4Y91A

Crystal structure of a thermotoga maritima hfq homolog
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
66
structure length
66
Chain Sequence
FNLQDRFLNHLRVNKIEVKVYLVNGFQTKGFIRSFDSYTVLLESGNQQSLIYKHAISTIIPSSYVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Thermotoga maritima Hfq homolog
rcsb
source organism Thermotoga maritima
molecule tags Rna binding protein/rna
molecule keywords RNA-binding protein Hfq
total genus 14
structure length 66
sequence length 66
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2015-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4y91A00
2DTHA 4NL3A 5LJ3j 2RM4A 4PJOB 4HT9A 4PJOC 1LOJA 3GIBA 4XTVA 3RKYA 2YLBA 3JCMV 4C8QB 3JB9F 4XU1A 1HXDA 4C92A 4M78G 1WPYA 4XU3A 4QVDA 3INZA 5GAOq 5LJ3e 3BFMA 4XTZA 1D3BA 3RKWA 2DZ9A 4Y91A 1M5Q1 2QTXA 3L1AA 1U1SA 3HFNA 5LJ5g 4J6XA 4RCBA 3JCMX 4JRIA 3JCMf 2EJFA 4M75E 1JBMA 3FJPA 4M77G 4M77A 4JUVA 3V7CA 5GAN3 4M78D 1I8FA 5LJ3f 2VXFA 1U1TA 2CGHA 5DY9A 5LJ5d 3QHSA 2DTOA 2RB6A 1HK9A 5GAOl 4JRKA 2FYKA 2DVEA 4M78B 2EWNA 4M7AF 1YCYA 5LJ5f 4HT8A 3QO3A 4M77E 4M7AD 1I4K1 5GAMg 1M8VA 1JRIA 4MMLA 5GAN8 2RA2A 4C8QC 4M77F 2K57A 2VXEA 4OP0A 3L2ZA 4M7DA 3QSUA 4XU0A 4C92B 5GAMe 4M7DB 3V8KA 1I81A 4X9CA 1X01A 4PJOA 4QVCA 5GAN7 5GAOp 5GANd 5GAN5 3JCMJ 4PJOG 5GAN2 4M7AE 1I5LA 4XQ3A 3RIRA 5GMKj 5GANh 2E1HA 4J5YA 4XTYA 5GAMj 1B34A 3JB9J 3VU3C 5GAOn 3JCMb 4M75D 3RKXA 4M7DG 5GAOr 5GAOm 3JB9G 5GMKl 5GANg 3JB9D 3HSBA 4C8QE 4V2SA 4XTWA 3SWNA 3M4GA 5GANe 3EFSA 4PJOF 1N9RA 2E64A 3RUXA 4PJOD 4M77D 4NL2A 2EJ9A 4PNOA 4XU2A 4M75G 1BIBA 4A54A 4DQ2A 3RERA 1KQ2A 2RD1A 2YLCA 1H641 1MGQA 5CAIA 1Y96B 2DTIA 3V8JA 4M75B 2EJGA 4F7UG 3JCMQ 4F7UE 4J6WA 3AHUA 5LJ3g 3BW1A 1WQ7A 4M7AA 3JCMe 2DKGA 4PJOE 5LJ3h 4EMGA 3SWNC 1KQ1A 4M75F 5GMKi 2FB7A 4RCCA 2DXUA 2DZCA 4M7AG 4M7DF 4M7DD 1D3BB 4XTXA 3FIFA 4C92D 3BDUA 4C92G 5GMKm 2DJZA 2ZGWA 4N0AC 4EMKC 2DEQA 4M78C 3JCMh 1N9SA 5GAMh 3V7SA 3JB9I 1LJOA 2I2LA 3JCMd 4C8QA 5GAN4 4M75C 5LJ5j 4M7DC 1BIAA 1WQWA 5LJ3d 2E10A 2E65A 4X9DA 4M77C 3RESA 4EMHA 4F7UF 3JCMW 4M78A 2E41A 4M78F 4M7AB 4MMKA 4EMKB 4F7UA 4M7AC 5LJ5e 2EAYA 4N0AA 5LJ5h 3FB9A 4C8QD 4M75A 2Y90A 2YHTA 4M78E 4NOYA 1Y96A 4C8QF 1TH7A 1WNLA 2DXTA 1LNXA 4M77B 4EMKA 5GAN6 3V7RA 3JCMg 5GAMf 4C92F 5GMKh 5I21A 3V8LA 3BY7A 3JCMP 5GANj 3SB2A 4C92E 2HNIA 3SWNB 2JN0A 3PGGA 3JCMc 4XTUA 5GAMd 5GANf 4HA8A 4JLIA 4M7DE 4C8QG 4WF2A 2VC8A 4C92C 5GMKe 4F7UB 3EFRA 3JB9H 1B34B 3QUIA 4A53A 3HFOA 4J6YA
chains in the Genus database with same CATH superfamily
2F1LA 4BD3A 4PJOB 1VQNT 4XTVA 1M1KR 4KUDK 4N4GA 2EYQA 2DD4A 3INZA 1WJQA 1LVKA 1TSFA 1YI2Q 2DZ9A 3I9QA 3CC4Q 1VQOA 3JCMf 4ANJA 2JS0A 1UEBA 1PWTA 1VQ9A 3M4YA 2XDDA 4OMMA 2DK3A 1Q7YC 2ENMA 5KYYB 1W4SA 4FIBA 3QO3A 3X24B 2JVVA 3AT1B 2VXEA 1BU1A 3HTRA 3HPWA 1EFNA 2RQTA 4RTYA 3CCEA 5GAN2 4IUVA 1Q7YU 5GAOn 2CS7A 5FU7B 3DLMA 3RKXA 2D8JA 8ATCB 3OYHA 1VQMT 1IXDA 1BCMA 4XU2A 2BZ8A 2A08A 4DQ2A 3X28B 1MGQA 3MP8A 4J9DA 1JEGA 2IVWA 1U3OA 1YITT 4M75B 1VQ6A 1ABQA 4JDSA 2RJEA 1PRLC 2FPFA 3JV3A 3HL8A 3G1JA 4MZPA 1NJIC 1QVFP 4DEYA 2GF7A 1BBZA 3FLGA 1RUWA 4N0AC 5LJ5j 1YN8A 3OS2A 2E41A 2D6FA 3QDRB 1WJSA 3IQLA 3M59A 4C8QF 5FROA 4QQ6A 1VQ9T 4RG8A 4KT0E 5IXFA 1Q86R 1BI0A 2DRMA 3MEUA 3CEYA 1SF9A 3VYHB 2XIDA 3DB3A 2W0ZA 5IN1A 2E70A 2E5QA 4D8KA 3CC4A 3ER0A 4OMQA 5M9OA 6AT1B 1LCKA 2O2OA 1OZ2A 1OX9A 1X6OA 1ZX6A 2VYTA 4UC4A 2CP7A 5CR2A 4M78G 1M1FA 1R77A 3VS7A 3CCLT 3J81E 5LJ5g 2GNCA 4J6XA 2A28A 4JRIA 2O9SA 3EG9A 3E1SA 1VQ5T 5DY9A 3HRSA 4BE0A 3G71T 4BB7A 3CCJT 2LQWA 2A36A 3H41A 4C0FA 1VQLQ 2JUFA 4M77F 4OP0A 4PFOA 3CCRQ 3JAME 2K2VA 3KBGA 1E6GA 5GANd 2ZPIB 1S1NA 8AT1B 3KUFA 4C5EA 4TVRA 3F70A 3EGDA 5I2MA 2SRCA 4FCYA 3RUXA 3CCUT 1PSEA 2YLCA 3ASKA 4JPBW 2CYZB 2DL4A 4GLKA 5D6XA 2DEUA 5LJ3h 1YIJA 1GCQA 2DZCA 2EQMA 2DEQA 1BK2A 1N9SA 5GJWB 1OU8A 2I2LA 4DBFA 3JCMd 3I5SA 2EKOA 3GBQA 3CCSA 2LVMA 2H3EB 1YJNT 4F7UA 1WXBA 2GTOA 2EAYA 2GQVA 3H9NA 5LJ5e 2XU8A 2DJQA 1VQKT 1K8AU 4NOYA 2EQUA 1NLOC 4BUGA 4DOVA 3CCMA 1OEBA 2ZZDA 2ROLA 4IUUA 1TTHB 1QVFS 3GOXA 4X1VA 5CKEA 4LUEA 3Q1JA 3J80E 3QWXX 2OTLT 3OW2S 2DO3A 3EH1A 1OQKA 1JQQA 1AWOA 4QKUA 1M2VA 4F04B 2OTLQ 1HXDA 4RTXA 2YSQA 3GF5A 3E19A 2LC4A 3UPUA 1VQ8Q 2A7YA 4BDZA 1HJDA 5GAMg 4OMFB 4M75E 5LJ3f 4N4HA 2IIMA 4FYYB 2RMOA 3P8BB 3M0RA 1NYGA 3LWIA 3GP8A 3MEWA 2DIQA 3QYHB 2X4YA 2HKNA 4FL6A 1B3QA 2EWNA 2DRKA 2YRDA 1O75A 1X6GA 1GCQC 4M7DA 1M90C 4E7HA 1VQ7Q 3V8KA 2YRCA 5IHKA 1UG1A 3ULRB 4PJOG 4CC7A 2CSQA 4FYXB 1B34A 2D0NA 2ECZA 5FRNA 1KQSP 5EG2A 4B6MA 3JB9G 1RI9A 1M90U 2KT8A 1N9RA 2ZAEA 5I22A 1GFDA 3OMCA 1QVGS 3CXCA 3C4SA 3C94A 3JCMQ 3OYFA 2YUQA 4DBHA 4KH1B 4R55A 2VKNA 4M7AA 1BKBA 2MYSA 3RDVA 5FLXE 4M75F 2AZSA 2XI9A 1LJOA 3M0UA 2A3LA 2QGFB 1VUBA 2OJ2A 5KE3A 1Y71A 2YHTA 2GTJA 1TH7A 1LNXA 1WHKA 1RL2A 1YNZA 2CP3A 3JRZA 4ZGEB 2IPOB 3BY7A 1G83A 1RAAB 3UA6A 4LD9K 1UGVA 3CCRA 3EGUA 4PKCC 1Q81R 3C95A 2FZGB 1GBRA 5LJ3j 1YI2T 3CPWS 1OZ3A 1XTDA 4C92A 3VS3A 2HMAA 1V29B 2DPPB 1D1CA 2KROA 1YJWQ 1AEYA 3PVQA 1VQNQ 2QEXT 2ZPEB 3HFNA 3CCJA 1SPKA 3H0FA 1RAHB 2CDTA 3QYGB 1VQ5A 4KGZB 2CP5A 5C6SA 5L23A 4RKUE 2X35A 1G3SA 5FWBA 1Q7YR 3QHSA 4HCZA 2HBWA 7AT1B 2CZ6B 1QKXA 3OQ5A 2K57A 1NM7A 5J26A 5GAMe 1OOTA 2VGNA 1WHJA 2LCSA 4HKEA 3HHTB 1WJRA 1ARKA 3DKMA 1VQLA 2LNHB 2J05A 5CQYA 1YITQ 3I55Q 4J9EA 1VQPQ 5A0GA 4MDWA 4OGCA 3PMIA 1VQMQ 1KD1C 3PMTA 1D0YA 2K5LA 4YTLA 2ED0A 3QIIA 5GJVB 1QVGA 4R0KA 1JB0E 1M1GA 2DL5A 2V8JA 4M7AG 3EG2A 2K6DA 2DJZA 2PNIA 3P8HA 2CKKA 4ZN1A 4JS5A 2FL7A 5CO7A 2H8HA 3A5ZB 2BE7D 4LDUA 2HQEA 2LT4A 2E4HA 1M9SA 1M30A 4O5VA 3A8HB 3VJPA 4AFSC 1WNLA 2A37A 5GAN6 5GAMf 4A4HA 1GBQA 3JCMP 2X51A 5GAMd 2DE0X 2RQVA 4HA8A 3HKSA 2QGGA 5GMKe 4QQDA 2FVUA 1PC0A 3I35A 2HSEB 2RO0A 3CC2T 2Z0WA 3M5AA 4EDUA 3MJXA 3KFVA 2RI5A 3NTHA 4PJJA 2K3XA 1QVPA 5ECAA 4RTTA 1PNJA 1LPLA 2HQHA 4RTZA 1NBEB 3LWHA 2FRWA 1NJIR 4A4FA 3L2UA 1VOMA 2EGEA 1MUZA 1N27A 1ZQ1A 2XK0A 1W1FA 1G3YA 1ZA2B 2KRNA 3VS5A 1MV3A 3CCVQ 1SG5A 5DLOA 1MMNA 2DFUA 3PNWC 1KQSA 2K9GA 2QA4A 1ZSZB 1QWFA 1OU9A 5HCKA 2DX1A 4LXCA 3S3NA 1AWWA 2C06A 3CCRT 5GAN5 4NS5A 2EQKA 3REBB 1S72A 2PZ1A 2QAZA 3JCMb 2PQWA 3EG0A 4BACA 3RBBB 4A63B 4C0GA 3O8VA 1M2OA 4ELZC 2M51A 4DA4A 4M77D 1W2BA 3OYLA 3RERA 2EGCA 1Y96B 3G7ZA 3OYKA 2MWPA 1UFFA 1D0XA 4M7DF 4JZ4A 1FX7A 3QPHA 2SEMA 1UGPB 2BZYA 1U8RA 2PU9B 2E10A 1VQKQ 4M77C 1OPKA 4EMKB 9ATCB 2L89A 3CXCS 5CVIA 4J7IA 2GQIA 1A0NB 2DL7A 2BIVA 1F1BB 3CMAQ 4BI8B 1NPRA 2JOYA 5HKCA 2RHIA 2K5FA 4C92C 2JTFA 2CSIA 3X25B 3M55A 3JSCA 3QUIA 3CCSQ 3HRUA 4BY6B 1Q82U 3CD6T 3JCMV 2CT3A 3QG1A 1QW1A 3ZBDA 4QVDA 1ZSZA 1ZBXA 5CCAA 1HSQA 2AK5A 2QI2A 3M58A 5KE2A 2MCNA 1ZUUA 1VQ4A 3LYIA 4JZ3A 2VWFA 3UATA 3OS0A 1SKUB 4PJMA 1CSKA 2FRYA 3CMET 3OW2A 3CCUA 2BZXA 2O31A 4C92B 3EG3A 2OTJQ 4HCBA 1UGSB 