4Y91A

Crystal structure of a thermotoga maritima hfq homolog
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
66
structure length
66
Chain Sequence
FNLQDRFLNHLRVNKIEVKVYLVNGFQTKGFIRSFDSYTVLLESGNQQSLIYKHAISTIIPSSYVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Thermotoga maritima Hfq homolog
rcsb
source organism Thermotoga maritima
molecule tags Rna binding protein/rna
molecule keywords RNA-binding protein Hfq
total genus 14
structure length 66
sequence length 66
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2015-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4y91A00
4A54A 5GAN4 4RCBA 2EJFA 2QTXA 4M78C 4WF2A 3SWNB 2DTHA 3RKYA 4PJOB 4C92D 3QUIA 1HXDA 3JB9D 1JRIA 5GAMh 5GAN8 5GAOm 1I5LA 4DQ2A 2DTOA 3JCMg 4HT8A 2VXFA 4PJOA 5LJ5e 3BFMA 1LOJA 5LJ3j 4M78G 3JB9H 4M7AD 4X9DA 2CGHA 4PJOC 4M78E 1LJOA 2YLBA 5LJ5f 3HFNA 5GAOl 1B34B 2EAYA 4C8QG 5GAOn 2HNIA 4M75B 2DZCA 3L1AA 3JB9J 4Y91A 3EFRA 1Y96B 3AHUA 4M77G 5LJ3d 1N9RA 1YCYA 2K57A 3FJPA 4XU0A 4C92C 2DXUA 1BIAA 1JBMA 3BY7A 4M78A 4C8QE 4C92G 3JB9F 4PJOE 5GAMd 3V7CA 4M7DG 3JB9I 4C92F 5LJ3e 4M7DC 2RA2A 5LJ5g 4NL3A 3QO3A 4M77A 5GAN3 3JCMV 4PJOD 3BDUA 4M77C 4M7AB 5GAOr 2DTIA 2DJZA 3M4GA 5CAIA 2E1HA 4XU1A 4F7UF 4QVCA 1WQ7A 4JRIA 1D3BA 1KQ1A 4MMLA 5LJ3f 2YHTA 4F7UA 4QVDA 4F7UG 3L2ZA 4X9CA 4XU3A 3JCMQ 1I8FA 4JRKA 4JUVA 1M8VA 5LJ5h 3QSUA 1Y96A 1HK9A 1BIBA 5DY9A 4M77F 4M78D 5GAMe 4XTVA 4C92A 3JCMb 5GMKe 5GAN2 2VXEA 4XTXA 5GANg 1B34A 5GAN6 5GMKh 3JB9G 3JCMP 4M77D 4M78F 2E41A 2JN0A 4OP0A 4V2SA 5I21A 4M7DA 3JCMX 3RERA 4XTZA 3SWNA 3JCMJ 2DXTA 4HT9A 4C8QD 1LNXA 4N0AA 3HSBA 2EJ9A 4N0AC 4NL2A 5GAOp 4M78B 4EMGA 1U1SA 3VU3C 5GAN5 2E10A 3JCMh 4J6XA 5GMKm 2EWNA 4J6YA 1N9SA 3FIFA 4PJOF 4EMHA 3V8JA 4XTWA 4M7DF 4XQ3A 5GAMj 1H641 2FYKA 5GANe 1WPYA 4XTUA 5LJ3h 4PJOG 5GMKl 3GIBA 4XU2A 3V7RA 5GANj 5GANf 3JCMd 3JCMc 5LJ3g 4M7DD 1X01A 4C8QC 5GANd 4EMKB 4M7DB 3EFSA 3SWNC 2RD1A 3V8LA 2I2LA 1I81A 4JLIA 5GMKj 3RUXA 4M75F 5LJ5d 5GAN7 2E64A 5GAOq 4EMKA 4HA8A 3RIRA 1I4K1 1WNLA 4M7AA 1WQWA 2VC8A 4EMKC 2DVEA 4J6WA 4M75D 4C92E 3PGGA 4F7UB 4NOYA 1M5Q1 1MGQA 5GAMg 3JCMf 3BW1A 4C8QF 2DZ9A 4C8QB 4M75E 5GMKi 3JCMW 5GAMf 2DEQA 2RB6A 4MMKA 4C8QA 2DKGA 5LJ5j 4M7DE 1D3BB 2E65A 4M7AE 3V8KA 5GANh 2EJGA 3HFOA 3RESA 4PNOA 3RKXA 1TH7A 3INZA 4M77E 2FB7A 2ZGWA 3QHSA 1KQ2A 4M7AF 4M75G 1U1TA 3JCMe 4A53A 4M75C 4M77B 4M75A 4M7AC 4RCCA 3RKWA 2Y90A 4M7AG 3V7SA 4XTYA 4F7UE 4J5YA 4C92B 3FB9A 3SB2A 2YLCA 2RM4A
chains in the Genus database with same CATH superfamily
2ROTA 2LX9A 2CSQA 4OMFB 1Q7YR 4A63B 4JPBW 2HKNA 3M58A 2MIOA 2B8AA 1ZHIA 2DTOA 2FEIA 5LJ5f 2FPFA 1F1BB 2DERA 3UA6A 1O9SA 1UJ0A 2EBPA 1W2BP 4C8QE 2PVOB 3L2VA 3H9NA 2ZZDA 4C92F 3OS0A 1G83A 1T0JA 2DL5A 4OB1B 5CK9A 3M4GA 4MZPA 3FLGA 4JRIA 4L5GA 1UUEA 3VS6A 3PE0A 2E6ZA 4CC7A 4XU3A 4AG1C 5AYFA 1BIBA 5J3BA 1VQOA 1KIKA 1QVFA 2VXEA 1CSKA 3CC2A 2E41A 9ATCB 4XTZA 4Q5WA 1VQNA 1WGSA 4HVWA 1YWPA 2JS0A 4D8DA 2M1HA 4DBQA 4WCIA 2GCXA 1WDXA 3C95A 2Y4YA 3JCMd 2IPOB 3SFMA 3TREA 3OYNA 1JQQA 1EFNA 1WYXA 1C6VX 1SHGA 2SEMA 3PFSA 2DE0X 4FT2A 1M4ZA 1WQWA 1OU9A 2JW4A 2LQWA 3HRSA 4B9WA 4ZGDB 2G3RA 1U3OA 3PTAA 4OB2B 2KAFA 1K73R 1UHFA 2LNHB 3TCJA 2X4WA 3INZA 4HVUA 4LDUA 1WXTA 1VQ7T 1JJ2P 1BCMA 1NYFA 1SPKA 4LXCA 2KDSA 1PNJA 3CCEQ 4F7UE 5KYWA 2K3BA 2WSFE 1M90R 3QG1A 3SWNB 1UB4A 3R6OA 2XKOC 1IO6A 2F2WA 5FRNA 4FU6A 2RO0A 4OB0B 5KE3A 4PJOA 4M7AD 2YLBA 3OS2A 4AG2C 3JSCA 3EGXA 1U06A 4B9XA 4XAXB 1K9MR 2QEXT 4M7DF 2HQHA 1BIAA 3I55T 2C0TA 3JB9F 5D6WA 3S6WA 4BE2A 3UF4A 1C1AA 3OQ5A 4NL3A 1N8RU 2KY9A 4A4FA 4C0FA 3L2RA 2E12A 1ARKA 3E2UA 2KE9A 4DOVA 2EKOA 2LRQA 3CBPA 3M4YA 2PUOB 2V8IA 3CCJQ 1QVGP 2KT1A 1RLQC 2QEXQ 1Y96A 1BYMA 4E7IA 1M1GA 1X2KA 2NWMA 1B34A 5FWCA 2DBKA 5KYUB 1WXBA 1T3LA 3OSSC 3RERA 3BDLA 4OF1A 3SWNA 4A4EA 3FDRA 3CMET 4BI8B 5LL6S 1LNXA 2HL3A 2J6OA 3VU3C 1TUCA 2HZYA 2DX1A 2D1XA 2JMCA 3I9QA 2H3EB 4EMHA 2D9TA 3UPUA 1KD1C 4EMKB 1AHJB 3I56T 3FEOA 2EYYA 4PJNA 1FMWA 2J06A 1GRIA 2X4XA 3RIRA 2VVKA 4J6WA 4A4GA 4VUBA 2KEAA 1W1FA 2QQ9A 2DETA 1BK2A 1NEBA 1K1ZA 2RF0A 3O8VA 4QQ6A 3RESA 8AT1B 3THKA 2NUZA 4M75C 2EQIA 1W2BA 3QDRB 4RCCA 3GF5A 5CQYA 3HSBA 1FMVA 3H0IA 2RM4A 2LNVA 2CP6A 4OMLA 4RTYA 3CMAA 4PJOB 1YJNQ 3GNFB 2FZGB 4J9BA 1ACMB 3I56Q 1I5LA 4DQ2A 2JUFA 3OYCA 3E1SA 4IIOA 1X27A 2KXCA 3CD6A 1OX8A 4E7JA 3RMQA 1ZLMA 3A5ZB 1VQ4Q 1ZSZC 2C0IA 4JJBA 2XDPA 2EGAA 4E6RA 3U23A 5A0DA 5LJ3e 4LN2A 3PVLA 2ATCB 1Y07A 1D3BA 1QMCA 2LCLA 2VUBA 3X20B 1N27A 1I8FA 4PFPA 2NUPB 2P84A 2RQRA 4HKEA 2KR3A 2GTOA 1YITQ 1K8AC 1JU5C 2FHDA 1M90U 4N0AA 2ESWA 1G3WA 5KYYB 3CC7T 2KYBA 3QZ5B 4J7IA 3FIFA 5HCKA 1M1FA 4KRTA 2JMAA 2HBPA 1KQSA 1TUDA 2KSSA 2ABLA 2NUTA 2V1QA 2PQWA 1HD3A 3OYIA 4HA8A 5I2MA 1I4K1 2ZPIB 1E6GA 4OMOA 4E7LA 3QZ9B 2DEUA 1M5Q1 1MGQA 4HCZA 1HJDA 1VQPA 2FVUA 2DM1A 4MMKA 1S72A 1Q86R 3V8KA 4JJCA 4RKUE 1OV3A 4MDXA 1UTIA 3TVTA 1Q81U 2O9SA 4OGCA 4PK4A 2EJFA 4M78C 5KE2A 1NLOC 1BCOA 2QTVA 1U5SA 5GAN8 3QJ6A 3CMEQ 2DXBA 3A8OB 3PMIA 1VQMQ 1VQ5T 2RPNA 3CCQT 2K2MA 3OY9A 3PMTA 2Z0WA 2P0QA 1YCYA 1VQKT 3ZFJA 1MMDA 1OULA 4RG8A 4M7DC 2HCKA 1ZSGA 1Z9ZA 2P4RA 3QJYA 2KROA 3I5RA 2DJZA 1M9SA 2E1HA 1X69A 2DIQA 3OA6A 4LDYA 1WFWA 2CH4A 2YHTA 4QVDA 1W2BS 3X25B 2HBWA 1K73C 2K9GA 2BZYA 3EGUA 4XTVA 3URGA 5GAN2 4EPCA 4F14A 2V26A 4M77D 2JN0A 5IN1A 3ASKA 1VUBA 1M90C 1YJ9A 2DL3A 2DRKA 2J6KA 2PNIA 2K6DA 3RMSA 1I1JA 3RR6A 3ZL7C 2EWNA 1RAIB 1H3ZA 5A0GA 3TSWA 4C5EA 3LWIA 2L5QA 2QQBA 2DXCA 2CKKA 3PIPA 1X01A 1AWXA 4KGZB 4JLIA 3SDZA 2LTOA 4J9IA 3CQTA 4FYYB 1VIFA 5FWBA 1KQSP 1QWFA 1TU0B 2XDBA 3G4SA 1RACB 1B7TA 3OYKA 5FU7C 3NGPA 3EAEA 2XIDA 3REBB 2K3YA 1YJWQ 4LDVA 1YHQA 4R56A 2LCSA 4PFZA 1UGQB 2QQRA 4BB7A 1RI0A 2CP5A 1U1TA 4M77B 1V29B 1OOTA 2GFAA 3OS5A 4XTYA 1UEBA 2MMPA 1KC8C 2RI3A 2LQ8A 2DFUA 3CMAQ 3F70A 1V76A 4ZN1A 3VV0A 4HT8A 4IUQA 4XK8E 1LOJA 4PJOC 3Q1JA 1JXMA 2AK5A 3G4ST 2HMAA 2EAYA 1MMNA 3CMAT 4PJMA 4E7ZA 2K57A 4C92C 1UHCA 4OMNA 3S3MA 3SEMA 4M7DG 3CPFA 1PRLC 5LJ5g 2XMFA 1LCKA 3VS2A 2X3XD 4ZN3A 4M7AB 5GAOr 2AT1B 3GNGA 4F7UF 2ZPBB 2RQUA 1U8RA 2DK3A 1Q81R 2P4TA 1K4US 5GMKh 3VS5A 3CCQQ 1PD0A 1VQMT 2KI7A 1VQ5Q 3MKDA 1OX9A 1NJIU 1AWJA 3CC4T 2LJ0A 3M0TA 2DO3A 5HY6A 1VQNT 1WJQA 2V8JA 2XG8D 1D1BA 1H641 2MOXA 5LJ3h 5GMKl 4LUDA 1CKBA 3CCQA 2D0NA 1QCFA 1VQLT 5LJ3g 5FROA 3NTIA 4C8QC 2P0PA 5KYUA 1OPLA 1WZOA 3SWNC 1IHVA 2LJ3A 4IIMA 2AHJB 1SRMA 2BE7D 3EG9A 4DBHA 1NM7A 2AIRB 3N5BB 4M7AA 3M0UA 4GY5A 2CP7A 3OS1A 2MCNA 2RHZA 1T3SA 3CCUT 4QQDA 2OJ2A 1EZZB 1WI7A 2NUPA 5GAMf 2L3QA 2JS2A 1VQ9Q 4J7FA 1WLPB 2K7AA 2EQMA 2C0OA 2O88A 3L42A 2O9VA 2X35A 4PJLA 4Y28E 1QLYA 3CCVT 3OYBA 3DKMA 4A54A 5GAN4 2XICA 5EG2A 2DTHA 1SRLA 2O4XB 4E47A 3M55A 4PFOA 2EW3A 3JB9D 2DIGA 4QT7A 5GAOm 5IXBA 4J9DA 1K76A 3M0QA 2ZPHB 2G6FX 4M78G 1H92A 3OW2A 