4Y9SA

Structure of an h300n mutant of potato epoxide hydrolase, steh1
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
320
structure length
320
Chain Sequence
KKIEHKMVAVNGLNMHLAELGEGPTILFIHGFPELWYSWRHQMVYLAERGYRAVAPDLRGYGDTTGAPLNDPSKFSILHLVGDVVALLEAIAPNEEKVFVVAHDWGALIAWHLCLFRPDKVKALVNLSVHFSKRNPKMNVVEGLKAIYGEDHYISRFQVPGEIEAEFAPIGAKSVLKKILTYRDPAPFYFPKGKGLEAIPDAPVALSSWLSEEELDYYANKFEQTGFTGAVNYYRALPINWELTAPWTGAQVKVPTKFIVGEFDLVYHIPGAKEYIHNGGFKKDVPLLEEVVVLEGAANFVSQERPHEISKHIYDFIQKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Expanding the Catalytic Triad in Epoxide Hydrolases and Related Enzymes.
pubmed doi rcsb
molecule keywords Epoxide hydrolase
molecule tags Hydrolase
source organism Solanum tuberosum
total genus 120
structure length 320
sequence length 320
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4y9sA00
3L1IA 1EDEA 4FHZA 1W1IA 1P0MA 1W52X 3I2HA 4U2FA 1XRNA 4CCYB 4AQDA 2BCEA 1ZI6A 3BJRA 1HPLA 1EVEA 4P08A 5JASA 1UXOA 5LP1A 1XRRA 5IVDA 1UFOA 2O2IA 3OG9A 3KWFA 1H2YA 4MYSA 1F8UA 4X6XA 1MX5A 4H7KA 5AM3A 1ZD4A 5ALGA 4BYMA 1ODCA 2JGEA 3I1IA 5AO9A 1HKHA 4P9NA 3WWDA 4DM7A 2PM8A 5CRIA 3HLKA 2BGRA 2HA4A 3VVMA 4FNMA 1K8QA 1CUDA 4FDMA 3WL5A 3ZLVA 1EB9A 4J03A 4C4XA 3EBLA 1GPNA 3HZOA 4DMHA 4IO0A 1AGYA 4DMCA 5IVHA 4PSDA 3G0GA 5DNUA 4NVRA 4NMWA 5AI5A 3VVLA 1BEZA 1DT5A 2HIHA 5D7BA 1R88A 4C4ZA 4PNZA 5ALKA 3V1MA 4FFWA 1IZ8A 1A88A 4BAZA 3G0BA 5JALA 2DHDA 2CUTA 4BZWA 4NS4A 4AX4A 4WFKA 5FXMA 2WUEA 2XB6A 1XQYA 1AKNA 1OILA 2HU5A 2C0PA 1FJ2A 2WU4A 1AMNA 5AKYA 3C8HA 5AK3A 2HA7A 5AOCA 3WIOA 3H2HA 4J0CA 3WLAA 1EDBA 1AURA 4PSCA 2GYUA 3KXPA 5K5EA 1CVLA 4FLFA 3UMJA 3VJKA 4K6HA 5ALQA 5AICA 1W76A 2JEZA 3AZOA 3RK4A 1VXOA 2BUAA 5JADA 4ZWNA 5AM5A 4DLNA 5AI8A 5K3FA 2ZSHA 1IUPA 4ITVA 4HXEB 1U2EA 2V9ZA 1Y7HA 2RAUA 1G66A 3ICWA 3Q8WA 3C70A 4HZGA 1QTIA 4LXIA 3HC7A 1ODSA 4YK7A 4RNCA 5SYNA 4FLMA 3C5VA 5I8PA 1BN6A 1GT6A 1CUUA 1SCIA 2HFJA 1Y7IA 4U2DA 3QITA 4K2AA 3O95A 1ORVA 3FYUA 5LZ2A 1ZOIA 4GLBA 4H7IA 3FSGD 5ALLA 1A7UA 4LYDA 3NOXA 3CCBA 4X91A 1DQYA 4WY8A 5JANA 3L1HA 1DQZA 1ZI8A 2OQVA 2QXUA 2WHQA 2ZJFA 5HK9A 1PJAA 2VT6A 1PV1A 5AKHA 2VQ6A 2R8BA 2HHAA 1B41A 1XZIA 2PU7A 3G8YA 2WUDA 1CUWA 2XMRA 4X7BA 4C87A 4BAUA 3ILSA 5KREA 2D5LA 2VA9A 2K2QB 3WK4A 4KAAA 2DQYA 4FKBA 4BP8A 4IHAA 4EY4A 1EI9A 2WG2A 5AM1A 2XE4A 4L72A 3H2IA 1MU0A 2XMSA 1R9NA 7YASA 5CURA 4G4GA 1R9MA 2WFLA 3IDAA 3WZLA 1X2EA 2XI4A 1ZJ5A 4AO8A 4OPMA 5DNVA 3WL8A 4TVKA 2BGNA 1CIJA 2WLSA 4IH1A 1P0QA 5C81A 1ZD5A 3IUMA 3RM3A 1EDDA 4EB0A 3DKKA 3EQ7A 1WB4A 3HEAA 4BVJA 3VKFA 4XVCA 1GXSA 2J4FA 3V48A 4CCYA 1YCDA 4W1PA 1QJ4A 3KSRA 4DNQA 5FKJA 3C87A 1YAHA 5ALPA 5KWJA 4WFJA 4KE9A 4FWBA 2QT9A 5AI4A 3G0DA 4QE3A 1J2EA 4X71A 5AJHA 2OG1A 3WK7A 2QM0A 1CR6A 3VJLA 1IMJA 4UHFA 1X70A 2XQGA 1FFBA 3R3ZA 1YSCA 1PFQA 1TIBA 4WDRA 4BDTA 2WKWA 1QLWA 5AM2A 4B84A 3DS8A 5JAOA 1FFEA 1ZIYA 4E15A 2PSEA 4XWGA 1L7QA 1SOMA 3I6ZA 4KAFA 1QIIA 5K3BA 2HDWA 1ODTC 4JUIA 1LZKA 2PSHA 4OD0A 1K6EA 4N5HX 5EHQA 1R4ZA 3FCXA 4C4YA 5ESRA 2B4KA 4BTVA 4W1QA 2WQZA 5D6OA 3H2JA 2V98A 1UOPA 3BF7A 3SX4A 3GUUA 3WYNA 1BROA 3H04A 2ZYRA 4UHCA 5DYTA 1S8OA 2C5FA 3HJUA 2C7BA 3K6KA 1UZAA 2VAVA 2E3JA 5ALNA 3TEJA 1XLWA 2XUPA 3D7RA 4IH4A 1E5TA 2FJ0A 2C5GA 1XFDA 3D59A 3DYIA 1QOZA 2QXTA 1AQLA 2Z3ZA 4HVTA 1G4HA 2ROQA 5HFAA 3QMVA 1JMKC 5FV4A 3F67A 3C5WP 2JEYA 1QIJA 2HA0A 4K6KA 2AJDA 3ANTA 3STUA 1VXRA 3FOBA 4QEKA 1DTEA 4E11A 5CT9A 2WG0A 2PU5A 1Q0RA 3WMRA 4B0OA 2XUHA 1VE7A 5HK8A 4OB7A 1XRMA 2YASA 1D07A 4FBMA 2GBGA 3BDIA 5HZGA 1P0IA 4P93A 4QNNA 3PF9A 1MX9A 3PE6A 1WHTA 1IZ7A 5DJ5A 2QRUA 3QPCA 3BIWA 2OGTA 2XUDA 3VDXA 1GQSA 2WU3A 1K5PA 2I3ZA 3AJAA 4B9AA 1CUCA 4N8SA 