4Y89A

Crystal structure of the n-terminal domain of ceacam7
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
109
structure length
109
Chain Sequence
b'AQTNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGIYTLHVIKENLVNEEVTRQFYVF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carcinoembryonic antigen-related cell adhesion molecule 7
publication title Structure of the N-terminal dimerization domain of CEACAM7.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 34
structure length 109
sequence length 109
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y89A01
2Q3ZA 2GITA 4WHTA 3WE6A 3OKOA 2F19L 4FTVA 4LCIH 2GJ6B 5BS0D 3O3DA 1PD6A 3V7AE 3ES6A 5BJTA 2OSLA 3SDAD 3AS1A 2IBBA 2VO5A 3MA9L 4XPFH 1Y6KR 4EQ2A 5I1HL 4MAYD 4X99A 1T20A 4K71C 3AS2A 3CXDL 3OKLA 4BSVB 4YBLC 1FZKA 1NCTA 4POZC 2FL5B 3KPLA 2Y5TB 15C8L 1RIVL 5F6IC 3U0TA 2FJHB 2NY7H 2IQAB 3CMOH 5EIIA 1ZGLP 3F7PC 4DK6A 4Y1AB 5ELIA 1CR9H 1UWGH 1NEZG 1JYXA 2B2XL 4YXHL 1KEGH 4TQEL 4C83A 3MRCB 4APQC 1T83A 5T1LD 5D5MB 4HS3B 2VYRE 4JAMB 1NEUA 5IWLC 3HMWH 3MA7A 3EYOB 3T65B 2GUOB 3JV4B 4BFIA 4N1CA 1J1XH 1U41A 1TVBB 1FGVH 2Z0BA 4KTDL 3NZHH 2YKLH 4G8IA 4LF3A 3IDXH 4HWBL 2A0LD 5L2KD 2VIRB 4YHZL 3LEYL 2I25N 4XTRD 5FDWA 4GKSA 2CXGA 4R7NA 4PRIE 1E28B 3M1BB 5KSBB 4L8BA 3UROR 1DSFH 3QNZA 1AO7B 3D9AL 4YEFA 4ZNEA 5I73B 1LO5A 4HUNB 1MIEL 2X89A 3V4VL 4R9HA 1RZJH 1U8QB 5HYEA 1TQCC 3BKYH 2VXVH 4MDIB 1H3TA 1N5AB 1TENA 1X3DA 3HCVB 4DGVL 2YPKB 4QRTA 1YEDA 2C4FU 4WFGE 4MQXC 1KTDB 5ADPH 1A5FL 3QNYB 3TPUA 1P4BH 2DL2A 3VMPA 4MD0B 3FT3B 4XBGB 5H37G 43CAA 4S2SB 4U6YB 1KG0A 1F11A 2HWZH 1ZVYA 2APBA 3MNVB 4CMMB 1OGAA 4NO3B 1HHHB 4H1LA 1LEGB 2PR4L 3SOBL 5D7LA 2HKHL 4J23A 1D5MA 4NN6C 3MRNA 1NANI 4KK9D 4PS4L 2XTJD 5IVXB 1JI1A 1WWBX 1R5VA 1KIPB 4AEHL 1P1ZA 1UCTA 3PWPB 1XCTB 5IQ7H 2O5ZL 3F6IA 1BFOA 4Y4FA 1CDUA 4M93B 5DQDL 3ZLQC 3MLPA 3O2WH 1UA6L 4ZXBB 2X4OB 1U95B 3P0YH 4Y5YC 12E8L 4HCRH 1PZ5A 4WUKL 3EKCA 1KJ3H 2RB8A 4MDJA 1F5WA 2VL5A 1BFSA 1F90H 1MCNA 3SO3C 1MCPL 4XBEH 4NUGH 5BZWB 4QXUL 1I3GL 2IG2L 5IJVA 4M1GL 4WFEE 4LP4A 5HYQA 1CICD 3RTQD 1EFQA 2RHEA 3ULSA 3ZKND 5HDQL 3SGDI 2LU4A 4XP9L 1IM9D 1VHPA 4OUUA 4HC1A 4RAUA 2MNUA 1TQBC 4IJ3B 2CUIA 1G7IA 2E6PA 4U6HA 2HLFD 3GFUA 3WSQH 3ULVL 4XBPA 4FQ2L 2EE6A 3MRDB 4BH8B 4F7MB 3QQNA 4QYOA 3O6KH 5GS0D 3H0TB 2ERJB 2J88L 3GMQB 1HDMB 2ZPKL 3L3KA 4OCSH 4LFHD 4YHNA 4LSVL 5DYOA 1H15A 2A1WL 3INUL 3BWUC 2DQUH 3WXVL 3W81A 2J3SA 1VFOA 5DI8A 3KAAA 1VCAA 2X5PA 4P0DA 1FFOB 4XZUB 5K9KA 3EDJA 1S9WB 2PYEB 3EOAB 4H1LG 2EDXA 5KSAB 3HE6C 4PLKC 4UQ3A 4OCLC 4BQCA 3WLBA 2WIIB 3HRZB 2IBZX 4Z77B 4YAQA 5ISZA 1N2RB 1QTYT 4S1SL 1IGCL 5IB1B 4MJID 1U6AH 3GJFH 3T04D 2APVA 1GH7A 1HHKA 5FCUH 3TZVB 5IM7B 5I1GH 2AQ1A 3VD3A 4XWGH 2FEEL 2XOTA 4I9WD 3WDHA 3WHE1 1J8HD 3HG1A 1VDGA 2F5AH 1A6ZB 3LEVH 2QSTA 3MREA 2VITA 1JN6B 1BREA 1QRNB 4J3XA 5GGQL 4X6DF 1KN2L 1UFUA 3UC0H 2FATH 4YHPB 3ARBD 3S36L 5HVWA 4K3HA 4CADB 1JGDB 1Y0LA 5F6HJ 4RFOL 5ITFA 4HFUH 4QT5B 2AJ3A 4YBLB 3VXPB 2CDFB 2ZG3A 2Z92A 2CK0L 1GGUA 4QRRA 1I7ZB 3DVGB 5I71C 1XR9A 5F6IB 2GT9B 1TTGA 3T2OA 2XIDA 5D6DA 5FGBC 5JUEL 2J8UB 2NLJA 2G75B 5DHYB 4I13B 5EWIL 1T04A 4C57C 4PGCB 1RHHB 4HC1L 2Z9TA 4APQB 1ZLVH 1B4JL 4UB0H 1W72A 5CJ5A 3HKFA 1G6VK 1K4CA 1AD9B 3FOMB 2CKNA 2AQ3A 2FWOA 3DROB 4HLZH 2V2XB 1HHGA 2VDOH 4Z0XA 3V4PH 1UEMA 4JM4L 3ZE1F 1A7RL 1IC5L 3NACL 3SDXF 2FD6H 5GHWL 3BQUB 2BSED 5DMYA 3T08A 5CEZE 5CBEB 1PG7L 1LP9A 5ALBL 1JVKA 3C6SB 5FOBA 5EZIH 5I1LB 2GCYA 3C8KA 3OBAA 2XWTA 2DYPA 5JHLL 3IRZA 3QIUA 4G9DB 1FCCA 2BVQB 5HYJA 2C3WA 4GS7B 1A3QA 3TN0C 3B9EA 3DV6B 1TQCB 5E2WL 1G7QB 1JWUB 3WDJA 4OZIE 1NFDF 4DTGL 4ZFZA 2VC2L 2OL3A 1GZPA 4PJ7E 5ESQA 3QAZC 5E94B 4PRIB 1NH6A 2G2RA 3D25B 3QIWA 3NIGF 1B0RB 5EIQA 5KAQF 4LLUA 4Z7NF 1AC6A 5CZVH 4PJFA 4X6EA 3BMWA 4HGMA 1U8KB 3MCKB 3LS5H 4UMGA 3HE7D 2N7AA 4Y19A 5CJXC 2A6IA 3GM0A 5KN5B 5FA4B 3WS6A 3UTSA 5D72L 4XPAH 2ICWA 3C08L 2PN5A 2ENYA 4NN6B 4NRYB 4D9RE 4UTAH 4WHDA 3L95B 3OKYA 4XNYH 5CP3A 2MMXA 2ID5A 1IAIH 1YDPA 3MYJA 4KPHH 5C6TL 2B1AH 3VWJA 1WC7A 1RD6A 3F12A 3V95A 2X9XA 5LBSL 1N8ZA 1DVFA 1SJXA 3BHBB 1BIIB 4Y5YB 4PJ9D 1DE4B 4ZS6C 4K8RH 1P84J 3L7FB 4G8GD 4PJEE 1W0VA 4I18C 2JB5H 4IRZH 2P5WE 1AE6H 4EBQL 3FL7A 1J0KA 5EU6A 4YHOL 4JRYD 3S36X 3SO3B 4XI5C 1WIPA 2FIKA 3QO0B 2H26B 3PGFH 4M3JA 4G6FD 3DRQB 2AJUL 4G5ZH 5E1AA 1DANT 3QXWA 4IIQB 1NAKH 5CZXC 2BY3A 3CDCA 1MHHB 4Z7UE 2A9MH 3UAJC 3LKOA 5ADOH 3TIEB 3T1WA 4LNRB 1A14H 4G8EB 3GJEA 3GO1H 5KOVC 2VDRH 5D7JD 4F8QA 4LVOC 4K7FA 3ULUH 1IEHA 1T22B 3QZWA 4KDVA 2BDNL 4ZOBA 1RJZA 1EFXA 3O45B 5HI5D 3UTQA 3PQYD 3TCLA 1M05B 5CWSB 4Y2OA 2OJEB 2IPKA 3RVVD 3I02B 1AIFB 1BZ9A 1PG7X 1GXEA 1YJDC 3F7QA 4JY5H 3LDBC 3MJ8A 4JRXD 4LSUH 4OD2B 3QHZL 3HE6B 2BRRL 3G9AB 4PIRF 1J5OH 4XCYA 5D1ZA 3IFOB 1XIWB 2AQ2A 3DXAE 8CGTA 3O9WC 4TPRL 1OPGH 3CSGA 4J8RA 2YPVH 2PTTA 4E41E 3OV6A 1OSZA 4OIIL 5C08E 3FB6B 1UACH 3BP4A 1UH3A 4R0LC 2RFXA 5DD5L 4P5TA 4O4YL 3L3HB 4BSJA 3T1FA 1JCKA 2OCFD 5GZOC 2I60L 2XFXB 2GK2A 3K2MC 1GVIA 5C0AA 1F6LL 2BOCA 2A9NH 4ZPTB 3GMMA 5IW6A 1PW3A 3NCJL 3IFLL 5D4QA 3P30H 5CBAB 2B0SL 1H3WM 4HUKB 