFCH 3D9AH 4HFWB 1IEHA 5FFLA 4K3GA 4O02L 4EUPA 2C1PA 1ZLUH 2D31A 2IBZY 2FBJH 5IVXA 5F7DB 4HMCA 4XMKL 4QRPD 4KK5C 4MJ4A 5GXBB 2XOTA 2ZZUT 3R8QA 5T3ZH 1NDGA 1EBAA 5I8CB 1MQ8A 3IDNB 4X6CF 5HHMB 1ULVA 2DB8A 4OGZA 5DZOA 2PYEA 3SEPA 4KROD 4FG6D 3QUMH 3FKUS 1N64L 5DJCB 3I02B 3X13A 4CBPA 1T03H 4FQXC 4O5LH 3KPSA 2FIKA 3IRPX 4R7NA 1GAFL 3RFZC 4GW4A 2WWMC 3HZVA 3MRBB 3OB0H 3PHOB 4NQCD 4M6NL 2HTKD 1D9KA 4HSQA 3PV7A 3U0PA 4U1NA 3CH8A 5JMRA 3LN5A 2RJMA 3U46B 3N1GC 1YEKL 4DVBA 2NZIA 5E2UL 4YEFA 4NOBA 2VLRB 2EDJA 4BYHA 4MSWA 1ZOXA 5HYSA 2V2XB 4I0KA 2E6QA 3T0DA 3QH3A 4J6RL 4BQ8A 5KVFH 4P5TD 5B38A 2X4PB 4Q74A 2YPLA 3IRZA 1H15B 1HNGA 4F3FA 3H9HA 3LS4H 1L4IA 4RQQA 1RY7B 4BZ1L 4GAJL 3AU1B 1WWCA 1LK3H 2VQ1B 4ZUVA 5CD5D 4FQPA 1A1OB 5DS8B 4YBQD 3SDAB 2WINB 4RMQA 3TESA 5D8JH 5ESAA 4MXWL 1WGOA 2QQNH 2PW2B 1CD8A 4G6JH 5D1ZD 3G6AA 4EI5B 5JOPD 4U6HA 4XMLL 5EPMA 3MJ9A 4X80H 4W6YB 4HKXB 5BO1H 3QA3B 3U1SH 2WBJB 4XNXL 5T3ZD 3RJDA 2E8YA 3SQOH 3VXTA 3FQWB 1S9XB 1HEZA 2W0KA 3ZT7A 2Q86A 3LN9A 4FQLH 3GSVB 1HHIA 1G9ML 5I0DA 4E42B 3WS3B 5C09D 1S78D 1CDIA 3MR9B 1Y0LA 1QVOA 2EC9T 2C4FT 4NWTH 1MJUH 3LQAH 1IQDB 1QRKA 3TIEA 1XH3A 4NN6B 3WLBB 3MRFA 4HCRH 3OAYH 3UXFA 5ICXB 5JPMA 3KS0H 3D2UB 4KHXL 4Z0BH 5E08L 3HG1E 3PGFH 4NQSB 1T2XA 2YXMA 3FT2B 4DEPB 2NY4C 1YJDL 2CRYA 1D5BB 3OKKA 3FO1A 1BZ7B 4P5MB 4X83A 4O2FA 1VFBA 4YZFF 3RIAK 2QSCL 2V5SA 4ZFOL 1U8JB 2MCPH 3ESVF 4LKXA 1VACB 4JRXA 4WHDA 1AHWA 5IVZB 5ESVB 1A6UH 1OAKL 1RVFL 1U0QA 4XB7A 4NDMA 1ZLVK 1A9BB 3INUH 4XVTL 2CO7B 5D5ME 3WFCL 3ZDYF 5A3IC 4HUMB 3NFSH 1VFOA 5I76B 4R96A 5EU3B 2F5AL 1ROWA 1WISA 4LVEA 1A5FH 5MEQA 3PF2A 4X4ME 1GXEA 3LQZB 4KHTH 4OZFA 