4Y9SA

Structure of an h300n mutant of potato epoxide hydrolase, steh1
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
320
structure length
320
Chain Sequence
KKIEHKMVAVNGLNMHLAELGEGPTILFIHGFPELWYSWRHQMVYLAERGYRAVAPDLRGYGDTTGAPLNDPSKFSILHLVGDVVALLEAIAPNEEKVFVVAHDWGALIAWHLCLFRPDKVKALVNLSVHFSKRNPKMNVVEGLKAIYGEDHYISRFQVPGEIEAEFAPIGAKSVLKKILTYRDPAPFYFPKGKGLEAIPDAPVALSSWLSEEELDYYANKFEQTGFTGAVNYYRALPINWELTAPWTGAQVKVPTKFIVGEFDLVYHIPGAKEYIHNGGFKKDVPLLEEVVVLEGAANFVSQERPHEISKHIYDFIQKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Expanding the Catalytic Triad in Epoxide Hydrolases and Related Enzymes.
pubmed doi rcsb
source organism Solanum tuberosum
molecule tags Hydrolase
molecule keywords Epoxide hydrolase
total genus 120
structure length 320
sequence length 320
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4y9sA00
4QWWA 3QM1A 3W2TA 4TGLA 2EEPA 3DKKA 4GEGA 1I6WA 5AM2A 5K3DA 3V1LA 2AJCA 1UK7A 1VKHA 5EHQA 1R4ZA 2JBWA 2QXTA 4BE9A 4B80A 2HA7A 5CTAA 1FFBA 1GKLA 3X3HA 3FLBA 3HXKA 2H7YA 5FXMA 3FCXA 4HXFB 1YB7A 4UHDA 4OYLA 5HF9A 5LKAA 3N0TA 1GPKA 1AQLA 3WL8A 1DINA 5IVIA 5CBKA 2BKLA 1E8MA 3DLTA 1B41A 5AO9A 4C6HA 1A7UA 1CUUA 2HA6A 3DL7A 3PDCA 4RGYA 2WFMA 3G0GA 5ISMA 4KACA 4BCDA 2I78A 4EBBA 4PSDA 3WYNA 3G9XA 1JJBA 1F0PA 3R3XA 3F9CA 2XMCA 2CBGA 5CRIA 5I9IA 2CKMA 5AM5A 4CCYB 2RONA 1YCDA 2AJBA 4PF1A 1CUHA 4BB0A 5LYYA 1WOMA 3WZMA 5JAHA 4BP9A 2ZVDA 4Y2XA 1XLWA 2Z5GA 3VXKA 5K3CA 1SFRA 1CUAA 2VT6A 4H7KA 4U2FA 2OAGA 1F8UA 2B4KA 4WY5A 1J07A 5AKHA 3STXA 1QJ4A 2QKYA 3PFBA 3ZV7A 3DS8A 1FSSA 5EIEA 1Z68A 4JEIA 5HF8A 4ZV9A 5ALZA 1DT5A 4EY8A 1NX9A 4DYHA 3G8YA 5K3EA 3WL7A 1U65A 1ZI8A 4BRSA 4W1SA 3VJMA 2QVBA 3GROA 4GECA 5ALQA 4AMZA 1VXOA 3VVMA 3WWEA 2ZJFA 2PPLA 4ZRDA 1IVYA 1TCAA 1BCRA 1XZJA 4B84A 3PUHA 4HRXA 5LP1A 3OTQA 3C45A 3AUKA 1O6FA 3WWDA 4L0CA 2ZJ7A 2OGZA 2BUCA 2QT9A 5AH0A 5D7BA 3W05A 2VQ6A 4ITVA 3K6KA 1A8UA 4UPDA 1Q0ZA 3I2FA 4U2DA 5C7YA 1Y7IA 4FOLA 2VAVA 2JGFA 1CUWA 3VDXA 1GPLA 4V2IA 1R88A 1QIJA 5AOAA 3C87A 3BDIA 3H1BA 4GXNA 1JMKC 3KWJA 1VA5A 1WM1A 3WQHA 4BDTA 4ZWNA 2XUPA 1EDDA 1BRTA 3JYHA 4FLEA 4UBIA 2ROQA 3V48A 4LXGA 1ODTC 5D3ZA 3HZOA 2XMBA 5CXXA 1XZHA 2HU8A 1X70A 4Y2YA 4KAFA 5FLKA 2WM2A 1IUOA 5ALFA 1QOZA 4MEBA 5A2GA 1N5MA 1YSCA 3R3UA 5EIHA 1UXOA 4Q34A 4QEKA 4UBMA 5IVHA 1BN6A 3E4DA 5DYWA 3QVMA 3GFFA 5AM4A 5A6VA 2ACEA 2WJ3A 4QZVA 5AK6A 5T4HA 3D7RA 2VAXA 2I3ZA 1JT2A 4CFSA 4BTVA 1XZKA 2BGNA 5HKBA 3DOHA 3BJMA 3PI6A 3WKDA 4P92A 4Q3OA 1YAHA 3C70A 4DNOA 1W76A 1XROA 4E15A 5AKKA 1UWCA 2O7VA 2XUJA 3FLEA 4GI1A 1USWA 4X7BA 5AM0A 3C43A 5CH5A 1ORVA 3LIIA 4JYPA 5KWIA 3WZLA 3WA7A 1G4HA 4MYSA 5D3KA 2J4FA 2YXPX 1M33A 1CUGA 3H04A 4QE3A 3H1AA 2O2HA 2QJWA 4J0CA 4AN0A 4GHWA 3ESCA 4DMCA 5AKEA 3RARA 4B9AA 2Y2UA 4C88A 2VJBA 4CG1A 1P0QA 1W6RA 5K3AA 1CUXA 3STTA 4G5XA 1EK1A 1CFJA 2JIDA 3STYA 4C4ZA 2I3DA 2WUDA 5AK5A 3ESAA 1KU6A 1EI9A 4BC0A 1SCKA 1CUSA 1YS1X 4RPCA 1QIIA 2BUAA 2ZYIA 5ALIA 2RI6A 1CUZA 1LZKA 4MEAA 1MAAA 4D9JA 4EY7A 3FNBA 4LKOA 3E3AA 1P0IA 2YASA 1XZLA 4PV7A 4DM7A 1S8OA 1UK8A 4LYDA 2V96A 4B7ZA 4Y2UA 1WHSA 1QGED 1LGYA 3QZUA 4Y2VA 2WTMA 1PJAA 1KU0A 4AO7A 2VTVA 1ETHA 3SX4A 4MJ3A 1YR2A 2OCLA 5AKGA 3T4UA 5AI5A 5AIBA 4X92A 4B9EA 5DLPA 4UBJA 4PNZA 2HA0A 3DKRA 3WKAA 4X93A 3LP5A 2DHDA 3ILSA 1H2XA 3D2BA 2WSLA 3WL5A 4A16A 1H22A 5LKRA 4B83A 3WK9A 1C7JA 3F98A 4K5QA 4FLFA 4UBNA 4AZ0A 4KE9A 2XE4A 3IIIA 4B0OA 3R3ZA 4Y9SA 4K6KA 5AI4A 3STVA 1IUNA 1XZMA 4X90A 5YASA 1AZWA 1QTRA 1QONA 3FYUA 1QZ3A 1XQYA 1L7QA 3DOIA 4QA9A 4HXGA 2C58A 1CLEA 1O6GA 1VJ5A 4G8CA 4WY8A 3CCCA 2HFJA 5FPPA 4W9RA 1CPYA 2P8SA 4H7JA 1E66A 5A71A 4K2AA 5JIBA 1LBTA 4UHEA 5AKIA 5JAOA 1MX5A 1JJIA 1XZCA 4BTLA 1XLVA 2BGRA 5K3BA 5AK4A 4H7DA 4EA6A 2ES4A 4H0CA 5E4TA 3PE6A 2OQVA 3QMVA 3FBWA 2VSQA 1ZICA 5IVKA 2WQZA 4H7FA 2C5GA 3V1MA 2PSEA 1AURA 4Q05A 2OQIA 1X2BA 3FSGA 3SC2A 2BFNA 4C4YA 1MPXA 4QLOA 2QZPA 1SOMA 1W1IA 5IH7A 5AKXA 2HU7A 5K5EA 5HFAA 1XZDA 1AUOA 2WUEA 4UHFA 3FLAA 1NU6A 3RK4A 3FYUC 1BN7A 3Q8WA 1WB6A 2WG1A 4AZ3A 2XUOA 3S2ZA 3AJAA 1CUFA 1MAHA 2VF2A 1B6GA 4BAGA 1BROA 5HKAA 4X71A 3H2IA 4GBGA 2B61A 1E89A 2HA3A 4B0PA 3OOSA 2QUAA 1E5TA 4H7IA 2GBIA 1ZD5A 2XUAA 2XQJA 1DTEA 4MQMA 4Y2JA 1ZOIA 2HIHA 3L1JA 5LZ9A 3WYDA 2XUKA 1LPAB 3I1IA 5JARA 4DMFA 2J3DA 4UUQA 5CURA 3FCYA 3M3DA 2Z3ZA 5FUMA 5HK9A 2XQGA 3STWA 1Y37A 5ALEA 2QTBA 4W63A 4DTCA 5E2IA 2ZJ6A 4B6GA 3OPMA 4LYEA 2GBCA 5JD4A 5ALMA 2PBLA 1LPSA 1YS2X 4N5HX 1H2YA 1UOQA 1DWOA 3PF8A 3H2HA 1G66A 2GYVA 2NW6A 3KSRA 4KRYA 4B85A 1W52X 5FOQA 2J3QA 1F6WA 2H7CA 4OYYA 4OSEA 1K63A 4P9NA 1HL7A 4JUIA 3SWWA 1TQHA 3C5VA 1THGA 3WK4A 1YA8A 5AKJA 3LS2A 1IZ8A 4ROTA 3GA7A 1RYYA 3I2KA 3AILA 3M83A 3WKBA 5FDFA 1R3DA 1ZI6A 2WIKA 2HM7A 2XUFA 5CH8A 2DHCA 2Y2VA 2V98A 2ACKA 1XRMA 4RE5A 1OXMA 5EHNA 1R9NA 1XRNA 2HADA 3HC7A 1QO7A 3IUNA 2QJRA 2JEZA 2Z8ZA 4E46A 2XUIA 4DNPA 3ZLTA 4UHCA 4DMHA 1EH5A 3WWPA 2D0DA 2GYUA 4KEAA 1WB4A 2XI4A 1J06A 3A6ZA 4AX4A 3G9TA 1XRQA 4CCYA 3H2JA 2CMFA 2XMDA 3BF8A 3QBJA 3A70A 5H3HA 3UUFA 3QH4A 4TPKA 4BC1A 3BL8A 5CXUA 3F96A 5A62A 3S8YA 3E0XA 4A23A 1CRLA 1ODSA 4QDOA 1JU4A 5BOVA 1LLFA 3EQ8A 1CUVA 1EB9A 4LXIA 3C5WP 