4AFUC 2LNVA 3M0TA 1RI0A 3ZEHA 4AFZC 1TUDA 1TU0B 4QVZA 3D7SB 3G6EQ 2P84A 5FU7C 2O88A 4KUIA 5AT1B 4A4EA 3CCLQ 3HSBA 4PLLA 1WX6A 5KYNA 4V2SA 3L2RA 1SHGA 3CCMT 5I2SA 4L5GA 1Y0MA 2VVKA 1VQKA 1SRMA 4Y92A 1H641 2LTOA 3SD4A 1BCOA 2CUBA 2P4TA 1M2VB 2D1XA 3G71A 2DNUA 2P0PA 2D9TA 5CK9A 1T0HA 1M4ZA 2R5AA 2ZPFB 1TG0A 3OYCA 3FIFA 3MEAA 4PFPA 4C92D 4OMPA 3CCLA 3CCQQ 4M78C 4JJNK 3L2VA 5GAMh 4IUQA 1WHLA 4LD6A 4N4IA 4J9FA 4MZTA 4X9DA 2M0YA 4M78A 2YDLA 2RI3A 1WHGA 3VUZA 1ZA1B 4C8QD 2I0NA 1PHTA 4EMKA 3M0QA 3JCMg 2WSCE 2DXCA 3DLLA 4LDXA 2MI6A 4CC4B 2JJ9A 1TUGB 1RACB 2MMPA 4M77G 2QDYB 2KXCA 4PJNA 3OYYA 3JB9F 2F5KA 3CBPA 2JM9A 3GNFB 1ZLMA 1G3WA 2R57A 3CXCP 2GBQA 3ME9A 3I56Q 4JLGA 4IKFA 3EHRA 4AT1B 2RQUA 2C0TA 3SEMA 4DBQA 1WXTA 2Y4XA 2CP6A 2FYKA 4M78B 1VQ6T 5LJ5f 1X2KA 2RNAA 4AFQC 3MEVA 1KC8R 1M3CA 4E47A 3CCEQ 2RA2A 2V26A 4BI3A 5CKHA 2JXBA 2J06A 3L2ZA 2RH2A 4XU0A 4BY6C 3LW5E 4HVUA 4J9IA 1H3HA 1X01A 3R6OA 2LQKA 3SHWA 2AZVA 4RG2A 4OMNA 4LDYA 2EIFA 2F69A 3MPUB 5GMKl 4JRQA 5GANe 3A8LB 2E64A 5J3BA 5KCOA 1G2BA 4FSSA 1Q82R 2RQRA 2DTIA 1AHJB 3BW1A 1DJ7B 1NEBA 1WFWA 3J7AF 2L2PA 5KCHA 3RMSA 1G8XA 2LP5A 1VQOT 4R56A 4F14A 2PVGB 4PFZA 4OVAA 1R8OB 2E65A 4WCIA 4N0AA 2RF0A 5LJ5h 1KC8C 1X27A 1K0SA 1Y96A 2QYZA 3QZ5B 4J7FA 1R0CB 2XKOC 4QT7A 2EVRA 2V1RA 1OPLA 3L42A 4C92E 4CRIA 1EX4A 2JN0A 4J9HA 2CUDA 3P8DA 2JS2A 3GPLA 3CCET 2LDMA 2OX7A 3HFOA 2J6KA 4PJOC 3VKIA 3BE3A 3RKYA 1I0CA 4C8QB 3E9FA 5HK0A 4XU3A 2EYYA 3X26B 1KD1R 1VQ4Q 4JRPA 1U1SA 2KE9A 3QBYA 1YJ9Q 3LGLA 1AWXA 1YJWA 2DTOA 4GY5A 2HD0A 3QZ9B 5IAYA 4C0DB 4M7AD 2KQWA 1RABB 4OGEA 2COZA 4MMLA 3URGA 4KH0B 4C8QC 2QA4T 2NUPB 3G6EA 1AVZC 1KQSS 3S3MA 3OYMA 4XQ3A 1YJWT 1Q86C 2KR3A 1QVGP 3OYGA 2VGMA 3M4GA 2DVJA 4RTVA 3EG9B 3LLRA 4C0DC 1UUEA 3H0IA 2RHYA 1BIBA 2RI2A 4HXJA 3OYJA 4FSXA 3C12A 3MHXA 2F2XA 4F7UG 3TREA 1WYXA 3CC2A 1HD3A 2E6ZA 1N5ZA 1YCSB 2DXUA 1N8RU 4M7DD 1RADB 2KXDA 3OSVA 3TU4K 1Q86U 3V7SA 1K9MR 3NTIA 4MDXA 2AT1B 2K2MA 4ESRA 2L0AA 1IRXA 3TQ7P 3LH0A 2PVOB 4ZN3A 1BI2A 2JMCA 2EQJA 4M75A 4M78E 2DM1A 2O4XB 1D1AA 2L3SA 2RJCA 3M54A 1SRLA 3NHNA 3PGGA 2DA9A 4ZGJB 3CPWP 4FW1A 3HP9A 4A53A 4KULA 1IZ6A 2DF6A 3THKA 3EGXA 2HCKA 2GCXA 3PVLA 3EFOA 1FXXA 1B07A 1D3BA 1UGQB 3M57A 4O6JA 1M5Q1 1D09B 1M3AA 2KRSA 2L3PA 2LMJA 1IGUA 2DL3A 4JUVA 4RTUA 1ACMB 3UT1A 2ZPHB 3LGFA 1PG5B 1YFNA 4JJBA 2VB6A 1YHQQ 1WHHA 1QMCA 2RJDA 1YCYA 3MP6A 4ZTJA 5A0DA 1NYFA 3QWYA 3ZFJA 2FPDA 2KVQG 1D1BA 4OB2B 1W2BS 3QSUA 1Q95G 1T3SA 3N5BB 1I81A 2MAMA 4OMOA 1FMWA 2J6FA 4XK8E 3UA7A 1WLPB 2CH4A 3CBMA 1G5VA 2ROTA 4XTYA 2QQRA 5GAOm 1YJNQ 1NPPA 3SWNA 1KK7A 1X2QA 1WDXA 1KG1A 4IIOA 1N6AA 4A4GA 2BE9B 5DM7R 2QEXA 2GFAA 4PJOD 3FRNA 2DBMA 3CCVT 3CCVA 3AHUA 2EJGA 4OB3B 4F7UE 2YWWA 5D6WA 2VASA 2JTMA 2PUKB 2F2VA 4RCCA 1QP3A 3NMZC 2F5TX 5FU6C 4C8QA 1IREB 1K9AA 4GLMA 2XICA 2X4XA 3X20B 3UDCA 4QW2A 3FEOA 3CC4T 2Y90A 5FRMA 2DLPA 2KYBA 3U23A 4J9GA 4ORZA 1IHWA 2M0OA 3SWNB 2KT1A 5GANf 1TS9A 4JLIA 2RJFA 4Q5WA 2ED1A 4LE9A 5EC7A 4F7UB 1E7OA 1B34B 3A98A 2FEIA 2CZ1B 2ZPGB 4J6YA 3CD6A 2KBTA 2MF2A 4HT9A 1RAIB 3CCQA 2YXYA 3VS6A 3G4SA 1I07A 2QQSA 5LJ3e 4Y91A 1KFZA 4RUGA 5IH2A 4RCBA 3JCMX 4KGVB 2JZ2A 3FJPA 4P5NA 3VUBA 1I8FA 2E5KA 1U1TA 2ZCFB 5GAOl 1HK9A 1MV0B 1M3BA 2RK1A 1YITA 2KI7A 4HT8A 5L8RE 1K0XA 2NUTB 3S3OA 1H8KA 2COWA 2EYXA 1PM3A 4X34A 1JO8A 1Y07A 1QQJA 2RK2A 3JCMJ 4IIMA 3JB9J 4J5YA 1B7TA 5GAMj 2LQNA 2MPXC 2HL5C 2KAFA 2KGTA 3OA6A 1KD1U 4PNOA 4A54A 3RR6A 4ZTFA 3EG1A 3CMEQ 1W2BP 4IUPA 1S72T 3QJ6A 5GMKm 3M0PA 1IGQA 3CC7Q 2M02A 4M75C 2COYA 3T9NA 3G6ET 2BKDN 2NYSA 3CPWA 4E7JA 5KYUB 4M7AC 2KNBB 4E7ZA 1TWBA 2AKLA 1I5OB 1ZUYA 1PCXA 1VIFA 5DLQE 4HCKA 1YIJT 2E6NA 3CQTA 2JTEA 3H6ZA 3VRYA 4XU1A 2DBKA 1P92A 4VUBA 3CD6Q 1AWJA 2QTXA 4Z89A 1AZGB 1G3TA 4LDVA 2O9VA 2KRMA 2FG0A 3MCAB 1N8RR 2LJ1A 5LJ5d 3ZL7C 1FMKA 4OMLA 4JRKA 2DVEA 1H92A 1RLQC 3OMGA 5KYUA 2OAUA 1UGRB 3WVDB 2CP2A 3OYIA 3KXTA 1H3ZA 2XHCA 1M90R 4KRTA 3SFMA 1NLPC 2QA4Q 3CC7T 1X75C 3RIRA 5GANh 4EPCA 1QLYA 4M75D 1VIEA 3EH2A 4XTWA 1K8AC 1EZZB 4NL2A 1C1AA 3UWNA 5KYYA 1KHIA 5FW9A 4EIKA 1UHFA 3META 1VQ8A 1MMGA 2RHUA 1AZEA 2DL8A 2QXFA 1K4US 1ZUKA 4OB1B 3EFOB 5CKDA 3JB9I 1VYTA 1JJ2A 1W6XA 2O4XA 5FU6B 5FWCA 2X4JA 1UJ0A 1PKTA 3A8OB 1UHCA 5I21A 3SB2A 2AHJB 2PVDB 3JCMc 2CH4W 2QQAA 2NUZA 2VC8A 4WTOB 4AG1C 3EFRA 2NWMA 1VQOQ 1K8AR 3VS1A 3OS1A 1Q81C 1YI2A 2MOXA 1BI3A 2XDBA 4LN2A 2RM4A 4II1A 2K4YA 2OAWA 5KYXB 3OYEA 1WPYA 4OF1A 1MHNA 1E6HA 3RKWA 3RNJA 4J83A 1GL5A 5IHNA 3V7CA 2YT6A 3I56T 1MNDA 4M4ZA 1VYUA 3NPFA 4Z88A 1VQPA 3OY9A 1XQHA 1I1JA 2FO0A 3R6NA 2LRQA 2X3WD 4Z8AA 2ABLA 1I4K1 4C5GA 3G4ST 1M8VA 3NGPA 3OYDA 4D8DA 4M7DB 2FZCB 5IT9E 1FWZA 3HRTA 5GAOp 3EHQA 4M7AE 1M8MA 1PKSA 1QCNA 2MWOA 5CKBA 2NUPA 3PT9A 3PTAA 4C8QE 2D0QB 5IXBA 1KIKA 1VQ5Q 1K1ZA 3G71Q 3TSWA 2FZKB 1KC8U 3OBWA 2CREA 4J6WA 1QVFA 1V1CA 1Q82C 1VQPT 4KGXB 2KY9A 1Z9QA 4PJOE 2XMFA 2FB7A 3VS0A 4PLIA 3O5ZA 2M9UA 2JT4A 2XDPA 4BE2A 3TVTA 2OI3A 4M7DC 3I5RA 3TEEA 1ZHIA 1YBYA 1UECA 3FDRA 2XD0A 2LJ0A 4BI4A 3OYBA 3DB4A 2R58A 3CCUQ 1YWOA 1FYNA 2HAXA 1IB8A 1OULA 2DXTA 2F2WA 2HQXA 5GMKh 3L2QA 5GANj 4QQGA 2Y4YA 4XTUA 2EKHA 4L59A 1ZSZC 4C8QG 2EPDA 2HZYA 3A8MB 2X9HA 3M56A 3OBYA 2BTTA 2EFIA 3MO8A 1FMVA 2DTHA 3PIPA 3NFCA 1YJ9T 1YHQA 5CIUA 2ESWA 1UJYA 1W70A 2HL3A 2AIRB 2DYIA 2WACA 3QJYA 3CMAT 1NE8A 1K73R 2RB6A 1Z9ZA 1GFCA 2GFUA 3MKDA 2A0FB 3VS4A 3M53A 3PFSA 1YJNA 2EQIA 2KYMA 3CCST 1VA7A 2C0OA 2CT4A 1RAGB 3NTKA 1PD1A 3REAB 5GAN7 2QG9B 4RTWA 3LH5A 5GMKj 2DETA 2E1HA 2G6FX 2NLUA 5AYFA 2X3XD 1UB4A 2HSPA 4ATOA 1NJIU 5GANg 3A8GB 2K3YA 3EFSA 2LCLA 4HVVA 3RMQA 2HBPA 2DAQA 1ZSGA 1KQ2A 2RHXA 4LNPA 3TCJA 2P0QA 2M1HA 2V8IA 1WQ7A 1BB9A 2MIOA 4LDWA 3JCMe 2DKGA 5GMKi 2OTJT 4E7LA 2HDAA 4DOWA 2DMOA 5A0LA 1WA7A 3BDUA 2CZ0B 3E2UA 2EYZA 4BDYA 3CC2Q 2CZ7B 3VRZA 4ME7A 1M1KU 3JCMW 1WZOA 2QDLA 1C0MA 4MMKA 3CCMQ 1X6BA 1RAFB 1GRIA 2V1QA 2JMAA 4CC3A 3V7RA 2JM8A 4FU6A 2EW3A 3QDFA 2XG8D 1VYVA 2KDSA 2ATCB 2DD5A 4NL3A 1SHFA 1AOJA 4C5IA 3GIBA 2YLBA 2J6OA 3OW2P 3BFMA 5KH6A 1K9MU 2LX7A 2HKQB 4E2FB 3PIOA 3I55A 2EJFA 4M77A 5D7UA 5LL6S 4M78D 2HEQA 1D0ZA 1RLPC 3M0SA 2LQ8A 3VS2A 4M7AF 4L6V5 4CC2A 2QQ9A 4D6WA 2ZPBB 4ZGDB 5GAN8 1YWPA 1OX8A 3OYAA 3GNGA 5KYXA 4CI0C 1QKWA 3M9QA 4JJCA 3WXMB 2LX9A 4F16A 3MP1A 2IG0A 5D6YA 1JXMA 5C0MA 2QK0A 5GAOr 1KJWA 1TXQA 4FM4B 3FJ5A 4PJOF 2MK5A 1EIFA 4JJDA 4M75G 2RN8A 4MZMA 3EAEA 2YUPA 1VQMA 3CBOA 3V8JA 2B8AA 2DIGA 2WSFE 1MMAA 2J7IA 4K11A 1VQLT 3OB9A 2QTVA 5A2QE 1QP2A 1V76A 4EMGA 1J3TA 1JXOA 5KYWA 4XTXA 4C92G 1IO6A 2X4WA 4C5HA 2C0IA 2O01E 1T0JA 1WI7A 5GAN4 4IURA 1WQWA 3VYGA 3CCQT 1ABOA 3OYNA 1WGSA 4EMHA 1UTIA 4F7UF 3E9GA 3TSZA 1SEMA 1X43A 1Y7XA 2AKKA 2DERA 4GBQA 2FHDA 1WHMA 4C92F 3V8LA 1CKAA 1OYXA 3FC3A 1ZBJA 4DEXA 2R5MA 3JB9H 1Y57A 3OSSC 3A1PA 1VQNA 1NG2A 2FPEA 2D8HA 