4Y8VA

Ca. korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 in complex with adp and additional adp bound to phosphate binding site
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
464
structure length
464
Chain Sequence
MNDLERLFNPSAIAVVGASKDPSKIGSQILRNLLSYGFKGKVYPINPTADELMGLKCYPKVSDVPDKVDVAVISVPSDKVLGVIDDCGKAGVKFAVVITSGFKEVGNEELEEELVRRAHSYGMRVLGPNIFGYLYAPARLNATFGPKDVLSGNVAFISQSGALGIALMGYTVVENIGISSIVSVGNKADLDDVDLLDFFDKDPNTGVIMIYLEGIAPGRGRMFIDVASRVSLRKPIIVIKAGRTEVGARAAASHTGSIAGSVAIYESAFKQSGILMAKSVEDAFDWTKALSWNPIPEGERLIVLTNGGGAGVQSTDTFADNGIYLSKPPESLIQEIKKFVPPFASFANPIDITGMAPDDWYYMGTLAALKNPDVDALTVLYCQTAVTTPIGVAKGIVDAIKEAGNSKPVTVGMVGGPEVAEAVSFLNKQRIAAYPTPERASSAMSALYAYARARSYVMKSLAVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Korarchaeum cryptofilum (strain opf8)
molecule tags Transferase
molecule keywords alpha subunit of acetyl-CoA synthetase (NDP forming)
total genus 173
structure length 464
sequence length 464
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13380 CoA_binding_2 CoA binding domain
A PF13607 Succ_CoA_lig Succinyl-CoA ligase like flavodoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 4y8vA02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 4y8vA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4y8vA01
1XELA 2PNFA 2C2YA 1ZH8A 3OM9A 4WLEA 5COQA 4D42A 1E7QA 5FI3A 3B20A 3W4JA 4FFPA 1VKNA 3WIDA 3NTOA 2B5VA 5B37A 4H16A 1PJ4A 4YRDA 1PGNA 3E9QA 4EUEA 4J4TA 2X0RA 4R4JA 4J1QA 4OAQA 1P77A 1BXZA 5I8ZA 1QYVA 3ZWBA 1RPNA 3RAJA 1FMCA 5JS6A 3S55A 1ZXBA 1XA0A 2AE1A 3JYOA 4HX5A 1PS9A 2BFMA 3IAHA 2ZQZA 2PKQP 1GPDG 3GFGA 3WWYA 2CF5A 4BO5A 1XR3A 1ZMTA 2FPPB 1A9YA 3DZIA 4YBZA 7MDHA 2ZJ1A 3HN7A 3UFXB 3FCOA 4PG8A 4EEZA 1C1DB 4CMJA 2IXBA 1CIVA 1YL6A 4CMGA 1JVBA 1UDAA 5TLSA 3DO5A 1QRRA 4MOWA 2BELA 4AG3A 1M67A 4DGSA 3RFXA 2EP7A 1I3NA 3EZLA 3NGXA 1C0KA 1B2LA 2H9IA 5J23A 2J5RA 5U1PA 3GUCA 1R4NA 4EJ0A 1PL7A 4Z3DA 3F46A 1X15A 3I6IA 3PWKA 1N2SA 1LSJA 4IY1A 4PZEA 2Q49A 3PWZA 3JQDA 4YQZA 3H9GA 4YJHA 3E5RA 1KC3A 2E4AA 4LMPA 5JO0A 1BGVA 1HLPA 2O4UX 4E21A 1T1SA 5GZ3A 1EEHA 3ZNQA 3UCEA 3GNSA 3CMMA 3GR6A 3GVXA 4GI2A 1YH3A 4YR9A 5EJ2A 5TX7A 1IPFA 1HWYA 3E48A 2Q1UA 4J6FA 2AEFA 3OJLA 1VL8A 1E3JA 3UUWA 4ALIA 4XQCA 5KKAA 2NWQA 3SLGA 4A73A 3ZW8A 2FPIB 1H93A 4Z9YA 4EJMA 1UXIA 5CP8A 3GVCA 1V0JA 3R3JA 4IS3A 4R5MA 1ZJZA 1HZJA 4EEXA 3NRCA 3HE3A 3O8QA 4F6CA 2WYVA 3PHHA 2OUIA 2PZLA 4I5GA 5DCUA 3JQ7B 5U4QA 3KSZO 1Z7EA 3QWAA 1KBZA 3ROMA 4DPMA 4UUMA 4GX0A 2EIHA 3RJ9A 4YT4A 1EUZA 2VQ3A 1CQIB 1TT7A 3ITKA 3KB6A 3WOHA 2QW8A 3VPHA 4N5MA 4P22A 1ZVMA 3BTSA 4HKTA 4R41A 4CMIA 4EJ6A 1E7RA 5JLAA 5JAIA 5ENVA 4RCVA 4PLCA 5GY7A 3WXBA 1OC2A 4XWYA 1X0VA 4D43A 3K5PA 5IFLA 4IIVA 1E7SA 3MJCA 4AJ2A 3TOXA 1NAHA 4BNUA 1ISFA 2Y0EA 3PHJA 1I24A 4W6ZA 3GRKA 1I0ZA 1VRWA 4L4RA 3QVSA 1HE4A 4ND4A 3GT0A 4NNJA 4CV3A 2VYND 1LU9A 4HY3A 1LDNA 4K28A 1LNQA 1WDKA 2I67A 1GDHA 2ZTVA 5COAA 1V8BA 4WEOA 2I3GA 1LDMA 5CDYA 5I7EA 4YJDA 3TZQA 4B79A 4KUGA 1JKIA 2C20A 1EK6A 3ZWWA 4D45A 3DAPA 3ZI0A 1MFPA 1ENZA 1YB5A 1GYQA 1QXSA 3WJAA 3VH2A 4IGEA 3LT4A 3EGOA 4DC1A 4XGIA 3VPSA 3PDUA 2FN7A 5BNFA 5THQA 4EGFA 4J1NA 2X9NA 3IQDB 4XJSA 4HFRA 2J3HA 2WWRA 4A10A 2DBZA 1E0DA 2XPCA 3JD2A 1K6XA 4B7XA 1QSGA 3MWDA 1E6UA 2J6IA 3WQRA 2ZTLA 1DDOA 3PQDA 4MIEA 4CV0A 4II2A 1DSSG 1K89A 4ZVVA 4NR0A 5I9LA 3F6YA 3TRIA 2Y0DA 4FB5A 5KVCA 3KXDA 3LLVA 3C1OA 1GU7A 4YJHB 5FI5A 4DIFA 5BSEA 3WMWA 4Z3KA 1P1KA 1HDYA 4CQMD 1LSOA 2D0IA 3DZJA 3QWIA 4YRAA 2B36A 4NJOA 2ZK7A 2NQ8A 2OORA 4OOFA 5F3RA 4YA6A 1ZXLA 1DIBA 1LEHA 4Y6PA 4E5MA 8LDHA 4L76A 5LC1A 1DFIA 1YRLA 1NQOA 1ZW1A 3S2FA 1B3RA 1ADGA 3GHHA 2BF7A 5JDIC 5A5FA 2C5EA 2FMUA 2VTEA 4YAKA 3NKLA 3RU9A 1XU9A 1EK5A 4I9HA 2J5QA 4HWKA 1JQBA 5L9AA 4UVHA 1X0XA 3ZHXA 1O0SA 3TZHA 2CF6A 5GMOA 3ZWXA 4MDHA 1XGKA 4OHUA 1UAGA 1B7GO 2YW9A 1L1FA 3JYNA 3TJRA 4IUYA 3WYEA 4BO1A 3RSHA 1F17A 3LF1A 1D1SA 3D3WA 3WYBA 1ZK2A 4WLOA 4KWHA 2Y1DA 2WE7A 4BQRA 1A27A 3JQ9C 4NI5A 2VRBA 1EVYA 4G2NA 5BR7A 1T4DA 1UDCA 4L4XA 2CY0A 3CEAA 1KVSA 1E1MA 3H5RA 4INAA 1N9GB 4XYMA 3GDGA 4ZU3A 4NZ9A 4Z0PA 1ENPA 3PQFA 3I9JA 1GZ3A 1W73A 3AOGA 3EW7A 4OM8A 2D1YA 4QO7A 5LDHA 1LLCA 2X1HA 1LI4A 1SEVA 3ETGA 4FOSA 4LRSB 5KVQA 4TRRA 3A06A 3GAFA 3OF2A 2Q45A 1BG6A 2O3JA 4KWIA 4A7PA 5JMWA 5I7VA 5FFFA 3R6DA 4ALNA 2HK7A 2ILTA 5TRTA 5CDUA 1OMOA 5EMHA 2UAGA 4WOKA 1Y8QB 1GUYA 2GN9A 4WK6A 3PYMA 3E6AA 3DZBA 2P5YA 3DMYA 4CLXA 1OAAA 1Y5RA 3AM4A 4CM7A 4D41A 3PZBA 3TZ6A 1XIVA 2NM0A 1Y1PA 3FHLA 4BGUA 3DBLA 4GSLA 1GFSA 1K6JA 2W2KB 2O2SA 3I9LA 4JNKA 1NYTA 4DUPA 1UXKA 5HA5A 3UAGA 1X1TA 1UZLA 2HMVA 4A03A 4EUHA 2EERA 2LDXA 4M54A 5EL0A 2JFFA 1EE9A 1LC3A 3ZWNA 3ADOA 5C37A 4LW8A 3ZU5A 3KLMX 5KVVA 1UXJA 2Q99A 3G3EA 4KP7A 1RKXA 1DO8A 1QG6A 2E82A 3PXXA 4CMBA 1JKJA 2VUTA 3PLRA 4BVAA 3BIOA 4CLHA 1FDTA 1WXDA 1DJQA 1KVTA 5TNXA 5DT9A 1IOLA 3ICPA 1IZ9A 2Y05A 4R1SA 4DPKA 1HXHA 1RM0A 2I66A 3DOJA 3KYBA 3RBZA 3ZV4A 4MINA 3MTJA 2FHSA 2VN8A 2YQ4A 4JJGA 3F47A 1ZEMA 4GWGA 5A04A 1EFKA 4PLHA 2NV6A 1M2WA 1E6EA 3HN2A 4I5EA 1KY4A 1HDZA 4Q3DA 3TOZA 3L6OO 1PIWA 3X2EA 1TA4A 2X23A 1ORRA 3L6DA 5EINA 3RUAA 5L3ZA 2X5KO 1KEUA 3FWNA 4YJGB 4CMAA 1T24A 5G0TA 3F4LA 