4C01A 1LPPA 1TRHA 3PF9A 5T4BA 1A88A 2DR0A 4NVRA 4PSUA 2Z3WA 4DSZA 2VT7A 1A8SA 5EGNA 4G9GA 4M0MA 4AN1A 3I2IA 1DWQA 1XQVA 4Q3LA 4UFPA 3N2ZB 5JZ9A 1GPNA 2VEOA 3W06A 2WJ4A 2BJHA 1BE0A 3B12A 1E8NA 2RGUA 4XJVA 3HEAA 1FJ2A 1N1MA 1DWPA 1VLQA 2G63A 3BIWA 4Y2SA 3QPAA 5EFZA 2ORYA 4DLNA 2PX6A 3U0VA 1H2WA 2HA4A 2ONCA 4GDMA 3HLKA 3D4LA 1MO2A 4FFWA 2GBGA 2XT0A 3EQ7A 3G0CA 4OU5A 2B20A 2D5LA 1ZI9A 2QS9A 4FWBA 4NMWA 1XZAA 3R3VA 3A2MA 2WILA 3H17A 4CI9A 5FP0A 1JKMA 2X8BA 2WFZA 4J03A 3R0VA 2Y6VA 4HXEB 1XLUA 2XUGA 2ZYRA 1A8QA 1ZGBA 1MNAA 1BEEA 1XZFA 1GXSA 3YASA 4ZXFA 3C6YA 1QE3A 4HRYA 3O9MA 5EHZA 4UFOA 3F67A 4J7AA 4HZGA 3BXPA 3WK8A 4DNQA 4U2EA 4BATA 4E14A 1MX1A 1GQRA 4U2GA 4OB8A 1H2ZA 4FTWA 3T52A 4HS9A 3ANSA 5J3JA 3G7NA 4GW3A 4ZI5A 4QDUA 2JGIA 1U2EA 2BUBA 1LBSA 2WLSA 4J0DA 4F0JA 1AKNA 2RHWA 5A7FA 3EIOA 4QNNA 3O4HA 2QUBA 4PSCA 1GGVA 2XLCA 3WJ2A 5AKLA 4CCWA 5E4YA 4EHBA 1QIGA 3NUZA 2XMGA 5JZBA 1LPNA 3I2HA 4G9EA 4PQEA 2Z8XA 2OG1A 1WB5A 5BWBA 3AINA 2XMSA 4IH4A 3U1TA 4B81A 4N8SA 4IO0A 5ALDA 1MX9A 5DTJA 3AIMA 3UMJA 1LPBB 2O2IA 1C7IA 2EDCA 1IZ7A 4FHZA 5HZGA 5AI0A 4ZV7A 2Y6UA 4EUSA 2OCKA 1MN6A 5LZ5A 1DX6A 2PU5A 3D5EA 5EIAA 4H7HA 1G5FA 3R41A 1UK6A 1EDBA 4OPMA 1LZLA 4HAIA 1W75A 2WHQA 4KE8A 4BVKA 2GBFA 1CUBA 3H2GA 1BCSA 1L7AA 2OCGA 4IH1A 3NWOA 2JGEA 2FX5A 5HCUA 5C8VA 5JAUA 5ALHA 1Y7HA 5CT8A 4YX9A 4WFJA 1HBJA 4L9AA 4U2CA 2HDWA 4EZIA 1GKKA 5JYCA 2ZSIA 1ACLA 1K8QA 3EQ9A 5C8ZA 5BV7A 5ALXA 2C0PA 2HL6A 1Q0RA 3TJMA 4WDQA 3AZPA 1EK2A 5HQ3A 3SK0A 1YASA 2PKYX 2XDWA 3RKSA 3K2IA 2PVSA 4Y2QA 4EY4A 3AFIA 2VJCA 2HA2A 4H35A 1CUYA 3QPCA 3D3NA 3ZI7A 1AX9A 5FRDA 3QMMA 5ALRA 3BF7A 1K5PA 4F5ZA 5AKYA 3OC0A 4C87A 3FWHA 3WL6A 4W1QA 2CB9A 1ZIYA 1VE7A 3W04A 5JD5A 3BJRA 4W1RA 3IBTA 2DQZA 3Q0TA 2DHEA 1RWQA 3KOOA 5CT4A 2DSNA 5AI9A 3DDUA 2FUKA 2XUDA 3C8DA 2QOEA 5KWJA 1QFMA 4Y2PA 4WCVA 1R1DA 4KYVA 3C6XA 1W4LA 2WG2A 4KE7A 4G4GA 1UZAA 3H18A 3HI4A 1H23A 2WFLB 3KWFA 3HSSA 1FFEA 4NZZA 4N5IX 4QDZA 5C8XA 1EA5A 3C6ZA 1WPXA 3STUA 1XRRA 2XUQA 5JD6A 4B82A 2XQKA 3DQZA 1BEZA 2DFPA 3CN9A 1KEZA 3G0DA 1DQYA 4I4CA 2CJPA 1CR6A 2CZQA 3DD5A 1THTA 4FDMA 1TCBA 4FBMA 5LZ8A 4RNCA 4O08A 3V1NA 4X91A 3A2LA 3QMWA 4GWLA 1E3QA 4CG3A 2AXEA 4QDTA 2Q0XA 1HKHA 1CQZA 5LIPA 4A5SA 3A2NA 5AHXA 3TEJA 2O2GA 5LLSA 4FNGA 3WLAA 1MJ5A 3B5EA 1U8EA 1GZ7A 5AP9A 3JWEA 1YAJA 1RP1A 4UHHA 4HVTA 4J0JA 3D2CA 3AZOA 1R50A 4FMPA 4UBLA 3O4IA 3IULA 3C6BA 1ZD4A 2FJ0A 1EDEA 2OXEA 4P08A 3WKCA 1XZGA 5ALPA 3AIOA 3D0KA 2HA5A 4KJXA 5EHXA 1WPRA 1XZIA 3WK5A 4DGQA 3NOXA 4EY5A 3BWXA 4MQLA 4X6XA 4BBZA 4MWTA 4Y7DA 3CCBA 5IKXA 1D07A 5I8PA 1UKCA 3DJYA 1UOOA 2B9VA 2W6CX 2DCMA 3IUQA 3O4GA 2PSFA 2V9ZA 4BCBA 3MUOA 3H0CA 4BE4A 1CQWA 3G0IA 3WIOA 4Z49A 3QPDA 5ALWA 3AZQA 5JALA 1EVQA 1GQSA 4H18A 4IHAA 4J0GA 5BWCA 5SYNA 5AKZA 2HHAA 4LHEA 3L1HA 4J0IA 4FKBA 2LIPA 5CMLA 1F0NA 2W22A 2WU4A 4WDRA 2WIFA 1BS9A 3D59A 4INZA 1VZ3A 2C0QA 2JF0A 3KD2A 3VJKA 3IA2A 3V9AA 4BRZA 2PSDA 4I3FA 4X6YA 2R8BA 2IIVA 3MVEA 1YB6A 1UKBA 4OB6A 3KXPA 3O9VA 1JMYA 4ZREA 3LCRA 5LZ7A 2RIPA 2G5TA 2JGJA 3FYTA 1QIEA 4LIPD 4ZGBA 2JGLA 1AC5A 1R9MA 2C4HA 5DNVA 4BVLA 1P0MA 3HJUA 4OU4A 5LZ2A 4FBLA 2WG0A 5AOCA 3GUUA 5CT6A 3FSGD 4C4XA 3G0BA 3ICVA 3FVTA 2XMRA 2WIGA 1CV2A 1ZD3A 3OG9A 4AO6A 5DNWA 2QR5A 1IMJA 1JI3A 3GELA 3ESBA 4HTAA 5CT5A 4IH9A 4X00A 1ZIXA 2VJDA 4M0EA 1OCEA 1DQZA 1HPLA 2C5FA 3FYUB 5KBYA 5ALKA 3KDAA 3BE8A 1VOTA 3EF3A 5DYYA 1MT3A 2VA9A 2XMQA 1ISPA 4CG2A 3BIXA 1QFSA 4H7EA 1CUCA 4K6GA 3DYVA 1DU4A 1ZJ5A 1QO9A 1EB8A 4K6HA 4YASA 3WMRA 4J0HA 4AB1A 4M0FA 1ZD2P 4ARAA 3IURA 5IVDA 2QXUA 2PUHA 3PFCA 3WWCA 2GYWA 5D6OA 3F8SA 3ZLVA 3TGLA 2JEYA 3EBLA 2QM0A 1ACJA 2PSJA 3H2KA 3WK7A 3D2AA 3ZWQA 4RE6A 3H19A 5T4FA 3P2MA 4H77A 4XX1A 1XQXA 2WKWA 2H7XA 3I1YA 5CW2A 1OILA 4CIAA 1VZ2A 4XWGA 2HRQA 2OAEA 1CIJA 1EVEA 2R11A 3R3WA 4Q1VA 3IDAA 3FOBA 3I28A 4JNCA 5DNUA 1VXRA 2AJLI 3PUIA 4XIIA 2E3JA 1JJFA 2H9YA 4ETWA 1UFOA 3HYSA 2ZYHA 1XQWA 4UHBA 3VVLA 3IVMA 3CN7A 1QLWA 2RAUA 4FNMA 5JAPA 3V1KA 2YH2A 1N5RA 1AGYA 4NS4A 4N8EA 4PO3X 3LIPA 4AMYA 4KAJA 4YK7A 5AOBA 1QIHA 1Q83A 1TAHA 1ZGCA 3QYJA 4F60A 3DL4A 2GZSA 3WJ1A 2CEKA 1BU8A 1UK9A 2FJPA 1ODCA 1DT3A 4DMKA 3VJLA 5A7GA 2BCEA 3WWOA 2QMQA 3DYIA 5ALTA 2WJ6A 1EX9A 3OM8A 3UUEA 4DIUA 2JGMA 5DYTA 3RLIA 1Q84A 4OCZA 4BDSA 4AQDA 2PUJA 5HF5A 4OD0A 1CUIA 1UKAA 1FFAA 4BAUA 4P93A 4X85A 1WCYA 3FAKA 5A7HA 5ALSA 3ZLUA 1MTZA 4DSAA 4PW0A 4FFVA 1XRPA 2XUHA 4Y2TA 1FFCA 2AJDA 4BYMA 1QIDA 4G8DA 5ALNA 1UOPA 4G4JA 1NU8A 3IB3A 5K3FB 3R3YA 4MXDA 5JADA 5AIAA 2XQIA 1VE6A 4N8DA 1SCQA 2DQYA 2PU7A 2ZYSA 1AMNA 5HFNA 1HQDA 5FPQA 1TK3A 5E4JA 1UT6A 3ESDA 2EDAA 3OURA 5ALJA 5AM1A 1XFDA 3DNMA 5CH3A 5HQ3B 3WK6A 4EB0A 3TRDA 5AK3A 1PV1A 2IITA 1XZEA 4OUKX 3PICA 4FLMA 3IUJA 4UBOA 4L72A 1SCIA 2RHTA 1XZBA 2UZ0A 3C8HA 4QLAA 4Q82A 5T4EA 4BVJA 4CIBA 1QTIA 4EY6A 3QITA 5AI6A 5DJ5A 1TKRA 4Q3KA 4JYMA 5EI5A 1QIFA 3ED1A 1QIMA 1QIKA 4BAZA 1L7RA 3MUNA 4BCCA 2PM8A 2GZRA 4X6UA 5AICA 4S0XA 2X5XA 4OB7A 1XKTA 3VKFA 2ZSHA 5HK8A 3HACA 4BZZA 3AIKA 3G02A 4QWMA 4X3CA 3IUMA 4KR0A 5DTIA 1ORWA 1GT6A 2K2QB 3I2JA 2YYSA 2G4LA 2XLBA 5ESRA 1CUEA 3B3QA 2WU3A 2QRUA 4WJLA 1J1IA 4X97A 2H1IA 4I19A 3GZJA 5HF6A 4F21A 