4Y9SA

Structure of an h300n mutant of potato epoxide hydrolase, steh1
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
320
structure length
320
Chain Sequence
b'KKIEHKMVAVNGLNMHLAELGEGPTILFIHGFPELWYSWRHQMVYLAERGYRAVAPDLRGYGDTTGAPLNDPSKFSILHLVGDVVALLEAIAPNEEKVFVVAHDWGALIAWHLCLFRPDKVKALVNLSVHFSKRNPKMNVVEGLKAIYGEDHYISRFQVPGEIEAEFAPIGAKSVLKKILTYRDPAPFYFPKGKGLEAIPDAPVALSSWLSEEELDYYANKFEQTGFTGAVNYYRALPINWELTAPWTGAQVKVPTKFIVGEFDLVYHIPGAKEYIHNGGFKKDVPLLEEVVVLEGAANFVSQERPHEISKHIYDFIQKF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epoxide hydrolase
molecule tags Hydrolase
source organism Solanum tuberosum
publication title Expanding the Catalytic Triad in Epoxide Hydrolases and Related Enzymes.
pubmed doi rcsb
total genus 120
structure length 320
sequence length 320
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4y9sA00
4L9AA 3H19A 1XZJA 5ALRA 4I3FA 5FUMA 1C7IA 2ZJFA 4BTVA 1MNAA 3LIIA 4WFJA 3E1GA 4BP8A 1ZJ4A 4FMPA 3WWDA 1GKKA 1ORWA 3ED1A 3PF8A 1W52X 3ZLTA 3QZUA 4IHAA 5HKAA 5ALIA 1QTIA 3N0TA 3OC0A 1VOTA 3KSRA 1JKMA 1LBSA 3QMMA 3LP5A 3ANSA 4ZREA 4L0CA 4OUKX 5DYTA 1Y7HA 5ALYA 1WPXA 4GBGA 4Q3KA 1N1MA 2Z3WA 2YYSA 1BCSA 1QFSA 1Y7IA 3STYA 4BC0A 5HZGA 3V1NA 5EHXA 1QIEA 2BKLA 4CG1A 4UHFA 1MNQA 1ZIYA 3L1JA 2VQ6A 2PSJA 1I6WA 3N2ZB 2PUHA 1XZKA 4UBMA 5HK9A 4CCYB 2ZYSA 2XUOA 4QLOA 2JGMA 4MJ3A 1GGVA 4UPDA 5EHZA 4MQMA 2PKYX 2XMDA 3FLEA 5JZSA 4F5ZA 4NZZA 1K4YA 5BWCA 3T4UA 2CZQA 2OG1A 4UBLA 5FPPA 5DNVA 1XZCA 3HC7A 4B0PA 4MQLA 4BATA 2CMFA 3H2JA 5JAPA 4B6GA 3T52A 2X76A 4W9RA 1LNSA 2OCKA 3IA2A 1XZLA 2HU8A 5HF6A 3RARA 3QPCA 4DIUA 3IUQA 4C4YA 3ESBA 1SOMA 5IH7A 5FRDA 4Y2PA 3BDIA 3GROA 1FFDA 1DINA 4C6HA 2AJBA 2HIHA 5K3FB 2HDWA 4IQ4A 3FOBA 4FLEA 5KREA 4ROTA 4BE4A 2WG0A 4X6UA 3V1LA 1UOQA 4WCVA 1S8OA 3WJ1A 3G9UA 2G63A 3FVRA 1DQZA 2BJHA 1K5PA 4JYPA 1B6GA 2VSQA 5FPQA 5JZ9A 4NMWA 3WL7A 5ALXA 5AM2A 5YASA 2DR0A 4M0MA 5LP1A 3QYJA 2WJ3A 5A71A 1R4ZA 1DX6A 3ILSA 2XI4A 4BP9A 1MTZA 3G0BA 3IVMA 1H2ZA 1THTA 4DSAA 1CUAA 1QIGA 3M3DA 3WZLA 5K5EA 1UZAA 1P0MA 2JIDA 4GW3A 3GELA 1TRHA 3V48A 3DS8A 1TCCA 1AURA 3STTA 3LLCA 4E11A 4OU5A 1GZ7A 1U2EA 1UOPA 3I28A 4E14A 1RYYA 4JH0A 4UHCA 4Q34A 1N5MA 1TAHA 1FJ2A 4G8CA 4J0CA 3D59A 5FOQA 1ORVA 4UHDA 2HHAA 2QXTA 2XLCA 1CUGA 4PV7A 4BAZA 1C7JA 3W9BA 1H23A 3H2IA 1R3DA 4J0HA 4I4CA 3PICA 3L1HA 1VJ5A 3NOXA 1WPRA 5AK6A 5JAHA 1UOOA 3JYHA 2RHWA 1AX9A 4Y2YA 2C5FA 2OQIA 5ALGA 4UBNA 3PF9A 5ALJA 1YSCA 4AX4A 2I78A 1ISPA 3KWJA 3UUEA 1RP1A 2R8BA 3YASA 4B81A 3C8DA 1ZD3A 3KD2A 2QM0A 1UKCA 1XZMA 1NU6A 5ALTA 2W22A 4OCZA 3H04A 4XVCA 1LBTA 1QIMA 2Y6UA 4OB7A 4X94A 4O08A 3BF8A 1WB5A 5ALUA 4L72A 4E15A 1LPPA 2WHRA 2DQYA 5AKHA 2Z5GA 1W6RA 5EGNA 5BOVA 5CMLA 2X8BA 3V9AA 3C87A 1QTRA 3E3AA 1ACLA 1BS9A 4BCCA 5DYYA 4X71A 1ZI8A 2XUAA 4AO8A 2Z3ZA 4MEAA 1JFRA 4I19A 2G4LA 2OPHA 3DOHA 3EBLA 3I1YA 4H7HA 5D6OA 3IDAA 1BCRA 1FFBA 3H2KA 4FOLA 4B84A 3W2TA 4N8EA 1XQXA 2Y1KA 2WHPB 1H22A 1MX9A 1Q0RA 2X5XA 4OPMA 1H2YA 4KR0A 5AP9A 3MGAA 4LXHA 3V1MA 4UBOA 1P0PA 4L3WA 1MJ5A 5T4HA 4MYSA 2XB6A 1XRMA 3BWXA 3IUNA 2WFZA 3VKFA 4UHEA 3WYNA 4C89A 3WWOA 3MVEA 4LIPD 4QWWA 1AQLA 2CB9A 4M0EA 2HFJA 4LXIA 2O2HA 3H1AA 1HKHA 1W75A 5D7BA 3TGLA 1IUNA 1XRNA 1LPBB 5CT8A 4Q82A 4X6YA 4X92A 2WFLB 2XDWA 4HXGA 4YX9A 4QLAA 3TEJA 4GDMA 5ALFA 2QR5A 1EDBA 3IUMA 5I8PA 4A5SA 4Y2RA 2UZ0A 5KWJA 1VZ3A 4HZGA 4M0FA 3C5WP 5AKIA 4RNCA 2XT0A 3JWEA 4KAAA 4KE8A 3VVLA 4GWLA 4U2DA 2QUBA 5JADA 5AOCA 3BDVA 1BEEA 1R88A 3HSSA 3M81A 2JF0A 1CUDA 3R3VA 2WQZA 3KWFA 4FLFA 4J0KA 2XLBA 3GUUA 3FLAA 4XJVA 1LPAB 5ALSA 3HXKA 5JAUA 1A88A 1C4XA 4B9EA 2C4HA 4B82A 3X3HA 2GZRA 5AKEA 5JIBA 2CUTA 1SCIA 4J0GA 1T4MA 4HXEB 1YA4A 3WZMA 3QM1A 2CBGA 3AIOA 3Q8WA 4QDZA 4U2CA 2BGNA 1ODCA 5AOBA 4X97A 3D3NA 1A8QA 5C7YA 4N8DA 5E2IA 4EY7A 1LPOA 5FV4A 1ZI6A 5I7UA 1P0IA 1JT2A 4A23A 5AICA 4F60A 2WUFA 2ROQA 3W06A 4BVKA 1UKAA 4QNNA 2XQGA 3WJ2A 4WDRA 1PJAA 2ZJ6A 6YASA 3DLTA 5C8ZA 2OCGA 1L7RA 1DT5A 1YB7A 4WJLA 1IZ8A 1R9NA 2XUHA 3ZPXA 2NW6A 5ALHA 3A2LA 2QJWA 3IBTA 1TCAA 3AUKA 1YA8A 4BE9A 1F0NA 2HM7A 5ESRA 2HA3A 2VJDA 3A2MA 3QPAA 3FYTA 4WFKA 1ODSA 4EBBA 3ZLVA 1EH5A 5AM5A 3HI4A 4EZIA 1OILA 3PUHA 1ACJA 5E4JA 4N5HX 3WL6A 3G9ZA 2HU5A 3HRHA 4XX1A 2WIKA 1IMJA 4KJXA 4HRXA 5AJHA 1AMNA 1U65A 4GHWA 3C8HA 1Q84A 1QIDA 1E66A 3BJMA 4W1RA 1CFJA 3K9BA 2WFMA 2DHCA 1QIKA 4KAFA 2V98A 3LS2A 4KE9A 4LKOA 2FX5A 2WFLA 5ALDA 3BXPA 5AKGA 2JGKA 4HS9A 4EY4A 2WILA 3FYUB 5CURA 4Q05A 4PF1A 1HL7A 1NU8A 2QMQA 2R11A 5DTJA 4C88A 4H77A 3JW8A 2WIFA 2XUJA 1USWA 4TGLA 2WU4A 1E3QA 3I2FA 4GLBA 1QIFA 1E8DA 1XFDA 2FJPA 1F8UA 3DCNA 4X95A 2JGFA 2ECFA 3DJYA 4GEGA 1XZGA 5T4EA 5FP0A 1K6EA 1F0PA 3WK4A 4DMHA 5AI5A 5LIPA 5ALNA 5K3EA 1AKNA 1XZBA 4Z49A 1CUVA 1K8QA 2QZPA 4UBKA 3DEAA 1F6WA 3WK8A 3B12A 1CUSA 3P2MA 5AIAA 1AZWA 4ARBA 3O9MA 3G0CA 1QIHA 3I2KA 3DOIA 3GA7A 4XWGA 4B85A 3AIMA 1E8NA 4BZZA 3LCRA 5ALWA 3NGMA 4UBIA 3WK7A 1L7QA 1IUOA 4QWMA 2XUKA 3MUNA 3PI6A 4TPKA 5SYMA 4EHBA 1MT3A 2VJCA 2I3DA 3PE6A 1QIJA 3VVMA 2PUJA 4DGQA 4CG2A 1QFMA 4Y2SA 4AMYA 2WJ4A 2C0QA 1JU4A 2WSLA 5FKJA 3O4HA 3GFFA 4F21A 2PVSA 4H7KA 5BWBA 1ZD4A 1CUFA 2ZSIA 5AKYA 3VISA 3OURA 2HA0A 