4Y89A

Crystal structure of the n-terminal domain of ceacam7
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
109
structure length
109
Chain Sequence
AQTNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGIYTLHVIKENLVNEEVTRQFYVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the N-terminal dimerization domain of CEACAM7.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Carcinoembryonic antigen-related cell adhesion molecule 7
total genus 34
structure length 109
sequence length 109
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y89A01
4NQSB 1FFNB 4PJIB 3SDAD 3UBXI 3SGJC 2LU7A 2NY1B 1HK6A 1INDH 3VFPB 1W72H 3G6DH 4HIIB 4BH8A 1Q9KB 5I1EL 1SEBA 4X4MA 3B83A 1ZT7B 4YDVA 2FLBT 3CFKA 5DK2B 1PX3A 3ARFC 3ZMRA 1C08A 3W39B 1MWAB 3LHPH 5E2UH 3U0WL 1CQKA 3C5ZD 1J8HD 4FTVE 5I76A 4RA0C 5BVPL 1C8PA 4ZSOA 4KROD 5FF6B 2P5EB 4HS3B 1MFDH 3MV7B 3C6SA 5ICXB 5KAQG 4UV7L 4DW2H 5JLZB 1YY9D 2Y25A 4HULB 4DUXA 4YHPB 1I9IL 3OKLB 4PIRF 3LEXA 4JN1L 2PNDA 3MJ9A 3AM8C 5E94A 3TN0A 5BOZG 5HPOA 1WEJL 1Q9LA 1S7UA 2ZCLL 3BI9X 3SE8L 4CADB 4UU9B 1LD9B 3TNMB 5EO9B 5J1AB 1TCRA 3EFFB 2NW3B 4MJ5A 3O0RH 2HLFC 4PJEF 2XT1B 4POYA 4Z95L 5BS0B 5KVDH 2R0KL 2GT9B 5BJTA 4YX2L 2B7DT 4RGNC 1IGCH 4QWWD 4YC2C 5K9OB 3QCTL 5I1AA 1A5FL 3MPCA 1SM3L 3T0WA 5DMYA 5EFIA 3SDDD 5FO7A 1G9NL 3GNML 2LAGB 7CGTA 1BLNA 3C5JB 5E1AB 5JW3H 2ICEA 4IDLA 4ZODA 4WHYG 4TUJB 4BYHA 5EU6B 3O3EB 2R4RL 3WNKA 4Z7VE 4JHWL 1I7RA 4KJWC 4BFEA 5F7NC 1D5IL 3IAGC 5DRZB 3O4LD 3LN9A 2KZWA 4P9HH 4U3XA 5JW5A 1A0QL 3V6OE 1NMBH 4OCWL 5EO1B 3QDGA 1MJJB 4HWNA 5B3JE 4U6VL 4ZNEA 1QHPA 1BF2A 1VA9A 1ZT1A 3DYOA 3HI1A 1IKFL 4J1UB 1PQZB 4PGCA 1PVHA 4QYOA 2JCCF 4YNYA 3B9KC 4KK6C 3QJHB 4OI9A 5CGYC 4LK4A 3CH1A 4QRPB 2IQAA 3S3JA 2EYRB 1DANT 1XCQA 3GM8A 5FYLD 3TO4A 2APVA 4U1GC 1WV7T 3A6BH 2D7TH 1GC1H 3PWLB 2Q20A 2BRQA 1D5BA 4JY5H 3NZHL 3FB6B 5IG7A 1QSED 2WLZA 3OX8B 5H35B 4KC3B 3I2CL 1FSKC 2DM4A 3KYKL 4LKXB 1NMCB 3IB4A 1OAYL 1A22B 1NH6A 3MO1B 1YECH 4WI7A 3F62A 2NY6B 4J3TA 1R3JB 3BWUC 4V1DA 4ZUTA 2R29L 2VAJA 2CLRB 2E8ZA 1RULH 1ZVSA 1A6UL 4ZDHA 5I74C 3CFEB 5B4MD 3WEXB 2IJ0C 4YO0B 4KTDL 4JFFE 4U6HA 3LMJL 1VEPA 1YMMB 4RGMC 3M45A 1TNMA 5EZOH 2F58H 2DL2A 3PL6C 5CHNB 3BD4A 3QUXD 5TQ0L 2B1AL 3AXLB 1FFOB 1JGLH 1MRCL 5SX5H 4ZYKA 2XI9A 4F58H 3CDGB 3LRGA 4P5MA 3RX7A 1EAPB 1YC7A 2HJLA 3P3YA 2DIJA 3KAAA 3DTXB 1YEDA 1S9VA 3F7YB 4QRQA 3RIFF 3MRDB 3T3PF 1D6VH 2JB5L 5HHQB 1MIEL 2J88H 2OBGA 1T89C 4YXLH 2WANA 3O6LH 1QSEB 3JVGC 2MTPA 1E4JA 4YUEL 1GZQA 1PY4A 3PWNB 1EJOH 3BSZL 1ZMYA 1IM3B 4H25B 1JZ6A 4Z7OE 5C0FA 1QNZH 1JWUB 1JPTL 1S9XB 3D39B 3VXRE 4QHNB 4KRPC 5E4EB 2PO6C 4JKPH 5FV1L 3WS3A 2B5IC 3VGBA 3PWPA 1KGCE 4GQ9L 3VG0H 3BE1H 4GT7A 1MI5E 2H8PB 3EYVA 4S1QH 3WLBB 1J12A 4AG4L 1HWGB 2H1PH 3QUXB 5FYKU 5BZWB 2EEAA 2PTUA 4IS6A 1SYVA 2O93L 5TH2B 3LPGA 4U2ZA 5SX4H 1JJUA 4GW4A 2R29H 4D3CL 4DFHA 3O6FC 3PHQA 4JHBA 3EOAB 3KYMB 5CEZH 3E6HA 3V4VL 1X5KA 4JDVA 5EWIL 1CF8L 2Q76B 1DTUA 4LQ1A 4D0DA 2EIEA 4XMKH 4WY7H 1RV6X 3PP4H 1F6LL 4KQ3L 2R2HB 5HI5C 1B4RA 1E4XH 1JK8B 4X5LA 3TNNB 3DXAE 2R0WL 4RFNC 3QRFM 5SWSD 2HT4C 1LEKB 2VZ1A 1AE6L 5ALCL 1PKOA 4GRLC 4JFQA 3RTQB 5IMKB 1R6VA 3VU2A 1U8HB 1ZANH 5KN5A 3O11A 1T3FA 1MUJB 4P4KC 4HCRA 2DM2A 2YR3A 1FLTX 2EDTA 3MV8A 3E2HB 2CUHA 1RHHA 2PETA 2W0PA 4MB3A 2GITB 1FG2B 2V5SA 3VJ6A 4CDHA 4PRIA 1U3YA 2APFA 5I19H 4LPWA 5ILTL 2NQCA 3MUY1 4ZOAA 4JFHE 4JJHA 3THML 5CBEA 4F3FB 3L3OB 5FDYA 4KZEH 1EGJA 4PJFA 4Y1AB 3STZB 5KBNC 1UM5L 3DRTA 4D8PA 3UPRA 3PL6D 1KELH 4JFDD 5HYFA 3BPLC 2ATPA 3V2AR 1RSFA 2QSQA 1NAMH 4QLRA 4AEHL 2ADFL 3VW3H 1DEDA 5DRWB 2Y4SA 4NQVA 3W9DA 4IRJD 1N8ZB 3G5YA 4FZ8H 3QXWA 4NRXA 4XPGH 3HRZB 1JHTB 5GS0L 5JO5B 5BOPA 4OD1L 1J8HE 2L7UA 2AXFA 1YN7B 5DMJB 2PCPB 2AKRA 3FQWA 4G80B 3MLUL 1U6AH 3HC3L 4PG2C 1ZSDA 4XNYH 4X7TB 5IQ7H 1JPGA 1CG9B 4IDJH 4XTRD 2X4RA 1X7QB 1HOCB 2M1KA 3PXJA 4UTBL 2QJDA 4YX2H 3PJSA 1C5CH 1F8TL 5IV2B 5DMGD 4EVNB 3QIBA 5E99L 2G9HB 2A6IA 2BOCB 2OXHA 3KPTA 3PWUB 4JFDB 3IJYA 2FB4H 5C1MB 2KQNA 4WW1B 5DQDL 1H3GA 4XPAL 3GSWB 3MLPA 3L5JA 4O51B 4PRDB 1JGVH 2H2SC 3PP3H 1P84K 3TM6A 5CMAB 4IRJB 1U3HB 5LQBH 2ILLA 2VLKB 3JWDL 2DLGA 1I9JL 2I9TB 1CE1L 1DBKH 2R2BB 3FTGB 1DBML 3ULUC 3RUGA 3EYUL 1M6OB 4J8RA 4WUUA 1FP5A 3EDKA 1IGFL 4W6YB 4MNGE 1W0VA 2AV1A 5T5NG 2EE2A 3S88H 5I16A 4RIRB 3MRPB 3RGVC 1NAMA 3U6RB 5F9WC 3SDYL 5IFJA 4BH8B 4YXKL 4PJXF 5ESQB 2OMNA 3MRGB 4M48H 4NOBA 4PJGF 3K2MC 4OTXH 5J1SC 1X5YA 3VGEA 3P77A 1FRGH 1MJUH 2ATKB 1J05B 1QR1A 2X41A 3LRSA 1EH9A 4HXAL 1NBQA 3KYOA 1MCBA 4Z0BL 4GKNA 4RMRA 1X5FA 1FJ1B 3NCFB 4OFVA 3S4SG 4EZMA 3MUJA 3QIWD 4M8QA 4BQ9A 2HN7B 5IB5B 5I73C 2CKBB 2EICA 1T22B 3F6IA 3GJEB 4LLUB 1RZ8B 1IM9D 2VZ3A 5FYKH 3MCLH 5MP6H 1KENH 2Q3ZA 1UEYA 3FRUB 3C6LC 2ED8A 5F7EL 1YEHH 4OZGF 3V6OC 3PQYD 1VFBA 1A1OB 3ARUA 4Z9KB 4YHYB 5EDXA 1A9EB 1TETL 3S37X 2Y72A 4PP1C 3RZCB 3I02B 4MB4A 2A6DB 5EBGA 1FN4B 3DHJA 3IGAB 6FABH 2XTJC 5DFVD 2VITA 5E5MA 4XVUC 3L3JB 3LQMA 1A1NA 3ALWA 1JL8A 2KBGA 4F7TA 1UJ3C 4LARH 4PRBA 5IB1A 5DFVC 2DBLL 1OGAD 5B22A 1GC1L 1ZHKB 3VE0A 5IW6B 3T0XA 2DQHH 1U8QB 1QSFD 3C6LD 2LAAA 3CC5A 5BCAA 