5MP6L 3Q6FA 5HGAB 3VXQA 1JGVL 2YXMA 3O2DA 5EU5B 4PGZA 4X9FA 5HYIA 3IDUA 2ZUUA 3UPAA 4MGXA 3HC0A 1CBVL 1EEZB 4JQVA 3TYFB 4HGWA 4PJ5D 4CU8A 2RGSA 5DS8B 1LO4H 5I6XB 4LASH 3S35L 5I71B 1HWHB 2Z35A 3GI8L 1AJ7L 2N56A 1J1PL 2YWZA 3B5TA 1MHPL 3RWHA 4M4RA 3QHFL 1X4XA 3QULB 3QZWG 4FFVD 4PLNC 4NQEE 1LDPH 5C2BH 4WWKD 3VRLF 5C0JB 4JZJB 3DVIA 5DRNB 3EDFA 3MOAH 1YQVH 2DBJA 4H8WH 4JREC 4R2GC 1XR8A 1SMOA 4O00A 3KPOB 3OKKB 4U7SA 3W5NA 1VGEL 2EE2A 2Y07L 2IH3A 1WTGT 1FYTB 1MY5A 2FRGP 4J3VA 3MJ6A 1VACB 2FR4A 5DD3L 1A7OH 4YHMH 2UZYB 4QWWD 3GUTB 4OBRA 2R69L 2PNDA 5HGBA 3CFKA 3JZ7A 2W07A 4XP1L 3V6ZA 2CIIA 4YX2L 1BGXH 1ZHLA 5L2JB 1R0AL 3TN0B 3Q1SH 3BPCA 1DTUA 1XZ0B 4XP6L 1V7MH 3TESA 1YEGH 4O02L 1QOKA 5FOJA 2VUOA 1QZ1A 4I77L 5C9KA 4Z7WE 3ZO0A 8FABB 4WJ5A 2ITDA 1BQHA 5I18H 4F9PC 5HY9B 1QRKA 4FQ1H 5DWUH 1J11A 4JRWA 4M1CD 1KEMH 1QPPA 3D0VA 4CKVX 3DGCR 2IEPA 1NCCH 2DQEH 4WUUD 4JB9L 3C5JB 2A74B 2ZZUT 4KRNA 1EJ6A 3P11L 3CFCL 4OGAD 3LS4L 3QUZD 4OZIB 4R96A 5HDBF 4DGIL 4PJ7B 2CO7B 4WY7H 5D2NB 1N7ML 1J0ZA 2R0WL 1BECA 1CDYA 2Y06H 3K3QA 2AXGA 1S8DB 4DGYH 5DLMH 1F58L 1UYWH 3DYOA 3O2DL 1ZT1A 1P2CA 3F7VA 3ARGA 5CCKL 1K2DB 2ZSVA 4GKZA 1KLUA 4HKJB 5HHXL 3QDMB 4R26H 3NIFF 2ICWJ 1CLZH 1ZLWK 5CJBA 1KGCD 4DVBB 5IG7B 4OF6A 2FEDD 4FNLL 2PXYC 2YRPA 3D85A 4JFED 4OKVA 5GRXG 2GJ6A 3GMLB 3K1KC 1R3LB 3TA3D 4OCRH 4GQ9H 2WZPD 2WAHA 4PJEB 3X12B 2OK0L 2P5WB 3S35X 1OAZH 3OSKA 3UTPE 1U8PB 1HQRB 1ZHNB 1QBLL 4AEIL 1JPST 4I48B 5F1IB 4BSVA 1TTFA 2FBJH 4PRHD 1QUNA 2F5BH 3UJTH 3DGGB 4U6XB 1BQHG 1ERNA 2KUTA 5IB2A 4Z7UB 1FNHA 2IQAA 3GBNL 5JW4M 4Y1AA 2X4QB 5GJSL 4OGXH 3B4NA 1ZEAL 2R29L 3RA7H 1NPUA 3BAEH 4X9IA 4M43L 3GNML 5FYLH 2APXA 4QTHA 3IFNH 3B5HA 1FE8H 2J6EA 3MRCA 4L9LC 4OT1L 1AY1L 5HHQB 5D5MA 3H3BC 4HS3A 3QG6B 4XP5H 5K59E 4JAMA 3KR3L 4FXGB 3T65A 2GUOA 2DMBA 4JFOB 1MCRA 3JV4A 2X05A 1VFAB 1WIOA 3CLFH 1RFDH 1RSFA 4HQQL 3DUSB 1TVBA 1L0YA 3O9WB 1VPOH 3EOBB 1ZK9A 2HAZA 1QA9B 1QBML 2C9AA 2MSPA 3TNNB 4R90L 2RCSL 1U0QA 3HUJE 2XA3A 4Y16D 1MHCA 4OGYH 4NFCA 4FABH 4R0LB 4JO3H 1KCSL 1A22B 2VKWA 1E28A 5BZDB 5KSBA 1KXTB 1E6OL 1TCRB 2R4RH 3BN9D 1QLEH 4QGYA 3MLVL 2AV7A 2OR8A 1AO7A 5FM5O 1FL6A 2BNRE 5DT1H 4EJ1C 1FP5A 1TJGL 1MRDL 3HA0A 3DXAB 4EOWH 3IDGA 1U8QA 2OP4H 2DJUA 4E41B 5KVGL 1YMMD 4DFIA 5C08B 4MDIA 1MH5A 1C5CL 1MEXL 5JA9A 4ETYA 4WW2A 4D9QE 1A6TB 1N5AA 3RNQA 3QYCA 5EULV 1FORH 2YPKA 1FNFA 4GAYB 4GG8B 1DQML 2XQBH 4A6YL 3QDJD 1JPFB 1KTDA 4Z95L 3U36B 1F4WL 4U6TA 2A6JB 3QNYA 3KNBB 3S97C 5AWNH 5DHVA 2VABB 3FT3A 4XBGA 1TDQA 4GMSH 4S2SA 4U6YA 1MIML 5T33L 3QEHA 3KHQA 4JFPA 4JZNB 2ATKB 3TYGL 4ODVL 3MNVA 3CDGB 4CMMA 1HHHA 4MQSB 1LEGA 3RGHA 1HNGA 3HZKB 1PAMA 4XC1L 2NPLX 5DUBB 4Z7OF 3OTTA 1F02I 3G6JF 4M61B 5E2UL 4YPJA 3UTTD 3SEPA 1AH1A 2VLJE 4X0KB 4JREB 1EJOH 3PWPA 5EORL 1XCTA 3T2NH 1FV1B 4OLZL 5A3IC 4ZXBA 2X4OA 1U95A 1JUFB 4OSUL 4XNXH 4LOUC 1B3JA 5D1QC 4K3DL 3SKOB 4UBDC 4ERSL 4LHUG 4OCXL 1OP3K 4AEFA 2R9HD 2FHCA 4M8VA 1CFVH 4KQ4L 5BZWA 3RX5A 3SDCC 1S7QB 1I3RB 1MLCB 4CRPA 2NY6D 2NY0B 2J6EL 1NBYB 4AH2B 4QOKE 1E0OB 4M1DH 1OD7A 3KYOB 2YC1B 4GSDH 3UBXI 3LN9A 3QQ9D 1QFWM 4M6AA 4PBWD 3QUYA 2P8PB 3P4LA 2ZCKL 2D0HA 1RZKH 1CVSC 2FHFA 4LCUB 4Q97A 1S9KC 3VWKC 5IV2B 5HHOE 3IYLW 4K7PH 3H42H 3LB6D 1B0GB 4TYUA 3MRDA 4OTXL 4LQFL 3PABB 4BH8A 4F7MA 1OW0C 5ITBL 3G5XB 1RZ7L 4LGSB 5SWSD 4YPGA 4NWTL 1DBAL 2XKSA 5JHDB 5EU7E 3GMQA 1HDMA 3MNZB 3ZHLA 1FGNH 4Z7WB 1INDH 2APWA 3FFCA 1KELH 4ODXB 5BMFL 4ZS7H 3BO8B 5JOPD 4YFEA 5FYJE 1UEYA 4LK4A 4NNPL 4CNIB 4LSDA 1FFOA 3N1QC 2JJWA 4XZUA 1S9WA 2PYEA 3EOAA 5BV7C 3BYYA 1BP3B 4GW4B 4ELMA 1UM6L 1YPZE 1T03L 3GMNA 3KGRA 2WIIA 3HRZA 4Z77A 5EU7C 1KBGL 1I3VA 1N2RA 1SBSH 4J4PA 2NTFB 4OLXL 1A6UL 5LCVH 4TVPE 1T1WB 3B6SA 3TZVA 5IM7A 3LPGA 2AAVA 3RVXC 5DSCA 1TJIH 3OAZK 1S7SB 4HIHB 3HMXA 3VGAC 1FYHB 3OAYH 2PXYB 4P59H 1A6ZA 1MPAL 3MV7D 1HH9A 4PJIF 1FNAA 1QRNA 2Z8SA 4PGBB 1MFEH 3O4LA 3I3BA 3H2WA 4D3CH 3C9NB 1PYWB 5D7SH 4GH7B 4XPHL 3ARFA 2VDLL 2XN9B 4YDIH 4JHAL 5I2IB 2CXKA 3RQ3A 3MGOB 1IC4H 4LSRL 3TPKA 2B8OT 4N0YH 2D4DA 4PJXF 3TBSB 4P23D 4NZTH 1KIRB 4GBXD 2CH8A 1DBJH 4YC2C 3FQRB 1I7ZA 3DVGA 1K9TA 3VXRE 1QLRB 1KF9B 2CGRL 2J8UA 2G75A 2ZUYA 3RVUD 3AB0C 5DHYA 4JFFB 3U9UB 3V52H 4OIBA 1PEZA 4BH7B 2LU3A 5KJRL 1RHHA 3ARRA 4APQA 4L9LB 4LVHC 5L6YH 4WTWA 1MHEB 4Y2DB 4LSTH 3KYAA 4TN9A 3J7HA 3T0EE 2APTA 3EGSB 3QH3A 2WP3O 2V2XA 3L9RB 1MCSA 3NAAH 4GRWH 4Z5RA 1JIBA 2A0LC 3BQUA 3STBA 4BQ8A 1U3HC 1HKLH 1WV7T 4F33B 5J9PB 2EH7H 3C6SA 5DO2D 3MJ7B 5I1LA 2GY7B 3KPRE 3VH8G 2YHGA 4L3AA 4P2QD 2VXVL 3MUZ1 4G9DA 4AYFA 3SJVE 3JSSA 4S0TD 1FQ9C 3T0EC 2DBLH 3QB7C 5KSUB 1MNUH 1OARH 4PJBA 1WFTA 2EDEA 2YSSB 3TBWB 1XCQA 3DV6A 1G7QA 3HUJB 3QEGH 2R2EA 1RIHH 1U8JB 2XZQH 4PR5B 3O4OB 3K8MA 4XNUH 1GGBH 4F58L 4P4KC 1CLOH 5E94A 3TJEH 4R4BA 4PRIA 4JKPH 4KRPD 3QWOB 3KHOA 1S9VA 3ZDXE 3D25A 1B0RA 1BFVH 2AK1L 2XG5A 4NGHH 2BNRB 2NMSA 5EUOF 1A1NB 4ODUA 4JPWH 1OAXL 4ONGH 4G6JH 1CD8A 1LD9B 1V3KA 3CH1B 4RMRA 1I9RH 2EZ0C 4OD1L 4G43B 3HMXL 1U8KA 4F37F 1K8DB 3S37L 5IMMB 2ESVB 3LIZL 5FA4A 3SGEI 4HJJH 4IRSC 4NRYA 5SX5K 3ZE2E 3L95A 4U2YA 3CVIL 1T1ZB 1R5IB 3GSNB 1CCZA 1CGTA 