4Y91A

Crystal structure of a thermotoga maritima hfq homolog
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
66
structure length
66
Chain Sequence
b'FNLQDRFLNHLRVNKIEVKVYLVNGFQTKGFIRSFDSYTVLLESGNQQSLIYKHAISTIIPSSYVM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-binding protein Hfq
publication title Crystal Structure of a Thermotoga maritima Hfq homolog
rcsb
source organism Thermotoga maritima
molecule tags Rna binding protein/rna
total genus 14
structure length 66
sequence length 66
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2015-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4y91A00
1KQ1A 4XU0A 5GAMg 4M77G 3HSBA 1Y96B 3BDUA 4RCCA 1Y96A 1TH7A 1HXDA 2K57A 4F7UE 2FYKA 4M78C 5GAMf 3JCMe 3JB9H 2E64A 2FB7A 1LNXA 1LOJA 3BW1A 3JCMW 2VXFA 4M78B 5LJ3e 2JN0A 3JCMh 5GANe 4XTZA 5GAMj 3GIBA 3QSUA 3RKWA 3BY7A 5LJ3d 4M7DG 2DTIA 4M78D 4C92E 5GANd 5LJ3h 5LJ5e 2CGHA 4M7AE 4RCBA 3V8JA 2DVEA 5LJ5h 5GAOn 4HA8A 4F7UA 4XTVA 4J6WA 1LJOA 2DZ9A 1I8FA 2EJFA 4J6YA 3JCMg 5GAN8 2HNIA 3BFMA 5DY9A 4M78G 3JCMQ 4HT9A 1WPYA 4V2SA 1I4K1 3JCMf 3SWNA 4C92A 1M8VA 5LJ5g 5GAN4 1U1TA 3VU3C 4M75E 4M7AA 2VC8A 5LJ3f 2EJ9A 4XU3A 2VXEA 3V8LA 4QVCA 3QO3A 5I21A 4F7UF 1X01A 5GMKm 5GAN7 5LJ5f 5LJ3j 1HK9A 4NOYA 2EAYA 5GANj 3JB9I 3JCMP 1BIAA 3FB9A 3INZA 4XQ3A 4N0AA 4PJOA 4XTXA 5LJ5j 3V8KA 2YHTA 2I2LA 4C8QE 4PNOA 3JCMc 4C92F 4M75B 2E10A 5GANh 4M7AF 4JRKA 3FIFA 4M75A 5GMKl 5GAN5 4XU2A 4F7UB 2RD1A 4M75D 4EMKB 1KQ2A 2DJZA 4JRIA 4EMKA 1BIBA 3SWNC 4C92C 4EMHA 3RERA 4PJOE 1U1SA 1N9RA 3QUIA 4M77E 4PJOF 3JCMb 5GMKe 4M7AC 5LJ3g 2DEQA 3V7SA 3SWNB 4Y91A 4C8QB 4MMKA 4C92B 5GANg 4J5YA 3JB9D 4M7AB 5GMKh 4J6XA 4C8QA 4C92D 4C8QD 4M75F 4M7AD 3SB2A 5GANf 4N0AC 4F7UG 3AHUA 4PJOC 2RM4A 3JCMJ 4M7DE 3RIRA 3JCMV 4M77B 2DZCA 4PJOB 3M4GA 4M75C 4M77A 5GAMd 3JB9F 1D3BB 3V7RA 4M77D 4DQ2A 3JB9J 4PJOD 2E65A 1N9SA 1D3BA 4C8QG 4C92G 4XTYA 4XTWA 2RB6A 4C8QF 4EMKC 5GAN2 4XU1A 4MMLA 3RUXA 4M7AG 3JCMX 3FJPA 4A53A 2YLCA 5GAOr 3QHSA 5GAOm 2YLBA 4XTUA 3PGGA 4NL3A 3EFSA 1WQWA 5GMKj 3L1AA 1YCYA 4X9CA 4C8QC 4M7DA 4PJOG 4M7DD 2E1HA 4M77F 5GAOp 1I5LA 4WF2A 3EFRA 3RESA 2ZGWA 5GMKi 3V7CA 3RKYA 4M75G 4JUVA 4A54A 5GAOl 5GAN6 1MGQA 3JCMd 1JRIA 4JLIA 4M77C 4EMGA 4NL2A 2DXUA 5CAIA 4M78A 3RKXA 1B34B 2DTHA 4M7DF 2DKGA 4X9DA 5GAMe 3HFOA 2EWNA 1B34A 1JBMA 5GAOq 3JB9G 5LJ5d 1WQ7A 5GAMh 2Y90A 2E41A 4M7DC 1M5Q1 1I81A 3L2ZA 1WNLA 2DTOA 5GAN3 4QVDA 3HFNA 4HT8A 2EJGA 4M78E 2RA2A 2DXTA 4M78F 2QTXA 4M7DB 1H641 4OP0A
chains in the Genus database with same CATH superfamily
1K0XA 2QG9B 1TWBA 3QDFA 4RCCA 3NPFA 2PUKB 5IN1A 1JO8A 4IIMA 1LOJA 5FROA 2CREA 3RDVA 5GAMj 3QXEB 3VYGA 1NPPA 1U06A 4BI4A 4HA8A 4F7UA 2W10A 3VUZA 1NJIR 2EJFA 1OEBA 3HL8A 3EH1A 2QA4A 2K4YA 4EPCA 4V2SA 2K3BA 4C92A 1PNJA 2GCXA 1U1TA 1QCFA 2VGMA 4CRIA 1A0NB 2PNIA 4KH1B 1WXBA 2DVJA 3NGPA 4E47A 1Q81C 1ZA2B 2RK1A 2JM8A 1SRLA 2LVMA 3PE0A 3VKIA 4KUIA 1YJNA 1M1GA 3RERA 4VUBA 3V7SA 3SWNB 3CCEQ 1YHQQ 4J6XA 2QEXA 4M7AD 1WZOA 2QI2A 2MMPA 3JCMJ 2RHXA 1NEGA 1T3LA 4YTLA 2AK5A 1E6HA 2J6KA 4M75C 3JB9F 1D3BB 4J9FA 2QGFB 1LPLA 1F1BB 3ZBDA 2M1HA 4XTWA 4M7AG 4MMLA 4Z02A 1VYUA 3MP6A 3UF4A 4D8DA 4BE0A 4C0DC 5GMKj 3CCSQ 2FZCB 5CKBA 2FO0A 4E7HA 2D8HA 2Z0WA 4HCBA 4JUVA 3TEEA 3P8HA 1YI2Q 1WHMA 4AMCA 5KYUA 4L6V5 2E70A 1YWPA 2EYQA 3O8VA 4X9DA 1Q86U 2RNAA 1B34A 2JUFA 1TUCA 2E6ZA 1K1ZA 1AOJA 2GF7A 3M5AA 3T9NA 4HT8A 4M7DB 3I55Q 4XU0A 5C0MA 1K8AR 4AT1B 1RADB 4Q5WA 4PFZA 1LNXA 2BE7D 1M90U 2AZSA 3A8HB 1ZUKA 3QSUA 2Y4YA 4PJJA 4Z88A 2OI3A 2YUNA 5LJ3h 5LJ5e 4X34A 1TU0B 2P4RA 1R77A 1AWWA 3RR6A 1Z9ZA 2LMJA 1V29B 3JCMQ 5CVIA 3R6NA 2DAQA 2LX7A 5LJ5g 4LUDA 1B7TA 4BACA 4N4GA 1AWJA 1UGSB 4RKUE 4M75B 1JJ2A 1M9SA 2NUTB 1IZ6A 1VIEA 1GFCA 1WHGA 4ME7A 4LD9K 1Q81U 1U5SA 2X35A 2DEQA 3OB9A 1M1KC 1BI2A 2HAXA 2XMFA 1VQ9A 1FYNA 3H8ZA 2ED1A 4QQ6A 3M59A 3SB2A 2JTEA 2CP7A 2M0YA 3HPWA 1UB4A 1SPKA 1YBYA 1X69A 1PCXA 2CT3A 1UJYA 1HJDA 2DF6A 3N5BB 3EFSA 2XIDA 2F1LA 4AFSC 3IQLA 3OS5A 2J06A 5KYYB 5FU7B 1RLQC 1BB9A 1M8MA 2KVQG 3JCMd 1NJIU 5IXBA 5I11A 2DJQA 2EWNA 4RTWA 4RTZA 1YITQ 1RAAB 2ZPIB 5GAMh 3QG1A 3LW5E 1WFWA 1WNLA 2BKDN 1Y57A 3PNWC 5IHIA 3CCET 4E7KA 2JJ9A 1YHQT 1Y71A 4RTTA 4LD6A 1N8RR 4F7UE 3EGDB 2K3XA 3RBBB 1TUDA 3JB9H 1AEYA 1R8OB 4M78B 2JN0A 4BI8B 5I2MA 4C92E 4OGEA 2GTOA 3OS2A 3G6EA 2F69A 4FSSA 4BUGA 3C94A 3CCQQ 3LWIA 3VUBA 3CCST 4ANJA 3C95A 5KH6A 5GAN4 4WTOB 4F04B 2R58A 2EJ9A 4XU3A 5KYXB 2MYSA 4BY6C 1YI2T 2X3WD 2M16A 2FPFA 3LYIA 1K0SA 3A8OB 3EG2A 4DBHA 3MJXA 3OYHA 2DD5A 3OS0A 3M4YA 2GTJA 3FIFA 2NUPB 5GMKl 2PQWA 5GAN5 1KQ2A 3LWHA 2GFUA 1Q95G 3I55T 4EDUA 1UHFA 2YUPA 3M0UA 4JRQA 5GMKh 2GNCA 1N8RC 3QZ9B 3OW2A 2DETA 4PJOC 1VQ8T 3VS4A 2QAZA 2CKKA 2V8IA 4F14A 2KMTA 2J7IA 4DQ2A 3DB4A 1K8AU 1M1KU 1ABOA 1V1CA 3OYNA 4GLMA 1K73R 3TU4K 3FJPA 2SEMA 2MWOA 1QQJA 1BI0A 4X9CA 3M54A 1VUBA 4M77F 1NYFA 2QQBA 2FRYA 3DLLA 4WF2A 2I0NA 1ZSGA 3CCVQ 2EGAA 3M0TA 3CCJA 2ATCB 4IUQA 1QVFA 3PIPA 4BDZA 1PG5B 5HKCA 2AKKA 2ECZA 2LNVA 1I81A 2WSFE 2VYTA 3G71A 2P4TA 3SHWA 1R0CB 3OS1A 1OQKA 1B3QA 2HDAA 1GCPA 1ZSZC 1Y96A 2IIMA 3MEVA 1PKSA 2E64A 2MI6A 1WYXA 4O5VA 2C06A 2QXFA 1YJWA 1EIFA 3MP8A 3I56Q 3ZFJA 3CXCP 5CQYA 3CCLA 3CCRA 2DZ9A 4GLKA 4X1VA 5DY9A 3HKSA 2LCCA 2HBWA 1VQMQ 1NLOC 1KC8C 2K3YA 1W2BA 1XOVA 3V8LA 2JS2A 1X01A 3OW2S 1WXUA 4J9BA 3JSCA 4N0AA 4FW2A 4XTXA 2YUQA 2YHTA 3M9QA 1YITT 2RJDA 2DFUA 1YN8A 5GANh 1VQ7Q 4PLLA 2DXBA 2HL5C 2RI5A 5CKEA 3NFCA 2P0KA 2EBPA 2EYWA 4M7AB 3CMAA 2HSEB 3OYIA 2B86A 1YFNA 1G5VA 4F17A 2D6FA 5GJWB 1GL5A 2HBPA 1TXQA 2MPXC 3EHQA 4MDXA 1G83A 3QJYA 1N8RU 1ZHIA 5IHNA 4J8OA 2XDPA 4FT2A 3CCQT 1TSFA 2JZ2A 1M3AA 3C12A 2ROTA 1UJ0A 1QLYA 3R6OA 2DBKA 2L5QA 2X4XA 2WACA 4RTVA 1KIKA 4M75G 1ZSZB 1UHCA 2WSCE 2O88A 2K9GA 2VGNA 4M7DF 1OYXA 1JBMA 4J9CA 5LJ5d 4A4KA 1WX6A 2KRMA 3EFOB 3M0SA 5KCHA 4A63B 1OX9A 2EYXA 3E2UA 2ZPEB 1QMCA 2X9HA 4IUPA 5IXFA 1YIJQ 1W2BS 1GBQA 3A5ZB 3S3NA 4IURA 4Y92A 3S6WA 2QDLA 2RHUA 5GANe 2CSQA 3MHXA 4OB1B 4ESRA 3V8JA 2C0IA 2O31A 2PVGB 1JU5C 2FRWA 2LQWA 1Q7YR 1H3HA 4MZPA 4KUDK 5CQXA 2NUZA 1KHCA 4AFQC 1I5OB 1QVGA 3QPHA 4EIKA 4J7IA 1UDLA 2OTJQ 2VXEA 4R56A 1NBEB 3OYKA 3CCVT 3GLXA 2O9VA 3CCMQ 2I2LA 3H9NA 1KC8U 1QCOA 4J83A 1ZUUA 2C0TA 3EGUA 1MNEA 4JPBW 4Z8AA 3CQTA 1SSHA 4PJOE 2MAMA 1RAEB 2CDTA 4LDYA 2CP0A 5L8RE 3Q1JA 1EZZB 1U8RA 3DLMA 3OYJA 2RM4A 4QQDA 4K11A 3OYMA 3M4GA 4M77A 3I56T 3VS7A 4QQGA 3H0HA 1TTHB 3PGGA 2L8DA 1ARKA 1ZA1B 1WQWA 1MNDA 1RLPC 3QIIA 2VB6A 1UGVA 3H6ZA 2CP3A 2DYIA 2DKGA 2QGGA 2DL8A 2YXYA 2ZAEA 1VQ7T 4JS4A 1HD3A 4ZN1A 4OB3B 4OMOA 2KQWA 4JZ3A 4M78F 2M0OA 3WVDB 2P0QA 3MO8A 3HSBA 4DEXA 1BYMA 2MIOA 1TH7A 2X4JA 3G4SA 2F5KA 1YJ9A 3WVEB 2RQWA 1BK2A 2PUOB 4XTZA 2F2WA 4HKEA 2LP5A 3CC7A 3CCUQ 4HCKA 3A98A 3M55A 1WIEA 2DVEA 3HRSA 1R0BG 4J6WA 1LJOA 