4Y91A

Crystal structure of a thermotoga maritima hfq homolog
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
66
structure length
66
Chain Sequence
FNLQDRFLNHLRVNKIEVKVYLVNGFQTKGFIRSFDSYTVLLESGNQQSLIYKHAISTIIPSSYVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-binding protein Hfq
publication title Crystal Structure of a Thermotoga maritima Hfq homolog
rcsb
source organism Thermotoga maritima
molecule tags Rna binding protein/rna
total genus 14
structure length 66
sequence length 66
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2015-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4y91A00
2E65A 4V2SA 3JCMP 2VXFA 4XU2A 2E41A 1KQ1A 3V8LA 2DXUA 5GAN4 5GANj 4M77B 4M77A 4X9DA 4DQ2A 3JCMQ 2DKGA 4QVDA 2DJZA 5GAMd 1X01A 2K57A 3JB9G 4HA8A 4PJOA 4NL2A 4N0AC 4A53A 5GAN2 4M78F 1JBMA 1MGQA 4C92E 5DY9A 3JB9I 5GANh 5GAOr 2E1HA 3JB9D 4XQ3A 4M7AB 3BW1A 3M4GA 4EMHA 5LJ5g 5LJ3g 2Y90A 4C8QC 5GAN7 4EMGA 3JCMh 4C92G 2RD1A 1I4K1 2FYKA 1TH7A 4C8QF 4M7DE 5GAN5 4RCBA 4A54A 2HNIA 5I21A 4C92D 4M77C 4M78A 3V8JA 5GMKe 4JUVA 3FJPA 4EMKB 4M77F 4M7DG 5GAN8 3L2ZA 3HFNA 4NL3A 1BIAA 1JRIA 3JCMb 4JLIA 1I81A 2YLBA 4M7DD 1H641 4PNOA 4C8QA 2RA2A 1N9SA 3SWNA 5LJ3f 5GAMe 1WQ7A 3QO3A 2EJFA 3V8KA 3JCMe 5GAOm 3GIBA 4M7AF 4M75G 2RB6A 1D3BB 1D3BA 4J5YA 3JCMd 3PGGA 4M78C 3JCMc 4XTVA 2DTOA 4XTUA 2EWNA 3JB9H 3RUXA 5GMKi 3L1AA 3JCMg 5GAMg 3BY7A 3BFMA 3RKWA 4M7AA 3RKYA 1WNLA 3BDUA 2DVEA 1M5Q1 2QTXA 1I8FA 3SWNC 4C92B 4RCCA 2EJ9A 4WF2A 1KQ2A 1LOJA 4HT9A 1BIBA 1YCYA 3FB9A 4XU0A 4EMKA 2E10A 4M7DB 3JB9F 4F7UG 3V7SA 5GAOl 4PJOE 1Y96B 1Y96A 4J6YA 4XU3A 4Y91A 4J6WA 4XTXA 5GANe 4M75E 4M7AC 1LNXA 4XU1A 2DTIA 3EFRA 5LJ5f 4PJOG 5LJ5j 5GMKm 5LJ3j 5GANd 2VC8A 2JN0A 4XTYA 4C92F 1WPYA 3V7RA 4PJOD 2DXTA 2YHTA 5GANg 1HK9A 3QSUA 2DZ9A 4M75D 4EMKC 4M78E 1HXDA 2YLCA 3EFSA 3VU3C 5LJ5h 2DTHA 4M7DF 5LJ3h 4JRIA 4M78G 4C92A 4F7UA 5GAN6 3RESA 2CGHA 5GMKj 4C8QE 3QUIA 4JRKA 4F7UE 1M8VA 5GAOp 2DEQA 4M78D 3AHUA 3JCMV 4M75F 4QVCA 4MMKA 4C8QG 4M77E 5GMKl 3FIFA 4M7DA 5GAMf 3JCMf 4C8QD 5GAMj 1WQWA 5LJ5e 3JB9J 5GMKh 5LJ3e 4M77G 3HFOA 4PJOB 1LJOA 4C92C 3RERA 5LJ5d 4M7AE 5LJ3d 4M75B 2E64A 3QHSA 4M77D 4M75A 4XTZA 1U1SA 4M7AG 4XTWA 3HSBA 3V7CA 4M7DC 5GAMh 3SB2A 4OP0A 1B34B 1B34A 4HT8A 4M7AD 4MMLA 1U1TA 2EAYA 2ZGWA 3INZA 4X9CA 4F7UF 5CAIA 2VXEA 4M78B 4PJOC 3JCMJ 5GAN3 2FB7A 4N0AA 5GAOq 3JCMW 4M75C 4PJOF 2RM4A 4NOYA 1I5LA 4J6XA 2EJGA 2I2LA 5GAOn 3RIRA 3RKXA 3JCMX 4C8QB 1N9RA 5GANf 4F7UB 3SWNB 2DZCA
chains in the Genus database with same CATH superfamily
3CCQT 1VQOT 4A4FA 2DEUA 1AWWA 5IXBA 2KAFA 3KXTA 3CCEQ 1NG2A 5CKHA 4LDUA 4C8QC 2VYTA 1VQ6T 3CCJA 3GF5A 3FRNA 1TH7A 4HVVA 1K73R 2LVMA 4M77C 2YUOA 1M1KU 5GMKe 2MWOA 4ELZC 2HD0A 3ZL7C 2DL5A 4HVUA 4N4HA 1I81A 3H0FA 4E7SA 1WI7A 5FRMA 1WQ7A 3QBYA 1D3BA 3JCMd 4AFUC 3PGGA 2VWFA 3NTHA 1JU5C 3OYKA 1C0MA 3VS2A 4C92B 2F5KA 2YRDA 1YCSB 2MI6A 3TEEA 5CKBA 1YJNT 3NTIA 2XK0A 2F69A 2O9VA 3QYHB 3URGA 4JDSA 4Y91A 2LT1A 4WCIA 3FLGA 2V8IA 5CKDA 4PFPA 1Q82U 1NM7A 3V7RA 2DA9A 1NLPC 1VQ8Q 5A0DA 1HXDA 2YLCA 3QIIA 4FYVB 1M3BA 4GLMA 3MJXA 1JB0E 4BE2A 3GLXA 2CGHA 1K8AR 4J9CA 3HKSA 2NUPA 2GQVA 4EDUA 3M0TA 1QVFS 2GTOA 2LQWA 2O31A 3GP8A 2DE0X 1NYGA 2H3EB 3VRYA 5EC7A 1FWZA 3JAME 3OYBA 4XTWA 1M1KC 2EIFA 2K3XA 4OP0A 5KYWA 3OYEA 1UB4A 1U1TA 2EAYA 2GQIA 1WHJA 3INZA 4LE9A 5GJVB 2A36A 2L8DA 4M78B 2R57A 4PJLA 2EQKA 3EHRA 2DRKA 2D0QB 3BDLA 4PJMA 5GAOn 2KK4A 4LXCA 4LN2A 4HCKA 2DTIA 2NUTB 4XU2A 2G3RA 2AT1B 3L2QA 2NUZA 4GBQA 2K9GA 1D1BA 1VQ5T 4ESRA 2A7YA 3QWXX 3CCLQ 4PFOA 2DF6A 4M7DE 5GAN5 4C92D 3LYIA 4N4GA 3CXCS 4Y92A 1BBZA 1JRIA 1SKUB 3DLLA 1Q82C 2X4YA 2YWWA 1S72T 2O4XB 3QO3A 3JCMe 1VQ9A 1PKTA 3GIBA 1OZ2A 3CCUT 2V8KA 2A28A 5HCKA 2JTMA 1WXTA 2RJFA 4PLIA 4J9EA 1M4ZA 1NPPA 3C95A 1M2VA 2EGCA 5CIUA 3LGFA 1UJYA 2NYSA 1PCXA 4EMKA 2LCLA 1SEMA 3RBBB 1U06A 2LC4A 2L2PA 4M75E 2JVVA 2YDLA 1SSFA 2VC8A 4FSXA 1WHMA 3HPWA 2VGNA 1HYOA 2KR3A 4JJCA 4R56A 2RI3A 1VQMQ 2RHZA 2VUBA 3CD6T 3CC7T 3RDVA 4M78D 2BTTA 2X4JA 3JRZA 1AWXA 2WSCE 3CPWP 3CC2T 2CDTA 4EPCA 1ZLMA 2COYA 4C0FA 5FWCA 3M59A 4HT8A 2RJDA 3G71Q 4L59A 1K8AU 1KSWA 1YITQ 4J6XA 5GANj 2L3PA 2O9SA 2E41A 2GFUA 3JCMQ 4DQ2A 2DJZA 1AZEA 4CI0C 3FJ5A 3CMET 1X69A 5GAOr 3QJYA 3PMTA 2PNIA 1HJDA 3BW1A 2ATCB 2QDYB 1IREB 2AZSA 4FW2A 4C8QF 1W70A 4B9WA 2XKOC 3CCJQ 1VUBA 1G3YA 4M77F 2K79A 2FPFA 3OSSC 2QYZA 1JO8A 2H8HA 5LJ3f 5CQXA 5GAMe 4M7AF 1YP5A 1D3BB 4A63B 1B3QA 1KQSA 5FROA 2LJ3A 4MDXA 2DTOA 4NS5A 3G4SA 2M16A 3LX7A 1YHQT 1TTHB 4RCCA 2CT3A 1EFNA 5IHNA 2DBKA 1YIJT 4XU0A 4AG1C 1JJ2A 2D9TA 2FRYA 3MEVA 2PZ1A 4J9GA 5FU6B 2AK5A 3VUZA 2YT6A 2ED0A 1QVFP 2M02A 1K8AC 1VQKT 3NPFA 1X2KA 2RH2A 3RR6A 1YJ9T 1GFDA 3QUIA 2HEQA 5KYUA 1U8RA 2NUPB 1XTDA 1VYVA 2J05A 2EYZA 4BI4A 2J7IA 2ZAEA 4DBRA 4PJOB 2E64A 3CCQA 1WYXA 1VQOA 3EG9A 3M0SA 3H0IA 4M7DC 1RABB 3P8DA 5KYWB 1VYUA 4BY6C 1ZSZA 2EYXA 3OA6A 1KC8U 3UWNA 4LNPA 1VQ6A 1QWEA 2DL8A 4OMFB 3I5RA 3JCMP 4HCZA 1QKXA 8AT1B 4JRPA 2DKGA 2KGTA 2JS2A 1YJWT 2BZXA 1I07A 3JB9I 2E1HA 2HQEA 2RF0A 2A3LA 2JXBA 5GAN7 3OYLA 5I2MA 4C92G 2X35A 1K0SA 3J81E 1NPRA 1D1CA 2RI2A 3L2ZA 2D8JA 3DLMA 1UGRB 1YJNA 4IUUA 4ORZA 4C0DB 2B86A 1VQ4T 3EGXA 4M75G 1G3TA 3GBQA 1ZX6A 4RG8A 1VQ9Q 3DKMA 3CPFA 1WNLA 2QA4A 4C5GA 1M2VB 4L6V5 1WHLA 1BIBA 3FB9A 2K3YA 3OSVA 1NJIR 4KRTA 3ZEHA 1VQLT 4E47A 2X3XD 2RPNA 2RQVA 3OYYA 2DETA 4IKFA 2KROA 1GFCA 4XU1A 4D6WA 4J9BA 4Q5WA 1Q81R 4PJOD 4E6RA 1MMGA 5C0MA 3EFSA 4F14A 1KC8C 3VRZA 1JJ2S 3EFOA 2E3IA 5ECAA 2WSFE 4M78G 4C92A 2J6KA 4B6MA 4J9FA 4PL6A 5GMKj 4C8QE 1VQPT 5D6YA 4F7UE 2CREA 2QXFA 3CCRT 4M77E 2COWA 3UATA 3JB9J 2XIDA 1OX9A 1BCMA 4M7AE 1JQQA 4M75A 1TXQA 2J6OA 1BI3A 1W6XA 3V7CA 1IZ6A 2O01E 3OYDA 2M9UA 1ZHIA 5AT1B 3MKDA 2L3RA 2BZYA 4JJDA 4PLLA 5L8RE 3RKXA 1N9RA 1I1JA 2VXFA 3GPLA 2RMOA 4RTVA 5J39A 3S3NA 2FEIA 4NL2A 4JZ4A 3OYCA 4EMHA 3SEMA 3CCUA 4XK8E 2Y90A 3EHQA 1N6AA 4ZNXA 2E12A 2CP3A 2HL5C 4LDYA 4M78A 4JUVA 2ECZA 4CC4B 3HHTB 1BIAA 1V1CA 4D8KA 2MYSA 3CCVT 5A0LA 2NUTA 1RADB 2COZA 4A4EA 3MEAA 1Y71A 4CC2A 2JM9A 1G3WA 3BDUA 1IB8A 4BE0A 2D1XA 2F2WA 2X4WA 3G4SQ 3FDRA 3M56A 1TOVA 3CD6A 3CC7A 3M0QA 4XTXA 5LJ5j 2V1QA 5LJ3j 1NLOC 3EH1A 4XAXB 2ENMA 3BE3A 3A5ZB 2DXTA 1HK9A 2DZ9A 3CC2A 2ZZDA 2CKKA 2CUDA 1U5SA 6AT1B 2DTHA 2XDBA 3M55A 3OYMA 5GAN6 2QAZA 3VYHB 5GAOp 2DEQA 1NJIU 1UECA 4BI8B 2C0TA 2XG8D 1SHGA 5FWBA 1H8KA 2NWMA 1OOTA 1GL5A 1Q81U 2H3JA 3REBB 4R55A 3EG9B 4IUQA 1U1SA 2KRSA 1SRMA 4Z8AA 4N4IA 3CCQQ 1VQOQ 1PSEA 2LCCA 2DJQA 1RUWA 4OGEA 2FL7A 4JS4A 1D09B 4II1A 3VV0A 4E7HA 1VQ6Q 5GANf 4VUBA 2DXUA 1GBQA 1VQ7T 1K1ZA 1JBMA 4EMGA 1ZUKA 1RAGB 1WIEA 2DX1A 2FG0A 2VKNA 2XDDA 1YIJA 4IIOA 5LL6S 2W10A 1YJNQ 3CXCA 2L3QA 1KQSP 1KD1R 3RUXA 2JUFA 2CYZB 3G6EA 1MV0B 5KE3A 1I8FA 2ZPFB 1NJIC 2HL3A 2QA4Q 1YCYA 