3O4GA 2OGSA 5LZ9A 1LLFA 4CIBA 4WY5A 2XUGA 1JI3A 1HLGA 2XMZA 3Q0TA 1FFAA 5EHQA 1GXSA 5CT5A 1QLWA 5JAOA 3H0CA 1LZLA 1CQZA 2QT9A 4GECA 2WG2A 3STWA 1YAJA 2O2IA 3QBJA 3V1KA 3K6KA 2QUAA 2YXPX 4HVTA 3FAKA 3STUA 1PFQA 3KXPA 3OM8A 5FXMA 4YK7A 2JBWA 1WHTA 2G5PA 5LKRA 4MWTA 5A6VA 1QO7A 2BAGA 2XUPA 2JGEA 2WIDA 3PDCA 3R3UA 4HAIA 1XZAA 4KRXA 4RPCA 1CUXA 5ALEA 5IKXA 1CUWA 4MWSA 1BE0A 5CBKA 1UWCA 2VEOA 4P9NA 4GXNA 1LGYA 4J03A 1MAHA 3VJLA 2JGLA 3ICVA 1CUIA 1EINA 3AZOA 5AK5A 3G7NA 3R3YA 4FTWA 1WM1A 1XLUA 2QTBA 2RI6A 2YH2A 4OB8A 2HL6A 1X70A 1QE3A 3ANTA 4RGYA 1OCEA 5HK8A 2HA5A 2J4CA 3WLAA 2CEKA 4AN1A 2CJPA 2ZSHA 1CUJA 3WK9A 5K3FA 5CW2A 2ONCA 3EQ7A 3D2CA 1EX9A 4QDTA 3SK0A 1JJFA 1JJIA 5DTIA 1EHYA 2OGTA 3G0IA 2W6CX 1GPLA 4DNQA 4H35A 5T4BA 3HABA 1LZKA 3PFCA 3F97A 4ZV9A 2JGIA 3FVTA 1XLVA 2BUCA 4K5QA 3I6MA 4TVKA 4OYYA 4BBZA 2WIGA 1O6GA 3WK5A 4IO0A 1EXWA 2FJ0A 2VT7A 1K63A 2ACKA 2HRRA 3RM3A 5JALA 4B83A 3UUFA 5HF9A 1UT6A 5AI0A 1MAAA 4ARAA 2GBCA 5EIEA 3NUZA 4U2FA 4C4XA 4QZVA 4AMZA 3FYUC 1YCDA 5AI6A 1AGYA 3S8YA 4GI1A 2HU7A 1ZICA 1WCYA 4KRYA 2Y2VA 1E89A 1DX4A 3CCBA 1M33A 1BU8A 2ZYIA 3C5VA 4H0CA 5AI8A 2ZVDA 3KDAA 2V97A 3BJRA 3AJAA 5ALMA 5K3CA 2H7CA 4FBMA 2V96A 1CPYA 2VAXA 4EB0A 2B9VA 5JYCA 1R50A 4BB0A 4BAUA 5C8VA 5JANA 3LIPA 2OQVA 3FCXA 1A8UA 2HA4A 1Y37A 4H7IA 1DT3A 4NVRA 4NS4A 4IH4A 5HFNA 2VJBA 4DNPA 5K3DA 5AH0A 2BUBA 5AK4A 1LPMA 3H2GA 3CCCA 2Z8XA 2C58A 4H7JA 3FSGA 3G02A 4UUQA 3G8YA 1GKLA 1TIBA 3ICWA 4LHEA 3AILA 2XQJA 2WU3A 1WHSA 4WDQA 2RHTA 2QOEA 2XMGA 4DM7A 1BN7A 1VLQA 5LZ7A 2Y2UA 5AI4A 2RGUA 3NWOA 2HADA 5AM0A 5A62A 2HFKA 2D5LA 3HACA 1DWQA 1VE6A 1DTEA 4P93A 3WYDA 2GZSA 4FFVA 1YS1X 5C8XA 4Y2JA 1N5RA 2PSEA 1B41A 3EF3A 1BROA 2J3DA 4LYEA 2LIPA 4KE6A 1P0QA 3ESAA 1XZHA 2B61A 4AQDA 1UFOA 3D2AA 1ETHA 3F67A 5LYYA 1RWQA 5CH3A 1YAHA 1FFCA 1QOZA 2WKWA 1KU6A 1XZIA 1J1IA 3D7RA 5A7GA 5BV7A 4OD0A 1SFRA 3I6YA 1G5FA 2Q0XA 3CN7A 1T2NA 3IURA 3R41A 5KWIA 5AOAA 1G4HA 5ALLA 1CR6A 4Y2XA 4BC1A 3WWEA 4FFWA 5AM3A 3H1BA 4BCDA 3IB3A 4EUSA 5LZ8A 4QDUA 5LZ5A 1LPNA 4QDOA 4H7FA 4HRYA 3G0DA 5LKAA 3R40A 1TCBA 1TK3A 3DL4A 2AJ8A 2DCMA 3OG9A 5CH8A 2AXEA 5AKKA 3WI7A 3ZLUA 4AO6A 3I6ZA 4B80A 1Q83A 2O7RA 5IVKA 3C6ZA 2GYWA 5JZBA 2VTVA 1BEZA 5DJ5A 3AZPA 2IITA 3WKBA 2XMRA 4CCYA 1EVQA 1R9MA 4RE5A 4K6GA 3BIWA 2ZYRA 4ETWA 1XRPA 2C7BA 2EDAA 4BAGA 2BUAA 1R1DA 4OYLA 1MX1A 1O6FA 4Q1VA 1U8EA 2OCLA 2DHDA 2AJDA 5DNWA 4BZWA 4INZA 3HLKA 4G8BA 3B5EA 1UK6A 4MYDA 4PQEA 4BYMA 2WUGA 5ALOA 3U0VA 1CIJA 2QS9A 4X6XA 3WWPA 4Q3LA 3F9CA 3AZQA 1U4NA 1UK7A 4EA6A 3F96A 1MPXA 2Z8ZA 5K3BA 4CG3A 3H18A 1GPNA 3I2IA 2ES4A 3ESDA 3WKAA 3DKKA 3SC2A 1TQHA 3QMVA 4MEBA 3ZWQA 5LZ4A 2IIVA 1CUEA 1E8MA 4W1SA 5CXXA 3VDXA 4X90A 1CUHA 5ALPA 1KEZA 3STXA 4FWBA 2GYUA 1UK9A 1GPKA 1A7UA 3IIIA 2GBIA 4CIAA 1EVEA 2AJCA 3PFBA 4KEAA 5J3JA 2JGJA 4V2IA 1HQDA 2ZYHA 5CTAA 2J3QA 1OXMA 4EY8A 1QO9A 1XRRA 1EK2A 4C4ZA 3HZOA 4AN0A 3O95A 3EQ9A 3PUIA 5LZ2A 2XE4A 1EK1A 1XZFA 3AIKA 3I2HA 4QDXA 2XQIA 5JASA 3EQ8A 4X91A 3CN9A 1JMKC 4X3CA 4MXDA 2WTNA 1MO2A 4AZ3A 2XUIA 5EFZA 2QJRA 2ZJ7A 3KOOA 5AIBA 1H2WA 5IVHA 3DYVA 3SX4A 4DTCA 5ALZA 2WTMA 4KE7A 5DWDA 3QITA 3WIOA 5AO9A 1CUYA 5K3AA 5CH5A 2PM8A 2J4FA 1AUOA 2FUKA 1HPLA 2HRQA 1CUBA 2I03A 3WKEA 3WL5A 4FKBA 1MN6A 1IZ7A 3DQZA 4KACA 2XQKA 4IH1A 2QKYA 1CRLA 3R3XA 5A7HA 1VE7A 4AO7A 3TJMA 1EDEA 4XIIA 5JATA 4FBLA 3WWCA 2B4KA 5HF5A 4W1QA 3R3WA 4OB6A 4BCBA 2DSNA 1WB4A 2BGRA 2K2QB 1EB9A 1D07A 3OPMA 5EIAA 2JEZA 4P08A 2DFPA 1G42A 2AJLI 4G4JA 4A16A 1DWPA 2RONA 3FSGD 2PU7A 4FNMA 3W05A 5CT6A 2XUFA 2XMSA 4OSEA 2G5TA 4G5XA 2D0DA 1XKLA 3F8SA 4BRSA 5KBYA 4HXFB 2HA7A 1FSSA 2I3ZA 5E4YA 5AM4A 4FHZA 2BCEA 4QA9A 1DU4A 2BFNA 1IUPA 2OLEA 5ALKA 3VJKA 5AM1A 1GT6A 3FLBA 5DYWA 1IVYA 2HA6A 1HBJA 3DDUA 3IULA 3D0KA 4UHHA 3C43A 1JMYA 5F4ZA 1ZOIA 3BIXA 5AKXA 2ORYA 1E5TA 4X7BA 2GYVA 4U2EA 2XMBA 4CCWA 5EI5A 3BF7A 4G4IA 1ODTC 3K2IA 5FDFA 1QJ4A 3RLIA 4ZRDA 5IVDA 3UMJA 2VT6A 3DKRA 1XKTA 2XQFA 4G9GA 2O2GA 3D4LA 2VAVA 5JD6A 1XQWA 3C45A 4LYDA 2H7XA 5AKZA 1AC5A 5EHNA 1J2EA 1ZGCA 2OXEA 5JD4A 2XMQA 4C87A 5JD5A 3G9XA 1YASA 1CQWA 1LPSA 5LLSA 4PSCA 1EI9A 4BDSA 2PSFA 2VA9A 4CI9A 4N8SA 4G4GA 3AFIA 1XQYA 5DLPA 5HFAA 4ZI5A 4JNCA 5HQ3B 2CKMA 4Y2TA 4X93A 3I2GA 3B3QA 3FWHA 4J0IA 5AKJA 4JEIA 5D3ZA 3GZJA 1VKHA 2Y6VA 4PSUA 2PL5A 4IH9A 4YASA 3BL8A 1VXOA 3R0VA 1CLEA 3S2ZA 4WY8A 2YASA 2PSHA 4UFOA 1UK8A 4JYMA 1FFEA 5CXUA 2WHQA 3C6XA 2WM2A 1ZI9A 1YS2X 1JJBA 1GQRA 4DSZA 4P92A 4JUIA 4DNFA 2OAEA 4B9AA 2WLSA 3O4IA 3WA6A 5SYNA 4H7EA 5HKBA 2V9ZA 3WL8A 1QGED 4K2AA 2XUDA 3F98A 2WIJA 4PO3X 4K6HA 1NX9A 3AINA 4DMKA 2QRUA 3C6YA 4Y2UA 3FYUA 5ISMA 4ITVA 1XROA 4DNOA 4WFIA 4DYHA 2H7YA 5HQ3A 1ZD2P 3E0XA 2HA2A 2PSDA 1QZ3A 1J06A 2JEYA 3FCYA 2DHEA 2GBFA 3L1IA 1UKBA 4LXGA 1ZJ5A 2WG1A 3FBWA 2XUQA 4ZGBA 1CUZA 4PNZA 1ZGBA 1GQSA 3WKCA 4AXBA 5ALQA 4FDMA 4B0OA 5A2GA 4EY5A 3WK6A 4Y9SA 3SWWA 3A2NA 4D9JA 3C6BA 3FNBA 1THGA 5I9IA 1EDDA 3E4DA 3HEAA 4OU4A 1VXRA 1YR2A 3BE8A 2H1IA 5CT4A 5T4FA 1JU3A 4ZV7A 1SC9A 3QH4A 4KAJA 4BVLA 1VA5A 4ZXFA 3W04A 4BRZA 3TRDA 2GBGA 2PU5A 3U1TA 2WUDA 2OAGA 4N5IX 1VA4A 4G8DA 5E4TA 1N8SA 3C70A 3RK4A 3STVA 3EIOA 1X2EA 4G1FA 3O9VA 1VZ2A 