2VKNA 2FRYA 1SG5A 1AWWA 2CYZB 2A37A 3EG2A 1YHQQ 3D7SB 4E7HA 1W70A 3JAME 4N4GA 3V7CA 2D6FA 1P92A 1WHKA 3I55A 3LWHA 1RABB 4OVAA 1AWOA 5KYXB 3A8GB 1YCSB 3SD4A 4JUVA 1VQ4T 2J7IA 2EYXA 4QKUA 3HRUA 1BI1A 1ZA2B 2LT4A 1KG1A 3JB9G 3G4SQ 2ROLA 1NJIC 3ER0A 2LQNA 4JZ4A 2ZPEB 2OTLA 5CKFA 4AFUC 2EJ9A 1H3HA 2FZKB 1KK7A 4TVRA 4NL2A 1YFNA 4M78B 4C0GA 4IUVA 1AD5A 2JXBA 1VQNQ 5FLXE 4RMOA 3G6EA 3MO8A 1C0MA 3R6NA 2QI2A 3EFSA 4A4HA 2KXDA 1I81A 3GLXA 2K5IA 2LC4A 5D6XA 4JDSA 1VOMA 1WX6A 4EDUA 2MAMA 3PGGA 4F7UB 1NE8A 4Z89A 2DILA 2YRVA 1LVKA 2E5QA 3ULRB 2EFIA 1UDLA 1PRMC 3JV3A 2E65A 4QVZA 3I5SA 3RKXA 2EPDA 1IB8A 2YT6A 4A53A 5KCOA 1VQMA 3EGDA 3MJXA 3RKWA 3J80E 1D1CA 5CKHA 2JTEA 4BDZA 2K5FA 1YIJQ 1FMKA 1R0CB 2LQKA 2E70A 1UJYA 3KFVA 5IAYA 3QIIA 1ZUUA 3BFMA 3LGFA 2JT4A 4DA4A 3LGLA 5CVIA 4C8QG 4FW2A 5GAOn 2L3RA 4LNPA 3OMGA 5HKCA 1S72Q 5GAMd 3C12A 2NUTB 3MEWA 3REAB 1BBZA 4E7SA 1VQPQ 2QA4T 1YITT 1PSFA 4KGVB 2DA9A 2ZCFB 3H0HA 2CSIA 5DY9A 4RTXA 1NPRA 4FW1A 1IGUA 5GMKe 4BE0A 2F2VA 2PUKB 3JCMX 4BI4A 5C6SA 3CC7A 2CT3A 4RTVA 4C8QD 2K3XA 3CCMT 4C5GA 1SSHA 2FG0A 5J39A 2CUBA 2COWA 3HKSA 4J6YA 1N9SA 4ZGJB 4PJOF 1VQLQ 2OTLQ 1UE9A 1ZQ1A 2A7YA 2FYKA 1WPYA 3RBBB 1GBQA 4IUPA 3CCMQ 4HCKA 3VS0A 1YBYA 1Y7XA 1BU1A 5I22A 2DD5A 5GANd 1B3QA 1UG1A 1W6XA 3H41A 4EMKA 1K8AR 4EMKC 4LE9A 3M0SA 1M1KU 2KRSA 1PKTA 2RQWA 3OYMA 3JCMW 5IXFA 2LP5A 2CT4A 2KMTA 3HRTA 2CDTA 2YUOA 1MV3A 4GBQA 3VUBA 2EJGA 4PNOA 2RI5A 2QDLA 3QHSA 1S72T 2JNGA 5FRMA 2EYWA 4O6JA 1BI2A 3CBMA 1YI2T 3I55Q 3CCSA 3QYHB 4ZNXA 2L89A 4JZ3A 4WF2A 1Y0MA 2LX7A 2LVMA 3M59A 5KYXA 5GAMh 1EX4A 5LJ5e 2LCCA 2E6NA 5GAOl 3EG3A 2ENMA 3P8BB 3UWNA 2GGRA 1YWOA 3JB9J 3VRYA 3OSVA 1VQ9A 2F1LA 3JB9I 4BY6B 2IIMA 5ECAA 4BUGA 2YXYA 2HSEB 3EH2A 4B6MA 4E7KA 4F7UG 4JRKA 4GLMA 2DAQA 3CXCA 3MCAB 3PNWC 2PZ1A 1JEGA 1JXOA 3CEYA 5CKBA 3JCMP 2FO0A 2VASA 3J81E 2HD0A 4BD3A 3MP8A 3EGXB 2HAXA 2DL7A 3TEEA 5GAN5 4PLLA 3CCLT 4FM4B 4AMCA 2CZ0B 3CCVQ 2RK1A 5GJWB 4PL6A 1KC8R 5GMKj 2DL4A 1M2OA 5GAN7 2VC8A 2DVEA 3M53A 5KYWB 3PT9A 1NPPA 3UA7A 1VIEA 2HQXA 5FU7B 3CCLA 1D3BB 4FCYA 4R55A 4CI0C 4M77E 4DEXA 1R0BG 1M2VA 1D0ZA 1E7OA 4C0DB 1G8XA 4EIKA 4LD6A 1AVZC 2CP0A 2A08A 4FYWB 3OW2P 2D0QB 2D8HA 3A8MB 1I07A 2CUDA 1SSFA 4GLKA 3FJ5A 2HNIA 4M75B 4Y91A 1Y96B 2KT8A 3BY7A 7AT1B 1QP3A 3DLMA 4KH0B 2COYA 3X26B 4N4HA 2RA2A 3CCSQ 1N8RC 3JCMV 3CCEA 3QBYA 4QVCA 5LJ3f 1WHMA 1WHHA 1QVGS 3EHRA 4KH1B 3PIOA 1YI2A 2YSQA 2H8HA 1V1CA 3TSZA 1GCQC 3VS1A 1VQKQ 2E10A 3JCMh 2ED1A 2SRCA 1NLPC 4KT0E 1QCOA 3CPWP 5L23A 2QQSA 2JTMA 3GIBA 4AFQC 3CCMA 1KD1U 3A98A 2RD1A 1VQLA 3CC4Q 3MP6A 6AT1B 2EYQA 1H8KA 4M75F 2EGEA 3P8DA 5EC7A 2QQAA 4QW2A 3MP1A 2M16A 1TTHB 1QQJA 1QKWA 2LZ6B 1WJRA 1GL5A 4M75E 4DOWA 2QYZA 3OYYA 5CR2A 2DKGA 5LJ5j 1VQOQ 1Q82C 2PVDB 3MEAA 2E3HA 1KQ2A 4M7AF 3CXCS 1ZBJA 1TS9A 4LDWA 2EKHA 2QK0A 2DF6A 1K0SA 4RCBA 2QTXA 2RHYA 3VS7A 2MPXC 2IVWA 2RHUA 4OB3B 3H0FA 2HQEA 3SHWA 1SHFA 5KH6A 4FL6A 1VQ6A 4L6V5 1XJWB 1QWEA 1LJOA 2F69A 3C0CA 1B34B 2L2PA 1X6GA 1M3BA 1LPLA 1VQ6Q 3CMEA 3CPWS 1YJNT 4ATOA 2OX7A 4M77G 4CC2A 4M78A 2M9UA 1NG2A 3QO3A 1YIJA 1PSEA 1HYOA 5CCAA 2J6FA 2Y4XA 1YJWT 2RMOA 4F7UA 1EIFA 2YRDA 1I5OB 1M3AA 1RADB 1JO8A 2M51A 5CO7A 1ZUYA 1FWZA 2LT1A 2ZPGB 3JCMJ 2O31A 4HT9A 2EQUA 3I35A 2X51A 4FT4A 3H6ZA 2K79A 1NZ9A 1VYTA 1M8MA 4PJOG 2OTJA 1PC0A 1Y57A 2VYTA 3JCMc 2DMOA 1WHGA 2M0YA 2RJDA 1G2BA 4CC4B 3QKJA 3OW2S 2RNAA 1VQKA 1N5ZA 3CCRA 1WIEA 2GQVA 1NJIR 3CCET 3LX7A 1VQ7Q 4C8QB 1T0HA 1DJ7B 2KNBB 1R77A 1MNDA 3ZBDA 1G5VA 1Q82U 1UGVA 4JS5A 1NEGA 5GANh 1VQOT 2C06A 2F2XA 3FRNA 1KHCA 1IZ6A 1TG0A 1Q81C 3CC2T 1VYVA 2Y90A 3OYEA 3I56A 4J9FA 1ABOA 3VS3A 4ANJA 2E5KA 1RLPC 2GTJA 2YUPA 2RK2A 2O4XA 3OB9A 4MZTA 1MNEA 2NLUA 1BKBA 2VGNA 3A1PA 4J9HA 3T9NA 4C0DC 3L2UA 2GNCA 4C5IA 3G71A 5LJ3d 1GXIE 2CREA 1N9RA 1JBMA 1PD1A 5CKEA 1D0XA 2BZXA 4M77A 5DLQE 4PJOD 1YNZA 2COZA 2EQJA 5HK3A 4ZTFA 1FYNA 2RJFA 3M0PA 1KQ1A 1M8VA 1NYGA 1WHJA 3CC4A 4M78D 5A0LA 2DJQA 1JB0E 1IREB 2QA4Q 4OGEA 2CP3A 3CD6T 2DYIA 3G71T 2RJEA 2HKQB 4IURA 4AT1B 2LJ1A 2JJ9A 1D0YA 1RL2A 1MMGA 2E4HA 3M5AA 4HVVA 1X2QA 4XTUA 1VQ8A 2OI3A 5GANj 5GANf 3EG1A 4M7DD 3A8HB 3CCUA 2FZCB 4DBFA 1M3CA 3M57A 2QEXA 2F5TX 4JS4A 3CCJA 1GFCA 3C94A 3L2QA 4RTZA 1Z9QA 2MWOA 2QGFB 1J3TA 1YIJT 1IRXA 3JCMf 1VQ5A 3RNJA 2RB6A 4JJNK 3WXMB 4C8QA 1RAGB 1PHTA 3OYAA 4CRIA 2RHIA 4PLIA 1UFFA 4LDXA 3CCST 5A2QE 4M7AC 1YP5A 3HTRA 2DVJA 2QXFA 1JJ2A 1W4SA 3MPUB 5D6YA 4C92B 4X1VA 2YLCA 3E9GA 3MHXA 3SB2A 1QVFS 5FU6C 2X4JA 3EG9B 2WSEE 4E2FB 1QVGA 2JTFA 3JCMg 4BACA 3M56A 1O75A 5LJ3j 3NFCA 3NMZC 2R58A 1X75C 3MEVA 2DYBA 2KQWA 2NYSA 1BI3A 2V8KA 4RTTA 4Z8AA 1OU8A 2JM9A 2MYSA 3OYFA 1WHLA 4DBRA 1RI9A 5GAN3 4KUIA 2QAZA 2WSCE 1S1NA 2YUNA 2FRWA 5CAIA 2A3LA 2H3JA 1UGPB 1Q82R 1PKSA 3JCMQ 1RAAB 2W10A 3TQ7P 5IHNA 3QYGB 5GAMe 1X6OA 2LMJA 2O2OA 4L59A 1K8AU 2CH4W 5I21A 4P5NA 1RAEB 3QPHA 2QASA 2PU9B 4EMGA 4JJDA 3QDFA 4HCBA 1YHQT 3HP9A 1I0CA 3NPFA 5KCHA 4XTWA 4Y92A 4XQ3A 3OYLA 2BTTA 4XU2A 1XNIA 3G1JA 2AZSA 3FC3A 3AT1B 3V8LA 2K5LA 2L3SA 5GAOq 1XOVA 1GCQA 2ZAEA 1GFDA 1FX7A 3VS4A 4K11A 5L8RE 3UATA 4M75D 5AT1B 1TXQA 5GAMg 2DZ9A 2FL7A 2L8DA 4QQGA 2XK0A 2XU8A 2M02A 2DL8A 4OMQA 1K9MU 3O5ZA 5CKDA 1UGRB 2GFUA 2QDYB 1WA7A 4M7AG 1ZUKA 4Z88A 3OMCA 4BY6C 2RN8A 4X9CA 2R57A 1ZSZA 3C4SA 1QW1A 1G3YA 2B86A 3VUZA 2P0KA 1M1KR 2XDDA 1IGQA 1K9AA 4ESRA 3WVEB 1MV0B 4M78E 4CC3A 3G6ET 3OYJA 3S3NA 4ME7A 4Z02A 4F04B 2BE9B 1KQSS 5GANg 1HSQA 2DXUA 3L2WA 2HL5C 2KYMA 1IXDA 5M9OA 3BDUA 4JRPA 1AZGB 3DLLA 4ELZC 2EVRA 1Y71A 1TWBA 1WQ7A 2I0NA 3CCRQ 2K2VA 1K73U 1OI1A 3JCMb 5IT9E 1JJ2S 5DLOA 4HCCA 4WTOB 4V2SA 4M7DA 1BI0A 5GAOp 2YDLA 2OAUA 3ZEHA 5GMKm 1N8RR 1TOVA 5GANe 3CC7Q 3V7RA 2KK4A 4FSXA 3EH1A 1PWTA 2I2LA 4KBMB 3KUFA 2IG0A 2E64A 1G3TA 1WNLA 1MMAA 1TUGB 2M0OA 4NOYA 2YWWA 3EFOA 1QVPA 3BW1A 3EHQA 4C8QF 5GMKi 3LW5E 4AFZC 1YITA 5CQXA 1AOJA 2DPPB 2AZVA 3CCJT 4AFSC 3VJPA 3DB4A 1SKUB 4J8OA 5CIUA 1TSFA 1K9MC 1BB9A 3OBYA 4M75G 5HK0A 4IKFA 1KFZA 3V7SA 3JRZA 2VWFA 1KC8U 2JOYA 1ABQA 4A4KA 3LH5A 1VQ6T 4J9GA 1VQ4A 3PVQA 2CS7A 1QP2A 1JRIA 1UECA 2XHCA 3CD6Q 1E6HA 3OBWA 2CGHA 2YRCA 3HFNA 3QWYA 2KGTA 2DZCA 3L1AA 2OTLT 2RJCA 2RQTA 2KRNA 3FJPA 4C92G 1YJNA 4NS5A 4PJOE 2KBTA 4JLGA 3KBGA 2EIFA 4M77C 2X9HA 3J7AF 4IUUA 4PKCC 2CZ7B 3CPWA 2HEQA 3QSUA 4M77F 2JZ2A 3ME9A 2PVGB 2RHXA 4RUGA 3X28B 4C92A 1XQHA 1AZEA 4XTXA 4F16A 1X6BA 3RDVA 4ORZA 4OP0A 3G6EQ 3A8LB 5DM7R 2R5AA 2DXTA 3META 1RAHB 2RI2A 1X43A 2XI9A 4M4ZA 1Q7YC 4BE1A 4RTUA 2OTJT 3HHTB 1AEYA 3V8JA 2L3PA 2DD4A 5GAMj 3BE3A 1YI2Q 2J05A 3S3OA 3GP8A 2DNUA 1B07A 3M54A 3E9FA 2JVVA 2A0FB 1OEBA 5FW9A 4DEYA 3NHNA 3LYIA 3CCRT 1ZBXA 2MI6A 2VGMA 1SF9A 4LD9K 4M7DE 4M7AE 4X34A 1PG5B 4J83A 3OYHA 3JCMe 1KD1R 4PJJA 4J5YA 3OYGA 4UC4A 1D1AA 3G7ZA 1N6AA 3RKYA 3OYDA 1QKXA 4C92D 3QUIA 1HXDA 