1VQKA 1NZ9A 4M7DB 1GBRA 4F7UG 4FW1A 4ZTJA 2ZPEB 1JJ2P 1Q81C 8ATCB 4RTUA 4M7AC 4ZGJB 1FMWA 2KQWA 4PJOG 2QEXT 1WPYA 5A2QE 2XMFA 2YHTA 3CCMA 4QKUA 1XOVA 2DD4A 3QWYA 1EIFA 4AG2C 3EFOB 4FCYA 5D6XA 3C94A 3LWIA 3ULRB 3KFVA 2DRMA 4TVRA 3L2WA 5HK3A 2R5AA 1AEYA 1MUZA 5GAMj 4JJNK 1R77A 1FXXA 1I5OB 2V8JA 4M75B 3QHSA 1M90R 2L5QA 1YFNA 4JZ3A 1RI0A 2CP0A 2WACA 1QP2A 4FT2A 5GAN3 1XJWB 3OQ5A 1N8RR 2RM4A 2QQAA 4ME7A 3X20B 4F7UA 1PWTA 1BB9A 2PQWA 1ZSGA 1T0JA 1M1FA 4M77A 2LQNA 1E6GA 2VVKA 4PJOA 1X01A 4OB2B 3Q1JA 4A53A 1BK2A 1K0XA 2RHUA 5CVIA 2X4XA 4HVWA 3EG3A 3CCUQ 3SD4A 5DLOA 3MHXA 3VS4A 2C0OA 5HK0A 1UDLA 2YLBA 4M7DD 4LD9K 3UPUA 1YWOA 2HKQB 1VQLA 2EJFA 1ZA1B 3V8KA 1AWOA 2RB6A 2RHYA 2EKHA 2LMJA 4J5YA 2YUPA 3OMCA 4RTXA 2HZYA 5GMKi 2QGFB 5HY6A 5A0GA 2AHJB 5KH6A 4Y28E 2BE7D 3RMQA 2KE9A 1QCFA 4LDXA 2KSSA 3JB9F 1LCKA 1VQPA 1VQ8T 4XU3A 1B7TA 4C5HA 3CD6Q 3CC7Q 1CKBA 5CK9A 3CCRA 2X3WD 1OZ3A 1P92A 1KD1U 4QQ6A 4M75D 1IHVA 5GJWB 1TG0A 2D6FA 2AZVA 3O8VA 3CC2Q 2YRVA 2RHXA 1GCPA 4Z88A 4HXJA 3AHUA 2F5TX 5KCOA 2HQXA 4J7IA 2EYQA 1JEGA 2DYIA 1WQWA 1LJOA 1OPKA 1YWPA 1ABQA 2QGGA 1TUCA 2ZPBB 1QCNA 2K5FA 4L5GA 2DIQA 4QQGA 2MPXC 2DPPB 1KC8R 1QQJA 5GAOq 4ZN1A 2AIRB 3A8GB 3JCMX 1PC0A 3JCMV 1QVGA 1SPKA 1TUGB 1K9MU 1KQ1A 1OYXA 2KI7A 3CCLT 3J7AF 2LX9A 3O5ZA 2RQUA 4DA4A 1M90U 2DBMA 5GANh 3ZBDA 2CP5A 1TU0B 1PNJA 2L0AA 4RTZA 1XQHA 4WTOB 3MP8A 1N8RU 2HBWA 3OBWA 3JCMb 1RI9A 2KDSA 1IXDA 1H641 4CRIA 2RA2A 4LUDA 2YRCA 3A8MB 1KD1C 3VS5A 2QTVA 2KXDA 1HD3A 1YIJQ 4O6JA 3QYGB 3CQTA 3BY7A 2GF7A 4ZTFA 3TSWA 2CP7A 2RO0A 1HSQA 3A8HB 2P0KA 2W0ZA 1A0NB 3G6EQ 1SG5A 1OI1A 5J3BA 3PIPA 1EZZB 1U3OA 2OTJT 2I0NA 1Q7YU 1WJRA 1VQKQ 4UC4A 1WGSA 1VQMT 5LJ5f 2JN0A 3M0PA 4IUVA 3VJPA 1SF9A 3M58A 1ZBJA 2LT4A 3OYJA 3CCMQ 3UT1A 4DBFA 2RJCA 3QDRB 1MMDA 1M8VA 2M1HA 4HCBA 4BDYA 3LH0A 3UDCA 4RTYA 2BZ8A 2ROTA 3JCMf 1ZSZC 1KFZA 3OS5A 3NMZC 3G7ZA 1M90C 1X6BA 1VQNA 1MNEA 4XTZA 1UJ0A 1VQ7A 3META 1N8RC 1WA7A 2KYBA 1YJWQ 1CSKA 4OMLA 3CEYA 3ZFJA 4FYXB 4NOYA 2LJ0A 1G3SA 4LDWA 5CKFA 1YNZA 4C8QB 4F7UB 4MZMA 3V8LA 5GAN4 4M77B 2HQHA 4J83A 4E7KA 5FU7C 4N0AC 3OW2S 3X25B 1AHJB 2EBPA 3HP9A 4M7AB 2OTLT 3VS0A 1UHFA 3LLRA 1F1BB 2DVJA 2FPDA 3ER0A 1RAFB 1QVGS 2QQ9A 1Y07A 1IGQA 3FJPA 3VS6A 3S3OA 4M7DG 2YUNA 1BKBA 2LDMA 1PD1A 4OMMA 2HMAA 2MAMA 2GBQA 3CXCP 1OV3A 3L42A 1VQLQ 2EQMA 2A37A 1YI2T 3L1AA 3I56T 2EQJA 2CH4W 1ZUUA 5KYYA 2BKDN 2EJ9A 3UA6A 2FVUA 2C06A 1TWBA 2FRWA 2IIMA 4QQDA 4PJJA 2JNGA 1M1GA 4BE1A 1QLYA 3EGDA 2K2MA 1VQPQ 5GMKm 2JT4A 3CCRQ 2CP2A 4IUTA 3JV3A 2R58A 2RQWA 4J9DA 1ZQ1A 3OYFA 3QKJA 2Y4YA 3QJ6A 1KG1A 1G2BA 4M7DA 5GAMf 4C8QD 5GMKh 1Y7XA 4RUGA 3SDZA 1R0CB 4M77D 3E9FA 2FZGB 1H3HA 3C4SA 3U23A 3OYAA 3HSBA 3MP6A 3WVEB 2P84A 4M7AD 2ZGWA 2RI5A 5CAIA 4BI3A 2OAWA 2DM1A 1RLPC 2HKNA 3DB3A 4HCCA 2ZCFB 3TSZA 1E7OA 9ATCB 4F17A 4X9DA 3TCJA 4QVDA 2K57A 2HCKA 3TREA 2XU8A 3LW5E 2L3SA 2V1RA 3M4GA 4Z02A 1VQ5A 4R0KA 4RCBA 4A54A 3ME9A 1VQ9T 1MMAA 3MEWA 2LNHB 2YSQA 3WVDB 1KHIA 2PUKB 1PSFA 1PRMC 2D8HA 3M9QA 3VUBA 1X27A 1S72A 2Z0WA 2ZPHB 1WHKA 3CBMA 2OJ2A 3SWNC 1LOJA 1PD0A 2J6FA 1QKWA 2JTEA 3I35A 4D8DA 1TSFA 1WZOA 1RLQC 3CPWA 1B07A 3EFRA 2X51A 1IRXA 2AKKA 4OB1B 3H9NA 2ABLA 3OYIA 5GANg 1WX6A 2WSEE 1IGUA 5LJ5h 2OX7A 5LJ3h 4J8OA 1FMKA 3PIOA 4IIMA 3CCST 4PKCC 1NBEB 2JOYA 2EFIA 4QVCA 4ELYC 3C0CA 1V29B 4C5EA 3HRUA 3MPUB 1BI0A 1V76A 2K3BA 3CMAT 1UFFA 1VQNQ 2CSQA 3NGPA 3QDFA 4KGXB 3M0RA 5DLQE 1VQ7Q 4MMLA 3M53A 3T9NA 2XHCA 2ZPGB 3I5SA 1X43A 4KGZB 2HBPA 2O88A 2IPOB 2QK0A 2KVQG 2I2LA 2E65A 3FC3A 1OEBA 1R0BG 2LP5A 3FEOA 4KH0B 2QQRA 4AFSC 1ARKA 1MV3A 3J80E 3RMSA 1W4SA 1AZGB 5HKCA 3CMEA 2MK5A 2LZ6B 1ZUYA 2K2VA 3NFCA 3V8JA 1BI1A 1SRLA 1ZA2B 5CR2A 4Z89A 1ACMB 5FRNA 1C1AA 2KT1A 2DAQA 2OTJA 4C0ZA 3I55T 5GAOm 3F70A 1D0ZA 3G4ST 3JCMc 4XTVA 5I22A 3EG2A 1MMNA 2FZCB 1VOMA 2LNVA 3M54A 3OS1A 2XD0A 3BFMA 3RKWA 2DVEA 5KYYB 4P5NA 2DXCA 3EG1A 3MO8A 2E70A 4HT9A 1OPLA 2AKLA 2XI9A 5D7UA 4CC7A 2FO0A 1YHQA 1NE8A 3EGDB 2LQKA 3OS2A 5J26A 4O5VA 4C92F 3R6OA 2O2OA 4QT7A 4AT1B 3P8HA 1RAHB 3VU3C 1Y57A 1C6VX 2ESWA 3CPWS 2FHDA 5FU6C 2SEMA 2PUOB 2GCXA 2QASA 4M75F 4AFZC 5FLXE 4C8QG 1YJ9A 4BY6B 3HRSA 2QI2A 4M77G 3CC4T 3MCAB 1GCQA 4RKUE 5LJ5d 3LH5A 5LJ3d 1T3LA 4DOWA 3A98A 3KUFA 1KJWA 5KYXA 1ABOA 4M7AG 3UF4A 5GAMh 2E6NA 1O9SA 2OTLA 2LX7A 4KT0E 4PJOC 5CKEA 1M2OA 4FSSA 4KBMB 2JMCA 3PFSA 3A8OB 4RTTA 2LRQA 1ZBXA 1K9MR 4ATOA 4HKEA 1OX8A 2DD5A 4HA8A 3H41A 5CO7A 4M78F 2K4YA 2KEAA 4E7JA 1LPLA 3M0UA 1YJWA 1YI2A 2FYKA 1G83A 1NEBA 3I56A 2HNIA 5I21A 4OB0B 3L2VA 1VQ5Q 2KRMA 2HSPA 1MNDA 2KMTA 2JMAA 1RACB 4C8QA 3CCET 2P4TA 1UGPB 2RN8A 1Y0MA 1W2BA 4OB3B 1UG1A 2QA4T 4BDZA 1VQ4A 3JSCA 1OU9A 2EQIA 1M3AA 3AT1B 2FZKB 4M4ZA 4M7AA 1S72Q 3RKYA 2MIOA 2VASA 3S6WA 4C0DC 2VB6A 3VYGA 4WF2A 3QPHA 4OMQA 4DBHA 3E1SA 3X26B 5KYNA 3QZ5B 1Q7YR 2LCSA 1VYTA 2LJ1A 4E7LA 2F1LA 4DEYA 3HL8A 3H8ZA 2CUBA 2DFUA 4ZGDB 4EMKC 3LWHA 2JTFA 2RHIA 1NEGA 2M0OA 1UTIA 4JRIA 4QW2A 5KE2A 5IHKA 3EG0A 2CP6A 3GNFB 4F16A 4JJBA 1LVKA 2QQBA 2KY9A 2XICA 5LJ5e 1DJ7B 1FMVA 1AOJA 1VA7A 2FPEA 3HFOA 5LJ3e 2EGEA 1GXIE 4C5IA 4FM4B 2G6FX 4OGCA 2CS7A 2RJEA 2XDPA 4ZGEB 4RG2A 2KYMA 2DNUA 1W1FA 2VGMA 2GNCA 1N27A 2DERA 2FB7A 3A1PA 1I5LA 1M8MA 4IUPA 3GOXA 4X1VA 1IHWA 3SWNB 2DZCA 3X24B 1RAEB 5GAMd 3SHWA 1M30A 1X2QA 3WXMB 4AMCA 2E3HA 4KUIA 3PVLA 4C92E 5DY9A 2GTJA 5LJ5g 5LJ3g 1K9AA 4K11A 4JRQA 1I4K1 1WJSA 1K73U 1PM3A 2DMOA 1UHCA 3CMEQ 3C12A 3OW2A 3LGLA 4OMNA 2KT8A 2R5MA 4FIBA 4KULA 3PMIA 2EGAA 4A4KA 3CBOA 1BI2A 3CBPA 2OTJQ 4J9HA 3CCVA 4OMOA 4FL6A 4E7IA 2E6ZA 4XTUA 2EWNA 3JB9H 3JCMg 2F2XA 3NHNA 2MOXA 1M5Q1 2JS0A 2K7AA 2PTKA 4GY5A 3TU4K 1W2BS 1EX4A 2E10A 4MDWA 3V7SA 4LUEA 3CCSA 2GGRA 2RQRA 1YHQQ 1D0YA 1WLPB 2EW3A 5L23A 4XTYA 3HRTA 3ASKA 5IT9E 4AFQC 3M4YA 4LD6A 4M78E 5M9OA 2KNBB 1M27C 2DILA 1TUDA 3CMAA 1WDXA 4JRKA 4BB7A 1PKSA 2L89A 2EKOA 2E5QA 4J9IA 2DL7A 2E5KA 1WXUA 3E19A 3VS3A 1YJ9Q 1KHCA 2DYBA 2CSIA 1O75A 4J7FA 5KYXB 1K73C 1H3ZA 4LDVA 1T0HA 1B34A 4F7UF 4YTLA 2EYWA 4F04B 5KCHA 4PJOF 2OTLQ 2LQ8A 1K9MC 2M51A 1E6HA 3PNWC 4DBQA 4V2SA 3MEUA 3PTAA 2B8AA 2BUDA 3I9QA 3G71T 4PFZA 5C6SA 3I55A 2RNAA 3JB9D 2KXCA 4XQ3A 1YITT 2DLPA 4BD3A 2Y4XA 4JLGA 2PU9B 1YI2Q 3N5BB 1CKAA 1AT1B 3I56Q 1QWFA 3HFNA 1Q86R 4PNOA 1UE9A 2C0IA 4FYYB 1FX7A 2P4RA 2IVWA 3G6ET 3CCJT 5IAYA 5GAMg 1VQ4Q 1G8XA 2DL3A 4PJNA 1I0CA 1Z9QA 1Q7YC 2JW4A 5IH2A 1IO6A 1Y96A 3M57A 3QZ9B 3CCMT 2EPDA 1KK7A 4OVAA 5GANd 1K76A 4ANJA 1VIFA 1YBYA 3PVQA 4CC3A 2MF2A 2YXYA 4ZN3A 3CC4A 5FW9A 2GFAA 2KBTA 5I11A 2QEXA 1J3TA 4A4GA 2QG9B 2RK2A 3QG1A 1TS9A 3HTRA 2MWPA 2EYYA 3IQLA 5GMKl 2RQTA 2ED1A 2MMPA 2J06A 4JPBW 3RNJA 2P0PA 4C92C 3RERA 1SSHA 5IN1A 2A0FB 2EVRA 3OS0A 3TQ7P 1RAIB 1D0XA 1X6OA 3SB2A 4PK4A 3OBYA 7AT1B 5EG2A 3SFMA 2ZPIB 2CZ6B 3THKA 4N0AA 3JCMW 4M75C 3VS7A 2EJGA 4FT4A 2OI3A 