4PR5A 2ESVA 2J6EH 3RVXD 5T3ZL 2GJ6B 4LASL 4KDTA 2PCPA 2VLKA 1PSKL 3FMGH 3ZYJA 4QHNB 5DJAB 1DLFH 3QUML 2MWCA 3DWTA 2CIIB 3MV8E 4W70A 5FHAH 1RK0A 4GKZB 4GW1A 1MWAH 3KJ4B 2MMXA 4O5LL 3F58H 3ZT6A 5DLML 4RGOH 4XHJC 1I7ZA 3QEUB 3CFBA 4TOYH 1CYGA 4EDWH 5C07A 4AIZB 3C2AH 4FOMA 2AS5M 4XPHH 3UJJL 3GSNA 2PYFA 4XNUH 2EE9A 4MYWB 2BSSB 4XH2A 5EBMA 2F54E 5ADOL 3QDJD 3UTPD 3VRLE 2FR4A 1BREA 2NNAA 5IP4A 1UXWB 3ULVF 5C1MB 2XG4A 3VGBA 3I75A 4KK8C 5KVFL 3HPJB 4PJXE 3V7AG 3HLAB 4HJ0D 3P4MB 1I1AD 1RJLA 3LS4L 1NPUA 4OZHE 1N4XH 2NY6C 3RVTD 3RNKB 1WZ1L 5D72H 3ZDXE 1AQDA 1CF8H 3QULA 4ETQB 1BQHB 3VGEA 5C71A 1E28B 4FQXB 1GGTA 5D8JL 4NKMA 1P4BL 4IHOA 3CIQA 4M7LL 1F5WA 2QQNL 4G43B 1FL5B 5ISZB 3BZ4B 1A4KA 4APQC 3NPSC 3U7AA 1MEXL 2VAAB 3E6HA 1MHPH 2Y5TB 2PF6A 5BO1L 4PJ7B 3U1SL 3VWJA 3HC3H 4ORGA 2XA3A 4X9IA 4LLQA 5TDNB 1VHPA 3VFSB 3O3DB 1L9MA 4ESKA 1ADQH 3S3PA 4EIZC 4U6XA 3BDYH 3EGSB 4C83B 4P3DA 4NWTL 1MJUL 4NQDE 5MENB 2ZJSH 4XC1H 4M43H 4CW1A 2CMRH 1OAZH 4G6AD 3SDCD 5C9KA 5SWZB 3F7YB 4HCRL 3WKNA 4QT5B 4HK0B 2EE2A 4Y19B 5LXGH 4V1DB 3PXJA 4GXUN 4X4XB 4JFEE 2FSEB 5ID0A 4TPRH 2Y4SA 4HK3J 4I18A 1G7HB 1KPVB 4LSDA 4PJBE 4UOW0 4OIBA 3T0WA 4U33A 3U9UA 3B5GA 4ONHA 3T0EC 1AJ7H 3CVHA 2FCBA 3JV0A 1JFQH 5C0CA 3EO1A 2F5BH 4PJ8A 1JGEA 5F9DC 1X5KA 2VDNL 5FIEA 1CE1H 1J8KA 4XAKD 3LKOA 4NPYB 3KPRA 1EGJA 4NO2B 1A6UL 4PD4K 1SM3H 3F8UB 5GSRB 1UEYA 1DEEB 1M7XA 2WSKA 2FJHA 2WUCH 4JFFD 1RAMA 4MXQD 5I30H 4LF3B 3NFSL 2B4CH 2AJVL 4POUB 4Y16A 4I0PA 1DL7L 1TVHB 3T77B 4KTDH 1A5FL 2J8UB 3WIIH 4P2RB 4XP4L 4KHTL 1F6FB 5JQ6H 1XF4A 4ZO9A 3EYSH 1TENA 1CIUA 2J6EL 3OXSA 5EUOB 5JNYB 4IMLA 5C0EB 5I1GH 5LGJA 1WK0A 5EOCH 