3OBWA 3EGXA 2LJ0A 3I35A 2DBMA 1WPYA 3SWNA 1K9AA 2QQ9A 3OYEA 5LJ3f 1Q82R 1JJ2P 1GFDA 1X43A 3FJ5A 3CMEA 3EAEA 1ZBXA 1J3TA 5FU6C 2KYBA 1X6BA 3PT9A 3ER0A 1M27C 1VQPA 2RD1A 2D1XA 2EPDA 3CC4Q 1VQ6A 1QKXA 4C92C 4MZMA 5D6YA 3MEAA 4FYVB 4OF1A 4Y91A 3JB9D 1YIJT 3E19A 4OMNA 3VS2A 4JJCA 3L2UA 2DK3A 4CI0C 4PJOD 1BU1A 4C8QF 1QVPA 4B9WA 1KQSA 3LGFA 5M9OA 5GAOm 4XTUA 1OPLA 4FYWB 4A4GA 4M7DA 2GQVA 2HQEA 4PJOG 4IKFA 1VQ4Q 2COYA 2OTJT 2ZGWA 2HD0A 4AFUC 2LJ1A 1MGQA 1S72A 5CKDA 1XNIA 2X51A 3MP1A 2COWA 2QQRA 3QZ5B 3CCMT 3KUFA 4KGXB 2CZ0B 5FW9A 3I55A 3EH2A 1NJIC 2KI7A 2QDYB 3FLGA 2VASA 2QA4Q 1BI3A 4DBRA 1VQ8A 1HXDA 3M0RA 5GAMf 2B8AA 2EKOA 3PMIA 2P0PA 4FIBA 2ESWA 2CGHA 5FU6B 2KK4A 3CC2A 1YWOA 1FMWA 2KXDA 3KBGA 1W6XA 1WLPB 2BZ8A 2LZ6B 2O4XB 1I8FA 2BUDA 1QW1A 5A0DA 5ECAA 5HK0A 3RNJA 1YJNQ 5CR2A 3UPUA 3VU3C 1BCMA 3TREA 2E5KA 2EYYA 2OAUA 2QEXQ 3OYYA 4E7JA 1B07A 2ZPFB 3CBOA 3CEYA 2M9UA 2XU8A 3VRYA 1I1JA 4DEYA 1RAFB 3SDZA 4M7AF 4OMMA 4XU2A 3GBQA 1JB0E 4E6RA 1KQSS 2RHIA 2QTVA 3OW2P 2PU9B 4GBQA 5D6WA 2XHCA 4M77E 2CUBA 5KYWB 5KYYA 1UECA 4HVVA 4KGZB 1VQNA 1KJWA 4LDVA 2PVOB 2JW4A 1PHTA 1PM3A 2O01E 1K4US 2HL3A 3EG9B 5HK3A 2H3JA 2LNHB 2A36A 1I0CA 3MEUA 3GPLA 3CCUT 2CYZB 4ZN3A 4XU1A 1NG2A 1X2KA 5GAOr 1IGUA 3TVTA 2KXCA 2VV5A 2E6NA 1VQOA 2AIRB 1KG1A 1G3YA 1ZUYA 3VS3A 1E6GA 2QQAA 4FU6A 4C0DB 2KBTA 1K8AC 1QVFP 4E7LA 3CBMA 5GMKi 1OZ2A 1PWTA 4AFZC 3QDRB 1YITA 5J39A 2JM9A 4M78A 1B34B 3UT1A 3RMSA 1TOVA 2LT1A 4ZGDB 1Q82U 3CC4T 2LCSA 1IHVA 4BI3A 4A4HA 1KQ1A 1VQKA 2DIQA 4Y28E 3VJPA 3G7ZA 5KYXA 5FWBA 3A8GB 5LJ3e 3VS0A 4ELYC 4QW2A 3GIBA 2PZ1A 2D8JA 5AT1B 4L59A 1VYVA 1MMAA 1T0JA 3QYGB 4RCBA 3CCQA 2NUPA 3OBYA 1M2VA 1W2BP 2FPDA 1GCQA 2EQJA 2DLPA 2E4HA 1VQLA 1VQ4T 4FW1A 1UE9A 1RUWA 9ATCB 1VIFA 1VQ9Q 4NOYA 2XKOC 3FB9A 4RTUA 3DKMA 3H0FA 1SF9A 2DA9A 2DE0X 4KH0B 4EMKA 1UG1A 5FRNA 2ZCFB 5FLXE 5A0LA 1U1SA 2F5TX 3VRZA 1RI0A 2QA4T 4J5YA 4RMOA 4C8QA 1KHIA 3MPUB 5GANf 3FC3A 2R57A 4J9GA 2LQKA 5DLQE 4M7DE 2M02A 3M53A 2DZCA 2QK0A 2YUOA 4M77D 3JB9J 4HXJA 3HHTB 3LH0A 3EG1A 4NL3A 2KT1A 1YJNT 1VA7A 2QEXT 3CPWA 4CC3A 2L3RA 3CD6A 2DTHA 5GAMe 1ACMB 4N4IA 2RJFA 2L3QA 2RN8A 2E41A 2YT6A 1VOMA 2AT1B 1M5Q1 4LN2A 1N5ZA 2RA2A 1W70A 5I22A 1WHLA 5GAMg 4D6WA 2D0NA 4MDWA 3S3OA 1FX7A 3QJ6A 4JDSA 1OPKA 2F2XA 2L3SA 3LH5A 4J9EA 1K9MR 1QVGP 2DL4A 2RI3A 1BCOA 1WHJA 4HCZA 3MEWA 2ROLA 1KFZA 2DMOA 1AWOA 2OTLA 3G1JA 4ZTFA 3M58A 4M7AA 4C5GA 3MCAB 2IG0A 3UWNA 3P8DA 3A8MB 1TS9A 4O6JA 2P84A 4BY6B 1FXXA 2XK0A 2KAFA 4LNPA 3LX7A 1K73C 1BI1A 4QVZA 3L2RA 2FZKB 1VQ5A 1OULA 5GMKe 4LUEA 3UA7A 1CKAA 3LLRA 4C92D 1QP3A 3D7SB 4IUTA 1AWXA 2VWFA 4N0AC 2V1QA 4F7UG 3CPWS 5CCAA 2L2PA 4PJOB 2BIVA 2KR3A 3CCJQ 4C92G 3BDLA 3RUXA 3EFOA 1IRXA 1QWFA 4A53A 2DX1A 3QHSA 3L42A 2YLBA 1YCYA 4M7DD 2E3IA 2FEIA 3G71Q 5AYFA 4UC4A 3RESA 2YRDA 3I5RA 2RQRA 3KXTA 4A54A 2ABLA 1VQ9T 1SHFA 1QCNA 3REAB 3X25B 1GXIE 2PTKA 1NYGA 1O75A 3OY9A 1YJWQ 5D6XA 4PJNA 4LDXA 3OYBA 3L2ZA 4QVDA 2L0AA 4WCIA 3CCLQ 3CCRQ 1X6GA 1WGSA 4OP0A 1Y96B 1JXOA 3I9QA 1C6VX 1OU9A 3OMGA 2RHYA 4TVRA 2BTTA 2K7AA 3L2QA 2K6DA 3JCMh 4PJLA 2E5QA 1KD1R 1PD0A 4KT0E 3JRZA 1N6AA 3TSWA 1LCKA 4ORZA 2GQIA 3E1SA 3QBYA 2LRQA 1FWZA 2K2MA 2NWMA 4LXCA 4HVUA 3REBB 3CMAQ 2XDBA 2EAYA 2ZZDA 5D7UA 4PLIA 3JV3A 5LJ5j 1RAIB 3V8KA 4C8QE 3WXMB 3JAME 1PKTA 2JVVA 1BIBA 2X3XD 3GOXA 1QWEA 1G8XA 4DBFA 3PTAA 3C4SA 5GANg 4M75F 4QT7A 1K73U 1WJSA 1KQSP 2GFAA 3RIRA 2XG8D 3ZL7C 2DILA 2PVDB 2NLUA 1CSKA 5IH2A 1JEGA 2DRMA 2E65A 1KD1C 2O9SA 5EG2A 3JCMX 2ENMA 1WJRA 1S1NA 1UGQB 4PFPA 2HCKA 2SRCA 2E3HA 3F70A 4C5HA 1AZEA 3EFRA 2VKNA 4NS5A 1IHWA 4KRTA 1JRIA 4M77C 2RH2A 2X4WA 1UEBA 4EMGA 4E2FB 2DL3A 2EFIA 3A8LB 2O2OA 2V1RA 2LJ3A 4DOWA 2DL7A 1Q7YC 3C0CA 5J3BA 3M56A 1Q86R 3I5SA 2DXTA 4OMQA 3UA6A 1VQMT 3EG0A 5FWCA 2LQ8A 2CZ1B 2A08A 2CP2A 4ELZC 5FRMA 2A28A 2RPNA 5HY6A 2CT4A 4M7AE 2KRSA 2XDDA 4JJNK 3J80E 1M90R 1M3CA 4J6YA 4LDWA 5KE2A 3OYLA 1UGPB 4J7FA 3G71T 2DNUA 4HT9A 3S3MA 1M8VA 4BD3A 3M0PA 2VC8A 1BKBA 5CKFA 3QO3A 4J9IA 5GMKm 5GAN7 1EFNA 3O5ZA 1HK9A 2HEQA 3JCMc 1YJWT 1OX8A 3OYFA 4FM4B 1SEMA 2LT4A 2QQSA 5C6SA 3J81E 2DD4A 3SWNC 3CCRT 1N9RA 3QUIA 1Y7XA 3KFVA 2W0ZA 4C8QD 5CK9A 4A4EA 1X27A 1M1FA 1IO6A 1ZQ1A 2KYMA 1Q81R 4CC4B 1JXMA 4M77B 3OYGA 5GAMd 1JQQA 1D3BA 4C8QG 4XTYA 1ZBJA 3X26B 2D9TA 3OQ5A 2KT8A 3CCEA 5CKHA 1YHQA 1W4SA 1D0XA 3CXCS 3QKJA 1KD1U 4JS5A 5IAYA 2A0FB 2FPEA 3CMAT 1TUGB 4IIOA 5GAN6 3G4SQ 2HKNA 1YJ9Q 1PC0A 4RG2A 2FG0A 3JB9G 1WHKA 4KGVB 3L2VA 4JJDA 4RUGA 3CC7Q 5KCOA 2A3LA 2LC4A 4M7DC 2RK2A 3EG3A 1D1BA 2O4XA 2R5MA 3CCSA 1H3ZA 1FMVA 1E7OA 5L23A 1H641 2KY9A 1YI2A 1Q82C 2G3RA 2HQHA 2L3PA 2GBQA 1Q7YU 1WXTA 2J6OA 2OJ2A 3BY7A 3CMEQ 2DTIA 3QWYA 3GP8A 5LJ5h 1RAGB 5GAOn 3PVQA 3EGXB 2ZPGB 4FYXB 1VQPQ 3BFMA 1M30A 2DPPB 3H41A 1VQ6Q 5KYWA 2CH4W 1D09B 2EVRA 3VV0A 2MF2A 2EGCA 3EG9A 2AHJB 2E12A 4KBMB 2R5AA 1FMKA 1SKUB 3VS6A 2FHDA 4M75A 4F7UB 2MCNA 2NUTA 1NM7A 1NLPC 2KDSA 4PJOF 3JCMb 2V8KA 3TSZA 1MUZA 2DL5A 4C92B 3E9GA 2BE9B 2DRKA 1S72Q 5I2SA 2AZVA 1OV3A 3L2WA 2KROA 4GY5A 4RTXA 1V76A 3CPWP 5FU7C 2K79A 3ULRB 3ASKA 1M1KR 5EC7A 2XD0A 1RI9A 3V7CA 3RKYA 2LQNA 1VQ8Q 2FL7A 1AVZC 3HP9A 1NE8A 3HFOA 2IVWA 1XTDA 3PIOA 3CC2Q 1GRIA 1G3WA 2EJGA 2A7YA 4XK8E 3SD4A 3EHRA 2K57A 3OYCA 2JOYA 4M78C 3EGDA 3HRTA 5KYUB 1PD1A 1X6OA 3GNFB 2BZXA 5GANd 1MV3A 4LDUA 5LL6S 1X2QA 2YRCA 3QYHB 1Z9QA 3CPFA 2HNIA 4ATOA 1K76A 4KULA 3FRNA 1ZX6A 1P92A 1I4K1 2MWPA 4R55A 3OSSC 3G4ST 1VQNQ 3U23A 2YDLA 2JTMA 1YJ9T 5GANj 1PSEA 3JB9I 2JMAA 3INZA 4XQ3A 1IGQA 4E7ZA 2H8HA 1RABB 4PNOA 3META 1MMDA 3CC7T 1GCQC 2DERA 3MKDA 3OYDA 3AT1B 4EMHA 4PJMA 2G6FX 1VQOQ 2XI9A 5LJ3g 1WA7A 2V26A 3QWXX 1Y07A 3J7AF 3NTHA 5IHKA 3M0QA 2MK5A 1WHHA 2V8JA 1OU8A 1RACB 3CMET 4AG1C 2AKLA 4ZTJA 3V7RA 3BE3A 3UATA 1U3OA 4EMKC 3NTIA 6AT1B 2ZPHB 5DLOA 1VQPT 2ZPBB 1MMGA 1TG0A 2RMOA 1VQ6T 4C8QC 5KYNA 4FT4A 2ED0A 2KGTA 1MHNA 1ZLMA 4PL6A 1VQKQ 1H8KA 1M4ZA 2K2VA 5CAIA 4R0KA 4AG2C 1JJ2S 4PKCC 2JXBA 4FCYA 1SG5A 2RJEA 4P5NA 1OZ3A 4B6MA 4J9HA 1G2BA 4J9DA 4M77G 1VQLQ 3BDUA 2A37A 1OOTA 2EQIA 2RO0A 1UGRB 1SSFA 3OSVA 2LDMA 3CCVA 2QASA 2FVUA 5J26A 2IPOB 2JNGA 2GGRA 7AT1B 3JCMW 1S72T 2VXFA 1AD5A 3RKWA 2CSIA 3PMTA 1AZGB 2RQVA 2XICA 1M2VB 3G6EQ 1NEBA 3FEOA 1G3TA 4BE2A 2KEAA 1YNZA 1QP2A 3JCMf 4M75E 2LX9A 4QVCA 1RL2A 3PFSA 4MZTA 5CO7A 2RQTA 4ZNXA 2HZYA 2M51A 4PJOA 3I56A 8AT1B 3NMZC 3X24B 4BB7A 2NYSA 1D0YA 3CC2T 2DM1A 4EMKB 4ZGEB 1MV0B 2DJZA 2RJCA 4JJBA 3X28B 1VQMA 4M7AC 2EYZA 1KC8R 1XQHA 4C8QB 4MMKA 4CC7A 2D0QB 2EQMA 4DBQA 1HYOA 5A0GA 3AHUA 5GJVB 4IUVA 4IUUA 3M57A 1GBRA 1VQ7A 3CD6Q 3VYHB 4PFOA 4II1A 1SHGA 2RB6A 4RG8A 5HCKA 1M3BA 1KK7A 2K5LA 1I5LA 3X20B 4OVAA 4E7SA 5GAOl 1VQNT 1RAHB 4DA4A 4JLIA 1ZSZA 2JTFA 4OGCA 2RQUA 1UUEA 5GAOq 1K9MC 1NPRA 4OB2B 2EGEA 1ABQA 1MMNA 1AHJB 2Y4XA 4M78E 4JRPA 