2H3JA 1M1KC 1LOJA 2LZ6B 2K3BA 2QQBA 5J39A 3L1AA 1AT1B 5HY6A 2P0KA 2KEAA 1JBMA 2QEXQ 1VQ6Q 2VXFA 4J9BA 4Y28E 2CGHA 4B9WA 3GLXA 3EGDB 4E6RA 2PUOB 4HCCA 3VV0A 4C0ZA 1WIEA 3S6WA 4M77E 3C0CA 3BDLA 1JRIA 2CP0A 4B9XA 1T3LA 1XJWB 3CPFA 4ZNXA 4X9CA 2NUTA 4PK4A 4PJOA 2GGRA 4FW2A 1M27C 3QXEB 1I5LA 1JJ2S 2EBPA 1PSFA 3VU3C 4E7SA 4M7DG 3WVEB 4LUDA 3JB9D 1XOVA 3I55T 4E7KA 2WSEE 2QASA 1PRMC 2DXBA 2EJ9A 4RMOA 4FT4A 1O9SA 2RD1A 2V8KA 1VQ9Q 1YP5A 3LX7A 2JNGA 2YRVA 3I56A 1N8RC 1UE9A 1VQ7T 1QWEA 1JU5C 2K79A 4EMKC 3JCMh 1WXUA 1S72Q 1GXIE 4A4KA 1BIAA 4FYWB 2L5QA 3RESA 4M7AB 2LJ3A 5CKFA 4IUTA 4BE1A 1OI1A 2KSSA 1Q81U 2W10A 1BYMA 4M77B 1PD0A 3SDZA 2DILA 2P4RA 4M7DE 1U5SA 2OTJA 2K5IA 3EGXB 2B86A 1YIJQ 1QCFA 2RPNA 5CQXA 2VV5A 1MMDA 3L2WA 2OTLA 4F17A 3CMEA 2E3HA 5GAOq 2LT1A 4XTZA 4ELYC 2EYWA 1X69A 4FYVB 2E12A 2LCCA 1VQ4T 3CCJQ 5GAN3 1KHCA 1VQ8T 2E3IA 4HVWA 1K9MC 2G3RA 1U06A 1C6VX 4FT2A 5IHIA 2RHZA 2BUDA 1BI1A 1GCPA 1OV3A 5HK3A 3OS5A 2DYBA 4AMCA 3QKJA 5KYWB 4QVCA 5I11A 1K73U 1HYOA 1TOVA 3H0HA 2M16A 3CMAA 4JS4A 3CC7A 2KMTA 2JW4A 3UF4A 1SSFA 1NZ9A 2VUBA 1SSHA 1YHQT 2YUNA 5CAIA 1CKBA 1YJ9A 4E7IA 5LJ3g 3G4SQ 3SWNC 3PE0A 1KQ1A 1MNEA 2K7AA 2L3QA 4Z02A 4DBRA 1D3BB 4OB0B 4AG2C 1JJ2P 2ZGWA 2L8DA 1RAEB 1K73C 4PL6A 5LJ3d 4J9CA 2RQWA 4M78F 2PTKA 3FB9A 4KBMB 1TUCA 2YUOA 3H8ZA 1KSWA 1XNIA 4PJLA 1NEGA 2L3RA 1QCOA 2EGAA 1K76A 1IHVA 2HNIA 2KK4A 1R0BG 4J8OA 4WF2A 1VQ7A 1AD5A 1UDLA 4XAXB
chains in the Genus database with same CATH topology
2DTHA 3M5AA 4EDUA 4BD3A 3PIPA 4PJOB 3NFCA 2GCXA 1VQNT 2RI5A 3NTHA 4XTVA 4KUDK 2K3XA 1YJ9T 1QVPA 4N4GA 1YHQA 1FXXA 2EYQA 5CIUA 2DD4A 3INZA 1WJQA 1D3BA 1UGQB 2DZ9A 3M57A 1M5Q1 4O6JA 3LWHA 1VQOA 4A4FA 3JCMf 3L2UA 1N27A 1ZQ1A 2XK0A 4JUVA 1UEBA 2WACA 3QJYA 3UT1A 2ZPHB 1VQ9A 3LGFA 3CMAT 3M4YA 2XDDA 1G3YA 1NE8A 2RB6A 2DK3A 1Q7YC 3JB9G 5DLOA 2GFUA 1W4SA 2RJDA 1YCYA 3MP6A 3PNWC 4FIBA 5A0DA 4ZTJA 1KQSA 3QO3A 3M53A 3PFSA 3ZFJA 3X24B 4OB2B 2KVQG 1YJNA 2JVVA 2QA4A 1W2BS 2VXEA 3CCST 3QSUA 3HPWA 3NTKA 3N5BB 1I81A 2MAMA 4XK8E 3S3NA 2C06A 5GAN7 3CCEA 3CCRT 5GAN5 3CBMA 5GAN2 4IUVA 5GMKj 1Q7YU 4NS5A 2E1HA 2EQKA 2NLUA 4XTYA 5AYFA 1G5VA 1S72A 5GAOn 2CS7A 1UB4A 5FU7B 3JCMb 2QQRA 3DLMA 2PQWA 3RKXA 4ATOA 5GAOm 4BACA 5GANg 1NJIU 1NPPA 3A8GB 3SWNA 4C0GA 2K3YA 3O8VA 1KG1A 3EFSA 2LCLA 1N6AA 4A4GA 4ELZC 3OYHA 3RMQA 5DM7R 2QEXA 1VQMT 2GFAA 4DA4A 2HBPA 4PJOD 4M77D 4XU2A 3FRNA 1W2BA 3OYLA 2DAQA 3CCVA 3CCVT 4DQ2A 3X28B 3RERA 1KQ2A 1MGQA 3MP8A 1Y96B 2IVWA 1YITT 2RHXA 3G7ZA 2EJGA 4M75B 4OB3B 4F7UE 3TCJA 1VQ6A 3AHUA 5D6WA 2P0QA 2M1HA 2V8IA 3OYKA 4JDSA 1WQ7A 2MWPA 2RJEA 2JTMA 4LDWA 3JCMe 3HL8A 4MZPA 2DKGA 1NJIC 2PUKB 5GMKi 4M7DF 4RCCA 4E7LA 2OTJT 4DOWA 2GF7A 1FX7A 1QP3A 5A0LA 3BDUA 2CZ0B 3FLGA 2F5TX 4N0AC 5FU6C 4BDYA 3QPHA 4C8QA 5LJ5j 1UGPB 1IREB 1U8RA 2CZ7B 2PU9B 2E10A 4ME7A 3OS2A 2XICA 4M77C 1M1KU 3JCMW 2X4XA 2E41A 4EMKB 4MMKA 3X20B 3UDCA 2D6FA 2L89A 4QW2A 3QDRB 3FEOA 1WJSA 5CVIA 2Y90A 3CXCS 4J7IA 3CC4T 5FRMA 3M59A 4C8QF 5FROA 3V7RA 2BIVA 4QQ6A 1VQ9T 4RG8A 4KT0E 2M0OA 4BI8B 4FU6A 1BI0A 1NPRA 2JOYA 2XG8D 3MEUA 3CEYA 3SWNB 5HKCA 2RHIA 2K5FA 2KDSA 2XIDA 3DB3A 4JLIA 2RJFA 4Q5WA 5IN1A 3VYHB 5GANf 4C92C 2E70A 2E5QA 2JTFA 4F7UB 3CC4A 1B34B 3ER0A 3X25B 3M55A 3JSCA 3QUIA 3HRUA 2ZPGB 2CZ1B 5M9OA 4J6YA 2DD5A 3CD6A 1OZ2A 4NL3A 4BY6B 2MF2A 4HT9A 1X6OA 1Q82U 4C5IA 3GIBA 3CD6T 3JCMV 2YLBA 3CCQA 2VYTA 4UC4A 3QG1A 5CR2A 1QW1A 3ZBDA 3G4SA 4M78G 4QVDA 1M1FA 1ZBXA 2QQSA 5LJ3e 3BFMA 4Y91A 5CCAA 5KH6A 1K9MU 3CCLT 3J81E 5LJ5g 4J6XA 4RCBA 3JCMX 2QI2A 3PIOA 3M58A 4JRIA 2EJFA 2JZ2A 3FJPA 4M77A 4P5NA 5LL6S 3VUBA 4M78D 1I8FA 3E1SA 1U1TA 2ZCFB 5DY9A 3LYIA 5KE2A 1VQ4A 1VQ5T 4KULA 3HRSA 4BE0A 5GAOl 1HK9A 3G71T 4BB7A 2LQ8A 3CCJT 3OS0A 4M7AF 4L6V5 2RK1A 1YITA 2QQ9A 4C0FA 4D6WA 4HT8A 2ZPBB 5L8RE 3CMET 3OW2A 4ZGDB 5GAN8 3CCUA 2JUFA 4M77F 4OP0A 3S3OA 3OYAA 3GNGA 4C92B 4X34A 3JAME 4CI0C 4HCBA 2K2VA 1UGSB 3KBGA 1Y07A 2LNVA 3M9QA 2RK2A 5GANd 3JCMJ 1RI0A 2ZPIB 3ZEHA 3WXMB 2LX9A 3JB9J 4J5YA 4QVZA 5GAMj 3MP1A 3KUFA 4C5EA 2IG0A 4TVRA 5D6YA 3F70A 5FU7C 2KAFA 5C0MA 4KUIA 4A4EA 5GAOr 3HSBA 4PLLA 4V2SA 3OA6A 4FM4B 3L2RA 3CCMT 5I2MA 5I2SA 4L5GA 4PJOF 1KD1U 1EIFA 3RUXA 3CCUT 4PNOA 4M75G 4MZMA 4A54A 1VQKA 1PSEA 2YLCA 1H641 3EAEA 3ASKA 2LTOA 4ZTFA 3CBOA 3SD4A 3V8JA 1VQMA 2B8AA 2CYZB 2P4TA 2DIGA 4IUPA 2WSFE 3G71A 2P0PA 2D9TA 4GLKA 5CK9A 1M4ZA 3I55A 3OB9A 1VQLT 5A2QE 1QP2A 2R5AA 5D6XA 5LJ3h 2ZPFB 4EMGA 1YIJA 3OYCA 1S72T 2DZCA 4XTXA 3FIFA 3MEAA 3QJ6A 4C92D 4C92G 2X4WA 5GMKm 2EQMA 3CCLA 4C5HA 2DEQA 4M78C 4JJNK 1N9SA 2O01E 5GAMh 4IUQA 3L2VA 2I2LA 3JCMd 5GAN4 4IURA 4M75C 3T9NA 3G6ET 2EKOA 1WQWA 4LD6A 4N4IA 2BKDN 2LVMA 3VYGA 3CCQT 3CCSA 3OYNA 1WGSA 4MZTA 4X9DA 4EMHA 1YJNT 4F7UF 3CPWA 4E7JA 3E9GA 4M78A 4M7AC 4F7UA 5LJ5e 2EAYA 2GQVA 2XU8A 2RI3A 1Y7XA 3VUZA 4C8QD 1K8AU 1VQKT 4NOYA 2EQUA 2FHDA 4EMKA 3JCMg 4BUGA 4DOVA 4C92F 3CCMA 3V8LA 2ZZDA 2WSCE 1OYXA 3FC3A 4IUUA 1QVFS 2DXCA 1VIFA 5DLQE 3GOXA 3DLLA 4LDXA 2MI6A 5CKEA 2R5MA 1YIJT 3JB9H 3Q1JA 3OSSC 3J80E 2MMPA 2OTLT 3OW2S 2DO3A 4M77G 1VQNA 2E6NA 2H3JA 1M1KC 2QDYB 1LOJA 3H6ZA 3OYYA 3JB9F 2F5KA 3CBPA 4XU1A 1HXDA 2QQBA 5J39A 3CC2T 3GF5A 3GNFB 1G3WA 1P92A 2R57A 4VUBA 3E19A 2QTXA 3L1AA 3ME9A 2LC4A 3UPUA 4JLGA 4IKFA 2A7YA 1G3TA 4BDZA 4LDVA 5HY6A 2P0KA 5GAMg 4OMFB 3MCAB 4M75E 1JBMA 4N4HA 5LJ3f 2VXFA 4Y28E 4B9WA 2CGHA 5LJ5d 3GLXA 3P8BB 3LWIA 3GP8A 3MEWA 2DIQA 3QYHB 4JRKA 2X4YA 2FYKA 2DVEA 2PUOB 2Y4XA 4HCCA 4FL6A 3OMGA 2EWNA 4M78B 3VV0A 3S6WA 4C0ZA 1VQ6T 2OAUA 5LJ5f 4M77E 1UGRB 1O75A 3MEVA 3BDLA 1JRIA 3WVDB 4B9XA 4E47A 3OYIA 2RA2A 3KXTA 4BI3A 4M7DA 5CKHA 1M90C 3L2ZA 2RH2A 4XU0A 4BY6C 2XHCA 4E7HA 3CPFA 1H3ZA 3LW5E 3V8KA 4X9CA 1X01A 3R6OA 4PJOA 3SFMA 3CC7T 2LQKA 4PJOG 3QXEB 1I5LA 1X75C 3RIRA 5GANh 1JJ2S 1B34A 4EPCA 1PSFA 4RG2A 3VU3C 5FRNA 4LDYA 4M75D 4M7DG 2EIFA 2F69A 1VIEA 5EG2A 3WVEB 1XOVA 5GMKl 3I55T 4JRQA 2WSEE 4XTWA 4E7KA 3JB9D 1K8AC 5GANe 1M90U 1N9RA 2DXBA 3A8LB 2E64A 5J3BA 4NL2A 2EJ9A 3OMCA 4RMOA 1QVGS 5KCOA 4FT4A 3UWNA 3CXCA 3C4SA 1O9SA 2RD1A 1KHIA 2DTIA 2V8KA 3C94A 1AHJB 3JCMQ 3OYFA 3LX7A 3BW1A 1DJ7B 2JNGA 2YRVA 4R55A 3META 4M7AA 1BKBA 3I56A 1VQ8A 5FLXE 2RHUA 4M75F 1N8RC 3J7AF 1VQ7T 5KCHA 2XI9A 3RMSA 2QXFA 1VQOT 4R56A 4EMKC 4OB1B 3JCMh 2PVGB 1GXIE 5CKDA 1LJOA 4A4KA 3JB9I 1BIAA 2A3LA 4OVAA 1JJ2A 1VUBA 1R8OB 2E65A 2L5QA 3RESA 2O4XA 4M7AB 5FU6B 5CKFA 4N0AA 4IUTA 5LJ5h 5KE3A 4BE1A 1KC8C 1Y71A 1OI1A 2KSSA 2YHTA 1Q81U 1Y96A 1TH7A 3QZ5B 4J7FA 2X4JA 1BYMA 4M77B 1LNXA 2XKOC 1RL2A 3SDZA 3A8OB 3JRZA 4ZGEB 5I21A 3BY7A 3L42A 3SB2A 4C92E 2AHJB 4CRIA 2JN0A 2PVDB 3JCMc 4M7DE 2QQAA 4LD9K 2VC8A 2OTJA 2K5IA 3P8DA 3GPLA 3EFRA 3CCRA 2LDMA 4PKCC 3CCET 3C95A 3HFOA 3OS1A 1Q81C 1YI2A 1BI3A 2XDBA 5LJ3j 2RM4A 4PJOC 3VKIA 5CQXA 3RKYA 3CPWS 4C8QB 4II1A 