5BOPA 3HUJE 2NY4B 3SDXE 1DLFL 2A73B 4AG4L 1MI5A 2V2WA 4X5WB 3REWA 5FHAL 1QOKA 4IRSA 1MWAL 1JCKA 3KLHD 4XCYB 3F58L 2V5TA 4TOYL 1RHHB 4DZBB 3MOBL 1KJMB 3S96B 3WIHL 4EDWL 1IC7L 1QSFD 4PIRF 3VXSE 4XPHL 2Y36H 4LSRH 3RVVD 2CUHA 1RZGB 1BD2A 2OL3L 4XNUL 3FB8A 3K7UA 3QIWA 4QCIB 1QSED 4ZO8A 4HUUB 4MNQB 5I71C 3C8KB 4HIIB 4S0SD 1S7TA 4OFYD 3DVNB 1MFEH 4L8SA 1ED3A 5JLZB 3GMOA 1GYAA 1RZJC 5FO9B 4YDLC 2VAJA 4QOKA 2AI0L 5CJBA 2UUDH 5AYUH 2DI9A 2ICWJ 4XWOD 5CGYD 1PLGL 5E2VH 1N4XL 1CICD 1KPUB 1T83A 3G5XA 4IMKC 2B7DT 2PN5A 5D72L 4NUJB 1CF8L 1CXLA 3QIBC 4LDOB 4QEGA 5F96H 5I8EA 5FYLE 2M1KA 3T3PE 1DBML 3ZE0F 4WHYG 1YEDA 1VADB 4HWUA 1UJ3C 2EDYA 2O26U 4EEEA 5C08E 4FTVE 2J8OA 1XIWD 2K7PA 3H9YA 3VXUD 3EFFA 2DIAA 2P8MB 2H3NA 2V7HB 2Y07H 2JJWA 2LABA 3OR7B 3HC3L 3HNSH 2BK8A 3V6FB 1FL6A 4QRTB 4I5BA 2BY1A 4KKCD 2P7TA 3EOBB 2LU4A 1DQQB 4UDTB 1QBML 2DQFA 3OGCA 1EZVY 1ADQL 2JB6B 5E9DE 3VCLA 1KYOJ 3P4OB 5T1KB 3BDYL 4Q0XH 3ZYZA 1KTKE 4HPOH 4AZ8A 1LHZA 1QPXA 4JO1L 2H6PA 2ZJSL 1CGUA 1T7YA 5C9JB 1IL1B 3SGJC 3U0WH 1ZGLB 2CMRL 1OAZL 2IAMC 2IPUK 5ENWB 2FIRT 3DXAB 4M8VA 3QCTH 5TQ2L 5EULV 3NCYP 4HLZG 5ACLA 3WLWD 3MRDA 4OI7A 2NY6B 5LXGL 1BJ1J 1A3RH 2H1PH 4FXKB 4AEEA 2X4SB 2EDEA 4KUZH 5C3TA 4F2MA 2GJZB 4L4TB 3BH8A 4YDJA 4K7FB 1J8HD 3WIFB 4WHCA 4BSVA 2E9IA 1M1SA 4QRRA 1AJ7L 5LBSH 3TN0C 1IC1A 1G7QA 5I66A 4OBRA 4APQB 3NPSB 4OCSH 5E1AB 4PRBB 3QIUD 2YEZB 4PG9B 3MBED 4BSJA 3OHXB 2AJYH 1MREH 2IG2H 4LSTH 5F70A 4NZTH 2LVEA 1SM3L 1UKSA 1RUPH 2XA8H 5EBWA 2WUCL 4OKDA 3QQNA 2NXZD 5I30L 1YPZB 4WIQA 3N85H 1NCWL 3O4LB 4KTDL 5J1SC 1BGXH 2EZ0D 4M6AA 4WNQB 3Q6FB 4KQ4H 4FHBD 3VXOB 3WHE0 1H0DA 1RZIA 4ODHH 5ADPL 3LKSB 