4BO4A 1BXGA 2JHFA 2FSVA 2HU2A 2WM3A 4QX6A 4RVFA 4PVDA 4RPHA 3ZV3A 1T2EA 1CEQA 3D5TA 3ZU3A 2YV2A 2BRUA 3GGOA 1ZO8A 4Q3BA 1ISMA 4NBRA 3ROKA 1H9BA 1ZK0A 4E2XA 5JCXA 4IDAA 1N8KA 2X0JA 2VZ9A 3D4NA 4QFCA 3C24A 4TWRA 5TC4A 5L53A 3DMTA 1I3LA 2RH8A 3PLNA 5KJCA 3WQSB 4OXNA 3MJEA 1JA9A 3PJFA 4JP3A 4CM3A 4CUZA 3BMOB 5K6AC 2ZB4A 2ZYAA 4OO3A 2OOSA 2H1SA 1I01A 1R0SA 1GYRA 1SCUB 4FN4A 5L51A 4NBWA 2P2SA 3OIDA 4ESOA 5B4VA 3I4CA 3G17A 4B3HA 1NR7A 5A3JA 4K6FA 4NQZA 4CMEC 1D7OA 3CINA 4CJXA 1VL6A 4O0LA 2DFVA 3WFIA 3RC1A 1BWSA 3ZWOA 2GN4A 1M6WA 1KVRA 4HADA 4RV9A 5ILGA 2CD9A 5T8KC 4AJ4A 9LDTA 3WLFA 5DOZA 1ZNQO 4YQYA 1PEDA 3FSRA 2HUNA 3QVTA 4UUOA 1K0UA 5AXBA 2EGGA 2TMDA 3GMSA 4PG7A 4Q9NA 3W6ZA 2WDZA 2FOIA 3H9EO 4M8SA 3GG9A 1C1XA 5IDWA 1ZIDA 1HYEA 1WPQA 4N54A 3JYPA 1V35A 2UV8A 4CMEA 1Y8QA 1GL3A 2IYPA 1YL5A 5JAZA 3VPXA 4PIVA 3ZH2A 4FFOA 5CEJA 2FPGB 1HE3A 4RZIA 5L45A 2AG5A 3JCZA 3ITDA 3BTOA 4KOAA 4U0JA 1MG5A 1QORA 4TKMA 4P4NA 1ZUD1 9LDBA 4NK5A 3LDHA 1SB8A 4YWJA 1WLYA 3OJFA 1MA0A 4J9VA 5EQFA 2SCUA 2J3KA 1PS8A 2O2YA 3WLEA 4EI2A 1HTBA 2B4TO 4P4LA 2QZ9A 2J3IA 1EQUA 4XD2A 1YQDA 4J49A 4ITUA 5CFZA 5F1KA 2CDBA 3P19A 3U62A 4ZQFA 3DXFA 1YJ8A 2FWMX 3BMCB 3NJ4A 4JGBA 2EV9A 4WCDA 1YL7A 3ONEA 1KC1A 2C59A 1EFLA 1YJQA 1FDVA 4YDRA 4JCOA 3BHMA 2FR1A 3GHYA 2EP5A 4CLDA 2C29D 4A0SA 1B26A 4CQLB 5B4TA 3OQ1A 3PDJA 1GQQA 1VJTA 1MB4A 1U3UA 4BNLA 2HO5A 3AY3A 5CEFA 3H9JA 3GGPA 4KUEA 2DPHA 3DQPA 3MJ4A 4GVXA 4EITA 1LQUA 4W82A 4F45A 4NPCA 5A3VA 3OMLA 4NH4A 2ZCVA 1VKOA 3GZNA 4WOJA 3DONA 2H6EA 2EF1A 4ZJUA 3WGQA 4PLTA 1M66A 4DVJA 1LLQA 4LRTB 1B8VA 1A71A 4KDFA 2RCYA 2NVUB 3QE3A 1F8GA 4YAGA 3V2UA 1EUCB 2X6TA 2Y67A 3PJEA 1SMKA 3IL2A 1I3MA 1I10A 2HJSA 4NJMA 4B4WA 2EHDA 3BHJA 3PVZA 1VL0A 4RDIA 1TB4A 2QG4A 1HYGA 1ZMOA 3DHYA 4DQXA 5G0UA 1U4SA 1DFHA 3RJ5A 4JIGA 1DJNA 1IUKA 5HS4A 3ETEA 2FRDA 1H6CA 3E82A 3LZ6A 1NTOA 4YT5A 4BNKA 1RM3A 4CODB 1ULSA 5IN4A 4XJTA 3UVEA 1SPXA 1ZK4A 2EXXA 1TT5A 3IKVA 4WPGA 2PFGA 2DBVO 1YDWA 1UR5A 1MG0A 2X8LA 3ZWAA 1LLDA 3GQVA 2B0JA 3QRWA 5H83A 5JYEA 3T7EA 1HKUA 3DMTC 4GWKA 3RIHA 4XDZA 4XYLA 4WCFB 4XX0A 1DFGA 5K6AA 5F5LA 1O9BA 4UUNA 3ZNNA 1GV0A 1EBFA 4R9SA 3MZ0A 2FSSA 1G0NA 4CM6A 1U7TA 5BQFA 2OMEA 1A72A 2AMFA 2R00C 4YJFA 3KV3O 4JJFA 4XYEA 3ZWVA 3PK0A 2QZZA 3ZU2A 4CLOB 3RROA 7ADHA 3NV9A 5A9SA 1U1IA 4S3MA 4D3SA 2E37A 1IB6A 1VM6A 1U3VA 3I6QA 4IMPA 2CVZA 1VSVA 3WTCA 1T25A 1PU2A 4E3ZA 3D3WB 3DOOA 2H63A 1ONNA 5FF9A 1LC0A 1PJQA 3B1KA 4B4OA 3PEFA 4RLHA 2DVMA 3NTRA 1P1RA 3F5SA 4RGBA 3GDFA 1YS4A 3LC2O 4G65A 2OZPA 3ZN2A 1EVZA 5JCJD 4BO9A 4DC0A 5F1OA 2W8ZA 3O38A 3O4RA 2JFGA 3EUWA 3MJSA 4TRJA 4ZD6A 3FBTA 4R69A 4FJ1A 1R4MA 1VE9A 3R0IA 4A5OA 3ZHYA 2BLLA 1J5PA 2GF2A 3SEFA 1MC4A 5CDGA 3HADA 1CQJA 3O8QB 3RI3A 4J2HA 3RWBA 4HBGA 1DEHA 1H5QA 4AJ1A 2J5KA 2NU8A 2P5UA 3WICA 1I2CA 3AK4A 4BNWA 3P2YA 4J1SA 3L4BC 1YB1A 1UJMA 3T7CA 4R1UA 2EWMA 4CM4B 4RVDA 3JQCA 2C07A 1WAMA 3QSGA 2R6JA 4BNHA 1DPGA 3ZGYA 2PH3A 4FGWA 5L7WA 4CQMA 3AW9A 4NBUA 2VHZA 5IJZA 4XQEA 3HFSA 3WGOA 4FJ2A 3OIGA 4N5LA 1IHYA 4YAEA 3DDNA 3K6JA 3TZCA 3Q9UA 5JPIA 2DC1A 4BV9A 4Z0TA 3KZVA 2X58A 4MVJA 2ZCUA 3WQQA 3F3SA 4CQMB 4DMMA 1UZNA 4E32A 1NQ5A 5A9RA 4BNZA 3INGA 1LA2A 1NFQA 3H9UA 3VH3A 3DFUA 4YXFA 1ZEJA 4CR8A 3LLSA 2PGDA 3AUAA 3IP3A 3UGKA 2DUUA 2VZ8A 2OP0A 5IZCA 3JQ6A 1PJSA 3OETA 2J8ZA 4CLEA 2X22A 4MVJE 4TSKA 4R01A 5DDIP 2IZZA 4OOEA 3RC2A 3E18A 4R5HA 4XGKA 3VPFA 3P2OA 5L95A 3JQGA 3CIFA 3BYZA 4OIMA 2YDXA 4A26A 4GL4A 5G4KA 4M87A 3DAGA 1PTJA 2DM6A 2I76A 4WCFC 4EYEA 3G79A 5MGBA 4OQYA 2Q3EA 4UEOA 5JXWA 4CV2A 4H15A 2G0TA 3VPGA 1X1EA 2VRCA 1HZZA 3NX4A 1B14A 2VYNA 4FPXA 2D2IA 4AL4A 1KYQA 1GYPA 3JYLA 3QV1A 1N92A 1E3WA 4C4OA 5A06A 1FK8A 4AVYA 4BO0A 4RDHA 2GZ1A 3SJUA 1P74A 1XWFA 5G0VA 2B4QA 4JJIA 3LT2A 1Y8RA 4GX5A 4MVJF 4BNTA 2BGKA 4CUJA 1PWXA 4YCAA 4J9UE 1YBAA 5CDSA 4BV8A 1U3TA 4H7PA 4DL9A 4Y67A 4XIJA 3PTZA 2WJPA 3MOIA 1D8AA 3U0BA 4TRNA 3W4KA 2PZKA 3V8BA 4IGFA 3VC7A 3GDOA 3Q6IA 2NTJA 3M2TA 1RJWA 4GSKA 3UH1A 4IS2A 3GVPA 4MP6A 1PZGA 1A7AA 2AQHA 4DMLA 4YRBA 3OIFA 5TGDA 3GAZA 1T2FA 4BO2A 5CPBA 4Z9FA 3EVTA 1N1EA 4M55A 2F00A 4XYGA 1H9AA 4UVEA 1B15A 4XDYA 2GNAA 4FIZA 4BKQA 3NTQA 2DTDA 3CXRA 3VZPA 1NPDA 2RH4A 3KHUA 3M2PA 5KVSA 3OSUA 5CDTA 2C82A 4KQXA 1MP0A 1BMDA 2C54A 3D4OA 1T2AA 3WSWA 5KCZA 4NBVA 4R16A 3H2SA 2FP4A 1ID1A 1QYWA 5C7OO 4AJPA 1P1FA 1PL8A 3KSDO 5A03A 4BNGA 4O5OA 2Q1SA 4E2YA 2NVUA 1EUDB 1ISJA 1DIRA 1PJBA 4B7CA 3H2ZA 1ZBQA 1GQ2A 4BMSA 1ADCA 4DLAA 2VYVA 3GNQA 1OOEA 3H4VA 1HE2A 1MC5A 1VC2A 5HTOA 3UFXA 4Z9XA 4ALLA 3OEYA 2EGHA 1UH5A 4MPDA 4NDNE 4N18A 2AXQA 5IAAA 3SJ7A 2ZQYA 5GZ1A 3W8DA 4QECA 4TQGA 4U7WA 1LTHR 1X13A 3U9LA 4CM8A 5T6BA 3AU9A 4BMVA 4RF3A 2WD8A 3U5TA 4XCVA 3GVIA 2VRCD 3L07A 3RU7A 2Q2WA 5KOIA 3GPDG 3TF5A 1KEWA 3ABIA 3JV7A 2I9PA 4PLPA 1D1TA 3UKOA 3LYLA 2EKLA 5A4DA 3IOYA 2PKQO 1MV8A 3WSVA 3OA2A 4PLVA 4E5PA 1DC5A 1LX6A 2Y1EA 2Q2VA 4F6LA 4PG6A 3JQ8B 2Y68A 4DBVO 4EW6A 4G5HA 2PK3A 1W4ZA 3ONDA 3ZCXA 3QWHA 3I9MA 1UUFA 4GX1A 2SCUB 2VOEA 2LDBA 3JQ9A 4ZQEA 5DOVA 5TT1A 2XOXA 5I9NA 3VTZA 4NU6A 1J49A 3JSAA 5C7LO 1U9JA 2TMGA 4PFJA 2FR8A 3VOSA 4BNNA 5FEUA 3GUYA 4CMKA 3OH8A 1N7GA 2GUGA 2WD7B 2Q2QA 1QR6A 2I5PO 3TQHA 1V3UA 2I65A 3FR7A 3D3EA 