1VQOT 4XAXB 1LVKA 1W1FA 4OMPA 4C0FA 2OTLQ 2FYKA 3BW1A 2BZYA 3DB3A 3SFMA 1T0HA 4M7DG 4QKUA 1M2OA 2DIGA 2L89A 1SRMA 4XTVA 2COZA 4D8KA 2LCLA 2JMCA 5GAN8 3LGLA 4JZ4A 4M4ZA 1YIJA 1HSQA 2EQUA 1VQ5Q 2MOXA 1IREB 1VQKT 4BE1A 2CUDA 4RTYA 1PRMC 4F7UF 4C0GA 1BIAA 1QVFS 2JS0A 4C92F 2HSPA 2E10A 4JRKA 2DYBA 4M75D 1G3SA 3TQ7P 4JRIA 3PVLA 3TCJA 1VQLT 4OMFB 2OTJA 3RMQA 1AT1B 2CS7A 1D1AA 2H3EB 2K5IA 3CCMA 4C0ZA 1O9SA 1NZ9A 2YWWA 4DOVA 3SEMA 2YSQA 3URGA 2FZGB 4LE9A 3G6ET 2RI2A 3H0IA 4PK4A 4FL6A 4F16A 3GF5A 1BBZA 1PSFA 3UDCA 3ZEHA 4B9XA 3OYAA 2E1HA 2DEUA 4FSXA 3VS5A 3OA6A 2JT4A 4Z89A 2HQXA 3A1PA 4HVWA 2CP5A 3P8BB 2QYZA 1WQ7A 2CH4A 1WJQA 2J05A 5IT9E 3FDRA 5DM7R 3HFNA 2QTXA 5GAN3 1K9MU 2RHZA 1VYTA 2KNBB 2K5FA 5KE3A 3JCMe 2FB7A 3E9FA 2RF0A 1UFFA 1XJWB 3CD6T 5LJ3d 1UTIA 4M78D 5A2QE 2EW3A 1T3SA 1EX4A 2DXCA 2X4YA 1IXDA 2CZ7B 3JCMg 3CBPA 2HKQB 4M78G 3CXCA 2KSSA 2CZ6B 4OMLA 3ME9A 5I21A 2CP6A 3THKA 1YP5A 2LTOA 5LJ5f 1N27A 5LJ3j 4L5GA 3NHNA 3JCMP 4FYYB 3CCUA 3VS1A 3CCJT 8ATCB 2EIFA 1KSWA 1C0MA 4C5EA 2KRNA 1WI7A 1D0ZA 1I07A 3HTRA 3NTKA 2OTLT 4ZGJB 1IB8A 4N4HA 4JLGA 4BDYA 1DJ7B 3HRUA 1OI1A 4HCCA 2J6FA 2OAWA 3JCMV 3GNGA 1CKBA 4E7IA 1N9SA 5GAN2 5GAOp 2EKHA 3CC4A 2YLCA 1H92A 2VVKA 2KE9A 1PRLC 3CCLT 3L1AA 1Q86C 2DO3A 1QVGS 2HMAA 1VQ5T 2WSEE 1D1CA 1X75C 2YRVA 4A4FA 2C0OA 5CIUA 4NL2A 2DXUA 1YCSB 3RKXA 4C5IA 2OX7A 1WDXA 1Y0MA 2Y90A 4CC2A 4OB0B 1C1AA 3OMCA 1QKWA 2EQKA 2DTOA 1M90C 1VQ4A 2F2VA 2VUBA
chains in the Genus database with same CATH topology
5GAMg 2ZPEB 4D6WA 4RCCA 4IUPA 2K57A 3OYCA 1W2BS 2PUKB 5IN1A 2JOYA 4M78C 4MDWA 3A5ZB 3S3OA 3HRTA 3S3NA 1LOJA 4IURA 5FROA 3S6WA 2RHUA 1FX7A 5GAMj 5GANe 1X6OA 3QJ6A 3QXEB 3GNFB 4JDSA 3VYGA 5GANd 1NPPA 3MHXA 4OB1B 4LDUA 5LL6S 3V8JA 2RI3A 2PVGB 4BI4A 4HA8A 4F7UA 4HCZA 3VUZA 3MEWA 3QYHB 2EJFA 4MZPA 4KUDK 3HL8A 3CPFA 2HNIA 5CQXA 4ATOA 1KHCA 2QA4A 4KULA 1QVGA 3FRNA 3QPHA 2K4YA 4EPCA 1P92A 1I4K1 4J7IA 2MWPA 4C92A 4ZTFA 2GCXA 3M58A 2OTLA 1U1TA 4M7AA 4R55A 4C5GA 2VXEA 4R56A 3OSSC 3MCAB 2IG0A 3G4ST 2VGMA 3P8DA 3UWNA 4CRIA 3OYKA 3CCVT 3A8MB 3GLXA 2JTMA 1YJ9T 4O6JA 5GANj 4BY6B 1PSEA 3JB9I 3INZA 4XQ3A 4E47A 1Q81C 2RK1A 1FXXA 2I2LA 2XK0A 4PNOA 1KC8U 2KAFA 3META 3CC7T 4J83A 2LVMA 3VKIA 3OYDA 4KUIA 3LX7A 1K73C 1BI1A 4QVZA 1YJNA 1M1GA 4EMHA 3L2RA 1VQ5A 3RERA 4VUBA 4PJOE 5GMKe 2MAMA 2XI9A 3V7SA 5LJ3g 4LDYA 3SWNB 5L8RE 3LLRA 4J6XA 3Q1JA 2QEXA 4C92D 1Y07A 3J7AF 1QP3A 4IUTA 4M7AD 3NTHA 1U8RA 3DLMA 4N0AC 4F7UG 3OYJA 2RM4A 3CPWS 2QI2A 2MMPA 5CCAA 4QQDA 2RHXA 2V8JA 3JCMJ 4PJOB 3CMET 2BIVA 4YTLA 3OYMA 3M4GA 4M75C 4M77A 4ZTJA 3JB9F 1D3BB 3V7RA 3I56T 3ZBDA 4C92G 4EMKC 2M1HA 3NTIA 3BDLA 4QQGA 4XTWA 3RUXA 4MMLA 4M7AG 4Z02A 4A53A 3MP6A 2ZPHB 3QHSA 3L42A 5DLOA 1VQPT 2YLBA 2ZPBB 4BE0A 3PGGA 2L8DA 4C0DC 1WQWA 5GMKj 1VQ6T 1YCYA 4C8QC 4M7DD 3QIIA 4FT4A 5AYFA 5CKBA 4V2SA 4UC4A 3RESA 4E7HA 3KXTA 1MHNA 4PL6A 4HCBA 4A54A 4JUVA 3TEEA 3P8HA 1M4ZA 3H6ZA 1VQ9T 2K2VA 4L6V5 3X25B 5CAIA 2E70A 2DKGA 2EYQA 3O8VA 4X9DA 1Q86U 1GXIE 1B34A 1O75A 2JUFA 1JJ2S 1VQ7T 4JS4A 4PKCC 3OY9A 2E6ZA 4ZN1A 4OB3B 5D6XA 4LDXA 3OYBA 3L2ZA 2KQWA 4QVDA 2GF7A 2RJEA 3M5AA 4P5NA 3T9NA 1OZ3A 4HT8A 4M7DB 4M78F 2M0OA 3WVDB 1WGSA 2P0QA 4OP0A 3MO8A 4XU0A 4M77G 5C0MA 1Y96B 2RO0A 3BDUA 3HSBA 1BYMA 1UGRB 1SSFA 3OMGA 2RHYA 1TH7A 2X4JA 4TVRA 3OSVA 3G4SA 2LDMA 3CCVA 3L2QA 2F5KA 4Q5WA 2FVUA 1YJ9A 5J26A 1LNXA 2JNGA 3WVEB 1M90U 3JCMW 1S72T 2VXFA 3JCMh 3A8HB 2PUOB 4XTZA 2Y4YA 3QSUA 4HKEA 3RKWA 3CC7A 3PMTA 5LJ3h 5LJ5e 4X34A 2E5QA 3M55A 2XICA 4KT0E 2DVEA 3HRSA 3JCMd 4J6WA 1LJOA 3FEOA 3JRZA 3OBWA 1G3TA 1N6AA 1V29B 4BE2A 3JCMQ 5CVIA 1WPYA 1QP2A 3JCMf 3SWNA 3E1SA 2DAQA 3QBYA 5LJ5g 2LRQA 2QQ9A 1FWZA 4M75E 3OYEA 5LJ3f 2LX9A 4QVCA 1RL2A 3PFSA 4BACA 4MZTA 4N4GA 5CO7A 3CMEA 3EAEA 2XDBA 1ZBXA 2EAYA 2ZZDA 4PJOA 5FU6C 3I56A 1UGSB 4PLIA 5LJ5j 3V8KA 4RKUE 4BB7A 3WXMB 3PT9A 3ER0A 3X24B 4M75B 4C8QE 1JJ2A 1M9SA 3JAME 3CC2T 1VQPA 2RD1A 1IZ6A 1VIEA 4EMKB 4ZGEB 4ME7A 4LD9K 2DJZA 2RJCA 2JVVA 1VQ6A 1BIBA 3GOXA 3X28B 4C92C 1VQMA 4MZMA 5D6YA 4M7AC 3MEAA 1Q81U 3PTAA 3C4SA 2X35A 2DEQA 1XQHA 4OF1A 4Y91A 5GANg 3OB9A 4MMKA 4C8QB 3JB9D 2D0QB 1M1KC 1BI2A 2EQMA 1YIJT 2HAXA 4M75F 1VQ9A 3E19A 3H8ZA 4QQ6A 3M59A 3SB2A 5A0GA 1K73U 3AHUA 1WJSA 4IUVA 4IUUA 2GFAA 3M57A 3L2UA 3RIRA 2XG8D 2DK3A 4CI0C 2PVDB 3HPWA 2NLUA 1VQ7A 1UB4A 1YBYA 3VYHB 4PJOD 2E65A 1KD1C 4II1A 4C8QF 2RB6A 1QVPA 4RG8A 5EG2A 3JCMX 4B9WA 1WJRA 1KQSA 3LGFA 5M9OA 1UGQB 4XTUA 5GAOm 3N5BB 3EFSA 2XIDA 4A4GA 4M7DA 2K5LA 2GQVA 2HQEA 3OS5A 4PJOG 4IKFA 5FU7B 1I5LA 3X20B 3F70A 4OVAA 4C5HA 3EFRA 2OTJT 2ZGWA 4NS5A 2HD0A 5GAOl 1VQNT 2KVQG 4DA4A 1MGQA 1S72A 5CKDA 1XNIA 1JRIA 2JTFA 2RH2A 2X4WA 3MP1A 4JLIA 1UEBA 4M77C 4OGCA 4EMGA 2QQRA 3QZ5B 3CCMT 2EWNA 5GAOq 1K9MC 3KUFA 1NPRA 2ZPIB 5GAMh 3A8LB 2EFIA 2CZ0B 4OB2B 4DOWA 3QG1A 3LW5E 3I55A 1WNLA 1AHJB 1Q7YC 2BKDN 2Y4XA 5J3BA 1NJIC 3M56A 4M78E 2DXTA 3PNWC 4JRPA 1VQOT 4XAXB 2QDYB 3FLGA 1VQMT 3CCET 4E7KA 1YHQT 1Y71A 2LQ8A 1BI3A 4C0FA 4LD6A 1VQ8A 1HXDA 4F7UE 2FYKA 2K3XA 5GAMf 2CZ1B 2B8AA 3JB9H 2EKOA 3BW1A 1R8OB 4M78B 3DB3A 3SFMA 2JN0A 4ELZC 3PMIA 2P0PA 5I2MA 4FIBA 4BI8B 5FRMA 4M7DG 4C92E 4OGEA 5HY6A 3OS2A 2CGHA 3G6EA 5FU6B 4M7AE 2KK4A 2XDDA 4JJNK 2F69A 3CC2A 3J80E 2DIGA 3KBGA 2L89A 4BUGA 4XTVA 3C94A 2O4XB 1NJIU 1I8FA 2LCLA 4J6YA 2BUDA 4LDWA 5KE2A 1QW1A 3LGLA 5A0DA 5GAN8 1UGPB 3OYLA 3LWIA 3VUBA 3CCST 4J7FA 3G71T 5HK0A 4HT9A 1YIJA 3S3MA 2EQUA 3C95A 5KH6A 5CR2A 4BD3A 3UPUA 1M8VA 1IREB 5GAN4 3VU3C 1VQKT 2VC8A 1BKBA 2R58A 2EJ9A 4XU3A 5CKFA 3TREA 4BE1A 3QO3A 4BY6C 4F7UF 1YI2T 2OAUA 2M16A 5GMKm 3LYIA 5GAN7 3OYYA 3A8OB 4E7JA 1HK9A 4C0GA 1BIAA 2ZPFB 1QVFS 3CBOA 3CEYA 2M9UA 2XU8A 3OYHA 2DD5A 3JCMc 4C92F 3M4YA 3SDZA 3OS0A 2E10A 1YJWT 4M7AF 4JRKA 3FIFA 3OYFA 5GMKl 5GAN5 2PQWA 4FM4B 4M75D 4XU2A 1JB0E 1G3SA 1KQ2A 3LWHA 1KQSS 4JRIA 2RHIA 2LT4A 2QQSA 5C6SA 2GFUA 3J81E 2DD4A 2PU9B 5D6WA 3SWNC 3CCRT 3I55T 1N9RA 2XHCA 3QUIA 4M77E 3TCJA 4EDUA 1VQLT 4OMFB 2OTJA 1Y7XA 4JRQA 3RMQA 5GMKh 2CS7A 1N8RC 1VQNA 4C8QD 4LDVA 5CK9A 2PVOB 4A4EA 3QZ9B 2O01E 3OW2A 4PJOC 1VQ8T 2K5IA 1M1FA 3CCMA 1ZQ1A 4C0ZA 5HK3A 2H3JA 2V8IA 2CKKA 1O9SA 1NZ9A 4DOVA 4M77B 3OYGA 2KMTA 3MEUA 5GAMd 3GPLA 4DQ2A 3CCUT 2CYZB 3DB4A 4ZN3A 3URGA 1K8AU 1M1KU 1D3BA 4C8QG 4XTYA 3OYNA 4XU1A 3X26B 3G6ET 3FJPA 2D9TA 2RI2A 3TU4K 5GAOr 4FL6A 2MWOA 1KD1U 2VV5A 2E6NA 3GF5A 3OQ5A 1VQOA 1KG1A 1PSFA 3UDCA 3ZEHA 3CCEA 1G3YA 1BI0A 4X9CA 3M54A 4B9XA 5CKHA 1VUBA 3OYAA 1YHQA 2E1HA 4M77F 1W4SA 2QQAA 4FU6A 2QQBA 4C0DB 3CXCS 3QKJA 1K8AC 4JS5A 4FSXA 3DLLA 4WF2A 4E7LA 3CBMA 5IAYA 3OA6A 5GMKi 1OZ2A 3CMAT 5GAN6 2HQXA 3QDRB 1YITA 3CCJA 5J39A 4IUQA 4M78A 1B34B 3UT1A 3P8BB 4RG2A 1QVFA 3RMSA 3JB9G 1WQ7A 2LT1A 1WJQA 3L2VA 4ZGDB 3PIPA 4BDZA 5KCOA 5HKCA 1Q82U 2A3LA 2LC4A 2LNVA 4M7DC 3CC4T 