4MAYA 3EYSL 4GO6B 4ODSL 5MERA 2AV1B 4E5XB 4UB0H 4MS8C 5KJRH 1DCLA 5EOCL 5T1LD 4MQ7A 4JG0H 1RD6A 3HZKA 1VSCA 1TCRA 4RWHA 3KR3H 3T0EB 5L88H 3MACH 1YUHA 1JMXA 1UA6L 2YSSB 4G9FE 2R23A 3IDJB 4PRPB 1N5AA 5FA4B 3PWVA 5HSFA 2AJSH 3DUSA 5GRVK 5SV4A 4G8EB 3ILQC 2GKIA 2L7JA 2UY6A 2ADGA 1FNHA 4HWZA 3RRQA 2X9YA 2VXVH 5JXEC 4Q6IC 2Y36L 4JO3H 4LSRL 3EYFA 4BQ9A 4JFPA 3FN3A 3QUKB 5KS9F 3ROLA 3QAZC 4WY7H 4XBPB 2VLJE 5GPRA 4PJCF 1YY8B 1I85A 3RGVC 1ITCA 1RI8A 1HHKA 1DQTA 3NFPB 3FO2A 1WEJL 5F7MC 5K9JH 3RU8H 4W4NA 4UU9B 3LKRB 1MFEL 2GT9B 2VDLH 5E8OA 2X6MA 5LG1A 4WHYH 3P9WB 1LEGB 3LPFA 1ZVSA 2EXYC 1Q1JH 1BQUA 1ORQA 5DJ2B 5HGAB 4KFZC 2HJKA 5JOFB 3DI2B 3O6MH 4JPVL 2YPKA 4L8BB 4ZFZB 4LCUA 3DX6B 5HBBA 3QDMD 1QBLL 4MDJB 4XCEB 4CN1A 3UTQB 1UT9A 2W92A 3BMVA 1ZT1B 5IOPA 2WIIB 1CBVH 3TIDB 4JM2A 4V2BA 3K2UL 1TFHA 2GEEA 3TZVA 5F7UA 3RDTA 3IDYC 4YFLI 3H42L 5KTEH 4M8QA 2VL5A 1ZT7B 3ULVE 3EYUH 3HI5L 5DJYA 5KVGH 4M4PA 2A74B 3UDWA 2Y07L 1MCRA 3BD5A 4X5XA 1KC5H 1OARL 3MLVH 4XI5D 4N0RA 4KROC 1U3HA 1FC2D 4FG6C 1TNNA 3WS6C 3C60C 3HAEA 2YD6A 4PY7B 4X99B 1FG2B 5DD6B 1KLUB 4HPOL 3BKMH 2BVPB 1W0WA 4YDLB 3R0NA 3LEVH 1JTPA 2HTKC 1HILA 4CL7A 1VESA 5DD3H 5HHOE 1A3RL 2H1PL 1OT1A 3QIBB 4BFIB 4JJHA 1YJDC 1B2WH 3EZ8A 1D5MA 4WWID 4C56E 4POYA 4YDVB 3DX9B 1UJ3B 3GK8H 3KNBB 1AXTL 4Z0XA 4OF7A 1D6VH 4P5TC 1HH6A 4XNQB 4ZYKA 5T1MB 4OCSL 5KSAC 4XTRD 4J7RA 3AXLB 2AJYL 4PTTB 4HIJB 2KZWA 4NZTL 1K4CB 3L5WB 1RUPL 3RUGA 5IB2A 4U0RC 4R4FL 1WBXB 2B8OT 1HSAB 2AXGB 4HGWA 2OZ4A 1FIGH 3U9PH 1HYRC 4KXZH 4XGZB 4M1CD 4WFEE 4A6YH 3MRIB 3QZWB 5CMAB 1BGXL 1JWMA 3BO8A 3DVGB 5L6YL 2IAMB 4KQ4L 1FH5H 3D0VB 3GBMH 3CD4A 4ODHL 4PGDB 