2I03A 5JZSA 4WFIA 1CUDA 3DCNA 4X94A 5LZ4A 4XVCA 2JGKA 1LPOA 5JATA 2WHRA 1PFQA 3LLCA 2C7BA 1K6EA 4WFKA 2WUGA 2V97A 4UFNA 1HDEA 4W1PA 1G42A 6YASA 2OPHA 2HRRA 2G5PA 3FVRA 3K9BA 4TVKA 3G9ZA 5ALYA 3I6MA 4X95A 1HLGA 2WUFA 5I7UA 2CUTA 5C81A 1MU0A 4QDXA 1T2NA 5K3FA 4J3JA 4KRXA 1JFRA 2VATA 2WHPA 3W9UA 2OLEA 4KAAA 5DWDA 1SC9A 3ZPXA 4ARBA 5F4ZA 5FKJA 2WIDA 5AI8A 1C4XA 3G9UA 2WFLA 5ALLA 1X2EA 4BZWA 4J0KA 4KE6A 5ALGA 4GLBA 1EXWA 4G4IA 2XB6A 1CVLA 5ALVA 1VA4A 3F97A 4AXBA 4LXHA 1XKLA 2Y1KA 2O7RA 3DEAA 3GBSA 3I2GA 5KREA 1LPMA 3ICWA 3O0DA 1CUJA 1LNSA 4JH0A 3MGAA 1ZJ4A 3L1IA 3RM3A 1XRLA 3I6YA 4DNFA 1N8SA 2IX9A 2XMZA 5JASA 4MWSA 4E11A 5FV4A 4YPVA 2PL5A 3NGMA 1TCCA 4C89A 2ECFA 3VISA 3BDVA 4Y2RA 1YA4A 3R40A 1TIBA 1MNQA 3I6ZA 2HU5A 3W9BA 1IUPA 3O4JA 4L3WA 5SYMA 1K4YA 1U4NA 3M82A 2WIJA 1E8DA 4G1FA 2WHPB 3HABA 3WKEA 1T4MA 2XQFA 4AO8A 1JU3A 2X76A 3CXUA 5ALOA 2OGTA 3HRHA 3E1GA 1WHTA 2WTNA 4UBKA 1EHYA 1P0PA 5JANA 1DX4A 4IQ4A 5ALUA 2J4CA 1FFDA 2HFKA 2BAGA 5AM3A 4MYDA 2AJ8A 7YASA 5AJHA 3WA6A 1CEXA 4G8BA 1J2EA 2OCIA 2OGSA 3WIBA 1EINA 3JW8A 3O95A 4BP8A 5CT9A 2VJAA 3WI7A 2PSHA 3ANTA 4U2BA 3M81A
chains in the Genus database with same CATH superfamily
3NP9A 3W2TA 4JVOA 5JCOC 5LMUB 3LAWA 4NZNA 3O82A 4TGLA 3SYNA 1SCUB 4OUDA 3ZWVA 3VR5A 3Q7TA 4ALKA 3HE3A 5K3DA 3V1LA 4DXDA 2A58A 1E4EA 1W1WA 2AJCA 1GNVA 5I45A 5LQAA 1JEYB 1TQ2A 3DMHA 3QKIA 4A2QA 2WM3A 4BE9A 1UT5A 1Z2NX 2LDXA 5DLEA 1PJ8A 3E23A 2FOXA 2QORA 1BCRB 1TVMA 3PFNA 3FLBA 3HXKA 1E4EB 2A67A 2H7YA 1X7HA 5FXMA 3TLZA 1N0VC 1PT9A 4ZCQA 2NVUA 4QGSA 4JLPA 3FCXA 3KHSA 4ABTA 4UW9A 2GF0A 3EEFA 3T3MB 1YB7A 4UHDA 1RRGA 2BISA 4HZUA 3JQFA 3RFFA 5BV8A 1CYDA 1NYTA 2JFHA 2VJLA 1P2SA 1HQYE 3BTUA 1PFWA 1N2SA 2R2AA 2HQBA 4MR9A 1FTYA 4KPFC 4EB3A 2VRWA 5LKAA 2KBFA 1GPKA 4OLHA 4U63A 2ZE8A 1SU8A 2DPGA 2ECQA 3QJ5A 2BFEA 4ZGWA 2QB5A 3FZGA 5IVIA 1VL1A 5G02A 4DJ5X 4JC8A 3IEPA 3K4HA 4QUAA 4ZVOA 1TM5E 3DLTA 1W9MA 3IAEA 2YDXA 3VU8A 4KR7A 3K9LA 4PO1A 5AHKA 4FMCB 3DPSA 3IXLA 1GV0A 1WCIA 1XJCA 1JFTA 1QE5A 1G2PA 2DY1A 3FSRA 4BZQA 2BH2A 4XPZA 5F35A 1YJAA 2WFMA 2VXCA 2ARKA 2Z4SA 4IUDS 2ENUA 1JUDA 4KACA 3R3SA 4M88A 4BCDA 4EBBA 3CGWA 3C7DB 2HBZA 4RH3A 4DKJA 3VNBA 2QX9A 3WY9A 4NATA 3HR8A 2WAMA 2WWTA 1G2IA 1WEHA 5FUXA 2NVBA 3BYZA 3Q98A 1IRIA 1PUIA 2CBGA 2XMCA 5CRIA 1HE5A 1OYWA 3LZDA 3BK1A 4I2NA 4INPA 4CCYB 5JH7B 3TIIA 2VIIA 4NE2A 3WHLA 4NYMQ 3P20A 3X44A 2AJBA 1T3HA 1P1HA 2ZS9A 2P0AA 3JASA 1L4HA 3WLFA 5KOHB 4BB0A 2GX6A 4F9TA 3KTAA 3QHQA 3IMFA 4JVSB 1M1YE 1AM4D 5DW0A 2IDKA 4GO1A 1OFHA 3ZCUA 5JH7A 5BSRA 3GXBA 3ADBA 3AX6A 3LOUA 3IV7A 2GZ2A 2GT1A 3QE2A 3TGWA 2V59A 3DE1X 5DNDA 4KQKA 2H1HA 1UBLS 1SFRA 5G4KA 4HP8A 1T36B 5EJAA 3SIRA 4MV0A 4RELA 2C54A 4DQXA 1CIVA 2FEWB 2OAGA 1DWUA 3A1DA 4MWDA 2B4KA 2EKLA 2PVPA 1ZONA 2GH1A 3O9ZA 3PWKA 4PFKA 2AUMA 2QRGA 4NYIQ 2EW1A 2IHBA 2KI5A 3DBOB 5AKHA 5TMDA 3STXA 1E77A 3CO0S 2Z9BA 2OPBA 3IKTA 4YRGA 2OMKA 3NVDA 3D7KA 4JI1B 2X3YA 3T06B 4RIHA 3W3AD 5EIEA 4IGAA 2HW8A 3TNLA 5B1HA 1D4OA 2P79A 1GCAA 5ALZA 4QLBA 1MB4A 2ZBUA 3SZUA 4EY8A 4FIDA 4QGAA 1NX9A 2BI8A 5C1PA 3MYRA 2AL7A 3KEMA 4DYHA 2V6BA 4KU4A 2GJ9A 1KMHB 5CVJA 1PFUA 5TIIA 1E9EA 1U65A 1UPBA 1VB3A 1ZI8A 3WDMA 3IUBA 2VUIB 4G9BA 4W1SA 1MVLA 1U8TA 2H8GA 2Q5HA 3OLXA 2QVBA 4GECA 1ZKMA 4MR7B 4RACA 5ALQA 1K0UA 1JZTA 2ZIFA 3QWBA 1MAVA 5ICMA 1VXOA 3MJHA 3NVKI 3VI4B 4QYSA 3EC1A 2BFPA 3PYXA 4DBLE 2P4QA 3QV2A 2ZJFA 4ND7A 3B2NA 3VPXA 1JU9A 3IDZA 4DJJA 4NI5A 4R5HA 2OSBA 2Z95A 5JSKA 1C1YA 5EVCA 5G0SA 1Z88A 1Z7YA 1KMNA 5ER6A 4C0SA 4ZHSA 5FUQA 2PZGA 1MV8A 5H0IA 3RW9A 4IVRA 1YVPA 1CZHA 2Q3HA 2VOEA 3HCBA 4CEIA 1TTQB 3A7DA 3KJNA 3LDHA 1T9BA 5LP1A 2C9BA 3T35A 4EPTA 3FDJA 5IAAA 2B82A 2C5HA 4EELA 5L6MB 2BCGY 3HWX1 2BOVA 2D1SA 3C45A 3AUKA 3OZUA 2XCQA 2ZVJA 5CBPA 5EUCA 1SY7A 4IKPA 4EI2A 5CFZA 3I32A 4L0CA 5EIBC 4LZWA 2ZQZA 1LQTA 1UT8A 4IUBS 5FT9A 5DTMA 3ISTA 1V9LA 2NQ8A 3UKOA 4FCVA 5AH0A 3LBIA 2B0JA 3H1PA 5D7BA 4F4DA 3W05A 5TQ2A 2VHXA 4EGCB 1EFLA 1T35A 3D7MA 1UBEA 3JYOA 3K6KA 1BHO1 4RENA 1A8UA 1E2FA 4UPDA 2GHRA 3D2LA 5TPZD 3ZCVA 2R00A 3CVJA 1L7EA 4CR7A 2TMKA 4CKEA 4D9MA 3CZ9A 1ZNZA 4HNQA 2QPTA 1R5OA 3MTJA 1T8UA 2CL6X 3DW1X 4DCMA 5C7YA 3KWLA 2AI1A 4LZJA 3B36A 4HRVA 1G8YA 2PXAA 3ZVMA 2W8BA 2VAVA 2FF5A 2P5UA 1OSNA 3MTEA 3CLHA 4F2PA 2C4UA 3BVPA 2A0UA 4W8OA 2O1SA 5KU7A 5THQA 3FYDA 3L9WA 2WUWE 3K92A 1JQDA 3C1AA 3LBHA 4KQGA 5AW2A 4HGQA 4KSYA 3W1VA 2CDAA 1THZA 4RHFA 4K9PA 4KL8S 5DK6A 4FC6A 3TW6A 1MQ9A 4R6WA 2YVQA 2QL7A 4L5IA 3I8OA 3T5DA 1IBMB 2VNAA 3CE6A 5FNVF 4QX6A 2I2DA 2I1QA 4V2IA 2OD2A 2X42A 3EQZA 5AJXA 2VK8A 3ERCA 1L8QA 1W47A 1WOYA 1R88A 2YNMC 4EYQA 1F12A 3W1EA 1JIJA 4ERXA 1QIJA 4RTLA 4S12A 4PLHA 3WRYA 3GJ5A 4F9FA 1B6TA 2X4DA 4GXNA 3N58A 3TAUA 5EHIA 2Y99A 3TX2A 2EKPA 5AHWA 1PR0A 2RDMA 3DXZA 1NXPA 3IAM1 4FXOA 4MULA 4U7GA 5IJ9B 1T4DA 2G09A 2J7KA 2HQOA 4BDTA 2UXDB 3SC3A 2HWXA 1FF9A 4RK5A 1Z5NA 3BRWD 4GH5A 3AF4A 4ZWNA 2XUPA 1DJNA 2BBTA 1KMQA 1EDDA 3N2EA 1Y8RB 3JYHA 3C5HA 4KLRA 4Y67A 3GT7A 2R6ZA 1RPAA 1GTG1 3IBFA 2D7DA 3NJRA 3V48A 2X0KA 4GGOA 3U4GA 3BEDA 3LY5A 1P7YA 4G26A 1SXPA 3F3MA 2X2EA 3SE7A 1KDPA 1M1YB 1VCIA 3HUTA 1X70A 1XMSA 4ZZIA 1G2OA 