1QO3A 3HAEH 2FZ3B 5C0CD 3V0WL 4U1NA 4P99A 1S7TA 4DVRH 4X6DE 1U42A 2BVTA 1BFTA 3L7FA 2Z8WC 3GSQA 4GG6E 3AY4C 1FC1A 2X4RB 1CL7I 1ACYL 2DN7A 2YD8A 5JXED 3SDCB 2H26A 3ARDC 4UT6H 3T3PF 1LHZA 5B3JE 4UV7L 4HAGA 2X1QA 3QPQD 4G3YH 4IIQA 3N85H 3SBWC 3STZA 4HX1B 5IBUG 4XWOD 2IH1B 2DAVA 1JNJA 3TIEA 3ULVD 4U1JA 4LSPH 3HZVB 5E8DL 2XQYK 5DJDB 3RPIB 4IOFC 2DQDH 4G8EA 5TFSH 2XWJA 2WNGA 4XNZC 3EFFB 1T22A 5C0FB 1FC2D 1KFAH 2HT3C 1KJVB 3CC5A 3EOTL 4U4BA 4NO0B 5I1CL 3O45A 3QUKA 3ZE1E 4JZOA 4KVCH 5K9JL 5C07E 2Y6SC 1M05A 4X4XA 5CWSA 1E6JH 2LABA 3IF1B 4F57L 1YNTA 3ULUD 3I02A 5HHOB 1AIFA 1WICA 3S3PA 3KG5A 4M6ML 1C1EH 4PV8B 1RJLB 2LV4A 4OD2A 2EYRB 1QSZA 1XIWA 1F13A 2JJVA 5F9DC 3S3JA 1MCWW 3BYTA 4BM7A 1X5GA 4GJTB 3PWUA 1NC4D 3KDMA 3FB6A 4JHWL 3EUUA 3TEUA 2BY2A 4FZEL 3L3HA 4XRCB 1FAIH 2SEBB 1RZ8B 3PDGA 3DETD 1MQ8A 4W81A 3CSPA 3S4SB 4LCCB 1S7WB 4NQDE 3VGAB 1YPZB 4L8SB 4ZPTA 4TULH 3SDYL 4Y4FD 3BVNA 5FYJU 1ZTXL 1JRHI 5CFHA 3BKCL 5CBAA 5T3XE 1HZHL 3ROOB 5ILTL 3GGWB 1H3PL 3ULVF 3BP5B 1G1CA 5HGAA 2LFGA 3RAJL 5EU5A 1P7QA 5EPMB 2H2SC 3FT4B 1A6AB 1UH4A 2EIBA 4NKIH 4DAGL 2DTMH 1SYVB 5TE6H 1EEZA 2EDYA 2VXQH 4LARH 2OTWB 4YC2B 3HLAB 5DS8A 4OLUL 4WGVB 5FUZL 4W6XB 2F54E 4LIQE 1UWXK 3FAXA 4Q9RL 4GO6B 2VMFA 4QHKI 4KAQL 4QXGL 3QULA 1Q72L 4H0GA 3ISWA 3TWCL 1UCBH 2VXSH 4ODWB 5CINH 5C0JA 4JZJA 5DRNA 4LVHB 3OKMB 3SCMC 5FF6B 4JO4L 3KPOA 1IQWL 3OKKA 4XP4H 4HGKC 1X5IA 4WV1C 1LNUB 5EZIL 1FYTA 1T7ZA 1ZV5A 1VACA 5I9QB 4LEOA 5CEXA 1ORQB 4M7JL 3NH7H 2DS4A 1U3HB 4FHBD 3GUTA 1BJMA 3RY4A 4I2XB 4JFQB 5FKAB 5E2VL 1RUPL 4JG0L 5DUPH 1T2QH 1U8MB 3MUGB 1OTTC 3T0EB 1YMHB 4MHHI 5L2JA 2OM5A 2W0FB 4LEXL 3IGAB 1AQKL 4FFYH 3VD7A 1U58B 4I1NB 5ISZD 4HHAB 3BUYB 5GGUB 1JHLH 1K4DB 2H8PB 5TJWK 3DX7B 3H9SD 5LGJB 1T80A 8FABA 3STLB 2A38A 4PJ8C 1OAYH 4GMTH 4WEUD 3KPRB 5HY9A 2GJZB 5SWZE 3X3FH 3ABZA 3LS5L 3A6CL 3MLUH 1L0XA 2QQNL 1IGMH 4OZIA 2HT4D 2CR3A 1YEIL 4HKBB 4UTAL 3NFPB 2W9LA 4RWYH 3BXNB 4PJ7A 2YOCA 2PO6C 4TTDD 1G6RB 3NZ8B 5DVNA 1ZSDB 5D2NA 2IJ0C 3FKUS 5EG6C 1CDIA 1VERA 3RU8H 2EDJA 1IKNC 4IRSB 5A2LH 1MJ8L 4MNQD 1QFUL 1VADB 3HN3A 3I9GH 3O11B 1VENA 3MR9A 4YEEA 3VU2A 1K2DA 5MEOA 3FN0L 5E08L 4PJGF 5I1JH 1JZ8A 4XNMB 3PL6C 3GKWH 4HKJA 3QDMA 4OFPA 4U7KA 3U82B 1JJUA 2Q20A 3TM6A 4ONFL 5T5FH 4DVBA 5IG7A 5KVEH 2QEJA 4UT9H 3ARDB 2CMRH 1KB9K 3UYRH 5I1DB 3D1MC 1WTLA 4WFFD 1QBBA 3GO1L 3GMLA 3U6RB 4XAWH 4PJEA 3X12A 4GG6B 1DBBL 4X80H 3D6GA 4PUBH 2R1WB 3MBEB 3HNTH 2IFFH 4KJYB 5HGDB 1HQRA 4XNZB 3VRLE 3IDMA 5F9AC 3RI5K 3I84A 3LKRB 1YEHH 3ZT5A 4I48A 2DD8H 5F1IA 1HSAB 3RIAK 3RKDC 3GRWA 4ZO6A 3BKML 4JFHD 1KN4L 1E4XH 3DGGA 2E3VA 4TNVK 2FGZA 3BZ4B 3BI9X 4F15C 4Z7UA 3FO1B 2QHRH 2WBJC 2B4CH 4NQCD 2X4QA 3QXAB 1F4YL 5EN2A 3SGJA 4ELKA 3BJ91 3AS3A 4ALAL 5EA0L 1Z6JT 1EGJH 3CXHK 5CEZL 3SQOH 2FX9L 1AXTL 2A73A 2VZSA 3A0OA 2YPVL 3QG6A 1YEJH 2JLLA 4NZUL 4W4OA 4FXGA 4JFOA 4X9GA 3SDDC 3EOBA 3TNNA 1QA9A 1S7RB 5C07B 3C60C 3BD3A 3SE3C 3JTSA 4R0LA 4JN2B 3HC4H 5DMGC 5DHXB 5AZ2L 3UTSD 5CSZB 5BZDA 3WUWB 1OTUC 1UB6A 1ZGLA 2VLKE 4CJ0A 1KTRL 3U2SB 2ICEB 4IRJA 5GRUH 3LQMA 2DM4A 3OX8A 1N26A 1DBKL 1B2WH 4U6VH 4TRPH 4E41A 5EBLB 5C08A 5L0QC 1DP0A 4JFYB 1G7JB 4M5YH 1P9MC 4WFHD 1A6TA 3FONB 4ZUSB 1LP9F 4GG8A 4V1DE 5J1SC 5ID0B 2ENSA 4F80A 1JPFA 2OJZH 2H3NB 2A6JA 3FQXA 3AM8C 3KNBA 2AJVL 1Q0XH 3VGEA 3VDAA 4NQDB 2V5TA 3TT1L 5C70A 1CFNB 2VLLB 4QTIH 3O8XD 3MYZA 1C12B 4U0RC 2OR9L 1OOAA 4JZNA 2ATKA 3REVA 5I17B 2AEPL 4HIEB 3QUXB 1V3LA 4X6FB 3NIFE 3HZKA 3PHSA 1T6VN 2X70B 1TVDA 3NA9H 5DUBA 3CX2A 3W9EB 1CLYH 1IAOA 3UEZA 1NAMB 3VFPB 3O6LL 3RUGE 3SCMB 3GSWA 1CTOA 4WWID 2UZIL 3KPSA 2PW1B 5FIEA 2ZCLL 1AGDA 3UBXB 1EFXD 4KHXH 4WV1B 3GRWL 2F54B 3WJJA 4XMPL 1TZHB 1D9KC 4G42B 5CAYB 3SKOA 1BQLL 1P6FA 3TT3H 5C0BB 4HWEH 2Y1VA 4D9LH 3F62A 5L7XH 1V7ML 1A64A 1V7NL 1S7QA 1I3RA 3BH8A 1HIMH 3F7YA 5K93A 4ZO9A 1NBYA 2WUCL 4AH2A 1YJDL 3BZFA 1T0PB 3PDDA 5D1ZD 3OG6B 2YC1A 3KYOA 3QFJD 1ZA3B 3TF7C 5ACMA 4HD9A 2DF3A 3RVTC 4LHJB 3BPOC 1FG2B 2H2PD 2HRLA 2P8PA 3RFZC 3RWEB 2R2CA 4PJ8B 5IV2A 4FQXA 1MFBH 4P5TD 1FZOA 3QI9D 4F9PA 1TLKA 3WHE0 4YGVA 1QQDB 3JBG7 2P44B 3G5XA 4OD3H 4GKNB 1EHLH 3QJHB 5GSRA 5JHDA 3OF6D 3JVGC 3MLSH 2ZKHH 4Z7WA 2JJTC 2PO6B 1HHIB 4ODXA 2O61A 3DURB 4ZODA 4PY8I 4DKFH 3BO8A 3U30B 1KNOB 2EH8H 3OZ9H 1CTNA 4MXWL 2ZOLB 2E7MA 1IGTB 5SWZB 2X4UA 5A43C 3O3UN 4CNIA 1A6VH 1BBDL 2UV3A 2VLMD 2I27N 3WFEH 4TSAH 4FFWD 1FNEB 3WHXA 3UZQA 1CLZL 4P3CH 1BD2D 2NTFA 4FQQA 2OQJA 1CDHA 1T1WA 4OCYH 3ZYZA 4KKCC 5DVLA 2IAMC 3SE9L 1G7HA 2Y36L 1IJ9A 4YDKH 2WINB 4GLRH 5EOQH 4A2MA 4ENED 2FO4B 3D2UA 2FNBA 1WISA 1Z9LA 1MI5E 4PBVC 1S7SA 3KPNB 4HIHA 5EBWB 3U48A 1RHFA 1MY7A 5HVHB 4I3GA 2PXYA 1X5ZA 4NJAH 4WI9A 4NWUH 5IUSA 5GS2H 1EAPA 1RZIB 1JZ7A 5I30H 3C9NA 1PYWA 4LPCA 4L29B 3QDGE 2I9LB 1WAAA 3DX8B 4AQ1B 1G9NC 1YEEL 3MRJB 5GXBB 2XN9A 4LCWE 3WUZA 5I2IA 1XAUA 2NY1C 1J9CT 2HMIC 3MGOA 25C8H 4NHCH 2BERA 3TBSA 2NY3C 4OGXL 3FQRA 4HEME 4QNPF 5FKPB 4F15B 3D39E 5JORB 3ALXA 1NCWH 3SE8H 3QUMB 5AEAA 2WBJB 4JFFA 2XZZA 1ZLSL 2NCMA 2PYFB 1PSKL 3UJIH 3CLFL 3MJGX 3KXFE 4R8WL 5FYKE 3ILPB 4L9LA 1DBMH 3GHBL 2IADA 1KCVL 4PRAA 4Y2DA 4LRNL 2NX5D 