1UCBH 2A6JA 1NCDH 4ZFOA 4PJDA 4QKXB 2EDWA 5FUCC 4LSVH 4F7PA 1NC2A 4JAMA 4OFIA 4N9GA 1A6AA 1JYNA 4J3WA 5KJRL 2R39A 5JHDD 1DE4B 4YR6A 4EI6A 1KIPA 2VISA 1XF1A 3KR3L 4OCWH 3TN0B 3MRPB 1R5WA 1AIFB 3GSOB 4HS6B 1UWXH 2X05A 2VZVA 4HJJH 1ZLVH 3IGAB 1B9ZA 1UYWH 2AJSL 2HG5B 1WAAF 1HNFA 1NCAH 1DBAH 3C9NB 2I9LB 2VXVL 4PRAA 3W39A 4R8WH 4JO3L 1S7SA 3ARUA 4WY7L 1LEKA 3BGFC 3D18B 2VZ3A 3WFZA 1EDQA 2UV3A 4LBEB 2F54D 2RGSA 1KEGH 3D5OF 1SY6L 2BVOB 2AEWA 2VDLL 3HNVH 4JKMA 2WBKA 3SGEH 2VC2H 5ICZA 1OD7A 3H2WA 3GMNB 1FVCB 5JPNB 5J6GA 3P9MA 1Q1JL 1U8OB 1IQWH 5LQBL 4NFDA 3MCLL 3O6ML 1PJ9A 1KSRA 3LMJH 4S1QL 3MNZA 1FZOB 3DBXB 5M95B 5IR1A 2HVKB 1MJ8H 1Q9KB 3ES6A 2AK4D 5B8CB 1CFTA 1FGNH 2QQKL 3Q2CA 4MXVF 3KPMA 4CADA 3FOMB 3EJYD 4YXKH 1J0HA 4H5SB 3WE6A 4QHMA 4MZ2A 5FYJE 4H0GA 4Q6IB 1KACB 1WZKA 3QAZB 3MLVL 3VXPB 3RGVB 4OZGB 3CH1A 1UZ8B 3UYRL 2YA2A 1I9EA 1ZS8A 4NBZB 1MCDA 4P9MH 4FQCL 5TQ0H 5D7KD 1UZ6F 1MNUL 3QFDA 2FH8A 3BKML 1I4FB 1VERA 4AM0B 1T20A 2OX5A 5D6DA 3I85A 4WI4A 3PABA 5EFIB 3DPBA 1QO3B 4KZEH 1NFDB 3BXNB 1HXYA 3BWAA 1A1MA 2DBLL 5E5MA 3DTXA 1H3XA 2XTJE 4JFED 4ALAH 1DTUA 5DD3L 2K9UA 4ISVB 4FXGA 3QNZB 2YA0A 1QR4A 2ICWI 3MLSH 1PG7X 1B2WL 4LPTA 4LVNC 2DAVA 1KLFA 4U1HA 5IB4A 3GKWL 4I2XA 3JV6B 3GK8L 3ZE1E 3IDYB 3BUYA 5F9JB 1D6VL 1SBBA 5C0BB 4AL8H 4F9PC 5AAWA 3WSQL 3O3UN 4RRPG 3RWEB 3FN9A 5ILTH 1H9VA 5FYLH 4XP6H 1RULH 4Y8AA 5FA3A 3C60B 3KLAA 1IE5A 3IDUA 1SEQL 4P49A 1FIGL 3MUGB 3U9PL 1KN4H 3RX7A 2IH1A 2XKNA 3FHAA 3QDJA 4A6YL 2OTUA 2EE3A 4CN6A 2DLIA 1NL0L 4NQCB 1U8QB 3ARDA 1FH5L 1XAUA 4G8FA 4JHWH 1WCQA 5F7KC 4NHUB 1MJJA 3GBML 4URTB 1YC7A 5DFVD 1UCBL 1HKLL 1S7XA 3MX0A 1I1AA 1HHGA 3D69B 