3G02A 5JARA 4UFOA 3O9MA 1JT2A 5D3ZA 3O4GA 4ZI5A 2G4LA 3T52A 3O4HA 4I4CA 5JD5A 4Y2TA 5FDFA 1DX6A 1Q83A 4UHEA 4FTWA 1UK6A 2QVBA 1C4XA 2OCGA 4H0CA 1QIEA 4CFSA 3WK6A 3G9ZA 2HU8A 3ICVA 5CT5A 1DWQA 2JIDA 4U2EA 4GHWA 2VATA 4UFPA 2HFKA 2XMCA 5I7UA 3JYHA 4OU5A 1TKRA 1WPXA 2WJ3A 1CUGA 1RP1A 1CUYA 1LPOA 1T4MA 3C6ZA 2EDCA 3E0XA 3O4JA 1FFDA 1GKKA 3AIMA 3W2TA 1MNAA 2Y2UA 3YASA 4OB6A 4Y2RA 4UUQA 4MWTA 3WIBA 1EK2A 5EIAA 1L7AA 4QDXA 4K5QA 1QIFA 1GZ7A 4AZ3A 1U4NA 4ETWA 4W1RA 5FLKA 2CMFA 1XZMA 1XZDA 1LNSA 3GELA 3DDUA 3ZLUA 1GQRA 1BEEA 2GBIA 1CLEA 5CH5A 5DYWA 3SC2A 2HRQA 2O2HA 2BJHA 1VLQA 4RE6A 4H18A 1GGVA 2WHPB 5DWDA 4HS9A 4CCWA 2GBFA 3RLIA 2H9YA 2OAEA 4PQEA 4BVLA 4CG1A 3C6BA 1LLFA 5A7GA 1BE0A 3N2ZB 2HU7A 5ALVA 2BKLA 2CKMA 2PSDA 5ALUA 3WA7A 1QO7A 1ZJ4A 3LCRA 4B7ZA 2RIPA 5HF9A 5CMLA 4J0GA 1MX1A 1LPNA 5AOAA 3LLCA 5K3AA 1GKLA 2NW6A 5HQ3B 2WIFA 5CTAA 4JH0A 1ZD3A 3AIKA 3WK8A 3OOSA 1XZCA 1CUEA 2XUOA 4Q05A 1EK1A 5CT6A 3QBJA 4BE9A 1DU4A 3G0CA 3QZUA 5F4ZA 2OCIA 5AP9A 5CBKA 1CUSA 2J3QA 5AHXA 3M82A 4RGYA 1EVQA 4B80A 3I2KA 5AK4A 6YASA 1OXMA 2JF0A 3E1GA 2LIPA 4F60A 1CUIA 4QWMA 1E8MA 4J7AA 3WWCA 1L7RA 2EDAA 5HF5A 3DYVA 1WCYA 3FLBA 4B6GA 1QIHA 4BRSA 4KYVA 3R3UA 2W22A 2ZYIA 3X3HA 2PSJA 2WILA 1AUOA 4DGQA 1DWPA 1C7IA 3KOOA 5CT4A 3I2JA 1ISPA 3QVMA 4DMFA 3M83A 1QTRA 5LKRA 4XX1A 1KEZA 2BFNA 4G1FA 4AO7A 5C8ZA 3FYTA 5E4TA 3WZMA 4F0JA 2HRRA 2HADA 2QJWA 1MN6A 1N5RA 2XUFA 4X94A 5LZ8A 2H7XA 1YS2X 2Y1KA 2OPHA 3A6ZA 3BWXA 5AI6A 5AKIA 1Y37A 1JU4A 3GROA 4W9RA 3F98A 4QDTA 1UT6A 2G5PA 2OGZA 4X90A 5JAUA 3HACA 4AXBA 2OQIA 4EY5A 3HSSA 2XQJA 5DTJA 1TQHA 3LP5A 5E2IA 3WA6A 5FUMA 4BE4A 1IUNA 3STXA 2IX9A 4PO3X 2XUQA 4GECA 4H35A 4DSZA 2DR0A 3VXKA 3H19A 2HA6A 1NU8A 2VSQA 2RHWA 1JMYA 3ZPXA 3Q0TA 2WFMA 4M0MA 1XZGA 4L3WA 1BRTA 3DD5A 3FNBA 2ZSIA 3FBWA 1JJIA 3MGAA 3WYDA 4MQLA 5A62A 1JJFA 5AH0A 2WIJA 3H1AA 4W1SA 3D0KA 2P8SA 5LZ9A 1XRQA 2YYSA 5EFZA 4DNFA 3VJMA 5ALHA 2PL5A 2UZ0A 3MUNA 2W6CX 4BCBA 3OC0A 2VJDA 1TK3A 1MAHA 4NZZA 3BJMA 1U65A 3A2LA 1JJBA 2O2GA 4WY5A 2H1IA 5DTIA 3V9AA 5K3CA 3ZV7A 1MJ5A 4Q1VA 4LHEA 4QDUA 5LZ4A 1QZ3A 1YB7A 5T4BA 3AFIA 4INZA 3E3AA 4S0XA 5ALZA 3HYSA 4Y2SA 1EA5A 3V1KA 4KACA 2WTNA 1WHSA 1ZIXA 4KEAA 1BCRA 5A7HA 4X85A 2Z3WA 1USWA 3H2KA 1IVYA 1QIDA 1WB5A 2CB9A 3QPAA 4QA9A 4KE8A 1W75A 1XZHA 3H2GA 4C6HA 5ALFA 3WWEA 1CUAA 4W63A 5H3HA 1J1IA 2WM2A 3RKSA 3FWHA 1A8UA 4DIUA 5J3JA 2G63A 1BS9A 4GBGA 1LGYA 5AIAA 2C4HA 2XT0A 3NUZA 4ZXFA 1G5FA 2WIDA 4C88A 2PUJA 4WCVA 5AM4A 5BWBA 3WKCA 1AC5A 4H77A 4MEAA 2AJBA 3UUFA 2XUAA 1RYYA 2FUKA 4OCZA 2PVSA 5JD6A 2DSNA 2AJCA 4J3JA 5ALOA 4UHHA 2C0QA 4KRYA 5AKEA 1Z68A 5CH3A 3FLAA 2PUHA 2WHRA 1CPYA 1LBSA 5AI0A 4B83A 5AKZA 2V97A 2QUBA 3QH4A 4PF1A 1U8EA 3I2GA 4GEGA 2WJ4A 3A2MA 4BCDA 4BB0A 3AZPA 2IITA 3WL7A 2FJPA 4ZREA 3EIOA 4EY6A 4BP9A 2Z5GA 3IULA 2OAGA 4Q3OA 3ESCA 4B82A 5AI9A 3ZI7A 3R3YA 3D2BA 3WKAA 3D2CA 3TGLA 2QR5A 2X5XA 3FYUC 3WK9A 2WFZA 1XZBA 3IIIA 2Y6UA 1WOMA 5ALXA 2ZJ7A 3NWOA 3OPMA 1N1MA 4HRYA 3A70A 2B9VA 1ORWA 1HQDA 4L0CA 3W04A 3I6MA 4U2GA 1TCCA 2O7VA 1E89A 3M81A 3QMMA 4KRXA 3CN7A 1QIGA 5ALEA 2WIGA 3DL4A 1F0PA 1XRLA 4ROTA 1TCAA 1VKHA 4TGLA 4OYLA 3D5EA 2HA3A 4X00A 1UKBA 5ALSA 5IH7A 1YASA 4OB8A 4BVKA 2XMBA 4G8CA 3ED1A 1Q0ZA 4G8DA 3IURA 3BIXA 1CQWA 2Q0XA 1FFCA 4MWSA 1FSSA 1J07A 2OLEA 2WUFA 4FFVA 1M33A 3PDCA 5DYYA 4X6UA 4G9GA 4IH9A 3DNMA 3CCCA 1LPSA 1G42A 3GBSA 2QMQA 3PFCA 3BDVA 4IQ4A 5CXUA 2JBWA 5JYCA 2GBCA 3JW8A 4BRZA 1HBJA 4BC1A 1R50A 3WKEA 1HL7A 5SYMA 5K3FB 3SWWA 3F97A 4I19A 4G5XA 4Y2VA 2XDWA 1SC9A 2ZYHA 5JIBA 3E4DA 4UBMA 1CUJA 3ESDA 1SCQA 2VTVA 3QM1A 2ES4A 4UHDA 5C7YA 4FNGA 4CIBA 2JGLA 3S8YA 4AMZA 5FPQA 3AINA 3WKDA 3K9BA 2XQFA 3R3VA 2XLCA 