1YI2T 2K4YA 1OZ3A 2VV5A 3E9FA 3L2WA 1XTDA 2OTLA 4C92A 3OYEA 5HK0A 1V29B 1WPYA 4OF1A 2DPPB 4XU3A 1MHNA 3CMEA 3X26B 2LT1A 5GAOq 4XTZA 3RKWA 4ELYC 2QEXT 4J83A 2ZPEB 4JRPA 1U1SA 3QBYA 3HFNA 3CCJA 3LGLA 2E12A 2LCCA 3QYGB 3V7CA 1VQ4T 1VQ5A 5GAN3 1KHCA 5C6SA 4RKUE 2X35A 1G3SA 3I56T 1YJWA 1K9MC 1VQ8T 2G3RA 3QHSA 4HCZA 2DTOA 2CZ6B 2HD0A 3QZ9B 4GY5A 3OY9A 1XQHA 1VQPA 5IAYA 4FT2A 2RHZA 4C0DB 2BUDA 1BI1A 4M7AD 2KQWA 2LRQA 1I4K1 3OQ5A 4OGEA 4C5GA 3G4ST 1M8VA 4MMLA 3URGA 3OYDA 4C8QC 5HK3A 2K57A 2QA4T 3OS5A 3G6EA 5J26A 3QKJA 5GAMe 4M7DB 1KQSS 3S3MA 5IT9E 3OYMA 1FWZA 4QVCA 3HRTA 5GAOp 2VGNA 4M7AE 1K73U 4XQ3A 1YJWT 2M16A 4HKEA 3CMAA 2MWOA 1Q86C 4JS4A 3HHTB 3CC7A 2KMTA 1WJRA 5CKBA 3DKMA 3PT9A 3OYGA 4C8QE 2D0QB 3PTAA 1VQLA 1SSFA 2VGMA 3M4GA 3LLRA 1NZ9A 5CQYA 4C0DC 2VUBA 2RHYA 1BIBA 2RI2A 5A0GA 1KC8U 1YHQT 3OBWA 4MDWA 5CAIA 4OGCA 1YJ9A 3OYJA 4FSXA 3C12A 3MHXA 3PMIA 4E7IA 4F7UG 3TREA 1KD1C 4J6WA 1QVFA 5LJ3g 1Q82C 3PMTA 1VQPT 3CC2A 2K5LA 2E6ZA 2KY9A 3QIIA 4YTLA 1QVGA 4PJOE 1JB0E 1M1GA 2V8JA 1KQ1A 3SWNC 4M7AG 2FB7A 2DXUA 4PLIA 4Z02A 1N8RU 4M7DD 1D3BB 4OB0B 3OSVA 3TU4K 2DJZA 2M9UA 2ZGWA 2L8DA 2XDPA 4BE2A 1Q86U 3V7SA 3P8HA 2CKKA 3NTIA 4ZN1A 4JS5A 4M7DC 2FL7A 4MDXA 1K73C 4PL6A 1ZHIA 5LJ3d 5CO7A 1YBYA 3TEEA 3A5ZB 3FDRA 2XD0A 4BI4A 4LDUA 2HQEA 4M78F 2LT4A 3OYBA 3LH0A 3DB4A 2PVOB 4ZN3A 1M9SA 2R58A 1BI2A 3A8HB 3FB9A 4O5VA 4KBMB 2EQJA 3H8ZA 4M75A 4M78E 3VJPA 2HAXA 1WNLA 1XNIA 2DXTA 2O4XB 5GAN6 2HQXA 5GAMf 2L3RA 2RJCA 3M54A 4A4HA 5GMKh 3L2QA 3JCMP 5GANj 2HNIA 4QQGA 3PGGA 2KK4A 2Y4YA 4XTUA 5GAMd 4L59A 4HA8A 4ZGJB 4C8QG 4J8OA 3HKSA 4WF2A 3A8MB 1VQ7A 5GMKe 3M56A 3OBYA 4QQDA 2FVUA 2EFIA 4XAXB 2RO0A 3HP9A 4A53A 1IZ6A 3MO8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DTH A;  4NL3 A;  5LJ3 j;  2RM4 A;  4PJO B;  4HT9 A;  4PJO C;  1LOJ A;  3GIB A;  4XTV A;  3RKY A;  2YLB A;  3JCM V;  4C8Q B;  3JB9 F;  4XU1 A;  1HXD A;  4C92 A;  4M78 G;  1WPY A;  4XU3 A;  4QVD A;  3INZ A;  5GAO q;  5LJ3 e;  3BFM A;  4XTZ A;  1D3B A;  3RKW A;  2DZ9 A;  4Y91 A;  1M5Q 1;  2QTX A;  3L1A A;  1U1S A;  3HFN A;  5LJ5 g;  4J6X A;  4RCB A;  3JCM X;  4JRI A;  3JCM f;  2EJF A;  4M75 E;  1JBM A;  3FJP A;  4M77 G;  4M77 A;  4JUV A;  3V7C A;  5GAN 3;  4M78 D;  1I8F A;  5LJ3 f;  2VXF A;  1U1T A;  2CGH A;  5DY9 A;  5LJ5 d;  3QHS A;  2DTO A;  2RB6 A;  1HK9 A;  5GAO l;  4JRK A;  2FYK A;  2DVE A;  4M78 B;  2EWN A;  4M7A F;  1YCY A;  5LJ5 f;  4HT8 A;  3QO3 A;  4M77 E;  4M7A D;  1I4K 1;  5GAM g;  1M8V A;  1JRI A;  4MML A;  5GAN 8;  2RA2 A;  4C8Q C;  4M77 F;  2K57 A;  2VXE A;  4OP0 A;  3L2Z A;  4M7D A;  3QSU A;  4XU0 A;  4C92 B;  5GAM e;  4M7D B;  3V8K A;  1I81 A;  4X9C A;  1X01 A;  4PJO A;  4QVC A;  5GAN 7;  5GAO p;  5GAN d;  5GAN 5;  3JCM J;  4PJO G;  5GAN 2;  4M7A E;  1I5L A;  4XQ3 A;  3RIR A;  5GMK j;  5GAN h;  2E1H A;  4J5Y A;  4XTY A;  5GAM j;  1B34 A;  3JB9 J;  3VU3 C;  5GAO n;  3JCM b;  4M75 D;  3RKX A;  4M7D G;  5GAO r;  5GAO m;  3JB9 G;  5GMK l;  5GAN g;  3JB9 D;  3HSB A;  4C8Q E;  4V2S A;  4XTW A;  3SWN A;  3M4G A;  5GAN e;  3EFS A;  4PJO F;  1N9R A;  2E64 A;  3RUX A;  4PJO D;  4M77 D;  4NL2 A;  2EJ9 A;  4PNO A;  4XU2 A;  4M75 G;  1BIB A;  4A54 A;  4DQ2 A;  3RER A;  1KQ2 A;  2RD1 A;  2YLC A;  1H64 1;  1MGQ A;  5CAI A;  1Y96 B;  2DTI A;  3V8J A;  4M75 B;  2EJG A;  4F7U G;  3JCM Q;  4F7U E;  4J6W A;  3AHU A;  5LJ3 g;  3BW1 A;  1WQ7 A;  4M7A A;  3JCM e;  2DKG A;  4PJO E;  5LJ3 h;  4EMG A;  3SWN C;  1KQ1 A;  4M75 F;  5GMK i;  2FB7 A;  4RCC A;  2DXU A;  2DZC A;  4M7A G;  4M7D F;  4M7D D;  1D3B B;  4XTX A;  3FIF A;  4C92 D;  3BDU A;  4C92 G;  5GMK m;  2DJZ A;  2ZGW A;  4N0A C;  4EMK C;  2DEQ A;  4M78 C;  3JCM h;  1N9S A;  5GAM h;  3V7S A;  3JB9 I;  1LJO A;  2I2L A;  3JCM d;  4C8Q A;  5GAN 4;  4M75 C;  5LJ5 j;  4M7D C;  1BIA A;  1WQW A;  5LJ3 d;  2E10 A;  2E65 A;  4X9D A;  4M77 C;  3RES A;  4EMH A;  4F7U F;  3JCM W;  4M78 A;  2E41 A;  4M78 F;  4M7A B;  4MMK A;  4EMK B;  4F7U A;  4M7A C;  5LJ5 e;  2EAY A;  4N0A A;  5LJ5 h;  3FB9 A;  4C8Q D;  4M75 A;  2Y90 A;  2YHT A;  4M78 E;  4NOY A;  1Y96 A;  4C8Q F;  1TH7 A;  1WNL A;  2DXT A;  1LNX A;  4M77 B;  4EMK A;  5GAN 6;  3V7R A;  3JCM g;  5GAM f;  4C92 F;  5GMK h;  5I21 A;  3V8L A;  3BY7 A;  3JCM P;  5GAN j;  3SB2 A;  4C92 E;  2HNI A;  3SWN B;  2JN0 A;  3PGG A;  3JCM c;  4XTU A;  5GAM d;  5GAN f;  4HA8 A;  4JLI A;  4M7D E;  4C8Q G;  4WF2 A;  2VC8 A;  4C92 C;  5GMK e;  4F7U B;  3EFR A;  3JB9 H;  1B34 B;  3QUI A;  4A53 A;  3HFO A;  4J6Y A; 
#chains in the Genus database with same CATH topology
 2F1L A;  4BD3 A;  4PJO B;  1VQN T;  4XTV A;  1M1K R;  4KUD K;  4N4G A;  2EYQ A;  2DD4 A;  3INZ A;  1WJQ A;  1LVK A;  1TSF A;  1YI2 Q;  2DZ9 A;  3I9Q A;  3CC4 Q;  1VQO A;  3JCM f;  4ANJ A;  2JS0 A;  1UEB A;  1PWT A;  1VQ9 A;  3M4Y A;  2XDD A;  4OMM A;  2DK3 A;  1Q7Y C;  2ENM A;  5KYY B;  1W4S A;  4FIB A;  3QO3 A;  3X24 B;  2JVV A;  3AT1 B;  2VXE A;  1BU1 A;  3HTR A;  3HPW A;  1EFN A;  2RQT A;  4RTY A;  3CCE A;  5GAN 2;  4IUV A;  1Q7Y U;  5GAO n;  2CS7 A;  5FU7 B;  3DLM A;  3RKX A;  2D8J A;  8ATC B;  3OYH A;  1VQM T;  1IXD A;  1BCM A;  4XU2 A;  2BZ8 A;  2A08 A;  4DQ2 A;  3X28 B;  1MGQ A;  3MP8 A;  4J9D A;  1JEG A;  2IVW A;  1U3O A;  1YIT T;  4M75 B;  1VQ6 A;  1ABQ A;  4JDS A;  2RJE A;  1PRL C;  2FPF A;  3JV3 A;  3HL8 A;  3G1J A;  4MZP A;  1NJI C;  1QVF P;  4DEY A;  2GF7 A;  1BBZ A;  3FLG A;  1RUW A;  4N0A C;  5LJ5 j;  1YN8 A;  3OS2 A;  2E41 A;  2D6F A;  3QDR B;  1WJS A;  3IQL A;  3M59 A;  4C8Q F;  5FRO A;  4QQ6 A;  1VQ9 T;  4RG8 A;  4KT0 E;  5IXF A;  1Q86 R;  1BI0 A;  2DRM A;  3MEU A;  3CEY A;  1SF9 A;  3VYH B;  2XID A;  3DB3 A;  2W0Z A;  5IN1 A;  2E70 A;  2E5Q A;  4D8K A;  3CC4 A;  3ER0 A;  4OMQ A;  5M9O A;  6AT1 B;  1LCK A;  2O2O A;  1OZ2 A;  1OX9 A;  1X6O A;  1ZX6 A;  2VYT A;  4UC4 A;  2CP7 A;  5CR2 A;  4M78 G;  1M1F A;  1R77 A;  3VS7 A;  3CCL T;  3J81 E;  5LJ5 g;  2GNC A;  4J6X A;  2A28 A;  4JRI A;  2O9S A;  3EG9 A;  3E1S A;  1VQ5 T;  5DY9 A;  3HRS A;  4BE0 A;  3G71 T;  4BB7 A;  3CCJ T;  2LQW A;  2A36 A;  3H41 A;  4C0F A;  1VQL Q;  2JUF A;  4M77 F;  4OP0 A;  4PFO A;  3CCR Q;  3JAM E;  2K2V A;  3KBG A;  1E6G A;  5GAN d;  2ZPI B;  1S1N A;  8AT1 B;  3KUF A;  4C5E A;  4TVR A;  3F70 A;  3EGD A;  5I2M A;  2SRC A;  4FCY A;  3RUX A;  3CCU T;  1PSE A;  2YLC A;  3ASK A;  4JPB W;  2CYZ B;  2DL4 A;  4GLK A;  5D6X A;  2DEU A;  5LJ3 h;  1YIJ A;  1GCQ A;  2DZC A;  2EQM A;  2DEQ A;  1BK2 A;  1N9S A;  5GJW B;  1OU8 A;  2I2L A;  4DBF A;  3JCM d;  3I5S A;  2EKO A;  3GBQ A;  3CCS A;  2LVM A;  2H3E B;  1YJN T;  4F7U A;  1WXB A;  2GTO A;  2EAY A;  2GQV A;  3H9N A;  5LJ5 e;  2XU8 A;  2DJQ A;  1VQK T;  1K8A U;  4NOY