1OQKA 3LH0A 1GBRA 4KULA 3NTKA 5GJVB 2EQKA 3GOXA 2W0ZA 3JB9H 3KXTA 2BZ8A 2FPEA 2JM8A 3TU4K 3VKIA 8ATCB 1NBEB 1PCXA 3EFRA 2E3IA 1XTDA 1Q86U 1M27C 1ZSZB 3CCLQ 2MK5A 4LUEA 4R0KA 2GF7A 4YTLA 4FIBA 4ELYC 1M2VB 3UT1A 1RAFB 1MHNA 4XU1A 1IHWA 4F17A 2WACA 4C5HA 5KYNA 2ZPFB 1HK9A 1OZ3A 1OPKA 2OAWA 3CCUQ 3VRZA 2EYZA 2AKLA 3CCVA 4M78F 5IHIA 4KUDK 1OYXA 2F5KA 1KJWA 1U1SA 4FSSA 1VQ8T 1Q7YU 1PM3A 2YUQA 2VB6A 2QA4A 5FU6B 3HL8A 1KSWA 4OMPA 4MZMA 1WXUA 1VQ8Q 4HXJA 2HDAA 3WVDB 4D6WA 2DBMA 2QG9B 2O01E 5LJ5d 3H8ZA 4N4IA 1ZA1B 2FPDA 4II1A 3UDCA 1QVFP 4RG2A 2AKKA 2LDMA 1YJ9Q 2EGCA 4ZGEB 3CC2Q 3VYGA 1D09B 5I2SA 1WJSA 4KGXB 1VQPT 3IQLA 2KRMA 1A0NB 2MWPA 3HFOA 1VQ9T 2ZGWA 3QXEB 1Q95G 1VYUA 4M75A 4OMMA 1QCNA 3EFOB 3CBOA 1TH7A 3FB9A 4MDWA 3CXCP 2PTKA 1MUZA 2A28A 3G71Q 2ECZA 3DB3A 2VXFA 1VA7A 5IHKA 2R5MA 4X9DA 2K4YA 3HPWA 4C0ZA 4BDYA 3P8HA 1GCPA 2VV5A 1M30A 1Q86C 3AHUA 4RTWA 1YJWA 1FXXA 4XU0A 2QGGA 1G3SA 1OZ2A 1ZX6A 2BIVA 2ED0A 3X24B 4ZTJA 2DTIA 3EG0A 1R8OB 2CZ1B 5KYYA 3GPLA 2BKDN 1UGSB 1KHIA 4MMLA 2RH2A 3L2ZA 2HSPA 5LJ5h 2CZ6B 5D7UA 5C0MA 2A36A 1YJ9T 5GAN6 4O5VA 1VQ7A 4JRQA 2GBQA 2X4YA 1K0XA 4N0AC 2DRMA 1AT1B 4FYXB 4J6XA 2XD0A 1CKAA 4J9CA 4BI3A 3QWXX 3EGDB 3LLRA 2OTJQ 2MF2A 4M7DB 2BUDA 3RUXA 5J26A 2RQVA 1SEMA 3M0RA 2GQIA 1M1KC 4D8KA 3E19A 4C92E 3M9QA 4J9EA 3NTHA 3GBQA 1YN8A 3VYHB 2DEQA 5I11A 2DLPA 2V1RA 1RUWA 2KVQG 3MEUA 2FB7A 5IH2A 2D8JA 4FYVB 2X3WD 2CP2A 2L0AA 4IUTA
chains in the Genus database with same CATH topology
2R57A 2LX9A 2RI3A 4LD6A 3C4SA 1QW1A 1G3YA 2LQ8A 4OMFB 3VUZA 2P0KA 3F70A 2D0QB 2XDDA 3M58A 2B8AA 3A8MB 1ZHIA 3WVEB 4ZN1A 1SSFA 2DTOA 3VV0A 4HT8A 4IUQA 4XK8E 4GLKA 1LOJA 4PJOC 3Q1JA 4M78E 5LJ5f 3G4ST 3G6ET 3OYJA 3S3NA 2EAYA 4ME7A 4Z02A 2HNIA 4M75B 3CMAT 4Y91A 1Y96B 1KQSS 2K57A 1O9SA 4C92C 5GANg 2DXUA 3BY7A 3L2WA 4C8QE 2PVOB 3L2VA 1QP3A 3DLMA 3S3MA 4M7DG 3CPFA 3X26B 2ZZDA 4N4HA 4C92F 2RA2A 5LJ5g 5M9OA 3OS0A 1N8RC 3JCMV 3CCEA 3BDUA 4JRPA 4ZN3A 4M7AB 5CK9A 4OB1B 3GNGA 3DLLA 5GAOr 3M4GA 4ELZC 4F7UF 1Y71A 2ZPBB 3QBYA 1WQ7A 3FLGA 4JRIA 4L5GA 4MZPA 4QVCA 2K2VA 2E6ZA 5LJ3f 4XU3A 1K73U 1OI1A 5AYFA 1U8RA 2DK3A 4M7AA 1BIBA 5J3BA 1VQOA 1QVFA 1QVGS 3JCMb 5IT9E 2P4TA 2VXEA 1JJ2S 5GMKh 5DLOA 3PIOA 4HCCA 4V2SA 1VQMT 2E41A 1YI2A 3CC2A 4M7DA 4XTZA 4Q5WA 1NJIU 1VQNA 1WGSA 3CC4T 1BI0A 2M1HA 5GAOp 2DO3A 2E10A 2OAUA 5HY6A 2GCXA 3JCMh 3ZEHA 5GMKm 1VQNT 1WJQA 2V8JA 2XG8D 4KT0E 3C95A 1H641 5GANe 5LJ3h 5GMKl 2QQSA 2JTMA 3GIBA 2Y4YA 3V7RA 3CCQA 2KK4A 4FSXA 1VQLT 3JCMd 3CCMA 5LJ3g 3SFMA 5FROA 3NTIA 4C8QC 1KD1U 2P0PA 3TREA 3OYNA 3SWNC 2RD1A 4KBMB 2I2LA 3MP6A 1VQLA 2AHJB 2EYQA 3KUFA 4M75F 2IG0A 2E64A 3P8DA 1G3TA 2QQAA 3PFSA 1WNLA 1M4ZA 1WQWA 3N5BB 4FT2A 4GY5A 3MP1A 2M0OA 2M16A 4QW2A 3OS1A 2RHZA 4NOYA 3CCUT 4QQDA 1QVPA 3BW1A 4C8QF 1WJRA 3HRSA 4M75E 4B9WA 4ZGDB 5GMKi 3LW5E 2G3RA 4DOWA 5GAMf 1YITA 5CQXA 2DPPB 3OYYA 4J7FA 5CR2A 3CCJT 3VJPA 2EQMA 2DKGA 5LJ5j 3DB4A 3PTAA 1Q82C 4J8OA 4OB2B 2KAFA 2PVDB 3L42A 5CIUA 3TCJA 2X4WA 3INZA 3MEAA 4LDUA 1K9MC 2X35A 1KQ2A 4M7AF 3OBYA 4M75G 4Y28E 3CXCS 1VQ7T 4LDWA 5HK0A 3CCVT 4IKFA 3V7SA 3OYBA 3JRZA 2KDSA 4E7KA 4F7UE 1KC8U 2JOYA 3DKMA 4A54A 2WSFE 4RCBA 5GAN4 4A4KA 2QTXA 2RHYA 2XICA 3QG1A 5EG2A 3SWNB 2DTHA 1UB4A 3R6OA 2O4XB 2XKOC 4E47A 3M55A 1VQ6T 1VQ4A 5FRNA 2IVWA 2CS7A 2RHUA 1QP2A 1JRIA 2DIGA 2HQEA 2RO0A 4FU6A 4OB0B 4OB3B 2XHCA 5KE3A 5GAOm 5KH6A 3OBWA 4FL6A 4PJOA 1VQ6A 4L6V5 2ZPHB 4M78G 4M7AD 2CGHA 3OW2A 1LJOA 2F69A 2YLBA 3HFNA 3OS2A 1B34B 2DZCA 3CMEA 3JSCA 3L1AA 3CPWS 1YJNT 2OTLT 2CYZB 4ATOA 2RJCA 4M77G 4B9XA 4XAXB 2QEXT 4M7DF 3FJPA 1BIAA 4M78A 2M9UA 4C92G 1YJNA 4C0DB 3I55T 3JB9F 4NS5A 4E7HA 5D6WA 3S6WA 4N4GA 3V7CA 3JAME 4BE2A 2D6FA 4PJOE 3OQ5A 1P92A 4JLGA 4NL3A 3QO3A 3KBGA 1N8RU 2EIFA 3I55A 1YIJA 1PSEA 4M77C 2KY9A 4A4FA 4C0FA 3L2RA 2E12A 3LWHA 3J7AF 4IUUA 4PKCC 2CZ7B 4OVAA 5CCAA 4DOVA 2Y4XA 3CPWA 1YJWT 3A8GB 4F7UA 2EKOA 2LRQA 3CBPA 3M4YA 2PUOB 2V8IA 3SD4A 1EIFA 4JUVA 1VQ4T 3QSUA 1Y96A 1BYMA 4E7IA 4M77F 2JZ2A 3HRUA 2PVGB 1M1GA 2RHXA 1BI1A 3ME9A 3X28B 4C92A 1XQHA 5CO7A 2LT4A 4XTXA 1B34A 1FWZA 1KG1A 3JB9G 2LT1A 2ZPGB 4OP0A 3A8LB 3OSSC 5DM7R 3RERA 2R5AA 3BDLA 4OF1A 3ER0A 3SWNA 3FDRA 4A4EA 2DXTA 2EQUA 2ZPEB 3META 4BI8B 5LL6S 1LNXA 3CMET 2OTLA 5CKFA 2EJ9A 2RI2A 4TVRA 2XI9A 4NL2A 4FT4A 4M78B 4C0GA 3VU3C 4IUVA 1Q7YC 3H6ZA 4BE1A 2OTJT 3HHTB 4EMHA 3V8JA 2DD4A 5FLXE 5GAMj 4RMOA 1NZ9A 2D9TA 4PJOG 2OTJA 2VYTA 3G6EA 3S3OA 3JCMc 3MO8A 3GP8A 3UPUA 2QI2A 1KD1C 4EMKB 3EFSA 1AHJB 4A4HA 3I56T 2RJDA 3M54A 1I81A 3FEOA 3E9FA 2JVVA 3QKJA 3GLXA 3OW2S 1VQKA 2K5IA 2LC4A 5D6XA 3CCRA 2X4XA 4JDSA 3RIRA 2GQVA 4EDUA 4J6WA 4A4GA 2MAMA 3CCET 3PGGA 4F7UB 3LX7A 4VUBA 3LYIA 3CCRT 1NE8A 1ZBXA 2MI6A 2QQ9A 2VGMA 4C8QB 2YRVA 2E5QA 1DJ7B 2EFIA 4LD9K 3ZBDA 1G5VA 1Q82U 4M7DE 2E65A 4JS5A 4M7AE 4QVZA 5GANh 1VQOT 2C06A 3O8VA 4QQ6A 3RESA 3RKXA 3FRNA 1KHCA 4X34A 1IZ6A 4J83A 3OYHA 3JCMe 4A53A 4M75C 5KCOA 1W2BA 1Q81C 1VQMA 3CC2T 3QDRB 4RCCA 3RKWA 2Y90A 3J80E 3GF5A 5CKHA 4BDZA 4J5YA 3OYGA 2K5FA 5CQYA 3OYEA 3HSBA 4UC4A 2LQKA 2RM4A 3I56A 3G7ZA 1N6AA 2LNVA 3RKYA 3CMAA 2E70A 4PJOB 3OYDA 4C92D 3GNFB 3QUIA 1HXDA 3LH0A 5IAYA 3QIIA 1I5LA 4KULA 4DQ2A 3NTKA 2RK2A 2JUFA 2O4XA 3OYCA 2EQKA 3BFMA 3E1SA 3LGFA 3OB9A 4MZTA 3GOXA 3JB9H 2NLUA 3KXTA 4DA4A 3LGLA 1BKBA 5CVIA 3TU4K 4C8QG 3VKIA 2VGNA 4C0DC 3T9NA 2L3RA 5GAOn 3L2UA 3JCMJ 3CD6A 1Q86U 3EFRA 4C5IA 1XTDA 3RMQA 3G71A 5LJ3d 4E7JA 1GXIE 1N9RA 3OMGA 5HKCA 3A5ZB 1JBMA 5CKEA 4HT9A 2XDPA 5GAMd 2GF7A 3C12A 4YTLA 3MEWA 5A0DA 4FIBA 4ELYC 5LJ3e 4M77A 5DLQE 3UT1A 4PJOD 2QA4T 1Y07A 1MHNA 2EQJA 4XU1A 5HK3A 1YITT 4ZTFA 1D3BA 2RJFA 2LCLA 1PSFA 2WACA 2VUBA 1KQ1A 3X20B 4C5HA 1N27A 1I8FA 2ZPFB 1M8VA 2ZCFB 3CC4A 5DY9A 1HK9A 1OZ3A 4M78D 4HKEA 1NPRA 5GMKe 5A0LA 1JB0E 3CCVA 4BE0A 4M78F 1K8AC 2PUKB 1IREB 3JCMX 2FHDA 4OGEA 4BI4A 5C6SA 3CC7A 1OYXA 1M90U 4KUDK 4C8QD 3CD6T 4N0AA 2K3XA 3G71T 3CCMT 2RJEA 4C5GA 4IURA 1G3WA 2F5KA 3CC7T 5J39A 1U1SA 1VQ8T 1Q7YU 3HKSA 3QZ5B 4J6YA 1N9SA 3FIFA 4J7IA 4PJOF 4ZGJB 1RL2A 3M5AA 1ZQ1A 1M1FA 2A7YA 2FYKA 1WPYA 4XTUA 1VQ8A 4IUPA 2QA4A 5FU6B 3HL8A 5GANj 5GANf 4MZMA 4M7DD 2HBPA 3A8HB 1KQSA 3CCUA 1YBYA 1Y7XA 2KSSA 5GANd 2DD5A 3WVDB 4D6WA 3M57A 2QEXA 2O01E 2F5TX 5LJ5d 4JS4A 3H8ZA 2PQWA 3C94A 4N4IA 3CCJA 3OYIA 4EMKA 3L2QA 4II1A 3UDCA 4HA8A 5I2MA 1I4K1 2ZPIB 4EMKC 2MWOA 1M1KU 4RG2A 1YIJT 2LDMA 4E7LA 3QZ9B 1M5Q1 1MGQA 4HCZA 1VQPA 3JCMf 3OYMA 4ZGEB 1VQ5A 3JCMW 3VYGA 5I2SA 2FVUA 2KMTA 2RB6A 1WJSA 4MMKA 1VQPT 3HRTA 4JJNK 3WXMB 4C8QA 1S72A 3VUBA 3V8KA 3OYAA 2EJGA 2MWPA 4RKUE 3HFOA 4CRIA 4PNOA 2RHIA 2RI5A 2ZGWA 1VQ9T 3QHSA 4PLIA 4MDXA 3QXEB 4LDXA 1S72T 2JNGA 1Q81U 5FRMA 3CCST 4O6JA 4M75A 4M7AC 2QXFA 1BI2A 3CBMA 1YI2T 1JJ2A 1W4SA 3CBOA 4OGCA 5D6YA 1TH7A 3FB9A 3SB2A 2YLCA 3E9GA 3MHXA 4MDWA 4C92B 