4CLOA 3FBGA 2YDYA 4ZQHA 2VCYA 1LDEA 1XG5A 4U0KA 3QWFA 3DTTA 4BNFA 1VI2A 3W8FA 4UVIA 5DCYA 1LBEA 3AWDA 1LSUA 2P68A 1P31A 3GVHA 5JMPA 5AQ1A 1R4MB 4J91A 3UICA 4ALKA 2GASA 5I8WA 3OA0A 3RCBA 1UP6A 3QQPA 1LDYA 2GERA 4CM9D 1SOVA 4GMGA 1E5LA 2UUPA 2ZKLA 3P7MA 2Z1NA 1CWUA 1Q0QA 2GN6A 4J1TA 4XB1A 1ONPA 3TL3A 3IJPA 1NXQA 2NVBA 5I9MA 1LLUA 4TVBA 5DF1A 1I3KA 4QFDA 3NAQA 3AOEC 4JBHA 1HE5A 2O3RA 4UUPA 3PIIA 2YHIA 3KEOA 5ENDA 1PL6A 4N7RA 3QY9A 3JD4A 3KYDA 1LRKA 3WWZA 5JE8A 4J7CA 1PJTA 1AXGA 1O5IA 5F1PA 1ADBA 1SOWA 2JD0A 1DB3A 1Q0LA 1Z75A 2EJVA 3FNEA 3ULKA 3C1TA 4AJIA 5JAQA 3VH4A 1I32A 1HSOA 2CDAA 2F1KA 1BVRA 1EUDA 5CAEA 3QW2A 3VKUA 1LUAA 4BO8A 4D3DA 1U3WA 4KMSA 4PZCA 3KRTA 3HB4X 3JQFC 3PGXA 1WW8A 2JCXA 4BIIA 3PPIA 5T67A 1CETA 2ZJ0A 1VLLA 4DWVA 4ZICA 5IZ4A 4E5NA 3WBFA 4K26A 1F14A 1P45A 5G4KB 3JQAD 4MVJP 3V1TC 3FI9A 5BNIA 1Z7BA 3PZRA 3AM5A 2OXIA 4BO7A 1LQTA 5T5QA 2GZ2A 2HMUA 4CQLA 2Q50A 5C3MA 2VHWA 3KBOA 4IBOA 3ZZNA 1N1GA 3A4VA 1IL0A 1RYEA 4QO8A 3BZUA 3H8VA 4OKNA 5A5EA 5JW6A 3NDRA 3QLJA 4OKIA 4KTVE 2VOJA 4EZBA 1CYDA 2FPIA 4B3JA 4XKJA 4AJKA 1Y6JA 3DOCA 2I3AA 1UXGA 1DAOA 3M1AA 4B4VA 3Q9NA 1E77A 2P9EA 2Y99A 3JTMA 2BFAA 4B8WA 2X9VA 4RORA 4ONEA 2B5WA 4I9UA 1P1JA 4YT8A 3DZKA 3NT5A 3EC7A 5TJ9A 2AQ8A 4FDAA 2NSDA 1PQPA 2FPPA 2HMTA 3PHGA 4XB2A 1BW9A 3DAFA 2DBRA 2VNAA 4M86A 3WBBA 2UDPA 4CM4A 2V6FA 3I52A 5H81A 4JROA 1YDEA 2O3QA 3QWBA 4LCJA 3BA1A 3QVWA 3T4XA 4FC7A 4LGVA 4Q3NA 2AEJA 3G1UA 5DN9A 2A94A 1PJLA 3COSA 4E33A 5KNLA 3E03A 3ZU4A 2BFOA 2AQIA 3HDHA 4JBIA 2OBYA 2YY7A 5EIOA 5KIAA 3LQFA 1PZFA 3FNGA 3MJTA 3E5MA 3I1JA 3RVDA 1ADFA 1RM4A 4U6SA 1P33A 2PLAA 3BMCA 1Y9AA 3WGHA 3MEQA 4OGWA 3TNLA 3MWEA 4PRLA 3WB9A 4RJTA 3V2HA 4E0BA 1IY8A 4RF4A 5B4UA 1SNYA 3K96A 5C7IO 2G5CA 4J16A 3F4BA 1AUPA 5THKA 1HRDA 1NWCA 2HDHA 2O3TA 4DIBA 4BB6A 1CRWG 2UUOA 1JAXA 4IDGA 3OQ6A 3BMQA 4I1IA 1T2DA 2D3TA 3E9NA 3SXPA 4E5KA 3GFBA 1DLIA 4IQ0A 2GD1O 2NU6B 1JAYA 1QP8A 4ND1A 3HQ4O 1W6UA 4WKGA 3ANLA 4IZHA 2E49A 4BNMA 4ALJA 2NUAA 2DKNA 1UAYA 4Y8VA 1LJ8A 3U3XA 5CPFA 3RASA 4BB5A 1QLJA 3BXXA 1QV7A 1J4AA 1ZSVA 2CZCA 1GUZA 4X54A 3LT1A 4YEDA 5EN4A 4BKUA 1TI7A 4NFSA 4XR4A 3AUSA 3VDQA 3WYCA 1U7HA 2DT5A 3DBRB 3O26A 1NX6A 2NADA 3H3JA 4GBJA 2VUSA 3WGYA 4AJLA 3K30A 4EUFA 4K1LA 4RF2A 4W9NA 3TL2A 5BSGA 1AHIA 1HLDA 2NLOA 2O3UA 3FF4A 4IDFA 1PSDA 1X7HA 1S6YA 1GTMA 5JDIA 6LDHA 2OO5A 4QT0A 4XEHA 5DNAA 4IDEA 4J3FA 1E1KA 4I9NA 2B37A 5IG2A 3ZNOA 4MO2A 1OFGA 2WEKA 1ZK3A 3HG7A 4ROSA 3VZQA 3JQBC 2E48A 4BS9A 2Y1FA 4BMNA 4O63O 4TVOA 1SCUA 4CLRB 5HM8A 3IUSA 4RPLA 4IQ8A 4KQWA 3GG2A 2IDZA 5HS6A 4B3IA 4E30A 5EERA 4RO0A 1DLJA 1H2BA 1JLLA 4OSOA 3BHIA 1B8UA 3JQ7A 4DBZA 3D64A 3AOEA 4FFRA 5CHEA 1P9LA 1YQXA 2IXAA 2ZTMA 4KDEA 4TRMA 1U5AA 1MLDA 1K6IA 1T2CA 2RBEA 3GK3A 4GGPA 1C0IA 1MXFA 2VWQA 2HSDA 2PH5A 1U2GA 3UXYA 1TT5B 3U4HA 1IHXA 4XRRA 3ST7A 1KS9A 4BQPA 4CM9A 1PR3A 5KJEA 1KOLA 1MX3A 1WZIA 3JQGB 2PA3A 4BKPA 1PQUA 1KEPA 2OHXA 4YB8A 4UVDA 3HDYA 1PGOA 2IZ0A 2GLXA 3JQAB 3CKYA 3LSYA 4OJNA 1PR9A 1RYDA 2VHVA 4R3NA 5GZ6A 4OSPA 3ZHBA 4R68A 4FBGA 3W8EA 4BNJA 4DRYA 3C8MA 2FR0A 4JLWA 1W0CA 3OEWA 3LF2A 4ZGWA 3V2GA 4OYRA 1HEUA 1KETA 1P0FA 5JFOA 1GPJA 4ZHSA 1YOVA 3EDMA 4JX8A 1NAIA 5BT9A 4GAEA 3ZNPA 4DREA 1PJ2A 5TF4A 4ND3A 5L4LA 2NU9B 3H3FA 4BGVA 1OBFO 3JD1A 2IEBA 5ILOA 4L73A 4XRGA 1MXHA 4BHTA 4FD3A 3MWEB 1GEGA 3KVOA 4ZRNA 1PJ3A 3TN7A 2NNLD 2XXBA 3OP4A 2Q46A 3SBOA 4L4SA 3CSDA 1HL3A 4Z0HO 3VTFA 3P5SA 1CQJB 3PYLA 3PIDA 4DTIA 2YFHA 3BTUA 1E6WA 1Z73A 3LK7A 1BXKA 1O89A 2O4CA 3FNHA 3O03A 2IEDA 4OL9A 5C5IA 1NWHA 2PR2A 4LISA 4IXTA 3TFOA 4L74A 5JO9A 3GLQA 4BNYA 4R1NA 1C0LA 3GA0A 1SO8A 2ZTUA 2D5CA 3PJGA 4PG4A 2P4HX 1PGJA 3ASVA 1H2HA 5A02A 5I7FA 3TWOA 4ZN6A 5G0SA 2AW5A 3BAZA 1CF2O 1K5HA 1LRLA 3EAGA 4JK3A 1V3VA 3WS7A 3AUTA 3EVNA 3GF4A 1PZEA 3RUCA 4Y9DA 1WMAA 3KYCA 3LT0A 4A2CA 1EBUA 3QA9A 1BDMA 1XQ6A 1WZEA 1GAEO 1GZ4A 5DBIA 3WJ7A 2YFQA 4FSHA 1DC4A 1U8FO 1NPTO 2WSBA 4PLZA 4IINA 4HFJA 1E5QA 1NHGA 3UCXA 5L7TA 1EMDA 1FDSA 3NYWA 2PD4A 4TROA 2E6UX 1Q0HA 1QYCA 2JD1A 3ADPA 2X0IA 3ROQA 3FPCA 3AI2A 3V1YA 5IXYA 2BI8A 2PGJA 1EDZA 1LSSA 1E1LA 1NVTA 1Y81A 4IPTA 4HP8A 4C7JA 5TJHA 4PLYA 1G0OA 1ISIA 4Q39A 5IF3A 1NHWA 1NBOA 5T8KA 1E92A 3RUDA 3ZV6A 4LK3A 1YGYA 2WYWA 4XYBA 4LVCA 1E1NA 4R54A 5JCJA 4E2ZA 1SZJG 2Y1CA 2DQ4A 4DQVA 3M6IA 3NDJA 1EVIA 1Y8RB 2NTNA 2ZATA 5IXSA 3JQBA 2YV1A 3CE6A 4XA8A 4NU5A 4DXHA 1KEVA 2W90A 3D5QA 4EDFA 2R2GA 2GYYA 1NPYA 2ET6A 1J6UA 3D7LA 4CM8B 5I7SA 3EMKA 2QRJA 4MVJI 4UEJA 4JXKA 4CV1A 1P1IA 1VSUA 3W1VA 3C85A 1AE1A 2BH9A 5KJ1A 1RWBA 2C0CA 1R0KA 1YO6A 2V6BA 5CG1A 3R1IA 2NU9A 4UVGA 4PN3A 4BGEA 3A1NA 1E7MA 4FC6A 4Y98A 1DAPA 1ZKMA 1IPEA 1K2WA 2DAPA 2Z95A 1YOVB 2HLPA 2VTDA 4PRKA 1DIHA 3RBXA 4G81A 1HDGO 3ZWYA 5A9SB 4HNGA 1PJCA 2VWHA 1DHRA 1I8TA 1VPDA 1ML3A 3ON5A 1XLTA 3NT2A 3VAZA 1WDMA 4DPLA 5CG2A 5AXCA 4R1TA 2IYOA 1M6HA 3BMNB 1DRVA 1EVJA 4YT2A 4NMHA 3RUEA 4WGGA 3RD5A 4GKBA 3VDRA 3M1LA 4A27A 1NFFA 3K92A 5EQDA 5ITVA 3SC6A 1KERA 1HDXA 2HK8A 4IQGA 2I6TA 1E3LA 1ENYA 2FY8A 2VHYA 2NU7B 2CVQA 3PFFA 1GV1A 4B7UA 4J90A 3AUUA 2D8AA 3AM3A 5CAEB 3IIEA 1OI7A 3WFJA 4LSMA 2HRBA 2P4QA 1XSEA 4RPKA 1JKFA 1EUCA 2A92A 4CUKA 1LDGA 3H7AA 4NBTA 1AN9A 2W2KA 2YZ7A 3I4FA 