3MRHB 2NCMA 4L4TE 5I1EH 1LEGB 5DJZA 3IJHA 2C3GA 1A6AB 4TPRL 4XHJC 3IDIB 5KSAA 1A7PL 3QDGB 5EIVA 2D9QB 4ZOBA 3JUYA 4JEGB 4WO4D 3QUYB 1QLEL 4GSDL 1NFDE 4FQXC 4KQ4H 1XIWA 4MWFB 3WJJC 4ZG1A 1KB5B 3PQYB 4AQOA 3CXDH 4JN1H 2E9BA 3G6AA 3QEUB 3WNLA 5AD0B 3TBWB 1SMAA 2QKIA 4KQ4L 3RVVD 2J4WH 3CFDA 4CVXA 3OWEA 3VI4E 3PP4L 4PB0L 4HXBL 1MFDL 1MVFA 3INUL 2VB5A 5EN2A 1ULVA 4OZGE 5B39B 3L5WB 4OQTH 4QRTA 4Q6YA 1MAJA 3PP3K 5IG7B 3R8BB 3LIZH 4U1LA 2CKNA 1FYTB 2IPUG 3HNTL 3OKEB 5DDHA 2Q87A 3QCTH 4ENEC 1QSFB 3C6LB 2JCCA 1HYSC 4GW5B 3Q5TA 3SGDI 1BAFL 1I7ZA 3ULSB 4JFEA 1QFUH 3OKDB 4NQTA 3T08A 1U8JB 1QLRB 5E2TL 1CLYH 4XX1E 5JIPA 1FZJB 1RMFL 2CDEA 3ARBB 2BVEA 4OZGA 4P9HL 5CHNA 4M61B 1FNSL 2OP4L 1FZOA 1KCSL 5F70A 1MF2L 3HR6A 4X80H 3RP1A 1LO3H 5SWSE 3ARDA 1ZAGA 5DRNA 3TT1L 4LF3A 1G7PA 4EQ3A 5MEQB 3CDGA 2XZQL 2A38A 1L9MA 4LSSL 1XF3B 4G6JL 4LLYA 3EDEA 4HJGA 5EOCL 4P46D 5CZVL 4I3SH 4JVPA 4QXUL 1TJHH 4CMHC 3RIFK 1V8HA 2C26A 1MCWW 1OT1A 2HA1A 1G9MH 4G42B 2WV3A 4HKJA 3RY4A 3K80A 5IFHL 3UJTH 1U2HA 5I1IH 3V79C 1RJYA 3UYOD 4XTRC 3MRJA 3VXSD 1XR8B 2CXKA 3TBYA 3J8F7 5DHXB 2VR5A 3ALPA 4DCQA 4ZQKA 1WIOA 5GSVB 2CK0L 3MCKB 2Q7YB 2WWKT 4WHYH 4GMSH 2CIIB 4BZ1H 5EBLB 1U8PB 3KYKH 2FWOB 2C3XA 2DLEA 5D2LB 2XXCB 3HI5L 4PJ5B 3PDGA 5T3XE 1BHGA 5FEBA 3OV6A 3V5DB 4X7SH 1A2YA 4JQXA 4KJQD 4XBGB 1ERNA 3HR5A 2LABA 2DWDB 3NCEB 4LAQH 1OGAA 1NFIB 3HC0B 4EBQH 3ARPA 4LIQH 4BQBA 5DVMA 1FZMB 1JNNL 1KB5H 2NYYC 1RUQH 3QI9B 5I1DB 3Q5YA 1DJSA 3RQ3A 3SJVE 2IGFL 3BISA 1WIUA 1AR2A 3G08B 4GH7B 2XG5A 1ORSB 4P46B 5J4MA 2Y36L 3WSQL 3D2UD 1HKFA 2UWEF 4MA3A 4JO1H 4LLWB 3K46A 3NIDE 2GK0A 3DVGA 1SVZA 2CGRH 3IVKA 5IIEB 3H0TB 1MCOH 3B3IA 4JZJC 4PTTA 5I1HL 1FNSH 4P2OA 2IG2L 4PRHE 5E8OB 1I1FA 2WLYA 4OZ4B 1V05A 4N0FA 1ADQH 2FYYB 2WBJC 3SE4A 3L3GA 5JXEA 1WT5A 3HC4H 5HGBA 3LKPB 1JZ3A 3OAUH 5E03A 2B39A 5E9DB 2P48B 3MJ9H 1S3KH 1BP3B 1ES0B 5GRWA 5HHVH 3HE7D 3CFCH 4NN6C 5MHSD 5HI5D 1I85A 8FABA 1F3DH 2FECL 1X5XA 1G9NC 3CAFA 5SV3A 3T09A 3UTQB 4LSTL 1F3RB 1FNEB 1LK2A 3MLWL 2A6KB 3TA3D 5GZNC 5C0GB 5EC2B 2QHRL 2P24B 3N0PB 1H8NA 1OW0C 1P1ZB 3GJFB 3T2OA 3L3OA 3MRNB 3MOBH 1D7FA 2DTML 3QNYB 2ZOKB 4X4XB 4ZXBA 5HGHB 5J56B 5HY9A 1CCZA 1QYGH 3GSXA 4Y5VB 4QT5B 4NWTH 3DX8B 2Z8VC 3I6GB 3QXDA 2BHUA 4XRCA 4I9WE 1VDGA 1GCFA 2IH1B 3OJDB 3RWJA 1CDIA 4LVOC 2IAND 1NGWB 4KVNL 1ZVHA 3GGWA 1A64A 4KTEH 4Q0XL 5C0ND 3VXTA 1LDPH 1MNUL 1VENA 1I7TB 5AZEL 1A4JB 1U8NA 3MREB 3E2HC 5E8NA 3VRLF 43C9A 5C0DB 4KJQC 4QGTA 1JZ2A 1KPRB 5T1MB 3C87A 3IRZA 3EJYD 1H5BC 1OOAA 5K9QI 2JJVA 1RK0A 4Q9RL 4Y2DA 4LFHD 4GJTB 2WBJB 3E3QE 1D9KB 4XI5C 5EC1B 3PV7A 1MRFL 1KIUA 2HTLD 4JB9H 5J6GA 1T04A 3BIKA 2Y5EA 3IDJB 5D7LB 4PB0H 15C8L 2OI9B 4K71C 4PV9A 2QR0A 2X4OB 3GO1L 3QAZC 4LVEA 2X4RB 2GW5A 2YN5A 2ZWLT 3BVNA 1CXLA 2X70B 4RSVA 3S5LB 4RNRB 2A74B 4E5XB 4WFEE 2PYEA 4NRZA 4I3GA 5IVXB 1D5XB 4EVNA 2A6IB 1RJCA 4J3SA 2B1HL 3BKML 5E8DL 4GFTB 2F8XC 1VERA 5DJCB 3O2DL 2DBJA 5INCB 1YDPA 3BOVA 5E8EB 4X5WB 2AK4B 3LKSB 4FRWA 4JFZL 1VADB 3MGTA 2ZSWA 4QRRB 1V7NL 3RX8A 3PIQB 4YHLH 4OIIH 4ZUWA 4LCIH 4PJGE 4AH2B 2VLRD 1IEHA 4RAVB 3TBVA 4DVRL 2VR9A 1CFSB 5EUOE 2XICA 4N5UA 4PD4K 4WIQA 2NX5B 4WI2A 2FATL 4PJBF 4FQ2H 2PN5A 4FQXA 3KXFA 3IFNH 5SWQB 2DIBA 3RL1B 3ILQC 5L6YL 4UUJA 1FO0L 5IW1A 4WENB 1F4HA 4WU7A 1O0VA 1D5IH 5IWLC 4F2MB 3C08L 1PG7W 3VXOB 5FCUL 5DMKB 5EZJB 3AFLA 3BDBA 2WBKA 4LSDA 4HSQA 2BNRD 3PWVA 3P4LA 2DQFA 4UT7L 5SWZE 3D6GA 1NL0H 3B9KD 4KK6D 4MNHA 4WHDA 1HILB 2YA0A 4HIEA 4D9RD 3REVA 1JYVA 3GMQB 4L3AA 3DV6B 5EU3A 4LCUB 5DJ0A 4YBQC 1MJ8H 4P57B 3WUWG 1A7RL 4R3SB 5IMLA 4KXZI 2Q7NA 1NGQH 1MCQA 4QRRE 1YYLH 3NFSH 1EFXA 4KDWA 2Q8BH 1WFNA 5T33L 1NEZB 5I15L 2VLRB 4GMSL 6CGTA 2C1OA 4FXKA 4FFZH 3CX2A 3C09B 2BNQB 2IPUK 4MNQB 1WISA 3I02A 3S8WA 1IGYA 5FK9A 1IFHH 1I9IH 4XBPB 2HTKC 2JCCE 4LAQL 2XTJD 1H3WM 1OAUH 4U1MA 1K8DA 4D94A 4TNWK 3K1DA 4XX1G 4IDJL 4PP1D 1U36A 4Y0GA 3ET9F 5EZLA 5IB3A 5E5RB 1KLUB 3MNVA 4RFOL 4F15C 1MCLA 2W92A 4FQPA 3MC0A 3OHXA 1I8MA 5AG8A 4OBSA 4D3CH 4OGZA 4QGYA 1JGDB 4HKXA 4L3ED 2Z4QA 2OTUA 3RWIA 5I1KH 5B8CB 2DQGH 4LCYA 5KSAB 3MLWH 2UZIH 1A6WH 4E41A 1CGVA 5TFSL 2MMXA 3SCMA 1HDMB 1ZA3A 4GKSB 4WJ5A 4PJIA 4U1SB 3CFIC 3VXUA 4DGIH 3K0WA 3LN4B 3VXSE 4EN3B 3WD5H 4RRPA 4OGAC 4L4VB 5JNYB 1MJ7L 5BV7B 1GPOH 1OF2A 3GMLB 1P4IL 3K74B 4BKLB 5IQ7L 3KPSA 1DCLA 3GSUB 4PJEE 4GOSA 2EDHA 1H3UA 2LTQB 1MCOL 4RDQF 3RNQA 3AUVA 4JPWL 4JFFA 2IFFH 4U1KA 3VRIB 2XTJB 5LXGL 1OAKL 4O2FA 4APQB 3L5XH 5GSRB 4R2GC 2AV7B 1T4KB 4MAYB 3RNKB 1U91B 5IUSA 3SDAC 4MD4B 4PG9A 1I8LA 1Z3GH 1M71A 4JREC 4RMTA 1T5XB 3PUCA 3GMPB 5DTFA 1I7ZB 4L3EB 3V95A 4DTGL 1IGIL 1A6VL 1H8SA 2NY5C 3DWTA 5IB4A 5HSFA 2VABB 4EEEA 1CGWA 2HRLA 3GK8L 4HIHA 4P46C 3DETD 3G6DL 2DS4A 3ME0A 1S7RA 4X8JA 4PRHD 4X6CA 3P4OA 4PB9H 5DVLA 4MDIB 3ZTNL 3K81A 5HYSB 2APTA 4C83A 1B3JA 2PTVA 3MMEB 5I9QC 1VGKB 3F7VB 3M17B 5JR1L 4IEFB 4B41A 2F8OA 2HVJB 1KEMH 5E1AA 1QUNA 3C9NA 4JRWA 3S6CA 3WXVL 3QIUD 2W9EL 4J23A 3HZKB 4I0PA 4APQD 1AGCA 5JW4R 1RJYB 2ENYA 3UPAA 2XWJB 2VNCA 1OP9A 3QFJB 1RIUH 5FYLH 4QHKJ 1IGTA 4JR9L 1WBZA 3PHSA 3LS4L 2ZSVB 5KANI 3X3GH 1T0MB 3HI1B 2J5LC 4R2GD 