3QYHB 3CCSA 2EJFA 1QVFS 2L89A 4M78C 4WF2A 3JB9D 5FU6C 5KE2A 2LVMA 3M59A 2X4JA 2WSEE 1QVGA 2JTFA 5GAMh 5GAN8 3DB3A 3QJ6A 3JCMg 4BACA 2VXFA 3M56A 2DXBA 1O75A 2LCCA 3A8OB 2R5MA 3NFCA 5LJ3j 5LJ5e 4X9DA 2K4YA 3PMIA 2E6NA 3HPWA 2R58A 4C0ZA 1X75C 5GAOl 3CCQT 4BDYA 1VQ5T 3P8HA 3MEVA 3P8BB 3UWNA 2VV5A 2KQWA 3PMTA 3OY9A 3JB9J 1Q86C 3AHUA 1BI3A 2V8KA 1YJWA 2P0QA 1YCYA 1FXXA 4XU0A 1VQKT 3ZFJA 3OSVA 1VQ9A 1OZ2A 1G3SA 3JB9I 4RG8A 2BIVA 4BY6B 3OYFA 1VQ7A 4M7DC 5GAN3 4BUGA 4KUIA 3X24B 4ZTJA 3QJYA 2DTIA 2DJZA 2WSCE 1R8OB 2CZ1B 1M9SA 2E1HA 5CAIA 3GPLA 2BKDN 2DIQA 3OA6A 2A3LA 1UGSB 4LDYA 2H3JA 1KHIA 1UGPB 4MMLA 2YHTA 2RH2A 4QVDA 4F7UG 3L2ZA 3X25B 3JCMQ 1W2BS 4JRKA 1K73C 5LJ5h 2CZ6B 2DAQA 3QYGB 3CXCA 5GAMe 3MCAB 5C0MA 3PNWC 4XTVA 3URGA 5GAN2 1X6OA 4EPCA 1YJ9T 5GAN6 3CEYA 4O5VA 5CKBA 3JCMP 4L59A 4M77D 2JN0A 5IN1A 3ASKA 3J81E 2HD0A 5I21A 4BD3A 1K8AU 1VUBA 4P5NA 4JRQA 3MP8A 1M90C 3QPHA 1YJ9A 2HAXA 3TEEA 2X4YA 2PU9B 4N0AC 3RMSA 4EMGA 5GAN5 4PLLA 3CCLT 4FM4B 4J6XA 2EWNA 3HP9A 5KCHA 1YHQT 1NJIC 4HCBA 2XD0A 1H3ZA 5A0GA 4XTWA 4C5EA 3LWIA 4XQ3A 2L5QA 3OYLA 2CZ0B 2QQBA 4BI3A 4XU2A 2DXCA 3LLRA 1XNIA 2RK1A 2CKKA 3PIPA 1X01A 2MF2A 4M7DB 3FC3A 2BUDA 3V8LA 4PL6A 4JLIA 5GMKj 2K5LA 5J26A 3RUXA 2LTOA 3SDZA 5GAN7 5GAOq 1VIFA 1XOVA 2VC8A 1FX7A 1M1KC 2DVEA 5L8RE 3E19A 3M53A 4M75D 4C92E 3M9QA 5GAMg 2XDBA 3PT9A 1NPPA 3NTHA 3G4SA 2DZ9A 1VIEA 2FL7A 3VYHB 3OYKA 2DEQA 5FU7C 2HQXA 2L8DA 4QQGA 2XK0A 2XU8A 5FU7B 3EAEA 2XIDA 2K3YA 3CCLA 1D3BB 4LDVA 1YHQA 4R56A 1UGQB 2KVQG 4CI0C 4R55A 3MEUA 4M77E 1K9MU 2QQRA 4BB7A 2FB7A 1RI0A 5CKDA 1U1TA 1UGRB 2GFUA 2QDYB 4M77B 1V29B 3OS5A 2GFAA 4M7AG 4XTYA 1UEBA 3OMCA 4BY6C 2MMPA 5A2QE 1KC8C 4IUTA 4X9CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A54 A;  5GAN 4;  4RCB A;  2EJF A;  2QTX A;  4M78 C;  4WF2 A;  3SWN B;  2DTH A;  3RKY A;  4PJO B;  4C92 D;  3QUI A;  1HXD A;  3JB9 D;  1JRI A;  5GAM h;  5GAN 8;  5GAO m;  1I5L A;  4DQ2 A;  2DTO A;  3JCM g;  4HT8 A;  2VXF A;  4PJO A;  5LJ5 e;  3BFM A;  1LOJ A;  5LJ3 j;  4M78 G;  3JB9 H;  4M7A D;  4X9D A;  2CGH A;  4PJO C;  4M78 E;  1LJO A;  2YLB A;  5LJ5 f;  3HFN A;  5GAO l;  1B34 B;  2EAY A;  4C8Q G;  5GAO n;  2HNI A;  4M75 B;  2DZC A;  3L1A A;  3JB9 J;  4Y91 A;  3EFR A;  1Y96 B;  3AHU A;  4M77 G;  5LJ3 d;  1N9R A;  1YCY A;  2K57 A;  3FJP A;  4XU0 A;  4C92 C;  2DXU A;  1BIA A;  1JBM A;  3BY7 A;  4M78 A;  4C8Q E;  4C92 G;  3JB9 F;  4PJO E;  5GAM d;  3V7C A;  4M7D G;  3JB9 I;  4C92 F;  5LJ3 e;  4M7D C;  2RA2 A;  5LJ5 g;  4NL3 A;  3QO3 A;  4M77 A;  5GAN 3;  3JCM V;  4PJO D;  3BDU A;  4M77 C;  4M7A B;  5GAO r;  2DTI A;  2DJZ A;  3M4G A;  5CAI A;  2E1H A;  4XU1 A;  4F7U F;  4QVC A;  1WQ7 A;  4JRI A;  1D3B A;  1KQ1 A;  4MML A;  5LJ3 f;  2YHT A;  4F7U A;  4QVD A;  4F7U G;  3L2Z A;  4X9C A;  4XU3 A;  3JCM Q;  1I8F A;  4JRK A;  4JUV A;  1M8V A;  5LJ5 h;  3QSU A;  1Y96 A;  1HK9 A;  1BIB A;  5DY9 A;  4M77 F;  4M78 D;  5GAM e;  4XTV A;  4C92 A;  3JCM b;  5GMK e;  5GAN 2;  2VXE A;  4XTX A;  5GAN g;  1B34 A;  5GAN 6;  5GMK h;  3JB9 G;  3JCM P;  4M77 D;  4M78 F;  2E41 A;  2JN0 A;  4OP0 A;  4V2S A;  5I21 A;  4M7D A;  3JCM X;  3RER A;  4XTZ A;  3SWN A;  3JCM J;  2DXT A;  4HT9 A;  4C8Q D;  1LNX A;  4N0A A;  3HSB A;  2EJ9 A;  4N0A C;  4NL2 A;  5GAO p;  4M78 B;  4EMG A;  1U1S A;  3VU3 C;  5GAN 5;  2E10 A;  3JCM h;  4J6X A;  5GMK m;  2EWN A;  4J6Y A;  1N9S A;  3FIF A;  4PJO F;  4EMH A;  3V8J A;  4XTW A;  4M7D F;  4XQ3 A;  5GAM j;  1H64 1;  2FYK A;  5GAN e;  1WPY A;  4XTU A;  5LJ3 h;  4PJO G;  5GMK l;  3GIB A;  4XU2 A;  3V7R A;  5GAN j;  5GAN f;  3JCM d;  3JCM c;  5LJ3 g;  4M7D D;  1X01 A;  4C8Q C;  5GAN d;  4EMK B;  4M7D B;  3EFS A;  3SWN C;  2RD1 A;  3V8L A;  2I2L A;  1I81 A;  4JLI A;  5GMK j;  3RUX A;  4M75 F;  5LJ5 d;  5GAN 7;  2E64 A;  5GAO q;  4EMK A;  4HA8 A;  3RIR A;  1I4K 1;  1WNL A;  4M7A A;  1WQW A;  2VC8 A;  4EMK C;  2DVE A;  4J6W A;  4M75 D;  4C92 E;  3PGG A;  4F7U B;  4NOY A;  1M5Q 1;  1MGQ A;  5GAM g;  3JCM f;  3BW1 A;  4C8Q F;  2DZ9 A;  4C8Q B;  4M75 E;  5GMK i;  3JCM W;  5GAM f;  2DEQ A;  2RB6 A;  4MMK A;  4C8Q A;  2DKG A;  5LJ5 j;  4M7D E;  1D3B B;  2E65 A;  4M7A E;  3V8K A;  5GAN h;  2EJG A;  3HFO A;  3RES A;  4PNO A;  3RKX A;  1TH7 A;  3INZ A;  4M77 E;  2FB7 A;  2ZGW A;  3QHS A;  1KQ2 A;  4M7A F;  4M75 G;  1U1T A;  3JCM e;  4A53 A;  4M75 C;  4M77 B;  4M75 A;  4M7A C;  4RCC A;  3RKW A;  2Y90 A;  4M7A G;  3V7S A;  4XTY A;  4F7U E;  4J5Y A;  4C92 B;  3FB9 A;  3SB2 A;  2YLC A;  2RM4 A; 
#chains in the Genus database with same CATH topology
 2ROT A;  2LX9 A;  2CSQ A;  4OMF B;  1Q7Y R;  4A63 B;  4JPB W;  2HKN A;  3M58 A;  2MIO A;  2B8A A;  1ZHI A;  2DTO A;  2FEI A;  5LJ5 f;  2FPF A;  1F1B B;  2DER A;  3UA6 A;  1O9S A;  1UJ0 A;  2EBP A;  1W2B P;  4C8Q E;  2PVO B;  3L2V A;  3H9N A;  2ZZD A;  4C92 F;  3OS0 A;  1G83 A;  1T0J A;  2DL5 A;  4OB1 B;  5CK9 A;  3M4G A;  4MZP A;  3FLG A;  4JRI A;  4L5G A;  1UUE A;  3VS6 A;  3PE0 A;  2E6Z A;  4CC7 A;  4XU3 A;  4AG1 C;  5AYF A;  1BIB A;  5J3B A;  1VQO A;  1KIK A;  1QVF A;  2VXE A;  1CSK A;  3CC2 A;  2E41 A;  9ATC B;  4XTZ A;  4Q5W A;  1VQN A;  1WGS A;  4HVW A;  1YWP A;  2JS0 A;  4D8D A;  2M1H A;  4DBQ A;  4WCI A;  2GCX A;  1WDX A;  3C95 A;  2Y4Y A;  3JCM d;  2IPO B;  3SFM A;  3TRE A;  3OYN A;  1JQQ A;  1EFN A;  1WYX A;  1C6V X;  1SHG A;  2SEM A;  3PFS A;  2DE0 X;  4FT2 A;  1M4Z A;  1WQW A;  1OU9 A;  2JW4 A;  2LQW A;  3HRS A;  4B9W A;  4ZGD B;  2G3R A;  1U3O A;  3PTA A;  4OB2 B;  2KAF A;  1K73 R;  1UHF A;  2LNH B;  3TCJ A;  2X4W A;  3INZ A;  4HVU A;  4LDU A;  1WXT A;  1VQ7 T;  1JJ2 P;  1BCM A;  1NYF A;  1SPK A;  4LXC A;  2KDS A;  1PNJ A;  3CCE Q;  4F7U E;  5KYW A;  2K3B A;  2WSF E;  1M90 R;  3QG1 A;  3SWN B;  1UB4 A;  3R6O A;  2XKO C;  1IO6 A;  2F2W A;  5FRN A;  4FU6 A;  2RO0 A;  4OB0 B;  5KE3 A;  4PJO A;  4M7A D;  2YLB A;  3OS2 A;  4AG2 C;  3JSC A;  3EGX A;  1U06 A;  4B9X A;  4XAX B;  1K9M R;  2QEX T;  4M7D F;  2HQH A;  1BIA A;  3I55 T;  2C0T A;  3JB9 F;  5D6W A;  3S6W A;  4BE2 A;  3UF4 A;  1C1A A;  3OQ5 A;  4NL3 A;  1N8R U;  2KY9 A;  4A4F A;  4C0F A;  3L2R A;  2E12 A;  1ARK A;  3E2U A;  2KE9 A;  4DOV A;  2EKO A;  2LRQ A;  3CBP A;  3M4Y A;  2PUO B;  2V8I A;  3CCJ Q;  1QVG P;  2KT1 A;  1RLQ C;  2QEX Q;  1Y96 A;  1BYM A;  4E7I A;  1M1G A;  1X2K A;  2NWM A;  1B34 A;  5FWC A;  2DBK A;  5KYU B;  1WXB A;  1T3L A;  3OSS C;  3RER A;  3BDL A;  4OF1 A;  3SWN A;  4A4E A;  3FDR A;  3CME T;  4BI8 B;  5LL6 S;  1LNX A;  2HL3 A;  2J6O A;  3VU3 C;  1TUC A;  2HZY A;  2DX1 A;  2D1X A;  2JMC A;  3I9Q A;  2H3E B;  4EMH A;  2D9T A;  3UPU A;  1KD1 C;  4EMK B;  1AHJ B;  3I56 T;  3FEO A;  2EYY A;  4PJN A;  1FMW A;  2J06 