3D69B 2VSDA 2WBKA 2H45A 3ETBF 5EIVA 4IMKC 4HT1L 4DN3L 4QHUB 1WEJL 3NPSC 3DYMA 4O5LL 3SDDB 4YQXH 3EGSA 3L3JB 4JN1H 3L9RA 4Z0BL 1NQBA 4BKLB 3C60B 1QYGH 2X40A 4P46D 4WENB 2VN4A 1RU9H 5F88B 4F33A 4AMKL 3HNSL 1LO3L 4YDVB 2XWBB 5GGTA 4X5XB 2BSSB 1AXSA 5HTSA 4HUUB 3VW3L 3LHPH 4ZOAA 1R6VA 3BJLA 3TBWA 2YSSA 4D8PB 2IQ9H 1K6QH 2AXJA 3ZDYE 3HUJA 4HEPG 4DN4H 1OP5K 1U8JA 2P43B 2YZ8A 4QGTA 3U9PL 3UX9B 1NGXB 2CUMA 3VXNB 4NQXA 2YMXL 1EH9A 3FN3A 3QWOA 4LMQE 1RUMH 3U79A 1EMTL 5GGVL 3TVMC 5F7LB 2VLKB 2BNRA 5DJCB 2NY5H 1JZ4A 1Y6MR 3BN3B 4U0RB 1LD9A 2O93L 3CH1A 4L4TE 2GJ6D 4U49A 3SKUD 3MOBH 4G43A 2BY0A 2IPUK 4OBSA 1CGUA 4DQOH 4ZAKB 2APFA 3LSOA 4MA3B 4P2OC 4B0MM 3UYOD 1DDHA 5DURB 2DWEA 2ESVA 3E2HC 4V1DB 5H2BB 4ZSOB 3FQTB 4EQ3A 3HHRB 4O2FB 4LLQB 1CK0H 1R5IA 3HR5A 3GSNA 5IBTH 4MWFB 3EHBD 5CLTA 3O41A 5E2JA 2FZ3A 3M8OH 5EFIA 3CFEA 2XNAB 4X9HA 1SM3H 2FCBA 4JQIH 2D4FA 3BOVA 4HXAL 1GHFH 5IEHB 3QIBC 5CGMA 4Y1AD 4TSCH 2R1XB 2HJFB 5EOTB 1QFHA 2HT2C 1QKZH 4P2RA 2X4RA 3I3DA 2XQYG 4UNTA 5T3ZE 4OF0A 1RQ5A 1N4XH 1WVZA 2NZIA 3RDTC 3RUGB 5CP7B 5C0NC 1OAUL 4Q2ZB 1AGCB 4AG4H 5D93C 5KVMC 5HYSG 3RPKA 2ARJQ 4S1DD 7FABL 1J0JA 4F7PB 4HX1A 2IH1A 3AVEA 1I7RB 5LGHL 3BPOB 43C9B 5H94B 4MMZC 4M48H 1MJUH 2AJYH 2FDBP 4BQ6A 3EFFA 3GSVB 4KK5C 4H20L 4UOJA 4LVEA 5TDOB 1AO7D 4WU5B 1IFHH 2O5YL 4MXQC 5C0FA 1OW0A 3U4BH 2MPAL 1JNHB 3F58L 5GGTL 3V6OA 1KJVA 5KS9A 2EDRA 1OLLA 4BZ1H 4RMSA 2DRUA 2QBWA 5F3HB 4YHYC 2ICCA 2P48B 1NKRA 1UB5B 2BVEA 3IJHB 2HKFL 3QEQB 3ARYA 3IF1A 1J10A 3OXSB 3VMOA 3H9HB 1OAKL 2MCPL 2J4WH 4U1KB 3EAKA 1T2JA 4X6CB 1XF2B 1YN7B 2ZOKB 2X4PB 4PV8A 5J1TC 1RJLA 3MRGB 2BFVL 1UJ3C 3WEXB 5E6IC 2GI7A 5E8PB 4JFDB 2VDQL 1IGYB 4OLEA 1KB5B 5E00B 3B8YA 3BE1H 3VD5A 1DLFL 1QHPA 2Z93B 5ENWB 4P9MH 1ZLUK 4ZFOB 2K1MA 3LN4B 2E8YA 5D5MF 2MQ3A 2K7QA 4I0PC 1S7WA 4LCCA 3PWPD 4L8SA 4LSSL 5J6HA 1AGEB 1T4KB 3GSNL 4ZXBD 5IR1B 4OZHA 2DB8A 1U8NB 3SY0B 1YNLL 3HAEA 4YDIL 5C7XH 3ROOA 3GGWA 4FOMA 5BRZB 1QFWH 2HRPL 1L6ZA 3HC3L 4R4NC 2ICES 3EO9H 3BP5A 3KPMA 1QPXA 3FQUB 4QCIA 5IGXL 3L6FA 4PTUB 1Q1JH 2ADFH 1QSEB 5KSBF 2J5LB 5EPMA 2OZ4A 1HQ4A 5BVPH 5LXGL 1MI5B 5JTWA 3CFIC 1SYVA 4GRLB 4PJHE 3PXJA 1EVUA 4Q74A 2OTWA 5EU3B 3U7WH 1A3RH 1IT9H 4XVJL 1EUTA 1KC5H 3ARED 1RMFH 3C6LC 2HN7B 3QDGB 4O51B 1PG7W 1QR4A 3FOLB 1D7FA 3IU3B 4LCWB 4U3CA 4PB0H 1I1AA 5TQ0H 5HI4D 3OKMA 3U0WL 2X2YA 1L9MA 2CKBB 1WBXB 5FF6A 5ICYB 4KROD 1H3GA 4R7DA 1B6DA 3D39B 3NPSB 1ZT7A 4OV5B 4OFYA 5FV2A 3LMJL 3L5HA 4H0HB 1ORQA 1REIA 1JFQL 1MREH 3PHOA 5DMIH 2IANE 4L5FL 5CMAB 1GRWA 1OARL 4I2XA 4JFQA 3KXFB 1UZ8B 5LG1A 2R0LL 3E6FB 1JWSB 3T0DA 4XVSL 5IVXF 4BQ9A 2X4NB 5KTEL 2PYED 3BIKB 5I1EL 1YMHA 1MFCH 5KSAD 3QQ3B 5C0GB 3H3PH 2W0FA 1IGIL 1MAMH 4S1RL 4JKPL 4FTVE 2V17H 4N0RA 1MVUA 5T1DL 2DQHH 5LGJA 1K4DA 1IM3B 2H8PA 2UZXB 3DX7A 1RUQL 3MUHL 4KTEH 1IC7L 4RIRB 5I8EB 3I6LD 5EOCL 3STLA 2R1YB 1G9MH 3TZVD 4LRIC 4FZ8H 1OP9A 3NBNA 3TVMB 1XMWA 1FO0B 1UXWB 3HAEG 3OB0H 1DEEB 1OWRM 4MLSA 5FYJL 1T0MB 1BQSA 2XTLA 2ZCHL 1HYRC 3QRGL 5EC1B 1WZ1L 2QADC 4LLYB 3BXNA 1FBIH 1SY6H 5KVDH 1G6RA 4P2OB 1TMCB 1CG9B 4XXCC 3E2HB 1WGOA 2E7CA 5JQ6H 1VADA 4X7DC 3O11A 3MLWH 4ZDHB 4POZD 3KYKL 2OZ4L 4L4TB 4Q6YA 1NCNA 1IGJA 1RZFH 1Y6NR 4XNMA 2A6KB 3QIBB 4HW6A 4WGWB 4C55A 4IBLT 4UINL 5D8JL 2V7HB 3AY4A 2YPLB 3R0MA 2AABH 1T83C 4APQD 4EXPX 3RDTB 5DDHB 1EIBA 4ZNEE 4NM4H 3U83A 5J12B 5TF1H 5I1DA 2YUXA 3ZTNL 5DTFB 1NCDH 3L5WA 3SBWA 3DOSA 3U6RA 3FB7B 2UYLB 1ADQA 1ETZB 1CE1H 1BVKB 3MBEA 3TV3H 3QRFM 4KKBC 5HGDA 3S5LA 4HV8A 3LKRA 3LKNA 5E4EC 1CE6B 5DR5H 1HSAA 5GQBA 3TIDB 1E6JL 1ITCA 1VB9A 3P2TA 3KWWA 4XCFH 4OFIA 1M6OB 3FO1A 4HH9B 4NZRH 1OGAE 2YK1L 3MQIA 3GB7B 3Q6GH 3QXAA 4XH2B 1JF1B 1KTKE 1EO5A 5D7LE 2QQLL 2VZTA 4PRID 2I5YL 2DQTH 1I7UB 3VFNA 2C1OA 4MQXD 4DW2L 2YXFA 4TOYH 4P3DB 2DKUA 1F3DH 5JR1L 4BK4A 3HI1B 3EW3B 1UM4H 1UJ3B 4RISL 5E6IB 4KRLB 3K80A 1S7RA 3HNVH 4O58H 1CZ8H 3FN9A 4YHLL 4NQSB 3P0VH 4JN2A 1Z9SA 5LWYL 1MSPA 5CSZA 4OM1L 1PVHA 3WUWA 1A1OB 3DX9B 4WFGD 2WM0A 1G6RL 1T3FB 5IKCB 2XT1B 4POYA 4LLDB 3MRHB 4OZFH 2EICA 2ICEA 4I0PB 4GW1B 3NCYP 5EOCJ 5EBLA 4K9EL 4ODSL 4JFYA 1G7JA 4ZMAT 1A7NL 5FB8B 3FONA 3N0PB 4N1EA 5ID0A 3SE4A 2DLFL 1NJ9B 4Y4HB 2J12B 1JGUH 2P1YA 4S0SD 4L4VA 3VG0H 4JVWA 1BJ1H 4UDUB 1CFNA 5MEQB 3S5LG 3X13B 2P8MB 1X5AA 5I17A 4NO5B 4HIEA 3QUXA 4FG6C 2R0KH 3TC9A 1FFQA 3C6LB 4JGMA 5EZLB 5J89A 1KENL 4XP4L 3SKJL 2F58H 3PWNB 1ADQL 3P73B 5DA0B 1ES0B 4GOSA 4WFED 3TO4B 1NEZB 4IS6B 1N64L 4PJHB 3VFTB 3JWOC 2UY6A 2PW1A 3UBXA 1P4IH 4WV1A 3EZ8A 5BV7H 2GYSA 4JDTL 1TZHA 3PDOB 1T2QL 4G42A 4OJFH 1IAKB 3CFBB 4HF5H 1KB9J 4F8TA 1F4XH 1X6LA 2R56L 5C0BA 1FIGL 1CIUA 2GFBB 4LL9A 4NC1E 3WIHH 5FFLA 2IALB 5J11C 1FVEB 3GHEL 4JPVL 4EIGB 1RAMA 3HG1E 4JR9L 2YEZB 1NGZB 3HE6D 5TE4H 4PLKD 2AKRA 1JPTL 3R06B 1UT9A 1ZA3A 3WUWG 2X4TB 4PP1C 4PD4K 3MXWH 1FG2A 3I2CH 1P7HL 3RWEA 4QHNB 1GC1H 4PJ8A 4Q9BA 3VCLB 2DLGA 3MLUL 1JZ2A 4NC1C 2E6QA 1RJCA 4Y88A 2E8ZA 4TVPH 4FP8L 2PTUA 1MCFA 4XGZB 4OZGB 4Q9QL 3U1SL 1L4IA 1EO7A 1QQDA 2GITB 3B9AA 5CD3B 3OKOB 4RA0C 4QRRE 3AXLB 1XGYH 3QJHA 4ACPA 3O3DB 1IQDA 3CXHJ 1W0WB 5BJTB 1ORSA 4WTXA 1E4KA 2PO6A 1HHIA 2VDPH 