4KK9D 4I9WD 1U8LA 5K59F 4JREB 4YNYB 2DTSA 4XC1L 1X5JA 3HHRB 4N0CC 1A2YB 4KKAD 2NY7L 4OLYH 3I6KB 2BRRH 4CMHB 4MAYC 4XBGA 4U1IA 3LB6C 4Z7VB 3OMZA 3IDGB 4WI5A 3SOBL 2ARJA 4YXHL 1JPSL 4EXPX 5GS0D 4LSTH 3ZKMD 3CPLA 4WW2C 2MFNA 3KYNA 4KKCD 4XH2B 5I9QB 3FB6A 4YDIH 3U7YL 4TRPH 1WCBA 2ADIB 3HNTH 2UY7A 5B38A 1BX2B 1J1PL 2HLAB 3RKDC 4MYWB 3X13A 1AC0A 4LLWA 1MWAH 1JFQH 3BWAB 1B0GB 4LFHG 4V1DB 5JMOC 5J3HD 4FZEL 2HT3D 3KLAA 4MCYB 4F33A 1RZJC 4K7PY 4C4KT 1RU9H 4ERSL 1OB1B 2E6JA 2OXGA 2F53D 4XCEA 2OQJA 4YR6B 4RMQA 3S4SB 4FTVA 3RZWA 4X6DA 3QIUA 5F1IA 4OLXL 1H9VA 2AEWA 2WWMD 3SDAB 1DLFH 1DQQA 3CLEH 3ZDXF 3CGTA 5HGBB 2E7CA 1ZHNA 1SQ2N 3CSPA 4GAJL 4R2GB 2VAAA 3W0WE 5F7FA 5IROC 4ZYKB 5DI8B 3SCMC 5DK0A 4TUKH 3LY6A 5C09D 2GTZB 8FABB 4L8BA 1KYOK 4YPGB 4JM4L 1LK2B 4H5SA 4I4WB 3LD8C 5EU4A 1DDHA 1PZUB 1GXEA 2DLFH 5BRZA 1A7RH 1VEMA 1DFBH 3MUZ1 2GIYA 4QRQB 1T1WB 3ZYOA 4YGVA 1KEGL 1XCTA 5MERB 3BPLB 5CD3B 1CE6B 4R4NC 2ZOKA 4R0LB 4GMTL 3RVXC 1AHWC 1P7QA 4ZUSB 1FYTE 5C7XL 4NQED 3S5LG 4K2UL 5DS8A 1B4JH 1DUYB 5HHME 2D03L 4PJHA 3SDYH 3I9GH 3HS0A 3T2PA 2ZZUT 1IM3A 4ONHA 1AGFB 3TESA 4YWGH 1T7YA 5FUCC 3LSOA 2UWEB 2AP2A 4OI7A 1MRDH 2QSTA 5IFHH 4LASL 1Q1JL 4D9QE 5ITFB 5JPNB 1KCLA 1JN6A 4MSWB 5I18L 2CGRL 3PHOB 5HGAB 4ALAH 4PRHA 3UCRA 3QEGH 1XGRB 3BRGC 2M2DA 1R3HA 3DROB 1DBBL 3EBAA 3PWJB 2VOTA 4GW4B 2DJUA 2X4QB 1TDQA 5T33H 3L7EB 5D2NB 5A2LH 3ZDXE 1HINH 4WDIA 3KYMA 3HE7C 2ZPKH 1RURH 4FQHA 5JOPE 4XP5H 4OF5A 3ZE0E 3RWEA 3D0VB 3GSOA 4HIIA 2XZZA 5C0JB 3B6SB 1AIFA 4H0IA 5C0BD 5DHVA 3DYMA 1AI1L 1MPAH 5CZVH 3L3DA 1HHKB 2VDQH 1WJ3A 3NA4A 4WV1C 4DK3A 5L9DH 1A3LL 1CVRA 2E9JA 5BVJA 1B0RB 1LO4H 2F5BH 4IHOA 3GJFH 4POUB 4TOYH 1S7XA 1GC1C 3CVHA 1UYWH 2DMCA 2VN7A 3HE6C 3U30C 2JLLA 5IVOA 1MFBH 1YZZA 1JZ7A 2PXYA 4DN4L 1EGJH 3O11B 5JW4N 5LXGH 4LLAA 2VL5A 2ID5A 3MBEB 5JZ7D 1CL7L 4G6AD 2V2WA 4KUCD 2YPKA 3AMLA 2YD5A 1Q9LB 2A1WH 5DMGC 4M5ZL 4ZUWB 1I1AB 5F7UA 4LLVB 4FXGA 5LGKA 3KLDA 3KDMB 1LE5A 1P4BH 4ODTL 5JOFA 2YUXA 4I18C 4AMKL 1CXKA 4Q9RH 1AO7A 5IJVB 3B9EA 5TF1H 2DI7A 1ZOXA 1FL5A 1R5WB 3WUWA 4NP4L 1Y0LA 4M1CD 4DQOL 4KK5C 4ONOA 4RDQG 1GIGL 3IDXL 4OGYL 1I7UA 1JZ4A 1N5YL 3HZYA 1F4WL 2J8HA 4K9EH 3IF1B 4IBLT 4MX7B 5FDWB 2DWEB 5JUEH 3CCHA 3VA6A 4TUJA 3P0VH 4LHUB 3E8UL 2F19L 4PGDB 2IC2A 3VFOA 3FJTA 4U1NA 4CKVX 1XF5B 1EDQA 3OXRB 3HMWH 5C09A 1A6PA 3ZKXC 5DHYA 4MJ2A 1CK0H 1ORQB 5BVPH 4DTGH 4ZPTB 1G9ML 3S34L 4Y4KB 1TTFA 1JZ8A 4NQEA 1XF4B 3SGJA 4ZNCD 3IFLH 3DMMA 1FC2D 1B6DA 1VGEH 2P5WD 3QWOB 4K55A 4P59L 5JQHC 5A16A 1CG9A 1PQZA 2NY6C 4X7FC 1FGNH 2IWGA 1HH6B 2XWTA 4X9HA 5D1XC 3TBTA 3T1FA 5E2VH 2A0LC 4OF3A 5GGSY 3WIHA 2O61B 3VXUD 1U92A 4HS6A 4YHMH 4JRYB 4IMLA 3U2SB 3T0ED 1GAFH 4RAUA 4WW2A 5IOPA 3D39D 4LSQH 3QRGH 1EEUA 5HI3C 4KTEL 5EUKA 4NNXB 1R24B 3F12A 3T1WA 5T3ZH 3QUZA 4NKMB 3T04D 2FDBP 1SBSL 3HNVH 3IDUA 5D71H 1VACB 1JGDA 4HKXB 2Z4QB 1E4XI 2I9TA 2IGFH 1J86A 3MACH 1C1EL 1U6AL 3SGKC 5B8CA 3DECA 4Z7WE 4WUUD 4ZOCA 4JO3H 4E41B 1E4WL 5MENE 4KHXL 5ISZE 1ZA3B 2VDOH 3TH4T 1NDMB 1NMAH 1D3CA 3ARVA 4Z8FH 5GJSH 3QO1B 1UJTA 2Q6WA 4WWKB 4RIRA 5F96H 2EKJA 1NCDH 2G75A 3S3PA 2HT2D 4ZPVA 4O02L 4XNXL 3QDGE 4FQIL 4UT9H 4HKZB 3RJDA 5IQ9A 5F3BA 3HC4L 3WN5B 4Z7UA 4GRMB 3MRLA 4CW1B 4M7KH 3DUHA 3B2VH 1EJ6A 3F65A 2FO4B 2HP4A 3GMMB 3MROB 1UADC 3BYYA 3KYOB 4YC2B 1BOGB 5FOBA 2BY1A 2YPLE 1G7MA 1GOFA 1W8NA 3VD4A 1MI5A 4JZOB 1MFCL 1IILE 3GMOA 5IF0B 4M8QB 5GGRB 2ZUWA 3C5SA 3T2QA 2ZCKH 2CKBA 1F4YH 1KJMA 2Q8BL 1UB6B 4LHUG 4KRMB 3VH8G 4CN1A 1DBAL 2IBGA 4XZUA 4M3JA 3WBDA 4L3EA 4H26B 5HDQH 2IAMD 4OM1L 5IB4B 1R3KB 3DRQA 3EO9L 3ARRA 4OUOA 2P5EE 3O2WH 2V7NB 3U0TA 2JTDA 4HHAB 3V8CA 2V17H 1KTLA 1AGBB 1BBJB 4QCIB 5FKAA 5JA8B 1F2XK 4KHTH 2EDDA 1EHLL 2NY7H 1DQTA 2PW1A 3BQUA 4WWKD 1Q0XH 1LE9A 5KSVA 2ZG2A 4OUUB 2YWZA 1KN4H 1KJ3L 2P1YA 3I50L 1HKLL 1S5IH 5DT1H 1KFAL 4ESKA 2XQBH 2Q76A 1QOKA 2AI0H 3MOQA 4LP4A 3I75A 1DLHB 1NGPH 4OZIB 4FXLA 3SGDH 5IEKA 2ZKHH 1JFQL 1MWAL 3BIAX 2X7LA 4ODVH 5IJKC 4U7MA 1JK8A 2EDRA 2X4TB 4FMKA 4PJDE 3I3BA 3HZVB 1EZVY 2X40A 4WEBL 2CKBH 3ARFA 2DKSA 3GBLA 4HPOH 2XZAH 5HHMD 2OR8A 4OZFG 1EO8L 1RK1B 2CDGA 3ZTJH 1TQBB 2XN9B 4JY4A 4UDUA 1MCJA 1FVCB 1CDBA 4FQQA 5IGXL 5MENA 3MJ7B 3WV0A 4F3FA 4I18A 3VFMA 3JV4A 3I6LE 4NHCL 1QFWH 3JVGA 2BOBB 5HDQL 5B38B 4HWEL 5DLMH 4XCFL 5DDHB 4OFYA 3NZHH 1FL6B 1M05A 1NDGA 5ACLA 3PABA 3DSFH 1EA9C 3IXAA 3S37H 1V3KA 2XNAB 4K8RC 4P9MH 5F9JA 5KVGL 3CK0H 1CD9B 1U42A 2W91A 5CCKL 1JRHH 2H6PB 4MDJA 1W72A 4KH2A 4NPYB 2OQJB 2VN4A 1QVOB 3SGEH 5HHNB 4TSCH 5EU5B 1WZ1H 3HRZA 3FOMB 4LLQB 5IROA 4R7NB 2RB8A 2VC2H 1MFEL 1J88A 2LVEA 1S5IL 2MQCA 1U3ZA 1YUHB 5HHMB 4POZC 1FPTH 1XF2B 4ENED 1BWWA 4M6NH 4XCYA 2R2CA 2UYLA 3MTRA 4QXTA 1KSRA 3GSVB 1BWMA 4XMKL 4FQJH 1F3DJ 4FMFA 1JPGB 5HYJB 5CAYB 3GKWH 3F7RA 1YNLL 2P4AB 1GGIH 2Y06L 3V6BR 4KTYA 5GRZA 4PPTA 2G9HA 5DS8B 5TE4H 5E2JA 1GOHA 2KH2B 4LCCA 1INDL 5FECA 1A5FH 1YY9C 5ACMA 5IVXE 1U8PA 2QQKL 2Z93B 5BMFH 2FWOA 2BRRL 3DUSB 4LRNH 1IAOA 2AQ3A 4AEIL 3HCVB 2ICCA 2VDML 4P99A 3RDTA 1F6AB 2F54E 4LOUD 4EQ2A 1L6ZA 1EAJA 3NFNB 3K1KC 3KPOB 4OZHE 1NC4B 4CMMA 1XGRA 2EZ0D 4U6YA 1F3JA 4Z77B 1R3HB 2N4IA 