4UBNA 3I2FA 1THGA 2ZVDA 3KWJA 3QMWA 3P2MA 5LKAA 1BN7A 2DQZA 4AN1A 4P92A 3WI7A 2ONCA 1SCKA 2H7CA 3DOIA 4BAGA 1H22A 1MO2A 4H7DA 3PICA 5HKAA 3NGMA 3FAKA 1UOQA 1MAAA 4UBKA 5LYYA 2OCLA 5T4FA 5IVIA 4CI9A 5ALIA 5K3DA 3OURA 4ARBA 4PV7A 1CRLA 1YA4A 4DYHA 3BF8A 4F21A 1E8NA 1SFRA 4BTLA 3H1BA 3R0VA 3CN9A 3PF8A 3G9TA 1XQWA 3AZQA 1GPLA 1EHYA 3KDAA 1CV2A 3LS2A 4H7JA 4QLAA 2PSFA 2QJRA 3W05A 2CEKA 1NU6A 4BDSA 1R3DA 3KD2A 1JFRA 3RARA 4ZV9A 1JKMA 2WIKA 4PW0A 1YS1X 1YR2A 1ZI9A 2GZRA 3ZWQA 1DINA 2I78A 3W9UA 4E46A 3FCYA 2XMGA 3D3NA 2OGSA 4YASA 2RGUA 3PFBA 1H2ZA 4J0HA 4A16A 1WM1A 1E66A 2B61A 4H7HA 1JU3A 1THTA 2YXPX 1KU6A 4H7FA 3HRHA 4EHBA 3QYJA 4Y2XA 3AIOA 1X2BA 4Q34A 4G8BA 3K2IA 4Q82A 1K63A 4Y2JA 4FLEA 3R41A 1XZEA 4E14A 1QFSA 4QZVA 3D4LA 5CT8A 3FLEA 1WPRA 1UKCA 1W4LA 2XUKA 1TCBA 2AJLI 5FP0A 4B85A 3WWPA 2OXEA 5C8VA 3V1LA 5JZBA 4J0IA 4GDMA 3S2ZA 1XLUA 2EEPA 5BOVA 1QE3A 5FOQA 4EY8A 5ALDA 2XUJA 2QKYA 3SK0A 4KJXA 5AK6A 3I2IA 5ALJA 4HTAA 4UPDA 4MEBA 4Q3KA 4HAIA 3ZLTA 2VT7A 1O6FA 2VJAA 2J4CA 4FOLA 4X3CA 5T4EA 4DTCA 1GPKA 2I3DA 5E4JA 4KE7A 4KAJA 1QO9A 1HLGA 5EHNA 4ZGBA 2RHTA 4UBIA 4A5SA 4C89A 2ZJ6A 1OCEA 1XZJA 5ALWA 3WJ2A 4L9AA 4UFNA 4WFIA 1KU0A 2Y2VA 4M0EA 1XQXA 2XQIA 1XROA 1EB8A 4QDZA 4G4IA 4FBLA 2X76A 4AB1A 5AKKA 3QPDA 5FRDA 2DHEA 1N8SA 4O08A 3B5EA 4LYEA 1AZWA 4UBJA 5ALTA 2JGKA 5AKXA 1CUHA 1QIKA 4G9EA 3IVMA 1H23A 5LZ7A 3WL6A 2H7YA 2X8BA 2JGIA 3PUHA 3N0TA 2R11A 2GYVA 5T4HA 5JAPA 1N5MA 1I6WA 4LXHA 3GFFA 4BBZA 1VZ3A 4BATA 2XMDA 1UKAA 1E3QA 4EY7A 5BWCA 1E8DA 1ZGBA 5KBYA 5DNWA 1WB6A 4RE5A 4AMYA 4KE6A 1ZICA 1H2WA 2JGJA 4BC0A 3O4IA 1QFMA 3IBTA 2PPLA 4N8EA 2JGFA 1QIMA 1A8QA 4F5ZA 2RONA 2VAXA 2XMZA 4OUKX 3W9BA 4A23A 3ESAA 5ISMA 3STWA 4UHBA 3GZJA 4CG3A 3H17A 2QS9A 3JWEA 3BXPA 1LZLA 2YH2A 1DX4A 4X6YA 2VJBA 1CQZA 1XZFA 1TAHA 3DL7A 3HABA 3FSGA 3PUIA 5I9IA 4DNOA 4EBBA 3FVRA 5HCUA 2IIVA 5ALYA 5YASA 3EF3A 5JZSA 1BU8A 3IUJA 5IKXA 3DEAA 4Y2QA 4GI1A 5BV7A 1XZKA 2HM7A 4HRXA 3BE8A 1CFJA 1CUXA 4Y9SA 4MJ3A 4GW3A 1CUVA 5EGNA 5HF8A 5CW2A 3L1JA 2ACKA 2XMQA 5JAHA 5JZ9A 2BAGA 4RPCA 5AK5A 1HDEA 1P0PA 3R3WA 1EINA 1MTZA 4XJVA 1QGED 1YB6A 4GXNA 3O9VA 1DT3A 4LIPD 2G5TA 5JD4A 2PBLA 4B0PA 4K6GA 3V1NA 2HL6A 2RI6A 1UK7A 4Y2YA 4YPVA 1EX9A 5HFNA 3C6YA 1ACLA 3B3QA 4BZZA 2WHPA 1W6RA 1CUZA 5HKBA 4ZRDA 4PSUA 4EA6A 3IUNA 4EZIA 1LPPA 4MYDA 4J0KA 3G0IA 5CXXA 4D9JA 1VZ2A 4N5IX 4WDQA 3B12A 3LIPA 5FPPA 2CJPA 4X95A 2DHCA 5ALRA 1H2XA 2AXEA 2FX5A 1ETHA 5EI5A 3F8SA 2B20A 2C58A 1XRPA 4OU4A 3OTQA 5HQ3A 4U2BA 5DLPA 2V96A 2Z8ZA 4GWLA 1YA8A 1K4YA 3ANSA 4CIAA 3UUEA 1ZGCA 4TPKA 4I3FA 3I1YA 2CZQA 2XUIA 2ECFA 4Y7DA 1AX9A 2VEOA 1ZD2P 3M3DA 3IA2A 2QTBA 4DMKA 1NX9A 4J0JA 1UK9A 3W06A 1LPMA 5EIEA 4Z49A 1F6WA 4N8DA 3U0VA 4J0DA 3MUOA 3G9UA 1XQVA 1LPAB 1CUFA 3ESBA 4HXFB 3GA7A 1BCSA 3STVA 3D2AA 3LIIA 4C01A 1ACJA 1XKTA 4FMPA 4M0FA 1EH5A 1YAJA 2CBGA 2AJ8A 3IB3A 2GYWA 3C43A 2WJ6A 2QZPA 2WG1A 2ZYSA 4QLOA 5HF6A 1VA5A 3WQHA 2WSLA 2PX6A 3MVEA 3WKBA 3EQ9A 3VISA 3I6YA 4AO6A 1F0NA 1VJ5A 2PKYX 1A8SA 3FVTA 3T4UA 5K3EA 4ZV7A 1JI3A 1T2NA 4QDOA 4WJLA 2DCMA 3AILA 1FFAA 3TRDA 3STTA 2XQKA 4BCCA 1IUOA 1VOTA 4KR0A 3CXUA 4OSEA 1UWCA 4DNPA 5AOBA 2BUBA 4DSAA 1MT3A 2VF2A 3IUQA 4V2IA 1XLVA 1MNQA 4H7EA 2DFPA 1R1DA 2D0DA 2ACEA 5EHZA 2I03A 3R3XA 2OCKA 1CEXA 4JNCA 1Q84A 5LZ5A 3DJYA 1UK8A 4G4JA 2ORYA 3WJ1A 5AKJA 1DWOA 4XIIA 4MQMA 3DCNA 4LKOA 5LLSA 1CUBA 3AUKA 4MXDA 1XZLA 3WWOA 5IVKA 3U1TA 3DKRA 3G9XA 1QONA 1VA4A 3WK5A 5AKGA 1LBTA 2XUGA 3TJMA 2QOEA 2JGMA 3C45A 1J06A 4X93A 1RWQA 4B9EA 2WTMA 1C7JA 4Y2UA 3A2NA 3FYUB 3DLTA 5CH8A 3DOHA 1MPXA 5JATA 1UOOA 5AM0A 5A71A 4Y2PA 3STYA 2GZSA 2QUAA 3EQ8A 3HXKA 3G7NA 1O6GA 3F9CA 4JYMA 2XLBA 1EXWA 5A7FA 3BL8A 5E4YA 1XKLA 4AN0A 2O7RA 4CG2A 1LPBB 5KWIA 5C8XA 2J3DA 2BUCA 3DQZA 3PI6A 5EHXA 3H18A 4U2CA 3HI4A 4B81A 4Q3LA 2Y6VA 5AIBA 1TRHA 2HA2A 4JYPA 3OM8A 2WUGA 3C6XA 5ALMA 3O0DA 2Z8XA 4HXGA 1VE6A 5A6VA 5EIHA 2VJCA 4JEIA 3I28A 5AKLA 2WFLB 4AZ0A 4EUSA 4OYYA 5LIPA 1XZAA 4X97A 4ARAA 4LXGA 3R40A 4X92A 2HA5A 1B6GA 3C8DA 5A2GA 3F96A 4YX9A 4QWWA 4UBLA 5D3KA 3H0CA 4UBOA