5DM4A 2XVXA 3QW2A 4YMTA 2MSKA 4KGVA 1C8KA 2EVWX 3H11A 4BQFA 3EXHA 1FX0A 3PIDA 4TTJA 2AMLA 2QAGB 2V6IA 1N5MA 3H99A 2I6QA 3RIHA 1R0LA 1Z6PA 2DUMA 2Z2JA 4CL0A 1L5GB 5K8LA 1R0RE 2KLBA 1UXOA 2NO0A 2GKOA 3CEAA 3EXHC 4TLAA 4WY2A 4AN4A 1M67A 7MDHA 2ODWA 2WWWA 4QEKA 1GFIA 1U0FA 1ZH0A 2ZJ1A 3N76A 2C9ZA 4KTTE 1BN6A 2QF7A 4UBMA 5FPSA 4L6AA 3ZDRA 4ENTA 5K09A 3EX7C 2JLVA 2Z2KA 2J85A 1X86B 4XDYA 5CITA 5DYWA 3HDJA 4Y6RA 1QR6A 4FX2A 4R2WA 5CNMA 4YRJA 2WJ3A 1EVZA 1YVEI 2G76A 2C83A 3WLSA 1AG9A 5KQMA 2DQKA 3GDOA 1T3LA 3MMZA 2BMJA 3QU9A 2CWWA 4HDSB 1FEZA 3DUFB 5AK6A 1FFSA 2V7UA 3KAPA 5T4HA 4BLSA 2OR3A 3D7RA 1CZUA 1E96A 1GYQA 2MHCA 3EVGA 5EKXA 1WMFA 1F2UA 4E0BA 2D8AA 1EZ4A 2QPAA 2P30A 1X1BA 2DVMA 4RKFA 1YBAA 3RJ5A 3F9RA 1YZLA 3C39A 1GPWB 4LV5B 1V8FA 3TOSA 3N0XA 4F96A 4LNHA 3W5HA 2XF8A 2E4VA 5IJXA 1GL6A 4Q7MB 4RMHA 3WKDA 1TEZA 2Q2QA 1IH8A 4P80A 2BFOA 1Y5LA 4Q3OA 4EHBA 1PZXA 1UQUA 2IYUA 3ZDEA 4CTKA 4S05A 1YAHA 3GRPA 2G9NA 1T5IA 4DNOA 2FEPA 3A6GA 3CZQA 1H2AS 3QU2A 5EE0A 1XROA 3T94A 1QU2A 3QUTA 1E2IA 3BFJA 3IJEB 3ZDXB 2V3VA 3C3EA 3COPA 2XUJA 3FLEA 5FBHA 5H16A 4O2AF 3SSMA 1USWA 1BWPA 3FW1A 1E2BA 2KB0A 5AM0A 1J0AA 2QM3A 4R2JA 5HRAA 8GPBA 5BV2P 2QGZA 3THYA 2DWOA 4Y6OA 4O6VA 1JJVA 4XCVA 1WXXA 2XIQA 4JMPA 4FFRA 4DLKA 1HDOA 3U60B 2UZ1A 3PC2A 3DZCA 3WZLA 4CLEA 4UCXA 3C3JA 1Q7CA 4WCFC 3HJBA 3NWPA 4IZ6A 3SJZA 2IEDA 2XDYA 1I1QB 4RHYA 4WVLA 1LLDA 2BHNA 4PG5A 3AG6A 1XD9A 4J0FA 1VKJA 1M1YA 3P2KA 3WIEA 2GCGA 5KUTA 3H04A 1IY9A 1OXBB 3TECE 4A36A 2WRZA 1II9A 1YR8A 3ZVLA 4L5JA 1AIPA 2IS6A 4Q6BA 2NAPA 4RPGA 3H1AA 1WDMA 1A4RA 2F3RA 4N3NA 5FHQA 4EMUA 1U2DA 1V5EA 2N42A 5LB2A 4ZIRB 2RIRA 3CPEA 2OILA 4CG1A 5KYNA 1DMSA 2J41A 1WY5A 5KX5B 1CUXA 1XXLA 3STTA 3WYBA 3ELYA 4G5XA 3PQEA 4ZEWA 4FYIA 1JEQA 4XB1A 3STYA 2IVFA 2I3DA 2FMKA 3SGLA 1K92A 2WMNB 3NIDB 1EWKA 3GA5A 4IIEA 4QHTA 2J9GA 5AK5A 4C14A 3BC1A 3IRVA 4EGQA 1DDIA 4LK3A 1KU6A 4IFTA 1EI9A 3GZNA 3D4BA 3HCWA 5K9ZA 4HQ0A 1SCKA 1WSAA 1Y5RA 3RH0A 4BC0A 4L0DA 4EW6A 1NXOA 3F46A 4DCCA 2JHAA 2DQ4A 1M7GA 2QLFA 1CUSA 4D92A 2AVDA 3RPEA 1QIIA 1SXIA 2ZYIA 3SOPA 2DFNA 1VCHA 4CDMA 3ICQB 1HE4A 3GNSA 1FU8A 3DAOA 5CA1A 1PV4A 2HDHA 3BD8A 1NSFA 3MLAA 4FHEA 5JC1A 1LZKA 5K0SA 4XW2A 1MAAA 1V5FA 2FHSA 4D9JA 3WHIA 3D7NA 4ZK6A 4EY7A 4PYNA 3T34A 1ICEA 1K6IA 5D3QA 3TCKA 4RJLA 5FOWA 4V39A 2IOYA 2AZTA 3DWFA 3SEQA 4LKOA 2WHXA 3AW8A 1IZZA 1XTPA 4Z4HA 4NNPA 1CY7A 1VYTA 5GV7A 3OZIA 1BG6A 5HRCA 3MPOA 3WGZA 1ULBA 2VNJA 2XEDA 3OT1A 3H7IA 3TQCA 4M9CA 1QYDA 1Z16A 4XSVA 4G65A 2FWMX 1UK8A 1CRWG 3O0TA 3FYHA 1VLHA 2V96A 4IWNA 4KO1S 4IZOA 1FBNA 4B7ZA 4BIMA 4I5EA 4N7JA 5IWAB 1HSOA 2GA9A 4MGYR 3FTPA 3WB2A 4OHFA 1PCXA 2B78A 4GX0A 2VJQA 4EPYA 2BGKA 1G1AA 2Y67A 3WQQA 5BVGA 3K0AA 4TYYA 4FB4A 4Y2VA 5JSUA 5B7QA 4RTJA 4CMGA 5DP2A 2WTMA 4YP5A 3NS7A 1OBVA 2LWIA 4YP9A 1IY1A 1GYRA 1WXHA 2X86A 4QUIA 3T0GA 1NPYA 2V54A 2Q27A 3JQGA 2V7QA 4GX1A 3SE0A 2AF4C 2WJJA 2QRVB 3KE8A 1E0JA 4RW0A 3S7ZA 1O4VA 1Q20A 3UJ8A 4DCVA 3G9QA 3LXXA 1ZCBA 2CF5A 4Q24A 4I5DA 1XJQA 1YR2A 3HRIA 3BB3A 4MUFA 3MRXA 4KITB 3AI7A 1Q3TA 3T4UA 2O06A 4TKUB 5AI5A 1XI2A 3S29A 1KAEA 3H1FA 5GTDA 4R98A 4UBJA 4PNZA 5HBRA 2ZQYA 4FJ0A 1ZGGA 2DG2A 5E1DA 1NFQA 4WMLA 1T4BA 1SKUA 2HA0A 1WPGA 1QK3A 2POQX 3OI7A 3WKAA 3VC3A 3WLIA 3ZKWA 1Y5MA 1UAGA 3L01A 1IM5A 2ZTLA 3LP5A 2MSNA 4M9XA 3TSYA 3V4RA 1REQB 2V7PA 1WG8A 4KN9S 3DL0A 3ZDBA 1KPIA 4IYRA 4J4BA 2DMRA 2JH8A 1QHNA 2FW9A 3VPDA 2ZIUB 3EB9A 3GH1A 5ICCA 4FP9A 3IVCA 3OA0A 1ZKDA 2ZI7A 5IFLA 3IUYA 1JG3A 2G08A 4GZ3A 3KLNA 4HDMB 3SLGA 2VDMB 2NUBA 4IM7A 4KVZA 2CDRA 1CJBA 1U7ZA 3UHFA 3OWHA 4FLFA 4IV5A 3I45A 1WS6A 1B76A 1JXOA 1VG1A 2NU9A 4WK4B 4IVPA 5LUBA 4RKQA 2WB2A 1GUZA 4Y0NA 2XA2A 4L27A 4LHZA 4MVJF 4P54A 4BUJA 1EWYA 2H3HA 4X6LA 3P0JA 1T15A 4O3FA 4DR2B 4ANFA 1JSXA 3FVVA 2C7QA 3AR6A 2Q8QA 4XYBA 1QTRA 2Q9CA 4QAQA 1BC5A 3OLZA 2WAAA 4A0SA 2VUHB 1Z29A 2VBCA 1X13A 1F7VA 1VSVA 3CZMA 2QL5A 2Q5JA 1CD5A 2JARA 1K5GA 4B71A 1VJ5A 1KQGA 2BKXA 1BX0A 3OJOA 4WY8A 3CCCA 3CX6A 5IDXA 3ENWA 1ZQ1A 3HMQA 2FFHA 4NABA 4PWZA 4YXFA 3TI9A 4KIJA 4AJHA 4YDSA 1EXMA 1SBZA 3B7GA 1RHJA 4Q1EA 4D97A 3AI2A 1KTIA 1CEQA 2ZQ5A 4N5NA 4RA9A 1DO0A 1RM0A 4KGZA 2J09A 5DM60 1PQYA 4AICA 2ZVPX 4KJZA 4K2AA 1RMTA 5AKIA 5B1EA 3KEOA 3AETB 1E4VA 1TVKA 1P4JA 4C4TA 4JBHA 1MX5A 1ZJJA 4ONEA 3GFOA 2R62A 2VWGA 4V02A 4GNRA 4OEHA 3VPFA 1WXGA 1NE2A 1XZCA 4BTLA 3D8UA 4F5DA 1AGXA 5AK4A 1K1EA 2SNIE 2YOFA 2ZJAA 1KZ9A 4OSPA 1SN7A 1TJNA 1LX7A 4H0CA 1XMXA 2WVAA 3KPJA 4HKTA 3HZHA 3LHIA 1U0NA 3BXHA 3GUHA 4LYJA 2AQKA 2BBOA 4EJSC 1OXUA 4JBWA 4GWKA 3ULKA 2OQVA 4TLBA 1J2JA 1HKUA 2GAFA 2JLRA 2KHZA 3FBWA 4WUTA 1VGVA 2VNIA 5JEDA 1BQ3A 1R4NA 1FP6A 3PR2B 1XU9A 2C5GA 1W4BA 3OEYA 4LOLA 3INRA 4US1R 1X1SA 3CR7A 4Q05A 2OQIA 5JXHA 1MENA 5K6TA 5A9TA 3ZV3A 2QHXA 4XOIA 3FSGA 3NYWA 4ED9A 3T1TA 1P18A 4KOEC 4JYCA 1GFWA 1QV6A 3PTZA 3IE2A 1MPXA 5H68A 3UTDA 3VKHA 2PZJA 4NXNB 4KLZA 3EDRA 1TM2A 3CW2A 4I55A 4Y0AA 2R6JA 2YHIA 3ZBUA 5IH7A 2NUAA 1Z4OA 3WYCA 5AKXA 3EGOA 4C4PA 3ZY5A 1ITZA 4WNYA 3QEAZ 4GMGA 2NX2A 2P8JA 5HFAA 2XAUA 3IPLA 4ZQCB 1ZJ6A 2AC4A 3TL3A 2Z4RA 1NMXA 1NF9A 2NT3A 3VOAA 1QQBA 5BSHA 5IBQA 5HKOA 2R7LA 4R0VA 3C16C 6CHYA 