5CCAA 4FYWB 1QP3A 3R6NA 2A08A 2YUQA 4FU6A 3OB9A 3OYHA 3VS1A 3CCEA 1RAAB 4MZTA 1UGQB 5GAN2 1MGQA 2NLUA 4BACA 4E7ZA 3REAB 2RD1A 4RMOA 1WHHA 2X9HA 1KQSS 1X75C 4OF1A 4EMKB 3MP1A 5GAN8 2JM8A 4NL3A 1T3SA 1N9SA 1WXBA 3KBGA 1BYMA 2DL4A 2BE9B 1OQKA 2P0QA 1W2BP 1BCOA 4M78C 4BUGA 4DEXA 1JXMA 3G1JA 1WHGA 3CCVQ 1Q95G 2QTXA 3QXEB 3A8LB 3E9GA 1BU1A 1Q86U 1H92A 4PJOE 3E2UA 3EH2A 1WFWA 2CT4A 4J6WA 5GANe 1QVPA 1LNXA 1Z9ZA 2JZ2A 3P8BB 3CCSQ 2D0NA 2K5IA 1VQ8A 3D7SB 1S1NA 2KRNA 2JJ9A 3PE0A 5IXFA 4KH1B 4A4HA 1QMCA 3RESA 2K5LA 1WJQA 4OMPA 3CMAQ 1M9SA 2QDLA 4GLKA 1RL2A 4C0GA 1VIEA 4MZPA 3DB4A 1AVZC 3GNGA 2LTOA 1B34B 3L2RA 4X9CA 2HSEB 1QCOA 3JCMJ 1M1KR 1N5ZA 1R8OB 3OYGA 2OAUA 4KGVB 1QW1A 3OY9A 3RIRA 1K4US 1UEBA 2PVGB 2DXBA 3JB9G 2CZ0B 5DM7R 2CZ1B 4X34A 2RK1A 3CCLA 1PHTA 2DK3A 3M5AA 3S3MA 3I55Q 2PVDB 2DIGA 3H6ZA 4E2FB 3JCMh 4KUDK 3X28B 1Q86C 3VKIA 4JS5A 2EQUA 4QVZA 4DOVA 3OW2P 4JLIA 1OU8A 3SWNA 2V26A 2O4XA 2PVOB 1PG5B 2M0YA 4IURA 1QVGP 2K6DA 1Q82R 3OMGA 1X6GA 2BIVA 2DO3A 1XNIA 2SRCA 3L2UA 5D6WA 2CZ7B 1KQ2A 5IHIA 2E4HA 3H0HA 2ROLA 1D1AA 5KYUB 1GRIA 5AYFA 1FYNA 3TVTA 5GAOl 1Y96B 4J6YA 4B9XA 4RTWA 3NTKA 1VQMA 2QQSA 3QSUA 3OYNA 5I2SA 1QVFA 2HDAA 3CC4Q 4M7DF 1ZSZB 1M3CA 3UA7A 1SHFA 2QEXQ 1GCQC 3EAEA 1UGSB 2CH4A 2IG0A 2MCNA 1G5VA 1KIKA 4MMKA 3FIFA 1VQNT 1NYFA 1OULA 1MHNA 1UGVA 2HAXA 3EGUA 4EIKA 3G71A 1UUEA 3PT9A 1AWJA 1YN8A 1AD5A 1YITA 2VXEA 5FU7B 2VV5A 2F2VA 5CQYA 1PRLC 1JXOA 3EGXB
chains in the Genus database with same CATH topology
2VXFA 3GPLA 3CCQT 3X24B 3V8LA 1VQOT 5J39A 5GAN4 4M77B 3S3NA 5GAMd 4A4FA 4J83A 4E7KA 5FU7C 2KAFA 3WXMB 4NL2A 4N0AC 4KUIA 4C92E 3OYCA 5DY9A 3OW2S 3X25B 1AHJB 3KXTA 3HP9A 4M7AB 4EMHA 5LJ5g 5LJ3g 4XK8E 2Y90A 4LDUA 5CKHA 2VYTA 3LLRA 4C8QC 3CCJA 3CCUA 1N6AA 1VQ6T 3ER0A 3GF5A 4JRQA 1I4K1 1WJSA 3FRNA 1TH7A 1QVGS 1K73U 2E12A 2LVMA 2QQ9A 1Y07A 4LDYA 4M77C 4M78A 5GMKe 2MWOA 1M1KU 4JUVA 3FJPA 4ELZC 2HD0A 3S3OA 3C12A 3OW2A 4M7DG 3LGLA 3HHTB 4N4HA 1BIAA 1I81A 1BKBA 2LDMA 3CCVT 2R5MA 4FIBA 4KULA 5A0LA 3PMIA 4A4KA 5FRMA 1WQ7A 3CBOA 1BI2A 3CBPA 4A4EA 2MAMA 1Y71A 1D3BA 3MEAA 3QBYA 3JCMd 3PGGA 3CCVA 3L42A 3NTHA 2EQMA 4FL6A 2E6ZA 4XTUA 3OYKA 4E7IA 2EWNA 3JB9H 3SWNB 1YI2T 3L1AA 3JCMg 3I56T 2EQJA 1G3WA 3BDUA 4BE0A 1M5Q1 2BKDN 4C92B 2F5KA 2EJ9A 2FVUA 2X4WA 2C06A 2MI6A 3TEEA 3FDRA 4GY5A 5CKBA 3M56A 3TU4K 3NTIA 2XK0A 4QQDA 2F69A 1YJNT 1W2BS 2E10A 3CD6A 3CC7A 2JNGA 1M1GA 3QYHB 4MDWA 3V7SA 3URGA 4BE1A 3CCSA 4JDSA 4Y91A 2LT1A 4XTXA 3FLGA 2V8IA 5LJ5j 5GMKm 5LJ3j 5CKDA 4XTYA 4XAXB 3HRTA 1Q82U 3V7RA 3A5ZB 3ASKA 2DXTA 5IT9E 1HK9A 4IUTA 2DZ9A 3M4YA 3CC2A 4LD6A 2ZZDA 2CKKA 5A0DA 4M78E 5M9OA 1HXDA 2YLCA 3QIIA 2R58A 2DTHA 2XDBA 3M55A 3CMAA 1JB0E 3OYMA 4BE2A 5GAN6 3GLXA 2CGHA 1ZQ1A 3OYFA 3QKJA 3VYHB 2Y4YA 4JRKA 4BB7A 3QJ6A 5GAOp 2DEQA 1KG1A 1NJIU 3HKSA 4BI8B 2GQVA 2XG8D 4EDUA 2L89A 4M7DA 2EKOA 2E5QA 1QVFS 3E19A 5GAMf 4C8QD 3GP8A 5GMKh 1Y7XA 3SDZA 1KHCA 1Q81U 2H3JA 4M77D 1O75A 3E9FA 4J7FA 4R55A 1FWZA 4IUQA 1U1SA 3C4SA 1K73C 3JAME 3OYBA 3OYAA 4N4IA 4XTWA 3HSBA 3MP6A 1H3ZA 4LDVA 1M1KC 3WVEB 2EIFA 1PSEA 2K3XA 2LCCA 1B34A 4OP0A 3OYEA 4M7AD 1UB4A 1U1TA 2EAYA 2ZGWA 3INZA 4YTLA 4F7UF 2RI5A 2L8DA 5CAIA 4M78B 2R57A 4BI3A 4OGEA 2FL7A 2EQKA 4JS4A 5KCHA 4PJOF 2D0QB 4II1A 3BDLA 2LQ8A 3VV0A 5GAOn 2KK4A 4E7HA 3DB3A 1K9MC 4HCCA 3PNWC 5GANf 2ZCFB 2DTIA 4V2SA 3MEUA 4XU2A 3PTAA 2G3RA 4VUBA 3L2QA 2DXUA 4X9DA 2B8AA 2BUDA 3TCJA 4QVDA 3G71T 1VQ7T 2K57A 5C6SA 1VQ5T 3I55A 3TREA 1JBMA 2XU8A 3LW5E 3JB9D 2A7YA 4XQ3A 1YITT 3M4GA 4Z02A 4EMGA 1VQ5A 4M7DE 5GAN5 4RCBA 4A54A 4BD3A 2Y4XA 4C92D 3LYIA 2PU9B 3ME9A 4JLGA 4N4GA 3CXCS 3N5BB 1VQ9T 3MEWA 3HFNA 1JRIA 2XDDA 1YIJA 4PNOA 3DLLA 5LL6S 1Q82C 3WVDB 1KHIA 2X4YA 1S72T 2O4XB 3QO3A 3JCMe 2PUKB 1VQ9A 1FX7A 3GIBA 1PSFA 1OZ2A 3CXCA 2OTLT 2IVWA 3M9QA 3G6ET 3CCUT 3VUBA 2V8KA 3CCJT 1S72A 2JTMA 5IAYA 3RUXA 2RJFA 5GAMg 2JUFA 2ZPHB 4PLIA 2CYZB 3CBMA 3G6EA 5KE3A 1M4ZA 1NPPA 3C95A 1I8FA 2ZPFB 3SWNC 1NJIC 1LOJA 1Q7YC 5CIUA 3LGFA 1YCYA 1VQKA 4EMKA 1NZ9A 4M7DB 2LCLA 4F7UG 1Y96A 2LC4A 4ZTJA 2ZPEB 3M57A 1Q81C 3QZ9B 4M75E 3CPWA 3CCMT 4M7AC 2JVVA 4ZGJB 3EFRA 2KQWA 4OVAA 1SSFA 4PJOG 5GANd 2VC8A 1VIFA 4FSXA 1YBYA 4OB1B 2QEXT 1WPYA 5A2QE 3OYIA 2MF2A 2YHTA 3CCMA 5GANg 3HPWA 4ZN3A 3CC4A 2WSEE 1XOVA 2DD4A 2VGNA 4R56A 2GFAA 2RI3A 1EIFA 2QEXA 5LJ5h 5LJ3h 2RHZA 2VUBA 5D6XA 3C94A 3LWIA 4A4GA 3CD6T 4J8OA 3CC7T 2RK2A 3PIOA 3QG1A 3CCST 4PKCC 4M78D 2X4JA 2JOYA 2EFIA 4TVRA 2MWPA 2R5AA 3JRZA 4ELYC 4QVCA 5HK3A 5GMKl 3L2WA 5GAMj 4JJNK 2MMPA 1V29B 1FXXA 2WSCE 2P0PA 4C92C 3CC2T 3RERA 2V8JA 4C5EA 4EPCA 4M75B 5IN1A 3HRUA 3QHSA 1BI0A 3CMAT 3OS0A 2L5QA 1X6OA 3SB2A 4C0FA 3M59A 4HT8A 2RJDA 5DLQE 4MMLA 4L59A 1RI0A 2WACA 3M53A 3OBYA 1QP2A 3T9NA 4FT2A 5EG2A 2ZPIB 3SFMA 2XHCA 2ZPGB 5GAN3 2CZ6B 1K8AU 3OQ5A 4N0AA 3JCMW 4M75C 2HBPA 2RM4A 4J6XA 2KVQG 2EJGA 2QQAA 4FT4A 2I2LA 4ME7A 5CCAA 1QP3A 3X20B 4FU6A 4F7UA 5GANj 2E65A 2PQWA 3FC3A 2E41A 2GFUA 3OB9A 3OYHA 1M1FA 4M77A 4DQ2A 3JCMQ 2DJZA 3FEOA 1X01A 4OB2B 3CCEA 4PJOA 4CI0C 3Q1JA 4A53A 4MZTA 1UGQB 5GAN2 1MGQA 3CMET 5GAOr 2NLUA 2QQRA 3PMTA 3QJYA 4BACA 3BW1A 3J80E 2RHUA 3RMSA 2QDYB 5CVIA 2RD1A 2X4XA 1IREB 1W4SA 4RMOA 5HKCA 3CMEA 4C8QF 4B9WA 3SD4A 2K2VA 3NFCA 2XKOC 1KQSS 3V8JA 1VUBA 1BI1A 1G3YA 1X75C 4OF1A 4EMKB 3MP1A 5DLOA 4M77F 5GAN8 3MHXA 5HK0A 5CR2A 4NL3A 3OSSC 5FRNA 2YLBA 4M7DD 4LD9K 3UPUA 2DAQA 1N9SA 2OTJA 3KBGA 5LJ3f 4C0ZA 5CQXA 5GAMe 3I55T 1VQLA 2EJFA 3V8KA 4M7AF 5GAOm 1BYMA 2RB6A 2RHYA 3F70A 1KQSA 1D3BB 4J5YA 2P0QA 3G4ST 5FROA 4M78C 3JCMc 4XTVA 4BUGA 4MDXA 2DTOA 3OMCA 4NS5A 5GMKi 2LNVA 2XD0A 3M54A 3OS1A 3BFMA 3G4SA 3RKWA 2DVEA 2M16A 2AHJB 3LX7A 2QTXA 2DXCA 4P5NA 5HY6A 5A0GA 5KH6A 3QXEB 4RCCA 3MO8A 4Y28E 2E70A 3RMQA 4HT9A 2XI9A 3A8LB 4LDXA 1YIJT 3E9GA 4XU0A 1YHQA 1NE8A 2KSSA 3JB9F 1Q86U 4PJOE 1VQPA 1JJ2A 1VQ8T 4XU3A 2D9TA 4J6WA 3MEVA 5GANe 4C5HA 1QVPA 1LNXA 5CK9A 3CCRA 2LQKA 2JZ2A 3OS2A 3P8BB 5FU6B 5J26A 4O5VA 2K5IA 1OZ3A 1P92A 4C92F 1VQ8A 3R6OA 1KD1U 4QQ6A 4M75D 3VUZA 3P8HA 2D6FA 3VU3C 3O8VA 1K8AC 1VQKT 3CPWS 2RH2A 2FHDA 4A4HA 2YRVA 3RESA 5FU6C 1YJ9T 2K5LA 2RHXA 3QUIA 1WJQA 2PUOB 2GCXA 3AHUA 2F5TX 1M9SA 5KCOA 1U8RA 2HQXA 4M75F 1XTDA 4GLKA 5FLXE 1RL2A 4J7IA 4C8QG 1YJ9A 2EYQA 4C0GA 4BY6B 4BI4A 1VIEA 4MZPA 1WQWA 3DB4A 3HRSA 2QI2A 4M77G 3CC4T 4PJOB 1LJOA 3MCAB 4RKUE 5LJ5d 5LJ3d 2E64A 3CCQA 4DOWA 3GNGA 3KUFA 1VQOA 4M7AG 2LTOA 5GAMh 4M7DC 2ZPBB 2E6NA 3P8DA 1B34B 4BY6C 3L2RA 2K5FA 4L5GA 1O9SA 2DIQA 4QQGA 4X9CA 2OTLA 3OA6A 4KT0E 4PJOC 2DPPB 3JCMJ 3UWNA 1KC8U 1R8OB 5CKEA 3OYGA 1VQ6A 5GAOq 2OAUA 4KBMB 4ZN1A 1QW1A 3PFSA 3OY9A 3A8OB 3RIRA 3A8GB 3JCMX 4OMFB 3JCMV 1QVGA 3JCMP 4HCZA 1K9MU 1KQ1A 1OYXA 1UEBA 1ZBXA 2LRQA 2LX9A 2PVGB 3CCLT 3J7AF 4ATOA 2DXBA 4JRPA 4HKEA 3JB9G 2DKGA 2DD5A 1YJWT 4HA8A 2CZ0B 