3EZYA 5A05A 4YACA 4FS3A 3QP9A 1JKJB 2OFPA 2C5AA 1PZHA 2EJWA 5IDQA 4GMFA 2YUTA 4NJMB 2V65A 3F5QA 4CPDA 4L75A 1DIGA 3GZNB 4W99A 1T26A 2DTXA 3WTBA 4H3VA 2W98A 1GY8A 1XU7A 4MIOA 1ONOA 2JCYA 1VJ0A 1MFZA 1ISHA 4DYVA 2A35A 3KUXA 2ZB3A 5T57A 1O95A 1YB4A 1FF9A 2HKIA 3HSKA 4DLBA 5KJ6A 3IUPA 1YXMA 1I30A 3E8XA 3UN1A 1Q7CA 2ZYGA 4CR6A 3DHEA 1N5DA 3VVCA 1QKIA 1G6KA 3N74A 5KJFA 5KWEA 3UHAA 2EG9A 4BOYA 3JQAA 3ZV5A 1W8DA 2Y1OA 4RVHA 2GRAA 3L4BA 3N7UA 2QQ5A 1Q1NA 2R00A 1TLTA 3DR3A 1Q2XA 1F0YA 5A9TA 4E12A 1JN0A 4GKVA 2FZEA 4RVUA 4W7IA 2RIRA 3AJRA 4MP8A 3FNFA 1QV6A 3ZWMA 2YHUA 5EPOA 3MOGA 5MDHA 3K9QO 3AFNA 1YBMA 4NK4A 5K0ZA 4GQAA 4D3FA 1GADO 3MWDB 1B3BA 2CVOA 5IDYA 3IKTA 1Z74A 3VZRA 3AY7A 3EYWA 2FPGA 3C7CB 4KTTE 3H9QA 3GEDA 1LDBA 1V9LA 2GSDA 1A4UA 3OHSX 4K6CA 4WNIA 1MGOA 2NU8B 2P9GA 3U49A 3DB2A 2PD3A 5L4SA 1YKFA 1R15A 2WTBA 4JP2A 4MKXA 3KYDB 3WX0A 1DBVO 5DULA 4E6PA 1I5RA 4HFMA 4D46A 4RVGA 4Y6SA 2P91A 2V6GA 1O6ZA 4I8XA 5ITWA 2B69A 1RM5A 2BGLA 2Q4EA 2Y1GA 4KZPA 2GDZA 3H65A 5LCXA 1WMBA 4QUKA 4WLNA 3AI1A 2NQTA 1UXHA 1G1AA 1AXEA 2VUUA 1UP4A 5JSFA 1DXYA 3WNQA 4BNXA 1X7DA 3QHAA 4OXKA 2B35A 5B1YA 5FWNA 2FZWA 4ND5A 5TT0A 2A9FA 1E7YA 4GVLA 1F06A 4GLLA 2ZB8A 5BSHA 1Z45A 5JYDA 1E3WB 1T1RA 1ZJYA 3PFWO 4MKRA 2O48X 3JD0A 3RC9A 3JD3A 3I3OA 2GR9A 4P8RA 1XEAA 4J43A 3B1FA 2YV3A 2GZ3A 4F3YA 3PQEA 5L4NA 2VWGA 1HF3A 3FRJA 2BGMA 1SEPA 3KTDA 3NJ8A 3BMNA 2JAHA 4IJUA 4O6VA 5KKCA 1A7KA 4DIOA 3WG9A 1SAYA 3PI7A 5TQVA 3KOUA 4AFNA 1NQAO 2GPTA 4II3A 4NFHA 5JY6A 3CPSA 4ZA2A 2WD7A 4WLUA 2QRKA 4GX2A 3OJ0A 2DTEA 4ZRMA 3TZKA 1E3SA 2B4RO 1O8CA 3ICCA 2AHRA 2D5AA 1WWKA 1Q7GA 4FQ8A 3DBHA 2WE8A 1XHLA 5A1TA 3AY6A 4PLWA 3V1UA 3VKVA 4BUCA 3OECA 3IS3A 6ADHA 2QX7A 3X2FA 4WCFA 4WEQA 1BXGB 3GGGA 4MVJH 1ZSNA 4O1MA 3Q0EA 4NHEA 3RFVA 2XXJA 1C0PA 3HHPA 2OP1A 5CEEA 3IJRA 1C3VA 3FTNA 4YAJA 4U5QA 4P4GA 2CDCA 2PV7A 5AOVA 4HXYA 4URFA 4J4HA 2XAAA 3WIEA 2OBNA 1JDJA 1Y7TA 3OICA 3OJOA 3ONFA 1Y5MA 2I99A 5EESA 3RKUA 1E7WA 4CLRA 1ENOA 2DLDA 3GRPA 5DP2A 4QTZA 5L7YA 4HNHA 3B6ZA 1ARZA 4D7AA 4IJVA 3G1TA 2Q1TA 4FFNA 5DP1A 2GO1A 1E3IA 2QIOA 2VYVD 1TVEA 4MIYA 1GEEA 1GD1O 2YHIB 5AXAA 1AGNA 4MKZA 4Y6RA 3S2IA 1DRUA 1F8FA 1X7GA 2JAPA 3S8MA 4Q3EA 2WMDA 2JFHA 1BSVA 4CMIB 2X5OA 2PKRA 3GEGA 5IDXA 3ANMA 4L0QA 1R12A 4IJWA 3DZGA 4RZHA 3NGLA 4PLGA 3DBRA 4NFYA 3DBHB 1HYHA 1PGQA 2YJZA 4FR5A 4RPJA 4CMHA 1PS0A 1XYGA 3PHIA 3GOHA 3C1AA 5JY1A 3CH6A 4P38A 1MUUA 1XKQA 2AEMA 2DUWA 3O9ZA 3HJAA 1D3AA 3GNTA 3WNVA 1OZAA 5BNTA 3OBBA 1ZSYA 5F5NA 2V6MA 4ILKA 3HDQA 3WGIA 1YBVA 5HBRA 4OMUA 3U4IA 3TSCA 2JD2A 4IDDA 1T4BA 1GQYA 3BTVA 3SVTA 5HRUA 2ZB7A 2NUAB 4OXYA 2JCVA 4MVJG 1N9GA 4WJZA 5K9ZA 1SBYA 3ORFA 5DCWA 5TS3A 1QYXA 4ZQGA 2O3SA 1NM5A 1R66A 3GN1A 5LDGA 4FFMA 3HZZA 2QYSA 3L0DA 2YYYA 3IC5A 3Q2IA 1PX0A 3PP8A 1CDOA 1UZMA 2BI7A 2OL4A 2Q4BA 4TKLA 4XIYA 1YVEI 3R3SA 4BO3A 3ROPA 4FJ0A 1EE2A 3MTGA 1UP7A 1NR1A 1H6DA 4BKOA 2VWPA 2D59A 3JQ8A 1YE3A 2JJYA 1DRWA 2AA3A 2C7GA 4LN1A 5AYVA 3RC7A 2PWZA 1GR0A 3W6UA 2Q1WA 3Q2KA 1KVQA 4PZDA 3HB5X 2EKQA 2WYUA 3RUIA 3AI3A 2BD0A 4AJOA 4DYDA 1A5ZA 2AG8A 4HV4A 4J7XA 2HQ1A 5ES3A 5KTKA 3RUHA 4UAGA 1FXSA 4OH1A 4YVFA 3QJ5A 4ALMA 4F46A 3VH1A 4MVJM 4PLFA 3HFGA 1DHTA 1M75A 5G2OA 2Z5LA 1NP3A 3G0OA 1VJ1A 1P3DA 4UREA 2V7PA 3ZHZA 5JC1A 1BDBA 3V5NA 3F1LA 4AICA 3K31A 2BFPA 3I9KA 2FP4B 2YQ5A 5HWSA 4I5FA 5DBGA 2O23A 4AJNA 5IZCC 1WVGA 1ZFNA 1PWZA 3A9WA 1I2BA 4MJLA 1M76A 3CZRA 5ER6A 3OFSA 4CL8A 4CL3A 2CMDA 2RAFA 2W4QA 4QSMA 1IZ0A 3ENKA 4HFNA 5JC8A 1J0XO 1P1HA 4MVJD 1BHSA 1R6DA 3UCFA 1B8PA 4CR7A 1FJHA 1PGPA 4RPGA 2PD6A 5G4LA 3INTA 5ICMA 3ANNA 4YJFB 4E31A 4Z6KA 2NU7A 1R16A 3Q11A 3I9NA 4IJKA 3L9XA 4I5DA 4LVUA 3FD8A 3HUDA 4RL6A 3GC6A 4UEKA 5ER9A 2RHCA 3Q1LA 4RLSA 4K9DA 4N5NA 3UOGA 5COBA 3E9MA 2HAEA 4TZTA 1DC3A 4BL5A 2ZIZA 1NASA 3I9OA 5B12A 3FN4A 1UDBA 3FTPA 5DBFA 3A28A 1I33A 3PHLA 2Y66A 4IDBA 4U6QA 1NFRA 3VHRA 1JVSA 2PGLA 5FYDA 4B8ZA 3GMDA 5TSDA 4GLOA 3DTYA 2EW2A 2GN8A 3QVOA 3B1JA 1XQ1A 2X7HA 1FDWA 3B70A 3C7DB 5JDCC 2HJRA 4J2OA 3DEYX 4RQTA 4NIMA 4WLVA 1JLLB 2JKVA 4D44A 4XQGA 1KIFA 3FWZA 4HUJA 4CM1A 3STHA 2GGSA 5L40A 4KUHA 4CM5A 4J4BA 4YPOA 1Y9EA 3SC4A 4S1VA 4R51A 1CQIA 4PGFA 4QXMA 5JBIA 1N7HA 3JQFA 3LC1O 5JDCA 2A4KA 2D4AA 1IULA 3NT4A 4LCEA 4BKRA 4E2WA 2O7SA 1LXCA 3GPIA 4FW8A 3OQBA 2NTVA 4EBFA 1GCUA 2UVDA 4GGOA 4BNIA 4NG5A 3ZDFA 1F12A 4W7HA 2QHXA 4IZIA 3GN2A 2EW8A 1HDOA 3CMCO 1BTOA 3W4IA 5JNLA 4WE3A 1GUFA 4Q3CA 2JHGA 1P44A 1TXGA 3A14A 3N58A 4IXWA 1H6BA 3RQSA 2O7QA 3GZ4A 3S1LA 3INRA 4CMCA 1HDCA 3BMQB 4DA9A 2X9GA 5G0WA 8ADHA 2JL1A 1U2DA 4ID9A 4J0EA 1YWGO 3U09A 2PZJA 3TDKA 2OGUA 1CERA 2X0NA 1A4IA 3GEMA 3IMFA 1SC6A 2EKPA 3G49A 2J3JA 3I5MA 3NUGA 3KM0A 4GPD1 4UULA 3I83A 3UW3A 2X86A 1DOHA 3KSUA 4JBGA 1EDOA 2HCTA 4YJGA 2C7VA 1GZ6A 3E1KA 5JAMA 1Z82A 2VNSA 3S2GA 4YAIA 4MP3A 1C1DA 4WLFA 2QRLA 3LU1A 4YYZA 4DLLA 1DIAA 1EQ2A 3ASUA 3AFMA 3GY0A 2Z1MA 3HDJA 4Q3AA 3U4CA 5H82A 3WR5A 3RUFA 1ZCJA 1P0CA 3D0OA 4W9NC 4E13A 3NDIA 1KY5A 1JTVA 1U5CA 1WDLA 1GCOA 3TFQA 1H0KA 3GH3A 1AHHA 3DHNA 2O50A 2H5LA 1ULUA 4RQUA 1B16A 4BO6A 2G82A 4IMRA 4AJEA 3FPLA 4M49A 1K3TA 3WGZA 1LRJA 1SB9A 4FCCA 4JQCA 1V3TA 1BVUA 1H94A 1BW9B 2POQX 1HETA 3KLPX 3H6KA 2PTGA 1X14A 3WGGA 2CFCA 4L8VA 3CUKA 3JYQA 3ETDA 3D4PA 4R3WA 3QVXA 1QYDA 3F1KA 1YQGA 1IYZA 3C3XA 3NEPX 3SX2A 1D4FA 5T64A 3L9WA 4M89A 1IE3A 4GH5A 4L9RA 3HNPA 4WUVA 4XZ3A 4C7KA 3PRJA 2BMAA 4O59O 4LMRA 4AJHA 2AE2A 2ZYDA 3FR8A 3KETA 1U28A 1WP4A 1JWBB 3AU8A 3KYCB 4I08A 3DL2A 3WMXA 3H5NA 4LSWA 2G17A 1B0AA 1I36A 2NACA 3ZWPA 3DFZA 2X4GA 2VZ0A 3OJEA 2HMWA 1C14A 4TZKA 1JW9B 3JQEA 1V6AA 5AVOA 3CZMA 1ZK1A 1EZ4A 3WGTA 4YTEA 2W2LD 1YONA 2B83A 1NQTA 2BKAA 2NVWA 2DFDA 1R0LA 4XX0B 1WNTA 3IP1A 3K2BA 4PG5A 1U4OA 2EEZA 1BRMA 3KEQA 2PZMA 5ICSA 4D0SA 3ZWCA 3MJVA 1PQWA 3F9IA 1NNUA 3PJDA 2GCGA 1XDWA 2IODA 1ISGA 1ZZEA 3KO8A 1H6AA 3I23A 2VT2A 3K8ZA 4OQZA 3HWRA 1TEHA 1R4NB 3T4EA 4IDCA 3K73O 4W4TA 4DQUA 2CSUA 3DC2A 4FGSA 1U8XX 2X5JO 5DZSA 3LC7O 1HT0A 2VHXA 4PVCA 3H5AA 2DPGA 2UYYA 3RBVA 4J7UA 4TMFA 2G76A 3WDSA 4QQRA 2PY6A 5F21A 2IZ1A 4FOOA 3PWSA 3MCVA 4AJJA 4RF5A 2RHRA 3ENNA 1HSZA 1L7DA 2IRWA 3RKRA 2Y0CA 3UF0A 3L6EA 2Y93A 4IM7A 2P9CA 3DBVO 3D1LA 1KVUA 3S2EA 1S7CA 3L77A 1OC4A 2G1UA 4R9RA 4ND2A 4E5YA 1XCBA 4D79A 3DBLB 2CNBA 1O94A 4QEDA 1R37A 3TPCA 1I2ZA 3C7AA 5AXDA 5U9CA 3DZFA 3K2EA 3VVBA 1Z6ZA 4ZQBA 5IN5A 4WECA 3LVFO 3BMOA 4IIUA 4B4UA 3ZW9A 4BGIA 2IE0A 3U4DA 2HMSA 4BNVA 5BSFA 2W2LA 2CUKA 4JN6B 4PCVA 5TIIA 1NVGA 3Q3CA 4WNCA 1JWAB 2XF8A 1A9ZA 3EY4A 1FDUA 5ADHA 3DZHA 3EK2A 2HK9A 3PGJA 2DU8A 4XQ9A 1QLHA 3CTMA 3RFTA 4E4YA 1L7EA 4J0FA 3L4SO 3IDSA 4D0RA 1DC6A 1QMGA 2DBQA 3SLKA 3EHEA 2NU6A 2QYTA 3DWFA 3VZSA 4U8GA 1E3EA 1Q7BA 1HDRA 2BHLA 4FFLA 1JU9A 1NVMB 4XR9A 2HRZA 1C1XB 4RVSA 2VT3A 3QIVA 4M1QA 2C2XA 4WASA 4XGNA 1CJCA 2AQKA 3PYXA
chains in the Genus database with same CATH superfamily
2C2YA 4D42A 4GOKA 1E7QA 5DRYA 4UQPA 3B20A 3W4JA 3K2IA 3RNLA 3WIDA 1PT6A 1Y3DE 2B5VA 2GHQA 4TZ6A 1ZOSA 4X6YA 2GA9A 5DI3A 1PJ4A 4R2KA 4J4TA 3EGDB 4J1QA 3O8RA 1T34A 2OFWA 1SD5A 4RPIA 5JS6A 1IK4A 1FMCA 2I80A 5CA1A 1ECBA 2PCLA 1G8YA 2B20A 4KGZA 2C3OA 5LYJF 1TVCA 3C43A 1PS9A 3L7NA 4HZUA 3TQIA 3K8QA 2PO7A 3CZ9A 3EGVA 4LMBA 3R5XA 4QDUA 4DAOA 4F38A 3V4RA 2PVSA 1TEXA 3LYHA 4Y1FA 2CF5A 3A3YA 5BN4B 1FP4B 4BO5A 4EOGA 1Y6ZA 3OU2A 2R7LA 5M2QA 1DBWA 4MNTA 7MDHA 2QUIA 3PI6A 2GM3A 3EBPA 3FCOA 3Q15C 4TXJA 2KBFA 2GJAA 3V46A 1GQFA 3AC0A 3V7WA 2MMGA 4CMJA 4BBZA 1YL6A 1RXWA 3PNOA 5FYQA 1UDAA 1QIKA 3WL8A 4E14A 3EIHA 2ZREA 3COYA 3EYAA 4JR2A 1S2NA 5F73A 3GV0A 1NDQA 3GWZA 2D4HA 3T4PA 1N6RA 4JOBA 3EZLA 5CU7A 1QGOA 4LS3A 4NS4A 4U39A 3DLTA 3NGXA 2H9IA 4F2GA 3LECA 2K6GA 5IYZF 1R4NA 4EJ0A 2DE0X 4Z3DA 1X15A 4IEEA 1L4BA 1DQPA 5GOTA 3ZWDA 1KDPA 1LSJA 4PEVA 4PZEA 3PWZA 3F2IA 2XV1A 4YQZA 4YJHA 1C3JA 3HCCA 5F9MA 1B43A 3VC1A 3VJMA 1IIRA 5BNZA 1VHLA 4I2VA 1ICIA 3GLHE 4AK9A 4RD6A 3AR5A 3DFFA 5EJAA 2WUVA 4RV5A 4DE5A 1TTTA 3ZNQA 1QK3A 3GR6A 3LIPA 4YR9A 1ZRNA 5TX7A 1J06A 5TVGA 4ZCIA 3S2UA 3X0DA 4ZJYA 2BKVA 5CXQA 5EKDA 3KQQA 2GWHA 3ZDXB 4XQCA 3E7XA 5KKAA 3D31A 2Z5GA 4QYIA 1NBHA 3RG2A 3SLGA 1MV5A 5AICA 4QJIA 4K9RA 4Q93A 4A73A 4BYGA 5JSQA 4Z9YA 3GZJA 2Q9UA 4NY1A 3M8KA 1V0JA 3OPXA 4GPIB 1VL5A 4BFZA 4I36A 3VO2A 3OTQA 1HZJA 1TUEA 3GARA 3ORSA 1RHJA 5BSTA 4FI3F 3KE8A 3SM9A 4RHYA 1GAXA 4JI2B 2GKSA 2W6IA 4LZPA 3TNYA 3EXEB 3TI9A 2C9YA 3FFWA 4JB8A 2VTBB 5KYWB 3IAEA 4I5GA 4E5SA 3JQ7B 2SKEA 3KSZO 4V03A 1H5UA 1KBZA 4DPMA 1DRJA 2C8LA 4K88A 1KI4A 1N75A 4IWNA 1T3GA 2VQ3A 1OJLA 1CUWA 1XZPA 1ZITA 3TCNA 3HXTA 1TT7A 2VPYA 1I2MA 3KB6A 3VPHA 1DUVG 4N5MA 4R41A 1YR9A 4MW2A 4YC7A 5AKJA 4LOIA 1I4DD 5JAIA 3C87A 1VMDA 2ZU6A 1Z63A 1M8KA 1IBRA 3AQIA 1RVDA 1SBQA 1JG7A 3GLKA 3P27A 2ODTX 4Y2JA 3F3YA 3K5PA 5CNKA 4CG2A 2H2WA 4IIVA 4P4UA 3BXEA 2G4VA 2OG2A 4FEAA 5JAPA 1TECE 4ZVQA 4BNUA 3QSYA 1XDGA 2WVHA 2PSEA 3ZQ4A 1G8PA 1J8VA 3PRHA 4BRUA 5GWXA 5LOVB 2DPMA 4NNJA 4GI1A 1AO0A 1JU3A 4BY9E 1NE2A 1UOQA 2ADFA 3EODA 4HY3A 3U3JA 4RFVA 4KDCA 3WYFA 4K28A 4LSGA 1LNQA 1T91A 2AX3A 1ILEA 1KBQA 5CVUA 4Q7MB 2IPOA 4GRDA 4UAJA 4CIAA 4BTVA 4RTKA 3ESZA 4OCZA 1F4VA 1PNOA 2XUQA 1MJ5A 1WULS 4OEHA 2ECQA 3L06A 1FXWF 2ZS9A 3LPCA 4RZSA 1KOFA 5EHQA 5EKUA 4ZVSA 3VPBA 4KX3A 4KUGA 3S1SA 1L0BA 1RRVA 4X93A 5TMPA 1JG1A 1GZHB 4FZJA 3R76A 3U3KA 3LTNC 2PS1A 1R3DA 1NDUA 1XN4A 1V9SA 4IGEA 1XTJA 4RXUA 4XGIA 2ZPTX 3V1NA 4ES6A 4X20B 5BNFA 1BQ4A 3TD9A 1KF0A 2E1PA 2X9NA 4MRAA 2V98A 1ADJA 2RHTA 2XB9A 3C6BA 3DM9B 1SBZA 2O2CA 3H7IA 4O2BA 4XJSA 5E6RA 4A10A 3FF1A 1G8KA 4X84A 2XPCA 3BD9A 2OVBA 5FV4A 2FJ0A 4M1ZA 2QLFA 3OG9A 1U3CA 2X0DA 4MIEA 1G59A 2FF5A 1EG7A 4II2A 3PXEA 2O8BB 3Q7PA 3AEUB 3F6YA 3TRIA 4FB5A 5KVCA 1EBBA 3BJRA 3KXDA 3LGSA 1Z36A 1ZGJA 1N2CB 1NQWA 4WOBA 3LPLA 1GU7A 5FI5A 4D4IA 2DMRA 4FTWA 1QRUA 1HDYA 4TS9A 4HTAA 4ND8A 1LSOA 5K4HA 2ZK7A 4OOFA 4KDRA 4AQ7A 2PZBA 5A0FA 1DIBA 3FZNA 2FWNA 5ALVA 1P29A 3KDSE 4QJ3A 16PKA 1V37A 2HREA 2OWEA 4OMCA 1JU4A 4Y2HA 1B0PA 3NYQA 5EZYB 4AKEA 1BX1A 1V16B 5JAOA 3FUTA 3HUTA 4E03A 1B3RA 4CFZA 1ADGA 4NE9A 4LXGA 5EXTA 2O2DA 5EIXA 1N32B 3WNDA 5JDIC 4ZO7A 1N2ZA 5A5FA 5K0CA 3Q7IA 2HA3A 2ETVA 2C5EA 3LRTA 2VTEA 5JS8A 4C5BA 1X1QA 1TF7A 3RW9A 1YVRA 1XNJA 2A9KA 4I9HA 4D9MA 4HWKA 3I5UA 4UVHA 1I0LA 1OTYA 1X0XA 1CUVA 4GGMX 3ZHXA 2GXAA 3K9LA 2F3SA 1O0SA 3AYZB 3LUJA 3TZHA 1VHTA 3ZWXA 4LJKA 2VPIA 4PC7A 1M83A 4RM3A 1FP6A 1U0TA 3Q3VA 1J2JA 1L5RA 3O2QB 3TJRA 4M1WA 4AMUA 1OIWA 1JHXA 1PNTA 1A2OA 