A;  1GRI A;  2X4X A;  3RIR A;  2VVK A;  4J6W A;  4A4G A;  4VUB A;  2KEA A;  1W1F A;  2QQ9 A;  2DET A;  1BK2 A;  1NEB A;  1K1Z A;  2RF0 A;  3O8V A;  4QQ6 A;  3RES A;  8AT1 B;  3THK A;  2NUZ A;  4M75 C;  2EQI A;  1W2B A;  3QDR B;  4RCC A;  3GF5 A;  5CQY A;  3HSB A;  1FMV A;  3H0I A;  2RM4 A;  2LNV A;  2CP6 A;  4OML A;  4RTY A;  3CMA A;  4PJO B;  1YJN Q;  3GNF B;  2FZG B;  4J9B A;  1ACM B;  3I56 Q;  1I5L A;  4DQ2 A;  2JUF A;  3OYC A;  3E1S A;  4IIO A;  1X27 A;  2KXC A;  3CD6 A;  1OX8 A;  4E7J A;  3RMQ A;  1ZLM A;  3A5Z B;  1VQ4 Q;  1ZSZ C;  2C0I A;  4JJB A;  2XDP A;  2EGA A;  4E6R A;  3U23 A;  5A0D A;  5LJ3 e;  4LN2 A;  3PVL A;  2ATC B;  1Y07 A;  1D3B A;  1QMC A;  2LCL A;  2VUB A;  3X20 B;  1N27 A;  1I8F A;  4PFP A;  2NUP B;  2P84 A;  2RQR A;  4HKE A;  2KR3 A;  2GTO A;  1YIT Q;  1K8A C;  1JU5 C;  2FHD A;  1M90 U;  4N0A A;  2ESW A;  1G3W A;  5KYY B;  3CC7 T;  2KYB A;  3QZ5 B;  4J7I A;  3FIF A;  5HCK A;  1M1F A;  4KRT A;  2JMA A;  2HBP A;  1KQS A;  1TUD A;  2KSS A;  2ABL A;  2NUT A;  2V1Q A;  2PQW A;  1HD3 A;  3OYI A;  4HA8 A;  5I2M A;  1I4K 1;  2ZPI B;  1E6G A;  4OMO A;  4E7L A;  3QZ9 B;  2DEU A;  1M5Q 1;  1MGQ A;  4HCZ A;  1HJD A;  1VQP A;  2FVU A;  2DM1 A;  4MMK A;  1S72 A;  1Q86 R;  3V8K A;  4JJC A;  4RKU E;  1OV3 A;  4MDX A;  1UTI A;  3TVT A;  1Q81 U;  2O9S A;  4OGC A;  4PK4 A;  2EJF A;  4M78 C;  5KE2 A;  1NLO C;  1BCO A;  2QTV A;  1U5S A;  5GAN 8;  3QJ6 A;  3CME Q;  2DXB A;  3A8O B;  3PMI A;  1VQM Q;  1VQ5 T;  2RPN A;  3CCQ T;  2K2M A;  3OY9 A;  3PMT A;  2Z0W A;  2P0Q A;  1YCY A;  1VQK T;  3ZFJ A;  1MMD A;  1OUL A;  4RG8 A;  4M7D C;  2HCK A;  1ZSG A;  1Z9Z A;  2P4R A;  3QJY A;  2KRO A;  3I5R A;  2DJZ A;  1M9S A;  2E1H A;  1X69 A;  2DIQ A;  3OA6 A;  4LDY A;  1WFW A;  2CH4 A;  2YHT A;  4QVD A;  1W2B S;  3X25 B;  2HBW A;  1K73 C;  2K9G A;  2BZY A;  3EGU A;  4XTV A;  3URG A;  5GAN 2;  4EPC A;  4F14 A;  2V26 A;  4M77 D;  2JN0 A;  5IN1 A;  3ASK A;  1VUB A;  1M90 C;  1YJ9 A;  2DL3 A;  2DRK A;  2J6K A;  2PNI A;  2K6D A;  3RMS A;  1I1J A;  3RR6 A;  3ZL7 C;  2EWN A;  1RAI B;  1H3Z A;  5A0G A;  3TSW A;  4C5E A;  3LWI A;  2L5Q A;  2QQB A;  2DXC A;  2CKK A;  3PIP A;  1X01 A;  1AWX A;  4KGZ B;  4JLI A;  3SDZ A;  2LTO A;  4J9I A;  3CQT A;  4FYY B;  1VIF A;  5FWB A;  1KQS P;  1QWF A;  1TU0 B;  2XDB A;  3G4S A;  1RAC B;  1B7T A;  3OYK A;  5FU7 C;  3NGP A;  3EAE A;  2XID A;  3REB B;  2K3Y A;  1YJW Q;  4LDV A;  1YHQ A;  4R56 A;  2LCS A;  4PFZ A;  1UGQ B;  2QQR A;  4BB7 A;  1RI0 A;  2CP5 A;  1U1T A;  4M77 B;  1V29 B;  1OOT A;  2GFA A;  3OS5 A;  4XTY A;  1UEB A;  2MMP A;  1KC8 C;  2RI3 A;  2LQ8 A;  2DFU A;  3CMA Q;  3F70 A;  1V76 A;  4ZN1 A;  3VV0 A;  4HT8 A;  4IUQ A;  4XK8 E;  1LOJ A;  4PJO C;  3Q1J A;  1JXM A;  2AK5 A;  3G4S T;  2HMA A;  2EAY A;  1MMN A;  3CMA T;  4PJM A;  4E7Z A;  2K57 A;  4C92 C;  1UHC A;  4OMN A;  3S3M A;  3SEM A;  4M7D G;  3CPF A;  1PRL C;  5LJ5 g;  2XMF A;  1LCK A;  3VS2 A;  2X3X D;  4ZN3 A;  4M7A B;  5GAO r;  2AT1 B;  3GNG A;  4F7U F;  2ZPB B;  2RQU A;  1U8R A;  2DK3 A;  1Q81 R;  2P4T A;  1K4U S;  5GMK h;  3VS5 A;  3CCQ Q;  1PD0 A;  1VQM T;  2KI7 A;  1VQ5 Q;  3MKD A;  1OX9 A;  1NJI U;  1AWJ A;  3CC4 T;  2LJ0 A;  3M0T A;  2DO3 A;  5HY6 A;  1VQN T;  1WJQ A;  2V8J A;  2XG8 D;  1D1B A;  1H64 1;  2MOX A;  5LJ3 h;  5GMK l;  4LUD A;  1CKB A;  3CCQ A;  2D0N A;  1QCF A;  1VQL T;  5LJ3 g;  5FRO A;  3NTI A;  4C8Q C;  2P0P A;  5KYU A;  1OPL A;  1WZO A;  3SWN C;  1IHV A;  2LJ3 A;  4IIM A;  2AHJ B;  1SRM A;  2BE7 D;  3EG9 A;  4DBH A;  1NM7 A;  2AIR B;  3N5B B;  4M7A A;  3M0U A;  4GY5 A;  2CP7 A;  3OS1 A;  2MCN A;  2RHZ A;  1T3S A;  3CCU T;  4QQD A;  2OJ2 A;  1EZZ B;  1WI7 A;  2NUP A;  5GAM f;  2L3Q A;  2JS2 A;  1VQ9 Q;  4J7F A;  1WLP B;  2K7A A;  2EQM A;  2C0O A;  2O88 A;  3L42 A;  2O9V A;  2X35 A;  4PJL A;  4Y28 E;  1QLY A;  3CCV T;  3OYB A;  3DKM A;  4A54 A;  5GAN 4;  2XIC A;  5EG2 A;  2DTH A;  1SRL A;  2O4X B;  4E47 A;  3M55 A;  4PFO A;  2EW3 A;  3JB9 D;  2DIG A;  4QT7 A;  5GAO m;  5IXB A;  4J9D A;  1K76 A;  3M0Q A;  2ZPH B;  2G6F X;  4M78 G;  1H92 A;  3OW2 A;  2VKN A;  2FRY A;  1SG5 A;  1AWW A;  2CYZ B;  2A37 A;  3EG2 A;  1YHQ Q;  3D7S B;  4E7H A;  1W70 A;  3JAM E;  4N4G A;  3V7C A;  2D6F A;  1P92 A;  1WHK A;  3I55 A;  3LWH A;  1RAB B;  4OVA A;  1AWO A;  5KYX B;  3A8G B;  1YCS B;  3SD4 A;  4JUV A;  1VQ4 T;  2J7I A;  2EYX A;  4QKU A;  3HRU A;  1BI1 A;  1ZA2 B;  2LT4 A;  1KG1 A;  3JB9 G;  3G4S Q;  2ROL A;  1NJI C;  3ER0 A;  2LQN A;  4JZ4 A;  2ZPE B;  2OTL A;  5CKF A;  4AFU C;  2EJ9 A;  1H3H A;  2FZK B;  1KK7 A;  4TVR A;  4NL2 A;  1YFN A;  4M78 B;  4C0G A;  4IUV A;  1AD5 A;  2JXB A;  1VQN Q;  5FLX E;  4RMO A;  3G6E A;  3MO8 A;  1C0M A;  3R6N A;  2QI2 A;  3EFS A;  4A4H A;  2KXD A;  1I81 A;  3GLX A;  2K5I A;  2LC4 A;  5D6X A;  4JDS A;  1VOM A;  1WX6 A;  4EDU A;  2MAM A;  3PGG A;  4F7U B;  1NE8 A;  4Z89 A;  2DIL A;  2YRV A;  1LVK A;  2E5Q A;  3ULR B;  2EFI A;  1UDL A;  1PRM C;  3JV3 A;  2E65 A;  4QVZ A;  3I5S A;  3RKX A;  2EPD A;  1IB8 A;  2YT6 A;  4A53 A;  5KCO A;  1VQM A;  3EGD A;  3MJX A;  3RKW A;  3J80 E;  1D1C A;  5CKH A;  2JTE A;  4BDZ A;  2K5F A;  1YIJ Q;  1FMK A;  1R0C B;  2LQK A;  2E70 A;  1UJY A;  3KFV A;  5IAY A;  3QII A;  1ZUU A;  3BFM A;  3LGF A;  2JT4 A;  4DA4 A;  3LGL A;  5CVI A;  4C8Q G;  4FW2 A;  5GAO n;  2L3R A;  4LNP A;  3OMG A;  5HKC A;  1S72 Q;  5GAM d;  3C12 A;  2NUT B;  3MEW A;  3REA B;  1BBZ A;  4E7S A;  1VQP Q;  2QA4 T;  1YIT T;  1PSF A;  4KGV B;  2DA9 A;  2ZCF B;  3H0H A;  2CSI A;  5DY9 A;  4RTX A;  1NPR A;  4FW1 A;  1IGU A;  5GMK e;  4BE0 A;  2F2V A;  2PUK B;  3JCM X;  4BI4 A;  5C6S A;  3CC7 A;  2CT3 A;  4RTV A;  4C8Q D;  2K3X A;  3CCM T;  4C5G A;  1SSH A;  2FG0 A;  5J39 A;  2CUB A;  2COW A;  3HKS A;  4J6Y A;  1N9S A;  4ZGJ B;  4PJO F;  1VQL Q;  2OTL Q;  1UE9 A;  1ZQ1 A;  2A7Y A;  2FYK A;  1WPY A;  3RBB B;  1GBQ A;  4IUP A;  3CCM Q;  4HCK A;  3VS0 A;  1YBY A;  1Y7X A;  1BU1 A;  5I22 A;  2DD5 A;  5GAN d;  1B3Q A;  1UG1 A;  1W6X A;  3H41 A;  4EMK A;  1K8A R;  4EMK C;  4LE9 A;  3M0S A;  1M1K U;  2KRS A;  1PKT A;  2RQW A;  3OYM A;  3JCM W;  5IXF A;  2LP5 A;  2CT4 A;  2KMT A;  3HRT A;  2CDT A;  2YUO A;  1MV3 A;  4GBQ A;  3VUB A;  2EJG A;  4PNO A;  2RI5 A;  2QDL A;  3QHS A;  1S72 T;  2JNG A;  5FRM A;  2EYW A;  4O6J A;  1BI2 A;  3CBM A;  1YI2 T;  3I55 Q;  3CCS A;  3QYH B;  4ZNX A;  2L89 A;  4JZ3 A;  4WF2 A;  1Y0M A;  2LX7 A;  2LVM A;  3M59 A;  5KYX A;  5GAM h;  1EX4 A;  5LJ5 e;  2LCC A;  2E6N A;  5GAO l;  3EG3 A;  2ENM A;  3P8B B;  3UWN A;  2GGR A;  1YWO A;  3JB9 J;  3VRY A;  3OSV A;  1VQ9 A;  2F1L A;  3JB9 I;  4BY6 B;  2IIM A;  5ECA A;  4BUG A;  2YXY