A;  2EQU A;  1NLO C;  4BUG A;  4DOV A;  3CCM A;  1OEB A;  2ZZD A;  2ROL A;  4IUU A;  1TTH B;  1QVF S;  3GOX A;  4X1V A;  5CKE A;  4LUE A;  3Q1J A;  3J80 E;  3QWX X;  2OTL T;  3OW2 S;  2DO3 A;  3EH1 A;  1OQK A;  1JQQ A;  1AWO A;  4QKU A;  1M2V A;  4F04 B;  2OTL Q;  1HXD A;  4RTX A;  2YSQ A;  3GF5 A;  3E19 A;  2LC4 A;  3UPU A;  1VQ8 Q;  2A7Y A;  4BDZ A;  1HJD A;  5GAM g;  4OMF B;  4M75 E;  5LJ3 f;  4N4H A;  2IIM A;  4FYY B;  2RMO A;  3P8B B;  3M0R A;  1NYG A;  3LWI A;  3GP8 A;  3MEW A;  2DIQ A;  3QYH B;  2X4Y A;  2HKN A;  4FL6 A;  1B3Q A;  2EWN A;  2DRK A;  2YRD A;  1O75 A;  1X6G A;  1GCQ C;  4M7D A;  1M90 C;  4E7H A;  1VQ7 Q;  3V8K A;  2YRC A;  5IHK A;  1UG1 A;  3ULR B;  4PJO G;  4CC7 A;  2CSQ A;  4FYX B;  1B34 A;  2D0N A;  2ECZ A;  5FRN A;  1KQS P;  5EG2 A;  4B6M A;  3JB9 G;  1RI9 A;  1M90 U;  2KT8 A;  1N9R A;  2ZAE A;  5I22 A;  1GFD A;  3OMC A;  1QVG S;  3CXC A;  3C4S A;  3C94 A;  3JCM Q;  3OYF A;  2YUQ A;  4DBH A;  4KH1 B;  4R55 A;  2VKN A;  4M7A A;  1BKB A;  2MYS A;  3RDV A;  5FLX E;  4M75 F;  2AZS A;  2XI9 A;  1LJO A;  3M0U A;  2A3L A;  2QGF B;  1VUB A;  2OJ2 A;  5KE3 A;  1Y71 A;  2YHT A;  2GTJ A;  1TH7 A;  1LNX A;  1WHK A;  1RL2 A;  1YNZ A;  2CP3 A;  3JRZ A;  4ZGE B;  2IPO B;  3BY7 A;  1G83 A;  1RAA B;  3UA6 A;  4LD9 K;  1UGV A;  3CCR A;  3EGU A;  4PKC C;  1Q81 R;  3C95 A;  2FZG B;  1GBR A;  5LJ3 j;  1YI2 T;  3CPW S;  1OZ3 A;  1XTD A;  4C92 A;  3VS3 A;  2HMA A;  1V29 B;  2DPP B;  1D1C A;  2KRO A;  1YJW Q;  1AEY A;  3PVQ A;  1VQN Q;  2QEX T;  2ZPE B;  3HFN A;  3CCJ A;  1SPK A;  3H0F A;  1RAH B;  2CDT A;  3QYG B;  1VQ5 A;  4KGZ B;  2CP5 A;  5C6S A;  5L23 A;  4RKU E;  2X35 A;  1G3S A;  5FWB A;  1Q7Y R;  3QHS A;  4HCZ A;  2HBW A;  7AT1 B;  2CZ6 B;  1QKX A;  3OQ5 A;  2K57 A;  1NM7 A;  5J26 A;  5GAM e;  1OOT A;  2VGN A;  1WHJ A;  2LCS A;  4HKE A;  3HHT B;  1WJR A;  1ARK A;  3DKM A;  1VQL A;  2LNH B;  2J05 A;  5CQY A;  1YIT Q;  3I55 Q;  4J9E A;  1VQP Q;  5A0G A;  4MDW A;  4OGC A;  3PMI A;  1VQM Q;  1KD1 C;  3PMT A;  1D0Y A;  2K5L A;  4YTL A;  2ED0 A;  3QII A;  5GJV B;  1QVG A;  4R0K A;  1JB0 E;  1M1G A;  2DL5 A;  2V8J A;  4M7A G;  3EG2 A;  2K6D A;  2DJZ A;  2PNI A;  3P8H A;  2CKK A;  4ZN1 A;  4JS5 A;  2FL7 A;  5CO7 A;  2H8H A;  3A5Z B;  2BE7 D;  4LDU A;  2HQE A;  2LT4 A;  2E4H A;  1M9S A;  1M30 A;  4O5V A;  3A8H B;  3VJP A;  4AFS C;  1WNL A;  2A37 A;  5GAN 6;  5GAM f;  4A4H A;  1GBQ A;  3JCM P;  2X51 A;  5GAM d;  2DE0 X;  2RQV A;  4HA8 A;  3HKS A;  2QGG A;  5GMK e;  4QQD A;  2FVU A;  1PC0 A;  3I35 A;  2HSE B;  2RO0 A;  3CC2 T;  2Z0W A;  3M5A A;  4EDU A;  3MJX A;  3KFV A;  2RI5 A;  3NTH A;  4PJJ A;  2K3X A;  1QVP A;  5ECA A;  4RTT A;  1PNJ A;  1LPL A;  2HQH A;  4RTZ A;  1NBE B;  3LWH A;  2FRW A;  1NJI R;  4A4F A;  3L2U A;  1VOM A;  2EGE A;  1MUZ A;  1N27 A;  1ZQ1 A;  2XK0 A;  1W1F A;  1G3Y A;  1ZA2 B;  2KRN A;  3VS5 A;  1MV3 A;  3CCV Q;  1SG5 A;  5DLO A;  1MMN A;  2DFU A;  3PNW C;  1KQS A;  2K9G A;  2QA4 A;  1ZSZ B;  1QWF A;  1OU9 A;  5HCK A;  2DX1 A;  4LXC A;  3S3N A;  1AWW A;  2C06 A;  3CCR T;  5GAN 5;  4NS5 A;  2EQK A;  3REB B;  1S72 A;  2PZ1 A;  2QAZ A;  3JCM b;  2PQW A;  3EG0 A;  4BAC A;  3RBB B;  4A63 B;  4C0G A;  3O8V A;  1M2O A;  4ELZ C;  2M51 A;  4DA4 A;  4M77 D;  1W2B A;  3OYL A;  3RER A;  2EGC A;  1Y96 B;  3G7Z A;  3OYK A;  2MWP A;  1UFF A;  1D0X A;  4M7D F;  4JZ4 A;  1FX7 A;  3QPH A;  2SEM A;  1UGP B;  2BZY A;  1U8R A;  2PU9 B;  2E10 A;  1VQK Q;  4M77 C;  1OPK A;  4EMK B;  9ATC B;  2L89 A;  3CXC S;  5CVI A;  4J7I A;  2GQI A;  1A0N B;  2DL7 A;  2BIV A;  1F1B B;  3CMA Q;  4BI8 B;  1NPR A;  2JOY A;  5HKC A;  2RHI A;  2K5F A;  4C92 C;  2JTF A;  2CSI A;  3X25 B;  3M55 A;  3JSC A;  3QUI A;  3CCS Q;  3HRU A;  4BY6 B;  1Q82 U;  3CD6 T;  3JCM V;  2CT3 A;  3QG1 A;  1QW1 A;  3ZBD A;  4QVD A;  1ZSZ A;  1ZBX A;  5CCA A;  1HSQ A;  2AK5 A;  2QI2 A;  3M58 A;  5KE2 A;  2MCN A;  1ZUU A;  1VQ4 A;  3LYI A;  4JZ3 A;  2VWF A;  3UAT A;  3OS0 A;  1SKU B;  4PJM A;  1CSK A;  2FRY A;  3CME T;  3OW2 A;  3CCU A;  2BZX A;  2O31 A;  4C92 B;  3EG3 A;  2OTJ Q;  4HCB A;  1UGS B;  4AFU C;  2LNV A;  3M0T A;  1RI0 A;  3ZEH A;  4AFZ C;  1TUD A;  1TU0 B;  4QVZ A;  3D7S B;  3G6E Q;  2P84 A;  5FU7 C;  2O88 A;  4KUI A;  5AT1 B;  4A4E A;  3CCL Q;  3HSB A;  4PLL A;  1WX6 A;  5KYN A;  4V2S A;  3L2R A;  1SHG A;  3CCM T;  5I2S A;  4L5G A;  1Y0M A;  2VVK A;  1VQK A;  1SRM A;  4Y92 A;  1H64 1;  2LTO A;  3SD4 A;  1BCO A;  2CUB A;  2P4T A;  1M2V B;  2D1X A;  3G71 A;  2DNU A;  2P0P A;  2D9T A;  5CK9 A;  1T0H A;  1M4Z A;  2R5A A;  2ZPF B;  1TG0 A;  3OYC A;  3FIF A;  3MEA A;  4PFP A;  4C92 D;  4OMP A;  3CCL A;  3CCQ Q;  4M78 C;  4JJN K;  3L2V A;  5GAM h;  4IUQ A;  1WHL A;  4LD6 A;  4N4I A;  4J9F A;  4MZT A;  4X9D A;  2M0Y A;  4M78 A;  2YDL A;  2RI3 A;  1WHG A;  3VUZ A;  1ZA1 B;  4C8Q D;  2I0N A;  1PHT A;  4EMK A;  3M0Q A;  3JCM g;  2WSC E;  2DXC A;  3DLL A;  4LDX A;  2MI6 A;  4CC4 B;  2JJ9 A;  1TUG B;  1RAC B;  2MMP A;  4M77 G;  2QDY B;  2KXC A;  4PJN A;  3OYY A;  3JB9 F;  2F5K A;  3CBP A;  2JM9 A;  3GNF B;  1ZLM A;  1G3W A;  2R57 A;  3CXC P;  2GBQ A;  3ME9 A;  3I56 Q;  4JLG A;  4IKF A;  3EHR A;  4AT1 B;  2RQU A;  2C0T A;  3SEM A;  4DBQ A;  1WXT A;  2Y4X A;  2CP6 A;  2FYK A;  4M78 B;  1VQ6 T;  5LJ5 f;  1X2K A;  2RNA A;  4AFQ C;  3MEV A;  1KC8 R;  1M3C A;  4E47 A;  3CCE Q;  2RA2 A;  2V26 A;  4BI3 A;  5CKH A;  2JXB A;  2J06 A;  3L2Z A;  2RH2 A;  4XU0 A;  4BY6 C;  3LW5 E;  4HVU A;  4J9I A;  1H3H A;  1X01 A;  3R6O A;  2LQK A;  3SHW A;  2AZV A;  4RG2 A;  4OMN A;  4LDY A;  2EIF A;  2F69 A;  3MPU B;  5GMK l;  4JRQ A;  5GAN e;  3A8L B;  2E64 A;  5J3B A;  5KCO A;  1G2B A;  4FSS A;  1Q82 R;  2RQR A;  2DTI A;  1AHJ B;  3BW1 A;  1DJ7 B;  1NEB A;  1WFW A;  3J7A F;  2L2P A;  5KCH A;  3RMS A;  1G8X A;  2LP5 A;  1VQO T;  4R56 A;  4F14 A;  2PVG B;  4PFZ A;  4OVA A;  1R8O B;  2E65 A;  4WCI A;  4N0A A;  2RF0 A;  5LJ5 h;  1KC8 C;  1X27 A;  1K0S A;  1Y96 A;  2QYZ A;  3QZ5 B;  4J7F A;  1R0C B;  2XKO C;  4QT7 A;  2EVR A;  2V1R A;  1OPL A;  3L42 A;  4C92 E;  4CRI A;  1EX4 A;  2JN0 A;  4J9H A;  2CUD A;  3P8D A;  2JS2 A;  3GPL A;  3CCE T;  2LDM A;  2OX7 A;  3HFO A;  2J6K A;  4PJO C;  3VKI A;  3BE3 A;  3RKY A;  1I0C A;  4C8Q B;  3E9F A;  5HK0 A;  4XU3 A;  2EYY A;  3X26 B;  1KD1 R;  1VQ4 Q;  4JRP A;  1U1S A;  2KE9 A;  3QBY A;  1YJ9 Q;  3LGL A;  1AWX A;  1YJW A;  2DTO A;  4GY5 A;  2HD0 A;  3QZ9 B;  5IAY A;  4C0D B;  4M7A D;  2KQW A;  1RAB B;  4OGE A;  2COZ A;  4MML A;  3URG A;  4KH0 B;  4C8Q C;  2QA4 T;  2NUP B;  3G6E A;  1AVZ C;  1KQS S;  3S3M A;  3OYM A;  4XQ3 A;  1YJW T;  1Q86 C;  2KR3 A;  1QVG P;  3OYG A;  2VGM A;  3M4G A;  2DVJ A;  4RTV A;  3EG9 B;  3LLR A;  4C0D C;  1UUE A;  3H0I A;  2RHY A;  1BIB A;  2RI2 A;  4HXJ A;  3OYJ A;  4FSX A;  3C12 A;  3MHX A;  2F2X A;  4F7U G;  3TRE A;  1WYX A;  3CC2 A;  1HD3 A;  2E6Z A;  1N5Z A;  1YCS B;  2DXU A;  1N8R U;  4M7D D;  1RAD B;  2KXD A;  3OSV A;  3TU4 K;  1Q86 U;  3V7S A;  1K9M R;  3NTI A;  4MDX A;  2AT1 B;  2K2M A;  4ESR A;  2L0A A;  1IRX A;  3TQ7 P;  3LH0 A;  2PVO B;  4ZN3 A;  1BI2 A;  2JMC A;  2EQJ A;  4M75 A;  4M78 E;  2DM1 A;  2O4X B;  1D1A A;  2L3S A;  2RJC A;  3M54 A;  1SRL A;  3NHN A;  3PGG A;  2DA9 A;  4ZGJ B;  3CPW P;  4FW1 A;  3HP9 A;  4A53 A;  4KUL A;  1IZ6 A;  2DF6 A;  3THK A;  3EGX A;  2HCK A;  2GCX A;  3PVL A;  3EFO A;  1FXX A;  1B07 A;  1D3B A;  1UGQ B;  3M57 A;  4O6J A;  1M5Q 1;  1D09 B;  1M3A A;  2KRS A;  2L3P A;  2LMJ A;  1IGU A;  2DL3 A;  4JUV A;  4RTU A;  1ACM B;  3UT1 A;  2ZPH B;  3LGF A;  1PG5 B;  1YFN A;  4JJB A;  2VB6 A;  1YHQ Q;  1WHH A;  1QMC A;  2RJD A;  1YCY A;  3MP6 A;  4ZTJ A;  5A0D A;  1NYF A;  3QWY A;  3ZFJ A;  2FPD A;  2KVQ G;  1D1B A;  4OB2 B;  1W2B S;  3QSU A;  1Q95 G;  1T3S A;  3N5B B;  1I81 A;  2MAM A;  4OMO A;  1FMW A;  2J6F A;  4XK8 E;  3UA7 A;  1WLP B;  2CH4 A;  3CBM A;  1G5V A;  2ROT A;  4XTY A;  2QQR A;  5GAO m;  1YJN Q;  1NPP A;  3SWN A;  1KK7 A;  1X2Q A;  1WDX A;  1KG1 A;  4IIO A;  1N6A A;  4A4G A;  2BE9 B;  5DM7 R;  2QEX A;  2GFA A;  4PJO D;  3FRN A;  2DBM A;  3CCV T;  3CCV A;  3AHU A;  2EJG A;  4OB3 B;  4F7U E;  2YWW A;  5D6W A;  2VAS A;  2JTM A;  2PUK B;  2F2V A;  4RCC A;  1QP3 A;  3NMZ C;  2F5T X;  5FU6 C;  4C8Q A;  1IRE B;  1K9A A;  4GLM A;  2XIC A;  2X4X A;  3X20 B;  3UDC A;  4QW2 A;  3FEO A;  3CC4 T;  2Y90 A;  5FRM A;  2DLP A;  2KYB A;  3U23 A;  4J9G A;  4ORZ A;  1IHW A;  2M0O A;  3SWN B;  2KT1 A;  5GAN f;  1TS9 A;  4JLI A;  2RJF A;  4Q5W A;  2ED1 A;  4LE9 A;  5EC7 A;  4F7U B;  1E7O A;  1B34 B;  3A98 A;  2FEI A;  2CZ1 B;  2ZPG B;  4J6Y A;  3CD6 A;  2KBT A;  2MF2 A;  4HT9 A;  1RAI B;  3CCQ A;  2YXY A;  3VS6 A;  3G4S A;  1I07 A;  2QQS A;  5LJ3 e;  4Y91 A;  1KFZ A;  4RUG A;  5IH2 A;  4RCB A;  3JCM X;  4KGV B;  2JZ2 A;  3FJP A;  4P5N A;  3VUB A;  1I8F A;  2E5K A;  1U1T A;  2ZCF B;  5GAO l;  1HK9 A;  1MV0 B;  1M3B A;  2RK1 A;  1YIT A;  2KI7 A;  4HT8 A;  5L8R E;  1K0X A;  2NUT B;  3S3O A;  1H8K A;  2COW A;  2EYX A;  1PM3 A;  4X34 A;  1JO8 A;  1Y07 A;  1QQJ A;  2RK2 A;  3JCM J;  4IIM A;  3JB9 J;  4J5Y A;  1B7T A;  5GAM j;  2LQN A;  2MPX C;  2HL5 C;  2KAF A;  2KGT A;  3OA6 A;  1KD1 U;  4PNO A;  4A54 A;  3RR6 A;  4ZTF A;  3EG1 A;  3CME Q;  1W2B P;  4IUP A;  1S72 T;  3QJ6 A;  5GMK m;  3M0P A;  1IGQ A;  3CC7 Q;  2M02 A;  4M75 C;  2COY A;  3T9N A;  3G6E T;  2BKD N;  2NYS A;  3CPW A;  4E7J A;  5KYU B;  4M7A C;  2KNB B;  4E7Z A;  1TWB A;  2AKL A;  1I5O B;  1ZUY A;  1PCX A;  1VIF A;  5DLQ E;  4HCK A;  1YIJ T;  2E6N A;  3CQT A;  2JTE A;  3H6Z A;  3VRY A;  4XU1 A;  2DBK A;  1P92 A;  4VUB A;  3CD6 Q;  1AWJ A;  2QTX A;  4Z89 A;  1AZG B;  1G3T A;  4LDV A;  2O9V A;  2KRM A;  2FG0 A;  3MCA B;  1N8R R;  2LJ1 A;  5LJ5 d;  3ZL7 C;  1FMK A;  4OML A;  4JRK A;  2DVE A;  1H92 A;  1RLQ C;  3OMG A;  5KYU A;  2OAU A;  1UGR B;  3WVD B;  2CP2 A;  3OYI A;  3KXT A;  1H3Z A;  2XHC A;  1M90 R;  4KRT A;  3SFM A;  1NLP C;  2QA4 Q;  3CC7 T;  1X75 C;  3RIR A;  5GAN h;  4EPC A;  1QLY A;  4M75 D;  1VIE A;  3EH2 A;  4XTW A;  1K8A C;  1EZZ B;  4NL2 A;  1C1A A;  3UWN A;  5KYY A;  1KHI A;  5FW9 A;  4EIK A;  1UHF A;  3MET A;  1VQ8 A;  1MMG A;  2RHU A;  1AZE A;  2DL8 A;  2QXF A;  1K4U S;  1ZUK A;  4OB1 B;  3EFO B;  5CKD A;  3JB9 I;  1VYT A;  1JJ2 A;  1W6X A;  2O4X A;  5FU6 B;  5FWC A;  2X4J A;  1UJ0 A;  1PKT A;  3A8O B;  1UHC A;  5I21 A;  3SB2 A;  2AHJ B;  2PVD B;  3JCM c;  2CH4 W;  2QQA A;  2NUZ A;  2VC8 A;  4WTO B;  4AG1 C;  3EFR A;  2NWM A;  1VQO Q;  1K8A R;  3VS1 A;  3OS1 A;  1Q81 C;  1YI2 A;  2MOX A;  1BI3 A;  2XDB A;  4LN2 A;  2RM4 A;  4II1 A;  2K4Y A;  2OAW A;  5KYX B;  3OYE A;  1WPY A;  4OF1 A;  1MHN A;  1E6H A;  3RKW A;  3RNJ A;  4J83 A;  1GL5 A;  5IHN A;  3V7C A;  2YT6 A;  3I56 T;  1MND A;  4M4Z A;  1VYU A;  3NPF A;  4Z88 A;  1VQP A;  3OY9 A;  1XQH A;  1I1J A;  2FO0 A;  3R6N A;  2LRQ A;  2X3W D;  4Z8A A;  2ABL A;  1I4K 1;  4C5G A;  3G4S T;  1M8V A;  3NGP A;  3OYD A;  4D8D A;  4M7D B;  2FZC B;  5IT9 E;  1FWZ A;  3HRT A;  5GAO p;  3EHQ A;  4M7A E;  1M8M A;  1PKS A;  1QCN A;  2MWO A;  5CKB A;  2NUP A;  3PT9 A;  3PTA A;  4C8Q E;  2D0Q B;  5IXB A;  1KIK A;  1VQ5 Q;  1K1Z A;  3G71 Q;  3TSW A;  2FZK B;  1KC8 U;  3OBW A;  2CRE A;  4J6W A;  1QVF A;  1V1C A;  1Q82 C;  1VQP T;  4KGX B;  2KY9 A;  1Z9Q A;  4PJO E;  2XMF A;  2FB7 A;  3VS0 A;  4PLI A;  3O5Z A;  2M9U A;  2JT4 A;  2XDP A;  4BE2 A;  3TVT A;  2OI3 A;  4M7D C;  3I5R A;  3TEE A;  1ZHI A;  1YBY A;  1UEC A;  3FDR A;  2XD0 A;  2LJ0 A;  4BI4 A;  3OYB A;  3DB4 A;  2R58 A;  3CCU Q;  1YWO A;  1FYN A;  2HAX A;  1IB8 A;  1OUL A;  2DXT A;  2F2W A;  2HQX A;  5GMK h;  3L2Q A;  5GAN j;  4QQG A;  2Y4Y A;  4XTU A;  2EKH A;  4L59 A;  1ZSZ C;  4C8Q G;  2EPD A;  2HZY A;  3A8M B;  2X9H A;  3M56 A;  3OBY A;  2BTT A;  2EFI A;  3MO8 A;  1FMV A;  2DTH A;  3PIP A;  3NFC A;  1YJ9 T;  1YHQ A;  5CIU A;  2ESW A;  1UJY A;  1W70 A;  2HL3 A;  2AIR B;  2DYI A;  2WAC A;  3QJY A;  3CMA T;  1NE8 A;  1K73 R;  2RB6 A;  1Z9Z A;  1GFC A;  2GFU A;  3MKD A;  2A0F B;  3VS4 A;  3M53 A;  3PFS A;  1YJN A;  2EQI A;  2KYM A;  3CCS T;  1VA7 A;  2C0O A;  2CT4 A;  1RAG B;  3NTK A;  1PD1 A;  3REA B;  5GAN 7;  2QG9 B;  4RTW A;  3LH5 A;  5GMK j;  2DET A;  2E1H A;  2G6F X;  2NLU A;  5AYF A;  2X3X D;  1UB4 A;  2HSP A;  4ATO A;  1NJI U;  5GAN g;  3A8G B;  2K3Y A;  3EFS A;  2LCL A;  4HVV A;  3RMQ A;  2HBP A;  2DAQ A;  1ZSG A;  1KQ2 A;  2RHX A;  4LNP A;  3TCJ A;  2P0Q A;  2M1H A;  2V8I A;  1WQ7 A;  1BB9 A;  2MIO A;  4LDW A;  3JCM e;  2DKG A;  5GMK i;  2OTJ T;  4E7L A;  2HDA A;  4DOW A;  2DMO A;  5A0L A;  1WA7 A;  3BDU A;  2CZ0 B;  3E2U A;  2EYZ A;  4BDY A;  3CC2 Q;  2CZ7 B;  3VRZ A;  4ME7 A;  1M1K U;  3JCM W;  1WZO A;  2QDL A;  1C0M A;  4MMK A;  3CCM Q;  1X6B A;  1RAF B;  1GRI A;  2V1Q A;  2JMA A;  4CC3 A;  3V7R A;  2JM8 A;  4FU6 A;  2EW3 A;  3QDF A;  2XG8 D;  1VYV A;  2KDS A;  2ATC B;  2DD5 A;  4NL3 A;  1SHF A;  1AOJ A;  4C5I A;  3GIB A;  2YLB A;  2J6O A;  3OW2 P;  3BFM A;  5KH6 A;  1K9M U;  2LX7 A;  2HKQ B;  4E2F B;  3PIO A;  3I55 A;  2EJF A;  4M77 A;  5D7U A;  5LL6 S;  4M78 D;  2HEQ A;  1D0Z A;  1RLP C;  3M0S A;  2LQ8 A;  3VS2 A;  4M7A F;  4L6V 5;  4CC2 A;  2QQ9 A;  4D6W A;  2ZPB B;  4ZGD B;  5GAN 8;  1YWP A;  1OX8 A;  3OYA A;  3GNG A;  5KYX A;  4CI0 C;  1QKW A;  3M9Q A;  4JJC A;  3WXM B;  2LX9 A;  4F16 A;  3MP1 A;  2IG0 A;  5D6Y A;  