3CIOA 4YJ2B 1BN7A 3C4VA 1WR8A 3E2IA 3NM5A 2NZXA 4UM7A 1YUBA 1WB6A 1C0LA 1VFPA 1XL1A 2WG1A 3Q12A 5HIJA 4KO2S 3WGNA 2ZB7A 4BKRA 1ZHHA 4K9LA 4CMIA 3T7SA 4EEXA 6REQA 5IM4A 1OI7A 1K7EB 1SC3A 4IX1A 4B45A 3AJAA 5KKAA 1Z12A 2ERXA 4CQMA 1Q7BA 2Y3IA 3HYRA 3R0JA 1K68A 5HE8A 1BROA 3EGEA 3FETA 3W2IA 2GN9A 2IPLA 2GPBA 2YY7A 2YFKA 2Z4TA 4GPTA 3D8NA 1SBIA 2NZWA 3OPNA 1KEUA 4PX3A 1J20A 4MI9A 4H3HB 4II2A 1IK6A 3B6EA 1KYTA 5FI5A 2ZZNA 1PJZA 3BJEA 3GYGA 3D6HA 3OOSA 4P5DA 2GEJA 4CN9A 3RG2A 1WKVA 1E3WB 1E5TA 1VRWA 1Z8HA 3OJLA 2E4ZA 2W9XA 4RLQA 3S40A 2XODA 3F71A 1TLFA 4DBVO 1SVWA 5KNBH 4HAYA 1ZD5A 3EXFB 4RD3A 4ZOLA 1E59A 3TRFA 1OHHD 3O21A 1NRIA 2NNWB 4MJXA 4GM4A 4MVJA 1Z06A 3UXEA 1WF3A 2V65A 4FFDA 1IPHA 1JWAB 4LVCA 3DAHA 3CJRA 3L1JA 4MUKA 1DBSA 3LUDA 4J1SA 2J48A 3E7DA 1LC0A 1LPAB 1IG0A 1TZKA 1YNOA 2XUKA 3I1IA 4FHFA 1XA0A 4GVLA 1V9SA 3EXHB 3RVOA 2OHGA 3BIFA 1AUPA 1I2DA 2BM8A 2GLUA 2J3DA 2P9TA 3E9RA 3I53A 1P2VA 1YUMA 1TLTA 3FCYA 5K51A 3ZWPA 2E4XA 4RZIA 3TAXA 1GGMA 4J3NA 3MLEA 2JCSA 1A5SB 3DWEX 4JFAA 4GAEA 3FCOA 4AZSA 4BQOA 3WQRA 4ZYYA 2C78A 2DCUA 5HK9A 3KQTA 1Y37A 3BG5A 2O5EA 3N7UA 2JHFA 2WVGA 1POXA 5F52A 5B4VA 3HO1A 4UMEA 1EUCA 3CX8A 4QQNA 5ALEA 1FL9A 4TS9A 4ZCPA 5I7HA 3ACBA 2QTBA 3IHLA 4U6NA 1T0IA 2CZGA 4YDRA 3UG7A 5A9SA 3NR2A 4TTRA 4EITA 4DTCA 2VZ0A 3OF5A 4LOIA 2XWQA 3MJDA 2NO5A 2J5BA 4NOJA 2VJOA 1HMPA 2P35A 5E2IA 3VPSA 1KJWA 4BASA 3QX3A 1YE3A 3JRWA 1DELA 1ESNA 4UNIA 4UAVA 2CCKA 3TMAA 1NW7A 2ZETA 2LGJA 1L5QA 2X7HA 3GWGA 1RLMA 2ZIAA 1TK9A 5JSFA 1KYYA 4LOAA 4V24A 1BXRA 3A3YA 3EYAA 3Q2IA 4KLNA 3VNVA 1DWOA 3IGFA 3L84A 3M6LA 3PF8A 4WAUA 3Q7PA 3H2HA 3RT7A 3OUZA 3IX7A 5JY6A 4W5RA 2EWWA 3NTRA 1ZK1A 2E5FA 2QD5A 1PR3A 1W52X 4B85A 4DRXB 5IBRA 2I71A 1C4OA 1F6WA 1I0ZA 1IWBB 1GJRA 1HM5A 3HY3A 1GGHA 1KAQA 3GN1A 3O92A 4L08A 4OSEA 2I8LA 4RF2A 3DR3A 4P9NA 4ZTBA 4JUIA 2ZIGA 2IPNA 3DXFA 1NLUA 1PW7A 1LEHA 1NVGA 3C5VA 2DECA 5JD3A 4OFBA 3V00A 3F6SA 1FYEA 2WR8A 4D0RA 5KJFA 1C1DB 3RANA 5JCXA 2QBYB 1YHZA 2V7VA 4RJJA 4R71A 3UK6A 4AL4A 3A0RB 4RZHA 2QRVA 4TWBA 4Q9DA 5A1JA 3EEQA 4D96A 3G2PA 1NDHA 1PNTA 4J0QA 4ZRNA 1S6YA 2YX1A 4LC0A 2GK6A 2HQ1A 4JQCA 4P7JA 1VDMA 1VE1A 1OWLA 3FXAA 3AILA 4Y9UA 4H7PA 3UHAA 4N5LA 1QHSA 3M2TA 5ITWA 4P82A 2Q5LA 5FB3A 1JMVA 2VRCA 2WIKA 2HM7A 4YPFA 1C80A 3E15A 1E2JA 1JLHA 3S2GA 2OFOA 2PGDA 1WA5A 1ZXLA 3E9YA 1EFKA 4OAQA 4XPIA 2VL7A 2VDVE 2JJ1A 2ACKA 5BN3B 1KH3A 4JI7B 4C0LA 3J81k 1Y1SA 4EQZA 3RI3A 3LCCA 3AWDA 3DDSA 1RC1A 1YZUA 2WLTA 3A6FA 1F1BA 5BWNA 4QGGA 2H7VA 3HC7A 1RYHA 4JU8A 4RFSB 4TSFA 1UBMS 4R31A 2G1KA 1BE8A 3WV4A 5CLIA 5LBTA 3IUNA 1TM3E 1Z0IA 5LQRA 1GLNA 2H4XA 3MCVA 3NC4A 4BKPA 3L49A 4ZN6A 1FUUA 4WZAB 2UZIR 1LDNA 1GR0A 1GU0A 3ZLTA 1A7KA 4LWPA 4UHCA 4YAKA 1THMA 1EH5A 3WWPA 1LQUA 3K71B 2UXCB 4MIKA 1WB4A 3NBYC 1RTTA 5KQLA 2JJQA 5L45A 1QHYA 2ZRHA 5KSZA 3AV3A 3RSFA 1JIQA 3BH6A 3R7NA 1ST2A 1BMFA 1H66A 2XZDA 5E1OA 4MA4A 2CSUA 1BH6A 5CVEA 3DOJA 1LX6A 3HM2A 3HNRA 3KT3A 5DI3A 5IULC 1FDOA 1L1EA 1N5IA 3AR4A 3OU2A 2P0EA 3PB3A 3H2JA 4F5YA 1FMJA 3I4CA 4O4LA 4F38A 5ARBA 2QYSA 3W3AH 1QP4A 5EQDA 3OIUA 3L8DA 3R74A 3BL5A 4UATA 3P9ZA 1AZLA 1PO7A 2C4WA 4OQFA 1NVTA 4HAVA 1JIUA 1M0SA 2QW0X 3QH4A 4TPKA 1MC1A 3DB2A 4IIBA 1L9KA 1KJJA 4IICA 1K27A 3KB2A 1RE0A 2NU8B 4L4SA 4YQYA 1QHGA 1SUWA 1U6JA 2BRUC 1I4OA 3HDVA 2IUFA 3VO8A 4RD2A 2MSEB 2XB4A 3K31A 3LX4A 3S8YA 4OX9B 1ZNWA 2YNMA 1ODSA 4XEUA 5FUBA 1KYIA 2OZEA 5BW8A 3KP1A 3TXYA 1MH9A 1P80A 4XVUA 1JU4A 2V7TA 2CXRA 1O5TA 3EARA 1NLMA 2BT4A 1MVNA 2YDYA 2IY9A 2GSWA 4BOYA 4DHWA 1EB9A 4NESA 4LXIA 2CBZA 3JARB 4V0KA 5FNVA 4C01A 5LL6P 4W9MC 2R7NA 4DV1B 2I67A 4YRRA 2B92A 2GHQA 3PDWA 1GZVA 2DR0A 2N46A 4QU9A 3SG0A 4A82A 5AW4A 2GESA 4KWTA 3RRBA 3WO0A 2I5PO 1ZHFA 1GHTA 3FVQA 3TSWA 1LC3A 3CRW1 1SOVA 4LSGA 1E3JA 3ZIUA 2GBPA 1PR1A 2C4NA 1CP3A 4JLVA 5I5GA 3PXCX 3RUAA 3FB4A 3VMMA 1W0CA 1T5LA 4G9GA 3UV6A 3HBLA 2RJOA 2O6HA 3I2IA 4L51A 4M0MA 5KJEA 5TPZA 4JGBA 3KEFA 3X1WA 1NJ2A 3PQ7A 5HOEA 3NH9A 4GOLD 4P34A 3SXPA 4NBLA 3L7AA 1D6NA 4NAHA 4FK8A 5B58C 3SIWA 3OPYA 1YQDA 3R5SA 4O0LA 5JZ9A 3UF0A 4YUWA 1AO0A 2AFRA 3BFVA 3T9AA 4KQEA 4YCCA 4BXOB 2BJHA 3IC5A 2RGUA 2GZDA 3ZDQA 4C5AA 5FLYA 3BWEA 4KTVE 1N1MA 1YQXA 4F12A 4XIFA 1T2FA 2IIPA 2H0QA 3GHYA 4JCCA 3CPHA 1IVSA 5LOVA 1SD2A 3ZH2A 1HZZA 4II3A 4CNBA 1I5EA 3EVDA 1NT2A 4ZCTA 3HY6A 5EFZA 2GPAA 4AXXA 2HSJA 3CZ5A 2PA0A 4BX9A 4CIXA 2GZAA 3N59A 3CBQA 5KOJA 3NCHA 1K9VF 1YZTA 5JLAA 1AF7A 4LVNA 4POOA 2RAVA 1GPAA 2BFEB 3WWZA 4GDMA 4M99A 4MZXA 4HX2A 5M34A 3CNLA 4JLSA 2QTWB 1X1AA 1R0XA 3GZ4A 2WB4A 3D4LA 3QA3E 5F3RA 3KLBA 1QX3A 1FX1A 4FFWA 4JR0A 2C99A 4RL4A 5FJIA 5U4XA 1TI7A 1PU2A 2EWVA 4LZPA 4G5HA 1IHPA 1P17A 1XWIA 2B20A 2D5LA 2JNWA 2X40A 2ZIVB 3O8OA 4HXYA 5EP4A 3Q11A 3V3TA 4MI1A 3LQQA 3U4AA 1I32A 2HJGA 3K1AB 3CUVA 4RABA 1Z82A 5K0ZA 4FR0A 1FDVA 2PWAA 2P68A 3TF5A 2OFPA 1BOOA 2Q3BA 3IQGX 1GPMA 4HQ6A 4X1YB 3SDSA 1B3RA 1BA3A 1JKMA 2WNHA 5AW6A 2WFZA 2VYVA 4WZ6A 5TGTA 1AQUA 2HJ9A 3HUDA 1KI2A 2G8LA 9LDBA 3HB4X 2P77A 2RK4A 2TYSB 4TUYB 4ZVLA 3U9LA 5JQGF 4CQNA 1ZXXA 3CU5A 5JVDA 1VSQA 5JJCA 4CTMA 3VDMA 2PZKA 1U99A 4YV1A 3AHDA 3EVBA 1A8QA 4R3UC 5AVOA 5DT2A 1I36A 3V8PA 3ICOA 4HNHA 