3FFDB 3DURA 5JZ7C 4LLWB 1KNOA 1MFDH 3T77B 1FZJB 3H7BA 1IGTA 5SWZA 5CUSL 3OKLB 1FZKB 3D18B 5I1JL 5LQBL 1R3IL 2E9WA 4UUJB 4JG1L 1FNEA 1U9KA 1EK3A 4G7YH 4LAJH 3REWA 1MAJA 1LP9E 3WD5H 1NSNH 1V5JA 4JY4B 5KW9L 3AUVA 3UBXG 4YHKL 1YZZA 2VISB 2FO4A 1NBVH 2HYMA 5HYJE 1IAIM 5GJTL 5IVZA 5EBWA 3MLRH 1A9BA 1UH2A 3OWEA 3MLXL 1GL4B 3GI9L 4RAVA 1RZIA 1YEHL 3DSFH 3OR6B 3MZTA 4OQ1A 5GRVL 1IEAB 1IKFH 4G6ML 4L29A 2I9LA 2WIMA 3DX8A 2AJXH 4PGJA 2GAZA 3MRJA 3QIUC 4MAUH 1J18A 5E4EB 4KKLC 2BXYA 1S78C 4KUCD 1O7SA 4JO2L 3BPNC 4FA8A 3EJJX 4NFDA 4U31A 1DLHA 2FBOJ 1A7BA 2BJMH 3TN0D 4PJFE 3CJJA 4N5EC 5ALCH 2VAAB 5FKPA 3K8LA 5JORA 1N6QH 2WBJA 3WNMA 5CEZD 4PJDA 4Y19E 3SQBA 4NRXB 3MBXL 2PYFA 4QRTB 1NUFA 1YEDB 3QIWC 2RBLA 5I1IH 4F7TB 5EZJB 2O26U 4K3JL 3D69A 5TQ2H 1FNSH 2MHAB 2WANA 4XMLH 5I8OL 2EYSA 1M7DB 2XICA 2BC4B 4QHUA 3SDDA 4LLAA 4PRPE 2DLTA 3L3JA 2R8SL 2IGFL 2LE9A 4BKLA 1D5BB 1N3NB 1OGAB 1LO2L 1NLBL 4JDVB 3SE3A 5CJOL 3LRSB 4QRSB 4OQTA 5D7LB 3AGVA 3WS6C 5F88A 3VG9C 4G9FE 4FMFA 5EU6E 4YDVA 1U92A 1WBYB 2VQTA 3F6LA 4X5XA 2BSSA 4HUUA 2JELL 5E2TL 3VWJC 3ZKSD 4D8PA 1SJHB 3OKNB 4M6NL 3BESR 1DVFC 4JO1L 1BLNB 4GAGL 3TFKC 4MDJB 4ORZC 1P9MA 4ZS6D 1NGXA 1AQDA 3VXNA 4L3EE 3VFGH 4LQ1A 4ONHB 4D9RD 3WFBH 5IIEA 1EZVY 5IJVB 4XI5D 2VLKA 5DJCA 4KUCF 4ZG1A 3I50L 4NT6A 4H26B 3MUY1 5CZXD 1NMAH 3L1OL 2G60H 3S34H 5GS0H 1RPQA 4JGJA 3UAJD 3O2VH 3OHXA 4G6AC 4ZAKA 5GIRB 3W2DH 3O6MH 3PWVA 1G7IB 2P5WD 4UV4H 3HRPA 4OKDA 5H2BA 4M02A 1S9XB 4U1HA 4ZSOA 4KHXL 4O2FA 4LLQA 5T1KD 5CIPB 4Y8AA 4MWFA 2EE9A 2V5SA 4OUOA 1DQJB 4L3CB 2XNAA 4HWEL 1E4WH 1JPSL 1C5DB 2ADGB 5L7XL 4OZIF 1GGIH 1MFNA 5IEHA 3VJ6A 2R1XA 1H15B 2HJFA 3QCTH 4PJ7F 5EOTA 3FHQA 5B39G 3QUML 1GSMA 3WKML 4I5BB 3RUGA 5J11B 5CP7A 2QSQA 3RY6A 4G8GE 4WCYL 1G0DA 1NC2A 1AGCA 5C0AE 4UQ3B 4YXLL 2JE8A 2FLRT 3WLBB 4Z8FL 3S3SA 3O9WD 4LCYB 1OSPH 4CMHB 3NCBB 1I7RA 5I74B 5DK3A 4DEPC 2GEEA 1GGCL 2NZ9C 43C9A 5H94A 1R24B 3CK0H 4Q9CA 4FS0A 1H0DB 3L3GB 3BRFA 3M07A 4BK5A 2DQCL 4OQTL 5TDOA 5GZOD 4WU5A 4F7CA 1AKJB 3HG1B 1JNHA 3CVHH 1Z0MA 3D3VA 4KFZC 4AT6A 4KZEH 3DXAD 3BDYL 1UB5A 2R0ZL 3IJHA 2CJUL 3WBDA 1CGXA 3QEQA 4JFZL 4E41D 5C08D 1FLTX 3JVGA 4C54A 4PJEF 4MX7B 3EJYC 4LAQL 2XRAH 5T3XH 3OXSA 3WFEL 3H9HA 4TSAL 5MERB 4ZOEA 4UZGA 4X6CA 1XF2A 2ZOKA 2HH0H 4TUKL 3VGDA 4QRRB 3MMEA 3WXWH 3WEXA 4RFEB 1XR9B 3RP1A 2MKLC 2ZJSH 4Z7UF 4JFDA 2NLJB 2QSCL 4NNXA 3R1GH 1IGYA 5F7EL 5E00A 4GAJL 3G6AB 1I9JH 4LIQH 2XXMB 2BVPA 2G5BA 3RRQA 5M7QA 2Z93A 5FGSA 3WFCH 1ZGLM 5ENWA 4ENEC 1YA5A 4AM0B 3GK8L 1W72B 1CL7L 3G6DL 4DKAA 1DQLL 3LN4A 1Z5LB 2A77H 3T2PA 2EYTB 3MLZL 4R2GD 2WLYA 1JMZA 1MCOL 4MB5A 5C86A 2AEQL 3CFDB 1HHGB 4Z76A 5IR1A 1U8NA 5K33A 3SY0A 1JHTA 3H6JA 5BRZA 4HDIA 2AI0H 4HJ0C 3T8XB 4L8DB 4NQED 2DYPB 1D5ZB 3N9GL 1QSEA 3QIUB 4UTBH 3JWDC 1NCWL 1MI5A 1EERB 4NDMA 4GRLA 2Q8AL 1D6EB 3X11B 1YNKL 5EU3A 5JMRA 5ETUB 4YDLC 4JM2A 3B8SA 5GGVY 1G9EA 4RGOH 5B8CC 2D31B 2OL3B 1J8HB 2QKIB 2HN7A 2WBWB 4KUZH 5CSGA 1YY8B 4O51A 3IU3A 4JPIB 3FOLA 4OCNC 2LAGB 4YQXL 3V0AC 3S88L 3QIWB 4LLUB 5EO9B 3GBML 2CKBA 1WBXA 1AR2A 5ICYA 4WW1B 1ZHBB 4IMKA 4PJFB 4MQTB 4OF5A 4OV5A 4PP2A 3EO1B 1T1XB 1T5WB 1S7XB 2ILLA 2OI9C 3QT2A 3VXMA 1FFRA 5CMAA 3VG9B 3KXFA 1UZ8A 1KCUL 3E6FA 4FQLL 3ARXA 2X4NA 2VDKL 4I3SL 3BIKA 5DD1H 1BEYH 1OQXA 2O5XL 5DC4B 1CF8H 4X83A 3VWJB 1A3LH 4PRPB 3ARGC 3CLEL 1PX4A 2YD2A 5HPMB 5HI3C 1J1OL 2PTVA 1YEFH 1W0VB 1YEKL 1JRHL 1RZGB 4RIRA 5GRJH 3RIFK 5I8EA 4G9FB 2R1YA 3IVKB 2EKSB 3UO1H 2V9RA 2BSTB 4MSWB 3FTGB 3TVMA 1KB5L 1UXWA 1T0MA 2DDQL 5FM5M 3OMZA 2PXYD 3MODL 1A0QL 4ZFOL 3EYUL 3LKOB 5EC1A 4LLYA 2F74B 4L3EB 1CG9A 1NCAH 5IOPB 3IXTB 3MROB 3RGVC 1UVQB 2AGJL 1IRAY 4UIKL 4Y4KA 3P4NA 4ZDHA 2VNCA 4TUJB 5JPMB 2R4SH 3ILQC 4L4TA 2R23B 2RIKA 3LH2L 4MHHG 3QIBA 3CCHB 2IPKB 4Z7WF 2V7HA 1VEMA 1RULH 2EDKA 2YPLA 3UTPD 2W9EH 3VXSE 5F1NA 2J8HA 5DDHA 3FO0H 4CU6A 1SJEB 4XCYB 1TNNA 1BM3H 2WUBL 3HI5H 2VXUL 1TJHL 4O9HL 2CKBL 5HD8C 1OSZB 3FQWB 2AXHA 4YJZL 2UYLA 4OLYL 3GSXA 3MRPB 1CXKA 3V4UL 3BP4B 3AROA 5IMLA 2KBGA 1F8TH 1BVKA 1MWAH 5DUML 2NY4C 3T1FB 4XPBL 4KDTA 4PJ9B 2DQJL 4G8GB 4N8CL 2NQCA 3TIDA 5C0AB 4XPTH 4WDIB 5FYKL 1RY7B 2CIKA 1JTPA 5C0EB 4RA3A 2WSKA 3MPCA 1M6OA 1PQZB 5DJZA 4HH9A 2VDMH 4CVZB 3OAUL 3Q6FB 4ZFGL 4N68A 1ULVA 4G6FB 4WW2C 3GB7A 5DGRA 3QG7H 1JF1A 1QHOA 1RURH 3VXQB 4CDHA 1KJ2H 1WAAF 3VE0B 3QP3A 1I7UA 3ZE0F 4X6BA 1N5YL 1JYVA 1Z3GH 2BNRD 4KY1H 1LQSR 1E4JA 5FM4A 1RVFL 3HI1A 5IHUL 1UJ3A 1FO0L 5E6IA 1DQDH 2Z35B 1J0HA 1GGYA 5F9JB 5J57B 1IAII 4IMLB 4PRBB 4D9QD 4NQSA 4KC3B 3LQZA 5BOZG 2QQKH 2ZUWA 3NTCH 3B9VA 2ZWLT 1A1OA 5ECJE 3DX9A 4FFZH 4OLWH 3ZYOA 4KQ3L 5IKCA 1D3CA 3A67L 4LLDA 4DZBB 3MRHA 1BBJB 3FRPA 1QFWL 4I0PA 2NXYC 4BZ2H 1OM3L 2IH3B 3K74B 1X44A 3IRPX 5A3ID 4NFBA 1JGLH 4LOUD 4NP4H 4LVNC 5D1QD 4AK1A 4UBDD 2BOBA 5TPWH 3ZL4H 3RL2B 4UT7H 5HGBB 1NJ9A 3E0GA 2DIBA 4P9HL 4Y4HA 4NM8L 4Q0XH 2HFGL 4OFDA 3SDCD 2VLJD 4UDUA 5MEQA 3BPCB 5GISL 3PJSA 1KUMA 4NOBA 3BT2H 1D5IL 4QHKJ 3X13A 4YDLB 2QQQA 3FZUC 3QUYC 1NMBH 4HS8L 4JPKL 5IK3B 5B8CB 3HUJF 3V0VB 5DEFA 4WJ5B 3FFCE 1YUHB 2UVFA 1FN4B 5JW4R 1SMAA 5EDXA 4NQUA 3ALPA 3VWKD 6CGTA 5IJKC 2EC9T 