4H7DA 5DNUA 3WIBA 1W76A 2PX6A 4W63A 4KYVA 1CV2A 1WOMA 2ACEA 4B7ZA 4G9EA 2XMCA 2QVBA 3WQHA 1XZEA 1EB8A 2C5GA 4FLMA 2DQZA 3QPDA 1BRTA 3HJUA 1SCQA 2B20A 4AZ0A 2RAUA 1DWOA 3QVMA 3W9UA 2WUEA 2VJAA 1EA5A 1TKRA 2PPLA 1SCKA 2H9YA 4QEKA 2PBLA 1X2BA 5JARA 4ZWNA 2WJ6A 1MU0A 4HTAA 4Y2VA 1G66A 1HDEA 3ZV7A 4U2GA 1W1IA 3WA7A 3O0DA 1XQVA 3D5EA 5H3HA 4E46A 4PW0A 3DNMA 1W4LA 4UFPA 5EIHA 2OGZA 2IX9A 3HYSA 1ZIXA 3H2HA 5C81A 4W1PA 3M82A 4EY6A 5D3KA 4BVJA 2E3JA 1BN6A 3H17A 1XZDA 4C01A 3D2BA 5AKLA 5HCUA 4X00A 3VXKA 4QE3A 5CT9A 3R3ZA 4UFNA 1MX5A 4UBJA 2C0PA 1Q0ZA 2QXUA 5AHXA 3WMRA 3VJMA 1L7AA 2O7VA 4YPVA 4Q3OA 1A8SA 1PV1A 3OOSA 1XRLA 5AI9A 4J7AA 1UXOA 3QMWA 5ALVA 1Z68A 1CEXA 1CUUA 1J07A 3G9TA 4H18A 4BDTA 4CFSA 4DLNA 3MUOA 3WKDA 2OCIA 3IUJA 4Y7DA 5CRIA 4DMCA 3CXUA 4X85A 4Y2QA 4UHBA 4FNGA 2EDCA 1XRQA 4F0JA 4U2BA 3OTQA 1WB6A 7YASA 4AB1A 3DL7A 4BTLA 5AK3A 1KU0A 1XLWA 4J3JA 3DD5A 3ZI7A 3M83A 3G0GA 1QIIA 3ESCA 1H2XA 2EEPA 5A7FA 3I2JA 2VATA 4S0XA 2RIPA 3O4JA 5HF8A 2P8SA 3A6ZA 3GBSA 1YB6A 1QONA 5IVIA 2WHPA 4RE6A 3I1IA 3RKSA 2VF2A 5FLKA 4J0JA 4PSDA 4J0DA 3DYIA 4K6KA 1ZD5A 3A70A 4DMFA 1DQYA 1CVLA 1CUCA
chains in the Genus database with same CATH superfamily
4EYEA 1Z5GA 2UDPA 3H19A 5IAOA 1ODJA 2F1JA 2ZT8A 5ALRA 2O2DA 3RUAA 1YWGO 2ZJFA 5DX8A 2AKAB 2QTVB 2G1KA 1VGVA 3D0RA 2WR8A 3GRKA 4CMAA 3PXGA 3ND7A 2Y1WA 3EHDA 3PX2A 3ZE2B 2ZE5A 3T6KA 4O0LA 2AW3A 3T8YA 4BP8A 3L4BC 3HTXA 1VIMA 2QTAA 1XI2A 1ZJ4A 2IY8A 2ZPTX 3F7TA 2ZIVB 3U4CA 2BBOA 4AZ0B 1U2PA 4BB9A 2JNWA 4HWGA 5AQ1A 2D06A 1DO8A 1PF7E 2A58A 2Q9AA 4IHAA 4QQ8A 4TYMA 1C30B 2V65A 3MZ0A 3OO0A 1GEEA 3OZIA 4C05A 1E79A 2MSEB 2VBIA 4FSXA 2P67A 3KLPX 1N5JA 5ALIA 4J91A 3EC7A 1QTIA 2AOVA 5CB8A 1PFUA 2XKJE 2HHCA 3PGKA 1PT8A 3QFFA 3SS9X 1PUIA 1XVLA 3OKFA 2DPGA 2Y1GA 3TYXA 3N0XA 3U7QB 1FW8A 1LBSA 5LA6F 1ZHHA 3AF6A 2VYND 3IDSA 3LP5A 3GH1A 4G84A 1HE8B 3PZRA 5K1ZA 3HY3A 4QXPA 4V0NA 2HIGA 3KVYA 2FSSA 5EL0A 4B31A 3JQFA 2QTCA 4L0CA 3QG5A 1TGYA 3WTBA 1Z08A 1WKVA 4KQ9A 2B8NA 3NC1C 2FPMA 4NFLA 1DJQA 3ETDA 5ALYA 1NQWA 2KHZA 2HBQA 1DZ3A 1WTAA 3JALA 4W7HA 3P9ZA 1BA2A 3UK7A 3OP1A 3WZ2A 1CY4A 2Z1NA 3CW2A 1CQIB 3K0KA 3SZMA 3QWHA 2CFIA 3KSZO 4EUKA 5K0GA 4BP3A 1P2DA 5A9RA 4YAEA 3VO8A 5EHXA 1U0JA 1RNLA 1FTNA 5K2OA 5HIAA 3H3XA 3H5AA 1SVUA 4LRYA 4DS3A 3IVGA 1HQKA 2CXUA 4X0EA 1C81A 3QY9A 5AVUA 1DOZA 2VC2B 4CG1A 8GPBA 1C30A 4GUDA 2P0EA 4XR4A 3EMVA 1MNQA 1GZ5A 3TO5A 1E6CA 1GYQA 3Q7RA 1OLSB 4BIMA 4D41A 1OA0A 3JZDA 3N2ZB 1VE3A 1I94B 1T91A 1U8CB 2JKYA 3AVPA 3CPJB 1L5OA 3OSZA 3TM5A 4OQ4A 1RE1A 1DI0A 3VVBA 1FDVA 4YGYA 1KOFA 3NIBA 1LF5A 3VR3A 2J5BA 2XUOA 2VK4A 1BD3A 4GPBA 3VGPA 2DRIA 1TYAE 3F5DA 3EGXB 3EXHB 3H5NA 2JGMA 2D5AA 4M7RA 1PL7A 4MJ3A 3U09A 3QI7A 3KE8A 4OQZA 1CY8A 1P5HA 3U6BA 1UZLA 3ORQA 2NSLA 3HQ4O 4MQMA 4C4AA 2E5WA 5EHZA 3M4ZA 3QVTA 3FLEA 2C54A 4IZOA 5JZSA 5A6SB 1SOVA 1REQB 2B35A 1C7ZA 3W2HA 2D1TA 2CE7A 3EK2A 3NIGB 3UHPA 5LUAA 1H1DA 4A0SA 3KKLA 4DXAA 4JB8A 2OG1A 4ARCA 1WMFA 2XJ4A 4I9FA 4GYWA 4K9PA 3WIEA 2DT5A 2BLLA 4FQ7A 3MYRA 1SG0A 2HIMA 1KZ4A 1FXWF 5G4LA 5DNVA 4ZKEA 4MRRA 5EVJA 3WNQA 4AC9A 1TO1E 2KB0A 1MR3F 2LIVA 2WAAA 5IFLA 3THWA 2Z6AA 4RTRA 3HC7A 2RH4A 1YDFA 4O2BB 1TZBA 4B0PA 2AC7A 5DHTA 3N8HA 4DA9A 4OREX 3QSGA 2AZMA 2GD2A 4KVFA 3DAYA 4M87A 2XRMA 4X61A 5IWAB 2FQWA 1Z22A 1C4OA 1BWPA 3RYCB 3IA2A 5FI1B 2JPDA 3HR7A 2GD1O 2DERA 1G55A 1RZUA 4LPSA 4F6LA 4G3XA 3WBJA 1WXWA 3N05A 2NSDA 4BMSA 3EH1A 1H94A 6ADHA 1WXXA 3IUQA 1EESA 2H4WA 2R2GA 1KI7A 1X8KA 4U63A 3Q5GA 3ESBA 4UUBA 2JHCA 3GMDA 3QLUC 4RL6A 1B14A 3CSSA 1C5KA 4DG5A 1N1DA 2E4AA 4KMRA 3GFSA 3HP7A 2D3TA 3S1AB 4F3NA 5K8IA 2NP7A 1S0UA 4UDNA 3LPDA 3FTPA 2P9HA 4G09A 2NU9B 1XCJA 3O7MA 2RBKA 2WZCA 1YONA 1TF5A 3Q2KA 4YLGA 3RAJA 1SBCA 2D2EA 4OLFA 1CZKA 3C1OA 4LQLA 3FKSD 3NGLA 3FSRA 4FLEA 1PO7A 1GCAA 5EQFA 1B3RA 1PWYE 3UY4A 2ZJ5A 1CQPA 4JQCA 4R0MA 1Y5LA 5KREA 2O5VA 4CKBB 1NUSA 1ZNXA 1HYGA 4K6CA 1S8OA 1QXSA 4GQAA 1MRNA 4R8MA 2G63A 3I9NA 3KT6A 3NHLA 3PFNA 5IAJA 3W4IA 4DA8A 4Z1OA 4MQFA 4C5BA 1BMTA 4IXWA 1AGRA 2PQ6A 3R3JA 5AR1A 4DJ5X 4LEIA 2O8BB 1T9DA 3VSEA 1EXMA 3C7AA 3EJ6A 3VM6A 4HC4A 5CJ2A 3TZCA 5FPQA 4C0XA 2JFVA 5ECDA 2H1HA 4PG4A 1XDDA 1U3VA 1OVGA 1ABFA 3WL7A 1DMSA 2Z2KA 2FRXA 3KS9A 5H0IA 4F72A 2IQ5A 2V6MA 4WCFA 4ZYUA 3GXOA 4EATA 4LGMA 1BS2A 1SXJC 1JDSA 1ZUWA 1Z9BA 2O48X 4M0MA 3ZYCA 4DMLA 4L08A 3RSSA 2A6PA 2W71A 1R4ZA 4ZTZB 4I66A 4I55A 1PHPA 4XUGB 4BP9A 1U0HC 1GSAA 1UDWA 3JAWA 3I3OA 3G0BA 1KSFX 1OKKA 3ZJUA 1H2ZA 2B8JA 2WY2D 4DSAA 4OMUA 1H42A 2PPVA 1M6YA 1SUEA 4J2OA 1U8ZA 3EPLA 1NONA 2WABA 4QJ3A 3D43A 3W9SA 2CK3A 2Y1EA 3WZLA 1L7EA 4US0R 4M1QA 4OXIA 5IW8A 2QU7A 5D00A 4QBFA 2IIPA 3E3MA 2RC6A 2A9KA 2V7EA 4AG6A 5MN6A 1I8TA 1TRHA 4CE6A 5DNYB 1RXUA 3DS8A 1OWPA 3UFXB 4RIHA 2I99A 3I6BA 3AKYA 3LQFA 4NV0A 2PD6A 4HAVA 1OGIA 3WAKA 5GONF 3STTA 4DPMA 1I3OA 3KJNA 5F2KA 4NQRA 1S1CA 1SG6A 4E11A 1ILWA 1CG6A 4IHQA 4L07A 1L1FA 1I4EB 1UOPA 3CZ9A 5EXEA 4R1QA 1F2DA 1KO8A 5GGYA 1G63A 2ZJ4A 2HWXA 1MABB 3OAAD 3QBDA 4I08A 4PYRA 2H3HA 5KSYA 3FNRA 4AJHA 1MRZA 1RYYA 3OE1A 4JH0A 4JY7A 4EB8A 3IT3A 2J8ZA 2O9JA 3UPDA 2LCIA 4D0NA 2VPTA 1JIJA 1TAHA 3OZAA 3OBIA 3H9BA 1IXYA 3DDSA 4OHWA 