5JXAH 3PV6B 3FO9B 4NHUA 5I1DA 4TTDD 5D2NA 3BZEA 4YHLL 1FE8L 2R23A 3V5HB 5I17A 2JK5B 1ZTXH 1VFAB 2FLRT 3GMNA 3RPKA 4CJ1A 32C2B 3K4AA 2G2RA 3EYOA 5C0RH 4H1LA 4LSPH 4YAQB 3B6SA 3QDMD 2HFTA 3RGVB 3H0TA 4HUXB 1EFQA 3FFDA 4QHMA 3L3DB 3RWDB 5D1XD 5BVJB 3P77B 2QQQA 1I1FB 5I1CL 4NSKA 2DYPA 4IHOB 5F72S 4KKBC 2F5AH 5JUEL 3CU1A 4BFBD 5F9AC 4WFGE 5HHXH 1HNGA 5DO2D 1HSBA 4M6MH 2P8MA 4BZ2H 1I8KB 3JV6A 2BSSA 4YFLI 4JCMA 3EHBC 4G6KL 4QXWA 4YHIB 3D39E 2VIRB 1E4KC 1I1YA 3QNZB 1HI6A 5EC2A 5HHOB 4JM2B 1NC4D 1LE5B 4ZFFB 1JPST 4X4XA 1HHHA 4W6XB 1NSNH 5JOFB 4IIQC 5F9WB 1TCMA 3WJLA 4UV7H 4DW2L 3TZVA 1AFVH 3SKJL 1BGXL 2B1AH 4N8VG 4I0CC 4K07A 1QLFA 4QXGL 4PLKD 5EOCH 1T0NB 9CGTA 2O5ZH 1XF1A 3HZMB 4OCXL 1WZMA 4L4TA 5D1XB 4M7ZC 3S98A 4MNGA 5DQJA 3CC5B 1UCBL 1O5DT 3F58L 1RVFH 1Y18A 3V9FA 4G3YL 2VDQL 3U48A 2ZP0T 1H0DB 1LO4L 1UZ6F 3QHZL 3SEPA 3IFNL 5DHYB 1AC6A 3HPLB 4DGIL 3S36L 5M7QA 3NZ8A 1FH5H 1SM3H 1KCUH 4JQVC 1RVFL 3ZKXB 4R96B 4PJ7F 2Q8AH 5DK2A 4Z0BH 5CILH 3A6BL 3K8KA 1MWAA 4XXDB 4U7KA 2LFGA 3VFPA 3BVNB 1KB5A 1I4FA 5HGGS 4Y4HA 4AEEA 3BYTA 1XIWD 2NY3B 2Y36H 1S7SB 3G6AB 3LS4H 3QEUA 3RWFA 5AD0A 2BVOB 4ODUA 3MCLL 3UTPD 4JG0H 4HCRH 1WC7A 4IMKA 2ZKHL 5E94B 4KV5E 2V9QA 1T6VN 1BD2D 4CADA 4LBEA 2J12B 4PJ5D 2XQBL 1RZKH 5JLZA 5DD6B 5TDPB 3DHMA 3T4YA 5EO9A 3TZVD 4W4OA 2B0SH 1LDSA 4PJHF 5KG9B 1QSFA 3C6LA 2A73A 4KPHL 2VE6B 5EWIH 2HT4D 1MHHB 3BEWB 3V4PH 3EO1B 2GT9A 3MV9D 3PGFH 4L8SB 1A02N 1I1AC 4DZ8A 3E8UH 3S35L 5DD0L 1BM3L 3TNMA 3PXHA 3ZDZF 5L2JA 5IFAL 3V6FA 4GQPH 4OJFH 1JGEA 1M7DB 1RZIB 1TZGL 3VDAA 1MCPH 1JF1A 3DXAB 1DQJB 1A6VH 1QSEE 1A6TA 5IM7B 4JKPL 3FAXA 4OZHF 3OGCB 5FO7B 4DAGH 1MHPL 4ZTOH 3VXME 3VXQB 4FTVD 4X6DF 3AS0A 3CMOH 3UJJH 5J12C 5HDOA 2CSPA 4F2MA 1J0IA 1NCWL 2UUDH 3S36X 5J12B 2Z9TA 3OAYK 4P5TC 5E1HB 3HAEB 1SY6H 4JO2L 4XMPL 1OSPH 3S35X 2K1MA 4K3DH 2F74B 3QXAB 2FBJH 1OAZH 3EJZC 1MI5B 2E9IA 2VDMH 3FN3A 3FQXB 3HE7B 4KVNH 5DQ9A 1SY6L 5E9DE 3EYQC 4LCCC 2DKUA 3DI2B 4PRAB 1MJJA 4RGOL 3T77A 2B5IB 1MFBL 3CH1B 2PO6B 5LKNA 3X12B 3ZYJA 4KGJA 5DURD 4HK0A 2BXZA 3DURA 1S9YB 4X9GA 2GUOA 2FGWL 4Y16A 1U58B 2DLTA 2YD7A 4WUKL 4Q9BA 4NZRH 3UTSE 5L2KB 4JO3L 4XB7A 1IGML 4NO3A 2ITDA 4NZUH 2I07B 1CXFA 1CN4A 4XC1H 1K8DB 2JKXA 5D6DC 4PY7A 1FAKT 4ZO7A 1BVLA 3L5HA 5IB3B 3QUXC 4YFDB 1UVQA 3O4LE 3QPXH 1SY6A 4OI8A 2C5DC 2NY3C 3KPRB 4MJIB 4F7EA 2P46B 1I75A 2D0FA 3G6JF 2WINB 2XQYK 3I75B 3KHQA 4NBXB 1MI5D 3RVWC 3CDFA 3PDDA 3R06B 4P2OB 4JRXB 2R1WB 1HZHL 3IU3A 2AQ2A 4OZ4A 3SCMB 1MHPH 2QSVA 3MRKB 5I1LA 3FONB 3QIWA 3O6KH 2PO6D 3HZVA 2PTTA 4HW6A 2H26B 4FFVC 4JPVL 2WP3O 1JIBA 2F5AL 5SX5K 3R1GH 5IEHB 1W0WA 1UM6L 2DAVA 3E0GA 1DFBL 1KC5H 1KEGH 2CDGB 4M6ML 3H7LA 1F2QA 2I60L 3BX7C 1IM9A 4HJJH 4LSPL 3TPUA 1U8KA 4JKWA 5GGRY 1DQMH 2E7MA 2P24A 1BBDH 1GZQB 3KG5A 2R69L 5IBUB 3TVMA 1A14L 1DANU 4HX1B 4X6BB 4XNZB 5CSGA 3I6GA 1AXIB 2AK4D 1OCWL 5L0QC 5EOTA 1U91A 5FUOH 4PG9B 5D7IB 2BFVH 5DD1H 5FO9B 3DX6B 4K7PX 4OD1H 3BDYH 1T5XA 3IXAB 4G43B 4AENB 1N64L 3STLB 2VABA 1HHJA 4PJXB 2R0ZL 2XKSA 3C8KA 2ZCHL 4XP6H 3QZWG 5TH2A 4P2OD 3WS3B 2AEPL 3KNBA 1H8OA 3HUJB 4M62L 1BJ1H 1DSFL 2XZQH 1P4IH 2AJVL 1U8IB 2VZTA 4JFOB 3UTTD 5K9JL 1UJ3A 5J11B 5D8JH 3KPQA 5D7JC 1SYVB 4D0DB 2IMNA 4LCIL 3FQTB 4QHLA 4RGNE 2XWBB 2UUDK 5IR1A 3ZZ1A 3GSQA 1I3GH 3DX7A 4JDVB 5T5FH 1ND0A 2YD3A 2HLFD 3AS1A 5DUBA 2AXHA 4NBZB 1FLRL 1T83C 3VXRA 3QQ4B 4BH7A 2DQEL 3EYQD 3MBXH 1AD9A 4HG4K 3OF6D 4P59H 5F88A 5JDSB 4BA8A 2I26N 1QFWL 4OFYD 5HHPB 1FG2A 5EIIB 4JZNA 3BRDA 1NCTA 1JNJA 5C2BL 2WM0A 3QQ9D 2FD6H 4K94C 1F4WH 2PYED 5KN5B 1NCBL 3NIFF 4PJBB 4OJFL 2ADGB 1IGFH 1GGUA 1IAOB 4K94H 5D7SL 3PIQA 2HFEB 4JGMA 2XFXB 3M8OH 2ATPB 2F53A 4NWUL 3KPOA 4HF5H 5C6TH 3D18B 4CL7A 3PGFL 1QA9B 1G9EA 1CFSA 2IMMA 3STZA 4YPJA 4TTGA 1KJVA 3BZEB 3P9MA 4KKLC 5HBBA 1MJ7H 4RGNB 5DJAA 1FNHA 4N8CH 5ACZA 1NUNB 3D25B 43CAB 2IPTL 5HJ3A 3NCYP 2R39A 3A67H 4PJIF 5MI0C 3ARGC 4M7LL 3GIZH 4CN6A 2IPKA 4H1LH 1S7TA 3W9DB 5CJ8A 4DAGL 3ARQA 2MNUA 2GKIA 5DMKA 4JHAH 5IMMA 4GAFB 3WCYA 1CK0L 2DDQH 1T66D 1CVSC 3FCTB 2YBRB 1UXSA 1U2CA 5IBLC 4KU1A 4QEGA 4OF6A 4R90H 1YN7A 3VFRB 5KSBE 3B9KA 3DV6A 1FGVH 3PJSB 3VCLB 3P40A 3MRMB 4R3SA 5DYOB 2BNRA 1KACB 1BAFH 1XT5A 2P43B 5FHAH 3QJFA 2G60L 1HOCA 1Z9SA 5CS7A 1WFUA 1JTTA 1YQ2A 4ZFFA 3O6LL 3C60C 5EU7C 3EFDL 3MV01 2BCKA 1U93B 1P7QB 3CFBA 4JY6A 1DBAH 5E7BA 3WD5L 1PYWA 3BHBA 4OB5H 4HIXL 5FYJH 3TJHD 2N7BA 1G7JA 5IESL 5L0QB 3HNSL 4XBPA 4PTUA 2VXTH 1TIUA 1KB9J 5BMFL 3FO1B 1YEGH 3HS0B 4M43H 5I1GH 3GSWA 1AGFA 3ES6A 1HZHH 1VESA 3D2UA 3FFCA 3IFPA 4JFZH 1J7VR 3CDCA 4LHQB 5LWYH 4Y19A 1FVEB 4MJ6B 3O3UN 2UVFA 5D1XA 4M7KL 1PLGL 5IBTH 1P4LA 3HMXH 4M7JH 2YD9A 2BVPA 3NCJL 5C3LD 1SHMA 5INDA 5FB8B 3MR9A 3LQZB 3LRHA 1RMFH 2ORBL 4PRHB 1X5IA 2BVYA 4GRLA 4PLOB 1C16B 3BN3B 4Z8FL 4LSVH 1B6UA 3K4DA 3IFOA 3A67L 4LDOB 4R96A 5ICYA 1BM3H 2W9DL 4OFIA 3BJLA 3BP5B 1D6EB 4HJ0C 4ELMB 3F7PC 1TVHA 3MACL 2PYFA 2DQUL 3D0VA 3GSOB 3Q3GB 4Y4FD 1S9KC 2P42B 1R5VA 1ACYH 1MFAL 5HGDB 5E00B 3IAQA 1WSST 3GSUA 4G9DA 4IOFC 3CDYA 5MEOB 1OL0A 3QFJD 5TPWL 2X1XR 3HG1E 1TQBC 5D1ZC 4LLUA 3FHAA 3N1GC 2R8SL 3H8NA 1N59A 1UWXH 4ZFOB 