3PWNA 1WZKA 1ES0A 4YXKH 3TO4A 1NEZA 1B88A 1MAKA 3L5XL 4IS6A 4YK4B 5T3ZL 3VFTA 5DEGB 2FX8H 5IFJB 3ZDZE 4JFXB 2BY1A 4ELME 4QOKD 3IS1X 5D70L 4NO0D 3BISA 1HWGB 3GKZA 3QCUL 1IAKA 3CFBA 2V6HA 2VE6B 3RZCC 1JHKL 3GZKA 5EH1A 3HI6L 4ODTL 3BZDA 5HHOD 2GFBA 4HMCA 4QRPE 5L8LB 2AXGB 1K3ZA 1J12A 4M62L 3B83A 1MQKL 4RDQF 4WRLA 5EU4B 2YEZA 1ONQB 1NGZA 5GS1A 1AGBB 1P2CB 4OB5H 5F9OH 4YWGH 3R06A 4GKZB 4WWKB 3ARVA 5IEKA 4TSBL 4J4PC 2X4TA 1QRNE 1PX3A 4BSWB 4H25A 2FX7L 3O4LE 2GTZB 2EDWA 3FRPG 3HFMH 1HSBB 3VCLA 2DJSA 1MVFA 4LRIA 3DRTB 2F8VA 5FYJD 3ZHDA 3RVXD 4XGZA 4OZGA 3O3EB 1A7PL 2EC8A 3B3IB 1G9NH 3D85B 5CD3A 6FABH 5IFAL 1FPTL 4OKVB 4OZFA 3AXLA 4XVTH 1OB1B 5FO9B 1HINL 1W0WA 3HPLB 2J8UE 3FO2A 3FFDA 4TVPD 3QFDB 5DZOA 3B9DA 4LLWA 3ARFC 3C2AH 4XXCA 3T77A 1Q9OB 1FZJA 2GK0A 3RGVB 4X8XA 4J6RH 3D18A 3Q5TA 4UUJA 5IB2B 3T2QA 1I9IH 2DJ4A 5SX4H 4CW1B 1FH5L 1JTOA 1WZMA 5C0DB 4I0KA 4GT7A 3BPLC 1DL7H 2DI7A 4ZTOH 4QTHB 1IEBB 1AFVH 4JY4A 3T3ME 2LAAA 2VISA 1A2YB 1A6WL 5EBMA 4OF8A 2E7LA 1NCBH 3HZMA 1MRCH 4Z78A 3PV7A 4GXVH 4PJBE 4LHUB 2JIXB 4NCDA 4H88L 4XC3H 1NGPH 3VXRD 1LO0H 4YFDB 3BQUC 3IFPB 1FHGA 4YBQC 1MHCB 2VWEE 4CU7A 2W9DL 5D71H 3OR6A 1IGFH 1PGRB 1IEAA 1U3HD 3CAFA 2BNQE 4PLJC 5FHBH 3VXSB 1DQTA 3KVQA 2NY4B 2AV7B 4XCFL 2DOCA 4L4JA 4UIMB 1FL6B 4G6KH 3T0WA 3WIHA 4GS7C 4P2YA 3T0ED 4HUMB 3IDGB 1YPZF 5AYUH 3U7YH 3UZEA 2VAAA 3W0WE 5T1MB 2BZDA 3WMSA 2VWEC 1MH5B 4EUPB 2KH2B 2E7HA 4HMEA 4WW2B 3RNQB 2M2DA 4P4KD 5I8KL 4NRXA 5INDB 3PGDA 5DK0B 4OZFG 3KPRD 2OS7A 4NN5C 3SJVD 2DKMA 3SDAA 4RGNE 5EZJA 3THMH 4F7TA 5DHVB 2XPGB 2MHAA 1M7DA 2RR3A 3QEHB 2BC4A 4K94L 4JFPB 3NCMA 3ESUF 3K4AA 3AU1A 2DQGH 1D5BA 1N3NA 2CRMA 2EZ0D 2VXTH 3A6BL 4JDVA 3CSYB 3BSZH 3LRSA 4QRSA 5DA4A 1BWMA 3BX7C 4K23H 2MFNA 1P69B 1SEQH 2IFGA 1WBYA 4IRSD 4RGNC 2D03L 2YR3A 4PD4J 1C5BL 5FHAH 2E27L 5AG9A 2NXYB 3QJFA 1SJHA 3OKNA 5T1LA 5SV3A 1BLNA 3RI5F 3K81A 3VG0L 3RIAF 4LVNB 1IBGH 5HHVH 4M7KL 4ONHA 4HIXH 4TNVF 4KMTH 1ZANL 3VFMB 2XA8H 4NN7C 4N8VA 4XMKH 4AL8H 2FB4H 3ARDD 3KLSA 5F96H 4IIQC 4H26A 3WIIH 5JLZA 2V7NB 4G80B 1MCCA 5CEYB 3QUYB 5GIRA 2WP3T 4MJ5B 4R6UA 3V5KB 2X9WA 1Q9LA 5KOMC 4KVNL 2C3VA 1S9XA 4IOFD 1CXLA 2DI9A 1YMMB 2G9HA 3MJ9A 5CIPA 4B53A 4HXBH 4OFKA 1UJTA 4YPGB 3RJQB 1A4KB 1DQJA 1YECH 2HT3D 4L3CA 3X3GH 4ZTPL 1K8IB 1C5DA 2ADGA 3KS0J 3EZJB 3FFCB 5C3TA 5TH2B 1AGFB 2Y6SD 4BFEA 3BGFC 3RZCB 5ANME 1SEBA 4HBQA 1JNLL 1SBBA 5TE4L 3DVNB 4I5BA 3BUTA 5DJAA 3ZDXF 1WCQA 5AG8A 3ALWA 3MXWL 3QCVL 3O6FC 4ELMB 1XIWC 2F19H 5IW3A 3GMNB 3BP6A 3VH8B 5TE7L 4LCYA 3HB3C 4AY0A 5C07D 5D96C 4PGEB 2DI8A 5I16B 1WFOA 3MA9H 3B6SB 5I1HH 4JCMA 3KPQA 1R24A 1MJ7L 1CGSL 4QRPB 3B2VL 4RZCB 1UZ6E 1H0DA 3L3GA 5DSCB 1J0IA 3CXDH 5DMKB 3ZE2F 4DKEL 3L3IB 4J3TA 1MCBA 1AKJA 2FYYB 4KH2A 2VDPL 15C8H 4X7SL 4L8CB 1HH9B 4UILL 2K9UA 5IHBA 3RWJB 5L9DL 2X4SB 4XCCL 4N8VG 4PY8J 1CICA 3O4LB 5AZEL 2B2XH 4MX7A 1EXUA 4YXHH 4GG6F 4TQEH 3V6BR 4K8RC 1QEWB 3ARFB 4EDXA 5MERA 3MV11 1IM9A 3MX0A 5HDLA 4BELD 1N6UA 2H2SD 4G7YL 2OMNA 4NQDD 5B3JF 2EDDA 4KJWC 5I6XC 4KTDH 4RFEA 4ORGA 1FYTE 1U3ZA 3N50A 5T3XD 4HWBH 1CU4L 4YHZH 3LEYH 3G6AA 1TXKA 4PG2C 3BPLB 5SWSB 1KLGB 2C4FT 4KKAC 5HGHB 1NKOA 2YA0A 4AM0A 3IAQA 4JZJC 3RY5A 1EO8L 3D9AH 4QY8B 1Z5LA 4OZ4A 3PP4L 3SCMD 1MIEH 1XGQA 2EYTA 3V4VH 4OM0L 1DFBH 3SO5A 3QH3B 3CFDA 5F44A 3MJ9L 1RK0B 3DJ9A 2F54D 4Z5RB 4HZLB 5GGSB 5HJ3B 3JWOL 2YD3A 3OXRB 2VRAA 4QF1A 5BCAA 2ARWA 3T8XA 4QLRA 4L8DA 1G7MB 5IBUB 1D5ZA 1DCLA 1A5FH 2X1PA 4MZ3A 4PGDB 1OTTD 4PJBB 1D6EA 3W5MA 3X11A 1XCQB 5EBGA 5ETUA 1AR1C 4F9LC 1FCGA 2R2EB 1WCBB 2D31A 2PR4H 3QDAA 3SOBH 2W0KA 1J8HA 2HKHH 2QKIA 5AD0A 5D2NE 4R4BB 2BNQB 3K46A 1R3JA 2KPNA 4PS4H 3SKNB 1YY8A 4PJ8D 4JPIA 2ZUQC 3GJFB 1S9VB 4MJ6B 1NMCC 5DJYB 1MCEA 2EIEA 2Q8BL 2JKXA 3LKSB 4NN5B 1I1YA 2HTLC 4AEHH 5EO9A 4ODUB 3SKMB 2O5ZH 1A7QL 3AFLA 1A4JB 3BD4A 4WW1A 5DQDH 1UWEH 5FUOL 1ZHBA 1UA6H 3W0WB 1EPFA 3ZKXC 4GXUN 3O0RL 12E8H 1WF5A 3CVHA 1T1XA 3EO1A 4WUKH 1T5WA 1S7XA 3IETB 5D2NC 1NUGA 5E0QA 5KVFL 2AP2A 2W59A 2PO6D 3QDME 1MCPH 4P5MB 5HYFA 1I9EA 2ITCA 4QXUH 1ZHKB 1I3GH 4RWHA 2IG2H 4Y5XB 4FQCL 5SWZD 4M1GH 4RGNB 4GAFB 2D7MA 2HVKB 1QO3B 5H8DA 5E8NB 1A1MB 4NJ9L 4PRPA 4U1NB 2PCPB 4XP9H 1S7TB 2VQUA 5HPMA 1ZE3C 2ORBL 4LFHG 3Q2CA 3GSQB 1M7XA 1RZGA 3PL6D 4G9FA 3IVKA 2EKSA 3ULVH 3BZEB 3BWAB 2BSTA 4MSWA 4KHTL 4FQ2H 3FTGA 4NN7B 3ZYJA 2B1HL 3QSKB 3S34L 5GS0L 5EO0A 3O2VL 1O7VA 4YUEL 4H8WC 4HSQA 2WW8A 1W72L 5GGRB 4PJAB 1X5HA 1ZVSB 3LEXB 2J88H 3STZB 2ZPKH 3IU4L 3BD5A 4LGPB 4LSVH 4U1JB 2F74A 1UKTA 2A1WH 3INUH 4KU1A 4L3EA 3WXVH 2XWJB 4HPOL 3K4DA 5IOPA 2E9BA 4ZOCA 3IXTA 3MROA 2FECI 3NOIA 4WTZA 3U7AA 1UVQA 3CPLB 5FO8A 5ICXB 2OXGA 3RKDD 1GPOH 2FLBT 1XH3B 3CC5B 4KRPB 4TUJA 3PP3H 5JPMA 3WFDL 3QUKB 2R23A 3NPZB 4JZOB 2EDFA 4YE4L 2W92A 4S1SH 1IGCH 4X4XB 4FQIL 2WBJD 3SGJC 3FB8B 2H9GB 3CCHA 4IDLA 4NOFA 1YNTB 1YC7A 3BGFB 1O5DT 5IFHL 4H1LH 4LKXB 3TCXA 2OL3L 2OR7A 5E99L 1K5NB 4W4OC 2VDNL 3AC0A 1SJEA 1BHGA 3O6FB 5DFVC 2P5EE 3GJFK 1H9VA 1MF2L 3SDDD 3K8KA 1RUAL 2KDGA 5GGQH 1KN2H 5JXAL 5GPRA 2J2ZA 3FQWA 3CDFA 3C60D 3PWUB 5D96B 3MRPA 3S36H 3KDMB 3QISA 5ANMB 2AW2A 1S7VB 5DMGD 3GIVA 