5EQDA 3DZJA 1P5JA 1GFIA 3OFSA 2R1VA 2FOIA 3MW8A 5DHQA 3TNFA 4FEEA 4OHUA 5G4KB 1E1KA 3TTWA 1Z07A 1IWPB 5IJ0A 4J0CA 4BEWA 3D59A 4M9SA 4PCUA 4UHDA 1EP2B 3TLGA 4C0SA 3DTVA 1XCBA 1E6MA 3UUGA 1NGSA 1NW4A 4H08A 2B34A 3IMFA 2DMRA 3RVKA 3WLRA 4BAZA 1C7JA 4MPPA 4PO9A 3VHRA 3W9BA 1PK8A 3KOMA 1O5IA 4J0QA 2PL9A 5G0VA 4EY3A 5DLQC 1ZU4A 1GXSB 3H2IA 3EXEB 5EWLA 4Z3KA 2HV8A 4OTZA 5JRJA 1FU4A 1DV2A 2AVNA 1GG2A 1JH9A 2GEDA 1RJDA 1VJ5A 2IYUA 3SNHA 3R7AA 1Z4IA 1CEEA 7GPBA 5JHHB 3U3OA 2R6AA 2I0FA 4ADSG 5A4DA 1MHPA 2CNWA 3ACDA 3NOXA 4NR0A 2NO7A 4R1PA 5JAHA 4TQAA 2GEVA 2O8CA 4ZFNA 3ND8A 3VU8A 1IHOA 3U9TA 4XQCA 5KSOA 3OFVA 3OMLA 5ICMA 3JYHA 3THXA 3T3HA 4AMVA 1TZKA 2R6ZA 3O0TA 3F7NA 3ZWDA 1RYDA 1ULTA 3G8DA 3PEUA 3PJRA 5KU1A 4G81A 3QA9A 1TPZA 4ZO8A 3BXOA 4P3PA 1FQKA 2EL7A 5ALJA 2HJSA 3PWZA 1G6Q1 5DSTA 1WDTA 1YSCA 3NJRA 5T8KC 4JJIA 6AT1A 1NV9A 2YNMD 3KWJA 5JC8A 2Q1WA 1K98A 3IO5A 5TJ9A 3DTVB 1JAYA 1CD5A 4GGMX 1MIHA 4FI3C 4LFBB 4UULA 4GMGA 5EYPA 4KREA 3C8DA 3L0YA 4BMOB 4RQAA 3LOPA 3IXQA 1JVNA 5DI3A 4DIEA 3A8TA 1XZMA 3HB1A 4JT4A 2HQBA 4OCZA 5ALTA 1WU8A 3GFTA 4QOFA 4CTMA 3NM5A 2A9JA 2F2TA 5AXBA 4NE9A 4ABYA 3U80A 3O4VA 2DR2A 2Q2OA 2P1ZA 4Y7CA 3IHLA 1U2TA 2WYUA 1KHTA 3AR6A 1BYIA 2BI4A 2G80A 1L6RA 1T2CA 3DPIA 4FFBA 1RQXA 4K9MA 4XH9B 2XRZA 1QP8A 2O2ZA 1ULSA 5ALUA 4DE5A 3U9SA 3JQEA 4GGPA 1MQ9A 2FPLA 1UWKA 1SKUA 2NXWA 1SC1A 3MWDB 2J0UA 3WYCA 4J16A 1YIOA 1LPPA 5JLJA 3AMVA 1FBNA 1GTRA 3CE6A 4JP1A 3RW9A 3TXYA 3QPWA 5KNDH 1E0AA 1DC5A 1W6RA 3DW3X 3P0RA 1AKEA 5BOVA 1NWCA 2F3TA 4Q3BA 3CWZA 2CVFA 5DBOA 5HR5A 4ZZ2A 1ISIA 3Q11A 2NGRA 5AWFC 5A9TA 2XSZA 5JDCA 1XZPA 4MVXA 1YR3A 1SU8A 4X63A 1M0SA 3P4YA 3MMSA 2QB5A 3S81A 2B1GA 1RHUA 5JW6A 1E3JA 3BK1A 3E3AA 1ACLA 1IK6A 1BS9A 2X58A 1CERA 1XOIA 2M1XA 3BXGA 4RYLA 4BCCA 2XAUA 5DYYA 4EA8A 3I4FA 4X71A 1A50B 1ZI8A 2V8OA 1QGYA 1KFBB 1Y6RA 3PXXA 4RPLA 4M7PA 5EZYB 3MBKA 2QRZA 3GHYA 4OGGA 1QLHA 2VBCA 5TQVA 2ENUA 4DN6A 2REQA 4M49A 4PG7A 4YYEA 2GTPA 4GNKA 1EZ4A 1WL8A 4DF3A 4F1JA 1HNXB 1MEEA 4CRWB 4H60A 3OQOA 1SVNA 3DOHA 3I1YA 3UG6A 4IHJF 2ZSEA 1UAAA 4DT1A 5DTEA 4KXLA 3C16C 4FOLA 4CCSA 2QEQA 3PHHA 2QMOA 1UAGA 3HCFA 4HQNA 1ECGA 3R23A 1W47A 1XTBA 2IOFK 1EE2A 2R6FA 2Y1KA 3A4VA 3PD0A 3AFHA 4EHIA 1Q0RA 2X5XA 2AN4A 3FLMA 4MB6A 2XF2A 1GG5A 4UNIA 3IKVA 1DG9A 3CZCA 3K5HA 3G85A 1CHNA 1KI6A 1Z29A 2HY7A 2PZFA 3OZDA 4LXHA 4PLVA 4TTQA 4TLLB 3V1MA 2YMQA 4JHLA 4PHHA 5FWXB 2XKKA 4LBYA 2WF7A 2Z2YA 1MJ5A 3MRTA 4HNVA 3JASB 1DBVO 7REQA 3UKOA 1WLSA 2KS6A 4MS1B 5JFTA 3V55A 3HRIA 5T4HA 7ABPA 2XB6A 3LY9A 4XSGA 2RAFA 1TEVA 4E0BA 3KUDA 3IUNA 1X1SA 5K8JB 5LVAA 1LJ8A 4OKIA 3P45A 2QQ5A 4G01B 2V5AA 3GT0A 4C89A 2QQGA 4ERXA 5KX5B 3BQ9A 1JQ3A 3A0RB 3PYMA 3ENVA 2VUIB 1U99A 1WD5A 2WF5A 3UENA 2AZDA 3DV0A 3QK7A 4X1YB 2WSBA 1U7WA 2A1IA 3WAJA 1Q22A 2O2HA 5G0UA 3H1AA 1HKHA 2AQKA 1LXCA 2BTOA 4IF4A 4XIJA 2YXDA 1W2HA 2VT2A 3KXLA 5D7BA 3RQSA 1Q6ZA 5B7QA 4Z99A 4F9FA 3ZHCA 1XRNA 1LPBB 1MO3A 2BTQB 1HT3A 2NYUA 4Q82A 1Q57A 5CT8A 2CV1A 1E6UA 1WQ1R 2PKQO 4MP3A 1BXKA 1K8XB 1U4SA 1YE8A 4RY8A 2BOVA 3QYFA 4LNUA 4YX9A 2EGUA 3AH8A 1IE3A 2EW1A 3TEJA 4ZAGA 3C7DB 4TS3A 1U3WA 3C14C 5ALFA 4D3YA 1EDBA 4MLZA 1CIVA 5I8PA 3UBTA 2ZJOA 3EAGA 5KWJA 4QBKA 4A0FA 5DU2A 4F04A 3EVCA 4G1EB 1V71A 4OLBA 3CEJA 2OZKA 3G89A 1LDBA 4CL3A 5AKIA 3KEMA 4M9RA 4RKQA 2ETXA 3ORHA 1KYXA 2JGAA 2XT0A 3L7MA 1F4VA 4RESA 4YAJA 1C0LA 5EJ5A 4DDMA 5EXXA 4KYUA 4U2DA 2YTZA 3P52A 3WDKA 2EERA 1ZVMA 5AOCA 4ZD6A 1GLGA 4IDEA 3QGMA 3WLNA 1BEEA 1L4KA 4DR1B 1OAKA 3KKKA 1ZA1A 3SD7A 3EXG2 2JHFA 1FTGA 3ZY3A 4J4BA 4HPJB 4DR4B 4MEJA 4D81A 1P33A 3NS7A 3ONVA 4YRNA 4AULA 1DXOA 2GBPA 1HETA 1U9CA 1YS4A 3ET4A 3EWIA 4E4TA 1ORIA 1KJWA 1MVOA 4H6PA 4K28A 1JWAB 4MWGA 4GQIA 3E18A 3KPUA 1TEZA 1XJCA 3FLAA 4G4SO 5ALSA 4HF7A 4TZ0A 5NULA 5GQSA 3MSCA 2J9GA 2VZ8A 5HZKA 2E0IA 1C4XA 3A6DA 3GVIA 4NICA 5HFJA 4B9EA 3WGIA 1WX1A 2PK3A 4DJDC 4YCCA 3LW7A 3JRXA 3RV4A 2GAJA 4MUHA 3N7UA 2GZRA 4F3YA 3IIEA 4JCCA 5BPFA 3QXSA 5JIBA 1JXOA 3K0CC 4EBFA 4D9IA 2XDQA 3KTDA 1ZWKA 3HEMA 5F64A 1PFWA 4IO1A 1OZAA 4M53A 4CTKA 3DAOA 1T1GA 1EFRD 4TV9B 1NDQA 1R74A 2GA9A 4YXWD 1T9HA 3S40A 2IHZA 1NUHA 4LZZA 4BLQA 4BS9A 3AJRA 4D7AA 2NTVA 3OEEA 2V3VA 3RPEA 2RD2A 3A4YA 4U2CA 1W0JD 4R8RA 1SQ6A 3GLRA 4B75A 4CM4B 2FN9A 5BXQC 2FWBA 5JPDA 1EDZA 5AOBA 1HNWB 3L5KA 3D3NA 3KZVA 1YVEI 1JKFA 2RH8A 3ZVKA 1UDBA 1OHHA 1O54A 2VSNA 1NJ6A 4Q03A 4Y0AA 1OYOA 3OOJA 3TZBA 3VYTB 1LPOA 4IKEA 3ZZNA 4JR2A 2AOTB 4JVMA 4AROA 4KPUB 2KSQA 1ZM4A 3CNOA 3Q98A 5I7UA 1I3LA 4YMGA 3QNMA 4HEA1 2FEKA 1BDMA 2V1XA 4KNWA 1NKTA 1ZMOA 3QHPA 2DFVA 1G5HA 1J25A 2NYVA 3KK0A 3GA0A 3RTAA 1U3GA 2R5FA 3TRHA 4H59A 5CVCA 1IONA 3GLQA 1TM5E 3CEPB 1SUIA 2G70A 4N4AA 4HMPA 4QNNA 3C4VA 4QREA 2VNKA 3W6UA 2BHTA 1T5LA 1WQ4A 4CGZA 4ENWA 2I80A 3PDIA 3AEKA 4N6GA 2CXPA 4WDRA 5DLDA 4M8LA 1L7PA 4RDIA 5EE3A 3TTYA 4MJXA 2ZJ6A 1RHMA 3K9NA 3AUSA 8OHMA 6YASA 4OHRA 2K87A 5C8ZA 3VC7A 1ZN9A 2VH1A 3ZNNA 2BBSA 2QLMA 3ZDEA 4FN5A 4B79A 5J47A 4IYJA 3EEFA 3MWJA 3TXAA 3ZIUA 3W7VA 3ZDAA 1ESMA 3AETB 4KBYA 1AZTA 4YRZA 2ZZNA 2ORVA 4IXMA 1GLVA 3ASZA 2BH2A 3VQTA 3EVNA 3NOOA 1GQ2A 4TLDA 5ALHA 5IJAA 4GRIA 1EVZA 4HDNB 4BQFA 3BFXA 3ZHZA 