3QUYC 1AFVL 3OG6B 3SKJH 4YHKL 4Y8DC 2NY4C 3ESUF 1CF8H 3G04B 1PBYA 1N3NB 2VL5B 3MBEA 2DM3A 4U6VH 1Z5LA 3P0YL 2V2WB 3FRPA 1J1XL 4F7MA 5HXMA 1CFQB 5JHDE 2A73B 2QV2A 3QQ3A 3BN9C 3P73A 5ERWA 2BFVL 1X9QA 4OD2B 1QR4A 4FXGB 1F4XL 5KS9A 4XNYL 3PGCA 1KBGL 2P8LB 3WIIH 5FYJU 5HHXL 4JAMB 4QXGH 1M7DA 1RZIA 3JSSA 2DQCH 1WLHA 3GNMH 3IGAA 3EO9H 5CGTA 3G5XB 1A3LH 4E0RA 4V1DE 4NT6A 3IJHB 3MUHL 3UTSA 4F57L 3F7VA 5D8JL 3PE9A 4XP9L 4MX7A 2DWEA 4YHYC 2MQ3A 4Z18A 4Y5XC 3ZSSA 25C8L 4CVZA 1U8QA 3GI9L 4PGDA 5KW9H 3ESVF 2WUCL 4HAGA 3ECBB 4I0PB 2QQNL 1VPOH 4NQCE 4M03A 3BEVA 5EZOL 3B4NA 3QFJA 4ONFH 4FNLL 3BP6A 5DWUL 1ZT7A 2JJSA 4J4PA 1CE1H 1WBZB 1ZE3C 3EYUH 4ODTH 5KANG 1Q1JH 2AK4E 3ALXA 1QD0A 4O5LL 2GUOB 3MYJB 4G6KH 4L8SC 3ULVE 5ICXA 2H45A 5AYQA 2J3SA 3TBWA 4AL8L 4H88H 3QQNA 4U1LB 2GJ6D 2NXYD 3MZTA 5EN2B 2VSDA 5E5UB 5CILL 2I07A 2LU3A 1HCFX 4N1HB 1K4CB 2JELL 1NCCL 4HK3N 4I3RL 1PG7L 3OKDA 4JG1L 3UTTE 1LD9A 2DQHL 1U8JA 2W1NA 1CGXA 4L4TD 3OKEA 4FFWC 1AY1L 1MCFA 1C5CL 1F8TH 5L9DL 4KMTH 4DN3H 5CZXC 4I0PD 1OQOA 5K9OA 2VISB 5DRNB 1QLRA 4LP5A 4HS8L 5EFIB 1OAZL 2R1WA 3IU3B 4YR6A 4DN4H 2YRZA 1CLOH 5F7MC 3G5ZA 4OZHA 1ZHNB 3TP4A 4WWKA 4YDJB 5D9SB 3NPZB 2A1WL 4GAYB 4XNZC 3B9AA 3ZE2F 2VXTL 4ZSOE 3WN5A 5JW5B 5CINL 4JZJB 2XTLA 3KPSD 4HJGB 4IJ3B 4OIIL 2WBWB 5EO1A 1UQSA 5IK3A 1WTLA 1OLZA 5BRZB 3JTTB 5J6HB 1UWXK 2EH8H 5HYQA 5CIPA 3BQUC 4R0LA 4YUEH 2IPTH 2DM7A 4UT6L 4YXHH 4DCQB 1HQRB 5D6CB 4L3CA 5FO9A 1EVUA 5KSUB 2IQAB 4OLVL 5MHSE 4ODSL 3HR5B 2DWDA 2JJWA 5F89A 4L8CA 2QADD 3BO8A 1RUKH 3O3DA 1AD0A 1KUMA 2BVQB 2Z35B 3DRQB 2L4OA 4YDLB 4PJXA 4ODHH 1BZ9B 4TSBH 4JPKL 5ENWA 1S8DA 4HGMA 3QHFL 1A47A 1QKZH 5J7CC 2BSRB 4FHBD 2VDLL 3KPQB 5AUMA 4I3SL 4TYUA 1CU4L 1X5AA 3ZE1F 4GSDH 4OLXH 4PD4J 5D5MB 4NO2A 2VXSL 3OKNB 1AKJA 4Q9QH 1RUML 4PJ7A 5GGUB 4XI5D 2VYRE 4S1DD 2E7HA 3D85A 2FHCA 1K2DB 5E9DA 5BZDB 2X7LB 3QEHB 1MLBA 3HG1A 2DRUA 1I3RB 4GUPB 2X9WA 1RJZA 2ZJSL 5D2NC 5FM8A 5F1KC 3LZFL 1I9RL 1QFUL 5HHPA 2OTWA 4P2QB 1T1ZB 1AQDB 1G7LB 2DBLH 2FBOJ 2A6KA 4J3XA 1GGYA 4UIMB 3MBEC 2DMBA 5FUCE 1G9NH 4HUKB 5CZXD 1QRNA 2OL3B 1LWRA 1W8OA 2D9CA 4PJBA 2EH8L 3O9WD 3MLVL 5DRXB 4YE4H 1IGCL 4WFFD 3B2UD 3KJ4B 3MJGX 1CGSH 4OD3L 3LKNA 4C56D 2A6JB 4I0PC 1JNHB 4OSUH 2D4FA 3NIFE 1RJLB 3KDMA 3D18A 4EUPB 4HZLB 4YK4C 3V7MA 3UZQA 5CLTA 3TPKA 2OP4H 4NZTH 1KJVB 1UGNA 4NQXA 1XMWA 1Z0NA 3D9AL 4XMLL 3VW3L 1KPRA 3WKNA 5DJAB 5IJVA 2COQA 5EORL 2IH1A 3OJDA 2AW2A 4XC3H 43CAA 2PXYC 4UQ3B 3FT3A 4HPYL 5C6PB 2FEEL 1RK0B 3D9AH 1FNGA 4XMLH 4NOFA 3MGOB 1FHGA 2SEBA 3BH8A 5T1DH 2WUBH 5CP3A 4IS6B 2H6PA 4MDJB 5GGTA 5GRYA 2Y07H 3MV7E 4XPBH 4KZDL 1N0XL 2DQGL 4W81A 4HGKC 3ROLB 2EYTB 5BQ7A 4P2QD 3U9UB 5F93C 3SE4C 3DBXA 4OCXH 12E8L 1SJHA 4EI6A 3MXWL 3HG1D 3VWJD 1BF8A 4RNRA 2CDFB 1QFWM 1XH3A 3LS5L 2HYMA 4QHUA 3CFKB 4R8WL 3KXFE 5IVXA 4RISL 4XPHH 1JUFA 3JWOC 1MELA 3LZFH 3EDDA 4GBXA 5JHDD 2BX5A 1ZT4A 4PJ8C 4NWUH 4LLDA 2CLZB 5FYKE 5INCA 3JWOH 1JYWA 2O61A 3C5ZC 3NCCB 1B88A 3IJSA 2E27H 1BECA 3LKSA 4PTUB 1GJIA 3LEXB 3QDJE 3VJ6B 3I3EA 3ZT5A 4WW2B 1XGTB 5CSZB 4UNTA 1NGQL 2MCG1 1YDPB 1B4JL 4J3OC 4U33A 4X5WA 2CH8A 1R24A 3F12B 3AY4C 4NNPH 1VADA 2JIXB 3P11H 2ZSWB 4QRRA 2NZ9C 4D8PB 3UPRB 1SEQL 3BPCB 1P4BL 2CK2A 5JORA 4OV5B 1GPOL 4POZD 1BFOB 4LARL 2VXVH 2J5LB 4W68A 5SWQA 4RWYH 4A2LA 4UV4L 4J2XA 4MAUH 5FM5M 4JKLA 1M7XA 1DVFC 4NQCD 2NY5H 3LQAL 4H8WH 4X7SL 3WXWL 5KJRH 3KXFB 3GIVB 1CLZH 4NRXB 3G5VB 4Y4FC 3RL1A 4KDTA 4X0KA 1CXEA 5M94B 2OYPA 3VI3F 4TOYL 2C7UA 3G9AB 1BQHA 4G7VL 1X3DA 2BC4B 2BHYA 2OS7A 4OZFH 4NZRL 2AABL 3RUGF 3MXWH 3MRLB 4CW1A 4L3EE 4ZFOL 1ZHLB 2C9AA 4UIKH 3V0AC 3FQWB 2YRLA 5T1KD 1PEZA 1QBMH 1FDLH 3GMMA 4UDTA 3PWVB 4DOHB 1EHXA 1ZSDB 2V6HA 3WDHA 4ZFOA 1F45A 3QDJB 4J1UA 1NEZA 4HIEB 1CBVH 2RBLA 4YHML 5IF0A 3ULUF 3WXVH 2C1OB 1CT8A 2NZ9D 2VLRE 1MFEH 1UB6A 1T2XA 5JMRA 3GJFK 2VIRA 4WCYH 3SE8H 4ETQB 3G9VA 4JFDA 5HHOA 4M9PA 4MZ3A 2VLRA 4PJAB 4O51A 1ZLUK 3P9LB 1ADQA 5CIPH 1NLBL 4WFHE 4IRSC 1MFNA 4PYHA 5C0AE 5DD5H 5BS0E 4H88L 3G5XA 4ZUTB 5I1CH 4QRSB 2F19H 2LV4A 4R97B 5IBTL 3K3QA 5J9PA 3MNVB 1AGDB 3SHSA 1L6XA 2M8XA 5GISH 2HG5A 5SWZD 1OAQH 3EDFA 5D71L 1W72L 5T1KB 2J7LA 3LN5B 2DIAA 4C57C 3U9PL 4Z0XB 3WFDL 4XHJD 3VRLE 5CP7A 3L1OH 4WVRA 5JXEC 5E8PB 1MJ8L 4MA8H 3ULVL 1U8OA 2RJMA 3MRRB 1RZKC 1KG0B 2X4TA 3BP6B 5DJ6B 1KJ2H 4QTHA 1S9WB 1DQDL 1X5ZA 3MJ6A 3PDOB 2XY1A 1IC5H 1T7VA 4Q2ZA 2AABH 2BZDA 2HJKB 4Y4HD 4XXDA 2OLDA 1LEIA 3EZJB 4R26H 1R3LA 1RAMA 4NM8H 3EOBA 3ARFB 1OW0A 4H0GA 4LASH 4FG6D 1KPUB 4NQDE 1QLEH 4M1DL 2AEPH 3RWFB 1BQLH 2D7QA 2X4UA 1U95A 2PXYD 4MXVE 4BKLA 1N7MH 2BVOA 2E9WA 1UZ8A 2CR6A 4I13B 4TUOA 4M62H 1IAII 2XTJE 4ODXB 4UDUB 1T21B 2W65A 3TA3A 3UC0H 4DKDC 4XAWH 3QG6B 4OCRH 3JTSB 3OR7A 3BT2L 4O9HL 5HPMA 2EKSB 3T2NH 1M71B 4XCNB 2FJGB 2NR6D 3HAEG 4Q6IC 4LBEB 3AROA 4KV5F 3BDYL 3U36B 5DD6A 3E1F1 3T4YB 3MV9A 4WI6A 5KG9A 1MY5A 1UH4A 2V5TA 4N9GA 2CO6B 1T03L 3EYVB 1YJDH 2Z31B 1NGZB 4LOUC 3P9WB 4OV6F 1OM3H 4P2RA 4PY8J 3SOBH 3AY4A 4ZMAT 4Z95H 5FGSA 1B0WA 4NUJB 5HYSA 4F7TB 3PHQB 1N6QL 3E6HB 5GZOD 3M07A 4B5EA 4RBPH 2A77H 3G5ZB 3NA9H 1P5UA 3KYAA 5IM7A 4HH9A 2D2OA 1EEYB 3HFMH 2ZCLH 