1JEYA 4YLYA 1P60A 4ZC1A 1ZM2A 5EIFA 3W5BA 1MABA 3YASA 1V8BA 2GCNA 3V2IA 4L5YA 4JQYA 1G3RA 1D0IA 1ESMA 2D59A 4J7AA 5A5DA 3M6XA 3WK8A 1X8XA 2H5IA 2PKCA 3VV2A 1FXWA 2IXGA 2HQRA 3Q85A 4HAXA 4U7JA 1G98A 1YONA 2YWDA 4QXRA 4PQYA 1ZR2A 2YVKA 1BFKA 1AGNA 1V95A 3AYXB 1W5TA 3DE2X 1H2ZA 4FTWA 4BO5A 3OCVA 3ZK8A 4F3RA 1QRTA 1PSDA 5K1ZA 3RWBA 3QFCA 1NQUA 1CB7A 2GKGA 3WLLA 2E18A 4HDKA 4I1SA 2PGLA 5BPFA 2WAYA 4KKXB 4RV4A 4GOJA 4JNKA 4ZI5A 2QT1A 4G4SO 1FNMA 3I9NA 4XD7A 1N9ZA 3FNIA 1XRSB 4WXYB 4OP3A 3VZPA 1U0RA 4J0DA 1NJ5A 2WLSA 4LSWA 4F0JA 1KS2A 2C88A 2QE6A 4C20A 1IXYA 4LXYA 3GLIE 3V1YA 3HJCA 1YIDA 4WXEA 3TOCA 1DGQA 5F12A 3FTDA 3UJ6A 1UPUA 3DBIA 5CX1A 4EEKA 4F5WA 3ZHRA 2OK7A 4K2HA 3P19A 3EGXB 1N0HA 2DWUA 4JI3B 2QUBA 2WF8A 1ZC3A 1L2TA 3WNQA 4CPDA 4Z1MD 4N01A 2AFIE 4GPD1 4ZAZA 4N7MA 2WIAA 3WJ2A 3GHHA 3L7IA 4LX0A 5LDHA 3BXZA 3RLFA 4FC7A 5ENVA 3K30A 3DTVD 1BKDR 4XUEA 2DKOA 1ZGZA 1GNQA 4U7TB 4C78A 4KXLA 2NIPA 2YY5A 4F1WA 1IHDA 1ND5A 2GN4A 3SY8A 3I2HA 2RGWA 3KDPA 3PRHA 4ETNA 4C2TA 1FTGA 3P45A 3CRZA 4LKRA 3HVHA 2PKQO 1WB5A 2OG2A 2RK3A 3AINA 2AK2A 4IH4A 3PPWA 1L8OA 2ZRCA 4MW2A 2H4FA 5CVDA 3HKCA 4MGEA 4FMDB 4FGWA 4YRSA 3AR8A 1TADA 5ALDA 4GIBA 2ZSUA 1QF6A 2B4AA 4D4KA 3UMJA 3MT8A 1ISHA 2ZREA 1KQFA 2Y77A 1SCDA 2EDCA 1ZSVA 4LK2A 3ZGLA 5K4GA 1J2YA 3Q10A 4BNGA 1N0IA 4RPHA 2WF5A 1ORHA 3BFXA 2F55A 3AF6A 3UPTA 1GG2A 2JH9A 3A06A 3NHFA 4I46A 1NV8A 3ZI0A 4GZ6A 3WRXA 5BNIA 5KYWB 1U9CA 2GVNA 2JKZA 3PQ5A 4OQYA 4B6JA 2BEUA 1DX9A 3EGDA 4MKGA 2PU5A 1TW2A 3QV1A 4JB0A 2NU7A 4FMCF 3N07A 5EIAA 3RNLA 4H7HA 1JJAA 1G5FA 3MC1A 1Z2DA 1IB0A 4FS8A 3RFXA 5ABPA 2JB9A 4KR9A 2R48A 4JUCA 1OFGA 3CY6A 1SUIA 1XF1A 1CQPA 2BLNA 4OGWA 2WF9A 4ZC8A 4TV9F 4HAIA 1W75A 2FSGA 3TRIA 3S81A 1L6IA 4HNSA 4UC0A 5HQJA 1FUEA 3UZUA 4XWAA 3ICPA 5JNWA 4FYVA 1M6WA 1Z4KA 3TSAA 2GBFA 4DF3A 2H16A 1CUBA 3ET4A 4AUMA 5I7RA 5EZSA 2P3LA 4B2IA 2G8NA 2X8LA 4I9NA 4A1OA 2OCGA 5JS8A 4IH1A 3L8YA 2H06A 3LYUA 4UREA 4DR6B 2WNIA 2X4LA 4KR2A 4CTJA 4WJZA 3TJRA 4EB6A 1YVDA 3IR6A 2JGEA 4N39A 5K7SA 1XSEA 4TMKA 5EWMB 1LY1A 1PS9A 2Q1XA 1X87A 1AKTA 1GG9A 2R751 2DR3A 5C8VA 3ORYA 3OHMA 2IK8A 5F9HA 4TKLA 4JI4B 4GKVA 5CT8A 4B6PA 3I9V1 6PFKA 4J9VA 4JEMA 2PQMA 5LBUA 2OLKA 4XLTA 5EZ5A 4ZAVA 4YX9A 4JGIA 3LFTA 1BA2A 1HBJA 4LZZA 4WFJA 3JR7A 1PLLA 1UC5B 1QV7A 1O8BA 3NXKA 1KYWA 5B58T 1UKYA 4JVLA 1XK7A 1RW4A 2YL2A 4H6PA 1DPGA 2NXWA 1OIXA 4EZIA 1Y5IA 4RK0A 4HMQA 1OXKB 2IH2A 1M2OA 3DMNA 4YRFA 5IABA 1K8QA 2JPDA 3MJTA 1DXHA 3V3KA 2ZYAA 1GA6A 4X84A 5TR9A 4RWZA 3ZK9A 4B40A 4BQSA 1W85B 3PDIB 2IEIA 4FQ5A 1DADA 1O95A 2F3TA 1R0KA 1Z6XA 3FUXA 5TGZA 4BY9E 5JISA 4YCJA 3V7UA 1OKKD 1GUFA 2A9PA 2O50A 5EPEA 4CM8A 3AZPA 1S2OA 3EBPA 1W34A 4N76A 4FD2A 2WT4A 4E2ZA 3RFUA 5BR8B 2HLPA 3QUSA 2R25B 2P3QA 4BBPA 5C5DA 3LVQE 3QELB 4GLJA 4UEOA 2PMKA 4D0GA 1YCHA 2I3GA 1QH9A 3SK0A 2OOKA 4TWZA 3K2IA 4FR5A 3DZ8A 2HCBA 4JI8B 5M5BA 1JIIA 2R5WA 3WB0A 2QN7A 3FR8A 2AOUB 1SQGA 2ZTMA 2VF8A 3KFXA 2C3PA 2N1BA 3BMOB 3P52A 1AUQA 3QPCA 1YL5A 3D3NA 4M7OA 4QRDA 1JLLB 3URMA 2WMDA 2I1VB 4F4JA 1R7RA 3BF7A 5JI3E 2IVZA 3QXGA 1IIBA 5E8JA 4DL9A 4MVJI 3WL6A 1ZIYA 3E3MA 2JASA 2QG4A 2WOJA 2DPLA 4P4SB 3GMIA 2V03A 5CLLA 2C7GA 4W1RA 4DV5B 5KYYB 2J5RA 3LTEA 3HR4A 3GFPA 3O26A 1IBRA 4RANA 4JR1A 1GRCA 5EE5B 3GARA 1OZAA 3DVLA 1G7CA 2X0RA 1QVAA 4WECA 3KOOA 5DHFA 3EIQA 4MRSA 2YV4A 2RGRA 1RJDA 3R9XA 1JA1A 1AGRA 3FUWA 5K8IA 5DGDA 4PCVA 3T3OA 5CUQA 1HYQA 2ZAIA 3DDUA 3KYJB 4NDAA 5IT9A 2QM7A 4PLYA 4Z53A 1PBTA 3MTIA 2C2XA 3UIEA 4I50F 4AMGA 3ZVKA 4LJAA 3NTQA 2QJOA 2XWSA 3CT4A 2J9ZB 4N12A 1YNSA 4ND4A 5WRFA 5L4NA 2IV2X 1E0SA 4HQRA 4K26A 4MKZA 3QFTA 4KYVA 4PCAA 1ZOOA 3ILYA 2CV1A 1B7GO 1ULTA 4D9KA 4F1JA 4FOOA 1XEXA 4G4GA 3OTOB 2B1IA 5KCZA 2B7CA 3KYDA 5JZOA 4Q7QA 3B3FA 5EZQA 4H1WA 1YJ5A 2XECA 2HPVA 1L7MA 3GNQA 4JUBA 4N5IX 4BMVA 1A72A 2D8MA 2PCLA 3KLOA 1UKZA 1HL3A 4AAYA 1Z33A 3PP8A 3URKA 2X3FA 5I7VA 1FDIA 4LF7B 1FFYA 4BGDA 1B8VA 1USVA 3QI7A 4R0MA 1VKZA 3NDJA 4RQUA 4G5OA 4XTRA 4MJ7A 1BEZA 2JBHA 2DFPA 1OVMA 4E21A 3CR3C 2I6SA 4ZI7B 1SZJG 1ZZEA 2YHIB 4I4CA 3JATA 1KK3A 1HLFA 5HG0A 3ER8A 2PRJA 1TJYA 4FZ3A 4TS1A 1KE2A 2CZQA 1P3Y1 2C7RA 2P2SA 4OHPA 1N5DA 4IG9A 4PZCA 2HUPA 2MR5A 3OCUA 3C3AA 2FSUA 1PT5A 4JN6B 2O8DB 3F9IA 4P83A 4H1VA 4X91A 1EFTA 4YR9A 4BMDA 4LRWA 3ZJTA 4WQMA 4LGVA 1VMAA 2FMUA 2TMYA 1E0DA 2AX3A 1LF5A 2WJYA 3GLSA 3GNTA 5EEGA 4ABYA 4ZI7F 3AEQA 2PUDA 1K86A 4R8MA 4RVFA 4MQ5A 3Q8MA 1HKHA 1JB9A 4ID9A 1HE8B 3UBTA 4GX2A 2YN0A 3KQWA 4XRGA 1CQZA 2DZDA 4BBAA 5LIPA 5B7PA 1I7QB 4MJLA 4MI3A 4JBXA 1R5BA 1YI8A 3GGGA 2AZMA 3GUCA 3ASZA 5BMVB 3SDBA 3PYMA 3TEJA 1VI5A 3M8KA 4NMHA 4ZI2A 2WQ6A 1JHUA 1CJUC 5LLSA 4QHSA 3DGFC 1ZD8A 2BGGA 4H2DA 3DDNA 4HAZA 2XKBA 2P9YA 4Z4GA 5JJLA 1A50B 5HFJA 1ETUA 2I99A 4PAOA 2YVLA 4E32A 5L3RA 2H2AA 3CRVA 3AVPA 3VO9A 3LPAA 3WLOA 2PKEA 1X6VA 4LDQA 4B3CA 4WBNA 5E2AA 1SXQA 4REQB 1XCBA 4PC7A 5TS3A 4KI0A 3I9LA 2R84A 4MDHA 4MS4B 1NULA 1V3QE 3DAPA 1Q6ZA 4MIOA 4EZBA 1NKTA 3I9MA 5SICE 1E3MA 1DBQA 2AIRA 5CVCA 2YW9A 3ENKA 5ERXA 4MP8A 4B44A 1A9TA 3O4IA 1DQNA 1K6JA 3P71T 1ECJA 4QPJC 3U16A 3ICEA 2Y4NA 1A9PA 3IULA 4KYTA 4N7BA 4HLUC 1U1FA 2P6PA 3KBOA 3GOQA 3MSCA 2RH5A 