2Z4QA 4PJ9A 1F3JB 4G8GA 4PV9A 5A2KH 4XAKE 1OTUD 4IRJC 5KBNC 4HZAA 2CK0H 4WDIA 5F72S 3BVNB 2C26A 1T5XA 5C0EA 1U8IB 5JUEH 4B7IA 1PQZA 2DWDA 1L7TL 1ZXQA 4CVZA 2Y4SA 3NABH 3ARUA 2IF7A 2ZG2A 1X5LA 5EWIH 3EFDL 4HC1H 1P7QB 3WXWL 3VE0A 2BP3A 1B4JH 3MZGB 4GXUM 2VH5L 2XZCL 2VLKD 4NBXB 3KPSE 1X4ZA 4PG9A 5CGYC 4JM4H 1LE5B 1A7RH 1IC5H 5D7JA 4ZUUB 4WTZG 5F9JA 5GHWH 4IMLA 3QHTC 4PRBA 1ZLVK 2A77L 5F7UA 5DURD 5GRWA 2OYPA 4V1DD 3UJJL 5JHLH 1RUKL 3B9KC 3M45A 5DRXB 5FYLE 4DZBA 3WJLA 1BBJA 4ESKA 2LVCA 5E2WH 2NXZC 1NUNB 3WJJC 4LEOB 4DTGH 5CEXB 2VC2H 3GBLA 3EYQC 3U46B 3S8WA 4MA7L 2D7TL 1UM5L 1D9KD 1OAQL 4EDWL 1OGTA 3RL2A 2YD7A 3MNWA 1FRGH 1KULA 2MJWA 1CD0A 4KZDL 4PFEA 5IESH 2NY0C 4S1QL 1H3VA 1CQYA 3MGTA 4C4KO 5JHDE 5IK3A 1CN4A 3QPXH 5B8CA 5JW3L 5C0RL 3V0VA 3RVTD 1YUHA 2ZP0T 3S98A 1FN4A 2DL9A 4FQXC 5D72H 3C08H 5L8KB 2DQIL 1H5BC 3DUUB 1YYML 2ZUQB 1NMCB 5DC0A 4OCWL 4FQJL 5DEGA 5C6TH 5IFJA 4JFXA 5EC2A 2UUDH 5LBSH 3ZKXB 1GIGH 4HIIB 2EO9A 4KMQA 3MC0A 4NBYB 2IPTL 4OIAA 2VE6A 3QWRA 1KPUB 3LZFH 4EBQH 1W0YT 3MCLH 4YHOH 1PLGL 3IS0X 3MSPA 3OPZL 5E24E 5I66B 3C5ZC 4LPYA 2AJUH 5JOEA 1CFSA 2AJZB 3MR9B 5EU4A 1ONQA 5J8OA 1AGBA 3MRQB 1INEL 1T89A 4IHOB 1NDGB 4WWKA 3D5OF 5MEOB 1R3KA 3TBYB 4BSWA 4HBCL 1W8OA 3VFOA 2GTZA 5LGKA 4HFWB 5F7DB 1HSBA 4K3EL 4PYGA 1WIUA 1WAAE 2DM3A 3DRTA 4PYHA 4KKCD 4K2UL 4PJGB 2IAMD 2XN9E 3ZE0E 3O3EA 5C9JB 3RUGF 2BDNH 2CRYA 2NR6C 3B3IA 3MFGB 5H35A 4ZD3L 5JOFB 3FB5B 1JTTA 1NL0L 5DVKA 3M17B 1OB1A 5FO9A 3HPLA 3VFUB 1KLFA 5FGCE 5ACLA 4JFFE 3LQAL 3QFDA 3IDMB 3CMGA 1Q9OA 2R4SL 5DD0L 3ROLA 3Q3GA 5DD6A 2JF1A 3RGVA 1NFIA 4RRPA 1SYSB 3H9SB 1MI5D 2NY1D 2HMID 1D6VL 3QBTB 3QHZH 1EHXA 2BRRH 1HOCA 5I1KL 2NY3D 4TPRH 3MLYL 4CW1A 1OVZA 3JWDL 4OIIH 5C0DA 3GM8A 1I85A 4WUUA 3V8OA 2AEWA 5E6ZA 5EN2B 4D0CB 5DD5H 4ELKB 3H9ZA 2H6PB 2QSVA 4I4WB 3QDGD 4O4YH 1IEBA 4HUVA 3PNWB 2UVEA 1RZKC 4WEBL 4LCWD 2I60H 2VLRE 3SHSA 2HP4A 1A2YA 2A73B 4Y2DC 3KYNA 3GDBA 3P40A 1NLDL 2F8OA 4BUGA 3NCJH 4LHUA 5LVEA 3IFLH 2JIXA 4R3SA 2IBGA 1CFQA 3D39D 2B0SH 4KDWA 2VL4A 3IFPA 1FLRL 1KJMA 3JTSB 2Y9RT 1TPXB 1JGVH 4DCQA 3JUYA 3VXSA 5JQHC 3W11C 3KXFD 5FYKD 4G7VL 3UDWA 4KXZH 1UB6B 4UIMA 1CBVH 1ZGLB 1N0XH 4IRJB 1I1RA 3CUPB 2P5EB 4ZUTB 3OX8B 5IBLD 5FUCE 3S35H 5T1MA 4XNQA 1AJ7H 3O4OC 1J1PH 4EUPA 1MHPH 3QHFH 5INDA 2ESVE 5DK0A 4MS8C 4JE4B 3TA3A 3RWDB 3L3DB 3BKJH 2YUWA 3DO3A 3FQXB 4X4MA 3TVMD 1M1SA 1JK8B 2XPGA 3UYPA 5FUCC 1VGEH 2Y07H 3MRLB 5LAXA 3T0XA 4D0BB 2OTPA 3REVB 1JNNH 5DD3H 4RRPG 1VESA 5HXMA 4I8DA 3U4EB 5F3BA 3CSYA 5F7KC 2AV1A 4P2OD 1F4AA 4R4FL 4P2RE 2EEAA 2M1KA 4YIQA 2L7UA 4N9GB 1IAOB 4IDJL 4ZO7A 4XP1H 3RHWK 5IMKB 3B9KB 1OLZA 5DRWB 3GSWB 4HUWB 3IXAB 3SGKA 5C71A 1BAFL 1R0AH 3KPSB 5K9QG 4LU5L 4XP6H 1AGDB 4X9BA 5CILL 1I7TB 2NXZB 4O02H 4L4TD 2YBRB 2ZG1A 4I77H 1XGPB 3QIBD 4M8QA 5ICZA 2HT2D 3VFMA 1FNLA 3ECBB 1KCRL 5MI0C 2R39A 2V5MA 3BH8B 3F7YB 4JB9H 4MNHA 3RDTD 4J3SA 3WL9B 5C0ND 3V6OE 5KS9E 5DK2A 3BZFB 3P11H 3CFCH 2BNUA 3LS4H 4ODHL 2V7NA 1RIUL 3KJ6L 4G80A 5CEYA 4DGIH 1OCWL 1E4XI 1LE9B 3NFSH 1N7MH 4MJ5A 3V5KA 3WIFA 2R0WH 5CKAA 4FQXB 5DQJB 1FZOB 1MRFL 1H5BB 5T3ZD 2AEIT 1YMMA 4KV5E 3GMRB 5BO1L 5IJKA 1NGQL 3PGCB 4KK5D 4I0CC 5F71A 1X5YA 4WIQA 1F58H 4AIOA 4E5XA 5IB5A 4YGVB 4EUPG 3V6OC 3O2DH 35C8L 5F93C 4MXQD 1A4KA 4J7RA 5CCKH 1BMGA 3QDJA 2XKUA 5CJQL 5GSRB 3ZDYF 1K8IA 3D48R 5MHSE 5JW5B 4LSQL 3MV9E 5B4MC 5TH2A 1AGFA 2O61B 1UGNA 3RZCA 1JF5A 5J4MA 2B5IB 4DUXA 1T66C 3DVNA 5FK9B 4CDGC 2X4UB 5B38G 2WV3A 4OF3A 3C5ZB 3P0GB 1KSRA 4FNLH 4M7LL 3IAGC 1ZKAA 4AENB 1TETL 3VH8A 3WHXB 2VERN 5E6ID 4OZHE 2VR5A 2LU7A 2OK0H 4P57B 4FQQB 4PGEA 2OQJB 4MA8L 5I16A 1VKXB 2M26A 4ETQB 4OLVH 1G7HB 4QRPA 1QBLH 4RZCA 1LDSA 4AEIH 4N0UE 4LCIL 3F7RA 5DMKA 2XY1A 3D2UB 3L3IA 3I6GB 1RK1B 4LCCC 5I76B 2FYYA 1X7QA 4L8SC 4I0PD 4XPFL 1M71B 4L8CA 5MENE 3GBNH 1EAPB 2HFEB 3RWJA 5GJSH 2W91A 2X4SA 1ZEAH 2R29H 3ZSTA 2AK4E 2IBZY 3ME0A 4M43H 4R4ND 3GNMH 4HCRA 1QEWA 3VI4E 5BVJB 3VD4A 3JV0A 4CGTA 4OT1H 4PJIA 1AY1H 1QNZH 4Y5VA 1CXFA 2NY7L 2XACC 3CMOL 3KR3H 1CR9L 2D2OA 1Q9WB 1UWGL 3G08B 3GMPB 3KPTA 4RX4D 1DL7L 2YD5A 3QI9B 1KEGL 1QBMH 4R90H 3HR6A 1KT2A 2P47B 2RCSH 5FGCB 3MOQA 2E7BA 1F97A 4M9PA 3HMWL 5SWSA 1KLGA 1KCSH 2MOVA 3QXUA 5E7BA 3VD9A 3C6LD 4K55A 5HGHA 1E6OH 4I2XE 5TGBB 1I1AC 1J1XL 1FGVL 3NZHL 4QY8A 5J13C 2IADB 4PRAB 1HI6A 2YKLL 4W6YB 4EI6B 2QTEA 2HG5B 4HJGB 3IDXL 1MRDH 5FM8A 1BX2A 1CXHA 2FH6A 3BW9B 5KVGH 1RK0A 1DSFL 5ERWB 5I9QC 1C5CH 4JJHA 4HZLA 5GGSA 5HJ3A 5D9SB 4EI5C 1MEXH 4Q6IB 3OXRA 1DJSA 1JPGB 4YBHA 2L4OA 5HYSB 4C59B 4N8PA 1DQMH 1G7MA 3UCRA 4A6YH 3V5HB 1RZJL 2VLRB 5E9DE 3BKYL 1AXSB 1F4WH 1VGKB 5C92A 4PGDA 2IWGA 1MIMH 4Y8DC 5T33H 1MOEA 2UWEE 4E42B 1T7WA 2YD4A 3TYGH 4ODVH 4EZMA 9CGTA 1QSFE 1WCBA 5ADPL 2F53E 3GMOB 1PFCA 1P4BL 3NGBC 1KTLA 2IAND 4NQXB 2BNQA 4XC1H 3SKNA 3MRRB 5DRZB 2YZ1A 5JDJA 3GJFA 4MJ6A 2HWZL 5DJYA 4QRQB 3LKSA 5E2UH 4OFVA 1F2XK 1BOGA 2HFFB 5EORH 3QXVA 3SKMA 4HG4K 1A4JA 1I8MB 4OLZH 3WN5B 5GRYA 3W0WA 3OGOE 4FTVD 3KLAA 3WLWC 3RKPA 4U05A 2I26N 3BEVB 3IETA 4K3DH 4JKMA 2QADD 3LSOB 4H5SB 4MZ2A 1DDHB 5C09E 2DWEB 4ERSH 5IQ7L 4P5MA 4OCXH 1Q94B 3O2WL 1U93B 