3OGCA 3X11B 2Z92B 3L1OL 2YA1A 1SJEB 4ISVA 4X6CF 4R8WH 2YUWA 1H15B 3GB7A 3K2UH 1BJ8A 1JI2A 3L95A 5HYQB 5AZ2L 5IHUL 5A2KH 3C5ZA 1FIGL 1EMTH 5C2BH 3O6FB 3UYRH 1MCDA 2GHWB 1QBBA 2IBZY 3EUUA 3X14A 1IGJB 1T20B 4CRPA 1LP9F 2Z91A 4U1IB 2VSCA 5AYUH 4BUHA 2DQEH 1JPFB 2V2XA 4JHZA 1T0MA 3QO0B 2HMID 2ARJB 2EE9A 4HK0B 3U46A 1Z9MA 4IOIA 2BVQA 2Z35A 4JM4H 5B39A 1N6VA 4QRTB 3FQRB 5E4EC 3GI8L 1KJ2A 3RDTB 2EIZB 5AZEH 1FNLA 3QH3A 2WIIB 4O2EA 1TPXC 3X13B 1IBGL 2IFGA 5HI4C 2AXGB 5GXBB 4U6YB 5D7SH 4Z77A 3QCVH 4XH2A 4TNVF 1KPVA 3HE6B 4UIKL 3U30B 4JFEB 3N1QC 3FB5A 4MNQE 2XYCA 2EDBA 4UNUA 4XCEB 4F7EB 4X6DB 5MEPB 2CDEB 2IBBA 4GKOA 5F6HI 3N50A 1MEXH 1CLZL 2NX5E 3QAZB 4B53A 3FFDB 4QHMB 2AQ1A 4JO1L 1Q0YH 1OB1A 1N5AB 5DK0B 4UQ2B 2WZPD 1KENL 2GYSA 3W0WB 3NIGF 3QHTC 2DICA 3EJYC 3SDAA 4H5SB 2EDOA 1OSZB 4S10A 4NZDA 4F80A 3Q6GL 1L0XA 4U3CA 2FIRT 4N90D 1HSBB 1GVIA 2NY2D 1NUFA 3KPNB 3VGHA 3VFNB 1H5BB 5D1QD 2VXVL 2R8SH 3RY6C 4I4WA 2XRAH 2WWKO 3CFCL 3QNZA 1I1YB 1G6VK 2YSSB 1CZ8L 4ZQKB 5JZ7C 2ZUYA 4HGWA 4JM2A 3MA9H 5ISZA 3VDCA 5EBLA 1NFDF 1LVEA 1D5ZA 5IVXF 5DJ8A 3LSOB 1QBML 3ZTNH 3TZVB 5A2FA 2X4PB 1FFPB 4Y1AE 1DUYA 3ULVC 3O2DH 1VKXA 4G7VH 4HWZB 2VXSH 5DJYA 2ADFH 1XGYL 4U6TA 2RFXA 5C92A 1OTUC 3PG2A 4NJ9H 3IDNB 2C3VB 1RI8A 3STLA 1ZA6A 5FCSH 1CICA 1HE7A 5FYKL 3SKMA 3BPNB 3EAKA 4NGHL 1QFPA 5GQBA 2UV3A 2C4FT 4J8RB 3W0WD 2GAZB 2D0GA 3QDHA 2DI8A 3H9YA 4P46A 3MLYH 1U8IA 2ADJB 3DIFA 4JFOA 3HI6H 4EDXA 1QO3A 1U41A 3HTLX 3GBMH 3HPLA 5BO1L 2VUYA 2V9TA 5ESQA 1IGMH 4L5FL 5C0EA 3MLYL 3S35H 1J0YA 2BJMH 2FGWH 5I2IA 1L7IH 3GRWL 3RU8H 3GSQB 4PJHE 1QR1B 1NL0L 3WNMA 4HQQH 3WLWD 1MQ8A 4NQEE 1WF5A 4Y5YB 5C0NC 5DGQA 3UAJD 3B2UC 1QKZL 2KPNA 3TYFB 3FB8A 4U1HB 5F88B 1S7VA 1TTUA 2XQYG 4FOMA 3IJSB 4XP1H 3DUUB 2HN7A 4O00A 3X3GL 1UC6A 3BGAA 4S2SA 1Q8MA 3DYPA 4Z7WB 5EIIA 5FO8A 4JZNB 5T1LA 1TVDA 3SY0B 3QPXL 2DMKA 3BGMA 4LAJH 5TJWK 3CVHH 3FRUA 4NN6B 3WNNA 2GSGA 4X6FA 1DUZB 2ADGA 4IRSB 5EU7E 2CRMA 2MKLC 1T2QL 3GSXB 4HC1A 3ILQD 1CIDA 4MD5A 1KIRA 5C8JA 2EEBA 5JW4Q 1NSNL 1D5MB 3GGWB 1MCRA 4MMZC 5HI3D 2OL3H 4AG4H 3ZYIA 4NJAH 4PRBB 3IF1A 4PJDF 4KY1H 3CCHB 4X6CE 3DO3A 5H2BA 1UH2A 1B2WL 3KPRD 1CDCA 1JI1A 1XIWC 3D25A 3JXAA 3GIVA 4MJID 1MFCH 1KC5L 3HI5H 4NO5A 4G9FE 4X99A 2P49B 3PNWA 4M4PA 1LEGA 2IALA 2N56A 2JF1A 3OXRA 2DLHA 3MFGB 2A0LD 2WBJA 1A6AA 3CUPA 1S7TB 35C8H 3RWCA 3OF6A 5CKGA 1CD1B 3BIKB 3IDJA 1QZ1A 4LHUA 4G5ZH 1ZHLA 3QUZD 4BZYA 1FFNA 1M7IB 4PR5B 2X4OA 2WSKA 4CBPA 5E6IA 2OZ4A 1PG7X 3OKMA 3X17A 2NY2C 3PQYA 5C08E 4JQVA 2LVCA 3MNZA 1CTNA 1YC8A 2XWTB 1NMAL 2A74A 4PJ9D 3T1FB 4P5KB 1N26A 4DK6A 4XBEL 3CFDB 3QUML 2FHFA 3MLVH 1P6AB 1A6ZB 5CSBA 5GS1B 3JZ7A 4WWID 2Z8RA 2YXFA 3LV3A 4MQTB 5DJXB 1YEEL 2AJ3A 3D3VA 5DQDH 2AK4A 4Z5RA 3FMGL 5EUKB 4NNXA 5L2KA 4NC0B 4ELKA 4PLKC 3C2AL 1NCNA 2ITDB 1UWEH 2FH8A 3IXTB 4MA7H 3WYRA 1I85C 4GW5A 4MXVF 3FAWA 4ORZC 3MV8E 5DVOA 2MHAA 4HZAA 3V5KB 4M1GL 3IFPB 4AH2A 3ROOA 3VGAC 3Q6FB 4Y2DC 1S5HB 3EFFA 3A0OA 3QUZB 3K8LA 5BJTB 3WO4B 4WI9A 1HNFA 1G9MC 3UTTB 1GGIL 4GLRI 4FQXB 1O7VA 4RFOH 3MOAL 1HINL 5HVFB 2ESVD 3O41A 2FO1A 3DOSA 3B8SA 4QRUB 2P5WE 3D85D 1J11A 1N64H 1KT2B 1XF3A 4ZFZA 5F1OB 5I1LB 3FONA 3QIWB 1FYHB 1EX0A 4M8VA 3VFSA 4WNQB 1FIEA 2A2QT 5I18H 5I71B 3SKOA 1W0WB 3N1FC 4JQXC 3BIBX 5FYLL 1MJUL 1A3RH 2DYPD 4UOW1 2VKXA 4JZOA 4HWBH 5IQ9B 1AHWA 3O4OB 4GRMA 4XVSH 1MNUH 2W65B 2ERJB 4LCUA 5DJ0B 3HN3A 1Y6MR 2FO4A 4UT6H 2FJHB 3S3SA 5CCKH 2W0FB 2YXMA 2OR9H 5DVKA 3RZCD 2K9UA 4RFEB 2HVKB 2FX7H 1QPPA 4AIOA 5LBSL 2APBA 3TJHC 2DDQL 1O7SA 3B43A 4F8TA 5EOTB 3WO3B 2FNBA 4OTXL 4HHAA 3QQ3B 3SDCA 4MNQA 1OGAB 4FQXD 4H26A 2J8UF 4LEOA 5A40E 1PX4A 2A9ML 1BEYL 5C0CD 2CQVA 3FT2B 3OX8A 1IGIH 1IZJA 5CFHA 1E6JL 3P4NB 5C3TA 1H3XA 3QDGD 2MCPH 3RVTC 1UJ3B 2GK0B 1DQDH 3DVGB 5MP6L 1E6JH 5C07B 4DN3L 3HKFA 3BH9A 4GXUM 4AEIH 2G60H 3VGAB 3MLSL 3WEXA 1FL3B 1YYLL 3GHEH 2YPLD 2W0LA 3DX7B 3R1GL 4U2YA 1IC4L 5HVGB 4OB5L 1CWVA 3ECBA 3H2WA 1CU4H 4GG6F 1FFOA 2AEIT 4RZCA 5HHOE 3WFEH 1GGBH 3EGSA 1FVDB 3BZFB 3UTQA 2Z91B 2WP3T 3P0GB 4CU6A 1EVTC 2P5ED 4TSAH 1KBGH 3U46B 4IOIB 5GGVH 3MRDA 4O2FB 4R4FH 4APQA 4L4JA 2FX9H 4Y16D 1EHLH 5KVEH 3EO0B 1J18A 4JHWH 3MNWA 2AV7A 2GTWA 3RI5K 3DPBA 2F9BT 5D7LE 3TO2A 2DQTH 2YN3A 3OKOB 4DKEL 2GJJA 3CZFA 1RZFL 4BFIB 2AXGA 5TDNA 5EZIH 5F1NA 4H25A 1K4CA 3RGHA 1S9XA 1SEQH 3L6FA 5E8NB 3FB5B 2XPGA 4FQ1L 1NGPL 5F9DC 2QQKH 3D5OF 4ZFGH 5T1MA 5HHNA 1MHCB 4LLMB 5MEPA 1AP2A 4PRPE 2C4XA 1AO7D 3WLBA 4OZFA 3FOMA 2AEQL 3LB6D 3WHE1 2QQLL 1PKQE 4G6JH 4Z7QE 2VISA 1FBIL 2E27L 3ZE0F 1VGKA 1XZ0B 4LCWE 5CEYB 4YDKH 5IJKA 2HVJA 3QPQD 5I15H 1KCSH 2D31B 5IMMB 2YD2A 5JA9A 5KOVC 4IRJC 4QOKD 2YBRA 2RHEA 3MBXL 2Y5TB 1RZKL 2ICES 4PBVC 3S5LA 1FQ9C 1YQVL 1H5BA 4PGEB 1BZQK 5GPRA 5LJYH 5EO0B 3K2UL 3MA7A 4GRWF 4XXCA 1IGTB 5ESVA 4I3RH 3UBXA 3GFUA 4HCRL 3VGDA 4AT6A 2R2EB 3LDBC 4ZUVA 3GI9H 1NAKH 2EE3A 4UTAL 5IFAH 5C0AB 1U8HA 3H9HB 1P9MC 5F7YC 2JJTA 3NH7L 1LO3L 2HWZL 4NO0A 5KAQF 3O45A 1FFPA 4L3CB 4LGRB 4ODVL 4Y5VC 3RWGA 4XVTH 1BZ7A 5GS1C 3WNPA 3TV3L 1DVFD 4KPHH 3MRQB 5DT1L 1XGUB 3D2UB 4P3DB 1XGPB 4YH6A 4F8QA 3V4VH 5KSAC 1X4YA 5B8CC 1BZ9A 3PV6A 