1KJNA 2G17A 1PF7E 2OV1A 3NHLA 5CPFA 2VNHA 3O90A 4UXJA 3FTNA 3UOGA 4OKSA 1GSIA 1B8NA 3D0KA 4KXXA 3L7CA 5KTOA 2C4VA 3EC7A 1SU6A 4ZU1X 4ZOEA 1ZC4A 4BN0A 5HWSA 1T2AA 5B12A 1LW6E 5BQ3A 2ZI4A 1Q16A 2XNSA 4XM0A 2IBMA 1W5EA 1KY2A 3AQ4A 3QEMA 1XZIA 1BFDA 3W4JA 1NDUA 4PG8A 1CR0A 1XXHE 2RHGB 2YXDA 4DGQA 4F92B 2V6FA 2ZWIA 5F64A 3VFDA 3FCSB 1XU4A 1PL0A 1VP3A 2FRDA 1FUKA 4RUKA 3K32A 1X1RA 3EVAA 4MQLA 2WV7A 1P39A 1NHWA 3AERA 4D9EA 1IN6A 5C7OO 2CW5A 2HXSA 2YWFA 4GF5A 3P7MA 5J2UB 4D26A 2E1RA 2W6JD 5JVDF 4DUZB 4PYQA 4MWEA 5ESWA 1SVOA 3L8MA 1PNOA 1QO0A 4I2VA 4Z0PA 3QUCA 3SDZA 4C4RA 3QQPA 4BNLA 3UQYS 3H1EA 4YJFA 2FE1A 1JT9A 2EFYA 5LSAA 1GSHA 4U0KA 1TMYA 5UKDA 5JPIA 2W4IA 1V3VA 3D5TA 1MAUA 3LCVB 3S1LA 4BLPA 4Y2GA 1Q5PA 3RFVA 4AF6A 4EFDA 3E5NA 3FHCB 1QS0A 1VFNA 3Q9SA 1N6NA 1GZHB 1UQRA 2CMDA 3IQIX 1TX4B 2ZR9A 1A7AA 3JQAB 1RWOA 1UOOA 4NE7A 4C22A 1CR2A 4W5TA 1Q50A 1QGAA 5FTNA 3ZW9A 2FN3A 3DAYA 3V7YA 1TJ5A 1YU9A 2PS3A 4I1RA 5JFGA 5IXSA 3DZDA 4Q7KA 3MUOA 1TEVA 2GK7A 3BK2A 1O9BA 4QVKA 1NAHA 2FPMA 3E4CA 1KSJA 1Q2UA 1SBNE 3LQYA 4M3NA 3R5FA 1BXRB 1V7CA 4AC9A 5CYPA 3E6AA 4RHXA 2A6PA 1PFKA 2WPNA 3O8DA 5HPYB 1JHYA 5D5HA 1I7PA 2DETA 2EQAA 5ADWA 1IRXA 1I2CA 4DA7A 1A5BB 3ZU5A 1AO3A 4H18A 3HDQA 2BMEA 1FVXA 3DDHA 4NCJA 5C46F 3E84A 3T4PA 2H5EA 2ZWVA 2OUKA 5IAJA 1M34E 2QJFA 3DMTC 4HV4A 1EX1A 4TQAA 5A1TA 5BWCA 1JA0A 4F4CA 2F8TA 2Z83A 2AWNA 4Q3EA 1DZ3A 1EFPA 4H1TA 3I58A 4JL5A 4LHEA 4YMIA 5A9SB 4D46A 1DOHA 1SC1A 5CA1F 1ZM9A 4M0LA 1TM4E 3H1TA 4YRPA 4HLQB 4BV2A 4FIZA 4DV0B 2V6JA 5B2ZA 2WU4A 2R7MA 2AFIA 2PY6A 4BRUA 3T4EA 3TLYA 5IXJA 4ZPJA 2AKYA 2X6QA 2FWRA 4IDHA 3UCEA 3ZE9A 3KQHA 1JIKA 4INZA 5CCXA 1YBHA 2JF0A 1JB1A 3H1GA 4KN8A 4A91A 3DZBA 1J7KA 2VTKA 4OYRA 5LN1A 3HCPA 4RPJA 3JQBA 3KEGA 4HX9A 2R8BA 2IIVA 2WSYB 4XGNA 4KDRA 2O14A 3UAXA 1BZYA 1E5LA 3DL2A 3FN4A 3O4FA 4BN5A 1KZ4A 4UTVA 5I4BA 4F71A 5B53A 1C4KA 4R2XA 4H0NA 4K0RA 2Q07A 3O9VA 4GUAA 1AUXA 3IEVA 4ZREA 4M38A 5KTNA 4D81A 4INJA 1KDRA 1QB7A 2FRDC 2LIVA 2RIPA 2X8JB 3JQ8A 4FGJA 1QIEA 1KJ9A 2P4UA 2WWGA 1ZM7A 3M6IA 4XIGS 4DIBA 3W6ZA 4RF4A 4CETA 4DV4B 2UXBB 1AC5A 1R9MA 1N5OX 1F4LA 3F7MA 4A15A 2DWPA 1IAVA 3EUAA 2NVWA 4OU4A 4JUFA 4KNYA 4P31A 2SCUB 1IQUA 3A9SA 1T3SA 3AHFA 4FBLA 3NWJA 4J1TA 1A9XA 3F78A 1MEJA 1N0WA 2QMOA 3E7FA 3GUUA 3QU4A 4HDCA 3GWZA 2QTTA 1MEOA 1XCJA 2ZE7A 2BZ0A 4Z2AA 1M2EA 2YMPA 1GL7A 1RBMA 3A9WA 3QVKA 3X1JA 5DNWA 1WXWA 5I9BA 2AR0A 1JFLA 2JAPA 3UNXA 1UDRA 4WK2B 3C3BA 3G8DA 3U49A 1V7PC 3FZQA 1GRRA 3NXSA 4MS1B 1YDEA 5F73A 4JYZA 3ZD7A 1OCEA 1ATIA 1DQZA 4A8PA 3LVBA 2CLFB 4YRTA 3GLTA 4M7RA 1TE2A 2WNSA 1OPRA 1O94A 4TRJA 2X0EA 4YCMA 1H3EA 3ND8A 5E3HA 3M4JA 4WBSA 3HK2A 1B6RA 1OWNA 4BP1A 1IZ9A 2I65A 4MRMB 1SHKA 4RX1A 3EF3A 2PJRA 3E27A 1KEPA 3EFHA 4NHEA 5BQFA 1QVVA 1BYUA 3AUYA 1M2FA 4WOKA 2XMQA 3H3XA 1IJEA 1DEXA 1ISPA 3N70A 2PMFA 2CJWA 3RUHA 2F4VB 4G56A 2VPZA 2XR1A 3BIXA 2APJA 1FZQA 2Z2IA 4HEA1 1E2HA 2XIJA 3DLHA 3O1LA 4YJGB 2I7XA 5FFMA 3SC2B 5BNTA 3BBPA 4OQNA 5REQA 2AEJA 3T5PA 2QR3A 4HWRA 4UXIA 2O3QA 4LRYA 1QO9A 3MLBA 4L1KA 3F5MA 4K6HA 4WADA 4DG8A 1A9ZA 4DWWA 5BOSA 1PLJA 5LMCA 3Q8LA 3DT6A 2JHCA 4J2OA 4TL9A 3TJZA 4RMJA 1JQ3A 2BSAA 1V1JA 4BNKA 2IZ0A 4ZMSA 2WHYA 4AB1A 2A5FA 4AY5A 4NBVA 4C04A 5MF6A 1NM5C 4KMMA 3G8BA 4O8ZA 4ZMBA 3L6CA 3RS8A 1HUQA 2CNBA 4YT4A 3F8SA 1VJRA 3QVGA 1GN9A 3SHQA 4KXWA 2JEYA 2PS1A 1I5RA 3KT6A 4YAWA 4TYWA 3NLLA 2GRAA 3DUFA 4BNWA 1HEUA 2C4TA 3EC2A 2E4AA 2PR7A 1AMUA 2X8JA 2PUFA 3CZ4A 1Y89A 4RKEA 4BO1A 1ORDA 2Z57A 3WK7A 2PWPA 3D2AA 4CKYA 2BR5A 3KS9A 3NAMA 4O2BA 4CTNA 1XNHA 1VE3A 1AF4A 1Z18A 3PEUA 3TLBA 3ZWQA 4PINA 4GYWA 1HNXB 1V7QA 4V0OA 3K15A 4KQWA 5L7WA 5EFOA 4ISBA 3THXA 2GD0A 1D4FA 1CETA 4H77A 4NENA 4XX0A 1NASA 4PQGA 3QX9A 4ZYWA 3DBRB 2YMMA 1PQWA 3C3MA 4B8ZA 3DF7A 3PD1A 3OVMA 1Q74A 4BX2A 5IP5A 4KIGA 2R11A 4Q1VA 4RH1A 4G84A 2VXOA 3CB4A 3IDAA 3RVPA 3O6VA 1NRJB 4BMZA 5KIAA 4JNCA 2XTJA 3EIUA 4IBOA 4Z99A 3OOEA 5DNUA 3AEQB 3ODPA 3M6WA 3O2SB 2BKAA 4XGQA 2AV6A 3L8EA 3FOFC 2WOOA 4XIIA 2E3JA 1X0XA 3RDPA 5HZHA 2H9YA 3JQ9A 1KWGA 1SA0A 1Z7GA 2PZ8A 2C07A 3OPQA 4TLLB 4ZEOA 3HYSA 1QWSA 2COKA 4LY6A 5FFNA 4I50A 1LH0A 1Z4IA 4HYQA 3C3PA 4RIFA 2BELA 1QP0A 1S1MA 2O2YA 2X0NA 1NW8A 3RJZA 4FB5A 1QGOA 3VHQA 3CN7A 1DSSG 1Z45A 1QLWA 4J29A 4MQ4A 1JEOA 4QUBA 4U6SA 2NSYA 2E89A 1GYPA 2CE2X 4FNAA 4L76A 5IF9A 4YCLA 4KXYA 3ORFA 2FCRA 1TT5B 1A5AB 1AGYA 2H63A 3OE7A 4O2AB 1Z22A 2ZRBA 4TXMA 2Z1DA 1NF3A 4L2IB 3HXOA 4LTDA 2DXIA 3LIPA 1P73A 4KAJA 4ND8B 1YACA 3P0EA 1S4QA 1X15A 1M5TA 5JG7A 3JD0A 4N5MA 4OXYA 2PKRA 1A96A 1Q83A 4P6VF 4BQNA 2FB9A 5CFOA 3WMWA 4I14A 3QG5A 4Q00A 3AL0C 1XCOA 4RQBA 3UAGA 1QK4A 1DAMA 1IQ0A 4NPHA 5EE1A 3L93A 3WAKA 4CI0B 1NDQA 1HDCA 4D42A 1UBUS 4PQRA 4F8YA 3P2JA 4FSHA 1E2DA 2GZSA 5E3IA 1ZR4A 2ZWAA 2V3WA 2FWNA 2F7SA 4I5IA 2D3WA 3H9JA 2ZI5A 3WFZA 4EVIA 1Y9JA 2CHUA 4OOFA 1JNXX 1ZUIA 3ONVA 5DM70 4KFCA 2B2XA 1ZGJA 4DMKA 3DCYA 3DDZX 4HCJA 1R37A 3GFQA 4MA0A 5GJCA 3VJLA 4YJ2A 2H1WA 4IKOA 3W7VA 3KQUA 5LP6A 2GWRA 3ASUA 2V7GA 4OJMX 4CU2A 2QMQA 2R6R1 3D8SA 3L7KA 1ZS9A 2YWGA 2FQQA 4OQZA 4EH1A 3SHTA 2QTGA 3LE8A 3I9JA 4NBKA 4ZOCA 5ALTA 1Z4JA 3G23A 1QHFA 2WJ6A 1CY8A 2BFDB 1G291 