5IT9E 1I81A 2RK2A 3FDRA 2O4XA 2WSFE 2R5MA 2VYTA 5DM7R 3CCSA 3G71A 2P4TA 3HFNA 1H3ZA 3OS1A 2QTXA 4A4HA 4BI3A 1H641 5GAN3 1KQ1A 1VQKA 2DIQA 4Y28E 1K9MU 2KY9A 3VJPA 3G7ZA 1Y96A 1YI2A 3MEVA 2RHZA 2K5FA 1Q82C 5KE3A 2G3RA 3JCMe 2E64A 2FB7A 2MI6A 3E9FA 1Q7YU 3A8GB 4O5VA 2C06A 2QXFA 5LJ3e 4ELYC 4QW2A 3GIBA 3CD6T 5LJ3d 3BY7A 2DTIA 4M78D 1YJWA 1EIFA 3MP8A 4L59A 3QYGB 5A2QE 4RCBA 3ZFJA 3GP8A 2DXCA 5LJ5h 3CCQA 5GAOn 3OBYA 2X4YA 5CQYA 3CCLA 3CCRA 2ZPGB 2DZ9A 2CZ7B 4GLKA 2EQJA 3JCMg 3BFMA 3CBPA 1VQLA 5DY9A 3HKSA 2LCCA 2DPPB 4M78G 1VQ4T 3CXCA 1KC8C 2K3YA 2KSSA 2CZ6B 1W2BA 3VV0A 1XOVA 3V8LA 2MF2A 3ME9A 5I21A 1X01A 3OW2S 2LTOA 5LJ5f 1N27A 1VIFA 2AHJB 4L5GA 2XKOC 2E12A 4NOYA 5LJ3j 3JCMP 3FB9A 3JSCA 3CCUA 4N0AA 4KBMB 4XTXA 2R5AA 2YHTA 3DKMA 3M9QA 1YITT 3CCJT 2RJDA 5GANh 2EIFA 2FHDA 4M75A 4PLLA 4F7UB 2DXBA 2RI5A 5CKEA 4EMKA 4C5EA 5FRNA 2ZCFB 5FLXE 5A0LA 1U1SA 2KDSA 3NFCA 4PJOF 2F5TX 3JCMb 2V8KA 3NTKA 2P0KA 1RI0A 4C92B 2QA4T 4J5YA 4M7AB 3CMAA 4RMOA 4C8QA 2OTLT 4ZGJB 1KHIA 4N4HA 4JLGA 3OYIA 1DJ7B 3E9GA 3HRUA 4BDYA 1G5VA 1OI1A 5GANf 4HCCA 3FC3A 2D6FA 2R57A 2LQKA 5DLQE 4M7DE 2HBPA 3M53A 3JCMV 2DZCA 5I2SA 4MDXA 4M77D 3GNGA 3JB9J 4E7IA 1N9SA 3QJYA 5GAN2 3HHTB 5GAOp 3L2WA 1N8RU 3LH0A 3CC4A 1ZHIA 4GY5A 2YLCA 4J8OA 2XDPA 4FT2A 3CCQT 4NL3A 5FU7C 3CCLT 3L1AA 1Q86C 2DO3A 1YJNT 2JZ2A 1QVGS 3ASKA 3C12A 1VQ5T 3R6OA 2WSEE 2X4XA 2L5QA 1X75C 2WACA 2YRVA 2XD0A 3V7CA 3RKYA 4M75G 4A4FA 2QEXT 3CPWA 5CIUA 2FL7A 2L3RA 3HP9A 4NL2A 2WSCE 2DXUA 3CD6A 3RKXA 2DTHA 2VGNA 4M7DF 4C5IA 1OYXA 5GAMe 1NE8A 3HFOA 4N4IA 1JBMA 5LJ5d 2IVWA 4A4KA 1XTDA 2RJFA 2Y90A 2E41A 4OB0B 3PIOA 3OMCA 5KCHA 1M5Q1 2EQKA 2DTOA 1M90C 1G3WA 2EJGA 2RA2A 1VQ4A 2VUBA 2A7YA 4XK8E 3SD4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQ1 A;  4XU0 A;  5GAM g;  4M77 G;  3HSB A;  1Y96 B;  3BDU A;  4RCC A;  1Y96 A;  1TH7 A;  1HXD A;  2K57 A;  4F7U E;  2FYK A;  4M78 C;  5GAM f;  3JCM e;  3JB9 H;  2E64 A;  2FB7 A;  1LNX A;  1LOJ A;  3BW1 A;  3JCM W;  2VXF A;  4M78 B;  5LJ3 e;  2JN0 A;  3JCM h;  5GAN e;  4XTZ A;  5GAM j;  3GIB A;  3QSU A;  3RKW A;  3BY7 A;  5LJ3 d;  4M7D G;  2DTI A;  4M78 D;  4C92 E;  5GAN d;  5LJ3 h;  5LJ5 e;  2CGH A;  4M7A E;  4RCB A;  3V8J A;  2DVE A;  5LJ5 h;  5GAO n;  4HA8 A;  4F7U A;  4XTV A;  4J6W A;  1LJO A;  2DZ9 A;  1I8F A;  2EJF A;  4J6Y A;  3JCM g;  5GAN 8;  2HNI A;  3BFM A;  5DY9 A;  4M78 G;  3JCM Q;  4HT9 A;  1WPY A;  4V2S A;  1I4K 1;  3JCM f;  3SWN A;  4C92 A;  1M8V A;  5LJ5 g;  5GAN 4;  1U1T A;  3VU3 C;  4M75 E;  4M7A A;  2VC8 A;  5LJ3 f;  2EJ9 A;  4XU3 A;  2VXE A;  3V8L A;  4QVC A;  3QO3 A;  5I21 A;  4F7U F;  1X01 A;  5GMK m;  5GAN 7;  5LJ5 f;  5LJ3 j;  1HK9 A;  4NOY A;  2EAY A;  5GAN j;  3JB9 I;  3JCM P;  1BIA A;  3FB9 A;  3INZ A;  4XQ3 A;  4N0A A;  4PJO A;  4XTX A;  5LJ5 j;  3V8K A;  2YHT A;  2I2L A;  4C8Q E;  4PNO A;  3JCM c;  4C92 F;  4M75 B;  2E10 A;  5GAN h;  4M7A F;  4JRK A;  3FIF A;  4M75 A;  5GMK l;  5GAN 5;  4XU2 A;  4F7U B;  2RD1 A;  4M75 D;  4EMK B;  1KQ2 A;  2DJZ A;  4JRI A;  4EMK A;  1BIB A;  3SWN C;  4C92 C;  4EMH A;  3RER A;  4PJO E;  1U1S A;  1N9R A;  3QUI A;  4M77 E;  4PJO F;  3JCM b;  5GMK e;  4M7A C;  5LJ3 g;  2DEQ A;  3V7S A;  3SWN B;  4Y91 A;  4C8Q B;  4MMK A;  4C92 B;  5GAN g;  4J5Y A;  3JB9 D;  4M7A B;  5GMK h;  4J6X A;  4C8Q A;  4C92 D;  4C8Q D;  4M75 F;  4M7A D;  3SB2 A;  5GAN f;  4N0A C;  4F7U G;  3AHU A;  4PJO C;  2RM4 A;  3JCM J;  4M7D E;  3RIR A;  3JCM V;  4M77 B;  2DZC A;  4PJO B;  3M4G A;  4M75 C;  4M77 A;  5GAM d;  3JB9 F;  1D3B B;  3V7R A;  4M77 D;  4DQ2 A;  3JB9 J;  4PJO D;  2E65 A;  1N9S A;  1D3B A;  4C8Q G;  4C92 G;  4XTY A;  4XTW A;  2RB6 A;  4C8Q F;  4EMK C;  5GAN 2;  4XU1 A;  4MML A;  3RUX A;  4M7A G;  3JCM X;  3FJP A;  4A53 A;  2YLC A;  5GAO r;  3QHS A;  5GAO m;  2YLB A;  4XTU A;  3PGG A;  4NL3 A;  3EFS A;  1WQW A;  5GMK j;  3L1A A;  1YCY A;  4X9C A;  4C8Q C;  4M7D A;  4PJO G;  4M7D D;  2E1H A;  4M77 F;  5GAO p;  1I5L A;  4WF2 A;  3EFR A;  3RES A;  2ZGW A;  5GMK i;  3V7C A;  3RKY A;  4M75 G;  4JUV A;  4A54 A;  5GAO l;  5GAN 6;  1MGQ A;  3JCM d;  1JRI A;  4JLI A;  4M77 C;  4EMG A;  4NL2 A;  2DXU A;  5CAI A;  4M78 A;  3RKX A;  1B34 B;  2DTH A;  4M7D F;  2DKG A;  4X9D A;  5GAM e;  3HFO A;  2EWN A;  1B34 A;  1JBM A;  5GAO q;  3JB9 G;  5LJ5 d;  1WQ7 A;  5GAM h;  2Y90 A;  2E41 A;  4M7D C;  1M5Q 1;  1I81 A;  3L2Z A;  1WNL A;  2DTO A;  5GAN 3;  4QVD A;  3HFN A;  4HT8 A;  2EJG A;  4M78 E;  2RA2 A;  2DXT A;  4M78 F;  2QTX A;  4M7D B;  1H64 1;  4OP0 A; 
#chains in the Genus database with same CATH topology
 1K0X A;  2QG9 B;  1TWB A;  3QDF A;  4RCC A;  3NPF A;  2PUK B;  5IN1 A;  1JO8 A;  4IIM A;  1LOJ A;  5FRO A;  2CRE A;  3RDV A;  5GAM j;  3QXE B;  3VYG A;  1NPP A;  1U06 A;  4BI4 A;  4HA8 A;  4F7U A;  2W10 A;  3VUZ A;  1NJI R;  2EJF A;  1OEB A;  3HL8 A;  3EH1 A;  2QA4 A;  2K4Y A;  4EPC A;  4V2S A;  2K3B A;  4C92 A;  1PNJ A;  2GCX A;  1U1T A;  1QCF A;  2VGM A;  4CRI A;  1A0N B;  2PNI A;  4KH1 B;  1WXB A;  2DVJ A;  3NGP A;  4E47 A;  1Q81 C;  1ZA2 B;  2RK1 A;  2JM8 A;  1SRL A;  2LVM A;  3PE0 A;  3VKI A;  4KUI A;  1YJN A;  1M1G A;  3RER A;  4VUB A;  3V7S A;  3SWN B;  3CCE Q;  1YHQ Q;  4J6X A;  2QEX A;  4M7A D;  1WZO A;  2QI2 A;  2MMP A;  3JCM J;  2RHX A;  1NEG A;  1T3L A;  4YTL A;  2AK5 A;  1E6H A;  2J6K A;  4M75 C;  3JB9 F;  1D3B B;  4J9F A;  2QGF B;  1LPL A;  1F1B B;  3ZBD A;  2M1H A;  4XTW A;  4M7A G;  4MML A;  4Z02 A;  1VYU A;  3MP6 A;  3UF4 A;  4D8D A;  4BE0 A;  4C0D C;  5GMK j;  3CCS Q;  2FZC B;  5CKB A;  2FO0 A;  4E7H A;  2D8H A;  2Z0W A;  4HCB A;  4JUV A;  3TEE A;  3P8H A;  1YI2 Q;  1WHM A;  4AMC A;  5KYU A;  4L6V 5;  2E70 A;  1YWP A;  2EYQ A;  3O8V A;  4X9D A;  1Q86 U;  2RNA A;  1B34 A;  2JUF A;  1TUC A;  2E6Z A;  1K1Z A;  1AOJ A;  2GF7 A;  3M5A A;  3T9N A;  4HT8 A;  4M7D B;  3I55 Q;  4XU0 A;  5C0M A;  1K8A R;  4AT1 B;  1RAD B;  4Q5W A;  4PFZ A;  1LNX A;  2BE7 D;  1M90 U;  2AZS A;  3A8H B;  1ZUK A;  3QSU A;  2Y4Y A;  4PJJ A;  4Z88 A;  2OI3 A;  2YUN A;  5LJ3 h;  5LJ5 e;  4X34 A;  1TU0 B;  2P4R A;  1R77 A;  1AWW A;  3RR6 A;  1Z9Z A;  2LMJ A;  1V29 B;  3JCM Q;  5CVI A;  3R6N A;  2DAQ A;  2LX7 A;  5LJ5 g;  4LUD A;  1B7T A;  4BAC A;  4N4G A;  1AWJ A;  1UGS B;  4RKU E;  4M75 B;  1JJ2 A;  1M9S A;  2NUT B;  1IZ6 A;  1VIE A;  1GFC A;  1WHG A;  4ME7 A;  4LD9 K;  1Q81 U;  1U5S A;  2X35 A;  2DEQ A;  3OB9 A;  1M1K C;  1BI2 A;  2HAX A;  2XMF A;  1VQ9 A;  1FYN A;  3H8Z A;  2ED1 A;  4QQ6 A;  3M59 A;  3SB2 A;  2JTE A;  2CP7 A;  2M0Y A;  3HPW A;  1UB4 A;  1SPK A;  1YBY A;  1X69 A;  1PCX A;  2CT3 A;  1UJY A;  1HJD A;  2DF6 A;  3N5B B;  3EFS A;  2XID A;  2F1L A;  4AFS C;  3IQL A;  3OS5 A;  2J06 A;  5KYY