2DN7A 1WCBB 2ADIA 4XMPH 2VDPL 4NZTL 2O5YL 1F11B 4OLUH 2R23B 1HYRC 3NFNA 1GHFH 1NC4A 3DVIA 3H3BC 3RTQC 1B0GA 3BWAA 1MAMH 3WJJA 4GRLB 32C2A 5KTEH 5DF0A 1YPZF 1KGCD 1CR9H 2O5ZL 3FO9A 1QRKA 4JR9H 1YMMD 5TF0A 5ICYB 4U6XA 2EXYC 4I77L 5I17B 2EDYA 1KXQE 3L3HB 3REWB 3OKNA 1N0XH 3L3KA 5LGHH 2G2RB 4F7PA 3O4LA 2XOTA 5CJXA 1ZS8A 2VRAA 2VAAB 5HGDA 3P0VL 4G8FA 4ODWA 1YECL 4HC1H 1I3RA 4GUPA 3T4AB 1NBZB 2VLJB 3VFGH 5EOQL 3MRFA 4Y5XB 2I9LA 4BSWB 4L8BB 3FO0L 4M48L 4G6FD 3LQAC 3RWHA 4G8GB 4YZFF 3QDMA 1DDHB 3Q1SL 5GJTL 3O2DA 2OJZL 1RHFA 3T65A 2VWEE 4EI5C 5BW7A 4KMTL 1JVKA 4OM0L 1HXMA 2OX5A 4CJ0A 1LNUA 3JV6B 1CGTA 4ZUSA 3BMWA 1QFWI 2Y7QA 3DX9A 4YHIA 2BNQA 1NCBH 4S1SH 3QIBC 5ERWB 2GJ6B 2NXYB 5F9OL 4DEPB 4OD2A 4PJHB 2BDNH 4X4YB 5K59E 4NHCH 4PS4L 4ONHB 2X1QA 5KS9B 2C1PA 1C7SA 3HLAA 3Q6GH 4L4TB 3QWRD 1EHAA 2BVUA 5C0RL 4LL9A 3QDME 3H6JA 3O2VH 1EPFA 4EI5D 1EEZA 5GRVL 3X3FL 3O8XA 2E5EA 5DQJB 1UM6H 3OHXB 1I8MB 3PHOA 4AY0A 3L9RA 3W11C 4S0TD 1YEFL 2JJUA 5F8QC 2F8VA 3C2AH 1IKNA 2VQTA 4J3VA 3NCJH 4LCYB 4HKBB 1WCQA 3MV9E 2DTMH 3NA9L 5D1QC 1L7TH 1UB5B 1T5WA 2MPAH 4WFGD 4OT1H 1WFTA 5BQ7B 3WFBH 4G6FB 4GKSA 4G8GD 1KJ2L 1A7NH 1V3MA 5LCVH 2NY0D 4MA1B 5JW4M 1UA6H 3AC0A 1K5NB 4GS7B 2EDLA 3MNZB 1LDPL 1XH3B 4UMGA 3KPSB 4N0YH 1IQDB 1J05A 3SGEI 5FKPB 1NCWH 5JHDA 4TRPL 3LRSB 4LGPB 1ACYL 4LVNC 1J0JA 1J10A 2R0ZH 1UG9A 4GKNB 1CDGA 1U3JA 3DV4A 3LV3B 1BOYA 5I1GL 3MV11 2HFFA 4UI2A 5I1JH 5KSBB 2ZUVA 4FFVD 4KVCL 4KK5D 1WAAF 2BNQE 4MD0A 1ZHBA 3S7GA 1R0AL 3IXTA 1BQHG 4OCSH 3V5KA 4GKZA 5ALBH 3ZLQC 3Q6FA 3PL6B 5C0IB 1I3GL 1OD7A 1WIPA 3QULA 3NGBC 3RZCA 4HIJB 4DGYL 1BFOA 4DZ8B 4NN5C 4ZOEA 1S7RB 4X8JB 5I1KL 2VUOA 3P4OB 4U3HA 5I74B 5KVDL 1BREA 3TH3T 4QRUA 4X5XA 3H7BB 2DLFL 1CDYA 1NJ9A 1UENA 4PLJC 5C9JB 5JPMA 1MFAH 4DKFH 4WNQA 1MLCA 3KLSA 4OZHB 4LNRA 4MZ2A 2HRPL 5B4MC 2DQIH 1N6QH 5B38G 4MVBD 5JHLH 3FQXA 1H3VA 5DQ9B 3TWCL 1AHWB 4MCZB 4I1NB 1FNFA 1DE4A 4HBCH 4YWGL 3W5MA 4OFDA 4FFZL 5ICZB 5J6HA 1IL1B 1UH3A 1NCAH 3TT3L 5ESAB 3UTZB 1KN2H 1MIMH 2AAVA 2QLVB 5K9KA 4KUCF 4YDKL 3HE7A 4LGSB 3RVTD 4LSSH 4P0DA 3O9WB 3SDCC 1JWSA 1HQRA 4N1CA 2QQLH 5TGBB 2EIBA 4KXZH 5DJ2A 4LQFL 4WEBH 4DQOH 2FJFA 4ACPA 5E95B 4I5BB 2EC9U 4YIQB 4C56B 4KZDH 3QG7L 5C9KA 4RAUB 1AD0B 3BAEL 4QTIL 4JFYA 4P3WA 5IOPB 1CGYA 2K7QA 1IC7L 2Q86B 4ZS7H 1OGTB 1LQSR 1BX2A 4G9FB 4DOHE 1FYTA 2VZUA 3N06B 1HSAB 2GCYB 1ZGLP 3BXNB 4XBEH 2AJYL 5K33A 1SMOA 4N5EC 4W4NA 4QOKE 5D5MA 5GIRA 4DVBA 4IRZL 1FL3A 4KRPD 5CD5D 3LPWA 3R06A 1VGEL 3BP7A 3FT4A 4G6ML 4DEPC 4JDZA 5CJXC 2FX8L 1FC1A 3CLFH 1WUNT 4PGBA 4MQXD 5ELIA 3BN9D 2PTTB 5GGUA 4M61A 3QO1A 2Q6WB 1QQDB 3SDXA 3HG1B 2ICWJ 1FZKA 2FEDC 2LE9A 3C2SA 4JRXA 2H9GA 5FFLA 4X8XA 2OTWB 4N5ED 4YPGA 3TPUB 3D69B 1MCHA 4Z7NF 5IEHA 3MROA 2ZPKL 3SE9L 1SJVA 1OTTD 4N8CL 3ZT6A 3B9DA 1F42A 2BP3A 4TUOB 4U0RC 5GGQL 5GGRA 1IM9B 3TBYB 1U3HC 1OP3K 2D0HA 3ARWA 1U8KB 1RFDH 4HWBA 2OTPA 1EO8H 1RJLA 2Q7YA 3TO4D 5GS0C 4LU5L 4ETYA 5A43C 2CR3A 4G43A 4AENA 1OSPL 2XPGB 5FUZL 4NRYB 5IB2B 2EECA 1IMHC 4NO0D 1YJDC 3IKKA 2JIXD 3UROR 3LEYL 4JY5L 4UILL 2NZIA 1MHCA 1KTLB 1QYGL 4LLMA 3V8OA 5HVHB 3ARBC 1INQB 3DVNB 2IADB 5FUZH 1YMME 5KSBF 4Y2OA 5HGAA 3K7UA 2SEBB 3WHE0 5C71A 4YQXH 4HIXH 5FYJL 5IESH 3SE3C 1C12A 3D0LB 4X98A 1MCPL 4QHLB 3H9SD 4OM0H 1MQKL 2EYTA 2J8UA 3MRCA 3U0PA 1W2KT 2QTEA 3OZ9H 1AGEA 4QO1A 5I66B 1SJHB 4EI6B 1MREL 5DUBB 1AIFB 5IIEA 3TCLA 3CLFL 5E2WL 1DQML 1KCRH 4L1DA 1ZTXL 4KVCH 4XWOC 5GGVL 2H2PC 1B0RA 3MA7B 2BNUB 4P2OC 4JLRB 1PY9A 2ORBH 1S7XB 2B2XL 1ONQB 5FM4A 4DVRH 1Q9OA 4AT6B 4GBXB 1YNTA 3EOTH 3C5ZB 1J8HB 4M7JL 5AG9A 4JHAL 3LKRA 3QUMH 1A8JH 4NO0B 5BV7C 4LEXH 3IDYC 5HDLA 1OHQA 5AAWA 2E7LA 3X14B 2JB5H 4P4RA 1CXHA 4HXBH 4EN3C 1BZ7B 4NYLA 3QO0A 1J1PH 5D7KE 4X9IA 2IAMC 4YE4L 1XGUA 4PRNA 1P1ZA 4L9LC 4P2CG 3KLHC 2D3VA 2BY3A 3QNYA 5E8DH 1IC5L 4JE4B 5HY9B 1HKLH 4QT5A 3WDJA 1RUKL 3H9SB 4DKEH 1K6QL 2CPCA 2P47B 1NGYA 4MQXC 1RZJH 4P4KB 2WIIA 2F53B 1QBLL 1FL5B 1R5WA 3TIDA 5ECJE 1NBVH 3VD3A 3WDIA 3VXTB 3VMPA 4ZXBD 3OB8A 3ZDYE 1K6QH 4DJMA 4KKLD 3MREA 5GRXG 5C0DA 3DMMC 7FABL 5FDWA 4RFNB 4Z78A 3ARBD 3REWA 4PJ8D 2J1KA 3RVWD 3RPIA 4UAOC 3VFOB 1AXTH 3NABH 2YD4A 3FCTA 3W9EB 1UXSB 2IPKB 1TNNA 4G8FB 3ARYA 3C60D 3T4AA 3NVQA 4UQ2A 1SBSH 1T04B 2Z8WC 3CLEL 3VFRA 4BSWA 3AAZA 3UZEA 2PYEE 2X1WL 4TVPD 3CXHK 4Y4KA 4NQEB 2QR0B 3GSVA 4Z76A 5BW7C 3VG9C 4NKIL 4QKXB 3LKOB 5DWUH 5TE7H 1E4XL 2H3NB 4G5ZL 3OL2A 1ZEAH 1HH6A 4OCYH 3VXSB 1OVZA 2BCKB 1P7KA 2DL9A 4O2CA 3O3BB 1G7JB 4FQIH 4UT9L 3WFHA 4UOW0 4QRPD 1T1XB 1KN4L 5ISZB 4K7PH 3OR6A 3BZ4A 2MOVA 1F90L 2J2ZA 4GW1B 3BAEH 1AXSB 4QTIH 4XPFL 5ETUA 1P84J 1IAMA 1YEKH 1DZBA 2AI0L 5C6WH 1URLA 1F6FB 4HDIB 2BVPB 4R4BA 1EEZB 2HKFL 4CNIB 4JVWA 2CKBL 5A2IH 1JV5B 3L9RB 4P23D 2NY6D 1UCTA 2AERT 2AS5M 4GRWH 4MJ6A 2I27N 2IANE 3OJMB 4OLUL 5C0BB 1GGCH 4NHUB 4JKMA 2HG5B 1Z9OA 4ALAL 1ZLUH 5E0QA 4PJBE 1KCUL 4TULH 4GXVH 3FFCD 2ADJA 3DIFB 3WIHL 3WLWC 3OKKA 1T7WA 1XR9A 2F5BL 5BV7L 3F58H 4HUXA 4JDTL 3CJJA 4LSRH 4RGMB 3RWDA 2DD8H 5F3BB 4N9OB 4QTHB 1S9WA 4F7CA 4MB5A 3S37L 2HJKA 3U4EA 1RUQL 3CMGA 1CFNB 3SGKA 1LO2H 3QCUL 4D0CB 1JRHL 4HC1L 1I1AD 1X5GA 