3DKVA 1C29B 3KD3A 3FCUB 4E32A 1N3YA 1Y8AA 5JXHA 1ND5A 3LHFA 2XCSB 2B4QA 3K5IA 2CF5A 3DO5A 3PSHA 5FTJA 3W8RA 1KFEB 1V9CA 2RGNC 3A1NA 4P1ZA 2G76A 4G8JA 4MQFB 4JELA 1C9JA 3BFJA 3F8TA 1OXVA 1TYZA 1TTQB 3ZWXA 4GSYA 2XHZA 3DFUA 2H08A 1V39A 2Z4TA 3NASA 2NAFA 3K0FB 3GRPA 3TBHA 3LXMA 4AJEA 3EGWA 3KHSA 3I32A 4RPIA 4DEYA 1PWXA 3I72A 2SKDA 4JDUA 4B3MB 5AM5A 3UOGA 3PUVA 4HNHA 2BL4A 1E1YA 3NCHA 5TVKA 1MAVA 3OU2A 2WKRA 2FW7A 3AY3A 1ACJA 3PL1A 4B4DA 3FGNA 5E4JA 3K0SA 2B3DA 3F6PA 5DRTA 4HFMA 5TEWA 3ANNA 1H4QA 3OUUA 2CV2A 5KJEA 1KSHA 4EI9A 1CDDA 1NJFA 1NC1A 1S2NA 2APJA 1UBEA 4BLOA 2H2FA 4YRKA 4ZOQI 3DE6X 3WYFA 1B6RA 1E0SA 2COKA 2G83A 2HU5A 4O25A 2QAGA 3HRHA 4P5EA 2AX4A 2Q6LA 4ZOLF 1GGNA 4BGIA 2FN4A 5AHRA 1AS2A 3OCZA 3G59A 4FE7A 4ZRMA 4Q7QA 4TTTS 2DQKA 5DSXA 2ZEJA 3LK6A 1CYEA 3SAJA 1W44A 3SVTA 5AJHA 3M6MD 4WA7A 3HUDA 1AMNA 1QHXA 4YJKA 2BFPA 4IFTA 3ASUA 5IFKA 3F5FA 4ZPXA 1C9NA 1Z0DA 1ZVQA 1E66A 3LTEA 3ZDZB 1QRDA 2NU9A 3JVEA 3KRTA 3QF4A 2QTFA 4PPYA 2X5JO 2JKZA 2ZTVA 4WA8A 1DCFA 1KNQA 4NOKA 1TJNA 2H9AA 2GPSA 2WAXA 2YMLA 2ZU0C 3I30X 4HAUA 2Y92A 1B0ZA 1DG3A 4YAIA 2NXNA 2B7BA 1GCIA 1NVUQ 1OI3A 1JVSA 5JNTA 1L5QA 1T0JB 3EHEA 4BMPB 1JQBA 1PJ2A 1W4ZA 4MDEA 3OEHD 5E2BA 1XO1A 4X24A 1WW3A 3T5GA 5CB6A 1M73E 1UEIA 3Q10A 4GL2A 5D5PA 5B3AA 2ZBRA 1T1JA 2VDWB 5D1HA 5ELXA 2FX5A 3HJNA 3PE3A 2C8JA 1JQ5A 1U7XA 2QTWB 4MMXB 1EUQA 4HCJA 5L3QB 1VGRA 5AKGA 5IT4A 2BE7A 1G2IA 3FYUB 4GOOD 3U3XA 2OL4A 3TIIA 2X40A 4PY2A 3GEGA 1QK5A 2Y1FA 4HX5A 1KFKB 4J1TA 1NU8A 4JC4A 5EZQA 5ES4B 3LQYA 2ZYWX 5IN4A 1VIDA 2BSQA 4JI1B 2VXOA 1XFAA 2VBFA 3OCVA 2F43B 2H4JA 4WY2A 1SUSA 3K1JA 3SMVA 3JW8A 2NVOA 2J45A 1RHJA 1KYIA 4KIJA 4KN6A 4TGLA 3VKWA 2CXRA 1N0IA 5C8YB 4UU1A 2VR1A 3L7IA 3L7BA 5I9BA 4C7XA 4DSTA 1QIFA 2VUUA 2RJNA 5E8JA 1UPXA 4F92B 2XGMA 3WLJA 3C3AA 4UOEA 1E8DA 2A9FA 3SEFA 1XFDA 3QJ5A 4UASA 3IAFA 3ZWOA 2GWRA 4HGZA 3BSFA 3V8VA 4WE3A 4BBPA 3SLKA 3ZW8A 3H6GA 2H8KA 1LSUA 2BD0A 2ZT7A 2VCEA 5JCJA 1ZVVA 4MNTA 1U3TA 2GDJA 3KTFA 4NARA 3V8NA 4X95A 4R8SA 2JGFA 4UJ3A 5EFOA 1EG7A 1XIVA 5T4EA 2ZVPX 3HXMA 1YZGA 1WABA 4II7A 4W9NA 3QV1A 1PZGA 2VHTA 5FWDA 3ONWA 1PKEA 2V6BA 2O0KA 2HIAA 1BCRB 2X86A 2ZATA 4IRUB 4CF3A 5BOSB 1KVRA 2D0OB 2IA5A 2JK1A 3RU9A 1KDTA 2R8EA 3JALB 4EQ6A 5LIPA 5JCOC 2FMTA 3FA2A 5K3EA 1B15A 1I4OA 2LVBA 4I4TB 1AKNA 2G82A 5I3CA 1XA0A 1GRCA 5JSZA 1YQQA 1E59A 4M88A 1I2MA 1XZBA 3QP9A 4TZKA 4KMOA 4Z49A 2PE5A 3KOUA 1K8QA 4KQIA 4LY0A 1FDWA 2WQ7A 3ZCVA 4ZT2A 3UMFA 1OF1A 3L1UA 4FZVA 4Q66C 4UBKA 2ZTMA 3L0PA 3DEAA 4H27A 3RSCA 1F6WA 3SVZA 5DOZA 1XK7A 4EUHA 4LVCA 3P2MA 1CUSA 1ZSYA 1GUYA 4DLKA 1G2QA 5T67A 4ARBA 1GNLA 4US2R 2FWNA 2ACWA 3DGFC 3G0CA 2A5LA 3H8SA 1T5IA 5B58C 3LD9A 1CZLA 3T5MA 4CDNA 1M8FA 3DHYA 2I55A 1UCFA 4RTJA 2PLWA 4I1UA 2VVTA 1RKBA 3PRHA 2R65A 2BM9A 2H2GA 1WF3A 2Z9BA 4URHA 2B6NA 1FTQA 4BIIA 4Q3DA 1FDOA 5HOQA 3U1BA 4Z0PA 4LECA 2R47A 2OM6A 2WWRA 2VDUE 1B42A 1FFWA 4TQUS 4BZZA 3IA7A 2PUDA 3WHKA 3NGMA 2IYVA 3WK7A 4BX2A 3T35A 2GCGA 3KQLA 4GF5A 1IUOA 4L0QA 1WHTB 2RGDA 5MHTA 3MUNA 3PI6A 1C9KA 4GZ6A 4TPKA 1U28C 2GJ8A 2QM3A 2ZS8A 2CK3D 1VSUA 4LOKA 4EX6A 5EEHA 3ERCA 1DE0A 3BQNB 1UMKA 3EUEA 3TSWA 3VUEA 1FQOA 4ZYTA 4DTIA 5A4FS 2HCTA 3OQVA 4O59O 2VJCA 4Q7EA 2O05A 3PE6A 1FK8A 1U2DC 4ZAZA 4I81A 1QIJA 3L0IB 4YRSA 5HPYB 4X44A 3L6BA 2EFEB 3EIUA 3HCOA 1AB5A 2W2KA 4AMYA 4CG2A 3V32A 4N48A 1CY2A 5KQLA 1EPUA 1S2MA 1GT91 2CSUA 1KY5A 2PDAA 1KR5A 4FGZA 3LYAA 1E2QA 4IIJA 1IM8A 1UFKA 3K15A 4FC7A 4LUCA 5IX8A 3GLFA 3TQRA 3DDWA 5KIAA 2I4IA 3O4HA 4D9FA 5L3ZA 2AQIA 2PVSA 4H7KA 1Y1RA 5COAA 5K05A 3B1JA 4MUMA 2GVNA 5BWBA 1ZD4A 1CUFA 5AKYA 4CEIB 3QI2A 1C4WA 3C3DA 5B58T 3THYB 2P77A 2PUTA 3B5IA 1OFUA 1DAOA 2HA0A 4B3XA 3ZLBA 3BMCB 5TEVA 3BBPA 3TAXA 2JVKA 2OGSA 1Z38A 2P91A 3NDIA 4IJQA 5LZ9A 1ZUHA 2ZPAA 3FKQA 2I3GA 3BXHA 3HB9A 2XUGA 3Q1KA 3UN1A 4PHFA 1ECPA 3QKIA 4M1OA 2FRVA 2PR2A 121PA 1FFAA 3LZDA 3SIWA 4ZI3A 5D86A 5EJ8A 4GXQA 4DHWA 3T3OA 1OU4A 4ID9A 5DE3A 3RRBA 4ZTUB 1Q11A 1GXSA 4G0XA 2ZOSA 2G9VA 3DP7A 4I7EA 2OXTA 4YT2A 1W9MA 1M1YE 1U9JA 1UL1X 3P0IA 4DLSA 3RGWS 3QUCA 5G1OA 3U17A 3UCEA 2WG2A 3GJ7A 3NANA 4P3KA 2UYOA 3IGFA 3SOPA 4AJ2A 2WIBA 1PQYA 2C4UA 4LS3A 4ZTBA 3SC6A 5DI3B 3K6KA 2O06A 2YXPX 2ZB4A 1WB9A 3FAKA 4BFLA 5B6JA 2OC4A 3KXPA 5JHGB 4V1CI 4L73A 4F2PA 2QQEA 1Y8CA 3FSJX 1BXRA 3CUVA 5CK4A 3FOCA 3KEOA 1O89A 1NF3A 2DPLA 3TUZC 4IQ0A 1KAEA 1YDEA 2XBUA 1X8LA 3RUCA 1ZIPA 4OQXA 3OE4A 1ETUA 1RM4A 1WTCA 3S68A 4LZNA 4BO1A 1VL0A 3ASVA 1E2EA 3CUEF 3G8CA 5TARA 2WHEA 5KDLA 1ZN8A 1T9ZA 4I1PA 1ZSVA 4MWTA 1B6SA 2PJZA 1ZOLA 2BIFA 3F7MA 3FIUA 4HH3C 2VFAA 5DXAA 5BV8A 1LF0A 3ELDA 1YJ5A 3F6RA 2AT1A 3H11B 2JLCA 4CJXA 3DZCA 3ANXA 1T8SA 2ZITA 2XKBA 1M34B 1OYYA 2DX7A 4IFBA 4QGAA 4ML3A 1T9KA 3GZTB 4OA5A 3OQHA 3LVRE 1FTSA 5ALEA 2DBRA 2QN8A 4GGOA 4AICA 1KK1A 1G8GA 3Q7QA 1T24A 4MWSA 5E8RA 3ZE8A 5A0FA 1BE0A 1UWCA 3MT8A 4PINA 4CIDA 1P4HA 1KNXA 3P0EA 4G41A 4GXNA 4J9VA 4TRJA 4EG0A 4RYDA 2AA3A 1RLIA 4GC9A 5CA0A 1LGYA 2IHTA 1U5BB 4KO3S 3R7WB 3LYLA 4LG1A 4B3TB 3ICVA 1QCZA 4MCAA 4R6XA 4D42A 3SE0A 4J1SA 2HPHA 4JEUA 5AK5A 2VHXA 1RZRD 3IOYA 1GGMA 4NATA 9ATCA 2JJMA 4F4UA 4PG5A 2P6PA 2RK4A 1AXRA 1NNI1 3S0JA 