B;  5FU7 B;  1RLQ C;  1BB9 A;  1M8M A;  2KVQ G;  3JCM d;  1NJI U;  5IXB A;  5I11 A;  2DJQ A;  2EWN A;  4RTW A;  4RTZ A;  1YIT Q;  1RAA B;  2ZPI B;  5GAM h;  3QG1 A;  3LW5 E;  1WFW A;  1WNL A;  2BKD N;  1Y57 A;  3PNW C;  5IHI A;  3CCE T;  4E7K A;  2JJ9 A;  1YHQ T;  1Y71 A;  4RTT A;  4LD6 A;  1N8R R;  4F7U E;  3EGD B;  2K3X A;  3RBB B;  1TUD A;  3JB9 H;  1AEY A;  1R8O B;  4M78 B;  2JN0 A;  4BI8 B;  5I2M A;  4C92 E;  4OGE A;  2GTO A;  3OS2 A;  3G6E A;  2F69 A;  4FSS A;  4BUG A;  3C94 A;  3CCQ Q;  3LWI A;  3VUB A;  3CCS T;  4ANJ A;  3C95 A;  5KH6 A;  5GAN 4;  4WTO B;  4F04 B;  2R58 A;  2EJ9 A;  4XU3 A;  5KYX B;  2MYS A;  4BY6 C;  1YI2 T;  2X3W D;  2M16 A;  2FPF A;  3LYI A;  1K0S A;  3A8O B;  3EG2 A;  4DBH A;  3MJX A;  3OYH A;  2DD5 A;  3OS0 A;  3M4Y A;  2GTJ A;  3FIF A;  2NUP B;  5GMK l;  2PQW A;  5GAN 5;  1KQ2 A;  3LWH A;  2GFU A;  1Q95 G;  3I55 T;  4EDU A;  1UHF A;  2YUP A;  3M0U A;  4JRQ A;  5GMK h;  2GNC A;  1N8R C;  3QZ9 B;  3OW2 A;  2DET A;  4PJO C;  1VQ8 T;  3VS4 A;  2QAZ A;  2CKK A;  2V8I A;  4F14 A;  2KMT A;  2J7I A;  4DQ2 A;  3DB4 A;  1K8A U;  1M1K U;  1ABO A;  1V1C A;  3OYN A;  4GLM A;  1K73 R;  3TU4 K;  3FJP A;  2SEM A;  2MWO A;  1QQJ A;  1BI0 A;  4X9C A;  3M54 A;  1VUB A;  4M77 F;  1NYF A;  2QQB A;  2FRY A;  3DLL A;  4WF2 A;  2I0N A;  1ZSG A;  3CCV Q;  2EGA A;  3M0T A;  3CCJ A;  2ATC B;  4IUQ A;  1QVF A;  3PIP A;  4BDZ A;  1PG5 B;  5HKC A;  2AKK A;  2ECZ A;  2LNV A;  1I81 A;  2WSF E;  2VYT A;  3G71 A;  2P4T A;  3SHW A;  1R0C B;  3OS1 A;  1OQK A;  1B3Q A;  2HDA A;  1GCP A;  1ZSZ C;  1Y96 A;  2IIM A;  3MEV A;  1PKS A;  2E64 A;  2MI6 A;  1WYX A;  4O5V A;  2C06 A;  2QXF A;  1YJW A;  1EIF A;  3MP8 A;  3I56 Q;  3ZFJ A;  3CXC P;  5CQY A;  3CCL A;  3CCR A;  2DZ9 A;  4GLK A;  4X1V A;  5DY9 A;  3HKS A;  2LCC A;  2HBW A;  1VQM Q;  1NLO C;  1KC8 C;  2K3Y A;  1W2B A;  1XOV A;  3V8L A;  2JS2 A;  1X01 A;  3OW2 S;  1WXU A;  4J9B A;  3JSC A;  4N0A A;  4FW2 A;  4XTX A;  2YUQ A;  2YHT A;  3M9Q A;  1YIT T;  2RJD A;  2DFU A;  1YN8 A;  5GAN h;  1VQ7 Q;  4PLL A;  2DXB A;  2HL5 C;  2RI5 A;  5CKE A;  3NFC A;  2P0K A;  2EBP A;  2EYW A;  4M7A B;  3CMA A;  2HSE B;  3OYI A;  2B86 A;  1YFN A;  1G5V A;  4F17 A;  2D6F A;  5GJW B;  1GL5 A;  2HBP A;  1TXQ A;  2MPX C;  3EHQ A;  4MDX A;  1G83 A;  3QJY A;  1N8R U;  1ZHI A;  5IHN A;  4J8O A;  2XDP A;  4FT2 A;  3CCQ T;  1TSF A;  2JZ2 A;  1M3A A;  3C12 A;  2ROT A;  1UJ0 A;  1QLY A;  3R6O A;  2DBK A;  2L5Q A;  2X4X A;  2WAC A;  4RTV A;  1KIK A;  4M75 G;  1ZSZ B;  1UHC A;  2WSC E;  2O88 A;  2K9G A;  2VGN A;  4M7D F;  1OYX A;  1JBM A;  4J9C A;  5LJ5 d;  4A4K A;  1WX6 A;  2KRM A;  3EFO B;  3M0S A;  5KCH A;  4A63 B;  1OX9 A;  2EYX A;  3E2U A;  2ZPE B;  1QMC A;  2X9H A;  4IUP A;  5IXF A;  1YIJ Q;  1W2B S;  1GBQ A;  3A5Z B;  3S3N A;  4IUR A;  4Y92 A;  3S6W A;  2QDL A;  2RHU A;  5GAN e;  2CSQ A;  3MHX A;  4OB1 B;  4ESR A;  3V8J A;  2C0I A;  2O31 A;  2PVG B;  1JU5 C;  2FRW A;  2LQW A;  1Q7Y R;  1H3H A;  4MZP A;  4KUD K;  5CQX A;  2NUZ A;  1KHC A;  4AFQ C;  1I5O B;  1QVG A;  3QPH A;  4EIK A;  4J7I A;  1UDL A;  2OTJ Q;  2VXE A;  4R56 A;  1NBE B;  3OYK A;  3CCV T;  3GLX A;  2O9V A;  3CCM Q;  2I2L A;  3H9N A;  1KC8 U;  1QCO A;  4J83 A;  1ZUU A;  2C0T A;  3EGU A;  1MNE A;  4JPB W;  4Z8A A;  3CQT A;  1SSH A;  4PJO E;  2MAM A;  1RAE B;  2CDT A;  4LDY A;  2CP0 A;  5L8R E;  3Q1J A;  1EZZ B;  1U8R A;  3DLM A;  3OYJ A;  2RM4 A;  4QQD A;  4K11 A;  3OYM A;  3M4G A;  4M77 A;  3I56 T;  3VS7 A;  4QQG A;  3H0H A;  1TTH B;  3PGG A;  2L8D A;  1ARK A;  1ZA1 B;  1WQW A;  1MND A;  1RLP C;  3QII A;  2VB6 A;  1UGV A;  3H6Z A;  2CP3 A;  2DYI A;  2DKG A;  2QGG A;  2DL8 A;  2YXY A;  2ZAE A;  1VQ7 T;  4JS4 A;  1HD3 A;  4ZN1 A;  4OB3 B;  4OMO A;  2KQW A;  4JZ3 A;  4M78 F;  2M0O A;  3WVD B;  2P0Q A;  3MO8 A;  3HSB A;  4DEX A;  1BYM A;  2MIO A;  1TH7 A;  2X4J A;  3G4S A;  2F5K A;  1YJ9 A;  3WVE B;  2RQW A;  1BK2 A;  2PUO B;  4XTZ A;  2F2W A;  4HKE A;  2LP5 A;  3CC7 A;  3CCU Q;  4HCK A;  3A98 A;  3M55 A;  1WIE A;  2DVE A;  3HRS A;  1R0B G;  4J6W A;  1LJO A;  3OBW A;  3EGX A;  2LJ0 A;  3I35 A;  2DBM A;  1WPY A;  3SWN A;  1K9A A;  2QQ9 A;  3OYE A;  5LJ3 f;  1Q82 R;  1JJ2 P;  1GFD A;  1X43 A;  3FJ5 A;  3CME A;  3EAE A;  1ZBX A;  1J3T A;  5FU6 C;  2KYB A;  1X6B A;  3PT9 A;  3ER0 A;  1M27 C;  1VQP A;  2RD1 A;  2D1X A;  2EPD A;  3CC4 Q;  1VQ6 A;  1QKX A;  4C92 C;  4MZM A;  5D6Y A;  3MEA A;  4FYV B;  4OF1 A;  4Y91 A;  3JB9 D;  1YIJ T;  3E19 A;  4OMN A;  3VS2 A;  4JJC A;  3L2U A;  2DK3 A;  4CI0 C;  4PJO D;  1BU1 A;  4C8Q F;  1QVP A;  4B9W A;  1KQS A;  3LGF A;  5M9O A;  5GAO m;  4XTU A;  1OPL A;  4FYW B;  4A4G A;  4M7D A;  2GQV A;  2HQE A;  4PJO G;  4IKF A;  1VQ4 Q;  2COY A;  2OTJ T;  2ZGW A;  2HD0 A;  4AFU C;  2LJ1 A;  1MGQ A;  1S72 A;  5CKD A;  1XNI A;  2X51 A;  3MP1 A;  2COW A;  2QQR A;  3QZ5 B;  3CCM T;  3KUF A;  4KGX B;  2CZ0 B;  5FW9 A;  3I55 A;  3EH2 A;  1NJI C;  2KI7 A;  2QDY B;  3FLG A;  2VAS A;  2QA4 Q;  1BI3 A;  4DBR A;  1VQ8 A;  1HXD A;  3M0R A;  5GAM f;  2B8A A;  2EKO A;  3PMI A;  2P0P A;  4FIB A;  2ESW A;  2CGH A;  5FU6 B;  2KK4 A;  3CC2 A;  1YWO A;  1FMW A;  2KXD A;  3KBG A;  1W6X A;  1WLP B;  2BZ8 A;  2LZ6 B;  2O4X B;  1I8F A;  2BUD A;  1QW1 A;  5A0D A;  5ECA A;  5HK0 A;  3RNJ A;  1YJN Q;  5CR2 A;  3UPU A;  3VU3 C;  1BCM A;  3TRE A;  2E5K A;  2EYY A;  2OAU A;  2QEX Q;  3OYY A;  4E7J A;  1B07 A;  2ZPF B;  3CBO A;  3CEY A;  2M9U A;  2XU8 A;  3VRY A;  1I1J A;  4DEY A;  1RAF B;  3SDZ A;  4M7A F;  4OMM A;  4XU2 A;  3GBQ A;  1JB0 E;  4E6R A;  1KQS S;  2RHI A;  2QTV A;  3OW2 P;  2PU9 B;  4GBQ A;  5D6W A;  2XHC A;  4M77 E;  2CUB A;  5KYW B;  5KYY A;  1UEC A;  4HVV A;  4KGZ B;  1VQN A;  1KJW A;  4LDV A;  2PVO B;  2JW4 A;  1PHT A;  1PM3 A;  2O01 E;  1K4U S;  2HL3 A;  3EG9 B;  5HK3 A;  2H3J A;  2LNH B;  2A36 A;  1I0C A;  3MEU A;  3GPL A;  3CCU T;  2CYZ B;  4ZN3 A;  4XU1 A;  1NG2 A;  1X2K A;  5GAO r;  1IGU A;  3TVT A;  2KXC A;  2VV5 A;  2E6N A;  1VQO A;  2AIR B;  1KG1 A;  1G3Y A;  1ZUY A;  3VS3 A;  1E6G A;  2QQA A;  4FU6 A;  4C0D B;  2KBT A;  1K8A C;  1QVF P;  4E7L A;  3CBM A;  5GMK i;  1OZ2 A;  1PWT A;  4AFZ C;  3QDR B;  1YIT A;  5J39 A;  2JM9 A;  4M78 A;  1B34 B;  3UT1 A;  3RMS A;  1TOV A;  2LT1 A;  4ZGD B;  1Q82 U;  3CC4 T;  2LCS A;  1IHV A;  4BI3 A;  4A4H A;  1KQ1 A;  1VQK A;  2DIQ A;  4Y28 E;  3VJP A;  3G7Z A;  5KYX A;  5FWB A;  3A8G B;  5LJ3 e;  3VS0 A;  4ELY C;  4QW2 A;  3GIB A;  2PZ1 A;  2D8J A;  5AT1 B;  4L59 A;  1VYV A;  1MMA A;  1T0J A;  3QYG B;  4RCB A;  3CCQ A;  2NUP A;  3OBY A;  1M2V A;  1W2B P;  2FPD A;  1GCQ A;  2EQJ A;  2DLP A;  2E4H A;  1VQL A;  1VQ4 T;  4FW1 A;  1UE9 