3AKDA 2CNNA 2NIPA 1X1RA 1F17A 3JPYA 2QXUA 1VBKA 1ZK2A 4WLOA 4KWHA 2WE7A 1Y3CE 1A27A 1A8PA 4HMOA 4NECA 4NI5A 3H2BA 4AYTA 4BMOB 4BQRA 1XD2B 4ENTA 1OB2A 3GRZA 1UBHS 2ZBQA 3UFBA 5C53B 1K98A 3B53X 2YINC 2R6ZA 2VG8A 3NVMB 4L4XA 4BX8A 3KJHA 3C7KA 4K03A 3T5MA 1N9GB 4X9XA 4X6UA 4CNBA 1I4OA 4YREA 3PQFA 2I6QA 3EXIA 1GZ3A 1NOJA 3EW7A 3MCZA 3OX4A 4M6WA 5C2JB 4FNOA 4QO7A 2ZETA 5LDHA 1LLCA 4H31A 4IFTA 4W9RA 1E64A 2RGBA 4Q4JB 5C5EA 5GADl 1K8QA 5J43A 1AMNA 1ESNA 2ESRA 4LRSB 5IJAA 3FPJA 2B0CA 4UPDA 3KP1A 3TLEA 1XZLA 2EFYA 1BG6A 1F6BA 3DT9A 4Y2XA 4A7PA 2RK4A 5JMWA 4C2BA 4AS1A 4GI7A 2IEZA 3KKMA 4QGFA 5CJPA 4JYBA 5CDUA 2PANA 2A3NA 4G89A 3FYHA 3MWKA 1GUYA 4WOKA 2PZFA 4X90A 3PYMA 3G5TA 5K51A 3UV7A 3HM2A 1LPOA 3A3PA 5BR8B 1WHSA 4FYVA 1O6BA 1A8HA 5DBHX 4EO4A 4ZK2A 2PIDA 4WSOA 4FIDA 3WGKA 3QEAZ 4TOIA 1Z8DA 3TZ6A 4EK9A 3PNYA 2M2IA 1CUEA 1Y1PA 2WRZA 3ZHCA 1QO9A 1GFSA 2JBHA 3HXMA 3LA6A 3LWDA 3I9LA 3I28A 1IHPA 2ZRLA 4DUPA 3FZEA 1YVUA 1JR3D 2A1UA 1UZLA 5F7ZA 2AJBA 2HIGA 3Q6NA 4D5GA 4Q4HA 1P0MA 2YNMD 3DMPA 3OT5A 4MI3A 3R4VA 1JFFB 4TQ9A 4U2CA 1EE9A 1LC3A 5DTEA 1QYRA 3EPLA 4LW8A 4P5DA 1X3SA 3KLMX 4H6VA 1UXJA 4KP7A 1NV9A 4KRXA 1XNHA 4J2TA 2QR5A 1QG6A 4UNQA 4UDOA 1HOTA 3R7WA 1LPBB 1OBHA 1LY1A 3PGKA 3PLRA 5E7QA 2ONKA 1H1LA 3BIOA 1NBEA 3SYMA 2WJGA 3M5CA 4KC0A 1FDTA 2IITA 3CY6A 1U3GA 2XVYA 3Q88A 4DPKA 1A0OA 2C00A 4FHGA 4B9EA 4F3RA 1KFKB 1QKKA 5AKKA 4NEHB 4F8JA 1PUJA 1ATZA 2D0DA 1ZM7A 5HCIA 2O7VA 1EFKA 2FQYA 1F4LA 2XVMA 2OCXA 4PLHA 1L4EA 5DCLA 1E6EA 1UFVA 1ISRA 4FDMA 3HYCA 2F7SA 1CUJA 1KY4A 3N7AA 3DXYA 3UGQA 3ZE1B 1L5GB 1R8JA 3R8FA 1OFIA 1PIWA 1P91A 1ZINA 3V1MA 1E89A 1V1RB 3H2HA 2OILA 3Q0IA 5F12A 2VDWB 2IU6A 1ECPA 1YCGA 2QPOA 2QQGA 2P35A 1GNVA 3FWNA 4CMAA 3SIRA 4FD2A 2OK8A 3F5DA 5I4BA 1EP1B 3U61B 1Q6ZA 4MYDA 4JLSA 4MA4A 3C6MA 4LGMA 1JIJA 2JHFA 4R0VA 3TK1A 2QN2A 4BO4A 1YZQA 1WZCA 2V5UA 1E94E 1HX7A 3GGOA 1ZO8A 2VT7A 1KQNA 2C2HA 3WSTA 5JANA 4NBRA 1QGDA 4JC0A 4PYRA 2JGLA 1UZUA 2R8RA 2Z1DA 1UT6A 4XGRA 5CIWA 2A0FA 4ZU1X 1WUIS 3UMFA 2P2NA 5A62A 1C41A 5TC4A 2PGNA 4TWRA 3C24A 4RETA 4KITB 3WIVA 3RE1A 1I3LA 2PBRA 3SYLA 3DWGA 1J9EA 3OX3A 2VPZA 2Z57A 3PJFA 2JVJA 2I78A 3RH0A 4CUZA 3BMOB 1CSEE 4PPNA 5FXMA 1R0XA 2ZPUA 4MTLA 1OWLA 3A1SA 1O97D 3OZIA 5DTQA 3V1KA 4BCCA 4JV5B 4QLAA 5EOVA 2H1SA 2J9RA 2DHQA 2E7ZA 2X1VA 3IIIA 2IZ5A 2HHLA 3D59A 3HLTA 2CBGA 3JRNA 2XB2A 3IQXA 3K53A 2JFWA 4N0PA 1F4PA 3HXQA 2VJDA 4MQLA 3ISVA 2M1XA 2X5NA 3AONB 3G17A 3IT0A 3GAMA 2GCOA 3E53A 1NRJB 3KHKA 3UJCA 4K6FA 4HB0A 4CMEC 3CINA 4CJXA 2DFVA 4FU0A 4CEJA 3N9IA 2GN4A 1M6WA 1KVRA 1V45E 4NH0A 5ILGA 2C92A 2ZJAA 4GP7A 4MQEB 5T8KC 5CVJA 5DOZA 4IIJF 4YQYA 2O20A 2HUNA 1A77A 5AM1A 4JLDA 5LU8A 4YV7A 3NUQA 1K0UA 2CLLB 4CEJB 4PO1A 3WLPA 1B1AA 1NRXA 4LXHA 3H17A 3X1KA 2ZB2A 2B9VA 4G1EB 1XFDA 2WDZA 2X2OA 4EECA 1FJXA 4GR9A 3UAWA 1PD0A 2AG0A 1TKAA 4BN0A 4TT8A 4KB5A 2VPPA 4NOMA 3GG9A 1I2AA 5DNYB 2KE5A 1C1XA 4FOLA 3UMMA 4AY4A 2YBDA 1ZIDA 2J67A 5ARBA 2OZVA 4QUDA 2UV8A 4IDNA 1RRPA 4KAFA 4WXPA 4YWHA 2CJFA 3UMBA 2IYPA 3PQ6A 2OTCA 3ZXSA 2JFYA 1HE3A 4AKHA 4O29A 2JC3A 3JCZA 5DWDA 2V5AA 4G1FA 4M0MA 5IAJA 3O3OB 4KOAA 5TQ2B 4AZ3B 3TZQA 2M9MA 1RHUA 3QUBA 4KN6A 4P4NA 5IT0A 2CUTA 2YS7A 1AM4D 4NK5A 1X1DA 3HVKA 4KQEA 2P27A 2ZE6A 1M74A 2SCUA 5EQFA 3EAFA 2J3KA 5KAPA 4JEUA 1KYVA 3DVLA 4O25A 2XYPA 1FQWA 3IRVA 2B7BA 2R11A 3A8TA 1Z4OA 3DUFB 3VO8A 1FFEA 4NP6A 4MR9A 2H52A 1NJFA 4KVZA 4J49A 2L2QA 4MS4A 5JO9A 5CFZA 1TK3A 5F1KA 3WYGA 2PSSA 3CNHA 4F86A 2FWMX 2XCOA 3TLJA 3JAWB 1YJXA 1II9A 4RAOA 2BJWA 4LE1A 1E18A 2EV9A 5AI6A 1YL7A 1P2UA 2QENA 3ZUPA 4LHXA 4XLZA 2C59A 1ZNXA 4C04A 1YS7A 2EFDB 1JQAA 4MVYA 2FR1A 3M3DA 4W5NA 4HX2A 2JARA 4A0SA 3PPXA 2VXCA 2X2EA 5B4TA 2QQFA 1VJTA 1MB4A 4BNLA 3T5PA 2H18A 3PA8A 5CEFA 2VP9A 4PSDA 2AZ4A 1S2OA 5AVUA 4KUEA 4ZARA 3MJ4A 3DQPA 5BYJA 3GH1A 3OZDA 1LQUA 4KN8A 4NPCA 3LXUX 1P9RA 1ZUNA 1JIQA 2JGFA 1VMKA 1W4AA 4NH4A 4PN7A 3VISA 2A9RA 1VKOA 3I73A 4EKGA 2RH5A 4HGPA 2PT9A 3NWBA 1A8QA 3IR6A 4H7IA 2ID9A 4PLVA 4ZJUA 1S0UA 3GCGA 4JVSB 1X7XB 3A36A 4HNSA 4PLTA 3QVLA 2FCRA 1L5OA 2FEPA 1M7BA 1LLQA 1QK4A 3LYAA 3PKJA 4LRTB 5F64A 5HTKA 4DVJA 1PQ4A 4D4GA 3T3NA 2VO1A 3QBTA 1BU5A 2RCYA 3UHJA 3IBCA 5HKKD 2ZYVX 1R8YA 4ENVA 5AIBA 3EF1A 1QWSA 3LT5A 4CL0A 4L50A 3ODPA 4LDQA 2HJSA 4GO1A 4LTDA 2GO7A 4NJMA 4AW9A 2EHDA 4R7ZA 3G2MA 5ITSA 4TS1A 2G40A 4RDIA 1TB4A 1WKVA 3AF6A 3QX9A 2PL5A 2HA2A 3DHYA 1L2TA 1KO7A 3EIFA 1SVWA 1UEJA 2VC2B 3A05A 1M6VB 1DCMA 3GRCA 4HDNB 2OD7A 4I19A 4JIGA 1DJNA 1IUKA 3K1TA 3MQFA 4YH1A 3R7BA 4AYWA 3LZ6A 1KTVA 2O6LA 3NLLA 2Q3DA 3E7FA 1RM3A 1JR2A 1WPGA 1MD9A 2D62A 2QWXA 3LUGA 3T9BA 1Z4NA 2Y1WA 5K1ZA 4O3MA 1HT3A 2EXXA 1WHTA 3H1AA 4IZ6A 1TT5A 1UXOA 1UOOA 2HV8A 2OXRA 1YDWA 1UR5A 3BWXA 3IKVA 3AEKB 2QZSA 2DPLA 4H59A 1DAEA 1MQSA 2Z4SA 3H5OA 4GWKA 4MPJA 4XASA 3RIHA 3NNSA 2GYVA 1HT1E 2VK4A 4KH1A 4UAUA 3HP1A 4WCFB 5GGXA 2F43A 1LPSA 3RRXA 1O9BA 1J7KA 2VYCA 4IJQA 4ARZA 2EVWX 2H07A 3B38A 2CNWD 2Z8XA 1QANA 3DLAA 2XLCA 1M2EA 4MGIR 4EFKA 5CX4A 1S8NA 3AUJB 1U4NA 1R2QA 1FNNA 2XE8A 3A2LA 3LAWA 4Y2SA 1AV6A 1ORIA 2HSZA 3NJRA 2WC1A 1BEZA 3QLTA 4DKJA 2I6SA 5F4ZA 1AC5A 3KV3O 3N86A 3ZWVA 4GDMA 3TZLA 2QZZA 1D5WA 3DGFC 3O3MB 3QOFA 4C03A 4ZPJA 