5CA1B 4R2KA 3IE1A 2GCOB 3KFLA 5BSKA 1IULA 2VHWA 2RHOA 3HGTA 1K3FA 1JS1X 2ZRQA 1I2ZA 1QE3A 3F3YA 2QNBA 1CR4A 4PZ0A 2NX2A 5HK8A 3RTGA 1SK9A 1R6XA 1X7XA 2HHLA 3WMGA 1COWA 1KO1A 1J0XO 2JEOA 3PQ7A 3T1NA 5EZ5A 1PEKE 2CJPA 3M9WA 3KTOA 2WD7A 3LUPA 2A9OA 1CUJA 1SCUA 4UTRA 2JFUA 3NWJA 1YDGA 2B78A 2UYGA 2ONCA 2F9LA 2QHXA 2EBWA 1IQPA 1HFJA 1G98A 4XX0A 1B0UA 5KYGA 1KC3A 3BFKA 1NNLA 2OHVA 3FN4A 2OO3A 3EQ7A 2C00A 3A27A 5E7IA 1QP7A 3SK0A 1Y6FA 4CT4B 2FW8A 1BFUA 2ZTUA 3NWPA 3VPSA 1IVSA 5THKA 3W77A 4ZVMA 1GPLA 1JG1A 3HKBB 4H35A 5KVSA 4FZJA 1JIUA 1Z73A 3A3KA 2JLAA 5T4BA 1IFXA 3H9JA 4BO4A 2ZUTA 1CRPA 3KJXA 1I80A 3IALA 2UXDB 4QRIA 1KS2A 3FSEA 4CQJA 4KIUA 3GNSA 4E33A 1DAPA 1S7GA 2E37A 2JGIA 3FVTA 3ROZA 3FZYA 3GNLA 3IKTA 4BO5A 1UBFA 2PZEA 1Z6AA 2C7RA 2BN4A 4R0VA 4TVKA 4CETA 1F06A 5E1BA 3KQSA 3JD3A 3AERA 3D6NB 2PX0A 3KE9A 1TCVA 1JEAA 4TYPA 5FI0B 1O6GA 3BCHA 1X42A 2GCNA 3AR4A 3KVRA 4V0SA 4JU9A 1E9VA 3MIIA 4B5LA 3D81A 3M5PA 1EXWA 2FJ0A 2GARA 4COOA 1K63A 2D74A 3IE2A 3V8EA 4OP2A 3QKWA 3VPCA 4D4HA 4IUBS 3EZ9A 4H4CA 4L4SA 3EUFA 5HF9A 1U0LA 4G89A 1QH8A 2OCDA 1RABA 1IRIA 3MINA 4ZZ3A 1E99A 1XMIA 1JKJB 3AHHA 3ZDYB 3GIWA 4K6FA 3ZK8A 4QU8A 1NG9A 2A57A 5L3QA 1VCHA 2ZR8A 4MRAA 1ECLA 3U13A 4DAEA 1IPHA 4GWGA 3LO5A 2PIDA 3QVGB 2OILA 1IC6A 1EHIA 1N1GA 2KI5A 4RQTA 4GU5A 4Y9DA 4Q01A 1KQNA 4NJMA 1QG6A 1UP4A 2BLNA 4L5YA 1ZCJA 1ORTA 3NT2A 5DFAA 5BQOA 2MT9A 3NUZA 4U2FA 4C4XA 4P22A 4S1VA 1YCHA 3L93A 1EA7A 1E1RD 3NTVA 2JATA 3GFPA 3M6FA 1RQ2A 4Q9KA 2HU2A 1OT5A 3PGJA 2Z4SA 3TGPA 4NMXB 4QO7A 1NZDA 1SU7A 5INTA 4XFJA 3EVBA 2O3RA 2ZRGA 5KVQA 2ZULA 1MC4A 3OIWA 3OIGA 2HU7A 3KDPA 4FIDA 1A5BB 1NW7A 2PS1A 1ZQ9A 3JYNA 1YBFA 4LZWA 2XZTA 3AI2A 1AZLA 4RXTA 4P3OA 5U4XA 1WCYA 4BFCA 4XOUA 3PRKE 4F93B 1V8OA 3LRTA 2JLQA 1KIMA 2XCLA 3OD1A 1UXGA 4ND1A 5JD3A 3RIXA 2GM5A 2RHGB 4QKQA 3ORRA 1LLUA 3JQDA 3L8FA 3CCBA 2CWWA 1UXKA 4LDZA 4PIVA 5DEOA 4N47A 3IUEA 4ZYWA 4DV5B 1BU8A 5CGZA 2C29D 3DMTA 2H4ZA 5IXSA 2LCQA 2PUBA 2QYSA 2HHHB 1SHJA 5GVRA 4QUJA 3W5HA 3FYSA 5SV2A 1QH8B 5AW8A 1TYDE 2I33A 4R2LA 4HUJA 4Z0NA 2AHOA 1DP4A 4H6XA 3VBEA 3WRXA 4EGFA 1RE0A 4KN9S 2X19A 3FYCA 2V96A 1V37A 3PEVA 1CPYA 1T9AA 2OESA 2VAXA 4EB0A 1T3TA 2FJUA 3N28A 5ITZB 5JYCA 4K9OA 1KDVA 4YHHB 1F8YA 1PL8A 5JANA 4O5AA 1UWVA 4KAXA 5LP6A 1QYXA 2JVIA 4ZI2A 3CX3A 3R76A 3BWCA 2AN9A 9LDTA 3WGUA 3GW8A 1VMIA 2JAUA 3AFMA 1VI6A 4ALIA 3ZZ1A 4UMEA 3UCXA 4YCJA 3VPAA 5AW0A 2Q41A 4NS4A 2CDNA 3MCUA 4YRQA 5KO2A 2R8RA 5I01A 1E1DA 5BSMA 3LNTA 4UZEA 2AC4A 5JNRA 4U1RA 1Z63A 1L9XA 4NHOA 1OHHD 2BGIA 1OBOA 4ON9A 5AK4A 4M1EA 2VYCA 3EVZA 4X8MA 3H2GA 4PX5A 3S2IA 4B71A 4Z0HO 1YMUA 2XODA 3HVHA 4KP7A 3FPAA 1W0JA 4TQ9A 1DRUA 3S4YA 1C1DA 1RC0A 1V8FA 2B8TA 2F48A 4YJHA 2GESA 4TV8B 1GVNB 2VHYA 3O3OB 3ZQ6A 3W9YA 1R9JA 3G8YA 2VDMB 1H2HA 3ICWA 4RUKA 2BMWA 4UNQA 4B6JA 1ZGZA 3LC2O 3AHDA 5EP1A 1T1RA 2A88A 1HKUA 2X5KO 2XQJA 4IY1A 1PS9A 1A97A 2O8FB 2ZXFA 2JLBA 2MWMA 1P6XA 2QF7A 4TS1A 4ZYLA 2XVMA 4PLGA 1HE2A 1R0LA 4ICIA 4J0FA 3KQKA 3C4JA 4LHYA 4TLBA 3DMNA 4OVKA 4IDFA 2FXVA 1F60A 1X3SA 5DBHX 4NABA 3R7DA 3TB4A 3NI2A 2Y9PB 1N3BA 4MO9A 2HLPA 4LA4A 5K0FA 2DUUA 3NWOA 2HADA 2Q5QA 1DQRA 2Z1DA 1E6KA 4RK4A 4UTZA 2D5LA 3VZQA 2AOXA 5BQ3A 4QAJA 3SQWA 4BY9E 2I7TA 4DKJA 4LSZA 1RIFA 1DWQA 5BSRA 3UAOA 5K7SA 3E48A 1QRRA 2NG1A 3KJEA 2XZOA 2R62A 1KQ3A 3HO6A 5COQA 1I2DA 5SZIA 2G5GX 5ICSA 1NOIA 1N77A 1NPYA 1SO8A 4YCDA 1QH1A 1XZNA 4UM5A 3RAPR 4MRMB 1Z47A 5IM4F 4REQA 5EKTA 2HUNA 1U4OA 3BILA 2I2XB 4D3XA 2O20A 2I6SA 2LTAA 3LY7A 4BUZA 1IY2A 1RWWA 1B41A 4MPRA 3EF3A 3F7OA 2V7WA 5JXIA 2LIPA 1PUJA 2EX4A 1GL3A 2B1IA 2RKOA 2SICE 3EH2A 3ESAA 3GO4A 1H2RS 2DPMA 3FWNA 3OPXA 4ZU6X 4AQDA 2PX8A 2C2XA 1LH0A 1PJLA 1GGJA 2R8XA 2YJNA 3D2AA 4MUBA 1AM4D 3KZNA 2CCJA 3P2IA 1AKUA 5KYVA 4BU1A 2IYTA 3EXFA 5HKOA 3JRWA 4BQSA 3TSAA 2SHKA 3ADDA 4MKFA 3U3RA 3ETCA 1KU6A 2C59A 4IG9A 1PBNA 2WINI 5LDGA 1T9CA 1ZRMA 1I6KA 1XYYA 1O6BA 1NBME 2IRWA 4ZYXA 2HLDA 2F9MA 3EXIB 1N6OA 3RV3A 1NMEA 3C6MA 1SAYA 1OTYA 3EQ6A 3VUFA 1U1EA 4EKDA 3T3NA 3N2KB 5BRNA 3IURA 1Z5UA 3R41A 3MGBA 2EX0A 3MLEA 4JUBA 2GM3A 4ZJYA 4N3BA 2VK2A 1Y9AA 3EIFA 5CLJA 1CR6A 4Y2XA 4LCJA 2RK3A 4I8IA 4PFJA 2QVLA 4A8JA 1FP7A 2Z08A 2H1WA 4BN5A 1FUIA 3T54A 5F78A 4LOIA 1OASA 4FMDB 2ZRFA 3DR5A 4N65A 1L7OA 2O5CA 3F47A 5LZ8A 3FHCB 5HRUA 5B1HA 2VRNA 5BUQA 2B2NA 2GLXA 2BHNA 2O1EA 3GPLA 3Q3IA 5KYTA 3ZWYA 4M89A 3GDOA 5TC4A 3AJ8A 1O94C 2GR9A 4MMYB 2ZSUA 3CX4A 1QF7A 2D7CA 4PZLA 4ZZ0A 2YQ5A 3IPXA 5GIOE 5E3HA 4QGFA 5IYZA 3AJ9A 3GJ3A 1E3WA 5C46F 1J2JA 2HBRA 2VDVE 1J56A 1KY4A 3I5MA 4MITA 3URMA 1MLDA 3EGXA 1G19A 4RS4A 1QK4A 2DUWA 2AW5A 3R40A 4AF8A 1NXOA 3R2JA 3W5BA 3ORFA 5IK2A 3X2SA 2DFDA 3OG9A 4RD2A 1XMSA 4E3ZA 4Q1BA 4GICA 4TTAA 4JZYA 3OZGA 4G5QA 4M0PA 1V1MB 1UOEA 4K9KA 2G25A 3HU2A 1JE1A 3I6ZA 4HRAA 2O7RA 5FI5A 1IG3A 1W93A 1AKVA 2VTEA 2UZ1A 2X8WA 3VI4B 2GN8A 1OLOA 1Z6GA 3INNA 2REXB 5IVKA 3C6ZA 3D6AA 2YWFA 1GG8A 1U7UA 1W4CA 1SVMA 1UIRA 1R8SA 3LPNA 4M83A 2IV2X 1XTVA 2D2IA 3JQ8A 4GDFA 3ZWAA 4OX9Y 4X8OA 3C8UA 3FJOA 1GV1A 5DJ5A 3LRXA 3VSDA 5LXTA 2OFOA 1KARA 1MV5A 4P4NA 1EXVA 1ST3A 4B34A 1J2RA 1X92A 3GLSA 4ETIA 3UJBA 3PKJA 4F91B 1ESDA 3T9DA 1EP9A 