chains in the Genus database with same CATH superfamily
4XYLA 4CR8A 3L1IA 3ZDXB 3GLGE 1W5AA 5EMNA 4EPXA 5LBIA 4FGZA 4WN9B 1N77A 1CQJA 4QG7A 3SMQA 4DIEA 3RW9A 3E27A 5LMZA 1P0MA 1BOOA 2ANCA 1M67A 3I2HA 4U2FA 5EOVA 2JLAA 3BXHA 4CKBB 1XPUA 4IRXA 4UCXA 4AQDA 1FLDA 5FOTA 4CTMA 4QGHA 1EVEA 4P08A 2VZ8A 4EUKA 4DA8A 5GZ1A 2JFYA 2ZZMA 2M1ZA 2GCEA 3A27A 3B9BA 5BSFA 1XALA 4RXMA 1JSZA 3K9GA 1X1RA 5L40A 1OVMA 2JRCA 3P32A 4PYQA 2EQ5A 2P1DA 2O2IA 3QVGA 1ZRNA 4BFWA 2F3TA 3KWFA 5GGYA 5HQJA 3L7AA 4BMOB 2ECOA 4EAAA 2GCIA 1GCOA 2PBRA 2QN1A 1IN6A 1YZYA 1OWNA 4IV5A 3O1LA 4LISA 3SHWA 2OXCA 2V0NA 3OCVA 1JDBC 3AEUB 1UBNA 4LDAA 2BFDB 4V3CA 3RVBA 3PHIA 3VHRA 5TX7A 3KLPX 4AKTA 4P4NA 4WE3A 1ODCA 3COYA 4KBGA 4W5HA 1E18A 2XDQA 3EW9A 4TWIA 4ZMRA 3FHTA 1AZLA 4B3CA 2FEKA 3IP9A 1NNLA 4D99A 4ZYVA 2Y9MB 1MV5A 1NXWA 1V9CA 5AO9A 4H1VA 5FI0B 3ERCA 4JUBA 1KI1A 4WUTA 4OJTA 4ZU3A 4KBFA 3H5OA 4DWJA 2QZJA 5CRIA 3GJZA 2HA4A 2P3OA 3UJDA 3MMNA 1ISFA 1G3IA 3R20A 5T8KC 3VVMA 2VSYA 3W9YA 2JCSA 5I4IA 1F2VA 4XGNA 1CUDA 5KTRA 1JJ7A 4PC6A 4YXFA 3IHTA 2CLLB 5KTTA 3ZLVA 1HOTA 1FP2A 4TMFA 5GM2A 3FBTA 4BMNA 1ZEMA 1TYCA 3LT5A 4C4XA 5JZMA 3IKVA 4GYKA 4WVFA 2P79A 3HZOA 2DWCA 2XH8A 4L9WA 4NE7A 5F9MA 4BGDA 2HN9A 3DJFA 1I3OA 3QG5A 1KPGA 4N6GA 3D6JA 2HBZA 4PSDA 3RFXA 5IVHA 4PQFA 2CFCA 1CCWA 3CEAA 3G0GA 4QVGA 2EG5A 3IILA 3Q6IA 5FR2A 2JI4A 5BSMA 3BJEA 3TCNA 4BHTA 5E7JA 5KYUB 4BRUA 1W87A 2O50A 3P19A 3Q6NA 5E8JA 1BEZA 2RH9B 3UPDA 3VQTA 5K6AC 2HIHA 3MWLA 3IR5A 4TMZA 3SEFA 3UWSA 4C4ZA 1SCUB 1LFAA 1RQNA 2QNIA 3RJMA 5LA6F 1V5GA 5ALKA 3RFCA 3UK0A 1ZH6A 5ILQA 1COWA 4L15A 4JGIA 4LZNA 4WCFA 4E22A 5HKKD 5JNLA 1ATIA 4OQYA 2IZ6A 5JALA 2AG5A 1JEJA 2EZ9A 1SQGA 2DHDA 4RQBA 3EWSA 3LUJA 4QICA 3ODPA 1TEXA 3Q7EA 1OY1A 1Q7RA 2SICE 3QVTA 3D3WB 5IYZF 4AX4A 3DDNA 4D9IA 4ZYTA 4FKZA 2CVPA 1L2TA 1Z5OA 3V7YA 1TK9A 1JHXA 5KYYB 2KQUA 3KHKA 5TF0A 5EERA 2VHWA 1OFTA 1JHRA 1OLUA 2I5PO 1XTIA 5JXWA 3KCQA 1KVQA 4Q3CA 4E3ZA 4KO8A 4YJ3F 2ZDQA 1P8JA 2ZR8A 2IYXA 1GLGA 1W8DA 3UXYA 5AKYA 1AMNA 5EJ8A 4R3UC 3DLBA 2HA7A 1NW7A 4F6LA 2X9NA 3ASZA 1RRGA 3E3LA 4ZVSA 2IBTA 1ZN9A 4K9LA 2Q9CA 3A58B 1EDBA 3HA5A 2ZSBA 3C3WA 5ED0A 3ZCQA 2HWKA 3CV3A 1EUQA 1GGJA 3IB6A 4KW7A 1ORHA 5K3SA 3TQQA 3CRRA 1RLJA 3VTZA 1OGIA 2XX3A 2ZR9A 2UUPA 2VHXA 3NCHA 4K6HA 5C46F 4R16A 5HUHA 1YJBA 3DG9A 4ZAGA 5B2ZA 3V4OA 4KWIA 1W76A 3AZOA 4RA6B 1FA9A 3FOFC 3K09A 2YNMA 5LDDC 2QB5A 5BWNA 2C29D 4Y1GA 1VXOA 4P4GA 1DFGA 521PA 1ST2A 4MVJI 1KGSA 2HMUA 4YRTA 1DAGA 4V1CA 1DOHA 1SUSA 4YR9A 5LUBA 4R1QA 3PKZA 1AE1A 2BFPA 5BT9A 2W8BB 3EIUA 3LTNC 2H51A 1PDOA 1BDJA 1HY3A 3A04A 4TQ9A 3UATA 3T9AA 2Q2WA 3D4OA 4NG5A 2V3WA 3IEUA 3FCSB 1W73A 3VAAA 4ES6A 4CIDA 3S99A 3E3NA 2VQ3A 4ITVA 4HXEB 2QG6A 3GW8A 1T6ZA 3L1VA 3CFYA 2G4VA 1NPTO 2Z2KA 4RY8A 2Q0HA 1P4JA 1SXHA 1GRVA 1MA3A 1Z4NA 5TQ0A 3RADC 1ZAKA 1B6SA 3EXEB 4GM0A 3IIMA 4IVQA 2JD2A 1JHUA 4DDHA 3L7KA 1TTTA 3NJ8A 2JJ1D 4PGAA 3RR2A 4CQLB 4B47A 1TTQB 1ODSA 1X15A 3EPHA 4RNCA 3K9CA 3M6VA 3LUAA 4BFTA 5B1EA 3C5VA 2J9FA 1BN6A 4WADA 4CF5A 2ID9A 1FNNA 2CZCA 4HLUA 4FOSA 1CUUA 3KU4A 1T2UA 3VR5D 5EE9A 4CLEA 1IJFA 1MZVA 1HO3A 2HFJA 3SVLA 3WYGA 1DJMA 5HHTA 1HX7A 1KSGA 3OY2A 4M4SA 3O1HB 4CTNA 2ZSFA 2HCRA 3C14C 2E4ZA 2MT9A 3JWJA 5ICCA 3NHPA 3O95A 4LF6B 1GZ5A 1XK7A 2V54A 3TIGA 3WGQA 5LZ2A 1Y8CA 2W83A 3LZDA 4GLBA 