5C0AE 3LY6A 3SE3A 1YMHA 3O2WH 4O9HL 1MFAH 1IGYA 5HD8D 4WI2A 3U4EA 4O2CA 1R0AH 2B20A 1FORH 2QHRH 5A2LH 3V6OA 3MUJA 1I3UA 2A38A 2PUQT 1Z0NA 1U58B 2VWEC 3X12B 4P5TB 3SDCC 3MRCB 2AV7B 1RZ8A 2OXHA 1UYWL 3UJTL 5KSAB 3VXSD 2WWKT 5GS1C 3HFML 1NCAL 1DBAL 4RAVB 1JRHH 1QFHA 4UDUA 2WLYA 3QUZA 2BOBB 4X6FA 2EDOA 4U0RB 3IJHB 5DJXA 1T3FB 2BMKA 3E3QC 1AGBB 1TMCB 4PRHE 3U2SB 4Y5YC 4L9LC 1X5FA 3NIDE 2B2XH 1MVUA 2AJ3A 1KEGL 4HX1B 1ORSB 2ZSWB 4M9PA 3HNVL 2AKRB 2VC2L 5I1EH 1T04A 4L29B 1MWAA 4U7MA 4DVRH 5A43C 1I8MA 4KK9D 2XZCL 4KU1A 3H3PH 1BIIA 4LNRB 4LRNH 3ZE2F 1G7MA 3IS1X 4DTGL 3EJJX 4R26L 5T3XE 3LMJL 1PD6A 1DQDL 1EFQA 3DVIA 2E27H 5FYLD 3FRUB 3LEYH 3QUMB 1ZLSL 5C09B 1MJ8L 4OLYH 1KJ3H 2QHLA 3SKUD 5HY9B 3P11H 5C08D 2VB5A 3OZ9L 4YXKL 3B4NA 3EO0A 4Z7OF 2BY0A 5C8JB 1MFBH 5TGBA 4F9LA 4I4WB 1P84K 2DWEB 3ARFA 4YDKH 3BGFB 3D0LB 4XMPL 4JHBA 1CLOH 4MNHB 4DZ8B 2EKSA 4W4OC 4N9OB 5TF1L 4PJ9D 5E9DD 5FOBA 4MHHI 1A1NA 3IDMB 2ARJQ 2VOTA 3GB7B 4P99A 4R2GD 3GIVA 2D7NA 1MRCH 2PO6A 4K94H 5TQ0L 1I1YA 5KBNC 3QEHA 1XGQB 5HGGS 1IEAB 2A9MH 4N0UA 1YNKH 4PJEF 2CLZB 5FO7A 3U0TB 4RMTA 2XPGB 3WO3B 4NM4H 4HD9A 5DRXA 1EJ6A 4KZEL 2EYSA 3K1DA 3S5LG 1XR8B 5FXCH 3AS2A 3LEXA 5I18H 3HC0B 4ALAL 3MGOA 5E70A 3S88H 3CVIH 4ZSOE 2X10A 5DHVH 3MLSL 2ED7A 1CD1A 4YIQB 4JQIH 3TNMB 2IJ0C 2X1XR 3QDGB 4I3RH 3B5TA 4R9HA 1MHEB 1GZPB 4XWOC 5KS9A 5CGYC 3SGDI 1JWSB 3V0AC 1OTUC 3IF1A 4PJCA 1QSFA 5L2JA 3GSUB 5ILTL 3CCHB 1HK6A 5FYLL 3IDGB 3W2DH 2AXFB 4L4VD 3FQUB 4LLWA 2CQVA 4CVXA 1QSEA 2XICA 1P7HL 2DKUA 2XWBB 5EC1A 1R3LB 3S98A 4G80A 3TLRA 2O5XH 1ZA3B 1IKNA 4OFYA 1XIWC 3EBAA 3B8SA 3CXHK 1OPGL 1T6WA 3GMQA 3CMOH 1B4RA 4LMQE 3MV7D 4AK1A 1A6TA 3O3AB 5BRZD 3JZ7A 5AD0A 1X5XA 3L3OB 4HIHB 4RNRB 5DD0H 5F89B 1LP9A 3I6KA 4KKCC 1YEFH 1UH4A 3ULUH 3O2WL 2BNRE 1G7IA 1YMMB 1CICA 3H7LA 2G75A 5FUOL 1X6LA 1CD9B 2ORBH 2BSRB 4LVNB 2DN7A 2QR0B 3VFVB 1H3GA 1I9RH 2VXQH 3KWWB 5D2NE 1R0AL 4G9FD 2QHRL 3SE9L 2BX5A 5L8LB 5FO8B 1P6FA 1IGCH 5DVOA 4XB8A 4FZ8H 1JTOA 3VRJA 3WFHB 5T5FH 1KTDA 2HN7B 2WV3A 3FT4B 3G9AB 3TM6A 1JRHL 2P45B 2BSTB 3K4DA 1Q0YH 1S7WA 1KTRL 5B39B 2VLJD 4JKPH 2R2CA 3V9FA 4HK3N 5DUML 4ZFFB 3LSOB 3AGVA 4LLMA 5TDOA 1KIRA 2CH8A 3ARZA 2B2XL 2O5ZL 1KTLB 4P9HH 5FF6A 3FB5B 3JTSB 4OAWA 1U93A 2Y7QA 2I60H 5I1EL 1I9IH 1TLKA 2NX5B 3QIUC 4PB9L 4DVRL 1HHHA 3H3PL 2DWDA 1PKQB 1EHAA 2Q8BH 2E7HA 2ATKA 2YA1A 4Z9KB 2DKMA 2XACC 1KIQB 1T7XA 1HWHB 2ICES 4JLRB 3LEYL 1EXUB 3MLXL 2P5WE 4OLYL 1KJ3L 4NQEE 1ZHNB 1J8HA 1Q72H 1CTOA 1QKZH 2DQIL 4UMGA 5CEYA 2EZ0C 3P11L 5BVJB 3SDCB 3VXME 3K8MA 1NKOA 3OKEA 4XNYH 1VPOH 4HKZB 5GS1B 5MEPA 4YHKH 3SCMD 4OZ4A 1OGAE 2F74B 4Z7UB 3MBEA 1FFPB 4NKDB 2OL3B 4YDKL 4NO0D 4XC3L 3D85D 1LO4H 1ACYH 1X5HA 2A9NL 3NACH 4LCYA 3ULUD 5JDSB 4X6DA 4YO0A 3SOBH 4Y5YB 3QNYA 4OB5H 1J05B 2CR3A 1KB5B 1W0VA 2JJTC 4FQHA 1J86A 1EK3A 4YHLL 1OSZA 1RK1B 1WSST 2P8PA 5C0GA 5I8KH 4F37K 2A9ML 2KH2B 5GIRA 4NM4L 5JUEH 1KPRB 4X7DC 2R2EB 5F1IA 3VH8A 4Y2DD 5HHOD 2WNGA 2Z8VC 5C0DA 1CDHA 4N5UA 1A8JH 5I18L 1LD9A 4OUUB 4N8CH 3CVIL 5FDWB 3UYPA 1UG9A 4IRJD 1CXFA 1F8TH 3RWDB 3LDBC 1YQVH 5FAAA 2E9JA 5KN5A 2VNCA 1WAAA 4I3RL 1HYSD 1UZ6E 3EFDH 7CGTA 3B9KA 4XXCA 3BQUA 2OJEA 4PJ5E 4OFVA 1XF3A 1PYWA 5IW1B 1QLRB 2FJGB 2XG5A 3W2DL 5D7SL 1T66C 3DUUA 4PJAA 2NCMA 4Q7DA 3VXRD 3D39A 1V3MA 2VDPL 4QNPF 1AO7A 2NLJA 2O5XL 3OSKA 1A7PH 3SKOA 