A;  2HSE B;  3EH2 A;  4B6M A;  4E7K A;  4F7U G;  4JRK A;  4GLM A;  2DAQ A;  3CXC A;  3MCA B;  3PNW C;  2PZ1 A;  1JEG A;  1JXO A;  3CEY A;  5CKB A;  3JCM P;  2FO0 A;  2VAS A;  3J81 E;  2HD0 A;  4BD3 A;  3MP8 A;  3EGX B;  2HAX A;  2DL7 A;  3TEE A;  5GAN 5;  4PLL A;  3CCL T;  4FM4 B;  4AMC A;  2CZ0 B;  3CCV Q;  2RK1 A;  5GJW B;  4PL6 A;  1KC8 R;  5GMK j;  2DL4 A;  1M2O A;  5GAN 7;  2VC8 A;  2DVE A;  3M53 A;  5KYW B;  3PT9 A;  1NPP A;  3UA7 A;  1VIE A;  2HQX A;  5FU7 B;  3CCL A;  1D3B B;  4FCY A;  4R55 A;  4CI0 C;  4M77 E;  4DEX A;  1R0B G;  1M2V A;  1D0Z A;  1E7O A;  4C0D B;  1G8X A;  4EIK A;  4LD6 A;  1AVZ C;  2CP0 A;  2A08 A;  4FYW B;  3OW2 P;  2D0Q B;  2D8H A;  3A8M B;  1I07 A;  2CUD A;  1SSF A;  4GLK A;  3FJ5 A;  2HNI A;  4M75 B;  4Y91 A;  1Y96 B;  2KT8 A;  3BY7 A;  7AT1 B;  1QP3 A;  3DLM A;  4KH0 B;  2COY A;  3X26 B;  4N4H A;  2RA2 A;  3CCS Q;  1N8R C;  3JCM V;  3CCE A;  3QBY A;  4QVC A;  5LJ3 f;  1WHM A;  1WHH A;  1QVG S;  3EHR A;  4KH1 B;  3PIO A;  1YI2 A;  2YSQ A;  2H8H A;  1V1C A;  3TSZ A;  1GCQ C;  3VS1 A;  1VQK Q;  2E10 A;  3JCM h;  2ED1 A;  2SRC A;  1NLP C;  4KT0 E;  1QCO A;  3CPW P;  5L23 A;  2QQS A;  2JTM A;  3GIB A;  4AFQ C;  3CCM A;  1KD1 U;  3A98 A;  2RD1 A;  1VQL A;  3CC4 Q;  3MP6 A;  6AT1 B;  2EYQ A;  1H8K A;  4M75 F;  2EGE A;  3P8D A;  5EC7 A;  2QQA A;  4QW2 A;  3MP1 A;  2M16 A;  1TTH B;  1QQJ A;  1QKW A;  2LZ6 B;  1WJR A;  1GL5 A;  4M75 E;  4DOW A;  2QYZ A;  3OYY A;  5CR2 A;  2DKG A;  5LJ5 j;  1VQO Q;  1Q82 C;  2PVD B;  3MEA A;  2E3H A;  1KQ2 A;  4M7A F;  3CXC S;  1ZBJ A;  1TS9 A;  4LDW A;  2EKH A;  2QK0 A;  2DF6 A;  1K0S A;  4RCB A;  2QTX A;  2RHY A;  3VS7 A;  2MPX C;  2IVW A;  2RHU A;  4OB3 B;  3H0F A;  2HQE A;  3SHW A;  1SHF A;  5KH6 A;  4FL6 A;  1VQ6 A;  4L6V 5;  1XJW B;  1QWE A;  1LJO A;  2F69 A;  3C0C A;  1B34 B;  2L2P A;  1X6G A;  1M3B A;  1LPL A;  1VQ6 Q;  3CME A;  3CPW S;  1YJN T;  4ATO A;  2OX7 A;  4M77 G;  4CC2 A;  4M78 A;  2M9U A;  1NG2 A;  3QO3 A;  1YIJ A;  1PSE A;  1HYO A;  5CCA A;  2J6F A;  2Y4X A;  1YJW T;  2RMO A;  4F7U A;  1EIF A;  2YRD A;  1I5O B;  1M3A A;  1RAD B;  1JO8 A;  2M51 A;  5CO7 A;  1ZUY A;  1FWZ A;  2LT1 A;  2ZPG B;  3JCM J;  2O31 A;  4HT9 A;  2EQU A;  3I35 A;  2X51 A;  4FT4 A;  3H6Z A;  2K79 A;  1NZ9 A;  1VYT A;  1M8M A;  4PJO G;  2OTJ A;  1PC0 A;  1Y57 A;  2VYT A;  3JCM c;  2DMO A;  1WHG A;  2M0Y A;  2RJD A;  1G2B A;  4CC4 B;  3QKJ A;  3OW2 S;  2RNA A;  1VQK A;  1N5Z A;  3CCR A;  1WIE A;  2GQV A;  1NJI R;  3CCE T;  3LX7 A;  1VQ7 Q;  4C8Q B;  1T0H A;  1DJ7 B;  2KNB B;  1R77 A;  1MND A;  3ZBD A;  1G5V A;  1Q82 U;  1UGV A;  4JS5 A;  1NEG A;  5GAN h;  1VQO T;  2C06 A;  2F2X A;  3FRN A;  1KHC A;  1IZ6 A;  1TG0 A;  1Q81 C;  3CC2 T;  1VYV A;  2Y90 A;  3OYE A;  3I56 A;  4J9F A;  1ABO A;  3VS3 A;  4ANJ A;  2E5K A;  1RLP C;  2GTJ A;  2YUP A;  2RK2 A;  2O4X A;  3OB9 A;  4MZT A;  1MNE A;  2NLU A;  1BKB A;  2VGN A;  3A1P A;  4J9H A;  3T9N A;  4C0D C;  3L2U A;  2GNC A;  4C5I A;  3G71 A;  5LJ3 d;  1GXI E;  2CRE A;  1N9R A;  1JBM A;  1PD1 A;  5CKE A;  1D0X A;  2BZX A;  4M77 A;  5DLQ E;  4PJO D;  1YNZ A;  2COZ A;  2EQJ A;  5HK3 A;  4ZTF A;  1FYN A;  2RJF A;  3M0P A;  1KQ1 A;  1M8V A;  1NYG A;  1WHJ A;  3CC4 A;  4M78 D;  5A0L A;  2DJQ A;  1JB0 E;  1IRE B;  2QA4 Q;  4OGE A;  2CP3 A;  3CD6 T;  2DYI A;  3G71 T;  2RJE A;  2HKQ B;  4IUR A;  4AT1 B;  2LJ1 A;  2JJ9 A;  1D0Y A;  1RL2 A;  1MMG A;  2E4H A;  3M5A A;  4HVV A;  1X2Q A;  4XTU A;  1VQ8 A;  2OI3 A;  5GAN j;  5GAN f;  3EG1 A;  4M7D D;  3A8H B;  3CCU A;  2FZC B;  4DBF A;  1M3C A;  3M57 A;  2QEX A;  2F5T X;  4JS4 A;  3CCJ A;  1GFC A;  3C94 A;  3L2Q A;  4RTZ A;  1Z9Q A;  2MWO A;  2QGF B;  1J3T A;  1YIJ T;  1IRX A;  3JCM f;  1VQ5 A;  3RNJ A;  2RB6 A;  4JJN K;  3WXM B;  4C8Q A;  1RAG B;  1PHT A;  3OYA A;  4CRI A;  2RHI A;  4PLI A;  1UFF A;  4LDX A;  3CCS T;  5A2Q E;  4M7A C;  1YP5 A;  3HTR A;  2DVJ A;  2QXF A;  1JJ2 A;  1W4S A;  3MPU B;  5D6Y A;  4C92 B;  4X1V A;  2YLC A;  3E9G A;  3MHX A;  3SB2 A;  1QVF S;  5FU6 C;  2X4J A;  3EG9 B;  2WSE E;  4E2F B;  1QVG A;  2JTF A;  3JCM g;  4BAC A;  3M56 A;  1O75 A;  5LJ3 j;  3NFC A;  3NMZ C;  2R58 A;  1X75 C;  3MEV A;  2DYB A;  2KQW A;  2NYS A;  1BI3 A;  2V8K A;  4RTT A;  4Z8A A;  1OU8 A;  2JM9 A;  2MYS A;  3OYF A;  1WHL A;  4DBR A;  1RI9 A;  5GAN 3;  4KUI A;  2QAZ A;  2WSC E;  1S1N A;  2YUN A;  2FRW A;  5CAI A;  2A3L A;  2H3J A;  1UGP B;  1Q82 R;  1PKS A;  3JCM Q;  1RAA B;  2W10 A;  3TQ7 P;  5IHN A;  3QYG B;  5GAM e;  1X6O A;  2LMJ A;  2O2O A;  4L59 A;  1K8A U;  2CH4 W;  5I21 A;  4P5N A;  1RAE B;  3QPH A;  2QAS A;  2PU9 B;  4EMG A;  4JJD A;  3QDF A;  4HCB A;  1YHQ T;  3HP9 A;  1I0C A;  3NPF A;  5KCH A;  4XTW A;  4Y92 A;  4XQ3 A;  3OYL A;  2BTT A;  4XU2 A;  1XNI A;  3G1J A;  2AZS A;  3FC3 A;  3AT1 B;  3V8L A;  2K5L A;  2L3S A;  5GAO q;  1XOV A;  1GCQ A;  2ZAE A;  1GFD A;  1FX7 A;  3VS4 A;  4K11 A;  5L8R E;  3UAT A;  4M75 D;  5AT1 B;  1TXQ A;  5GAM g;  2DZ9 A;  2FL7 A;  2L8D A;  4QQG A;  2XK0 A;  2XU8 A;  2M02 A;  2DL8 A;  4OMQ A;  1K9M U;  3O5Z A;  5CKD A;  1UGR B;  2GFU A;  2QDY B;  1WA7 A;  4M7A G;  1ZUK A;  4Z88 A;  3OMC A;  4BY6 C;  2RN8 A;  4X9C A;  2R57 A;  1ZSZ A;  3C4S A;  1QW1 A;  1G3Y A;  2B86 A;  3VUZ A;  2P0K A;  1M1K R;  2XDD A;  1IGQ A;  1K9A A;  4ESR A;  3WVE B;  1MV0 B;  4M78 E;  4CC3 A;  3G6E T;  3OYJ A;  3S3N A;  4ME7 A;  4Z02 A;  4F04 B;  2BE9 B;  1KQS S;  5GAN g;  1HSQ A;  2DXU A;  3L2W A;  2HL5 C;  2KYM A;  1IXD A;  5M9O A;  3BDU A;  4JRP A;  1AZG B;  3DLL A;  4ELZ C;  2EVR A;  1Y71 A;  1TWB A;  1WQ7 A;  2I0N A;  3CCR Q;  2K2V A;  1K73 U;  1OI1 A;  3JCM b;  5IT9 E;  1JJ2 S;  5DLO A;  4HCC A;  4WTO B;  4V2S A;  4M7D A;  1BI0 A;  5GAO p;  2YDL A;  2OAU A;  3ZEH A;  5GMK m;  1N8R R;  1TOV A;  5GAN e;  3CC7 Q;  3V7R A;  2KK4 A;  4FSX A;  3EH1 A;  1PWT A;  2I2L A;  4KBM B;  3KUF A;  2IG0 A;  2E64 A;  1G3T A;  1WNL A;  1MMA A;  1TUG B;  2M0O A;  4NOY A;  2YWW A;  3EFO A;  1QVP A;  3BW1 A;  3EHQ A;  4C8Q F;  5GMK i;  3LW5 E;  4AFZ C;  1YIT A;  5CQX A;  1AOJ A;  2DPP B;  2AZV A;  3CCJ T;  4AFS C;  3VJP A;  3DB4 A;  1SKU B;  4J8O A;  5CIU A;  1TSF A;  1K9M C;  1BB9 A;  3OBY A;  4M75 G;  5HK0 A;  4IKF A;  1KFZ A;  3V7S A;  3JRZ A;  2VWF A;  1KC8 U;  2JOY A;  1ABQ A;  4A4K A;  3LH5 A;  1VQ6 T;  4J9G A;  1VQ4 A;  3PVQ A;  2CS7 A;  1QP2 A;  1JRI A;  1UEC A;  2XHC A;  3CD6 Q;  1E6H A;  3OBW A;  2CGH A;  2YRC A;  3HFN A;  3QWY A;  2KGT A;  2DZC A;  3L1A A;  2OTL T;  2RJC A;  2RQT A;  2KRN A;  3FJP A;  4C92 G;  1YJN A;  4NS5 A;  4PJO E;  2KBT A;  4JLG A;  3KBG A;  2EIF A;  4M77 C;  2X9H A;  3J7A F;  4IUU A;  4PKC C;  2CZ7 B;  3CPW A;  