4WOKA 4B74A 1HL3A 4D45A 1X7YB 3BMXA 4NV3A 4MTCA 3ICEA 1H0RA 5IXYA 1Y81A 4QRDA 5ANRB 3G5MA 4WCFB 3QENA 3TLZA 2KYRA 1Z5WA 1QUFA 4BRWA 1EFKA 4KBGA 4BAGA 4NV1A 4O4HB 3QWBA 4BLUA 3ZUGA 2RMKA 1H93A 3Q8LA 2AWNA 3C15C 4EYQA 3DZDA 1P91A 1RRCA 4Q1VA 1A27A 2PD4A 1Y3BE 2NZWA 3JQGA 2XBLA 3MMXA 1UJBA 2AJDA 3FW1A 3O2NA 4IQFA 3O8RA 3H05A 1C3OB 4BZWA 4DDVA 4MR7A 1E4EA 4G4SP 1Z26A 5EZYF 3ROPA 1Z0KA 3B5EA 1D0IA 1ULUA 3RJMA 1VIYA 1L4MA 3IP3A 2HEIA 1N9ZA 1UK6A 2ZJBA 4PQEA 5JWRA 1WETA 4HB3A 1XGKA 4ZU3A 2WMDA 5C1DA 5CEEA 2FQQA 1MMFB 2QENA 4V02A 4XYMA 1CIJA 1UH5A 5ALOA 3JARB 4HWRA 5I9MA 3TLAA 1YR6A 4ZOLA 3DB2A 1PYGA 2QRQA 3V80A 5HUHA 4ISBA 3U40A 2TMKA 3WR5A 1D09A 2POQX 5I9SA 1K27A 3ZY4A 4EA6A 2G0NA 3I2YX 4WESA 1I3KA 4ZVPA 1H4SA 3P5BA 3IEIA 2J9XB 2AE2A 1O8CA 4JL8A 3A1EA 3TZLA 4IEEA 3IP6A 3UBMA 3DM5A 2WTXA 3ESDA 2C99A 4IDCA 1G1MA 1YKSA 1Q91A 1P0FA 2Z09A 3LGXA 4U9UA 4Z2YA 1RPTA 3PIIA 4QVGA 4PTYA 2B36A 3QMVA 4OAQA 3ZWQA 4Z7OB 1Z28A 1NZJA 4DQDA 1CUEA 4WWHA 1E8MA 4W1SA 5DN6D 4BNXA 4I3HA 4E08A 2RG7A 1X1TA 1WXEA 2NIPA 5DCLA 5EEGA 3VDXA 2ODAA 3B2NA 3ZX5A 3DG9A 3STXA 1CUHA 1KEZA 4ZPJA 2WJJA 4UE3S 4DJFC 2YN2A 3RWMB 2H1FA 2UVPB 2FQYA 3A6JA 1GPKA 1HY3A 2DKFA 3KYJB 3RVOA 1A7UA 2GBIA 1MB0A 2H16A 4EF4A 4IICA 4RSHA 5B1DA 3WGOA 3CRNA 4ZCPA 1EVEA 1IM5A 4IDPA 2MR6A 4KEAA 1NC3A 2P4QA 3TINA 3CB2A 1BKYA 4RACA 1BXGA 2XRFA 3WWZA 1QQ5A 1WUHS 2J6IA 4B09A 1SUDA 4YCMA 2ZYHA 4GBMA 5GJBA 2E82A 2GN2A 1SVWA 2PD3A 2Q4RA 2X9NA 1IN7A 2A0XA 1OXMA 2Y0BA 1QO9A 1THMA 2B37A 3P2EA 1XRRA 2C95A 2RFLA 3A9WA 4R69A 5KHLB 4G5HA 2BCJQ 3HKEB 4NENA 1ODLA 3NC0C 1MJGA 3O95A 4RPKA 1QG4A 5BVHA 1E1MA 3BRCA 3NH9A 1V1RB 4UNSA 2EZTA 4M7OA 4F4JA 1N4DA 1KWGA 2VYVA 3BTOA 5CEFA 5AVZA 5CCXA 1QKJA 3PUIA 3TGWA 3FGOA 4KDCA 1EFCA 3HYTA 1T1SA 2HTFA 2W2TA 3IKJA 4OHVA 4YO8A 2J7KA 3VOAA 2OKCA 5JASA 4P2BA 1XTZA 2QN2A 1Q7EA 2G5CA 5GM2A 1AJEA 1CNMA 3EGIA 3EQ8A 3F49S 4IDGA 4LTNA 2IV3A 3WRVA 1GCOA 1N2GA 1OB5A 4XLLA 5A5GA 1HE5A 1YXMA 3LUDA 4EEZA 2BEWA 1B6TA 1L4FA 1JMKC 5JS8A 1HSOA 1JYFA 1P7YA 3N74A 3OF3A 1ULBA 3G17A 2ZRDA 1FP4A 1MO2A 3SX0A 3TFQA 1KBOA 2BF7A 3GGJA 1K89A 4FX2A 1J6UA 5HILA 5JQGB 1SZCA 1N4AA 3KOOA 3C0KA 3FNHA 3W2FA 2KX7A 4RY9A 4AMUA 5IVHA 1JIQA 1N5DA 4M7WA 3DYVA 2G3YA 1QNFA 2P4UA 1Y8QA 1XUOA 4J2HA 3ZWBA 3DBIA 2P11A 1NVVQ 3PV0A 5DWDA 4OGKA 4X9XA 1KAMA 1Y82A 3VR1A 3FMVA 3CKMA 3QITA 2OCAA 3NHBA 4LI0A 4GP7A 4M1TA 2AVDA 4NCXA 4LBVA 1X94A 3D3QA 3H4VA 3R0IA 1Z2DA 4P4UA 3PD7A 4YJGB 5C0OE 4JFAA 5K3AA 1BFDA 2PM8A 2ZSDA 4OG2A 4TVSA 4GPZA 2ZXEA 1V43A 3EFOB 2B2XA 1AUOA 1G6OA 4HWOA 4MVWA 1ULZA 1Q50A 2HRQA 4KR7A 4E5VA 3D02A 3WSTA 1Z39A 1SBNE 3BMOB 4JT8A 4MUJA 3WL5A 1W5AA 1ZGJA 4GVPA 4RKWA 1MHTA 2ZBGA 3RC2A 1U2SA 3CX8A 4KPGA 3WGLA 3L0BA 1MN6A 1H85A 3MJCA 1IZ7A 3UB4A 1YFJA 2FX3A 3P96A 4C4PA 4I5IA 1QQ7A 1KK2A 2IHBA 1AHHA 2P6NA 2UAGA 3D7SA 3ZGZA 3O26A 1FUYB 1AG9A 3DE7X 3E9ZA 4A2PA 4C03A 3NHUA 1BHJA 5IG2A 1RC8A 2BM0A 1UDAA 1Y9EA 2EFGA 5CDFE 5L7WA 2UKDA 4PYQA 4L16A 4Q9HA 1RRPA 4ZIRA 3LH5A 1QBKC 3LT5A 4NRDA 4ZMSA 1HT1E 4ZDKA 1WCV1 2R3SA 1EDEA 1TM3E 2FYTA 5JDIA 4TLMB 2OK8A 4FMCF 3WLEA 1RRMA 2B4KA 2WICA 1CLUA 3ND6A 2P3LA 4FINA 3M2PA 1YZQA 4QYWA 1FBTA 1T2EA 2DFKB 2NZYA 3SQMA 1N6KA 4W1QA 1LKZA 3R3WA 4A8TA 1BMQA 1HQYE 4QJ5A 2W8ZA 4ZA2A 6PFKA 2XCIA 5IXJA 2X9GA 1JA0A 1QKKA 4J16C 1UPTA 3AVXA 1P1JA 2HJWA 3WFZA 1DAKA 1ZGGA 5M04A 2FPSA 1SGWA 5JTUA 3HG7A 4O4IA 4XDGA 5FBKA 1EB9A 4HNQA 4F96A 2I66A 1X7XB 3OPMA 3RS4A 4B44A 1HTTA 2IEZA 1WXDA 3K8OE 2ZBFA 3HL4A 4FGJA 4PIMA 5EAIA 5H4HA 3LTNC 4ZHQA 4AKGA 4HD8A 4WOJA 2QRMA 3MTDA 3MAAC 4B7UA 1F3LA 4P08A 2GZ3A 1G42A 2ZIXA 2W6IA 4TYQA 2IPNA 3PUZA 4G4JA 2UZ4A 1MUUA 2FF5A 5KNCH 2PQ2A 2RONA 3FSGD 5G1NA 3RKRA 1PNTA 1WVGA 4ME6A 1JLSA 3CYFA 4JQOA 3WMXA 3U60B 1YF3A 2ZCJA 3UJ8A 4ND7A 4LF4B 1VCMA 2XUFA 1Z7WA 1MAWA 1ZRHA 2JRLA 2PRSA 2PYIA 2VDQB 3ED5A 3IJEB 3LFTA 3SKYA 4C20A 2FZCA 2JBAB 3QBTA 2OD2A 4DCOA 3D6FA 5KWSA 1SVIA 3FCCA 3Q8XB 4G5XA 4OK5A 4I50B 3QW2A 4ZI7F 2POCA 1N6PA 2CJYA 4Q1DA 2YOHA 4LE0A 2HA7A 1Z4PX 2AR9A 2CC2A 2XTMA 4MB2A 3ZV4A 1DJLA 4WLNA 4RD1A 2BCEA 4G1BA 1SXPA 2WNIA 5EE5B 4OGWA 2VSXA 1VMDA 4ZVLA 4BKOA 4EHDA 2D2XA 1O2DA 3BTVA 3GJSA 3DHVA 5ALKA 1IOZA 1BGXT 3K31A 3VJKA 4RW0A 2R5NA 2HO5A 2XYPA 4JLMA 4NOMA 3C1TA 2JCSA 5L4LA 4KTVE 4Y3UA 3GP5A 5MF6A 4HUQB 1X80B 4AYWA 4DR5B 2WTAA 5K8VA 3M6IA 4BFYA 1P9WA 4UHKA 2I91A 3KZOA 4ARIA 1NOKA 1EFUA 1XE3A 2E48A 3A0UA 4JROA 1LQUA 1SEVA 1O0BA 1VBMA 5JR3A 3IVXA 5TLSA 3T9BA 4FGSA 1WE2A 4R1UA 4DRXA 3OIYA 3IBFA 2UUBB 5HDBB 4YMTA 2CNWD 1RVDA 4F8YA 4X1IB 2BDEA 1FU8A 1GITA 3TR5A 1JB9A 5JH7B 4Z53A 1AU9A 3H8JA 2XZLA 2FDCA 4JOSA 1JMYA 4WLOA 2PRZA 4S1NA 5F4ZA 1T10A 5K6AC 1E61A 3VKHA 4BFSA 4TVOA 3Q0IA 1D0VA 2DQ4A 4OMDA 1YL5A 2RG1A 4WLVA 2GN6A 5AKXA 2AN3A 2ORYA 1AXGA 1H8HD 4BFTA 3JZAA 2O2SA 2B6HA 1RZVA 2BZSA 4MQUA 4TLEA 1L7NA 1W9HA 1WMBA 3T15A 3QQ5A 2K7FA 3DVAB 2O8CB 1F9EA 1R6VA 3SIPA 1HV8A 1Q7GA 2DSTA 4ZAWA 4U2EA 1LQ2A 1JALA 1Y5NA 1GPWB 1WS6A 2XMBA 4YMHA 1NN1A 1S3IA 4MPJA 4MRNA 2A7XA 5EPEA 5JSYA 5LQNA 5HMMA 4JC5A 1QJ4A 3OQ6A 4U02A 4YB8A 3VDQA 5B1YA 1Z17A 4ZRDA 3X1YA 2Q9BA 2P4SA 3UMJA 3H5IA 4BFUA 1AK1A 3BDAA 2XQFA 3VFDA 3U3MA 1EIZA 