A;  1RUW A;  9ATC B;  1VIF A;  1VQ9 Q;  4NOY A;  2XKO C;  3FB9 A;  4RTU A;  3DKM A;  3H0F A;  1SF9 A;  2DA9 A;  2DE0 X;  4KH0 B;  4EMK A;  1UG1 A;  5FRN A;  2ZCF B;  5FLX E;  5A0L A;  1U1S A;  2F5T X;  3VRZ A;  1RI0 A;  2QA4 T;  4J5Y A;  4RMO A;  4C8Q A;  1KHI A;  3MPU B;  5GAN f;  3FC3 A;  2R57 A;  4J9G A;  2LQK A;  5DLQ E;  4M7D E;  2M02 A;  3M53 A;  2DZC A;  2QK0 A;  2YUO A;  4M77 D;  3JB9 J;  4HXJ A;  3HHT B;  3LH0 A;  3EG1 A;  4NL3 A;  2KT1 A;  1YJN T;  1VA7 A;  2QEX T;  3CPW A;  4CC3 A;  2L3R A;  3CD6 A;  2DTH A;  5GAM e;  1ACM B;  4N4I A;  2RJF A;  2L3Q A;  2RN8 A;  2E41 A;  2YT6 A;  1VOM A;  2AT1 B;  1M5Q 1;  4LN2 A;  1N5Z A;  2RA2 A;  1W70 A;  5I22 A;  1WHL A;  5GAM g;  4D6W A;  2D0N A;  4MDW A;  3S3O A;  1FX7 A;  3QJ6 A;  4JDS A;  1OPK A;  2F2X A;  2L3S A;  3LH5 A;  4J9E A;  1K9M R;  1QVG P;  2DL4 A;  2RI3 A;  1BCO A;  1WHJ A;  4HCZ A;  3MEW A;  2ROL A;  1KFZ A;  2DMO A;  1AWO A;  2OTL A;  3G1J A;  4ZTF A;  3M58 A;  4M7A A;  4C5G A;  3MCA B;  2IG0 A;  3UWN A;  3P8D A;  3A8M B;  1TS9 A;  4O6J A;  2P84 A;  4BY6 B;  1FXX A;  2XK0 A;  2KAF A;  4LNP A;  3LX7 A;  1K73 C;  1BI1 A;  4QVZ A;  3L2R A;  2FZK B;  1VQ5 A;  1OUL A;  5GMK e;  4LUE A;  3UA7 A;  1CKA A;  3LLR A;  4C92 D;  1QP3 A;  3D7S B;  4IUT A;  1AWX A;  2VWF A;  4N0A C;  2V1Q A;  4F7U G;  3CPW S;  5CCA A;  2L2P A;  4PJO B;  2BIV A;  2KR3 A;  3CCJ Q;  4C92 G;  3BDL A;  3RUX A;  3EFO A;  1IRX A;  1QWF A;  4A53 A;  2DX1 A;  3QHS A;  3L42 A;  2YLB A;  1YCY A;  4M7D D;  2E3I A;  2FEI A;  3G71 Q;  5AYF A;  4UC4 A;  3RES A;  2YRD A;  3I5R A;  2RQR A;  3KXT A;  4A54 A;  2ABL A;  1VQ9 T;  1SHF A;  1QCN A;  3REA B;  3X25 B;  1GXI E;  2PTK A;  1NYG A;  1O75 A;  3OY9 A;  1YJW Q;  5D6X A;  4PJN A;  4LDX A;  3OYB A;  3L2Z A;  4QVD A;  2L0A A;  4WCI A;  3CCL Q;  3CCR Q;  1X6G A;  1WGS A;  4OP0 A;  1Y96 B;  1JXO A;  3I9Q A;  1C6V X;  1OU9 A;  3OMG A;  2RHY A;  4TVR A;  2BTT A;  2K7A A;  3L2Q A;  2K6D A;  3JCM h;  4PJL A;  2E5Q A;  1KD1 R;  1PD0 A;  4KT0 E;  3JRZ A;  1N6A A;  3TSW A;  1LCK A;  4ORZ A;  2GQI A;  3E1S A;  3QBY A;  2LRQ A;  1FWZ A;  2K2M A;  2NWM A;  4LXC A;  4HVU A;  3REB B;  3CMA Q;  2XDB A;  2EAY A;  2ZZD A;  5D7U A;  4PLI A;  3JV3 A;  5LJ5 j;  1RAI B;  3V8K A;  4C8Q E;  3WXM B;  3JAM E;  1PKT A;  2JVV A;  1BIB A;  2X3X D;  3GOX A;  1QWE A;  1G8X A;  4DBF A;  3PTA A;  3C4S A;  5GAN g;  4M75 F;  4QT7 A;  1K73 U;  1WJS A;  1KQS P;  2GFA A;  3RIR A;  2XG8 D;  3ZL7 C;  2DIL A;  2PVD B;  2NLU A;  1CSK A;  5IH2 A;  1JEG A;  2DRM A;  2E65 A;  1KD1 C;  2O9S A;  5EG2 A;  3JCM X;  2ENM A;  1WJR A;  1S1N A;  1UGQ B;  4PFP A;  2HCK A;  2SRC A;  2E3H A;  3F70 A;  4C5H A;  1AZE A;  3EFR A;  2VKN A;  4NS5 A;  1IHW A;  4KRT A;  1JRI A;  4M77 C;  2RH2 A;  2X4W A;  1UEB A;  4EMG A;  4E2F B;  2DL3 A;  2EFI A;  3A8L B;  2O2O A;  2V1R A;  2LJ3 A;  4DOW A;  2DL7 A;  1Q7Y C;  3C0C A;  5J3B A;  3M56 A;  1Q86 R;  3I5S A;  2DXT A;  4OMQ A;  3UA6 A;  1VQM T;  3EG0 A;  5FWC A;  2LQ8 A;  2CZ1 B;  2A08 A;  2CP2 A;  4ELZ C;  5FRM A;  2A28 A;  2RPN A;  5HY6 A;  2CT4 A;  4M7A E;  2KRS A;  2XDD A;  4JJN K;  3J80 E;  1M90 R;  1M3C A;  4J6Y A;  4LDW A;  5KE2 A;  3OYL A;  1UGP B;  4J7F A;  3G71 T;  2DNU A;  4HT9 A;  3S3M A;  1M8V A;  4BD3 A;  3M0P A;  2VC8 A;  1BKB A;  5CKF A;  3QO3 A;  4J9I A;  5GMK m;  5GAN 7;  1EFN A;  3O5Z A;  1HK9 A;  2HEQ A;  3JCM c;  1YJW T;  1OX8 A;  3OYF A;  4FM4 B;  1SEM A;  2LT4 A;  2QQS A;  5C6S A;  3J81 E;  2DD4 A;  3SWN C;  3CCR T;  1N9R A;  3QUI A;  1Y7X A;  3KFV A;  2W0Z A;  4C8Q D;  5CK9 A;  4A4E A;  1X27 A;  1M1F A;  1IO6 A;  1ZQ1 A;  2KYM A;  1Q81 R;  4CC4 B;  1JXM A;  4M77 B;  3OYG A;  5GAM d;  1JQQ A;  1D3B A;  4C8Q G;  4XTY A;  1ZBJ A;  3X26 B;  2D9T A;  3OQ5 A;  2KT8 A;  3CCE A;  5CKH A;  1YHQ A;  1W4S A;  1D0X A;  3CXC S;  3QKJ A;  1KD1 U;  4JS5 A;  5IAY A;  2A0F B;  2FPE A;  3CMA T;  1TUG B;  4IIO A;  5GAN 6;  3G4S Q;  2HKN A;  1YJ9 Q;  1PC0 A;  4RG2 A;  2FG0 A;  3JB9 G;  1WHK A;  4KGV B;  3L2V A;  4JJD A;  4RUG A;  3CC7 Q;  5KCO A;  2A3L A;  2LC4 A;  4M7D C;  2RK2 A;  3EG3 A;  1D1B A;  2O4X A;  2R5M A;  3CCS A;  1H3Z A;  1FMV A;  1E7O A;  5L23 A;  1H64 1;  2KY9 A;  1YI2 A;  1Q82 C;  2G3R A;  2HQH A;  2L3P A;  2GBQ A;  1Q7Y U;  1WXT A;  2J6O A;  2OJ2 A;  3BY7 A;  3CME Q;  2DTI A;  3QWY A;  3GP8 A;  5LJ5 h;  1RAG B;  5GAO n;  3PVQ A;  3EGX B;  2ZPG B;  4FYX B;  1VQP Q;  3BFM A;  1M30 A;  2DPP B;  3H41 A;  1VQ6 Q;  5KYW A;  2CH4 W;  1D09 B;  2EVR A;  3VV0 A;  2MF2 A;  2EGC A;  3EG9 A;  2AHJ B;  2E12 A;  4KBM B;  2R5A A;  1FMK A;  1SKU B;  3VS6 A;  2FHD A;  4M75 A;  4F7U B;  2MCN A;  2NUT A;  1NM7 A;  1NLP C;  2KDS A;  4PJO F;  3JCM b;  2V8K A;  3TSZ A;  1MUZ A;  2DL5 A;  4C92 B;  3E9G A;  2BE9 B;  2DRK A;  1S72 Q;  5I2S A;  2AZV A;  1OV3 A;  3L2W A;  2KRO A;  4GY5 A;  4RTX A;  1V76 A;  3CPW P;  5FU7 C;  2K79 A;  3ULR B;  3ASK A;  1M1K R;  5EC7 A;  2XD0 A;  1RI9 A;  3V7C A;  3RKY A;  2LQN A;  1VQ8 Q;  2FL7 A;  1AVZ C;  3HP9 A;  1NE8 A;  3HFO A;  2IVW A;  1XTD A;  3PIO A;  3CC2 Q;  1GRI A;  1G3W A;  2EJG A;  2A7Y A;  4XK8 E;  3SD4 A;  3EHR A;  2K57 A;  3OYC A;  2JOY A;  4M78 C;  3EGD A;  3HRT A;  5KYU B;  1PD1 A;  1X6O A;  3GNF B;  2BZX A;  5GAN d;  1MV3 A;  4LDU A;  5LL6 S;  1X2Q A;  2YRC A;  3QYH B;  1Z9Q A;  3CPF A;  2HNI A;  4ATO A;  1K76 A;  4KUL A;  3FRN A;  1ZX6 A;  1P92 A;  1I4K 1;  2MWP A;  4R55 A;  3OSS C;  3G4S T;  1VQN Q;  3U23 A;  2YDL A;  2JTM A;  1YJ9 T;  5GAN j;  1PSE A;  3JB9 I;  2JMA A;  3INZ A;  4XQ3 A;  1IGQ A;  4E7Z A;  2H8H A;  1RAB B;  4PNO A;  3MET A;  1MMD A;  3CC7 T;  1GCQ C;  2DER A;  3MKD A;  3OYD A;  3AT1 B;  4EMH A;  4PJM A;  2G6F X;  1VQO Q;  2XI9 A;  5LJ3 g;  1WA7 A;  2V26 A;  3QWX X;  1Y07 A;  3J7A F;  3NTH A;  5IHK A;  3M0Q A;  2MK5 A;  1WHH A;  2V8J A;  1OU8 A;  1RAC B;  3CME T;  4AG1 C;  2AKL A;  4ZTJ A;  3V7R A;  3BE3 A;  3UAT A;  1U3O A;  4EMK C;  3NTI A;  6AT1 B;  2ZPH B;  5DLO A;  1VQP T;  2ZPB B;  1MMG A;  1TG0 A;  2RMO A;  1VQ6 T;  4C8Q C;  5KYN A;  4FT4 A;  2ED0 A;  2KGT A;  1MHN A;  1ZLM A;  4PL6 A;  1VQK Q;  1H8K A;  1M4Z A;  2K2V A;  5CAI A;  4R0K A;  4AG2 C;  1JJ2 S;  4PKC C;  2JXB A;  4FCY A;  1SG5 A;  2RJE A;  4P5N A;  1OZ3 A;  4B6M A;  4J9H A;  1G2B A;  4J9D A;  4M77 G;  1VQL Q;  3BDU A;  2A37 A;  1OOT A;  2EQI A;  2RO0 A;  1UGR B;  1SSF A;  3OSV A;  2LDM A;  3CCV A;  2QAS A;  2FVU A;  5J26 A;  2IPO B;  2JNG A;  2GGR A;  7AT1 B;  3JCM W;  1S72 T;  2VXF A;  1AD5 A;  3RKW A;  2CSI A;  3PMT A;  1AZG B;  2RQV A;  2XIC A;  1M2V B;  3G6E Q;  1NEB A;  3FEO A;  1G3T A;  4BE2 A;  2KEA A;  1YNZ A;  1QP2 A;  3JCM f;  4M75 E;  2LX9 A;  4QVC A;  1RL2 A;  3PFS