5CO7A 5DM7R 2CZ1B 4DA4A 4M78F 4X34A 2RK1A 1M90U 3JB9I 3CCLA 5GANh 3ZBDA 2E1HA 2HQEA 2K4YA 4E7JA 2DK3A 3M5AA 2A3LA 3S3MA 2PVDB 2DIGA 3H6ZA 5GAN7 3JCMh 3OYLA 5I2MA 4C92G 1YJWA 4KUDK 1YI2A 2FYKA 3I56A 2X35A 2HNIA 3X28B 5I21A 1Q86C 4OB0B 3L2VA 1XQHA 3VKIA 4JS5A 3MP8A 1NPRA 2EQUA 2RI2A 4QVZA 4DOVA 3J81E 2KMTA 1N8RU 3OBWA 3L2ZA 3DLMA 1UGRB 2KDSA 4JLIA 3JCMb 1YJNA 4IUUA 1H641 4C0DB 4CRIA 4C8QA 2RA2A 1VQ4T 3A8MB 3SWNA 1KD1C 2P4TA 3CCET 2O4XA 2PVOB 1UGPB 4IURA 4M75G 1W2BA 4OB3B 1G3TA 2QA4T 4BDZA 4RG8A 4O6JA 1VQ4A 3JSCA 3QYGB 3OMGA 3DKMA 3BY7A 3CPFA 2BIVA 2GF7A 2DO3A 4ZTFA 2RO0A 1XNIA 4M7AA 3RKYA 1WNLA 3S6WA 4C0DC 2QA4A 3A8HB 2P0KA 3L2UA 5D6WA 4C5GA 2CZ7B 3VYGA 4WF2A 1KQ2A 4L6V5 1OI1A 1BIBA 5J3BA 3QPHA 3PIPA 3FB9A 2K3YA 3OSVA 2OTJT 5AYFA 3E1SA 3X26B 3ZEHA 1WJRA 1Q7YU 3QZ5B 5GAOl 4E47A 1VQLT 1Y96B 4UC4A 1WGSA 4J6YA 1VQMT 4B9XA 4IKFA 3OYYA 4XU1A 1YHQT 5LJ5f 4E7LA 4D6WA 2JN0A 3NTKA 4Q5WA 3HL8A 4IUVA 3H8ZA 1VQMA 4PJOD 2QQSA 4ZGDB 5C0MA 3VJPA 3QSUA 3M58A 4EMKC 3OYNA 3LWHA 2LT4A 2JTFA 3EFSA 5I2SA 2RHIA 3OYJA 1KC8C 1JJ2S 1QVFA 3UT1A 4M7DF 2M0OA 4JRIA 2WSFE 4M78G 2RJCA 4C92A 3QDRB 3EAEA 4PL6A 4QW2A 5KE2A 4C8QE 5GMKj 5D6YA 4F7UE 1VQPT 1M8VA 3GNFB 1UGSB 2IG0A 2M1HA 2QXFA 4HCBA 4BDYA 1G5VA 3CCRT 4MMKA 3LH0A 4M77E 3FIFA 3UDCA 2QQBA 2KY9A 2XICA 1VQNT 3JCMf 3JB9J 3OS5A 5LJ5e 1DJ7B 3G7ZA 1MHNA 2XIDA 3HFOA 5LJ3e 1M90C 4M7AE 2HAXA 4M75A 1GXIE 4C5IA 1VQNA 4XTZA 4FM4B 1BI3A 4OGCA 3G71A 1VQ7A 3V7CA 3PT9A 1IZ6A 2CS7A 2O01E 2RJEA 2XDPA 4ZGEB 3OYDA 2M9UA 3META 4RG2A 1N8RC 1ZHIA 2VGMA 1YITA 2VXEA 5FU7B 1N27A 2FB7A 3CEYA 2VV5A 3ZFJA 4NOYA 5CKFA 1G3SA 4LDWA 1I5LA 4IUPA 5CQYA 3GOXA 2L3RA 4PLLA 3RKXA 5L8RE 4C8QB 1N9RA 4F7UB 4MZMA 2DZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E65 A;  4V2S A;  3JCM P;  2VXF A;  4XU2 A;  2E41 A;  1KQ1 A;  3V8L A;  2DXU A;  5GAN 4;  5GAN j;  4M77 B;  4M77 A;  4X9D A;  4DQ2 A;  3JCM Q;  2DKG A;  4QVD A;  2DJZ A;  5GAM d;  1X01 A;  2K57 A;  3JB9 G;  4HA8 A;  4PJO A;  4NL2 A;  4N0A C;  4A53 A;  5GAN 2;  4M78 F;  1JBM A;  1MGQ A;  4C92 E;  5DY9 A;  3JB9 I;  5GAN h;  5GAO r;  2E1H A;  3JB9 D;  4XQ3 A;  4M7A B;  3BW1 A;  3M4G A;  4EMH A;  5LJ5 g;  5LJ3 g;  2Y90 A;  4C8Q C;  5GAN 7;  4EMG A;  3JCM h;  4C92 G;  2RD1 A;  1I4K 1;  2FYK A;  1TH7 A;  4C8Q F;  4M7D E;  5GAN 5;  4RCB A;  4A54 A;  2HNI A;  5I21 A;  4C92 D;  4M77 C;  4M78 A;  3V8J A;  5GMK e;  4JUV A;  3FJP A;  4EMK B;  4M77 F;  4M7D G;  5GAN 8;  3L2Z A;  3HFN A;  4NL3 A;  1BIA A;  1JRI A;  3JCM b;  4JLI A;  1I81 A;  2YLB A;  4M7D D;  1H64 1;  4PNO A;  4C8Q A;  2RA2 A;  1N9S A;  3SWN A;  5LJ3 f;  5GAM e;  1WQ7 A;  3QO3 A;  2EJF A;  3V8K A;  3JCM e;  5GAO m;  3GIB A;  4M7A F;  4M75 G;  2RB6 A;  1D3B B;  1D3B A;  4J5Y A;  3JCM d;  3PGG A;  4M78 C;  3JCM c;  4XTV A;  2DTO A;  4XTU A;  2EWN A;  3JB9 H;  3RUX A;  5GMK i;  3L1A A;  3JCM g;  5GAM g;  3BY7 A;  3BFM A;  3RKW A;  4M7A A;  3RKY A;  1WNL A;  3BDU A;  2DVE A;  1M5Q 1;  2QTX A;  1I8F A;  3SWN C;  4C92 B;  4RCC A;  2EJ9 A;  4WF2 A;  1KQ2 A;  1LOJ A;  4HT9 A;  1BIB A;  1YCY A;  3FB9 A;  4XU0 A;  4EMK A;  2E10 A;  4M7D B;  3JB9 F;  4F7U G;  3V7S A;  5GAO l;  4PJO E;  1Y96 B;  1Y96 A;  4J6Y A;  4XU3 A;  4Y91 A;  4J6W A;  4XTX A;  5GAN e;  4M75 E;  4M7A C;  1LNX A;  4XU1 A;  2DTI A;  3EFR A;  5LJ5 f;  4PJO G;  5LJ5 j;  5GMK m;  5LJ3 j;  5GAN d;  2VC8 A;  2JN0 A;  4XTY A;  4C92 F;  1WPY A;  3V7R A;  4PJO D;  2DXT A;  2YHT A;  5GAN g;  1HK9 A;  3QSU A;  2DZ9 A;  4M75 D;  4EMK C;  4M78 E;  1HXD A;  2YLC A;  3EFS A;  3VU3 C;  5LJ5 h;  2DTH A;  4M7D F;  5LJ3 h;  4JRI A;  4M78 G;  4C92 A;  4F7U A;  5GAN 6;  3RES A;  2CGH A;  5GMK j;  4C8Q E;  3QUI A;  4JRK A;  4F7U E;  1M8V A;  5GAO p;  2DEQ A;  4M78 D;  3AHU A;  3JCM V;  4M75 F;  4QVC A;  4MMK A;  4C8Q G;  4M77 E;  5GMK l;  3FIF A;  4M7D A;  5GAM f;  3JCM f;  4C8Q D;  5GAM j;  1WQW A;  5LJ5 e;  3JB9 J;  5GMK h;  5LJ3 e;  4M77 G;  3HFO A;  4PJO B;  1LJO A;  4C92 C;  3RER A;  5LJ5 d;  4M7A E;  5LJ3 d;  4M75 B;  2E64 A;  3QHS A;  4M77 D;  4M75 A;  4XTZ A;  1U1S A;  4M7A G;  4XTW A;  3HSB A;  3V7C A;  4M7D C;  5GAM h;  3SB2 A;  4OP0 A;  1B34 B;  1B34 A;  4HT8 A;  4M7A D;  4MML A;  1U1T A;  2EAY A;  2ZGW A;  3INZ A;  4X9C A;  4F7U F;  5CAI A;  2VXE A;  4M78 B;  4PJO C;  3JCM J;  5GAN 3;  2FB7 A;  4N0A A;  5GAO q;  3JCM W;  4M75 C;  4PJO F;  2RM4 A;  4NOY A;  1I5L A;  4J6X A;  2EJG A;  2I2L A;  5GAO n;  3RIR A;  3RKX A;  3JCM X;  4C8Q B;  1N9R A;  5GAN f;  4F7U B;  3SWN B;  2DZC A; 
#chains in the Genus database with same CATH topology
 3CCQ T;  1VQO T;  4A4F A;  2DEU A;  1AWW A;  5IXB A;  2KAF A;  3KXT A;  3CCE Q;  1NG2 A;  5CKH A;  4LDU A;  4C8Q C;  2VYT A;  1VQ6 T;  3CCJ A;  3GF5 A;  3FRN A;  1TH7 A;  4HVV A;  1K73 R;  2LVM A;  4M77 C;  2YUO A;  1M1K U;  5GMK e;  2MWO A;  4ELZ C;  2HD0 A;  3ZL7 C;  2DL5 A;  4HVU A;  4N4H A;  1I81 A;  3H0F A;  4E7S A;  1WI7 A;  5FRM A;  1WQ7 A;  3QBY A;  1D3B A;  3JCM d;  4AFU C;  3PGG A;  2VWF A;  3NTH A;  1JU5 C;  3OYK A;  1C0M A;  3VS2 A;  4C92 B;  2F5K A;  2YRD A;  1YCS B;  2MI6 A;  3TEE A;  5CKB A;  1YJN T;  3NTI A;  2XK0 A;  2F69 A;  2O9V A;  3QYH B;  3URG A;  4JDS A;  4Y91 A;  2LT1 A;  4WCI A;  3FLG A;  2V8I A;  5CKD A;  4PFP A;  1Q82 U;  1NM7 A;  3V7R A;  2DA9 A;  1NLP C;  1VQ8 Q;  5A0D A;  1HXD A;  2YLC A;  3QII A;  4FYV B;  1M3B A;  4GLM A;  3MJX A;  1JB0 E;  4BE2 A;  3GLX A;  2CGH A;  1K8A R;  4J9C A;  3HKS A;  2NUP A;  2GQV A;  4EDU A;  3M0T A;  1QVF S;  2GTO A;  2LQW A;  2O31 A;  3GP8 A;  2DE0 X;  1NYG A;  2H3E B;  3VRY A;  5EC7 A;  1FWZ A;  3JAM E;  3OYB A;  4XTW A;  1M1K C;  2EIF A;  2K3X A;  4OP0 A;  5KYW A;  3OYE A;  1UB4 A;  1U1T A;  2EAY A;  2GQI A;  1WHJ A;  3INZ A;  4LE9 A;  5GJV B;  2A36 A;  2L8D A;  4M78 B;  2R57 A;  4PJL A;  2EQK A;  3EHR A;  2DRK A;  2D0Q B;  3BDL A;  4PJM A;  5GAO n;  2KK4 A;  4LXC A;  4LN2 A;  4HCK A;  2DTI A;  2NUT B;  4XU2 A;  2G3R A;  2AT1 B;  3L2Q A;  2NUZ A;  4GBQ A;  2K9G A;  1D1B A;  1VQ5 T;  4ESR A;  2A7Y A;  3QWX X;  3CCL Q;  4PFO A;  2DF6 A;  4M7D E;  5GAN 5;  4C92 D;  3LYI A;  4N4G A;  3CXC S;  4Y92 A;  1BBZ A;  1JRI A;  1SKU B;  3DLL A;  1Q82 C;  2X4Y A;  2YWW A;  1S72 T;  2O4X B;  3QO3 A;  3JCM e;  1VQ9 A;  1PKT A;  3GIB A;  1OZ2 A;  3CCU T;  2V8K A;  2A28 A;  5HCK A;  2JTM A;  1WXT A;  2RJF A;  4PLI A;  4J9E A;  1M4Z A;  1NPP A;  3C95 A;  1M2V A;  2EGC A;  5CIU A;  3LGF A;  1UJY A;  2NYS A;  1PCX A;  4EMK A;  2LCL A;  1SEM A;  3RBB B;  1U06 A;  2LC4 A;  2L2P A;  4M75 E;  2JVV A;  2YDL A;  1SSF A;  2VC8 A;  4FSX A;  1WHM A;  3HPW A;  2VGN A;  1HYO A;  2KR3 A;  4JJC A;  4R56 A;  2RI3 A;  1VQM Q;  2RHZ A;  2VUB A;  3CD6 T;  3CC7 