1SZDA 1YGYA 3FSGD 1E1QD 3LL4A 1I1HA 2DP4E 3G0HA 3ZXIA 1T8SA 4KYIB 1PHRA 3VH1A 1U8AA 1Z5UA 1HFEL 3IP7A 1UP6A 4RMGA 3T35A 1ONSA 1TW2A 3NOXA 1G0OA 1I32A 3K0HA 3MT0A 4ETNA 5DBIA 2AN4A 3SJCA 3A6JA 2HHCA 4X91A 1SCJA 2CL0X 2BFWA 2ZYGA 2QAIA 3L1HA 4KXXA 5H5JA 1DQZA 5FOQA 5JANA 3RWBA 1OFHA 5LLDA 4LI0A 3RAPR 3ANNA 1NXOA 2QXUA 5DHRA 2XZPA 2ZJFA 1PJAA 4WNIA 3NDBB 4K9OA 5IAJA 1N9KA 3MQFA 1MX3A 5CNKA 5CA0A 1HDZA 1OX4B 5I3CA 2M2IA 1Z82A 3HGTA 4OHOA 2NUTA 1ZN8A 4PYJA 2WTXA 3PK0A 3R4CA 2HBRA 2QL7A 1ILWA 4JLDA 1RCTE 4YAWA 1P9OA 2JAHA 3TLMA 1WS6A 3ONNA 4MS3A 2V58A 1XZIA 4ZEMA 1XDWA 3Q8LA 2WUDA 2OCAA 3ZQ6A 1M8JA 3LRXA 4BFCA 4PNHA 1FFXB 2PT6A 3M5DA 2WU1A 2ATEA 4BAUA 1FW8A 1SBIA 2D5LA 4BLTA 2VA9A 2HXSA 4XRGA 1R0RE 3CZPA 5DKFA 1Z74A 2WAYA 3WK4A 4KAAA 1Y42X 1PEKE 3H5RA 3RB8A 1MJGA 4O0MA 1K6XA 2O07A 4ZDWA 1BW9A 1UUFA 3HFGA 3RBXA 4F3NA 5IS2A 3WGKA 2WG2A 1C3JA 3MGCA 4OHZA 1Q5PA 4IIVA 3KKPA 4FK8A 1NYRA 3H2IA 3A9CA 3ZD8A 1LSSA 1N0UA 2H2DA 3HM9A 1E6MA 2IE8A 4JJAA 7YASA 3DTYA 3FVQA 1U3DA 3JALB 4R0VA 4I4TF 1HE2A 2J3KA 2PS9A 4KVZA 4DIDA 4E1VA 2WFLA 5K8VA 3IDAA 5JS2A 1KXJA 3CMMA 4RIEA 4EG7A 4Z0TA 3IDZA 2CE2X 3NTQA 3LPAA 4BOYA 3HK2A 2XI4A 1NJ5A 3IDQA 4OPMA 1DKQA 2YMLA 5DNVA 3BXEA 4MSUA 4RFSA 3LY9A 1II8A 4TVKA 4Q9KA 3V6LA 3SQXA 2FWRA 2PMDA 2WLSA 1HR0B 3HU5A 1XDZA 5BN4A 1ZD5A 4OI1A 4EKGA 3RUCA 1FRFS 2P0AA 3ITDA 2VRBA 3CZAA 5HCNA 1RP7A 3I4LA 1NVMB 1Z5VA 3SJBA 5HRUA 3QP9A 2Q3LA 3WYEA 3ADBA 3IOMA 1T24A 4D3DA 4V0LA 3DKKA 2Q7OE 4F3CA 1Z4IA 1M7BA 3OOYA 2YUTA 1XE3A 1CE8A 1JJAA 3IERA 4XUGB 3WB9A 3CURA 5HE8A 5BMVF 3GCWA 5BR7A 3NUGA 4A0SA 4P3YA 5GV8A 2BSXA 1JL3A 1PT5A 1G64A 2G3YA 1EJ2A 1NZDA 2P90A 4C7VA 3I8XA 3DE5X 3VOSA 1YAHA 4AROA 4FYHA 4YRGA 2E9SA 3U1VA 1JBEA 3IVGA 4MDEA 4FWBA 1HDGO 2XHEA 4GD3Q 4G24A 2I4NA 4II3A 4K03A 4TTVA 4MX8A 2ZM6B 3EAFA 3G79A 2MR6A 4DFDA 1AZTA 1QG2A 3DNFA 3OQIA 3PYXA 4X71A 1OC2A 4JX8A 1H8ED 3ORRA 3V4FA 1KZ9A 5GM1A 1ZSVA 1O3YA 5P8WA 4MAAA 3IALA 3FDZB 5JV5A 4IGAA 3NI2A 2C94A 3A1FA 1V7CA 5H9VA 4H0NA 5HMLA 3SC2B 2Y77A 1X70A 3DZIA 3MHPA 4PG4A 5JAZA 1CRWG 2HBQA 2XQGA 3CUVA 3WSVA 5IHPA 2JIZD 2UYHA 1ZY2A 3GFPA 3LDAA 4L3VA 3CVVA 2H4HA 1D2EA 3M33A 1E9BA 2IIPA 4HGZA 3WBKA 4JJ8A 4CF4A 1EYZA 2IXEA 4TZ0A 1WW3A 1IM8A 4LHYA 2ZRJA 3VU0A 4A03A 4CR7A 4ON9A 5KOHB 3JVDA 2YVKA 2BE7A 3IE2A 4B84A 1RTTA 4TMKA 3ZJYA 4EG3A 3OFNA 1DJPA 4DLXA 2XCSB 2DZDA 1E3TA 2OD7A 2E4YA 3SEZA 2UUAB 3EEFA 2C3YA 5DT9A 4MQ4A 3R8FA 4IZ6A 4QPDA 4W8OA 5ESXA 2GAOA 2CXHA 4B17A 2OO5A 2PKEA 4S3MA 1PG0A 2NOAA 3A6LA 4EHLA 1U8XX 2C5HA 2BEWA 3O2SB 1GVHA 1FUKA 2G0TA 4HNRA 1ZC3A 2EW8A 1GEGA 1XYGA 3LU1A 4HBZA 1NQVA 2XB9A 3I6ZA 5DPMA 2ZTUA 3EDRA 1CT9A 1XTKA 5KYVA 3SZMA 1DKRA 2D2EA 4FOPA 4JUIA 4AT1A 1MEEA 4I50A 5H1YA 4RKQA 1BMTA 1Z35A 4CM4B 1GPBA 2WKQA 1JAIA 2GJKA 1W88B 3W8FA 3BMOA 2V65A 1QLJA 1W36B 3PQCA 1CNMA 4Z2YA 4K1LA 1OBOA 2ZI3A 4M8KA 2H54A 3RSGA 5BSRA 3QVJA 4ZI7F 2C0CA 2X15A 4CCAA 1M5TA 1Q0SA 1IC6A 5JVDB 1PFKA 1DBQA 3E03A 3VNUA 3VKGA 4QGSA 4GM1A 2ZRLA 3I37X 2W7TA 3TINA 1KK3A 4Z4HA 1RJ9A 2CLHB 2CWDA 1C1XB 2P9QA 1HNXB 4E94A 1R0SA 3QFCA 1QH0A 2AQHA 3IEPA 4RL6A 4UDOA 4YMUA 3H2JA 2WSYB 3RRBA 2XGGA 1T13A 3FUWA 2NVUA 2D7DA 1SK8A 1N2SA 4JLPA 1IUKA 4M1MA 3UAVA 5IBCA 1WD5A 5AWFC 3AY0A 3TLAA 3VPXA 4M9CA 3GUUA 3G0OA 3FOWA 5D5HA 5A5DA 1BX3A 4K9MA 1FBTA 3M0EA 4I9GA 2Q1UA 4E5UA 3AIIA 3OE1A 1AKYA 1RQ7A 2CHFA 2EWMA 3OJCA 1VMDA 3HP1A 2Q62A 3VAYA 2F8LA 3KKEA 5G1PA 3Q5GA 1UPXA 3DAHA 3LE8A 3NNSA 5DNAA 1S89A 4JBLA 4NBTA 5GTDA 3FCAA 1I7DA 2IWRA 3UK6A 4UHCA 4MS1A 1AGRA 3OSZA 1AN9A 2A9QA 2C5FA 3U19A 2EOAA 2X41A 5M7EA 1UZAA 2VHTA 3VX4A 2E3JA 4PQRA 1XVVA 3SS7X 3MGGA 3SQWA 4C2TA 4O1IA 2FX3A 1L5LA 4OHUA 4TWZA 1FXWA 3SFZA 