1SVCP 4Y5XA 1ZHKA 4KQ4H 3P0YL 3HR5B 4WNQA 3LKQB 4HCRL 2HVKA 4K9EC 5A16B 1C08B 1CWVA 1KJ3L 2J6EH 1H3XA 1X5FA 3O41B 5E8NA 4PJHF 1A1MA 5EFIB 2E6JA 3CFEB 4GLRI 2AS5M 1F90L 1IBGL 3IKCB 1HEZA 2PCPA 5E5MB 4XBEL 4NUGL 4RMVA 1NUDA 2NX5B 2ZCKH 1EHNA 3WNPA 1S5IH 3P9LB 4P2RB 1DQQB 1ZOXA 3QXTA 5JPNB 3BZEA 4X7TA 3BWAA 3NN8A 2I9TB 4MJ2A 1F45A 4OTXH 5MI0B 4LQFH 1OTSC 3LPFA 5MEPB 1G1YA 4BFGA 5AUMA 1RZ7H 3WFHA 4LPUA 5HBBA 4NWTH 1DBAH 1SQ2N 3W39B 2BRQA 5GGRA 4PJAA 3WSQL 3LEXA 1ZVSA 3OQ3B 2P24B 3VMNA 4X4YA 5TDNB 4MLIA 5BMFH 3EJZC 3ARPA 2Z8VC 4GRWB 3V5DB 3MBEC 3TJHC 3O6KL 3C2SA 2KQNA 4KKBD 4NNPH 5C6WH 3MRIB 3CPLA 5ICXA 4HULB 4OCSL 4OZGF 1UM6H 1T03H 5KS9B 1XH3A 2X89D 1EHAA 2DQUL 3Q5OA 5DQ9A 4HS6A 1KBGH 5AYQA 4OLXH 2EEDA 1A6UH 1FDLH 2VN7A 3FB8A 4XCNB 2WK2A 2H9GA 4HK3J 2DTSA 2L0DA 1I8LC 3RVWC 4K07A 1P53A 1FVCA 4LKXA 1K5NA 1U6AL 1MPAH 3O6FA 4MB4A 5FCUL 5I1GL 3X14B 4X7FC 5CHNB 2V9TA 4XWGL 4ZNCD 3MV9B 1OGAD 2ZUSA 4YZFF 5ANMA 5D7LD 4XPHH 5C0CA 2F5AL 4MQ7A 5D7KE 2VDLH 1S7VA 3EIFA 3LEVL 5FDYA 3OAYK 4JHAH 3DTXB 1MCJA 4LSRH 3DHMA 5D2LB 1EAJA 1F3JA 4L4VE 1F00I 3UC0L 4PB9H 2JTDA 2FATL 3R0NA 1KACB 1IL1B 1CLCA 1J88A 3BDBA 5J6HB 4OZHB 1U8IA 2CGRH 3HAEB 5JXEA 4HFUL 4Z7QE 3KPMB 4QCIB 3L6FB 5KJRH 4N0UB 3SE4C 4NNYB 1HQ4B 4HLZG 2AVGA 4XVUC 2EE3A 2CK2A 3QQ4B 2X1WL 1R3HB 5MENB 3MRKB 5DJ8B 1TCMA 1LE5A 4WI5A 4DWHA 4NZDA 5E8OB 3QUXC 4ZUUA 5GS3A 2AK4B 4UB0L 1JZ3A 4FG6D 4PG2A 5C8JB 4W4NA 5C0BE 1DFBL 1I1AB 1CVRA 3V4PL 2VDOL 5DRXA 5J13B 1F2QA 3JV6B 2FD6L 5E7FA 3S9DB 1D5XB 4R7DB 4Z18A 1ZT7B 4RBPK 1MCQA 1S5HB 5DZNA 3U46A 4QHLB 4F58H 4EI5B 4FXLA 1QP1A 5DJXB 1MFAH 3OG4B 3PHOB 3DIFA 4M7ZB 1DN2A 2B4CC 5HVFB 2C3GA 3VRJB 2AK1H 1UKSA 1VEOA 4WO4C 2FH8A 1NC4A 4XPGH 3RNKA 1W8NA 4XHJC 1CGYA 1MCKA 1OAXH 2VQ1B 3DNKA 5A2FA 4OD1H 4F9LA 3HMXH 1MVUB 4KJQC 3S37H 4PRNB 4PP1D 2LVEA 3NGBB 1DN0B 3LIZH 4LHQB 4N5UA 2AJSH 1BVLA 1L9NA 5CZVL 1UWEL 5E9DB 5CD5C 3DUUA 1BIHA 4E0RA 3KJ4B 3CVIH 3FHAA 2NW2B 2X1OA 2ATPB 2UWEB 1AKJD 3HG1D 3V0WH 4XPAL 2F8XC 1CS6A 1QSFB 5IQ9B 4HIIA 3HPJB 2LQRA 4XNYL 3FO9B 2F53B 1E4KC 2YD1A 2CDGB 1KPUA 3U30C 1IAIL 1ACYH 3CZJA 4KPHL 5JZ7D 2B1AL 4MMXC 1AXIB 5I66A 3SPVB 1GOFA 4TNWK 3AREB 4K8RL 4UV7H 1HNFA 2AJZA 2JB5L 4IRZL 3MRQA 4QRRD 1AE6L 2P46B 5BXFB 1VFUA 1RJYB 1NDGA 4IHOA 3OKDB 1IGJB 2DICA 3TBYA 1JMXA 3OJ2C 5E8DH 5C09B 3MRMB 3PGFL 2KL6A 4KROB 4G5ZL 4HFWA 2K3TA 4RFNC 5F7DA 4MCZA 1NAKL 3L3OB 4MVBC 2HJKA 4PJGA 5HHME 1QFWI 3H9YA 2A9ML 5ADOL 5C9JA 3WYRA 2EXWC 2R15A 1EVTC 5HVHC 3EOTH 4NIKB 5I1CH 5JOFA 3FB5A 1A14L 1XGUA 3L5WB 2ADIB 5K9JH 3M17A 2AXFB 2VDRL 3VFUA 1SHMA 4YR6A 5BW7A 3ULUL 4PJDE 3GSUB 4F57H 4MJ4A 1GPOL 4M00A 3S5LB 4HV8B 3LKNB 1DANU 2DYPD 4NKOA 4M6MH 3QIUD 2PKDA 3HZYB 3F8UB 3PE9A 1SYSA 3H9SA 4KKLD 5HYJD 1S78D 1ZA6B 3KWWB 4B5EA 2MCG1 2ZUTA 3BIBX 4N5ED 4JY5L 4JHWH 4D0CA 4EN3C 4LSUL 1KV3A 2H6PA 3LRGA 4I4WA 2FO1A 4FZEH 3PNWA 1J5OL 2GY5A 1OPGL 3O3AA 3VFNB 4CN4A 3QIWD 2C1OB 4KI5E 1HXMB 1CQKA 3P4OB 1UACL 3SDYH 3T4AB 4F3FA 3BFOA 3RIFF 4X7CC 1ZTXH 3MLTB 3T0AA 1XF4B 3BKCH 5B3NA 4MNQA 1HZHH 4K71B 5ILTH 1H3PH 1WBZB 3OR7A 2WWMC 1I1FB 1P5VA 3NA4A 4U0QB 4Y19D 1IARB 3RAJH 1NDMB 2A9NL 1H8SA 5HGGS 4YFLI 1AI1H 4KI5C 1NBZA 3P30L 5F70A 4DAGH 3ZT6A 3NABL 3CH8A 3CZFB 3CUPA 2P5EA 4CAGA 4ZUTA 3VWJD 4WI6A 4OLUH 1N6VA 4PRPD 5FUZH 1M4KA 3PWLB 4Q9RH 3ZYIA 1DVFD 4KAQH 3UPCA 5J3HC 4QXGH 3TFKD 1Q72H 4G9FD 3TWCH 1JGEB 5EU6D 1II4E 3VXOA 1LVEA 1LO4L 4ZSOE 4LASL 3I6KB 3RWDA 1FG9C 3L3DA 4L4VB 5INCA 5F7WC 2FJGB 1JK8A 1FFPA 4JO4H 1IQWH 4AIXA 1AP2A 3MRLA 1RV6X 3RWIB 4YDJA 4D0BA 3P4MB 3LKPB 1LDPL 1F4HA 5C2BL 1C16A 2BCKA 3DMMC 3RWGB 4ZAKC 1U36A 4M7JH 3U4EA 3MOAL 1YQVL 1O0VA 4H8WL 4G6AD 4L3ED 2ZSWB 3JXAA 5E2VH 1RUPH 3NCCB 4JG0H 4N9GA 4O2CB 3R8BB 3QNXA 3C8DA 5IMKA 1INQB 3B9KA 4NQCA 5DRWA 4HUWA 1A7OL 3IXAA 2ARJB 4YHML 4LEXH 1AHWA 1MLBB 1RI8A 1AQKH 3MCG1 3VFSA 3KYMB 1I7TA 4PJFF 2YBRA 1FRGL 1XGPA 4RQQA 1BGXL 5IESL 2CLRA 3Q1SL 3ARWA 3EDEA 2C7UB 4EVNB 3ECBA 1X5KA 3WCYA 1YEGL 1I8KB 3RY6C 4WO4B 4HLJA 4JANB 3KPPA 4FMKA 3A6CH 3QPXL 3WL9A 1I8IB 4N90E 3D3VE 2QQNH 5I18L 2AKRB 4E9LA 1YEIH 4FQ1L 4N0FA 5DWUL 5TF0A 2PUQT 1KEML 2VKXA 2Z31C 3QEQE 1I75A 4AEEA 4MNGA 5GSVA 1LE9A 1NCCL 2DQEL 1ZS8B 2XXCB 3DSNA 2NZ9D 3N1MC 5DQJA 4LPXA 3R4DA 1H5BA 1MJ8H 1J05B 5DJ2A 3GMRA 1GIGL 5FA3B 3PGCA 1QFUH 3DVFA 2YA1A 4X6CE 5C0AD 4WY7L 3PV6A 3LZFL 2NY2C 3QR2A 5F7NC 3MCLL 2EXYC 2Y06L 1IQDB 3FN0H 4PRDB 5E08H 2NYYC 4JFDE 5JW5A 4BA8A 1ORSB 5DJ6B 4DGYL 5DLML 5FECB 1A9EB 4Z9KB 1ZLWH 1UYWL 3EJYD 3O8XA 4ONFH 4PREA 3H7BB 2HTKC 4URTB 5FK9A 3C5ZA 2A83B 1TQBB 1YY9C 4DUWA 4KRMB 4AENA 2NY5C 3DV4B 1TZIA 4R26L 3W82A 1DBBH 4P57A 3REWB 1A21A 5BRZE 1VKXA 4RFNB 1NGYB 4ETQA 1U8OB 1TITA 1QSEE 4OCRL 3I6GA 4GQ9L 1RK1A 3BKMH 5I76A 5IVZB 1KN4H 1Q0YH 1OAZL 1A9BB 3TO2B 1M71A 3SN6N 4JEGB 3T09A 4RAVB 2HFEA 3GSOB 2VZUA 1F4YH 4LBEB 2FBJL 4CBPA 1WT5C 1Q9KA 2F5BL 1KCLA 4HJ0D 5EA0H 5GRVK 3UJTL 4ALAH 2GAZB 5BVJA 5HHMB 2QJDA 3QFJA 5CEZH 2J5LC 2FX9H 1AXTH 5FEBA 2NW3B 4NZUH 4GRLC 3U0PB 3RA7L 1DLHB 1Q9WA 3G08A 3GMPA 3BAEL 4UQ2B 3QI9A 4JM2C 5FYLL 4LDOB 3IFNL 1FE8L 3TBTB 2VJXA 3VRIB 4XP5L 4PJDB 5J0BA