T;  3RDV A;  4M78 D;  2BTT A;  2X4J A;  3JRZ A;  1AWX A;  2WSC E;  3CPW P;  3CC2 T;  2CDT A;  4EPC A;  1ZLM A;  2COY A;  4C0F A;  5FWC A;  3M59 A;  4HT8 A;  2RJD A;  3G71 Q;  4L59 A;  1K8A U;  1KSW A;  1YIT Q;  4J6X A;  5GAN j;  2L3P A;  2O9S A;  2E41 A;  2GFU A;  3JCM Q;  4DQ2 A;  2DJZ A;  1AZE A;  4CI0 C;  3FJ5 A;  3CME T;  1X69 A;  5GAO r;  3QJY A;  3PMT A;  2PNI A;  1HJD A;  3BW1 A;  2ATC B;  2QDY B;  1IRE B;  2AZS A;  4FW2 A;  4C8Q F;  1W70 A;  4B9W A;  2XKO C;  3CCJ Q;  1VUB A;  1G3Y A;  4M77 F;  2K79 A;  2FPF A;  3OSS C;  2QYZ A;  1JO8 A;  2H8H A;  5LJ3 f;  5CQX A;  5GAM e;  4M7A F;  1YP5 A;  1D3B B;  4A63 B;  1B3Q A;  1KQS A;  5FRO A;  2LJ3 A;  4MDX A;  2DTO A;  4NS5 A;  3G4S A;  2M16 A;  3LX7 A;  1YHQ T;  1TTH B;  4RCC A;  2CT3 A;  1EFN A;  5IHN A;  2DBK A;  1YIJ T;  4XU0 A;  4AG1 C;  1JJ2 A;  2D9T A;  2FRY A;  3MEV A;  2PZ1 A;  4J9G A;  5FU6 B;  2AK5 A;  3VUZ A;  2YT6 A;  2ED0 A;  1QVF P;  2M02 A;  1K8A C;  1VQK T;  3NPF A;  1X2K A;  2RH2 A;  3RR6 A;  1YJ9 T;  1GFD A;  3QUI A;  2HEQ A;  5KYU A;  1U8R A;  2NUP B;  1XTD A;  1VYV A;  2J05 A;  2EYZ A;  4BI4 A;  2J7I A;  2ZAE A;  4DBR A;  4PJO B;  2E64 A;  3CCQ A;  1WYX A;  1VQO A;  3EG9 A;  3M0S A;  3H0I A;  4M7D C;  1RAB B;  3P8D A;  5KYW B;  1VYU A;  4BY6 C;  1ZSZ A;  2EYX A;  3OA6 A;  1KC8 U;  3UWN A;  4LNP A;  1VQ6 A;  1QWE A;  2DL8 A;  4OMF B;  3I5R A;  3JCM P;  4HCZ A;  1QKX A;  8AT1 B;  4JRP A;  2DKG A;  2KGT A;  2JS2 A;  1YJW T;  2BZX A;  1I07 A;  3JB9 I;  2E1H A;  2HQE A;  2RF0 A;  2A3L A;  2JXB A;  5GAN 7;  3OYL A;  5I2M A;  4C92 G;  2X35 A;  1K0S A;  3J81 E;  1NPR A;  1D1C A;  2RI2 A;  3L2Z A;  2D8J A;  3DLM A;  1UGR B;  1YJN A;  4IUU A;  4ORZ A;  4C0D B;  2B86 A;  1VQ4 T;  3EGX A;  4M75 G;  1G3T A;  3GBQ A;  1ZX6 A;  4RG8 A;  1VQ9 Q;  3DKM A;  3CPF A;  1WNL A;  2QA4 A;  4C5G A;  1M2V B;  4L6V 5;  1WHL A;  1BIB A;  3FB9 A;  2K3Y A;  3OSV A;  1NJI R;  4KRT A;  3ZEH A;  1VQL T;  4E47 A;  2X3X D;  2RPN A;  2RQV A;  3OYY A;  2DET A;  4IKF A;  2KRO A;  1GFC A;  4XU1 A;  4D6W A;  4J9B A;  4Q5W A;  1Q81 R;  4PJO D;  4E6R A;  1MMG A;  5C0M A;  3EFS A;  4F14 A;  1KC8 C;  3VRZ A;  1JJ2 S;  3EFO A;  2E3I A;  5ECA A;  2WSF E;  4M78 G;  4C92 A;  2J6K A;  4B6M A;  4J9F A;  4PL6 A;  5GMK j;  4C8Q E;  1VQP T;  5D6Y A;  4F7U E;  2CRE A;  2QXF A;  3CCR T;  4M77 E;  2COW A;  3UAT A;  3JB9 J;  2XID A;  1OX9 A;  1BCM A;  4M7A E;  1JQQ A;  4M75 A;  1TXQ A;  2J6O A;  1BI3 A;  1W6X A;  3V7C A;  1IZ6 A;  2O01 E;  3OYD A;  2M9U A;  1ZHI A;  5AT1 B;  3MKD A;  2L3R A;  2BZY A;  4JJD A;  4PLL A;  5L8R E;  3RKX A;  1N9R A;  1I1J A;  2VXF A;  3GPL A;  2RMO A;  4RTV A;  5J39 A;  3S3N A;  2FEI A;  4NL2 A;  4JZ4 A;  3OYC A;  4EMH A;  3SEM A;  3CCU A;  4XK8 E;  2Y90 A;  3EHQ A;  1N6A A;  4ZNX A;  2E12 A;  2CP3 A;  2HL5 C;  4LDY A;  4M78 A;  4JUV A;  2ECZ A;  4CC4 B;  3HHT B;  1BIA A;  1V1C A;  4D8K A;  2MYS A;  3CCV T;  5A0L A;  2NUT A;  1RAD B;  2COZ A;  4A4E A;  3MEA A;  1Y71 A;  4CC2 A;  2JM9 A;  1G3W A;  3BDU A;  1IB8 A;  4BE0 A;  2D1X A;  2F2W A;  2X4W A;  3G4S Q;  3FDR A;  3M56 A;  1TOV A;  3CD6 A;  3CC7 A;  3M0Q A;  4XTX A;  5LJ5 j;  2V1Q A;  5LJ3 j;  1NLO C;  3EH1 A;  4XAX B;  2ENM A;  3BE3 A;  3A5Z B;  2DXT A;  1HK9 A;  2DZ9 A;  3CC2 A;  2ZZD A;  2CKK A;  2CUD A;  1U5S A;  6AT1 B;  2DTH A;  2XDB A;  3M55 A;  3OYM A;  5GAN 6;  2QAZ A;  3VYH B;  5GAO p;  2DEQ A;  1NJI U;  1UEC A;  4BI8 B;  2C0T A;  2XG8 D;  1SHG A;  5FWB A;  1H8K A;  2NWM A;  1OOT A;  1GL5 A;  1Q81 U;  2H3J A;  3REB B;  4R55 A;  3EG9 B;  4IUQ A;  1U1S A;  2KRS A;  1SRM A;  4Z8A A;  4N4I A;  3CCQ Q;  1VQO Q;  1PSE A;  2LCC A;  2DJQ A;  1RUW A;  4OGE A;  2FL7 A;  4JS4 A;  1D09 B;  4II1 A;  3VV0 A;  4E7H A;  1VQ6 Q;  5GAN f;  4VUB A;  2DXU A;  1GBQ A;  1VQ7 T;  1K1Z A;  1JBM A;  4EMG A;  1ZUK A;  1RAG B;  1WIE A;  2DX1 A;  2FG0 A;  2VKN A;  2XDD A;  1YIJ A;  4IIO A;  5LL6 S;  2W10 A;  1YJN Q;  3CXC A;  2L3Q A;  1KQS P;  1KD1 R;  3RUX A;  2JUF A;  2CYZ B;  3G6E A;  1MV0 B;  5KE3 A;  1I8F A;  2ZPF B;  1NJI C;  2HL3 A;  2QA4 Q;  1YCY A;  1VQK A;  1NZ9 A;  4M7D B;  1GBR A;  4F7U G;  4FW1 A;  4ZTJ A;  2ZPE B;  1JJ2 P;  1Q81 C;  8ATC B;  4RTU A;  4M7A C;  4ZGJ B;  1FMW A;  2KQW A;  4PJO G;  2QEX T;  1WPY A;  5A2Q E;  2XMF A;  2YHT A;  3CCM A;  4QKU A;  1XOV A;  2DD4 A;  3QWY A;  1EIF A;  4AG2 C;  3EFO B;  4FCY A;  5D6X A;  3C94 A;  3LWI A;  3ULR B;  3KFV A;  2DRM A;  4TVR A;  3L2W A;  5HK3 A;  2R5A A;  1AEY A;  1MUZ A;  5GAM j;  4JJN K;  1R77 A;  1FXX A;  1I5O B;  2V8J A;  4M75 B;  3QHS A;  1M90 R;  2L5Q A;  1YFN A;  4JZ3 A;  1RI0 A;  2CP0 A;  2WAC A;  1QP2 A;  4FT2 A;  5GAN 3;  1XJW B;  3OQ5 A;  1N8R R;  2RM4 A;  2QQA A;  4ME7 A;  3X20 B;  4F7U A;  1PWT A;  1BB9 A;  2PQW A;  1ZSG A;  1T0J A;  1M1F A;  4M77 A;  2LQN A;  1E6G A;  2VVK A;  4PJO A;  1X01 A;  4OB2 B;  3Q1J A;  4A53 A;  1BK2 A;  1K0X A;  2RHU A;  5CVI A;  2X4X A;  4HVW A;  3EG3 A;  3CCU Q;  3SD4 A;  5DLO A;  3MHX A;  3VS4 A;  2C0O A;  5HK0 A;  1UDL A;  2YLB A;  4M7D D;  4LD9 K;  3UPU A;  1YWO A;  2HKQ B;  1VQL A;  2EJF A;  1ZA1 B;  3V8K A;  1AWO A;  2RB6 A;  2RHY A;  2EKH A;  2LMJ A;  4J5Y A;  2YUP A;  3OMC A;  4RTX A;  2HZY A;  5GMK i;  2QGF B;  5HY6 A;  5A0G A;  2AHJ B;  5KH6 A;  4Y28 E;  2BE7 D;  3RMQ A;  2KE9 A;  1QCF A;  4LDX A;  2KSS A;  3JB9 F;  1LCK A;  1VQP A;  1VQ8 T;  4XU3 A;  1B7T A;  4C5H A;  3CD6 Q;  3CC7 Q;  1CKB A;  5CK9 A;  3CCR A;  2X3W D;  1OZ3 A;  1P92 A;  1KD1 U;  4QQ6 A;  4M75 D;  1IHV A;  5GJW B;  1TG0 A;  2D6F A;  2AZV A;  3O8V A;  3CC2 Q;  2YRV A;  2RHX A;  1GCP A;  4Z88 A;  4HXJ A;  3AHU A;  2F5T X;  5KCO A;  2HQX A;  4J7I A;  2EYQ A;  1JEG A;  2DYI A;  1WQW A;  1LJO A;  1OPK A;  1YWP A;  1ABQ A;  2QGG A;  1TUC A;  2ZPB B;  1QCN A;  2K5F A;  4L5G A;  2DIQ A;  4QQG A;  2MPX C;  2DPP B;  1KC8 R;  1QQJ A;  5GAO q;  4ZN1 A;  2AIR B;  3A8G B;  3JCM X;  1PC0 A;  3JCM V;  1QVG A;  1SPK A;  1TUG B;  1K9M U;  1KQ1 A;  1OYX A;  2KI7 A;  3CCL T;  3J7A F;  2LX9 A;  3O5Z A;  2RQU A;  4DA4 A;  1M90 U;  2DBM A;  5GAN h;  3ZBD A;  2CP5 A;  1TU0 B;  1PNJ A;  2L0A A;  4RTZ A;  1XQH A;  4WTO B;  3MP8 A;  1N8R U;  2HBW A;  3OBW A;  3JCM b;  1RI9 A;  2KDS A;  1IXD A;  1H64 1;  4CRI A;  2RA2 A;  4LUD A;  2YRC A;  3A8M B;  1KD1 C;  3VS5 A;  2QTV A;  2KXD A;  1HD3 A;  1YIJ Q;  4O6J A;  3QYG B;  3CQT A;  3BY7 A;  2GF7 A;  4ZTF A;  3TSW A;  2CP7 A;  2RO0 A;  1HSQ A;  3A8H B;  2P0K A;  2W0Z A;  1A0N B;  3G6E Q;  1SG5 A;  1OI1 A;  5J3B A;  3PIP A;  1EZZ B;  1U3O A;  2OTJ T;  2I0N A;  1Q7Y U;  1WJR A;  1VQK Q;  4UC4 A;  1WGS A;  1VQM T;  5LJ5 f;  2JN0 A;  3M0P A;  4IUV A;  3VJP A;  1SF9 A;  3M58 A;  1ZBJ A;  2LT4 A;  3OYJ A;  3CCM Q;  3UT1 A;  4DBF A;  2RJC A;  3QDR B;  1MMD A;  1M8V A;  2M1H A;  4HCB A;  4BDY A;  3LH0 A;  3UDC A;  4RTY A;  2BZ8 A;  2ROT A;  3JCM f;  1ZSZ C;  1KFZ A;  3OS5 A;  3NMZ C;  3G7Z A;  1M90 C;  1X6B A;  1VQN A;  1MNE A;  4XTZ A;  1UJ0 A;  1VQ7 A;  3MET A;  1N8R C;  1WA7 A;  2KYB A;  1YJW Q;  1CSK A;  4OML A;  3CEY A;  3ZFJ A;  4FYX B;  4NOY A;  2LJ0 A;  1G3S A;  4LDW A;  5CKF A;  1YNZ A;  4C8Q B;  4F7U B;  4MZM A;  3V8L A;  5GAN 4;  4M77 B;  2HQH A;  4J83 A;  4E7K A;  5FU7 C;  4N0A C;  3OW2 S;  3X25 B;  1AHJ B;  2EBP A;  3HP9 A;  4M7A B;  2OTL T;  3VS0 A;  1UHF A;  3LLR A;  1F1B B;  2DVJ A;  2FPD A;  3ER0 A;  1RAF B;  1QVG S;  2QQ9 A;  1Y07 A;  1IGQ A;  3FJP A;  3VS6 A;  3S3O A;  4M7D G;  2YUN A;  1BKB A;  2LDM A;  1PD1 A;  4OMM A;  2HMA A;  2MAM A;  2GBQ A;  3CXC P;  1OV3 A;  3L42 A;  1VQL Q;  2EQM A;  2A37 A;  1YI2 T;  3L1A A;  3I56 T;  2EQJ A;  2CH4 W;  1ZUU A;  5KYY A;  2BKD N;  2EJ9 A;  3UA6 A;  2FVU A;  2C06 A;  1TWB A;  2FRW A;  2IIM A;  4QQD A;  4PJJ A;  2JNG A;  1M1G A;  4BE1 A;  1QLY A;  3EGD A;  2K2M A;  1VQP Q;  5GMK m;  2JT4 A;  3CCR Q;  2CP2 A;  4IUT A;  3JV3 A;  2R58 A;  2RQW A;  4J9D A;  1ZQ1 A;  3OYF A;  3QKJ A;  2Y4Y A;  3QJ6 A;  1KG1 A;  1G2B A;  4M7D A;  5GAM f;  4C8Q D;  5GMK h;  1Y7X A;  4RUG A;  3SDZ A;  1R0C B;  4M77 D;  3E9F A;  2FZG B;  1H3H A;  3C4S A;  3U23 A;  3OYA A;  3HSB A;  3MP6 A;  3WVE B;  2P84 A;  4M7A D;  2ZGW A;  2RI5 A;  5CAI A;  4BI3 A;  2OAW A;  2DM1 A;  1RLP C;  2HKN A;  3DB3 A;  4HCC A;  2ZCF B;  3TSZ A;  1E7O A;  9ATC B;  4F17 A;  4X9D A;  3TCJ A;  4QVD A;  2K57 A;  2HCK A;  3TRE A;  2XU8 A;  3LW5 E;  2L3S A;  2V1R A;  3M4G A;  4Z02 A;  1VQ5 A;  4R0K A;  4RCB A;  4A54 A;  3ME9 A;  1VQ9 T;  1MMA A;  3MEW A;  2LNH B;  2YSQ A;  3WVD B;  1KHI A;  2PUK B;  1PSF A;  1PRM C;  2D8H A;  3M9Q A;  3VUB A;  1X27 A;  1S72 A;  2Z0W A;  2ZPH B;  1WHK A;  3CBM A;  2OJ2 A;  3SWN C;  1LOJ A;  1PD0 A;  2J6F A;  1QKW A;  2JTE A;  3I35 A;  4D8D A;  1TSF A;  1WZO A;  1RLQ C;  3CPW A;  1B07 A;  3EFR A;  2X51 A;  1IRX A;  2AKK A;  4OB1 B;  3H9N A;  2ABL A;  3OYI A;  5GAN g;  1WX6 A;  2WSE E;  1IGU A;  5LJ5 h;  2OX7 A;  5LJ3 h;  4J8O A;  1FMK A;  3PIO A;  4IIM A;  3CCS T;  4PKC C;  1NBE B;  2JOY A;  2EFI A;  4QVC A;  4ELY C;  3C0C A;  1V29 B;  4C5E A;  3HRU A;  3MPU B;  1BI0 A;  1V76 A;  2K3B A;  3CMA T;  1UFF A;  1VQN Q;  2CSQ A;  3NGP A;  3QDF A;  4KGX B;  3M0R A;  5DLQ E;  1VQ7 Q;  4MML A;  3M53 A;  3T9N A;  2XHC A;  2ZPG B;  3I5S A;  1X43 A;  4KGZ B;  2HBP A;  2O88 A;  2IPO B;  2QK0 A;  2KVQ G;  2I2L A;  2E65 A;  3FC3 A;  1OEB A;  1R0B G;  2LP5 A;  3FEO A;  4KH0 B;  2QQR A;  4AFS C;  1ARK A;  1MV3 A;  3J80 E;  3RMS A;  1W4S A;  1AZG B;  5HKC A;  3CME A;  2MK5 A;  2LZ6 B;  1ZUY A;  2K2V A;  3NFC A;  3V8J A;  1BI1 A;  1SRL A;  1ZA2 B;  5CR2 A;  4Z89 A;  1ACM B;  5FRN A;  1C1A A;  2KT1 A;  2DAQ A;  2OTJ A;  4C0Z A;  3I55 T;  5GAO m;  3F70 A;  1D0Z A;  3G4S T;  3JCM c;  4XTV A;  5I22 A;  3EG2 A;  1MMN A;  2FZC B;  1VOM A;  2LNV A;  3M54 A;  3OS1 A;  2XD0 A;  3BFM A;  3RKW A;  2DVE A;  5KYY B;  4P5N A;  2DXC A;  3EG1 A;  3MO8 A;  2E70 A;  4HT9 A;  1OPL A;  2AKL A;  2XI9 A;  5D7U A;  4CC7 A;  2FO0 A;  1YHQ A;  1NE8 A;  3EGD B;  2LQK A;  3OS2 A;  5J26 A;  4O5V A;  4C92 F;  3R6O A;  2O2O A;  4QT7 A;  4AT1 B;  3P8H A;  1RAH B;  3VU3 C;  1Y57 A;  1C6V X;  2ESW A;  3CPW S;  2FHD A;  5FU6 C;  2SEM A;  2PUO B;  2GCX A;  2QAS A;  4M75 F;  4AFZ C;  5FLX E;  4C8Q G;  1YJ9 A;  4BY6 B;  3HRS A;  2QI2 A;  4M77 G;  3CC4 T;  3MCA B;  1GCQ A;  4RKU E;  5LJ5 d;  3LH5 A;  5LJ3 d;  1T3L A;  4DOW A;  3A98 A;  3KUF A;  1KJW A;  5KYX A;  1ABO A;  4M7A G;  3UF4 A;  5GAM h;  2E6N A;  1O9S A;  2OTL A;  2LX7 A;  4KT0 E;  4PJO C;  5CKE A;  1M2O A;  4FSS A;  4KBM B;  2JMC A;  3PFS A;  3A8O B;  4RTT A;  2LRQ A;  1ZBX A;  1K9M R;  4ATO A;  4HKE A;  1OX8 A;  2DD5 A;  4HA8 A;  3H41 A;  5CO7 A;  4M78 F;  2K4Y A;  2KEA A;  4E7J A;  1LPL A;  3M0U A;  1YJW A;  1YI2 A;  2FYK A;  1G83 A;  1NEB A;  3I56 A;  2HNI A;  5I21 A;  4OB0 B;  3L2V A;  1VQ5 Q;  2KRM A;  2HSP A;  1MND A;  2KMT A;  2JMA A;  1RAC B;  4C8Q A;  3CCE T;  2P4T A;  1UGP B;  2RN8 A;  1Y0M A;  1W2B A;  4OB3 B;  1UG1 A;  2QA4 T;  4BDZ A;  1VQ4 A;  3JSC A;  1OU9 A;  2EQI A;  1M3A A;  3AT1 B;  2FZK B;  4M4Z A;  4M7A A;  1S72 Q;  3RKY A;  2MIO A;  2VAS A;  3S6W A;  4C0D C;  2VB6 A;  3VYG A;  4WF2 A;  3QPH A;  4OMQ A;  4DBH A;  3E1S A;  3X26 B;  5KYN A;  3QZ5 B;  1Q7Y R;  2LCS A;  1VYT A;  2LJ1 A;  4E7L A;  2F1L A;  4DEY A;  3HL8 A;  3H8Z A;  2CUB A;  2DFU A;  4ZGD B;  4EMK C;  3LWH A;  2JTF A;  2RHI A;  1NEG A;  2M0O A;  1UTI A;  4JRI A;  4QW2 A;  5KE2 A;  5IHK A;  3EG0 A;  2CP6 A;  3GNF B;  4F16 A;  4JJB A;  1LVK A;  2QQB A;  2KY9 A;  2XIC A;  5LJ5 e;  1DJ7 B;  1FMV A;  1AOJ A;  1VA7 A;  2FPE A;  3HFO A;  5LJ3 e;  2EGE A;  1GXI E;  4C5I A;  4FM4 B;  2G6F X;  4OGC A;  2CS7 A;  2RJE A;  2XDP A;  4ZGE B;  4RG2 A;  2KYM A;  2DNU A;  1W1F A;  2VGM A;  2GNC A;  1N27 A;  2DER A;  2FB7 A;  3A1P A;  1I5L A;  1M8M A;  4IUP A;  3GOX A;  4X1V A;  1IHW A;  3SWN B;  2DZC A;  3X24 B;  1RAE B;  5GAM d;  3SHW A;  1M30 A;  1X2Q A;  3WXM B;  4AMC A;  2E3H A;  4KUI A;  3PVL A;  4C92 E;  5DY9 A;  2GTJ A;  5LJ5 g;  5LJ3 g;  1K9A A;  4K11 A;  4JRQ A;  1I4K 1;  1WJS A;  1K73 U;  1PM3 A;  2DMO A;  1UHC A;  3CME Q;  3C12 A;  3OW2 A;  3LGL A;  4OMN A;  2KT8 A;  2R5M A;  4FIB A;  4KUL A;  3PMI A;  2EGA A;  4A4K A;  3CBO A;  1BI2 A;  3CBP A;  2OTJ Q;  4J9H A;  3CCV A;  4OMO A;  4FL6 A;  4E7I A;  2E6Z A;  4XTU A;  2EWN A;  3JB9 H;  3JCM g;  2F2X A;  3NHN A;  2MOX A;  1M5Q 1;  2JS0 A;  2K7A A;  2PTK A;  4GY5 A;  3TU4 K;  1W2B S;  1EX4 A;  2E10 A;  4MDW A;  3V7S A;  4LUE A;  3CCS A;  2GGR A;  2RQR A;  1YHQ Q;  1D0Y A;  1WLP B;  2EW3 A;  5L23 A;  4XTY A;  3HRT A;  3ASK A;  5IT9 E;  4AFQ C;  3M4Y A;  4LD6 A;  4M78 E;  5M9O A;  2KNB B;  1M27 C;  2DIL A;  1TUD A;  3CMA A;  1WDX A;  4JRK A;  4BB7 A;  1PKS A;  2L89 A;  2EKO A;  2E5Q A;  4J9I A;  2DL7 A;  2E5K A;  1WXU A;  3E19 A;  3VS3 A;  1YJ9 Q;  1KHC A;  2DYB A;  2CSI A;  1O75 A;  4J7F A;  5KYX B;  1K73 C;  1H3Z A;  4LDV A;  1T0H A;  1B34 A;  4F7U F;  4YTL A;  2EYW A;  4F04 B;  5KCH A;  4PJO F;  2OTL Q;  2LQ8 A;  1K9M C;  2M51 A;  1E6H A;  3PNW C;  4DBQ A;  4V2S A;  3MEU A;  3PTA A;  2B8A A;  2BUD A;  3I9Q A;  3G71 T;  4PFZ A;  5C6S A;  3I55 A;  2RNA A;  3JB9 D;  2KXC A;  4XQ3 A;  1YIT T;  2DLP A;  4BD3 A;  2Y4X A;  4JLG A;  2PU9 B;  1YI2 Q;  3N5B B;  1CKA A;  1AT1 B;  3I56 Q;  1QWF A;  3HFN A;  1Q86 R;  4PNO A;  1UE9 A;  2C0I A;  4FYY B;  1FX7 A;  2P4R A;  2IVW A;  3G6E T;  3CCJ T;  5IAY A;  5GAM g;  1VQ4 Q;  1G8X A;  2DL3 A;  4PJN A;  1I0C A;  1Z9Q A;  1Q7Y C;  2JW4 A;  5IH2 A;  1IO6 A;  1Y96 A;  3M57 A;  3QZ9 B;  3CCM T;  2EPD A;  1KK7 A;  4OVA A;  5GAN d;  1K76 A;  4ANJ A;  1VIF A;  1YBY A;  3PVQ A;  4CC3 A;  2MF2 A;  2YXY A;  4ZN3 A;  3CC4 A;  5FW9 A;  2GFA A;  2KBT A;  5I11 A;  2QEX A;  1J3T A;  4A4G A;  2QG9 B;  2RK2 A;  3QG1 A;  1TS9 A;  3HTR A;  2MWP A;  2EYY A;  3IQL A;  5GMK l;  2RQT A;  2ED1 A;  2MMP A;  2J06 A;  4JPB W;  3RNJ A;  2P0P A;  4C92 C;  3RER A;  1SSH A;  5IN1 A;  2A0F B;  2EVR A;  3OS0 A;  3TQ7 P;  1RAI B;  1D0X A;  1X6O A;  3SB2 A;  4PK4 A;  3OBY A;  7AT1 B;  5EG2 A;  3SFM A;  2ZPI B;  2CZ6 B;  3THK A;  4N0A A;  3JCM W;  4M75 C;  3VS7 A;  2EJG A;  4FT4 A;  2OI3 A;  5CCA A;  4FYW B;  1QP3 A;  3R6N A;  2A08 A;  2YUQ A;  4FU6 A;  3OB9 A;  3OYH A;  3VS1 A;  3CCE A;  1RAA B;  4MZT A;  1UGQ B;  5GAN 2;  1MGQ A;  2NLU A;  4BAC A;  4E7Z A;  3REA B;  2RD1 A;  4RMO A;  1WHH A;  2X9H A;  1KQS S;  1X75 C;  4OF1 A;  4EMK B;  3MP1 A;  5GAN 8;  2JM8 A;  4NL3 A;  1T3S A;  1N9S A;  1WXB A;  3KBG A;  1BYM A;  2DL4 A;  2BE9 B;  1OQK A;  2P0Q A;  1W2B P;  1BCO A;  4M78 C;  4BUG A;  4DEX A;  1JXM A;  3G1J A;  1WHG A;  3CCV Q;  1Q95 G;  2QTX A;  3QXE B;  3A8L B;  3E9G A;  1BU1 A;  1Q86 U;  1H92 A;  4PJO E;  3E2U A;  3EH2 A;  1WFW A;  2CT4 A;  4J6W A;  5GAN e;  1QVP A;  1LNX A;  1Z9Z A;  2JZ2 A;  3P8B B;  3CCS Q;  2D0N A;  2K5I A;  1VQ8 A;  3D7S B;  1S1N A;  2KRN A;  2JJ9 A;  3PE0 A;  5IXF A;  4KH1 B;  4A4H A;  1QMC A;  3RES A;  2K5L A;  1WJQ A;  4OMP A;  3CMA Q;  1M9S A;  2QDL A;  4GLK A;  1RL2 A;  4C0G A;  1VIE A;  4MZP A;  3DB4 A;  1AVZ C;  3GNG A;  2LTO A;  1B34 B;  3L2R A;  4X9C A;  2HSE B;  1QCO A;  3JCM J;  1M1K R;  1N5Z A;  1R8O B;  3OYG A;  2OAU A;  4KGV B;  1QW1 A;  3OY9 A;  3RIR A;  1K4U S;  1UEB A;  2PVG B;  2DXB A;  3JB9 G;  2CZ0 B;  5DM7 R;  2CZ1 B;  4X34 A;  2RK1 A;  3CCL A;  1PHT A;  2DK3 A;  3M5A A;  3S3M A;  3I55 Q;  2PVD B;  2DIG A;  3H6Z A;  4E2F B;  3JCM h;  4KUD K;  3X28 B;  1Q86 C;  3VKI A;  4JS5 A;  2EQU A;  4QVZ A;  4DOV A;  3OW2 P;  4JLI A;  1OU8 A;  3SWN A;  2V26 A;  2O4X A;  2PVO B;  1PG5 B;  2M0Y A;  4IUR A;  1QVG P;  2K6D A;  1Q82 R;  3OMG A;  1X6G A;  2BIV A;  2DO3 A;  1XNI A;  2SRC A;  3L2U A;  5D6W A;  2CZ7 B;  1KQ2 A;  5IHI A;  2E4H A;  3H0H A;  2ROL A;  1D1A A;  5KYU B;  1GRI A;  5AYF A;  1FYN A;  3TVT A;  5GAO l;  1Y96 B;  4J6Y A;  4B9X A;  4RTW A;  3NTK A;  1VQM A;  2QQS A;  3QSU A;  3OYN A;  5I2S A;  1QVF A;  2HDA A;  3CC4 Q;  4M7D F;  1ZSZ B;  1M3C A;  3UA7 A;  1SHF A;  2QEX Q;  1GCQ C;  3EAE A;  1UGS B;  2CH4 A;  2IG0 A;  2MCN A;  1G5V A;  1KIK A;  4MMK A;  3FIF A;  1VQN T;  1NYF A;  1OUL A;  1MHN A;  1UGV A;  2HAX A;  3EGU A;  4EIK A;  3G71 A;  1UUE A;  3PT9 A;  1AWJ A;  1YN8 A;  1AD5 A;  1YIT A;  2VXE A;  5FU7 B;  2VV5 A;  2F2V A;  5CQY A;  1PRL C;  1JXO A;  3EGX B; 
#chains in the Genus database with same CATH homology
 2VXF A;  3GPL A;  3CCQ T;  3X24 B;  3V8L A;  1VQO T;  5J39 A;  5GAN 4;  4M77 B;  3S3N A;  5GAM d;  4A4F A;  4J83 A;  4E7K A;  5FU7 C;  2KAF A;  3WXM B;  4NL2 A;  4N0A C;  4KUI A;  4C92 E;  3OYC A;  5DY9 A;  3OW2 S;  3X25 B;  1AHJ B;  3KXT A;  3HP9 A;  4M7A B;  4EMH A;  5LJ5 g;  5LJ3 g;  4XK8 E;  2Y90 A;  4LDU A;  5CKH A;  2VYT A;  3LLR A;  4C8Q C;  3CCJ A;  3CCU A;  1N6A A;  1VQ6 T;  3ER0 A;  3GF5 A;  4JRQ A;  1I4K 1;  1WJS A;  3FRN A;  1TH7 A;  1QVG S;  1K73 U;  2E12 A;  2LVM A;  2QQ9 A;  1Y07 A;  4LDY A;  4M77 C;  4M78 A;  5GMK e;  2MWO A;  1M1K U;  4JUV A;  3FJP A;  4ELZ C;  2HD0 A;  3S3O A;  3C12 A;  3OW2 A;  4M7D G;  3LGL A;  3HHT B;  4N4H A;  1BIA A;  1I81 A;  1BKB A;  2LDM A;  3CCV T;  2R5M A;  4FIB A;  4KUL A;  5A0L A;  3PMI A;  4A4K A;  5FRM A;  1WQ7 A;  3CBO A;  1BI2 A;  3CBP A;  4A4E A;  2MAM A;  1Y71 A;  1D3B A;  3MEA A;  3QBY A;  3JCM d;  3PGG A;  3CCV A;  3L42 A;  3NTH A;  2EQM A;  4FL6 A;  2E6Z A;  4XTU A;  3OYK A;  4E7I A;  2EWN A;  3JB9 H;  3SWN B;  1YI2 T;  3L1A A;  3JCM g;  3I56 T;  2EQJ A;  1G3W A;  3BDU A;  4BE0 A;  1M5Q 1;  2BKD N;  4C92 B;  2F5K A;  2EJ9 A;  2FVU A;  2X4W A;  2C06 A;  2MI6 A;  3TEE A;  3FDR A;  4GY5 A;  5CKB A;  3M56 A;  3TU4 K;  3NTI A;  2XK0 A;  4QQD A;  2F69 A;  1YJN T;  1W2B S;  2E10 A;  3CD6 A;  3CC7 A;  2JNG A;  1M1G A;  3QYH B;  4MDW A;  3V7S A;  3URG A;  4BE1 A;  3CCS A;  4JDS A;  4Y91 A;  2LT1 A;  4XTX A;  3FLG A;  2V8I A;  5LJ5 j;  5GMK m;  5LJ3 j;  5CKD A;  4XTY A;  4XAX B;  3HRT A;  1Q82 U;  3V7R A;  3A5Z B;  3ASK A;  2DXT A;  5IT9 E;  1HK9 A;  4IUT A;  2DZ9 A;  3M4Y A;  3CC2 A;  4LD6 A;  2ZZD A;  2CKK A;  5A0D A;  4M78 E;  5M9O A;  1HXD A;  2YLC A;  3QII A;  2R58 A;  2DTH A;  2XDB A;  3M55 A;  3CMA A;  1JB0 E;  3OYM A;  4BE2 A;  5GAN 6;  3GLX A;  2CGH A;  1ZQ1 A;  3OYF A;  3QKJ A;  3VYH B;  2Y4Y A;  4JRK A;  4BB7 A;  3QJ6 A;  5GAO p;  2DEQ A;  1KG1 A;  1NJI U;  3HKS A;  4BI8 B;  2GQV A;  2XG8 D;  4EDU A;  2L89 A;  4M7D A;  2EKO A;  2E5Q A;  1QVF S;  3E19 A;  5GAM f;  4C8Q D;  3GP8 A;  5GMK h;  1Y7X A;  3SDZ A;  1KHC A;  1Q81 U;  2H3J A;  4M77 D;  1O75 A;  3E9F A;  4J7F A;  4R55 A;  1FWZ A;  4IUQ A;  1U1S A;  3C4S A;  1K73 C;  3JAM E;  3OYB A;  3OYA A;  4N4I A;  4XTW A;  3HSB A;  3MP6 A;  1H3Z A;  4LDV A;  1M1K C;  3WVE B;  2EIF A;  1PSE A;  2K3X A;  2LCC A;  1B34 A;  4OP0 A;  3OYE A;  4M7A D;  1UB4 A;  1U1T A;  2EAY A;  2ZGW A;  3INZ A;  4YTL A;  4F7U F;  2RI5 A;  2L8D A;  5CAI A;  4M78 B;  2R57 A;  4BI3 A;  4OGE A;  2FL7 A;  2EQK A;  4JS4 A;  5KCH A;  4PJO F;  2D0Q B;  4II1 A;  3BDL A;  2LQ8 A;  3VV0 A;  5GAO n;  2KK4 A;  4E7H A;  3DB3 A;  1K9M C;  4HCC A;  3PNW C;  5GAN f;  2ZCF B;  2DTI A;  4V2S A;  3MEU A;  4XU2 A;  3PTA A;  2G3R A;  4VUB A;  3L2Q A;  2DXU A;  4X9D A;  2B8A A;  2BUD A;  3TCJ A;  4QVD A;  3G71 T;  1VQ7 T;  2K57 A;  5C6S A;  1VQ5 T;  3I55 A;  3TRE A;  1JBM A;  2XU8 A;  3LW5 E;  3JB9 D;  2A7Y A;  4XQ3 A;  1YIT T;  3M4G A;  4Z02 A;  4EMG A;  1VQ5 A;  4M7D E;  5GAN 5;  4RCB A;  4A54 A;  4BD3 A;  2Y4X A;  4C92 D;  3LYI A;  2PU9 B;  3ME9 A;  4JLG A;  4N4G A;  3CXC S;  3N5B B;  1VQ9 T;  3MEW A;  3HFN A;  1JRI A;  2XDD A;  1YIJ A;  4PNO A;  3DLL A;  5LL6 S;  1Q82 C;  3WVD B;  1KHI A;  2X4Y A;  1S72 T;  2O4X B;  3QO3 A;  3JCM e;  2PUK B;  1VQ9 A;  1FX7 A;  3GIB A;  1PSF A;  1OZ2 A;  3CXC A;  2OTL T;  2IVW A;  3M9Q A;  3G6E T;  3CCU T;  3VUB A;  2V8K A;  3CCJ T;  1S72 A;  2JTM A;  5IAY A;  3RUX A;  2RJF A;  5GAM g;  2JUF A;  2ZPH B;  4PLI A;  2CYZ B;  3CBM A;  3G6E A;  5KE3 A;  1M4Z A;  1NPP A;  3C95 A;  1I8F A;  2ZPF B;  3SWN C;  1NJI C;  1LOJ A;  1Q7Y C;  5CIU A;  3LGF A;  1YCY A;  1VQK A;  4EMK A;  1NZ9 A;  4M7D