2HEQ A;  3QSU A;  4M77 F;  2JZ2 A;  3ME9 A;  2PVG B;  2RHX A;  4RUG A;  3X28 B;  4C92 A;  1XQH A;  1AZE A;  4XTX A;  4F16 A;  1X6B A;  3RDV A;  4ORZ A;  4OP0 A;  3G6E Q;  3A8L B;  5DM7 R;  2R5A A;  2DXT A;  3MET A;  1RAH B;  2RI2 A;  1X43 A;  2XI9 A;  4M4Z A;  1Q7Y C;  4BE1 A;  4RTU A;  2OTJ T;  3HHT B;  1AEY A;  3V8J A;  2L3P A;  2DD4 A;  5GAM j;  3BE3 A;  1YI2 Q;  2J05 A;  3S3O A;  3GP8 A;  2DNU A;  1B07 A;  3M54 A;  3E9F A;  2JVV A;  2A0F B;  1OEB A;  5FW9 A;  4DEY A;  3NHN A;  3LYI A;  3CCR T;  1ZBX A;  2MI6 A;  2VGM A;  1SF9 A;  4LD9 K;  4M7D E;  4M7A E;  4X34 A;  1PG5 B;  4J83 A;  3OYH A;  3JCM e;  1KD1 R;  4PJJ A;  4J5Y A;  3OYG A;  4UC4 A;  1D1A A;  3G7Z A;  1N6A A;  3RKY A;  3OYD A;  1QKX A;  4C92 D;  3QUI A;  1HXD A;  1OQK A;  3LH0 A;  1GBR A;  4KUL A;  3NTK A;  5GJV B;  2EQK A;  3GOX A;  2W0Z A;  3JB9 H;  3KXT A;  2BZ8 A;  2FPE A;  2JM8 A;  3TU4 K;  3VKI A;  8ATC B;  1NBE B;  1PCX A;  3EFR A;  2E3I A;  1XTD A;  1Q86 U;  1M27 C;  1ZSZ B;  3CCL Q;  2MK5 A;  4LUE A;  4R0K A;  2GF7 A;  4YTL A;  4FIB A;  4ELY C;  1M2V B;  3UT1 A;  1RAF B;  1MHN A;  4XU1 A;  1IHW A;  4F17 A;  2WAC A;  4C5H A;  5KYN A;  2ZPF B;  1HK9 A;  1OZ3 A;  1OPK A;  2OAW A;  3CCU Q;  3VRZ A;  2EYZ A;  2AKL A;  3CCV A;  4M78 F;  5IHI A;  4KUD K;  1OYX A;  2F5K A;  1KJW A;  1U1S A;  4FSS A;  1VQ8 T;  1Q7Y U;  1PM3 A;  2YUQ A;  2VB6 A;  2QA4 A;  5FU6 B;  3HL8 A;  1KSW A;  4OMP A;  4MZM A;  1WXU A;  1VQ8 Q;  4HXJ A;  2HDA A;  3WVD B;  4D6W A;  2DBM A;  2QG9 B;  2O01 E;  5LJ5 d;  3H8Z A;  4N4I A;  1ZA1 B;  2FPD A;  4II1 A;  3UDC A;  1QVF P;  4RG2 A;  2AKK A;  2LDM A;  1YJ9 Q;  2EGC A;  4ZGE B;  3CC2 Q;  3VYG A;  1D09 B;  5I2S A;  1WJS A;  4KGX B;  1VQP T;  3IQL A;  2KRM A;  1A0N B;  2MWP A;  3HFO A;  1VQ9 T;  2ZGW A;  3QXE B;  1Q95 G;  1VYU A;  4M75 A;  4OMM A;  1QCN A;  3EFO B;  3CBO A;  1TH7 A;  3FB9 A;  4MDW A;  3CXC P;  2PTK A;  1MUZ A;  2A28 A;  3G71 Q;  2ECZ A;  3DB3 A;  2VXF A;  1VA7 A;  5IHK A;  2R5M A;  4X9D A;  2K4Y A;  3HPW A;  4C0Z A;  4BDY A;  3P8H A;  1GCP A;  2VV5 A;  1M30 A;  1Q86 C;  3AHU A;  4RTW A;  1YJW A;  1FXX A;  4XU0 A;  2QGG A;  1G3S A;  1OZ2 A;  1ZX6 A;  2BIV A;  2ED0 A;  3X24 B;  4ZTJ A;  2DTI A;  3EG0 A;  1R8O B;  2CZ1 B;  5KYY A;  3GPL A;  2BKD N;  1UGS B;  1KHI A;  4MML A;  2RH2 A;  3L2Z A;  2HSP A;  5LJ5 h;  2CZ6 B;  5D7U A;  5C0M A;  2A36 A;  1YJ9 T;  5GAN 6;  4O5V A;  1VQ7 A;  4JRQ A;  2GBQ A;  2X4Y A;  1K0X A;  4N0A C;  2DRM A;  1AT1 B;  4FYX B;  4J6X A;  2XD0 A;  1CKA A;  4J9C A;  4BI3 A;  3QWX X;  3EGD B;  3LLR A;  2OTJ Q;  2MF2 A;  4M7D B;  2BUD A;  3RUX A;  5J26 A;  2RQV A;  1SEM A;  3M0R A;  2GQI A;  1M1K C;  4D8K A;  3E19 A;  4C92 E;  3M9Q A;  4J9E A;  3NTH A;  3GBQ A;  1YN8 A;  3VYH B;  2DEQ A;  5I11 A;  2DLP A;  2V1R A;  1RUW A;  2KVQ G;  3MEU A;  2FB7 A;  5IH2 A;  2D8J A;  4FYV B;  2X3W D;  2CP2 A;  2L0A A;  4IUT A; 
#chains in the Genus database with same CATH homology
 2R57 A;  2LX9 A;  2RI3 A;  4LD6 A;  3C4S A;  1QW1 A;  1G3Y A;  2LQ8 A;  4OMF B;  3VUZ A;  2P0K A;  3F70 A;  2D0Q B;  2XDD A;  3M58 A;  2B8A A;  3A8M B;  1ZHI A;  3WVE B;  4ZN1 A;  1SSF A;  2DTO A;  3VV0 A;  4HT8 A;  4IUQ A;  4XK8 E;  4GLK A;  1LOJ A;  4PJO C;  3Q1J A;  4M78 E;  5LJ5 f;  3G4S T;  3G6E T;  3OYJ A;  3S3N A;  2EAY A;  4ME7 A;  4Z02 A;  2HNI A;  4M75 B;  3CMA T;  4Y91 A;  1Y96 B;  1KQS S;  2K57 A;  1O9S A;  4C92 C;  5GAN g;  2DXU A;  3BY7 A;  3L2W A;  4C8Q E;  2PVO B;  3L2V A;  1QP3 A;  3DLM A;  3S3M A;  4M7D G;  3CPF A;  3X26 B;  2ZZD A;  4N4H A;  4C92 F;  2RA2 A;  5LJ5 g;  5M9O A;  3OS0 A;  1N8R C;  3JCM V;  3CCE A;  3BDU A;  4JRP A;  4ZN3 A;  4M7A B;  5CK9 A;  4OB1 B;  3GNG A;  3DLL A;  5GAO r;  3M4G A;  4ELZ C;  4F7U F;  1Y71 A;  2ZPB B;  3QBY A;  1WQ7 A;  3FLG A;  4JRI A;  4L5G A;  4MZP A;  4QVC A;  2K2V A;  2E6Z A;  5LJ3 f;  4XU3 A;  1K73 U;  1OI1 A;  5AYF A;  1U8R A;  2DK3 A;  4M7A A;  1BIB A;  5J3B A;  1VQO A;  1QVF A;  1QVG S;  3JCM b;  5IT9 E;  2P4T A;  2VXE A;  1JJ2 S;  5GMK h;  5DLO A;  3PIO A;  4HCC A;  4V2S A;  1VQM T;  2E41 A;  1YI2 A;  3CC2 A;  4M7D A;  4XTZ A;  4Q5W A;  1NJI U;  1VQN A;  1WGS A;  3CC4 T;  1BI0 A;  2M1H A;  5GAO p;  2DO3 A;  2E10 A;  2OAU A;  5HY6 A;  2GCX A;  3JCM h;  3ZEH A;  5GMK m;  1VQN T;  1WJQ A;  2V8J A;  2XG8 D;  4KT0 E;  3C95 A;  1H64 1;  5GAN e;  5LJ3 h;  5GMK l;  2QQS A;  2JTM A;  3GIB A;  2Y4Y A;  3V7R A;  3CCQ A;  2KK4 A;  4FSX A;  1VQL T;  3JCM d;  3CCM A;  5LJ3 g;  3SFM A;  5FRO A;  3NTI A;  4C8Q C;  1KD1 U;  2P0P A;  3TRE A;  3OYN A;  3SWN C;  2RD1 A;  4KBM B;  2I2L A;  3MP6 A;  1VQL A;  2AHJ B;  2EYQ A;  3KUF A;  4M75 F;  2IG0 A;  2E64 A;  3P8D A;  1G3T A;  2QQA A;  3PFS A;  1WNL A;  1M4Z A;  1WQW A;  3N5B B;  4FT2 A;  4GY5 A;  3MP1 A;  2M0O A;  2M16 A;  4QW2 A;  3OS1 A;  2RHZ A;  4NOY A;  3CCU T;  4QQD A;  1QVP A;  3BW1 A;  4C8Q F;  1WJR A;  3HRS A;  4M75 E;  4B9W A;  4ZGD B;  5GMK i;  3LW5 E;  2G3R A;  4DOW A;  5GAM f;  1YIT A;  5CQX A;  2DPP B;  3OYY A;  4J7F A;  5CR2 A;  3CCJ T;  3VJP A;  2EQM A;  2DKG A;  5LJ5 j;  3DB4 A;  3PTA A;  1Q82 C;  4J8O A;  4OB2 B;  2KAF A;  2PVD B;  3L42 A;  5CIU A;  3TCJ A;  2X4W A;  3INZ A;  3MEA A;  4LDU A;  1K9M C;  2X35 A;  1KQ2 A;  4M7A F;  3OBY A;  4M75 G;  4Y28 E;  3CXC S;  1VQ7 T;  4LDW A;  5HK0 A;  3CCV T;  4IKF A;  3V7S A;  3OYB A;  3JRZ A;  2KDS A;  4E7K A;  4F7U E;  1KC8 U;  2JOY A;  3DKM A;  4A54 A;  2WSF E;  4RCB A;  5GAN 4;  4A4K A;  2QTX A;  2RHY A;  2XIC A;  3QG1 A;  5EG2 A;  3SWN B;  2DTH A;  1UB4 A;  3R6O A;  2O4X B;  2XKO C;  4E47 A;  3M55 A;  1VQ6 T;  1VQ4 A;  5FRN A;  2IVW A;  2CS7 A;  2RHU A;  1QP2 A;  1JRI A;  2DIG A;  2HQE A;  2RO0 A;  4FU6 A;  4OB0 B;  4OB3 B;  2XHC A;  5KE3 A;  5GAO m;  5KH6 A;  3OBW A;  4FL6 A;  4PJO A;  1VQ6 A;  4L6V 5;  2ZPH B;  4M78 G;  4M7A D;  2CGH A;  3OW2 A;  1LJO A;  2F69 A;  2YLB A;  3HFN A;  3OS2 A;  1B34 B;  2DZC A;  3CME A;  3JSC A;  3L1A A;  3CPW S;  1YJN T;  2OTL T;  2CYZ B;  4ATO A;  2RJC A;  4M77 G;  4B9X A;  4XAX B;  2QEX T;  4M7D F;  3FJP A;  1BIA A;  4M78 A;  2M9U A;  4C92 G;  1YJN A;  4C0D B;  3I55 T;  3JB9 F;  4NS5 A;  4E7H A;  5D6W A;  3S6W A;  4N4G A;  3V7C A;  3JAM E;  4BE2 A;  2D6F A;  4PJO E;  3OQ5 A;  1P92 A;  4JLG A;  4NL3 A;  3QO3 A;  3KBG A;  1N8R U;  2EIF A;  3I55 A;  1YIJ A;  1PSE A;  4M77 C;  2KY9 A;  4A4F A;  4C0F A;  3L2R A;  2E12 A;  3LWH A;  3J7A F;  4IUU A;  4PKC C;  2CZ7 B;  4OVA A;  5CCA A;  4DOV A;  2Y4X A;  3CPW A;  1YJW T;  3A8G B;  4F7U A;  2EKO A;  2LRQ A;  3CBP A;  3M4Y A;  2PUO B;  2V8I A;  3SD4 A;  1EIF A;  4JUV A;  1VQ4 T;  3QSU A;  1Y96 A;  1BYM A;  4E7I A;  4M77 F;  2JZ2 A;  3HRU A;  2PVG B;  