5EIXA 2FLKA 5C3MA 4K40A 2PXCA 1VRVA 4J0FA 3B3AA 2YFHA 3HB0A 4PFSA 3T99A 1QH9A 2A5GA 2FGKA 4LYFA 3NFRA 3CW2A 5FUWA 5IFLA 3G8DA 3H5VA 2R86A 4WEQA 4Z2AA 1I0ZA 5DYIA 1M83A 3H5TA 4NU5A 3DZBA 1RYZA 3PWSA 1LTHR 1N1GA 2YXLA 4PYKA 5GVRA 1IULA 4DPKA 4HUJA 3D7MA 2DT8A 1AV7A 1R6UA 5JO0A 1RVV1 4N39A 1FYXA 2ONKA 3PC8A 3BC1A 4KMSA 1MO4A 2INGX 5IK2D 2MWMA 5EQJB 2Z3ZA 2JIRA 3GJ8A 4EBFA 1V41E 3H86A 5BSKA 5CDFE 2F4VB 5F51A 1G6KA 1RXVA 2HMWA 3BERA 2MSEB 1X1QA 2QSZA 2PX4A 2RIRA 5BQ5A 4EW2A 1JMKC 5I8ZA 1MD9A 5A4DA 4DANA 4FINA 4JVMA 4F7DA 4IJKA 5FV4A 4L5CA 3T7KA 1CTQA 3EIFA 3OJWA 2WP8J 4S04A 2XCIA 2YQZA 1NDQA 2J0QA 3IQEA 1U1EA 4FHCA 1UJNA 4M9RA 2OZPA 3ML1A 3NT2A 3W2HA 3FOBA 1Z12A 5IN5A 5EZYA 3LX5A 5PGMA 4E11A 4QFCA 1JLKA 1MH1A 1FMFA 4O4HB 5IJ9B 3VVBA 3HCWA 1IJEA 1GN8A 2VEDA 4B0OA 1FQKA 3JQ9C 1U81A 3OU6A 1VE7A 3DT9A 4PXYA 5IBPA 4FXPA 3RC2A 2PJDA 2RGYA 3GVCA 1DBIA 3EZ9A 2ZETA 4X8HA 3ILYA 2R6FA 2NQTA 1X6VA 3R7WB 1M1YB 1V7ZA 1GAJA 2CNOA 3L6RA 3CMCO 5FLEX 2C88A 2VSNA 3DEJA 4GQBA 4P93A 4AKHA 3PF9A 4EOGA 1I9GA 3PE6A 4LY6A 1IZ7A 4I4NA 1CZNA 5DH9A 4AJ2A 3D8UA 1SHTX 1T2VA 2IUSA 4LHSA 5DJ5A 4KOEC 1XAGA 2GN0A 1U2DA 2I3GA 3LQFA 1QQTA 2OYRA 1O4VA 2WEKA 4F91B 2JLXA 3ZY3A 3FCEA 1V95A 3DQPA 4NXMB 4DQLA 3QKSB 2C8KA 2WU3A 3R6WA 4IJ6A 3KHSA 4Q1DA 1K5PA 1FNSA 1PV2A 3SF8A 1UM9B 5K01A 3IUPA 3PTAA 3B3GA 4AY3A 1WXWA 5JARA 1TXGA 3L4KA 1I7PA 1PGPA 2H0QA 2I8LA 4NEQA 4OGFA 4DDMA 2OTCA 2V6FA 4Q4AB 4AKGA 3DO6A 4RQTA 4DL9A 1ZLYA 5EIFA 1JT2A 5D3ZA 3C3YA 4GNRA 3B2EA 4H4DA 3DWEX 4UXIA 1XEWY 4XQEA 5JY1A 3FYSA 3L2OB 2G4LA 5EJMA 1A77A 5LQKA 3UM9A 3ER8A 4IOKA 1XEAA 5EGSA 3O4HA 5BWOA 1NASA 2R9VA 3LCUA 1LJ8A 1KP2A 1U0RA 3GLUA 5BV1A 2OCBA 2W6ZA 4DABA 1UBSB 2XVMA 4Y2TA 3CUTA 2FZ4A 1P1BA 1KYYA 5E6UB 4NDNE 1E5XA 4CQMA 2A5YB 1G1MA 1Z0IA 2AXPA 4X65B 3HVRA 1R6AA 3EFOB 4UAVA 2AEEA 1TYZA 1X7XB 3VPFA 2QVBA 3AOEC 3JQAA 1C4XA 4L57A 4NQRA 4Y1FA 3EVCA 4NQZA 2PJUA 3AESA 4XD7A 1IOLA 1SAYA 1E3DA 2PZMA 3G9ZA 3GRFA 4WBNA 1XP8A 1WUHS 1IEWA 3ICVA 1KK2A 4R05A 2FZVA 4Y0AA 5DCLA 3T06B 4U2EA 4CKCA 1D9XA 2C3OA 3HXLA 1TUEA 2OAP1 3NOOA 4UAGA 3TZBA 2M6RA 2HFKA 1F14A 1GHTA 2XMCA 3PHHA 4G5GA 5G2OA 2VQSA 3JYHA 2YWBA 3Q5DA 4EKDA 1R5OA 2QN3A 5AVTA 3LXXA 4QOEA 3THYB 3CUEF 3S40A 2GLUA 3IR6A 1YIOA 5CFOA 4I1PA 3IEVA 1YDMA 2CVQA 4TYPA 3RS2A 4G1BA 2XW6A 2H59A 2W6NA 1U3UA 3AUAA 4G23A 5EIWA 2IRWA 5IWCA 1PL8A 3EVFA 1XCMA 3DUFB 4RS3A 1QO0D 2PG3A 3MUEA 2XD4A 2X14A 2CV1A 3O4JA 1XYYA 3WICA 1FFDA 1KEUA 3LYUA 2WDZA 3NDRA 1JHYA 1X1DA 2P62A 4RWEA 4WEOA 2JFUA 3LV8A 1VL0A 1TM7E 4A0FA 5I9SA 5DXAA 3W2TA 1B0PA 4MVJM 3CNQS 4L95C 1MNAA 4MLCA 4RIFA 4UUQA 3WMFA 3DC2A 2ERXA 3DTVA 1M9NA 3DZJA 2OBNA 3HFJA 4FYKA 4L50A 4K5QA 3WZ2A 3G82C 3AG5A 2UYCA 4OK5A 1CZKA 1JDNA 1YRBA 1UMKA 3NXSA 1NE2A 4QAJA 1QIFA 2IWHA 4CKEB 2L19A 1S8FA 3RS7A 2BEJA 2QN9A 2V45A 3EE6A 1T6NA 1ZGAA 2CMFA 1XZMA 3OEED 4W1RA 2WWYA 1UDXA 4B3XA 4OP2A 1S2LA 2ADMA 3K2BA 3VA7A 5M34A 2OQ2A 2B82A 4MUKA 4Q5IA 1AA9A 1LNSA 2BHRA 2ZBFA 3GELA 2GLTA 3DDUA 3UNXA 3WXBA 2QK4A 5CFZA 5JEDA 1T9BA 2PV0A 4WTOA 1OSNA 1ND5A 2ZWPA 3BTUA 1GQRA 1W8IA 1BEEA 4XTCS 1YZ3A 1KK1A 3RTCA 4HNUA 1J2YA 4NX2A 2QE7A 1PD1A 3ESQA 4YAUA 1EMDA 1QRUA 2ABWA 5EXPA 1SUWA 1FXUA 5C8ZA 2VNKA 2V03A 3URKA 2HRQA 1ZCJA 5COAA 3TW8B 2BJHA 3EBOA 2WWFA 1VLQA 4UE6A 4H18A 2VAWA 2JEOA 3EGVA 4X1YB 4G37A 5DWDA 4TSFA 2E48A 1OI4A 1CJSA 2AW3A 3Q3JB 4HS9A 4M36A 2B8NA 3B38A 1DEAA 3UZUA 3W77A 4CCWA 2CK3D 3MWKA 2ZKIA 1T34A 1E9RA 2LCQA 4QIHA 2J6IA 1U9ZA 3DM5A 3WLPA 3ZY4A 3WA7A 2H9YA 3A1SA 3L8ZA 3P9XA 3DUWA 2A1IA 2OENG 4U3JB 2Q3BA 3C6BA 2BMFA 4XWAA 4BVLA 3EGIA 3CVWA 1BE0A 2DF8A 4JI2B 5I6DA 3PSHA 1P2GA 2FH5B 1FDSA 2N1BA 2XWSA 4X41A 1ZVJA 2D00A 4B3DA 1DEOA 4B3HA 3PNVA 1ORRA 2X86A 5AQ1A 1CFZA 1XL1A 2I0FA 2IP2A 5F12A 1OH5A 4B7ZA 1RYNA 1MB0A 3ZGNA 3OSUA 3JR7A 4Q4HA 2X8WA 1LVUA 8GPBA 1C3OB 2AHOA 4PSAA 3PHJA 2NM0A 4MK4A 1HZJA 1Q2UA 1E3IA 1MX1A 1PS0A 3NBZC 4GZLA 4Z6KA 5DDIP 5AOAA 5JE8A 4CN8A 1GGMA 5K3AA 1GGEA 1AGPA 3OWOA 1AXGA 3D1LA 1PI3A 4R2KA 5EWLB 5I7AA 2NW6A 1WF6A 2VHUA 2WWRA 1IHDA 4JASB 2ZSKA 3A26A 3H9QA 4ME6A 1PWEA 4U00A 4BYGA 5T7BA 1WU8A 1DAKA 2C4UA 2EKDA 2ZU6A 3C1AA 4JB8A 2JLUA 1IRIA 1FRNA 1IAVA 1TPYA 1VJ1A 1ZD3A 2IHBA 4KQCA 3LVBA 3PZRA 2AN1A 3UC9A 3A36A 3V55A 3PPIA 2R6CA 3L04A 1DBSA 3REOA 4EHFA 3O47A 3SQMA 1Y9EA 2NZUG 4TTTS 1EK1A 1LDEA 2WBLC 1GTVA 2CJWA 2VH5R 2VF8A 1KR2A 3C3BA 3LC2O 3OOHA 3PEUA 4HNSA 4YUYA 3H1TA 3TOVA 3RIGA 1JSRA 4MB2A 1XR3A 4Q4JA 5TEVA 4L3OA 2AX3A 3HDGA 3QQPA 3QZUA 3HNOA 3VKUA 2J3LA 1TQ8A 3DZ8A 4RTRA 2PUAA 2GPSA 5IJWA 3KV3O 2Q9BA 2EGUA 4ETMA 1NQXA 3E15A 3S2IA 5AHXA 4JROA 3FI9A 1LX6A 1IXRC 4RGYA 3KOYA 4HAOA 1HTWA 3UBTA 2JZOA 3CVYA 3FRIA 3D7LA 1LDGA 2IUYA 2GZ1A 3ELYA 3GVIA 6YASA 1Z4LA 3KQNA 3AO0B 3LCVB 1N32B 4CF3A 1L8AA 3MAJA 2QI9C 3QEMB 4QWMA 4MQEB 1WDWB 3BCRA 4DM3A 1LRJA 2XKAA 5TGTA 4HMOA 5HF5A 4D3SA 5K9ZA 2WP0A 2NVWA 3FLBA 1FJGB 5HIMA 3DXZA 5BPHA 2QM3A 1QX3A 3CGGA 3V4VB 3WL4A 4Q3BA 1R12A 3R23A 4FBGA 4N3CA 3MWEA 3OF3A 4ZCQA 1SULA 4E70A 5K05A 3CEHA 4IICA 1JPJA 3R3UA 2SKDA 2W22A 3FXAA 2X8JA 2Q5QA 1NATA 3OCWA 4MO2A 3TOZA 3OJEA 1CX9B 3MQ2A 1KBQA 1N2HA 1DWPA 1YDFA 1QKKA 1CB0A 4UM5A 4QU5A 1TI7A 4D79A 1A4UA 3M83A 1Y3IA 2P2ZA 1O54A 4F4IA 2CLMB 4LCJA 5FUQA 4URHA 5IJZA 4MHSA 2WTUA 1CVIA 2CE7A 4JBXA 5EY5B 3T7DA 5DHQA 4K9DA 5SV2A 3ZXSA 2ZBVA 2PO5A 3AXSA 3KKNA 4OBXA 5JCOA 5E4TA 3EZGA 3I3OA 5KDDA 1M1XB 2HRRA 5B4UA 1JMVA 2HADA 2QJWA 1CU1A 1LBIA 4XYBA 4HWTA 1ICIA 1DC7A 1MN6A 1N5RA 1HOXA 1NKTA 2N75A 1WP9A 3KQQA 3JVUA 3NP7A 3S4YA 5AM4A 4KQXA 1JHDA 4LXUA 5LZ8A 5BRJA 1X3SA 1MOQA 5I51A 2CJFA 4NR0A 4XDYA 1PSZA 5CB0A 1YI0A 2Y1KA 1YB1A 3BTSA 5DRYA 2OPHA 4LHWA 2F43B 2X5OA 1T8UA 2GPWA 3AJ9A 5AKIA 5EKDA 3OHMA 4HADA 3T7CA 1Y37A 3GFTA 3ZUPA 1S1MA 3QV1A 3SIWA 4REMA 1YZQA 4EI9A 1OFUX 3N7TA 1GNRA 4MAFA 4ER0A 3VR3A 5J1SB 2MDTA 2XNKA 3EUAA 4UVEA 1OB2A 1UT6A 4WKNA 4ALLA 3DW3X 1TA9A 3QBTA 5HVNA 1OLXB 3TM4A 2IYQA 4QTZA 3R9IA 4A2QA 1E9VA 1C8VB 1U2TA 4IINA 3DT6A 3UTCA 1M8PA 1G17A 1K6IA 5LB4A 3A6HA 4YXWD 2XQJA 4D5GA 4E1BA 3C5CA 2R8YA 5B1IA 4LYAA 3WA6A 4BE4A 3STXA 4XD2A 3RBZA 1AD2A 3GLRA 2IEDA 4XSHA 3V6MA 3ASYA 3VXKA 4DG9A 5FOUA 4NJEA 4B3IA 5IVPA 4NOLA 1GG8A 1K7CA 1VP9A 2HGSA 3Q2KA 4OH1A 1WUYA 1P61B 2FR8A 5GQSA 5BR1A 1KBOA 2EGHA 2GHQA 5TVKA 3L8HA 1AM4D 2L17A 3CKLA 3CU5A 3T3GA 3ZGLA 3CPEA 3WFIA 3VDMA 4F2WA 2OK7A 3PYMA 4M0MA 2HK6A 1RRKA 3K9NA 2I2WA 4JIGA 4KAXA 1NNEA 1ELOA 1XZGA 1JLLA 3L3BA 4L3WA 1E9CA 4A9AA 1Y8ZA 1B8PA 3O3NB 4MW0A 1PUXA 1PG2A 1RW4A 3JQ8A 4W5QA 2B1JA 1L5RA 5A4AA 4FHDA 2O14A 1V7PC 1APBA 2X5JO 1ZCBA 3MGAA 1IB6A 1RAAA 5JJIA 4I0WB 3OPNA 3EDQA 3BXZA 4WLUA 5A3JA 4HZUB 1JJFA 1RAGA 2O7SA 3E7WA 4ENTA 3UUWA 4W1SA 3H1AA 4B8WA 2PWBA 4X1KA 3THOA 2B35A 3IAM1 4WXEA 4UTPA 3EXIB 1JT9A 2AD5A 3A9WA 2D54A 1YKSA 1QK4A 3CNOA 5ALHA 3O8RA 4RH1A 1WKBA 4E1AA 5B64A 1DWUA 1KXZA 2I87A 2RJOA 1I5OA 1XCOA 3IELA 4NNOA 3WGZA 4W5TA 1O6CA 4IHKA 4NV0A 1U65A 4W9NC 1XDBA 5CW1A 1KOFA 1Z0KA 2AFRA 1W59A 1BMFD 3Q9LA 1E5QA 2J3IA 3A2LA 4UD6A 4YPOA 3P5SA 1W36C 4GPD1 2K87A 4U63A 5CBPA 3NEJA 3QE3A 1JJBA 4WY5A 2II6A 1WCV1 2BFCA 3DWIA 1DNPA 1T29A 2AOWA 3RUHA 4LUCA 3G2IA 2GPAA 2IGBA 1MJ5A 1AV6A 2B6HA 3NTOA 2E4AA 5EXDA 4BFXA 1KZHA 4BP1A 4J3FA 1YB7A 4JJKA 4G56A 3NWPA 2ASEA 2ZBRA 4A2WA 1VIAA 4F5EA 5ALZA 3UWDA 4JVNA 4TUYB 1EA5A 4LJ7A 2O7QA 1RWVA 1U8ZA 2NV0A 1LVGA 3OHPA 4MULA 4ESHA 1JSCA 1X42A 5KNDA 4HVCA 2HGZA 2O8BA 1DUVG 