B;  2LCL A;  4F7U G;  1Y96 A;  2LC4 A;  4ZTJ A;  2ZPE B;  3M57 A;  1Q81 C;  3QZ9 B;  4M75 E;  3CPW A;  3CCM T;  4M7A C;  2JVV A;  4ZGJ B;  3EFR A;  2KQW A;  4OVA A;  1SSF A;  4PJO G;  5GAN d;  2VC8 A;  1VIF A;  4FSX A;  1YBY A;  4OB1 B;  2QEX T;  1WPY A;  5A2Q E;  3OYI A;  2MF2 A;  2YHT A;  3CCM A;  5GAN g;  3HPW A;  4ZN3 A;  3CC4 A;  2WSE E;  1XOV A;  2DD4 A;  2VGN A;  4R56 A;  2GFA A;  2RI3 A;  1EIF A;  2QEX A;  5LJ5 h;  5LJ3 h;  2RHZ A;  2VUB A;  5D6X A;  3C94 A;  3LWI A;  4A4G A;  3CD6 T;  4J8O A;  3CC7 T;  2RK2 A;  3PIO A;  3QG1 A;  3CCS T;  4PKC C;  4M78 D;  2X4J A;  2JOY A;  2EFI A;  4TVR A;  2MWP A;  2R5A A;  3JRZ A;  4ELY C;  4QVC A;  5HK3 A;  5GMK l;  3L2W A;  5GAM j;  4JJN K;  2MMP A;  1V29 B;  1FXX A;  2WSC E;  2P0P A;  4C92 C;  3CC2 T;  3RER A;  2V8J A;  4C5E A;  4EPC A;  4M75 B;  5IN1 A;  3HRU A;  3QHS A;  1BI0 A;  3CMA T;  3OS0 A;  2L5Q A;  1X6O A;  3SB2 A;  4C0F A;  3M59 A;  4HT8 A;  2RJD A;  5DLQ E;  4MML A;  4L59 A;  1RI0 A;  2WAC A;  3M53 A;  3OBY A;  1QP2 A;  3T9N A;  4FT2 A;  5EG2 A;  2ZPI B;  3SFM A;  2XHC A;  2ZPG B;  5GAN 3;  2CZ6 B;  1K8A U;  3OQ5 A;  4N0A A;  3JCM W;  4M75 C;  2HBP A;  2RM4 A;  4J6X A;  2KVQ G;  2EJG A;  2QQA A;  4FT4 A;  2I2L A;  4ME7 A;  5CCA A;  1QP3 A;  3X20 B;  4FU6 A;  4F7U A;  5GAN j;  2E65 A;  2PQW A;  3FC3 A;  2E41 A;  2GFU A;  3OB9 A;  3OYH A;  1M1F A;  4M77 A;  4DQ2 A;  3JCM Q;  2DJZ A;  3FEO A;  1X01 A;  4OB2 B;  3CCE A;  4PJO A;  4CI0 C;  3Q1J A;  4A53 A;  4MZT A;  1UGQ B;  5GAN 2;  1MGQ A;  3CME T;  5GAO r;  2NLU A;  2QQR A;  3PMT A;  3QJY A;  4BAC A;  3BW1 A;  3J80 E;  2RHU A;  3RMS A;  2QDY B;  5CVI A;  2RD1 A;  2X4X A;  1IRE B;  1W4S A;  4RMO A;  5HKC A;  3CME A;  4C8Q F;  4B9W A;  3SD4 A;  2K2V A;  3NFC A;  2XKO C;  1KQS S;  3V8J A;  1VUB A;  1BI1 A;  1G3Y A;  1X75 C;  4OF1 A;  4EMK B;  3MP1 A;  5DLO A;  4M77 F;  5GAN 8;  3MHX A;  5HK0 A;  5CR2 A;  4NL3 A;  3OSS C;  5FRN A;  2YLB A;  4M7D D;  4LD9 K;  3UPU A;  2DAQ A;  1N9S A;  2OTJ A;  3KBG A;  5LJ3 f;  4C0Z A;  5CQX A;  5GAM e;  3I55 T;  1VQL A;  2EJF A;  3V8K A;  4M7A F;  5GAO m;  1BYM A;  2RB6 A;  2RHY A;  3F70 A;  1KQS A;  1D3B B;  4J5Y A;  2P0Q A;  3G4S T;  5FRO A;  4M78 C;  3JCM c;  4XTV A;  4BUG A;  4MDX A;  2DTO A;  3OMC A;  4NS5 A;  5GMK i;  2LNV A;  2XD0 A;  3M54 A;  3OS1 A;  3BFM A;  3G4S A;  3RKW A;  2DVE A;  2M16 A;  2AHJ B;  3LX7 A;  2QTX A;  2DXC A;  4P5N A;  5HY6 A;  5A0G A;  5KH6 A;  3QXE B;  4RCC A;  3MO8 A;  4Y28 E;  2E70 A;  3RMQ A;  4HT9 A;  2XI9 A;  3A8L B;  4LDX A;  1YIJ T;  3E9G A;  4XU0 A;  1YHQ A;  1NE8 A;  2KSS A;  3JB9 F;  1Q86 U;  4PJO E;  1VQP A;  1JJ2 A;  1VQ8 T;  4XU3 A;  2D9T A;  4J6W A;  3MEV A;  5GAN e;  4C5H A;  1QVP A;  1LNX A;  5CK9 A;  3CCR A;  2LQK A;  2JZ2 A;  3OS2 A;  3P8B B;  5FU6 B;  5J26 A;  4O5V A;  2K5I A;  1OZ3 A;  1P92 A;  4C92 F;  1VQ8 A;  3R6O A;  1KD1 U;  4QQ6 A;  4M75 D;  3VUZ A;  3P8H A;  2D6F A;  3VU3 C;  3O8V A;  1K8A C;  1VQK T;  3CPW S;  2RH2 A;  2FHD A;  4A4H A;  2YRV A;  3RES A;  5FU6 C;  1YJ9 T;  2K5L A;  2RHX A;  3QUI A;  1WJQ A;  2PUO B;  2GCX A;  3AHU A;  2F5T X;  1M9S A;  5KCO A;  1U8R A;  2HQX A;  4M75 F;  1XTD A;  4GLK A;  5FLX E;  1RL2 A;  4J7I A;  4C8Q G;  1YJ9 A;  2EYQ A;  4C0G A;  4BY6 B;  4BI4 A;  1VIE A;  4MZP A;  1WQW A;  3DB4 A;  3HRS A;  2QI2 A;  4M77 G;  3CC4 T;  4PJO B;  1LJO A;  3MCA B;  4RKU E;  5LJ5 d;  5LJ3 d;  2E64 A;  3CCQ A;  4DOW A;  3GNG A;  3KUF A;  1VQO A;  4M7A G;  2LTO A;  5GAM h;  4M7D C;  2ZPB B;  2E6N A;  3P8D A;  1B34 B;  4BY6 C;  3L2R A;  2K5F A;  4L5G A;  1O9S A;  2DIQ A;  4QQG A;  4X9C A;  2OTL A;  3OA6 A;  4KT0 E;  4PJO C;  2DPP B;  3JCM J;  3UWN A;  1KC8 U;  1R8O B;  5CKE A;  3OYG A;  1VQ6 A;  5GAO q;  2OAU A;  4KBM B;  4ZN1 A;  1QW1 A;  3PFS A;  3OY9 A;  3A8O B;  3RIR A;  3A8G B;  3JCM X;  4OMF B;  3JCM V;  1QVG A;  3JCM P;  4HCZ A;  1K9M U;  1KQ1 A;  1OYX A;  1UEB A;  1ZBX A;  2LRQ A;  2LX9 A;  2PVG B;  3CCL T;  3J7A F;  4ATO A;  2DXB A;  4JRP A;  4HKE A;  3JB9 G;  2DKG A;  2DD5 A;  1YJW T;  4HA8 A;  2CZ0 B;  5CO7 A;  5DM7 R;  2CZ1 B;  4DA4 A;  4M78 F;  4X34 A;  2RK1 A;  1M90 U;  3JB9 I;  3CCL A;  5GAN h;  3ZBD A;  2E1H A;  2HQE A;  2K4Y A;  4E7J A;  2DK3 A;  3M5A A;  2A3L A;  3S3M A;  2PVD B;  2DIG A;  3H6Z A;  5GAN 7;  3JCM h;  3OYL A;  5I2M A;  4C92 G;  1YJW A;  4KUD K;  1YI2 A;  2FYK A;  3I56 A;  2X35 A;  2HNI A;  3X28 B;  5I21 A;  1Q86 C;  4OB0 B;  3L2V A;  1XQH A;  3VKI A;  4JS5 A;  3MP8 A;  1NPR A;  2EQU A;  2RI2 A;  4QVZ A;  4DOV A;  3J81 E;  2KMT A;  1N8R U;  3OBW A;  3L2Z A;  3DLM A;  1UGR B;  2KDS A;  4JLI A;  3JCM b;  1YJN A;  4IUU A;  1H64 1;  4C0D B;  4CRI A;  4C8Q A;  2RA2 A;  1VQ4 T;  3A8M B;  3SWN A;  1KD1 C;  2P4T A;  3CCE T;  2O4X A;  2PVO B;  1UGP B;  4IUR A;  4M75 G;  1W2B A;  4OB3 B;  1G3T A;  2QA4 T;  4BDZ A;  4RG8 A;  4O6J A;  1VQ4 A;  3JSC A;  3QYG B;  3OMG A;  3DKM A;  3BY7 A;  3CPF A;  2BIV A;  2GF7 A;  2DO3 A;  4ZTF A;  2RO0 A;  1XNI A;  4M7A A;  3RKY A;  1WNL A;  3S6W A;  4C0D C;  2QA4 A;  3A8H B;  2P0K A;  3L2U A;  5D6W A;  4C5G A;  2CZ7 B;  3VYG A;  4WF2 A;  1KQ2 A;  4L6V 5;  1OI1 A;  1BIB A;  5J3B A;  3QPH A;  3PIP A;  3FB9 A;  2K3Y A;  3OSV A;  2OTJ T;  5AYF A;  3E1S A;  3X26 B;  3ZEH A;  1WJR A;  1Q7Y U;  3QZ5 B;  5GAO l;  4E47 A;  1VQL T;  1Y96 B;  4UC4 A;  1WGS A;  4J6Y A;  1VQM T;  4B9X A;  4IKF A;  3OYY A;  4XU1 A;  1YHQ T;  5LJ5 f;  4E7L A;  4D6W A;  2JN0 A;  3NTK A;  4Q5W A;  3HL8 A;  4IUV A;  3H8Z A;  1VQM A;  4PJO D;  2QQS A;  4ZGD B;  5C0M A;  3VJP A;  3QSU A;  3M58 A;  4EMK C;  3OYN A;  3LWH A;  2LT4 A;  2JTF A;  3EFS A;  5I2S A;  2RHI A;  3OYJ A;  1KC8 C;  1JJ2 S;  1QVF A;  3UT1 A;  4M7D F;  2M0O A;  4JRI A;  2WSF E;  4M78 G;  2RJC A;  4C92 A;  3QDR B;  3EAE A;  4PL6 A;  4QW2 A;  5KE2 A;  4C8Q E;  5GMK j;  5D6Y A;  4F7U E;  1VQP T;  1M8V A;  3GNF B;  1UGS B;  2IG0 A;  2M1H A;  2QXF A;  4HCB A;  4BDY A;  1G5V A;  3CCR T;  4MMK A;  3LH0 A;  4M77 E;  3FIF A;  3UDC A;  2QQB A;  2KY9 A;  2XIC A;  1VQN T;  3JCM f;  3JB9 J;  3OS5 A;  5LJ5 e;  1DJ7 B;  3G7Z A;  1MHN A;  2XID A;  3HFO A;  5LJ3 e;  1M90 C;  4M7A E;  2HAX A;  4M75 A;  1GXI E;  4C5I A;  1VQN A;  4XTZ A;  4FM4 B;  1BI3 A;  4OGC A;  3G71 A;  1VQ7 A;  3V7C A;  3PT9 A;  1IZ6 A;  2CS7 A;  2O01 E;  2RJE A;  2XDP A;  4ZGE B;  3OYD A;  2M9U A;  3MET A;  4RG2 A;  1N8R C;  1ZHI A;  2VGM A;  1YIT A;  2VXE A;  5FU7 B;  1N27 A;  2FB7 A;  3CEY A;  2VV5 A;  3ZFJ A;  4NOY A;  5CKF A;  1G3S A;  4LDW A;  1I5L A;  4IUP A;  5CQY A;  3GOX A;  2L3R A;  4PLL A;  3RKX A;  5L8R E;  4C8Q B;  1N9R A;  4F7U B;  4MZM A;  2DZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...