1M1G A;  2RHX A;  1BI1 A;  3ME9 A;  3X28 B;  4C92 A;  1XQH A;  5CO7 A;  2LT4 A;  4XTX A;  1B34 A;  1FWZ A;  1KG1 A;  3JB9 G;  2LT1 A;  2ZPG B;  4OP0 A;  3A8L B;  3OSS C;  5DM7 R;  3RER A;  2R5A A;  3BDL A;  4OF1 A;  3ER0 A;  3SWN A;  3FDR A;  4A4E A;  2DXT A;  2EQU A;  2ZPE B;  3MET A;  4BI8 B;  5LL6 S;  1LNX A;  3CME T;  2OTL A;  5CKF A;  2EJ9 A;  2RI2 A;  4TVR A;  2XI9 A;  4NL2 A;  4FT4 A;  4M78 B;  4C0G A;  3VU3 C;  4IUV A;  1Q7Y C;  3H6Z A;  4BE1 A;  2OTJ T;  3HHT B;  4EMH A;  3V8J A;  2DD4 A;  5FLX E;  5GAM j;  4RMO A;  1NZ9 A;  2D9T A;  4PJO G;  2OTJ A;  2VYT A;  3G6E A;  3S3O A;  3JCM c;  3MO8 A;  3GP8 A;  3UPU A;  2QI2 A;  1KD1 C;  4EMK B;  3EFS A;  1AHJ B;  4A4H A;  3I56 T;  2RJD A;  3M54 A;  1I81 A;  3FEO A;  3E9F A;  2JVV A;  3QKJ A;  3GLX A;  3OW2 S;  1VQK A;  2K5I A;  2LC4 A;  5D6X A;  3CCR A;  2X4X A;  4JDS A;  3RIR A;  2GQV A;  4EDU A;  4J6W A;  4A4G A;  2MAM A;  3CCE T;  3PGG A;  4F7U B;  3LX7 A;  4VUB A;  3LYI A;  3CCR T;  1NE8 A;  1ZBX A;  2MI6 A;  2QQ9 A;  2VGM A;  4C8Q B;  2YRV A;  2E5Q A;  1DJ7 B;  2EFI A;  4LD9 K;  3ZBD A;  1G5V A;  1Q82 U;  4M7D E;  2E65 A;  4JS5 A;  4M7A E;  4QVZ A;  5GAN h;  1VQO T;  2C06 A;  3O8V A;  4QQ6 A;  3RES A;  3RKX A;  3FRN A;  1KHC A;  4X34 A;  1IZ6 A;  4J83 A;  3OYH A;  3JCM e;  4A53 A;  4M75 C;  5KCO A;  1W2B A;  1Q81 C;  1VQM A;  3CC2 T;  3QDR B;  4RCC A;  3RKW A;  2Y90 A;  3J80 E;  3GF5 A;  5CKH A;  4BDZ A;  4J5Y A;  3OYG A;  2K5F A;  5CQY A;  3OYE A;  3HSB A;  4UC4 A;  2LQK A;  2RM4 A;  3I56 A;  3G7Z A;  1N6A A;  2LNV A;  3RKY A;  3CMA A;  2E70 A;  4PJO B;  3OYD A;  4C92 D;  3GNF B;  3QUI A;  1HXD A;  3LH0 A;  5IAY A;  3QII A;  1I5L A;  4KUL A;  4DQ2 A;  3NTK A;  2RK2 A;  2JUF A;  2O4X A;  3OYC A;  2EQK A;  3BFM A;  3E1S A;  3LGF A;  3OB9 A;  4MZT A;  3GOX A;  3JB9 H;  2NLU A;  3KXT A;  4DA4 A;  3LGL A;  1BKB A;  5CVI A;  3TU4 K;  4C8Q G;  3VKI A;  2VGN A;  4C0D C;  3T9N A;  2L3R A;  5GAO n;  3L2U A;  3JCM J;  3CD6 A;  1Q86 U;  3EFR A;  4C5I A;  1XTD A;  3RMQ A;  3G71 A;  5LJ3 d;  4E7J A;  1GXI E;  1N9R A;  3OMG A;  5HKC A;  3A5Z B;  1JBM A;  5CKE A;  4HT9 A;  2XDP A;  5GAM d;  2GF7 A;  3C12 A;  4YTL A;  3MEW A;  5A0D A;  4FIB A;  4ELY C;  5LJ3 e;  4M77 A;  5DLQ E;  3UT1 A;  4PJO D;  2QA4 T;  1Y07 A;  1MHN A;  2EQJ A;  4XU1 A;  5HK3 A;  1YIT T;  4ZTF A;  1D3B A;  2RJF A;  2LCL A;  1PSF A;  2WAC A;  2VUB A;  1KQ1 A;  3X20 B;  4C5H A;  1N27 A;  1I8F A;  2ZPF B;  1M8V A;  2ZCF B;  3CC4 A;  5DY9 A;  1HK9 A;  1OZ3 A;  4M78 D;  4HKE A;  1NPR A;  5GMK e;  5A0L A;  1JB0 E;  3CCV A;  4BE0 A;  4M78 F;  1K8A C;  2PUK B;  1IRE B;  3JCM X;  2FHD A;  4OGE A;  4BI4 A;  5C6S A;  3CC7 A;  1OYX A;  1M90 U;  4KUD K;  4C8Q D;  3CD6 T;  4N0A A;  2K3X A;  3G71 T;  3CCM T;  2RJE A;  4C5G A;  4IUR A;  1G3W A;  2F5K A;  3CC7 T;  5J39 A;  1U1S A;  1VQ8 T;  1Q7Y U;  3HKS A;  3QZ5 B;  4J6Y A;  1N9S A;  3FIF A;  4J7I A;  4PJO F;  4ZGJ B;  1RL2 A;  3M5A A;  1ZQ1 A;  1M1F A;  2A7Y A;  2FYK A;  1WPY A;  4XTU A;  1VQ8 A;  4IUP A;  2QA4 A;  5FU6 B;  3HL8 A;  5GAN j;  5GAN f;  4MZM A;  4M7D D;  2HBP A;  3A8H B;  1KQS A;  3CCU A;  1YBY A;  1Y7X A;  2KSS A;  5GAN d;  2DD5 A;  3WVD B;  4D6W A;  3M57 A;  2QEX A;  2O01 E;  2F5T X;  5LJ5 d;  4JS4 A;  3H8Z A;  2PQW A;  3C94 A;  4N4I A;  3CCJ A;  3OYI A;  4EMK A;  3L2Q A;  4II1 A;  3UDC A;  4HA8 A;  5I2M A;  1I4K 1;  2ZPI B;  4EMK C;  2MWO A;  1M1K U;  4RG2 A;  1YIJ T;  2LDM A;  4E7L A;  3QZ9 B;  1M5Q 1;  1MGQ A;  4HCZ A;  1VQP A;  3JCM f;  3OYM A;  4ZGE B;  1VQ5 A;  3JCM W;  3VYG A;  5I2S A;  2FVU A;  2KMT A;  2RB6 A;  1WJS A;  4MMK A;  1VQP T;  3HRT A;  4JJN K;  3WXM B;  4C8Q A;  1S72 A;  3VUB A;  3V8K A;  3OYA A;  2EJG A;  2MWP A;  4RKU E;  3HFO A;  4CRI A;  4PNO A;  2RHI A;  2RI5 A;  2ZGW A;  1VQ9 T;  3QHS A;  4PLI A;  4MDX A;  3QXE B;  4LDX A;  1S72 T;  2JNG A;  1Q81 U;  5FRM A;  3CCS T;  4O6J A;  4M75 A;  4M7A C;  2QXF A;  1BI2 A;  3CBM A;  1YI2 T;  1JJ2 A;  1W4S A;  3CBO A;  4OGC A;  5D6Y A;  1TH7 A;  3FB9 A;  3SB2 A;  2YLC A;  3E9G A;  3MHX A;  4MDW A;  4C92 B;  3QYH B;  3CCS A;  2EJF A;  1QVF S;  2L89 A;  4M78 C;  4WF2 A;  3JB9 D;  5FU6 C;  5KE2 A;  2LVM A;  3M59 A;  2X4J A;  2WSE E;  1QVG A;  2JTF A;  5GAM h;  5GAN 8;  3DB3 A;  3QJ6 A;  3JCM g;  4BAC A;  2VXF A;  3M56 A;  2DXB A;  1O75 A;  2LCC A;  3A8O B;  2R5M A;  3NFC A;  5LJ3 j;  5LJ5 e;  4X9D A;  2K4Y A;  3PMI A;  2E6N A;  3HPW A;  2R58 A;  4C0Z A;  1X75 C;  5GAO l;  3CCQ T;  4BDY A;  1VQ5 T;  3P8H A;  3MEV A;  3P8B B;  3UWN A;  2VV5 A;  2KQW A;  3PMT A;  3OY9 A;  3JB9 J;  1Q86 C;  3AHU A;  1BI3 A;  2V8K A;  1YJW A;  2P0Q A;  1YCY A;  1FXX A;  4XU0 A;  1VQK T;  3ZFJ A;  3OSV A;  1VQ9 A;  1OZ2 A;  1G3S A;  3JB9 I;  4RG8 A;  2BIV A;  4BY6 B;  3OYF A;  1VQ7 A;  4M7D C;  5GAN 3;  4BUG A;  4KUI A;  3X24 B;  4ZTJ A;  3QJY A;  2DTI A;  2DJZ A;  2WSC E;  1R8O B;  2CZ1 B;  1M9S A;  2E1H A;  5CAI A;  3GPL A;  2BKD N;  2DIQ A;  3OA6 A;  2A3L A;  1UGS B;  4LDY A;  2H3J A;  1KHI A;  1UGP B;  4MML A;  2YHT A;  2RH2 A;  4QVD A;  4F7U G;  3L2Z A;  3X25 B;  3JCM Q;  1W2B S;  4JRK A;  1K73 C;  5LJ5 h;  2CZ6 B;  2DAQ A;  3QYG B;  3CXC A;  5GAM e;  3MCA B;  5C0M A;  3PNW C;  4XTV A;  3URG A;  5GAN 2;  1X6O A;  4EPC A;  1YJ9 T;  5GAN 6;  3CEY A;  4O5V A;  5CKB A;  3JCM P;  4L59 A;  4M77 D;  2JN0 A;  5IN1 A;  3ASK A;  3J81 E;  2HD0 A;  5I21 A;  4BD3 A;  1K8A U;  1VUB A;  4P5N A;  4JRQ A;  3MP8 A;  1M90 C;  3QPH A;  1YJ9 A;  2HAX A;  3TEE A;  2X4Y A;  2PU9 B;  4N0A C;  3RMS A;  4EMG A;  5GAN 5;  4PLL A;  3CCL T;  4FM4 B;  4J6X A;  2EWN A;  3HP9 A;  5KCH A;  1YHQ T;  1NJI C;  4HCB A;  2XD0 A;  1H3Z A;  5A0G A;  4XTW A;  4C5E A;  3LWI A;  4XQ3 A;  2L5Q A;  3OYL A;  2CZ0 B;  2QQB A;  4BI3 A;  4XU2 A;  2DXC A;  3LLR A;  1XNI A;  2RK1 A;  2CKK A;  3PIP A;  1X01 A;  2MF2 A;  4M7D B;  3FC3 A;  2BUD A;  3V8L A;  4PL6 A;  4JLI A;  5GMK j;  2K5L A;  5J26 A;  3RUX A;  2LTO A;  3SDZ A;  5GAN 7;  5GAO q;  1VIF A;  1XOV A;  2VC8 A;  1FX7 A;  1M1K C;  2DVE A;  5L8R E;  3E19 A;  3M53 A;  4M75 D;  4C92 E;  3M9Q A;  5GAM g;  2XDB A;  3PT9 A;  1NPP A;  3NTH A;  3G4S A;  2DZ9 A;  1VIE A;  2FL7 A;  3VYH B;  3OYK A;  2DEQ A;  5FU7 C;  2HQX A;  2L8D A;  4QQG A;  2XK0 A;  2XU8 A;  5FU7 B;  3EAE A;  2XID A;  2K3Y A;  3CCL A;  1D3B B;  4LDV A;  1YHQ A;  4R56 A;  1UGQ B;  2KVQ G;  4CI0 C;  4R55 A;  3MEU A;  4M77 E;  1K9M U;  2QQR A;  4BB7 A;  2FB7 A;  1RI0 A;  5CKD A;  1U1T A;  1UGR B;  2GFU A;  2QDY B;  4M77 B;  1V29 B;  3OS5 A;  2GFA A;  4M7A G;  4XTY A;  1UEB A;  3OMC A;  4BY6 C;  2MMP A;  5A2Q E;  1KC8 C;  4IUT A;  4X9C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...