2P5EA 4HS3A 4XCFH 3LEYH 4UILH 4M1CC 4OCMC 1NFDA 3DSFL 5L2KE 3GMQA 4LSUL 2F58L 3DUUA 4KKNA 1T21A 3TA3B 1TTGA 2H1PL 1JHLH 3GHBL 4K3EL 1S7UB 4WFED 2YD1A 1HHGB 2NW2B 5ID1A 1EFXB 4ZO8A 4IJ3C 1A3RL 4U1GB 2X4SA 3T0AA 3V4PL 2OI9C 3U36A 1S7WB 1Z5LB 1HHHB 1T2JA 4OZIE 4S1SL 2ED9A 1FIGH 4MJ5B 2NW3A 2FHBA 1D9KC 1G0YR 5D5ME 3KPLB 4K9EL 1G6RH 4PJ8A 4KQ3H 4Z7UE 3SE3A 1T0NA 3HE6D 4JFED 4M93C 3LKQB 4LDLB 5I8EB 2A9NH 4FZEH 4JJ5A 5KS9E 4CVZB 4BSVA 5GRVK 1IJ9A 4Y4KD 1OARL 2P5WB 1LK3L 3WKMH 3JWNC 1BIHA 1FGNL 3C60A 2V5YA 3QPQC 3HA0A 3P4MA 4YBLB 4N0UA 1PW3A 5KVMC 4M00A 5D93C 3CVHL 3OPZL 2ITCB 1Q38A 2X89A 4IRZH 3VXUB 4PR5A 1YY8A 5T3ZE 1N4XH 3DO7A 1EFXD 1TITA 1ZT1B 3ZDZE 4NCC2 3GKZA 4Z7UF 1VCAA 5J13B 2NY2B 3WHXA 5H94A 4NKDB 5CWSA 1T20A 3JWDC 4YDLC 5CGYD 3VXRD 3CSYB 4I2XE 4D9RE 5HI4D 1KCRL 1FVCA 4FQQB 3WFEL 2XXMB 2O26U 5GRUL 3MJ7A 1ZWIA 4YJZL 3PWLA 4Q58C 3OJVC 4BUGA 5DJXA 4QRRD 3BJ91 5DD3H 1TQCB 4CVUA 5IMOA 3NIGE 4RRPG 1Q94A 5ANMB 4QF1A 4LSQL 1KIQB 4WEMB 5DTFB 3I85A 1ZLWH 1PGRB 1A9BA 4KK8C 4XPTH 3IU4H 3FQNB 4ZD3H 3QI9C 5TQ2L 1RZFH 1W72B 5TE7L 4XNXH 3UO1L 5JHLL 3ILPA 1OY3B 3JUZA 4IOSD 3JBG7 4NIKB 1TMCB 3VFWA 5D1ZA 4R7NA 5EBMA 5I75B 1NAKL 4FABL 4ONGH 5GISL 1WGOA 2GK2A 1FZKB 2XIDA 3MMEA 1TJIL 4OAWB 4P5MB 1OTUD 1XF2A 4B7IA 4XCYB 4JZJA 5IK3B 1IRAY 3VFSB 4XNQA 3NPSC 1OSZA 3ULVD 1T2QH 1MCEA 1QEWA 4YDJA 5D9SA 3WMSA 5JXED 2NLJB 3I84A 4OCRL 5CZKA 5CIPB 1WZLA 5HDBF 1NMBL 4OCWH 5F21B 3NAAH 2XWJA 1OD9A 1REIA 2VWEC 3QBTB 4HEPG 4ELME 5E2WH 5F7DB 1Y6KR 3BUYB 4P5TD 4HUVB 1IQWL 1IC1A 5C0FB 3GK8H 3ZKMC 3OJ2C 3DURB 1IAIL 3NTCL 1U58A 2P7TB 2X4PA 4A2MA 3AREB 4ZXBC 1F13A 1ZEAL 4FQCH 3DLQR 4Y88A 2QSCH 4KAQH 3IDNA 4K94L 2VLKD 3U4AA 1F3JB 1SJXA 5I19L 4OSUL 3QEGL 1M1SA 1WFOA 4MQSB 1JNLH 1S8DB 3P4NA 4V2CB 5TQ0H 4NQDA 1N6UA 3RI5F 5F44A 3RY5A 1QO3B 3KPSE 3CSBA 5KSAD 4YHZL 3KLAB 1MCIA 1GHFL 2FH6A 1K2DA 5BZDA 5J57B 2FL5A 2X10A 2X42A 3ARDC 1DQLH 2WW8A 1PZ5B 1UKQA 4EN3D 1PG7H 1GZPA 4JG1H 2ZG1A 4PJ7B 1T1ZA 1DBMH 1F02I 2XACC 4JFQB 3RTQA 4PY8I 4H8WC 3HMXA 1Q0XL 3FB7B 4P2QE 4QRPE 4GRWB 1L0YA 1B9ZA 1NCAL 2WMPA 1K8IB 3CFJA 3BFOA 3MRBB 2EDQA 2HJFB 5T1LB 2A6JA 1HI6B 2CRIA 1XGQB 5IKCB 1IEAA 2GSGB 4X6FB 2ZOLB 2FX8H 4EUPA 5KZCD 4MAYD 1MH5B 3IS1X 2MCPL 4X9BA 4X6BA 3DRTB 3U83A 3LKNB 4MD5B 5ALBL 5C8JB 3DX6A 1QNZL 5TDNB 4JRYE 1QLFB 1RU9L 3ZT7A 4ERSH 1EEQA 4HZLA 2AXJA 2RR3A 4P3CL 3VWKC 4NUGL 5EU6E 4NQVB 4N1EA 3FFCE 5FGRA 1N4XL 1PKQA 5H2BB 2W60B 3V4UL 1HIMH 2FSEA 4HWBL 3ZKSD 4NO5B 1MCNA 4QNPE 4ZTPL 4LPTA 1FNGB 1IVLA 5EUOB 3WJLC 1ZLSH 2ESVB 2OR9L 1YPZA 1MQKH 4JQIH 3NZ8B 3Q5OA 2AXFB 3SO3B 3BPOC 3ROLA 2C3WA 5D5MF 2B4CL 1YNLH 2AJZB 3DBXB 4X7TA 4NFDA 4OLYL 3RWEB 4J4PD 4WO4B 5DR5L 4OCNC 3SKNA 3IFLL 3QNXA 4WWKC 4I8DA 5I30L 4C56E 4S0SD 1LP9A 3SN6N 5EOCJ 4LLDB 1S7SA 4PGEA 3P30L 5T3ZL 2YHGA 4P5KA 2NY1D 1JUFB 1MSPA 4HS8H 3HMWL 5ESVB 1I8IB 1A6ZA 5DK3A 3ULUE 3D87B 3UBXB 4WTWA 4XGZB 4LRNL 3IAPA 1UA6L 1MRDL 4TN9A 5DXWA 3BZ4B 1ZKAA 4ZUVB 3UDWA 3RIAF 4XT1C 4XP1L 1TZIB 1AQKL 2XKNB 3QG7H 1I9EA 4ELKB 4HDIA 2NY1C 3HPJA 4OM1H 4R4BB 3EIFA 1J8KA 3PWPD 4U05A 1M4KA 1MHHA 4KROB 4G8IA 3I3DA 1FYTD 3MV7D 4Q7DA 5FHBH 1OGAE 4NC2B 4PP2B 3VI3E 4PJXE 2DQCL 5C0CB 3GKWL 4WHTB 4XPBL 2EH7L 4XP5L 3N1MC 5C0BA 2Y06H 1AXTL 3NABL 1T89A 1F11A 2L0DA 2PUQT 1WITA 3TGXA 2UZYB 3D48R 4OCSL 1JF1B 1UEMA 1KTDA 1KTRL 2VLLB 2X09A 2H32A 1A6TB 4NJAL 4D9QD 3HC3H 2OJEA 5I8OH 4ODBD 4ORGA 4Q6IB 2NTFB 3WL9B 5T3ZD 1J5OL 5BS0D 4UNVA 1YNKH 1MY7A 1U8MB 4O02H 3L3HA 4BZ1L 1HEZA 3QEQA 1AKJD 2CRZA 1CXIA 4UINH 3L7FB 3SKOB 4F7PB 3SDDB 5C09B 1FJ1A 4KHXH 2R4RH 4FQCL 3BRFA 1WBYB 3NCBB 4ZPTA 3VCLA 5E6IC 5DYOA 1I1CA 4FQ1H 5E56A 4N68A 2HTKD 1A3QA 2X4SB 1NBYA 1VFOA 1P69B 2VZVA 4BK4A 2P8PA 3T0EC 4Y16B 3BW9A 5IGXH 3CFBB 4JY6B 2DKMA 1UWEL 3NACL 1MF2H 2Y7QB 5F8RC 5T5NF 4EIZC 2WAHA 4HS6B 4I48A 4PRID 2GJ6A 1ZLWK 1FLRH 3WIFB 1WQVT 3NAAL 4KZEL 4XAWL 5I1HH 4LEOB 3GSNA 4RX4A 3UTOA 3NOIA 5F3HA 5E5MB 3KPMB 1X4XA 2PKDA 4N8PA 4QRSA 1A1NB 1ZGLA 1BVLB 5IB1B 2AJYH 3MFFB 4JJ5B 4BJLA 1UVQB 3KGRA 4HUNB 4I0KA 1DEEA 4BSVB 1DBKL 4OQ1A 1RY7B 3TFKD 5CP7B 5GGTL 3ZDYF 2O5XH 5GGVY 1RIHL 1KG0A 1DBJH 3MRKA 1ZGLM 5GGSB 3MSPA 3BP5A 4Y4FA 5J11C 5F97E 3I50H 3IETB 3Q2CA 4RZCB 1U8OB 3MRRA 3EOBB 1R5VB 3M8OL 3WHXB 3DVFA 2HFGL 4PFEA 3CX5J 3O81A 1AR1D 3ZHLA 4DWHA 2NY0C 3DNKA 4ODXA 2VMFA 5JIKA 3TFKC 3CZJA 1LEIB 3JTSA 5DFTA 2FZ3B 1ZWIB 4XCNA 5TF1L 3L5WA 2R1XB 5C0AD 1U95B 3TVMB 3G04A 5B21A 3MNWB 1TZHA 4S11A 3C5SB 4MXWL 4BSJA 5IMOB 4HPOL 4C59B 3OKOA 4FS0A 4N9GB 4BFIA 3QA3A 4XWGH 3S96B 2J8OA 5LBSH 4XZUB 5FM5O 1DVFB 1GSMA 4UU9A 2IANB 1A7OH 1J1OH 3VWJC 3T0EE 1WZKA 3C8KB 4NNYA 4PBXA 3KJ6L 1EGJL 1AGBA 4YEFA 3NTCH 2Z31A 2ZNWA 3EFDH 2Q3AA 3UX9B 3ZE1E 1F00I 3KJ6H 5I1AB 4OF8A 2MKWA 3ARSA 1G7PB 5MEQA 3W82A 2X2YA 2WBJD 3FQTA 4G3YH 3ZHKA 3FQUB 4RBPK 4HMEA 2VDRL 3CX5K 4TVPH 4KJYA 3MX0A 4NQDD 4FQLL 3A6OA 3P11L 2AJUH 3KS0J 1EEYA 3L95B 3D3VE 4PJCB 2E3VA 5I1JL 3VD7A 4KDTC 1SVCP 4Z7OF 1G6RL 5DURB 1MAML 5KTEL 1UFUA 5DD0H 2VLJD 3MRJB 1AD9B 5JOEA 1HQ4A 3H42L 1G6RA 1IGJA 1ZLSL 2FRGP 5AEAA 4JB9L 3VWKA 3WXWH 3FO2A 2ZJSH 5D2LA 4LDEB 4P9HC 4XP4H 4URTB