1WXWA 3KZ1E 4EJSC 1U1IA 2ZVQX 1OZFA 3RVPA 4D3SA 2QE7D 2I9KA 2XXAB 3IAUA 3I6QA 5FOQA 3WMFA 1CQWA 5GV7A 2LNDA 1OZGA 2D1TA 1SBTA 4E3ZA 1WSWA 3G13A 4JYZA 1A8UA 1RYYA 2OC9A 1ONNA 1SC1A 4L3VA 3N53A 1LC0A 5T4BA 4ENWA 4B4OA 3F8WA 3V8NA 2AV6A 3CKKA 3WISA 4RLHA 4NDAA 1WEHA 2OQIA 3NTRA 3R8XA 4X60A 1KI6A 3LC2O 3NONA 2OZPA 4V3CA 5JCJD 4Z5XA 4KI0A 5F1OA 3R9KA 1SY7A 4UARA 2GN1A 5BVHB 4U9HS 1HMYA 1Q7RA 1KMHB 5BRNA 4R1QA 4FB4A 3FBTA 4R69A 3K6SA 3DVAA 1TZKA 4RK7A 3ENZA 3ZVMA 3RYHB 3K35A 4C2TA 2SBTA 3OLXA 4QNNA 2H4YA 2AFHA 5BOSA 2D0OB 1YRWA 3T5DA 2AL7A 1J2UA 1J0AA 4RGQA 3JAKB 3SEFA 1RRMA 5CDGA 1L5SA 1CE8B 4HC4A 4I4NA 4QU0A 1DBSA 4OYHA 4JI1B 4BZQA 1DEHA 1H5QA 5CFLA 3G82C 5EKSA 2ZYWX 1Z5VA 4RYDA 3EGEA 4DCOA 2ZRBA 3AK4A 8ATCA 4YRNA 3P2YA 4N0EA 2XGJA 2C94A 3T7CA 1VYTA 5JBNA 1QGUB 4R1UA 2EWMA 4EWLA 1D1QA 2DUJA 2HZBA 3GT3A 3HJFA 1AKEA 3V4ZA 1LKZA 2C07A 3K0CC 2B8WA 3VOAA 1PR6A 2NXNA 5ES4B 4WERA 4CI9A 2PH3A 4EYSA 2RI0A 2GJKA 3VTKA 2VHZA 1SJ9A 1M34A 1R1DA 2XDAA 1PUIA 2II6A 4KCGA 3T7JA 5KYNA 3UWPA 5HUJA 1KI8A 4YAEA 5EXSA 4H1UA 1QV9A 5JPIA 3ZR4B 3LO8A 2A0WA 4MUGA 3KZVA 4RV4A 3T7IA 4MVJA 2ZCUA 4LBYA 3F3SA 2NGRA 3N0VA 3GLIE 4N12A 3QBDA 1NQ5A 3OZRA 4CN8A 4HYYA 4BNZA 3INGA 5A9RA 2QUAA 2P67A 1PK9A 4ZPXA 1E9AA 1BS1A 4JLJA 3KL2A 4OA8A 3QYJA 4GNRA 5DYTA 3AUAA 2IH4A 3GQBB 2BEVB 2VJCA 3BBPA 5IZCA 1F6DA 3OETA 2J8ZA 4YRFA 1FNDA 4A3SA 2H1HA 2WINI 1M1YA 4YY3B 5DDIP 1KKMA 4XTCS 1JFTA 2BJVA 3E18A 2JRLA 5C1PA 3ZJUA 2VSNA 3L46A 3JQGA 2J4DA 2NVOA 3K09C 3LBNA 4A26A 2Q9CA 2XDYA 4HDNA 4M87A 3UAYA 2WYIA 2I76A 1XTBA 4BEJA 1CHDA 3IVGA 3LD9A 1C5KA 3GUZA 5TGZA 2G9RA 3RO7A 1Y1RA 4IKOA 2Z3ZA 4IUDS 3W04A 5MGBA 3MUNA 4AN1A 4XM0A 4UEOA 3O8BA 3Q5EA 2BHNA 4JVNA 3F7OA 3SC2B 2KPOA 2JGEA 1KQPA 1SOMA 1YAJA 3KWJA 4LHEA 5DM0A 1Z68A 1QQTA 1V96A 2OB1A 4AL4A 2D2IA 4C4OA 2WZQA 3JYLA 4EMTA 1E3WA 6Q21A 1OI4A 5A06A 3EZ2A 1CDDA 3EMDA 2WF9A 3JAMA 3ZBQA 2VF4X 4CDGA 3EFHA 4MGZR 3ECSA 1TRHA 3SJUA 2YASA 1GARA 4AQDA 2BTEA 1XWFA 3IQGX 3RSZA 1SBHA 5G0VA 4G5QA 3GX1A 5I47A 1CF4A 4MZXA 4MVJF 4LJ9A 5DM1A 1GGJA 4BNTA 4CUJA 4F97A 3OI7A 3GRYA 5LOVF 2NAFA 5GONB 2VEOA 4BJ6A 3V48A 1Y4UA 4BV8A 2YJNA 2WF7A 2ZBEA 3CIOA 3I92A 2P6NA 4RD2A 4KQCA 3FPSA 5F2KA 3ZQKA 5BUSA 2PZKA 3IUBA 2QR3A 2WIKA 3EXFA 4BFLA 3VC7A 3GDOA 4OU4A 2G28A 4Y1RB 5KOJA 2MDTA 1M54A 1XTIA 4P9NA 3G0CA 5BWCA 1RJWA 4GSKA 3BQNB 1Z3IX 2F8TA 3UH1A 4H0CA 2H9YA 3TUZC 2PLNA 1HR0B 2QGFA 3OIFA 5JD5A 3CEMA 3GAZA 5FV7A 3KKNA 3C6ZA 4BO2A 2AFVA 2AJLI 4I6GA 1N1EA 4XYGA 2QV7A 3F7TA 4UVEA 2LP4Y 1RFLA 4XDYA 5DM2A 3TB6A 4FIZA 2FQWA 3SJAA 3NTQA 4EPYA 2Q21A 4UOEA 3VZPA 2CJXA 4XH9B 1L6RA 5AKYA 2P2LA 1C2TA 1DZ3A 4F2WA 5KVSA 5K0NA 2CKDA 2C82A 4KQXA 5A71A 1MP0A 1OXBB 2FVYA 4MAFA 3GCXA 4QASA 4P81A 5ENZA 5K0JA 3ISTA 3JS5A 1UBMS 3U4MA 2X0EA 4KMMA 1SQSA 5C7OO 4AY5A 4IH9A 1P1FA 3Q1KA 1DELA 1J24A 1GUAA 3MJDA 5HF5A 2NVUA 1Z5GA 5HILA 1WZ2A 1TU3A 4HDKA 3MTBA 2XUDA 4I3GA 2IY9A 3F78A 3H2ZA 1ZBQA 1GQ2A 4G9GA 2M6SA 1RXIA 5GIPE 5A5DA 5EUMA 4GKAA 2BISA 3SXJA 2VYVA 3K71B 4DUYB 5EFZA 3BERA 4EB6B 3QF4A 2RD2A 3OEYA 3L8HA 4B0OA 1Y8ZA 4MPDA 4FWBA 4NDNE 1CUIA 3UMSA 2A5LA 4X7PA 2I6FA 4L2IB 5IAAA 5HE9A 1LTHR 4GU5A 1E2FA 5CLGA 1X7ZB 4CM8A 5JVDF 2PT5A 3OZFA 5KWSA 1Q1GA 3I72A 3N8IA 3RVOA 3UA4A 3E3MA 4BMVA 3GVIA 4B6JA 1WR8A 2NXEA 3NBFA 5HJ5A 4LGCA 3N8KA 3ABIA 3I2HA 4N82A 5A4FS 4G07A 3HWX1 2DSNA 2F1RA 4HSEA 5BWLA 3IOYA 2Q8PA 4DNFA 4LTMA 3VZDA 4UE6A 4E5PA 2CXXA 4E4TA 5C8VA 2Q2VA 4AXBA 4DBVO 4OHKA 4EW6A 2WM8A 2REBA 1FQKA 3GUHA 4QICA 4ENPA 2D7CA 4LV6A 4BN4A 3GJ4A 2WILA 5HKBA 1VDZA 3ANYB 3KL4A 2RI6A 5I6DA 1KO1A 3BKWA 5TT1A 3RRYA 2XOXA 1XQXA 4FCWA 4IILA 2UZAA 1SKMA 3TDNA 1J49A 1N3IA 1U9JA 1OKKD 5TPWA 5JPCA 1F7VA 2FR8A 2XRFA 2PL9A 2X2FA 4BNNA 4H7KA 1D2RA 2CLEB 1Z7WA 1XCPA 4I6EA 4D80A 2GUGA 3EDRA 2R6DA 3USZA 3WHPA 1X1SA 3DEAA 1ND5A 1V3UA 4L0MA 4MQFA 5B1EA 5AVKA 1EGHA 3T3MB 4MJXA 3FAZA 1XJQA 3GEBA 2CLMB 2FZ4A 4CLOA 4RX1A 5DNEA 3FBGA 1CNFA 1HQDA 4K9QA 4K8OA 2VCYA 4QBFA 4YI3A 3TXXA 4YMHA 1P4AA 4ZAWA 2JBAB 2WPDD 4BNFA 1VI2A 2ZWPA 4QG7A 4UVIA 4DWWA 4NRDA 3RIXA 2P2DA 2LW7A 1AY0A 2P5TB 3TQCA 1SELA 2VDMB 3L7OA 4Q4AA 2OV8A 5J2TF 1J20A 1M9NA 5I7SA 5KNBA 1JJFA 1WV0A 2QP4A 3KKZA 5JMPA 4KNYA 5JCPA 3FOCA 3ZTTA 4ALKA 5I8WA 3EVDA 1YQTA 3KSBC 1UP6A 1XLUA 3DG9A 1LDYA 4AN0A 4GMGA 1YJBA 2YJTD 1UK9A 2UUPA 3B6MA 2WKPA 1U7PA 4TTIA 4TSFA 3BUSA 5ECGC 5FUWA 2Z1NA 2IZ7A 3CF6R 1Q0QA 1UC8A 1EE1A 2GN6A 5TVKA 3WIUA 3L92A 3OE7D 3TL3A 4OXQA 1KZ6A 3T4UA 5B3KA 2NN3C 1KP3A 3IJPA 4HEJA 4KQIA 3PDHA 4MV4A 5IAOA 1QG2A 4JVOA 1RMQA 5ILQA 1I3KA 4KXMA 1ZU5A 2H0RA 2NZJA 4QFDA 3NAQA 3ROFA 3WZMA 1B73A 4CYMA 1X7YA 2O8EB 1E4EA 2RI1A 1U8EA 4FW9A 2YHIA 2UYHA 1XWWA 4BU0A 4G0WA 1PL6A 2WWVD 3WWZA 4V0OA 4J7CA 1PJTA 3T0FA 3VA7A 2V8BA 3N39C 1TTPB 1MX1A 1U2GC 3EXG1 1Q0LA 1SZCA 3FNEA 3RWOA 4UATA 3ULKA 1SURA 2X8JA 1XT6A 3HBLA 4HVTA 3D3NA 2Y2UA 2CDAA 1BVRA 1EUDA 1OROA 3SD7A 1UANA 1RD4A 2ZIXA 4F4FA 4D3DA 4W8OA 3STXA 1TEVA 1U3WA 1E96A 1G21B 2EIXA 1YRQA 3GJSA 3KRTA 5JECA 2IC5A 1LS1A 3UWMA 4RKQA 3IPXA 4KK4A 1P19A 1EHIA 3UAZA 2RMKA 3QH4A 5K3AA 2NXCA 2G4CA 3C98A 1VLLA 1W34A 2CNWA 2WW8A 3AV3A 3CH5A 4Q9DA 2B8EA 4K26A 4O4IF 4IXDA 4BKMA 4D3ZA 4E5NA 3OPNA 1F14A 1P45A 4L15A 