1JXM A;  5C0M A;  2QK0 A;  5GAO r;  1KJW A;  1TXQ A;  4FM4 B;  3FJ5 A;  4PJO F;  2MK5 A;  1EIF A;  4JJD A;  4M75 G;  2RN8 A;  4MZM A;  3EAE A;  2YUP A;  1VQM A;  3CBO A;  3V8J A;  2B8A A;  2DIG A;  2WSF E;  1MMA A;  2J7I A;  4K11 A;  1VQL T;  3OB9 A;  2QTV A;  5A2Q E;  1QP2 A;  1V76 A;  4EMG A;  1J3T A;  1JXO A;  5KYW A;  4XTX A;  4C92 G;  1IO6 A;  2X4W A;  4C5H A;  2C0I A;  2O01 E;  1T0J A;  1WI7 A;  5GAN 4;  4IUR A;  1WQW A;  3VYG A;  3CCQ T;  1ABO A;  3OYN A;  1WGS A;  4EMH A;  1UTI A;  4F7U F;  3E9G A;  3TSZ A;  1SEM A;  1X43 A;  1Y7X A;  2AKK A;  2DER A;  4GBQ A;  2FHD A;  1WHM A;  4C92 F;  3V8L A;  1CKA A;  1OYX A;  3FC3 A;  1ZBJ A;  4DEX A;  2R5M A;  3JB9 H;  1Y57 A;  3OSS C;  3A1P A;  1VQN A;  1NG2 A;  2FPE A;  2D8H A;  2H3J A;  1M1K C;  1LOJ A;  2LZ6 B;  2K3B A;  2QQB A;  5J39 A;  3L1A A;  1AT1 B;  5HY6 A;  2P0K A;  2KEA A;  1JBM A;  2QEX Q;  1VQ6 Q;  2VXF A;  4J9B A;  4Y28 E;  2CGH A;  4B9W A;  3GLX A;  3EGD B;  4E6R A;  2PUO B;  4HCC A;  3VV0 A;  4C0Z A;  1WIE A;  3S6W A;  4M77 E;  3C0C A;  3BDL A;  1JRI A;  2CP0 A;  4B9X A;  1T3L A;  1XJW B;  3CPF A;  4ZNX A;  4X9C A;  2NUT A;  4PK4 A;  4PJO A;  2GGR A;  4FW2 A;  1M27 C;  3QXE B;  1I5L A;  1JJ2 S;  2EBP A;  1PSF A;  3VU3 C;  4E7S A;  4M7D G;  3WVE B;  4LUD A;  3JB9 D;  1XOV A;  3I55 T;  4E7K A;  2WSE E;  2QAS A;  1PRM C;  2DXB A;  2EJ9 A;  4RMO A;  4FT4 A;  1O9S A;  2RD1 A;  2V8K A;  1VQ9 Q;  1YP5 A;  3LX7 A;  2JNG A;  2YRV A;  3I56 A;  1N8R C;  1UE9 A;  1VQ7 T;  1QWE A;  1JU5 C;  2K79 A;  4EMK C;  3JCM h;  1WXU A;  1S72 Q;  1GXI E;  4A4K A;  1BIA A;  4FYW B;  2L5Q A;  3RES A;  4M7A B;  2LJ3 A;  5CKF A;  4IUT A;  4BE1 A;  1OI1 A;  2KSS A;  1Q81 U;  2W10 A;  1BYM A;  4M77 B;  1PD0 A;  3SDZ A;  2DIL A;  2P4R A;  4M7D E;  1U5S A;  2OTJ A;  2K5I A;  3EGX B;  2B86 A;  1YIJ Q;  1QCF A;  2RPN A;  5CQX A;  2VV5 A;  1MMD A;  3L2W A;  2OTL A;  4F17 A;  3CME A;  2E3H A;  5GAO q;  2LT1 A;  4XTZ A;  4ELY C;  2EYW A;  1X69 A;  4FYV B;  2E12 A;  2LCC A;  1VQ4 T;  3CCJ Q;  5GAN 3;  1KHC A;  1VQ8 T;  2E3I A;  4HVW A;  1K9M C;  2G3R A;  1U06 A;  1C6V X;  4FT2 A;  5IHI A;  2RHZ A;  2BUD A;  1BI1 A;  1GCP A;  1OV3 A;  5HK3 A;  3OS5 A;  2DYB A;  4AMC A;  3QKJ A;  5KYW B;  4QVC A;  5I11 A;  1K73 U;  1HYO A;  1TOV A;  3H0H A;  2M16 A;  3CMA A;  4JS4 A;  3CC7 A;  2KMT A;  2JW4 A;  3UF4 A;  1SSF A;  1NZ9 A;  2VUB A;  1SSH A;  1YHQ T;  2YUN A;  5CAI A;  1CKB A;  1YJ9 A;  4E7I A;  5LJ3 g;  3G4S Q;  3SWN C;  3PE0 A;  1KQ1 A;  1MNE A;  2K7A A;  2L3Q A;  4Z02 A;  4DBR A;  1D3B B;  4OB0 B;  4AG2 C;  1JJ2 P;  2ZGW A;  2L8D A;  1RAE B;  1K73 C;  4PL6 A;  5LJ3 d;  4J9C A;  2RQW A;  4M78 F;  2PTK A;  3FB9 A;  4KBM B;  1TUC A;  2YUO A;  3H8Z A;  1KSW A;  1XNI A;  4PJL A;  1NEG A;  2L3R A;  1QCO A;  2EGA A;  1K76 A;  1IHV A;  2HNI A;  2KK4 A;  1R0B G;  4J8O A;  4WF2 A;  1VQ7 A;  1AD5 A;  1UDL A;  4XAX B; 
#chains in the Genus database with same CATH homology
 2DTH A;  3M5A A;  4EDU A;  4BD3 A;  3PIP A;  4PJO B;  3NFC A;  2GCX A;  1VQN T;  2RI5 A;  3NTH A;  4XTV A;  4KUD K;  2K3X A;  1YJ9 T;  1QVP A;  4N4G A;  1YHQ A;  1FXX A;  2EYQ A;  5CIU A;  2DD4 A;  3INZ A;  1WJQ A;  1D3B A;  1UGQ B;  2DZ9 A;  3M57 A;  1M5Q 1;  4O6J A;  3LWH A;  1VQO A;  4A4F A;  3JCM f;  3L2U A;  1N27 A;  1ZQ1 A;  2XK0 A;  4JUV A;  1UEB A;  2WAC A;  3QJY A;  3UT1 A;  2ZPH B;  1VQ9 A;  3LGF A;  3CMA T;  3M4Y A;  2XDD A;  1G3Y A;  1NE8 A;  2RB6 A;  2DK3 A;  1Q7Y C;  3JB9 G;  5DLO A;  2GFU A;  1W4S A;  2RJD A;  1YCY A;  3MP6 A;  3PNW C;  4FIB A;  5A0D A;  4ZTJ A;  1KQS A;  3QO3 A;  3M53 A;  3PFS A;  3ZFJ A;  3X24 B;  4OB2 B;  2KVQ G;  1YJN A;  2JVV A;  2QA4 A;  1W2B S;  2VXE A;  3CCS T;  3QSU A;  3HPW A;  3NTK A;  3N5B B;  1I81 A;  2MAM A;  4XK8 E;  3S3N A;  2C06 A;  5GAN 7;  3CCE A;  3CCR T;  5GAN 5;  3CBM A;  5GAN 2;  4IUV A;  5GMK j;  1Q7Y U;  4NS5 A;  2E1H A;  2EQK A;  2NLU A;  4XTY A;  5AYF A;  1G5V A;  1S72 A;  5GAO n;  2CS7 A;  1UB4 A;  5FU7 B;  3JCM b;  2QQR A;  3DLM A;  2PQW A;  3RKX A;  4ATO A;  5GAO m;  4BAC A;  5GAN g;  1NJI U;  1NPP A;  3A8G B;  3SWN A;  4C0G A;  2K3Y A;  3O8V A;  1KG1 A;  3EFS A;  2LCL A;  1N6A A;  4A4G A;  4ELZ C;  3OYH A;  3RMQ A;  5DM7 R;  2QEX A;  1VQM T;  2GFA A;  4DA4 A;  2HBP A;  4PJO D;  4M77 D;  4XU2 A;  3FRN A;  1W2B A;  3OYL A;  2DAQ A;  3CCV A;  3CCV T;  4DQ2 A;  3X28 B;  3RER A;  1KQ2 A;  1MGQ A;  3MP8 A;  1Y96 B;  2IVW A;  1YIT T;  2RHX A;  3G7Z A;  2EJG A;  4M75 B;  4OB3 B;  4F7U E;  3TCJ A;  1VQ6 A;  3AHU A;  5D6W A;  2P0Q A;  2M1H A;  2V8I A;  3OYK A;  4JDS A;  1WQ7 A;  2MWP A;  2RJE A;  2JTM A;  4LDW A;  3JCM e;  3HL8 A;  4MZP A;  2DKG A;  1NJI C;  2PUK B;  5GMK i;  4M7D F;  4RCC A;  4E7L A;  2OTJ T;  4DOW A;  2GF7 A;  1FX7 A;  1QP3 A;  5A0L A;  3BDU A;  2CZ0 B;  3FLG A;  2F5T X;  4N0A C;  5FU6 C;  4BDY A;  3QPH A;  4C8Q A;  5LJ5 j;  1UGP B;  1IRE B;  1U8R A;  2CZ7 B;  2PU9 B;  2E10 A;  4ME7 A;  3OS2 A;  2XIC A;  4M77 C;  1M1K U;  3JCM W;  2X4X A;  2E41 A;  4EMK B;  4MMK A;  3X20 B;  3UDC A;  2D6F A;  2L89 A;  4QW2 A;  3QDR B;  3FEO A;  1WJS A;  5CVI A;  2Y90 A;  3CXC S;  4J7I A;  3CC4 T;  5FRM A;  3M59 A;  4C8Q F;  5FRO A;  3V7R A;  2BIV A;  4QQ6 A;  1VQ9 T;  4RG8 A;  4KT0 E;  2M0O A;  4BI8 B;  4FU6 A;  1BI0 A;  1NPR A;  2JOY A;  2XG8 D;  3MEU A;  3CEY A;  3SWN B;  5HKC A;  2RHI A;  2K5F A;  2KDS A;  2XID A;  3DB3 A;  4JLI A;  2RJF A;  4Q5W A;  5IN1 A;  3VYH B;  5GAN f;  4C92 C;  2E70 A;  2E5Q A;  2JTF A;  4F7U B;  3CC4 A;  1B34 B;  3ER0 A;  3X25 B;  3M55 A;  3JSC A;  3QUI A;  3HRU A;  2ZPG B;  2CZ1 B;  5M9O A;  4J6Y A;  2DD5 A;  3CD6 A;  1OZ2 A;  4NL3 A;  4BY6 B;  2MF2 A;  4HT9 A;  1X6O A;  1Q82 U;  4C5I A;  3GIB A;  3CD6 T;  3JCM V;  2YLB A;  3CCQ A;  2VYT A;  4UC4 A;  3QG1 A;  5CR2 A;  1QW1 A;  3ZBD A;  3G4S A;  4M78 G;  4QVD A;  1M1F A;  1ZBX A;  2QQS A;  5LJ3 e;  3BFM A;  4Y91 A;  5CCA A;  5KH6 A;  1K9M U;  3CCL T;  3J81 E;  5LJ5 g;  4J6X A;  4RCB A;  3JCM X;  2QI2 A;  3PIO A;  3M58 A;  4JRI A;  2EJF A;  2JZ2 A;  3FJP A;  4M77 A;  4P5N A;  5LL6 S;  3VUB A;  4M78 D;  1I8F A;  3E1S A;  1U1T A;  2ZCF B;  5DY9 A;  3LYI A;  5KE2 A;  1VQ4 A;  1VQ5 T;  4KUL A;  3HRS A;  4BE0 A;  5GAO l;  1HK9 A;  3G71 T;  4BB7 A;  2LQ8 A;  3CCJ T;  3OS0 A;  4M7A F;  4L6V 5;  2RK1 A;  1YIT A;  2QQ9 A;  4C0F A;  4D6W A;  4HT8 A;  2ZPB B;  5L8R E;  3CME T;  3OW2 A;  4ZGD B;  5GAN 8;  3CCU A;  2JUF A;  4M77 F;  4OP0 A;  3S3O A;  3OYA A;  3GNG A;  4C92 B;  4X34 A;  3JAM E;  4CI0 C;  4HCB A;  2K2V A;  1UGS B;  3KBG A;  1Y07 A;  2LNV A;  3M9Q A;  2RK2 A;  5GAN d;  3JCM J;  1RI0 A;  2ZPI B;  3ZEH A;  3WXM B;  2LX9 A;  3JB9 J;  4J5Y A;  4QVZ A;  