3WNLA 5FHBH 3ULVL 1YNTA 4M1GH 5E8NA 2FEEI 4LPVA 3O2DH 4P48A 4PJIF 2A83B 2YRPA 3ARXA 4Z7WB 3IXAA 5MEOB 1YEFL 3TBVA 2J3SA 5ESQB 3QDMA 3SKNB 4CMMB 5HHQB 3EYVB 2HT2C 1ZKAA 4P4RA 2ORBL 1BBDH 2DJSA 5H94A 1WBZA 3H9SE 4P46D 1CU4H 1VGKA 2R1WB 1A02N 1U2CA 4MAUH 3DOSA 4EBQH 4K3HA 1IGCL 4FZ8L 3MGTB 5IQ9B 4NFBA 4CNIB 5IW6B 1EO5A 5T5FL 4FA8A 4F33A 1IGTA 2I25N 1Q0YL 4JO4L 5F21B 1S9WA 1NCUA 5E2WH 5F7HA 4KRMB 3BH9A 3RWCA 3N1QC 4XNMB 5IHZB 3T0BA 3JV4A 1FVDB 4DFIA 2RFXA 3RAJH 2CUMA 4GRWE 4ZG1A 1FE8H 4JFHE 3T1FA 5CEXB 5LAXA 3G5VA 4P9HL 2V2TB 3FQTA 1XIWB 3NIFF 3VXUB 1SJEB 5B3JF 2I60L 4GQ9H 5IVXB 3U48A 2X42A 1UKQA 4CRPA 4XTRC 1JWUA 4LLVA 3MJ8A 1YN6A 2ZOKA 4NIKB 1CDGA 4K8RH 3TGXA 2Q8BL 4S10A 4KI1A 3TPUA 2JIXD 1CGYA 4XPTH 5GRVL 1NFIB 1MCWW 3VE0A 1ZLWH 1BAFH 1Q72L 2Y5EA 5D1QA 1QKZL 4LVHC 4L3CA 5A1AA 3ZHLA 1F4XH 1OSPH 1I3RB 3BP4B 1QLFA 1HHJA 3L9RA 4XP5H 3T2QA 5JW5A 1A7NL 4R7NB 2JTDA 3QJFB 7FABH 1TITA 3F65A 5E99H 5F3HB 1NMAH 1I3VA 2IWGA 3TH3T 1BHGA 1D9KB 1Q9LB 1LO4L 3QG6B 3ZE2E 5KANI 4ODUB 1ACYL 3HMXH 3SOBL 5DK0A 2XNAA 2CLRB 2Z31D 1GC1H 3T65A 5HHXH 4JZOA 2C7UA 3O3EA 3RWGB 2GITA 5ANMB 3HE7A 4POZD 1OAXH 4MA3B 3QIUB 5K59F 3H7BA 4J4PA 1O7VA 3UX9B 4G8GE 1UM4H 1L7IH 4QF1B 4OIIH 5JUEL 5B38B 4HKBB 4JFDA 5DC9B 2XTJD 3BRGC 3V52L 2DM3A 3SHSA 3VMPA 2NMSA 1NGWB 3KYOB 1JZ4A 5BZDA 3KXFE 4M6MH 5D7IF 3ZTNL 4KUCF 43CAA 5JHDA 3B6SB 4Z77A 4UNVA 1G0YR 4HBQA 4YFEA 4HXBH 1F8TL 4E41D 2YUWA 4WW2C 5IUSA 5K9OA 5FECA 2ARJA 5I1HL 1MCHA 5HHPA 4RISH 3HMWH 5T3XH 4PJEE 4KJPD 5EPMB 4PTUA 3PHSA 5IMLB 1LK2A 5GSVA 4HEME 4K8RD 2DQJL 4Y4FD 3VFMB 3KPQA 2FZ3B 3B9DA 5HTSA 2DI7A 2D3VA 4KMQA 2YD5A 5CKAA 1GSMA 1FNAA 4PFEA