5G4KB 1Q15A 3OWXA 3V1TC 3PZRA 3AM5A 4BO7A 4NZMA 4JBNA 4KO8A 3DCIA 2M6RA 1QVRA 2VHWA 3KBOA 4IBOA 1PI3A 2QP3A 4DRZA 4EGSA 4F21A 3SNKA 3RWMB 3A4VA 5KNDH 4KR7A 4B3RB 1FFWA 1IL0A 2WIDA 4QO8A 4RFSB 4ZVLA 3H8VA 5T3YA 5A5EA 4NF2A 1CJVC 4FCTA 2HCRA 4YP6A 4KTVE 1CYDA 1WF3A 3IOEA 4B3JA 4RA6A 1E2DA 3COWA 4L8GA 4ZAFA 1CK4A 4C7MA 3BVPA 3M34A 2I3AA 4UC0A 2ZVPX 5LOVA 1BXRA 1DAOA 4IIGA 4K9NA 5FOWA 1G1MA 3JTMA 4PYKA 3TKLA 3QJGA 4S35A 1PNQA 2B5WA 2J6BA 2HT6A 4I9UA 2F6RA 4Y30A 1RZRA 3LFHA 4C0LA 2CE2X 3DZKA 3Q3HA 4WGFA 4D26A 1CYEA 2QLJA 1G3QA 1YOBA 2V6IA 3KXLA 4G9EA 1LI5A 1PQPA 2HMTA 4XB2A 1KYWA 5TARA 1MAVA 4D9JA 5IC5A 4EL0A 2VNAA 3PQCA 5E2IA 3EQ9A 5FTKA 3WBBA 5BXYA 5JWRA 4BRZA 3B3GA 2GN0A 1XJWA 1EI9A 1K27A 1QGUA 1AG9A 1YB6A 2TSYB 2BFCA 3Q8WA 4Z9AA 4M7RA 5H81A 3CCFA 4DQ0A 4N5DA 1HFWA 3QWBA 1SXJD 3QVWA 3AXTA 4PW0A 3R6TA 1QGYA 3L8ZA 1KJYA 2Z5FA 3JVUA 1I1NA 3C70A 3HDHA 2OBYA 2YY7A 1J99A 3LY5A 3LQFA 3IB3A 1BCRB 2JAXA 2R7KA 3FNGA 4OH7A 3NC1C 4MYRA 2AOXA 4PS1A 1XTUA 1JMKC 2J9YB 3UPTA 3VYSB 1W94A 2X4LA 2R4UA 4PSAA 1AA6A 3P2IA 4OGWA 4V0LA 2Q0QA 1TVKB 2XSZA 3WB9A 2WHPA 1FTQA 2WPNA 1UBEA 5FOXA 3ZE7A 4E0BA 1IY8A 2C1EA 1TADA 3JR3A 4KSCA 3R9WA 5B4UA 2VFAA 4O4IA 5BQXA 5C7IO 4J16A 1ZESA 3F4BA 4GFDA 5B2ZA 4TM8A 3UK2A 1NWCA 1WD5A 3CH7A 3STYA 1CRWG 3E0QA 4D92A 3KLBA 4I1IA 5IYZA 4MQUA 1T2DA 1X19A 2Z0MA 3FFTA 1RXCA 4HJXA 4PTYA 2ORVA 1DLIA 4IQ0A 2GD1O 1XLVA 2H2AA 2OHVA 3WNBA 3HJGA 5CFQA 2I55A 1TE2A 2AC4A 3VU9A 3HQ4O 1DKQA 4QBHA 1W6UA 4WKGA 3ANLA 1NVDA 5EJIA 1G5RA 4BNMA 2NUAA 1KOGA 2V55B 2JVKA 2PMCA 1R7RA 2HQOA 1LJ8A 4S2UA 4HB3A 2JGRA 1TJ5A 4JD5A 5JRJA 4WESA 3BXXA 3ADBA 1ORVA 2VH5R 5EN4A 3LT1A 1XTVA 3LX4A 1TI7A 4XR4A 1JZTA 3VDQA 4ARIA 4WFQA 1U7HA 2WP0A 4OJMX 2NADA 2XGSA 2BM9A 2VUSA 4OQ4A 5KQRA 5M04A 1W35A 1WE2A 3WLRA 4K1LA 2XUHA 3TLMA 4BIMA 4OQQA 4C22A 3I0NA 2EBUA 1HLDA 2CXUA 4MHSA 5LNK1 6REQA 4CIVA 4D4JA 1PSDA 3MN1A 5KPJA 1EK2A 1GTMA 2Q5HA 1RP1A 821PA 2K2QB 1K88A 2R1UA 3KOMA 1FZQA 4QA9A 1J8QA 4EITA 5DNAA 3HJUA 1M72A 3GNLA 2GK4A 3UAOA 5FD8A 4O33A 3CSSA 3SYTA 4WK2B 4JKYA 4EHIA 1F38A 1F8YA 4CGZA 4TLDA 3LWZA 1XO1A 3JQBC 1COWD 3NTXA 2E48A 4GPEA 4MCAA 4MR8B 2PL1A 2QGZA 3UK6A 2D5IA 2W70A 5KYXA 1MBZA 3INYA 2H2DA 3B5JA 1ULHA 3CZ5A 3QG5A 2HZ7A 1ZRSA 4OATA 3SIPA 2CMGA 1G20A 5TGTA 1OH5A 2FKNA 3QVGA 4D9CA 4Q7LA 1G7RA 2XQIA 3OE1A 1IFXA 1XN1A 2IDZA 3QEJA 4B3IA 4E30A 5KNDA 1FW8A 2XDWA 3FSGD 2ODBA 3WXMA 2F2TA 4OSOA 2I8AA 1JLLA 3ITEA 2WTXA 4OFBA 3AZOA 2Q1YA 3B3AA 3WZLA 3D64A 2FN9A 4B83A 5H8WA 5KMGB 1PN3A 3MSCA 3O82A 1RADA 3DHWC 3GA5A 4CF3A 1YRAA 1ZN2A 2QLMA 2C77A 4R2LA 4BVBA 4ER0A 1MLDA 1K6IA 2WWGA 2EJBA 2R65A 3KQYA 3LTEA 4YONB 3AVWA 1JE0A 1MXFA 1UQTA 2CNOA 2VWQA 4U7DA 2FE4A 1E2JA 1IHUA 3OOYA 1GVNB 2EP8A 3PR1A 3R3WA 4H17A 1IHXA 3C5CA 3U4HA 4D9HA 2RE8A 1KS9A 4QVGA 1LBSA 4S0XA 3D6FA 5G41A 5KYKA 4D97A 1PR3A 1LNSA 2G88A 2P11A 4PSUA 5G1OA 2P6UA 2N1MA 4MUKA 1WB5A 3SQLA 3B1XA 3ELDA 3QBEA 4L3WA 2G5TA 4UVDA 1PGOA 4MEJA 4UW9A 1BD3A 4PNZA 4A82A 2RC5A 3LSYA 1RYDA 1M1XB 5GZ6A 1QVWA 2IE8A 2XNKA 1I2DA 2WG1A 3FJ1A 4OSPA 4R68A 1U81A 3ICOA 3BBLA 2AKEA 1TJPB 3BFJA 4N0MA 4QATA 3W8EA 1Z33A 1WF6A 2WB4A 2BEUA 1BHJA 3GZTB 1T36B 4JLWA 4TM7A 1W0CA 3N0XA 1XA3A 5HVNA 4B32A 3JQQA 4OGKA 5GM2A 3V2GA 1IQUA 1FXWA 3GW8A 1S2IA 1E79A 1RAHA 2HB6A 2RGAA 5LQSA 4ZHSA 1YOVA 3DLBA 4NCHA 1NE7A 2DKOA 1M8FA 1NMYA 2EFEB 1U80A 2H4HA 2ZWIA 3LBYA 2QEQA 3ZNPA 4DREA 5LJIA 5TF4A 2YHAA 3AR6A 2G63A 1P5HA 4V0NA 1E5XA 1N78A 4ENUA 5IMBA 4EJSA 1YBHA 4IVQA 5K7SA 2XUAA 1O0BA 4JT4A 4GW3A 4YJ3B 2HHAA 4WCVA 4XRGA 4HWGA 1MXHA 3MWEB 2QMHA 2ORIA 2V03A 3GJRA 4YK7A 4FR0A 4X8MA 3NVKI 4ZRNA 5AW0A 2P2ZA 3ESDA 1WJGA 3KCNA 3U3RA 3V42A 3CO5A 2OB2A 4PIPA 2CT8A 1Z06A 2R87A 1AD2A 1O9GA 1FQJA 3DQQA 1K66A 5FOSA 5KBYA 2MT9A 1IBKB 3HRHA 2VKTA 1XAIA 2AMLA 1PZMA 3VTFA 5D5HA 1EWKA 1PV2A 3KJZA 1CQJB 3L01A 3PIDA 4DTIA 4NCAA 2O52A 4HH0A 4TLCA 1HT2E 2YFHA 4O2LA 3UQYS 2VPQA 3LK7A 4NG4A 3PQ4A 1F2UB 2IEDA 3WV4A 1Z2OX 1GJRA 2QN8A 3C3JA 4IXTA 4HS4A 3JALA 4QPNA 2VJBA 5LUBA 3EUFA 2ZWOA 3IERA 3M1YA 3EGCA 3PSAA 4TTVA 2CLSA 4KSYA 3HR4A 4ZOEA 1B8OA 3T1NA 4BNYA 2CL7X 3QMMA 2XKBA 2ZTUA 5DGHA 2VJAA 1NBMA 4ESEA 1KI2A 3GJZA 3ZDQA 3ZEAA 5BSKA 2WZDA 1T0BA 4WVLA 2P4HX 4X5OA 4Q4JA 1PGJA 2IOFK 1H2HA 3AY0A 3LX8A 3R0JA 3O7MA 3TE6A 3VR4H 3IDOA 3M5WA 5I7FA 3ADCA 4KO4S 2HXYA 4DEXA 3VKFA 5IJ0B 1CF2O 2CXSA 1LRLA 3GEHA 3KWLA 3PSHA 1JMVA 2MSWA 4QRDA 3ND8A 4Z4CA 5DLYA 2FSGA 4B8YA 2ZIWB 4KQ1A 3A6ZA 1R0WA 2JI9A 1T29A 3OUZA 5E1DA 3AL2A 3RT7A 4HYEA 1Y3FE 1EBUA 2G1JA 3B82A 5FUBA 4B17A 1WZEA 1GAEO 1GZ4A 1PTJC 3GT4A 3ELYA 1U8FO 1NPTO 4AP9A 4CXMA 3TW8A 3R9XB 4LY9A 1KDZA 2H5IA 2PLWA 5DTMA 1V39A 4HFJA 4FGKA 2HTFA 3H8SA 4RW0A 1BMQA 1F51E 2GZHA 1E2PA 4MUHA 1RKBA 4M4SA 1YD7A 3UEOA 2PD4A 2ZIEA 3AHIA 4JJKA 1RHRA 1AKYA 3EQZA 3HCNA 4KE8A 4NZNA 1OY1A 2B25A 3DFKA 4JSTA 4EHBA 3JWGA 3R0XA 4BLWA 4Q1FA 4C3UA 2Z8ZA 1Z5PA 2QZPA 3ADPA 2DFKB 4AT1A 3W34A 4OGLA 4BMPB 3R3VA 2A0KA 3V1YA 1FU8A 5EWMB 4MPTA 5IXYA 2ZZMA 2JJ2D 4JOCA 3LDUA 1Y81A 1NVTA 4IFEA 4DIDA 2R9VA 3C3KA 5D8DA 3V3TA 1Z37A 4C7JA 4PLYA 5J5CA 2Z9BA 4D6YA 4RDXA 4BTEA 2YWDA 2WUGA 5F52A 1Q44A 5LD2C 3RSCA 3HCAA 1P7ZA 2WSIA 3RUDA 4BDTA 4EQ6A 5HYVA 1FLAA 5KMG