3HB7A 3UHAA 4QXQA 4PCAA 1JDPA 1S2OA 4P0PB 4FILA 3ZW7A 3T99A 1NP3A 3C45A 1P75A 2H7XA 4RENA 1I30A 4DIKA 4YYZA 2DKNA 2H5JA 3JD1A 1KQFA 3RR2A 1I2CA 1U1GA 1ZGCA 2FN7A 2IF0A 2YXLA 3A6HA 2PRKA 4NBSA 1JB1A 4UREA 5IVPA 3E5HA 5K6TA 2FTKE 4J3FA 5JSQA 10MHA 2XMQA 4C87A 4TUYA 3RIHA 4QYIB 3DZHA 3G9XA 1YASA 3IUYA 4EJMA 3PQFA 5AW6A 1LPSA 3KXIA 2Y1CA 1DCKA 1G8HA 4X5OA 5LLSA 4RCYA 4XCXA 4OHYA 4H7PA 4HPXB 4BDSA 2VA9A 4OFXA 1A1SA 1JPNA 2O4UX 4CMIB 1C9EA 1KJ8A 2PZLA 3HUTA 3HDYA 1PAUA 1Z0AA 2BC9A 1GHTA 3AFIA 4WCFC 1J8QA 2I7CA 2BWJA 4B32A 2WI8A 4AKEA 5SY4A 2ZB2A 2OHHA 1Y6GA 3GJ5A 1XP5A 3LMKA 1R66A 4ZVUA 4RZUA 3BB3A 4CPDA 1WDMA 1VI5A 2LBPA 2XOEA 3WLMA 3VYWA 3K4HA 4R01A 3BUSA 3I2GA 3B3QA 3FWHA 3RREA 3PNOA 3DMGA 2B30A 3ZZTA 2VG8A 2XY4A 1VBFA 3ILHA 3FFWA 4MH0R 3E5NA 1TT5B 3M33A 5EXDA 1R15A 4YT4A 4PHGA 4WPGA 4KQMA 3W5SA 2IX3A 1ONOA 1VXOA 4Y6OA 2GEJA 3AUXA 3UJCA 2JZNA 1KZ6A 1TZJA 3ABZA 1N2CE 3HL0A 5AW9A 4I9NA 3ZNPA 4TL8A 2OOSA 1L2TA 3FYHA 4R9UC 4IOJA 4PG8A 1FFEA 3RHFA 4TRNA 4GKVA 3W5AA 4H3VA 2AWOA 3AHFA 3EFBA 3JVDA 2CUNA 2WHQA 2P62A 3UNXA 5ITWA 3GLGE 1MJFA 2FFQA 1HTBA 5H83A 1Q0PA 3WLHA 3JQ9A 1EUZA 4NZOA 3LUGA 4BQQA 2XYRA 1VJCA 3O1JC 1GZVA 1R0KA 3C6XA 1N1EA 1PN3A 3R77A 1L3BA 4YBRA 2NQ8A 4I1RA 1Z2EA 4Z4CA 2E4ZA 2C2MA 3KXDA 4HDMB 4P92A 4DSZA 5BSGA 4UQLA 4EVRA 2O7NA 1N75A 1Z8NA 3DXFA 2W6PA 2X0KA 3O3CA 4Y1RA 4YP9A 1V2GA 2YJZA 3O8BA 2QY9A 2WLSA 1SA0B 2ORWA 3O4IA 5ITZA 2E1PA 1E3LA 1CIPA 1KEWA 4WXMA 3HVUA 4MCIA 3MCVA 3AETA 3UFBA 4TOIA 2YV4A 4XDHA 3ZTTA 4DABA 1ZHOA 4ZO6A 5DBGA 1YA6A 1JQEA 1ZMTA 4H7EA 3TQQA 1S2DA 1N5LA 1VB5A 2HSWA 1J0BA 1GR0A 5AJVB 3WL8A 2Y8EA 4BKUA 1YC2A 4G5GA 4K2AA 4JWKA 2O7SA 4HVAA 3TAHA 5TR9A 4DMKA 2IGBA 1LSJA 2NVBA 2X8JA 1VRCA 2QRUA 2WYVA 3C6YA 4IVNA 5ENZA 4OQPA 4WN9A 5IC6A 2HK6A 4FONA 3TLYA 2J3KA 3DVSX 3EGEA 3GVPA 5K0CA 1G59A 3S2GA 3O2SB 4KNYA 2AG6A 3K4PA 2YWGA 5HQ3A 5FYQA 5I8WA 4P5PA 1VCNA 1ZD2P 2OLJA 3E0XA 1E9DA 3G0OA 4Q9DA 2WT9A 3BJIC 4BQIA 4HZUB 5LMNB 2EWMA 1J06A 2OPBA 4J6FA 4TV8A 3ABQB 3RASA 1FMJA 5LIRA 5BUZA 4B3JA 1FVXA 3FCYA 4OYHA 3W90A 4RJTA 3AEQA 2DHEA 1Q0QA 3LW8A 2MCFA 4TSFD 3DAPA 5JNLA 2HQRA 3H9GA 1ZJ5A 2WG1A 4F5EA 2G9ZA 2XUQA 1HWYA 2QG6A 4HNGA 3FBTA 2WMYA 2X3FA 1JNXX 3AW8A 4EKNB 1HDOA 1GQSA 4IBOA 4Q15A 4UCWA 5ALQA 5ITSA 3W8NA 3HYNA 1GNTA 1R8XA 3LXRA 4MW0A 4P53A 5A2GA 3WK6A 4GI7A 5ECYA 3KR0A 4AY5A 1D03A 4AK9A 2MHCA 5BWLA 3OOEA 3G2KA 4DV3B 4Y9SA 3SWWA 3OCJA 4D9JA 4GO1A 1CQXA 2IZ7A 3BCSA 3FNBA 2XQVA 3HP1A 3KVNA 3NAQA 3EW9A 1E7YA 2JASA 4L4RA 4PAOA 4YACA 3RHSA 3W3AH 4EI8A 3D3WA 3N58A 3OF5A 1T34A 1EDDA 3PEEA 2AG0A 2IE0A 1XF1A 3HEAA 1IHXA 3R6TA 4CQLA 3U19A 3ITEA 3F1LA 4C04A 1VXRA 4WT7A 2Y1LA 3GCDA 1R9GA 3GCGA 3OPQA 4I2VA 2PMDA 4RVCA 4BO6A 4Z4HA 4C6SA 1EZZA 3TFOA 4O1HA 1SD1A 2PBZA 1ZIDA 4GPAA 2JGRA 4L9SA 4TRRA 4DA7A 4FUTA 1EVKA 1VA5A 2UYQA 1MOZA 4BWGA 1E2KA 3CBQA 3NXKA 2GBGA 2PU5A 3INTA 2O07A 1EZ1A 3K9CA 3MT7A 5E7JA 3UB2A 4JT2A 5CNMA 3SQLA 2AJTA 1Y1PA 3PYLA 3RRXA 2PWZA 3BREA 3DC7A 4G8DA 4TMZA 2Q28A 1JFTA 3B7PA 4K46A 1Z83A 3EIOA 3STVA 4OXRA 1IBSA 2J46A 2H2DA 3MHTA 2Z5LA 1ZCAA 3P97A 1Y1QA 4AURA 5DEIA 1PFKA 3ZD9A 1TTTA 2NPIA 2BSAA 2PWPA 2YMPA 3DMYA 4KXUA 5EMMA 5DNUA 3B60A 4NAUA 3I5AA 3UMYA 1N9GA 1VECA 2XAAA 4LDAA 2O23A 4OM7A 5L7YA 4C0JA 5ICEA 2AQ8A 3WTCA 5B7GA 1OXXK 2QJFA 2A0UA 4ERNA 2JARA 3J80A 5DYGA 4WRRA 2XOKA 2R79A 4H3HB 1IAVA 3FHTA 4G9EA 2OZPA 5AQEA 3P0HA 5GZ6A 2G0AA 3RE1A 1UC8A 2IFTA 4EG4A 1FLVA 2QLNA 1YVPA 1BRTA 1UBCA 2HF8A 2SECE 3F8WA 1VCIA 3OZTA 4NYMR 4V0KA 4UXHA 2O14A 4EO9A 3K6SA 4IRXA 4RGVA 1MW8X 3QVMA 1R37A 4NY1A 3FTQA 1LDMA 1IBLB 1AN9A 4DIBA 1SKBA 1EA5A 4TTVA 1N8KA 5FNVA 4TS4A 4CM9A 5ARBA 3LXXA 2A84A 3C3PA 4F8EA 4YDSA 3DW1X 3DF7A 2QV7A 1RBMA 1KAGA 3JPYA 2QX6A 1Y1SA 1MABA 4HTAA 4WSOA 2P6MA 5F73A 4ZCLA 2JAOA 2N1BA 3SY8A 4Q3CA 4M9XA 5BWNA 4Y2VA 1TU4A 5K01A 1ZM2A 2JIZD 4UEJA 5CNKA 4DIOA 4XWKA 2C5LA 5LSAA 3NFYA 3GQBA 4PXSA 4MUIA 4EFDA 4A9AA 3IO3A 1K08A 3ZY2A 3BD9A 1DDIA 4QATA 3ZV7A 1NJGA 1W1IA 3PG5A 4D4MA 4YP7A 1Z8DA 2BRUA 2OENG 3O0DA 4UEKA 5J59A 4DIFA 5CBPA 1QC5A 1XQVA 3D5EA 3I01A 4E51A 3U7HB 2A4KA 4C2AA 4BN4A 4KQHA 3TRFA 1EX7A 1TDJA 4PGMA 2AL7A 1JJAA 2PKRA 1M7BA 4G2NA 3F6CA 2PJUA 5HBGA 4L8GA 4U9IS 1QCYA 1RWBA 5T57A 1RI1A 2EBUA 2OD7A 1TD1A 2IX9A 1RT9A 3SSNA 4CLEA 1ZIXA 3P8ZA 1BMDA 4W1PA 3M82A 4UOQA 4OKNA 1U9YA 3DEIA 2IL1A 2JANA 4KHZA 1BN6A 3VTFA 5J63A 1OFHA 1SKQA 4RH1A 4U3JB 3SM9A 5L8VA 1N2SA 1NN0A 5IDWA 2OO5A 3D1LA 2IU6A 4R8LA 1MORA 4FCVA 4AP5A 4EPYA 1RU3A 2QRNA 4X00A 1HNZB 4BQOA 4Z7JA 3AOEC 3D4BA 2QMEA 5FHQA 1QO0D 2V7XA 3UV6A 4UFNA 1MD9A 5TQ0A 3AVQA 3CZMA 3I8SA 2QT0A 2C0PA 4MWZA 4BEVA 3FTDA 4OKSA 5E9AA 3CLTD 2GRAA 1J49A 3AEKB 2DWPA 1VLZA 5K03A 2XGOA 1L7AA 2NWQA 1SXGA 4Q48A 4PAWA 5TY0A 3WYAA 4Q3OA 5I7HA 3KT0A 1F1JA 4HAZA 2WC1A 4J7AA 4NJEA 4X3OA 2ZRIA 5IC5A 1IB0A 1Q5PA 2BW0A 1G64A 1G8SA 5FFNA 2ZETA 1ZNYA 4YP6A 1N57A 1UKVY 5EPOA 3R7WA 2YYZA 4L6CA 2ZI3A 5FQNA 1D04A 1PHRA 2X2FA 2WTBA 4AUNA 1J07A 1NR7A 3R5KA 4BMZA 4WLEA 4RTNA 4IG4A 1B0AA 1TL7C 4BDTA 4L3VA 3RYHA 1GTVA 5G3ZA 6REQB 1R6BX 4PQRA 3U4DA 3B5JA 1Z0ZA 3ICOA 2OP1A 3PUYA 1NJ2A 2OCIA 1TLFA 2E4YA 3FKJA 3R6LA 2AEJA 4RVUA