A;  4MZT A;  5CO7 A;  2RQT A;  4ZNX A;  2HZY A;  2M51 A;  4PJO A;  3I56 A;  8AT1 B;  3NMZ C;  3X24 B;  4BB7 A;  2NYS A;  1D0Y A;  3CC2 T;  2DM1 A;  4EMK B;  4ZGE B;  1MV0 B;  2DJZ A;  2RJC A;  4JJB A;  3X28 B;  1VQM A;  4M7A C;  2EYZ A;  1KC8 R;  1XQH A;  4C8Q B;  4MMK A;  4CC7 A;  2D0Q B;  2EQM A;  4DBQ A;  1HYO A;  5A0G A;  3AHU A;  5GJV B;  4IUV A;  4IUU A;  3M57 A;  1GBR A;  1VQ7 A;  3CD6 Q;  3VYH B;  4PFO A;  4II1 A;  1SHG A;  2RB6 A;  4RG8 A;  5HCK A;  1M3B A;  1KK7 A;  2K5L A;  1I5L A;  3X20 B;  4OVA A;  4E7S A;  5GAO l;  1VQN T;  1RAH B;  4DA4 A;  4JLI A;  1ZSZ A;  2JTF A;  4OGC A;  2RQU A;  1UUE A;  5GAO q;  1K9M C;  1NPR A;  4OB2 B;  2EGE A;  1ABQ A;  1MMN A;  1AHJ B;  2Y4X A;  4M78 E;  4JRP A;  1VQO T;  4XAX B;  1LVK A;  1W1F A;  4OMP A;  4C0F A;  2OTL Q;  2FYK A;  3BW1 A;  2BZY A;  3DB3 A;  3SFM A;  1T0H A;  4M7D G;  4QKU A;  1M2O A;  2DIG A;  2L89 A;  1SRM A;  4XTV A;  2COZ A;  4D8K A;  2LCL A;  2JMC A;  5GAN 8;  3LGL A;  4JZ4 A;  4M4Z A;  1YIJ A;  1HSQ A;  2EQU A;  1VQ5 Q;  2MOX A;  1IRE B;  1VQK T;  4BE1 A;  2CUD A;  4RTY A;  1PRM C;  4F7U F;  4C0G A;  1BIA A;  1QVF S;  2JS0 A;  4C92 F;  2HSP A;  2E10 A;  4JRK A;  2DYB A;  4M75 D;  1G3S A;  3TQ7 P;  4JRI A;  3PVL A;  3TCJ A;  1VQL T;  4OMF B;  2OTJ A;  3RMQ A;  1AT1 B;  2CS7 A;  1D1A A;  2H3E B;  2K5I A;  3CCM A;  4C0Z A;  1O9S A;  1NZ9 A;  2YWW A;  4DOV A;  3SEM A;  2YSQ A;  3URG A;  2FZG B;  4LE9 A;  3G6E T;  2RI2 A;  3H0I A;  4PK4 A;  4FL6 A;  4F16 A;  3GF5 A;  1BBZ A;  1PSF A;  3UDC A;  3ZEH A;  4B9X A;  3OYA A;  2E1H A;  2DEU A;  4FSX A;  3VS5 A;  3OA6 A;  2JT4 A;  4Z89 A;  2HQX A;  3A1P A;  4HVW A;  2CP5 A;  3P8B B;  2QYZ A;  1WQ7 A;  2CH4 A;  1WJQ A;  2J05 A;  5IT9 E;  3FDR A;  5DM7 R;  3HFN A;  2QTX A;  5GAN 3;  1K9M U;  2RHZ A;  1VYT A;  2KNB B;  2K5F A;  5KE3 A;  3JCM e;  2FB7 A;  3E9F A;  2RF0 A;  1UFF A;  1XJW B;  3CD6 T;  5LJ3 d;  1UTI A;  4M78 D;  5A2Q E;  2EW3 A;  1T3S A;  1EX4 A;  2DXC A;  2X4Y A;  1IXD A;  2CZ7 B;  3JCM g;  3CBP A;  2HKQ B;  4M78 G;  3CXC A;  2KSS A;  2CZ6 B;  4OML A;  3ME9 A;  5I21 A;  2CP6 A;  3THK A;  1YP5 A;  2LTO A;  5LJ5 f;  1N27 A;  5LJ3 j;  4L5G A;  3NHN A;  3JCM P;  4FYY B;  3CCU A;  3VS1 A;  3CCJ T;  8ATC B;  2EIF A;  1KSW A;  1C0M A;  4C5E A;  2KRN A;  1WI7 A;  1D0Z A;  1I07 A;  3HTR A;  3NTK A;  2OTL T;  4ZGJ B;  1IB8 A;  4N4H A;  4JLG A;  4BDY A;  1DJ7 B;  3HRU A;  1OI1 A;  4HCC A;  2J6F A;  2OAW A;  3JCM V;  3GNG A;  1CKB A;  4E7I A;  1N9S A;  5GAN 2;  5GAO p;  2EKH A;  3CC4 A;  2YLC A;  1H92 A;  2VVK A;  2KE9 A;  1PRL C;  3CCL T;  3L1A A;  1Q86 C;  2DO3 A;  1QVG S;  2HMA A;  1VQ5 T;  2WSE E;  1D1C A;  1X75 C;  2YRV A;  4A4F A;  2C0O A;  5CIU A;  4NL2 A;  2DXU A;  1YCS B;  3RKX A;  4C5I A;  2OX7 A;  1WDX A;  1Y0M A;  2Y90 A;  4CC2 A;  4OB0 B;  1C1A A;  3OMC A;  1QKW A;  2EQK A;  2DTO A;  1M90 C;  1VQ4 A;  2F2V A;  2VUB A; 
#chains in the Genus database with same CATH homology
 5GAM g;  2ZPE B;  4D6W A;  4RCC A;  4IUP A;  2K57 A;  3OYC A;  1W2B S;  2PUK B;  5IN1 A;  2JOY A;  4M78 C;  4MDW A;  3A5Z B;  3S3O A;  3HRT A;  3S3N A;  1LOJ A;  4IUR A;  5FRO A;  3S6W A;  2RHU A;  1FX7 A;  5GAM j;  5GAN e;  1X6O A;  3QJ6 A;  3QXE B;  3GNF B;  4JDS A;  3VYG A;  5GAN d;  1NPP A;  3MHX A;  4OB1 B;  4LDU A;  5LL6 S;  3V8J A;  2RI3 A;  2PVG B;  4BI4 A;  4HA8 A;  4F7U A;  4HCZ A;  3VUZ A;  3MEW A;  3QYH B;  2EJF A;  4MZP A;  4KUD K;  3HL8 A;  3CPF A;  2HNI A;  5CQX A;  4ATO A;  1KHC A;  2QA4 A;  4KUL A;  1QVG A;  3FRN A;  3QPH A;  2K4Y A;  4EPC A;  1P92 A;  1I4K 1;  4J7I A;  2MWP A;  4C92 A;  4ZTF A;  2GCX A;  3M58 A;  2OTL A;  1U1T A;  4M7A A;  4R55 A;  4C5G A;  2VXE A;  4R56 A;  3OSS C;  3MCA B;  2IG0 A;  3G4S T;  2VGM A;  3P8D A;  3UWN A;  4CRI A;  3OYK A;  3CCV T;  3A8M B;  3GLX A;  2JTM A;  1YJ9 T;  4O6J A;  5GAN j;  4BY6 B;  1PSE A;  3JB9 I;  3INZ A;  4XQ3 A;  4E47 A;  1Q81 C;  2RK1 A;  1FXX A;  2I2L A;  2XK0 A;  4PNO A;  1KC8 U;  2KAF A;  3MET A;  3CC7 T;  4J83 A;  2LVM A;  3VKI A;  3OYD A;  4KUI A;  3LX7 A;  1K73 C;  1BI1 A;  4QVZ A;  1YJN A;  1M1G A;  4EMH A;  3L2R A;  1VQ5 A;  3RER A;  4VUB A;  4PJO E;  5GMK e;  2MAM A;  2XI9 A;  3V7S A;  5LJ3 g;  4LDY A;  3SWN B;  5L8R E;  3LLR A;  4J6X A;  3Q1J A;  2QEX A;  4C92 D;  1Y07 A;  3J7A F;  1QP3 A;  4IUT A;  4M7A D;  3NTH A;  1U8R A;  3DLM A;  4N0A C;  4F7U G;  3OYJ A;  2RM4 A;  3CPW S;  2QI2 A;  2MMP A;  5CCA A;  4QQD A;  2RHX A;  2V8J A;  3JCM J;  4PJO B;  3CME T;  2BIV A;  4YTL A;  3OYM A;  3M4G A;  4M75 C;  4M77 A;  4ZTJ A;  3JB9 F;  1D3B B;  3V7R A;  3I56 T;  3ZBD A;  4C92 G;  4EMK C;  2M1H A;  3NTI A;  3BDL A;  4QQG A;  4XTW A;  3RUX A;  4MML A;  4M7A G;  4Z02 A;  4A53 A;  3MP6 A;  2ZPH B;  3QHS A;  3L42 A;  5DLO A;  1VQP T;  2YLB A;  2ZPB B;  4BE0 A;  3PGG A;  2L8D A;  4C0D C;  1WQW A;  5GMK j;  1VQ6 T;  1YCY A;  4C8Q C;  4M7D D;  3QII A;  4FT4 A;  5AYF A;  5CKB A;  4V2S A;  4UC4 A;  3RES A;  4E7H A;  3KXT A;  1MHN A;  4PL6 A;  4HCB A;  4A54 A;  4JUV A;  3TEE A;  3P8H A;  1M4Z A;  3H6Z A;  1VQ9 T;  2K2V A;  4L6V 5;  3X25 B;  5CAI A;  2E70 A;  2DKG A;  2EYQ A;  3O8V A;  4X9D A;  1Q86 U;  1GXI E;  1B34 A;  1O75 A;  2JUF A;  1JJ2 S;  1VQ7 T;  4JS4 A;  4PKC C;  3OY9 A;  2E6Z A;  4ZN1 A;  4OB3 B;  5D6X A;  4LDX A;  3OYB A;  3L2Z A;  2KQW A;  4QVD A;  2GF7 A;  2RJE A;  3M5A A;  4P5N A;  3T9N A;  1OZ3 A;  4HT8 A;  4M7D B;  4M78 F;  2M0O A;  3WVD B;  1WGS A;  2P0Q A;  4OP0 A;  3MO8 A;  4XU0 A;  4M77 G;  5C0M A;  1Y96 B;  2RO0 A;  3BDU A;  3HSB A;  1BYM A;  1UGR B;  1SSF A;  3OMG A;  2RHY A;  1TH7 A;  2X4J A;  4TVR A;  3OSV A;  3G4S A;  2LDM A;  3CCV A;  3L2Q A;  2F5K A;  4Q5W A;  2FVU A;  1YJ9 A;  5J26 A;  1LNX A;  2JNG A;  3WVE B;  1M90 U;  3JCM W;  1S72 T;  2VXF A;  3JCM h;  3A8H B;  2PUO B;  4XTZ A;  2Y4Y A;  3QSU A;  4HKE A;  3RKW A;  3CC7 A;  3PMT A;  5LJ3 h;  5LJ5 e;  4X34 A;  2E5Q A;  3M55 A;  2XIC A;  4KT0 E;  2DVE A;  3HRS A;  3JCM d;  4J6W A;  1LJO A;  3FEO A;  3JRZ A;  3OBW A;  1G3T A;  1N6A A;  1V29 B;  4BE2 A;  3JCM Q;  5CVI A;  1WPY A;  1QP2 A;  3JCM f;  3SWN A;  3E1S A;  2DAQ A;  3QBY A;  5LJ5 g;  2LRQ A;  2QQ9 A;  1FWZ A;  4M75 E;  3OYE A;  5LJ3 f;  2LX9 A;  4QVC A;  1RL2 A;  3PFS A;  4BAC A;  4MZT A;  4N4G A;  5CO7 A;  3CME A;  3EAE A;  2XDB A;  1ZBX A;  2EAY A;  2ZZD A;  4PJO A;  5FU6 C;  3I56 A;  1UGS B;  4PLI A;  5LJ5 j;  3V8K A;  4RKU E;  4BB7 A;  3WXM B;  3PT9 A;  3ER0 A;  3X24 B;  4M75 B;  4C8Q E;  1JJ2 A;  1M9S A;  3JAM E;  3CC2 T;  1VQP A;  2RD1 A;  1IZ6 A;  1VIE A;  4EMK B;  4ZGE B;  4ME7 A;  4LD9 K;  2DJZ A;  2RJC A;  2JVV A;  1VQ6 A;  1BIB A;  3GOX A;  3X28 B;  4C92 C;  1VQM A;  4MZM