2VC2B 3HYNA 3I04M 3OM8A 3TKAA 1XIVA 3KCNA 4XYEA 1D7OA 4DIUA 1X0VA 3K70D 1TUBB 2JI8A 1F2DA 2EP7A 4IXNA 2E0IA 4JI6B 2EV9A 3QEMB 5J58A 1Y9ZA 3LT2A 3E8MA 4MWGA 4NAVA 1KEEA 1GADO 2GCOB 2IHTA 1PEAA 1RBZA 3N2IA 5HF5A 3HXMA 1SWWA 2O0LA 4A6XA 1RPJA 2D2VA 4LUCA 1CUIA 1L4LA 1MXHA 4H3SA 4HPXB 1UKAA 1F8FA 4EDHA 3UJ9A 1HV8A 3ROTA 3RRZA 3IP3A 4NCBA 1E1CA 3WRWA 4IRXA 1DOAA 1WCYA 5EIBD 1Y4SA 3OZAA 1YQWA 1NY5A 1XBTA 1EEXB 1L5WA 5K0LA 2R4UA 1MA0A 4CKBA 1G6OA 2POCA 3QTBA 1L5HB 2ZIWB 5AW7A 1YC2A 4DKXA 3ZLUA 2AMJA 2WAOA 3C5CA 1GARA 3KB6A 4RHEA 3V4VB 1EAMA 2QG9A 4DSAA 2KBEA 4BQRA 2P9BA 4E4RA 1QS0B 4G25A 1Z6QA 2ZJZA 3S5JA 2CYCA 1ID8A 2COUA 5F2OA 5DDIP 3GLFE 4Y2TA 1XJ0A 2HLDD 3C7KA 2AH5A 5BSKA 3I62A 1LA2A 2IKSA 3AC0A 2GB4A 5BWMA 3I23A 3L6BA 4FZRA 2V0GA 4CM5A 1QIDA 1Z0JA 2X9GA 1NG1A 1SUPA 2DBRA 2VXYA 3NJ4A 3Q7EA 1FFHA 2JFFA 4RETA 5FA5A 3KEQA 5JNRA 3CVXA 4G4JA 4O2AA 4RVHA 1WUIS 4WXRA 4NFSA 2BONA 2ENWA 1H3NA 5JXJA 2PAAA 1OKKA 3NW9A 4N8DA 1DDGA 2MSDB 3PWTA 1S2LA 3E5HA 1EM8B 2WVJA 1SCQA 3FZEA 3N7TA 2DQYA 4J4TA 4JVMA 2HSWA 4QXOA 3VH2A 5LYJB 2ZEJA 3Q3VA 1SQSA 3CB2A 2FLWA 3KVOA 2VCEA 5KOIA 4WOCA 2A4MA 1NBHA 3NTOA 1M1ZA 5FPQA 2VDOB 1Y9DA 4Q4AB 4LGYA 1KFCB 4WKBA 5TY0A 3EW7A 1G64A 3RKRA 3ZWYA 3BKXA 3CLUD 2Z2ZA 4HB3A 4WKPA 1XAIA 2PX8A 2M6RA 3LMKA 1KP9A 2VZEA 4X61A 3RVJA 3H5RA 2GMWA 3PA8A 3KT8A 2EDAA 3OSZA 1P4RA 4FUTA 3A3NA 3OURA 4RQTA 3E9EA 3RVLA 4BMPB 2HHLA 2WF6A 3DNMA 4W5WA 1CFZA 1GPJA 4HX5A 1BX1A 4M0CA 1IN5A 3WFIA 4ERNA 5KSWB 1XLTC 3UFXB 2LUOA 4WEQA 1ODKA 4Y9DA 3VYRB 4KRFA 2K2WA 2EF1A 3MOSA 3Q5DA 2R4TA 4PZ9A 4YMLA 1WUJS 1W29A 3IR7A 4EB0A 5HP4A 5AK3A 5KOHA 1XTTA 3FOZA 3QE3A 1TD1A 4ZVKA 4JDPA 3MMXA 4HYYA 3LUKA 2GYYA 2L0XA 4WPGA 4YCAA 5EWJB 4CIWA 3JZDA 4XWWA 4OUKX 2PYIA 1QZXA 1N5LA 2NQ2C 2A30A 4FLMA 1SZCA 3EGDB 1J0DA 1TYZA 1NLYA 4B3FX 3EZ2A 4MS3B 3VC2A 1DUIA 3RSGA 1RWMA 3WWYA 3DYBA 7GPBA 1SCIA 5KYWA 3EDYA 1N7JA 3FUCA 5DULA 3ZTTA 2UZ0A 3C8HA 1IBLB 3E3NA 1F9EA 3EXEB 4GKAA 5LQNA 1R8XA 3TCNA 2JLYA 1HR0B 5F51A 5TRTA 3O3MB 4JLOA 1DHTA 1O2DA 2FDXA 2P9QA 3DTVB 3OEHA 4GR4A 4MQUA 1KPGA 4TVSA 1PYDA 1NTRA 1UR5A 2GN0A 3EXAA 3ZJ4A 3OKCA 2YZKA 2NYAA 3K8OE 5JWRA 5LQSA 1WXDA 1BW9B 3ZEAA 3U5ZB 3WV5A 2GDZA 4K9OA 1SOWA 3N2KA 4C2AA 4XWKA 3BH0A 4H1UA 2B1JA 2VSFA 3QITA 5DNCA 3GMDA 4N40A 3W8RA 3EIEA 2AC2A 1B0AA 1PKEA 1VL2A 4C21A 4JYMA 5F2NA 3ICCA 3FPBA 4OKNA 3H6GA 4RZXA 4QYIA 1HWYA 2YMQA 2I2CA 2WVHA 1X7WA 4Q4JB 4ZQBA 3CURA 4BL5A 4ZYXA 5L6LB 4CQMD 3EUEA 3VHXA 3BRSA 3LK7A 5I01A 2PM8A 4GZ5A 2GZRA 4QOGA 3LO8A 3T5MA 1UL1X 2Q1YA 4D5EA 1RRFA 4UDOA 2OT3B 3ZCSA 1AXEA 4ZDKA 2G9VA 2JFVA 4X6UA 1P77A 5AICA 3EVZA 4I1IA 2IBTA 2X5XA 4KFSA 1XKTA 4D4LA 5BURA 2O6LA 3B2QA 5HK8A 1TVCA 1G9XA 1W49A 3DTVA 2CHGA 3KJIA 3BUSA 3H11B 4C1NA 5IF3A 3QU5A 2AYZA 4NBSA 3ZWMA 1J8QA 4RZSA 1VCMA 3OX3A 5IT0A 3E9MA 1MJNA 3ZGNA 3AIKA 3NH6A 4BXOA 4X3CA 4QWMA 1DE0A 1QH8A 2ZJ2A 2NU6A 2PV7A 1ORWA 3NGLA 1E1QA 3QLJA 2YYSA 4N4AA 2PRZA 3DV2A 4Z7JA 4AKIA 1SVKA 2V58A 1MH1A 3TM4A 1A9OA 2E2WA 2F17A 3QSYA 1E0AA 5CB0A 4TZKA 2WU3A 4ZJZA 1W94A 4WJLA 2C3YA 5ICGA 1HYGA 1SRRA 3B1JA 3LQ4A 1NSTA 3CSDA 3PC8A 1FFXA 3QYFA 4E4TA 2XZOA 5KKCA 1ZDMA 4X97A 3TPZA 4OQ4A 1Z75A 1FQOA 1B1CA 4LJKA 5J2UF 3GZJA 1WAMA 2OLJA 2L82A 3PEWA 1MA3A 5IFKA 2IYPA 3I73A 4U9UA 3TR6A 2QY9A 4JENA 1FNCA 2JGKA 3B7WA 4JWTA 4MLPA 4YRLA 5GP1A 3SP1A 1P4AA 2F9LA 4OX9Y 1NR1A 1S9HA 1ZINA 3GD5A 5EAIA 4M98A 5HTKA 4CVNA 5A4KA 1QYVA 3PXBA 3HMKA 3INTA 1H0KA 4EX6A 1PFQA 3CMCO 4JHLA 4UCFA 2FPGB 4I3HA 3DHWC 1A1SA 3JALA 4JT2A 5F1OA 1APBA 5DASA 1HT3A 2QTMA 4M8SA 2ZOSA 3CQ9A 4B6RA 1K6EA 4WFKA 2OC9A 2XW6A 2PMCA 4EB8A 1FJHA 4F1KA 5FPYA 3PHGA 4URYR 1I80A 3WDSA 5BN5A 2Q0SA 4X1YA 3CG0A 3KJGA 3S2IA 3SR3A 1G42A 1TZCA 1H8HA 1VSTA 2Q99A 2FPGA 3HHPA 3IV6A 2OPHA 4CM4A 3BWBA 3QF4A 2KX7A 1ES9A 1C3XA 2SKEA 3K9BA 2GLXA 3LOPA 2O3RA 4TVKA 1W5SA 3I6MA 3GMTA 3OPXA 5D84A 1GAJA 4X95A 2A1TR 5H8WA 1KP2A 2VYVD 4J49A 3GG9A 5C4MA 3IAHA 5I7UA 5C81A 1GCOA 5AQ1A 4AD8A 3QTLA 5K3FA 1PZNA 3DR5A 2VZ9A 1P5ZB 3TQHA 4BUCA 4MV7A 3ZCPA 5K3OA 3L1VA 3RASA 3F49S 5LDDC 2DFVA 2VDWA 3OZEA 3RC3A 1XTSA 3HCDA 3MGGA 4HN2A 3DCIA 3SOZA 2VSXA 4M6WA 1SU4A 1BMDA 1OBCA 5SYAA 2FGKA 5TMBA 3D8RA 5CFRA 1UMCB 2E21A 3K05A 1JFVA 2OFXA 3P94A 5FKJA 1N8KA 3ILVA 5JAIA 5EUBA 1N2CB 3S2FA 1Y98A 2RCYA 3IYLW 2WIDA 4M89A 5DOZA 4D9IA 4CQLB 1NWHA 4LQLA 1VC2A 1SUFA 3G9UA 4P32A 2OYCA 1O9GA 5GZ3A 1Q0SA 1NN0A 2AD1A 3DGEC 2I3BA 3LA6A 4PGMA 5ALLA 4RTNA 2YV2A 1CKEA 2GJAA 4YHBA 2I2FA 5HX7A 1C9EA 2FH5B 4D25A 1KETA 5JVDB 4TLMB 1DJMA 1WV0A 3ZE2B 4UUBA 1QYCA 4BNXA 4BZWA 3BRQA 4J0KA 4N9WA 4QATA 4D8XA 3JVVA 3N39C 3NX4A 4EBFA 5FEUA 4KQFA 2VHVA 3GJRA 1TAUA 5ALGA 4ESEA 2GD6A 3V55A 4GLBA 2WKQA 2R4QA 1N2CA 1XDWA 2H0AA 1QQ7A 4AECA 2VWQA 4GDFA 2PLWA 3A14A 4FN5A 5L9AA 1KP3A 4XPIB 1PFVA 2MU1A 2QMUA 1XKLA 2Q9AA 3L4EA 2ZAYA 4C4AA 1WP4A 4S2EA 4ZT7A 2V9CA 4NCNA 4AYTA 5G3ZA 5KDOA 4B8WA 3OT5A 3WBBA 1M34B 3I2GA 2HYIC 1KVUA 4RKYA 3RRFA 3U1VA 3W5JA 3CR8A 1D2HA 2OO5A 2GF2A 3MGAA 4KNWA 4MITA 2ICAA 2JAHA 1SUCA 2OCYC 3BA6A 2PT5A 1A0OA 3E70C 2HT6A 3I6YA 2YOHA 4M7PA 4ML3A 4DNFA 2R0QC 2JLSA 4RZQA 2OO5C 3MTQA 3RBVA 3KQNA 2FOIA 1S0UA 1WDWB 3O1JC