5GAM j;  3MP1 A;  3KUF A;  4C5E A;  2IG0 A;  4TVR A;  5D6Y A;  3F70 A;  5FU7 C;  2KAF A;  5C0M A;  4KUI A;  4A4E A;  5GAO r;  3HSB A;  4PLL A;  4V2S A;  3OA6 A;  4FM4 B;  3L2R A;  3CCM T;  5I2M A;  5I2S A;  4L5G A;  4PJO F;  1KD1 U;  1EIF A;  3RUX A;  3CCU T;  4PNO A;  4M75 G;  4MZM A;  4A54 A;  1VQK A;  1PSE A;  2YLC A;  1H64 1;  3EAE A;  3ASK A;  2LTO A;  4ZTF A;  3CBO A;  3SD4 A;  3V8J A;  1VQM A;  2B8A A;  2CYZ B;  2P4T A;  2DIG A;  4IUP A;  2WSF E;  3G71 A;  2P0P A;  2D9T A;  4GLK A;  5CK9 A;  1M4Z A;  3I55 A;  3OB9 A;  1VQL T;  5A2Q E;  1QP2 A;  2R5A A;  5D6X A;  5LJ3 h;  2ZPF B;  4EMG A;  1YIJ A;  3OYC A;  1S72 T;  2DZC A;  4XTX A;  3FIF A;  3MEA A;  3QJ6 A;  4C92 D;  4C92 G;  2X4W A;  5GMK m;  2EQM A;  3CCL A;  4C5H A;  2DEQ A;  4M78 C;  4JJN K;  1N9S A;  2O01 E;  5GAM h;  4IUQ A;  3L2V A;  2I2L A;  3JCM d;  5GAN 4;  4IUR A;  4M75 C;  3T9N A;  3G6E T;  2EKO A;  1WQW A;  4LD6 A;  4N4I A;  2BKD N;  2LVM A;  3VYG A;  3CCQ T;  3CCS A;  3OYN A;  1WGS A;  4MZT A;  4X9D A;  4EMH A;  1YJN T;  4F7U F;  3CPW A;  4E7J A;  3E9G A;  4M78 A;  4M7A C;  4F7U A;  5LJ5 e;  2EAY A;  2GQV A;  2XU8 A;  2RI3 A;  1Y7X A;  3VUZ A;  4C8Q D;  1K8A U;  1VQK T;  4NOY A;  2EQU A;  2FHD A;  4EMK A;  3JCM g;  4BUG A;  4DOV A;  4C92 F;  3CCM A;  3V8L A;  2ZZD A;  2WSC E;  1OYX A;  3FC3 A;  4IUU A;  1QVF S;  2DXC A;  1VIF A;  5DLQ E;  3GOX A;  3DLL A;  4LDX A;  2MI6 A;  5CKE A;  2R5M A;  1YIJ T;  3JB9 H;  3Q1J A;  3OSS C;  3J80 E;  2MMP A;  2OTL T;  3OW2 S;  2DO3 A;  4M77 G;  1VQN A;  2E6N A;  2H3J A;  1M1K C;  2QDY B;  1LOJ A;  3H6Z A;  3OYY A;  3JB9 F;  2F5K A;  3CBP A;  4XU1 A;  1HXD A;  2QQB A;  5J39 A;  3CC2 T;  3GF5 A;  3GNF B;  1G3W A;  1P92 A;  2R57 A;  4VUB A;  3E19 A;  2QTX A;  3L1A A;  3ME9 A;  2LC4 A;  3UPU A;  4JLG A;  4IKF A;  2A7Y A;  1G3T A;  4BDZ A;  4LDV A;  5HY6 A;  2P0K A;  5GAM g;  4OMF B;  3MCA B;  4M75 E;  1JBM A;  4N4H A;  5LJ3 f;  2VXF A;  4Y28 E;  4B9W A;  2CGH A;  5LJ5 d;  3GLX A;  3P8B B;  3LWI A;  3GP8 A;  3MEW A;  2DIQ A;  3QYH B;  4JRK A;  2X4Y A;  2FYK A;  2DVE A;  2PUO B;  2Y4X A;  4HCC A;  4FL6 A;  3OMG A;  2EWN A;  4M78 B;  3VV0 A;  3S6W A;  4C0Z A;  1VQ6 T;  2OAU A;  5LJ5 f;  4M77 E;  1UGR B;  1O75 A;  3MEV A;  3BDL A;  1JRI A;  3WVD B;  4B9X A;  4E47 A;  3OYI A;  2RA2 A;  3KXT A;  4BI3 A;  4M7D A;  5CKH A;  1M90 C;  3L2Z A;  2RH2 A;  4XU0 A;  4BY6 C;  2XHC A;  4E7H A;  3CPF A;  1H3Z A;  3LW5 E;  3V8K A;  4X9C A;  1X01 A;  3R6O A;  4PJO A;  3SFM A;  3CC7 T;  2LQK A;  4PJO G;  3QXE B;  1I5L A;  1X75 C;  3RIR A;  5GAN h;  1JJ2 S;  1B34 A;  4EPC A;  1PSF A;  4RG2 A;  3VU3 C;  5FRN A;  4LDY A;  4M75 D;  4M7D G;  2EIF A;  2F69 A;  1VIE A;  5EG2 A;  3WVE B;  1XOV A;  5GMK l;  3I55 T;  4JRQ A;  2WSE E;  4XTW A;  4E7K A;  3JB9 D;  1K8A C;  5GAN e;  1M90 U;  1N9R A;  2DXB A;  3A8L B;  2E64 A;  5J3B A;  4NL2 A;  2EJ9 A;  3OMC A;  4RMO A;  1QVG S;  5KCO A;  4FT4 A;  3UWN A;  3CXC A;  3C4S A;  1O9S A;  2RD1 A;  1KHI A;  2DTI A;  2V8K A;  3C94 A;  1AHJ B;  3JCM Q;  3OYF A;  3LX7 A;  3BW1 A;  1DJ7 B;  2JNG A;  2YRV A;  4R55 A;  3MET A;  4M7A A;  1BKB A;  3I56 A;  1VQ8 A;  5FLX E;  2RHU A;  4M75 F;  1N8R C;  3J7A F;  1VQ7 T;  5KCH A;  2XI9 A;  3RMS A;  2QXF A;  1VQO T;  4R56 A;  4EMK C;  4OB1 B;  3JCM h;  2PVG B;  1GXI E;  5CKD A;  1LJO A;  4A4K A;  3JB9 I;  1BIA A;  2A3L A;  4OVA A;  1JJ2 A;  1VUB A;  1R8O B;  2E65 A;  2L5Q A;  3RES A;  2O4X A;  4M7A B;  5FU6 B;  5CKF A;  4N0A A;  4IUT A;  5LJ5 h;  5KE3 A;  4BE1 A;  1KC8 C;  1Y71 A;  1OI1 A;  2KSS A;  2YHT A;  1Q81 U;  1Y96 A;  1TH7 A;  3QZ5 B;  4J7F A;  2X4J A;  1BYM A;  4M77 B;  1LNX A;  2XKO C;  1RL2 A;  3SDZ A;  3A8O B;  3JRZ A;  4ZGE B;  5I21 A;  3BY7 A;  3L42 A;  3SB2 A;  4C92 E;  2AHJ B;  4CRI A;  2JN0 A;  2PVD B;  3JCM c;  4M7D E;  2QQA A;  4LD9 K;  2VC8 A;  2OTJ A;  2K5I A;  3P8D A;  3GPL A;  3EFR A;  3CCR A;  2LDM A;  4PKC C;  3CCE T;  3C95 A;  3HFO A;  3OS1 A;  1Q81 C;  1YI2 A;  1BI3 A;  2XDB A;  5LJ3 j;  2RM4 A;  4PJO C;  3VKI A;  5CQX A;  3RKY A;  3CPW S;  4C8Q B;  4II1 A;  1YI2 T;  2K4Y A;  1OZ3 A;  2VV5 A;  3E9F A;  3L2W A;  1XTD A;  2OTL A;  4C92 A;  3OYE A;  5HK0 A;  1V29 B;  1WPY A;  4OF1 A;  2DPP B;  4XU3 A;  1MHN A;  3CME A;  3X26 B;  2LT1 A;  5GAO q;  4XTZ A;  3RKW A;  4ELY C;  2QEX T;  4J83 A;  2ZPE B;  4JRP A;  1U1S A;  3QBY A;  3HFN A;  3CCJ A;  3LGL A;  2E12 A;  2LCC A;  3QYG B;  3V7C A;  1VQ4 T;  1VQ5 A;  5GAN 3;  1KHC A;  5C6S A;  4RKU E;  2X35 A;  1G3S A;  3I56 T;  1YJW A;  1K9M C;  1VQ8 T;  2G3R A;  3QHS A;  4HCZ A;  2DTO A;  2CZ6 B;  2HD0 A;  3QZ9 B;  4GY5 A;  3OY9 A;  1XQH A;  1VQP A;  5IAY A;  4FT2 A;  2RHZ A;  4C0D B;  2BUD A;  1BI1 A;  4M7A D;  2KQW A;  2LRQ A;  1I4K 1;  3OQ5 A;  4OGE A;  4C5G A;  3G4S T;  1M8V A;  4MML A;  3URG A;  3OYD A;  4C8Q C;  5HK3 A;  2K57 A;  2QA4 T;  3OS5 A;  3G6E A;  5J26 A;  3QKJ A;  5GAM e;  4M7D B;  1KQS S;  3S3M A;  5IT9 E;  3OYM A;  1FWZ A;  4QVC A;  3HRT A;  5GAO p;  2VGN A;  4M7A E;  1K73 U;  4XQ3 A;  1YJW T;  2M16 A;  4HKE A;  3CMA A;  2MWO A;  1Q86 C;  4JS4 A;  3HHT B;  3CC7 A;  2KMT A;  1WJR A;  5CKB A;  3DKM A;  3PT9 A;  3OYG A;  4C8Q E;  2D0Q B;  3PTA A;  1VQL A;  1SSF A;  2VGM A;  3M4G A;  3LLR A;  1NZ9 A;  5CQY A;  4C0D C;  2VUB A;  2RHY A;  1BIB A;  2RI2 A;  5A0G A;  1KC8 U;  1YHQ T;  3OBW A;  4MDW A;  5CAI A;  4OGC A;  1YJ9 A;  3OYJ A;  4FSX A;  3C12 A;  3MHX A;  3PMI A;  4E7I A;  4F7U G;  3TRE A;  1KD1 C;  4J6W A;  1QVF A;  5LJ3 g;  1Q82 C;  3PMT A;  1VQP T;  3CC2 A;  2K5L A;  2E6Z A;  2KY9 A;  3QII A;  4YTL A;  1QVG A;  4PJO E;  1JB0 E;  1M1G A;  2V8J A;  1KQ1 A;  3SWN C;  4M7A G;  2FB7 A;  2DXU A;  4PLI A;  4Z02 A;  1N8R U;  4M7D D;  1D3B B;  4OB0 B;  3OSV A;  3TU4 K;  2DJZ A;  2M9U A;  2ZGW A;  2L8D A;  2XDP A;  4BE2 A;  1Q86 U;  3V7S A;  3P8H A;  2CKK A;  3NTI A;  4ZN1 A;  4JS5 A;  4M7D C;  2FL7 A;  4MDX A;  1K73 C;  4PL6 A;  1ZHI A;  5LJ3 d;  5CO7 A;  1YBY A;  3TEE A;  3A5Z B;  3FDR A;  2XD0 A;  4BI4 A;  4LDU A;  2HQE A;  4M78 F;  2LT4 A;  3OYB A;  3LH0 A;  3DB4 A;  2PVO B;  4ZN3 A;  1M9S A;  2R58 A;  1BI2 A;  3A8H B;  3FB9 A;  4O5V A;  4KBM B;  2EQJ A;  3H8Z A;  4M75 A;  4M78 E;  3VJP A;  2HAX A;  1WNL A;  1XNI A;  2DXT A;  2O4X B;  5GAN 6;  2HQX A;  5GAM f;  2L3R A;  2RJC A;  3M54 A;  4A4H A;  5GMK h;  3L2Q A;  3JCM P;  5GAN j;  2HNI A;  4QQG A;  3PGG A;  2KK4 A;  2Y4Y A;  4XTU A;  5GAM d;  4L59 A;  4HA8 A;  4ZGJ B;  4C8Q G;  4J8O A;  3HKS A;  4WF2 A;  3A8M B;  1VQ7 A;  5GMK e;  3M56 A;  3OBY A;  4QQD A;  2FVU A;  2EFI A;  4XAX B;  2RO0 A;  3HP9 A;  4A53 A;  1IZ6 A;  3MO8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...