A;  5D6Y A;  4M7A C;  3MEA A;  1Q81 U;  3PTA A;  3C4S A;  2X35 A;  2DEQ A;  1XQH A;  4OF1 A;  4Y91 A;  5GAN g;  3OB9 A;  4MMK A;  4C8Q B;  3JB9 D;  2D0Q B;  1M1K C;  1BI2 A;  2EQM A;  1YIJ T;  2HAX A;  4M75 F;  1VQ9 A;  3E19 A;  3H8Z A;  4QQ6 A;  3M59 A;  3SB2 A;  5A0G A;  1K73 U;  3AHU A;  1WJS A;  4IUV A;  4IUU A;  2GFA A;  3M57 A;  3L2U A;  3RIR A;  2XG8 D;  2DK3 A;  4CI0 C;  2PVD B;  3HPW A;  2NLU A;  1VQ7 A;  1UB4 A;  1YBY A;  3VYH B;  4PJO D;  2E65 A;  1KD1 C;  4II1 A;  4C8Q F;  2RB6 A;  1QVP A;  4RG8 A;  5EG2 A;  3JCM X;  4B9W A;  1WJR A;  1KQS A;  3LGF A;  5M9O A;  1UGQ B;  4XTU A;  5GAO m;  3N5B B;  3EFS A;  2XID A;  4A4G A;  4M7D A;  2K5L A;  2GQV A;  2HQE A;  3OS5 A;  4PJO G;  4IKF A;  5FU7 B;  1I5L A;  3X20 B;  3F70 A;  4OVA A;  4C5H A;  3EFR A;  2OTJ T;  2ZGW A;  4NS5 A;  2HD0 A;  5GAO l;  1VQN T;  2KVQ G;  4DA4 A;  1MGQ A;  1S72 A;  5CKD A;  1XNI A;  1JRI A;  2JTF A;  2RH2 A;  2X4W A;  3MP1 A;  4JLI A;  1UEB A;  4M77 C;  4OGC A;  4EMG A;  2QQR A;  3QZ5 B;  3CCM T;  2EWN A;  5GAO q;  1K9M C;  3KUF A;  1NPR A;  2ZPI B;  5GAM h;  3A8L B;  2EFI A;  2CZ0 B;  4OB2 B;  4DOW A;  3QG1 A;  3LW5 E;  3I55 A;  1WNL A;  1AHJ B;  1Q7Y C;  2BKD N;  2Y4X A;  5J3B A;  1NJI C;  3M56 A;  4M78 E;  2DXT A;  3PNW C;  4JRP A;  1VQO T;  4XAX B;  2QDY B;  3FLG A;  1VQM T;  3CCE T;  4E7K A;  1YHQ T;  1Y71 A;  2LQ8 A;  1BI3 A;  4C0F A;  4LD6 A;  1VQ8 A;  1HXD A;  4F7U E;  2FYK A;  2K3X A;  5GAM f;  2CZ1 B;  2B8A A;  3JB9 H;  2EKO A;  3BW1 A;  1R8O B;  4M78 B;  3DB3 A;  3SFM A;  2JN0 A;  4ELZ C;  3PMI A;  2P0P A;  5I2M A;  4FIB A;  4BI8 B;  5FRM A;  4M7D G;  4C92 E;  4OGE A;  5HY6 A;  3OS2 A;  2CGH A;  3G6E A;  5FU6 B;  4M7A E;  2KK4 A;  2XDD A;  4JJN K;  2F69 A;  3CC2 A;  3J80 E;  2DIG A;  3KBG A;  2L89 A;  4BUG A;  4XTV A;  3C94 A;  2O4X B;  1NJI U;  1I8F A;  2LCL A;  4J6Y A;  2BUD A;  4LDW A;  5KE2 A;  1QW1 A;  3LGL A;  5A0D A;  5GAN 8;  1UGP B;  3OYL A;  3LWI A;  3VUB A;  3CCS T;  4J7F A;  3G71 T;  5HK0 A;  4HT9 A;  1YIJ A;  3S3M A;  2EQU A;  3C95 A;  5KH6 A;  5CR2 A;  4BD3 A;  3UPU A;  1M8V A;  1IRE B;  5GAN 4;  3VU3 C;  1VQK T;  2VC8 A;  1BKB A;  2R58 A;  2EJ9 A;  4XU3 A;  5CKF A;  3TRE A;  4BE1 A;  3QO3 A;  4BY6 C;  4F7U F;  1YI2 T;  2OAU A;  2M16 A;  5GMK m;  3LYI A;  5GAN 7;  3OYY A;  3A8O B;  4E7J A;  1HK9 A;  4C0G A;  1BIA A;  2ZPF B;  1QVF S;  3CBO A;  3CEY A;  2M9U A;  2XU8 A;  3OYH A;  2DD5 A;  3JCM c;  4C92 F;  3M4Y A;  3SDZ A;  3OS0 A;  2E10 A;  1YJW T;  4M7A F;  4JRK A;  3FIF A;  3OYF A;  5GMK l;  5GAN 5;  2PQW A;  4FM4 B;  4M75 D;  4XU2 A;  1JB0 E;  1G3S A;  1KQ2 A;  3LWH A;  1KQS S;  4JRI A;  2RHI A;  2LT4 A;  2QQS A;  5C6S A;  2GFU A;  3J81 E;  2DD4 A;  2PU9 B;  5D6W A;  3SWN C;  3CCR T;  3I55 T;  1N9R A;  2XHC A;  3QUI A;  4M77 E;  3TCJ A;  4EDU A;  1VQL T;  4OMF B;  2OTJ A;  1Y7X A;  4JRQ A;  3RMQ A;  5GMK h;  2CS7 A;  1N8R C;  1VQN A;  4C8Q D;  4LDV A;  5CK9 A;  2PVO B;  4A4E A;  3QZ9 B;  2O01 E;  3OW2 A;  4PJO C;  1VQ8 T;  2K5I A;  1M1F A;  3CCM A;  1ZQ1 A;  4C0Z A;  5HK3 A;  2H3J A;  2V8I A;  2CKK A;  1O9S A;  1NZ9 A;  4DOV A;  4M77 B;  3OYG A;  2KMT A;  3MEU A;  5GAM d;  3GPL A;  4DQ2 A;  3CCU T;  2CYZ B;  3DB4 A;  4ZN3 A;  3URG A;  1K8A U;  1M1K U;  1D3B A;  4C8Q G;  4XTY A;  3OYN A;  4XU1 A;  3X26 B;  3G6E T;  3FJP A;  2D9T A;  2RI2 A;  3TU4 K;  5GAO r;  4FL6 A;  2MWO A;  1KD1 U;  2VV5 A;  2E6N A;  3GF5 A;  3OQ5 A;  1VQO A;  1KG1 A;  1PSF A;  3UDC A;  3ZEH A;  3CCE A;  1G3Y A;  1BI0 A;  4X9C A;  3M54 A;  4B9X A;  5CKH A;  1VUB A;  3OYA A;  1YHQ A;  2E1H A;  4M77 F;  1W4S A;  2QQA A;  4FU6 A;  2QQB A;  4C0D B;  3CXC S;  3QKJ A;  1K8A C;  4JS5 A;  4FSX A;  3DLL A;  4WF2 A;  4E7L A;  3CBM A;  5IAY A;  3OA6 A;  5GMK i;  1OZ2 A;  3CMA T;  5GAN 6;  2HQX A;  3QDR B;  1YIT A;  3CCJ A;  5J39 A;  4IUQ A;  4M78 A;  1B34 B;  3UT1 A;  3P8B B;  4RG2 A;  1QVF A;  3RMS A;  3JB9 G;  1WQ7 A;  2LT1 A;  1WJQ A;  3L2V A;  4ZGD B;  3PIP A;  4BDZ A;  5KCO A;  5HKC A;  1Q82 U;  2A3L A;  2LC4 A;  2LNV A;  4M7D C;  3CC4 T;  5IT9 E;  1I81 A;  2RK2 A;  3FDR A;  2O4X A;  2WSF E;  2R5M A;  2VYT A;  5DM7 R;  3CCS A;  3G71 A;  2P4T A;  3HFN A;  1H3Z A;  3OS1 A;  2QTX A;  4A4H A;  4BI3 A;  1H64 1;  5GAN 3;  1KQ1 A;  1VQK A;  2DIQ A;  4Y28 E;  1K9M U;  2KY9 A;  3VJP A;  3G7Z A;  1Y96 A;  1YI2 A;  3MEV A;  2RHZ A;  2K5F A;  1Q82 C;  5KE3 A;  2G3R A;  3JCM e;  2E64 A;  2FB7 A;  2MI6 A;  3E9F A;  1Q7Y U;  3A8G B;  4O5V A;  2C06 A;  2QXF A;  5LJ3 e;  4ELY C;  4QW2 A;  3GIB A;  3CD6 T;  5LJ3 d;  3BY7 A;  2DTI A;  4M78 D;  1YJW A;  1EIF A;  3MP8 A;  4L59 A;  3QYG B;  5A2Q E;  4RCB A;  3ZFJ A;  3GP8 A;  2DXC A;  5LJ5 h;  3CCQ A;  5GAO n;  3OBY A;  2X4Y A;  5CQY A;  3CCL A;  3CCR A;  2ZPG B;  2DZ9 A;  2CZ7 B;  4GLK A;  2EQJ A;  3JCM g;  3BFM A;  3CBP A;  1VQL A;  5DY9 A;  3HKS A;  2LCC A;  2DPP B;  4M78 G;  1VQ4 T;  3CXC A;  1KC8 C;  2K3Y A;  2KSS A;  2CZ6 B;  1W2B A;  3VV0 A;  1XOV A;  3V8L A;  2MF2 A;  3ME9 A;  5I21 A;  1X01 A;  3OW2 S;  2LTO A;  5LJ5 f;  1N27 A;  1VIF A;  2AHJ B;  4L5G A;  2XKO C;  2E12 A;  4NOY A;  5LJ3 j;  3JCM P;  3FB9 A;  3JSC A;  3CCU A;  4N0A A;  4KBM B;  4XTX A;  2R5A A;  2YHT A;  3DKM A;  3M9Q A;  1YIT T;  3CCJ T;  2RJD A;  5GAN h;  2EIF A;  2FHD A;  4M75 A;  4PLL A;  4F7U B;  2DXB A;  2RI5 A;  5CKE A;  4EMK A;  4C5E A;  5FRN A;  2ZCF B;  5FLX E;  5A0L A;  1U1S A;  2KDS A;  3NFC A;  4PJO F;  2F5T X;  3JCM b;  2V8K A;  3NTK A;  2P0K A;  1RI0 A;  4C92 B;  2QA4 T;  4J5Y A;  4M7A B;  3CMA A;  4RMO A;  4C8Q A;  2OTL T;  4ZGJ B;  1KHI A;  4N4H A;  4JLG A;  3OYI A;  1DJ7 B;  3E9G A;  3HRU A;  4BDY A;  1G5V A;  1OI1 A;  5GAN f;  4HCC A;  3FC3 A;  2D6F A;  2R57 A;  2LQK A;  5DLQ E;  4M7D E;  2HBP A;  3M53 A;  3JCM V;  2DZC A;  5I2S A;  4MDX A;  4M77 D;  3GNG A;  3JB9 J;  4E7I A;  1N9S A;  3QJY A;  5GAN 2;  3HHT B;  5GAO p;  3L2W A;  1N8R U;  3LH0 A;  3CC4 A;  1ZHI A;  4GY5 A;  2YLC A;  4J8O A;  2XDP A;  4FT2 A;  3CCQ T;  4NL3 A;  5FU7 C;  3CCL T;  3L1A A;  1Q86 C;  2DO3 A;  1YJN T;  2JZ2 A;  1QVG S;  3ASK A;  3C12 A;  1VQ5 T;  3R6O A;  2WSE E;  2X4X A;  2L5Q A;  1X75 C;  2WAC A;  2YRV A;  2XD0 A;  3V7C A;  3RKY A;  4M75 G;  4A4F A;  2QEX T;  3CPW A;  5CIU A;  2FL7 A;  2L3R A;  3HP9 A;  4NL2 A;  2WSC E;  2DXU A;  3CD6 A;  3RKX A;  2DTH A;  2VGN A;  4M7D F;  4C5I A;  1OYX A;  5GAM e;  1NE8 A;  3HFO A;  4N4I A;  1JBM A;  5LJ5 d;  2IVW A;  4A4K A;  1XTD A;  2RJF A;  2Y90 A;  2E41 A;  4OB0 B;  3PIO A;  3OMC A;  5KCH A;  1M5Q 1;  2EQK A;  2DTO A;  1M90 C;  1G3W A;  2EJG A;  2RA2 A;  1VQ4 A;  2VUB A;  2A7Y A;  4XK8 E;  3SD4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...