3GJ6A 1ACMA 2DUJA 3LQYA 4QL3A 2W6IA 1ECPA 1KQ3A 3QHQA 3WMGA 2F8TA 2PEYA 3IMCA 5EMLA 2FPXA 3FUTA 3CIOA 3QHAA 3GGPA 3WGJA 4B8YA 4NFYA 1CF4A 4Z3OA 1YNSA 4ZIRB 1KERA 3HWWA 3BMQB 4AFNA 2Y1XA 3S7ZA 4M0PA 3OJLA 1ABBA 2XCRB 2GJ9A 4ZC1A 1IG0A 4BFUA 1EKXA 3FCUB 5DM4A 3AV3A 4MV8A 4MUGA 2IU4A 4E2FA 4LRYA 3DAFA 4KE8A 4WN9A 1JX6A 4DRXB 4JT9A 4PM4A 5LL6P 1J22A 4WY2A 5FOXA 3R7AA 1SIOA 3H2GA 1EHIA 3LY8A 1D4FA 3M6IA 1Q17A 2D4AA 2WI8A 4M1ZA 1NVDA 4PONA 5G53C 3I62A 5CG2A 3LM8A 5B1SA 2IEGA 2JAUA 1FYVA 3C4VA 2FPGA 2ZJBA 3GOQA 3KOXA 3RKSA 3QW4B 4CKBA 1AQ6A 1E6LA 3E82A 2DWPA 3OX4A 1A8UA 2IUTA 3U7QA 3ZG6A 1EE2A 2QE6A 1BS9A 1R6BX 4YJDA 1ZIPA 1V4BA 3LBYA 1LGYA 1BHSA 2KLBA 3HCEA 2JFWA 2C4HA 2ZJ4A 4CV0A 3AP3A 1N6IA 3KZMA 2XT0A 5CYPA 4JI3B 2GAFA 2H1SA 4LA4A 1A9RA 4F4UA 1XI2A 1VE3A 4C0SA 1B1AA 3AEQA 2VPPA 2XE7A 3IVXA 3P9RA 3W2IA 4LZAA 5HCIA 2MOKA 4OXRA 3CEJA 3AEUA 4R2LA 1VYHA 3LUGA 2BFDA 3EVBA 1GL7A 3FE2A 3IP1A 3IBGA 1XTSA 5EE0A 3SOZA 1U99A 4UUPA 1FU7A 3UUFA 3U1BA 2JKZA 3FDXA 4GVPA 4L8YA 4KPUB 1ZXXA 2JJYA 3RRMA 4X61A 3WIEA 4D4LA 2NG1A 2GQ0A 1GUBA 2PVSA 5JZVA 5JD6A 1CJKC 2ORED 2YNMC 1OBCA 1P1HA 4IYRA 1EJBA 4PIMA 4C22A 4J3JA 3CIFA 3PE4A 3SDSA 4U5QA 1LEHA 1E2UA 2ZE8A 3TQSA 3ZK7A 1L8OA 1R0CA 2HDOA 1BEUB 1U7HA 1VPVA 3KQWA 1FVXA 3HS3A 1Z68A 4LMBA 3HKBB 3RHSA 1LCIA 4WI1A 4DKJA 3UMFA 1V1MB 4URUR 4G81A 3DBRB 5J63A 3SF8B 3ONWA 2IY8A 3HM2A 4KQWA 4LRSB 3FMVA 1LBSA 3LO5A 3U0BA 1J0AA 1M66A 1NFQA 3AFNA 4TLBA 4DJEC 4B45A 3UWMA 1C8LA 1OOEA 2P9ZA 2V97A 2ZYUX 3CZCA 1E98A 2QUBA 4HEA6 4PX2A 5F2NA 3D8BA 4PLTA 4BO2A 2LBPA 5E8RA 3MFQA 1JEAA 4KDEA 1WMDA 1TAUA 2BBWA 4PF1A 3VZQA 1PNVA 4QUKA 1KZ7B 3I2GA 2IDKA 2WJ4A 2ZBGA 5C1PA 2HT6A 5KYUA 1T9KA 5KKCA 2QYOA 2BGGA 3V4LA 2LP4Y 4HR7A 1Q1GA 3GLFE 1KEVA 1D3AA 4GOOD 1B0AA 4MUHA 4BCDA 2GNOA 1VP3A 2JIMA 1XBTA 2FR1A 3MWJA 3OWXA 2FJPA 1TZJA 2Z56A 1N2CA 4LOLA 3EIOA 4EY6A 5JMTA 1DC6A 2Z5GA 1OZAA 4EAQA 3SC6A 2OAGA 1Z62A 4MV0A 4LW8A 4NFLA 4R7GA 4DW8A 4N54A 2IPAB 4CBVA 4FMDB 1RACA 4X62B 3ZI7A 1OBFO 2B3DA 4UM9B 3WKAA 3CJTA 1NNI1 3LPMA 1J09A 4XQCA 3TGLA 2V5AA 5KYYA 4LBYA 3G7UA 2WFZA 4OLHA 4WOCA 4CW7A 4EATA 4B79A 1WXEA 2EG9A 4Z4GA 3EULA 3LYHA 4L76A 1QGAA 3WHKA 1W4RA 2ZJ7A 2TS1A 1GRRA 3BRQA 5KSZA 5CA1B 1VIVA 1CF2O 3A4IA 3L01A 3NHRA 4JODA 3QTLA 4RHYA 3ZNNA 5FLXA 1E0JA 5FBWB 4XZ3A 2PQ6A 3GGOA 1QKIA 2G6BA 4R9UC 4RV4A 2YY5A 4L0CA 4GWKA 421PA 1N3YA 3I45A 3Q10A 3PQEA 1GLVA 3O8DA 1P80A 4NP6A 4DB2A 3ETCA 3ZI0A 1J9ZA 1KDYA 2VG8A 1Z0DA 1NE7A 3R5HA 2FQ1A 4NBNA 4OFWA 2EWWA 4ND3A 4U2GA 3KSMA 5A04A 4CKWB 4IXTA 3IT0A 3BG5A 5D3QA 1A3CA 4TQUS 5FYDA 1DHTA 2F1HA 3ESRA 3R76A 5ADUS 1U9JA 3UMYA 1GITA 1L5SA 2ZQ5A 1UBLS 5E38A 5ILOA 4LOAA 5EG5A 3EOBI 4DIMA 1TYAE 2REBA 2A5DA 3KQSA 1XRLA 4DV2B 3CVOA 3T1NA 3UWOA 4F9FA 2BSQA 3PXCX 2W8BA 8ABPA 2HA3A 3KPWA 1JR3E 2J5QA 2H4ZA 2WVJA 4RTKA 1ZD9A 3L0PA 1FDUA 3M6FA 5ALSA 4TXHA 4EPVA 2CLDX 3F7OA 6NULA 4JI7B 3WGTA 1N2GA 2R1ZA 4LC1A 1L5ZA 3ED1A 4BE9A 3ECAA 3NKLA 3CHYA 3JD0A 3NNNA 2GKGA 1Z6PA 1ODIA 1T9GS 1OVGA 3H5LA 3AL0C 4OMFG 4N7BA 4GX2A 3D8HA 3M5CA 3BT7A 2IZ5A 1FFCA 1OHHD 3EXEA 1J07A 3HCAA 4DR3B 2ZE7A 3VYRB 4KL8S 3V33A 3PD7A 3J7TA 1O03A 1UAYA 5EKUA 1QYIA 2G7ZA 5B7PA 1ZO8A 1EFAA 1Z34A 2QW0X 3HJBA 4L8WB 3TI7A 1XMQB 1BVRA 2OBBA 1Y9AA 3BWYA 3FPAA 4YMTA 5HR5A 2FU5C 2CVZA 3JARA 3EFEA 1E60A 2I2AA 3B51X 3ABIA 3LKZA 4KFUA 3P9KA 3K1YA 3VDRA 3D4PA 1IN1A 5DWQA 3NM6B 1HT2E 3WNBA 5E2BA 5L7TA 4UNPA 4GSYA 3LD9A 1PNQA 5ECWA 3S68A 2FSHA 1OXUA 3CZMA 4IQ4A 3ROTA 4OHYA 1XZ8A 3LNCA 2JBWA 3CZQA 3IT1A 3RGGA 5E0KB 4U8GA 1EAYA 2VAMA 1CR2A 2XODA 2RE8A 3AUXA 3K73O 4FYIA 2AFHA 1MOSA 2PRIA 3MIZA 3PX2A 1C0LA 3JR3A 4P5DA 2NO7A 1G2QA 3COVA 4AUMA 5KJ6A 4AWXA 2ZGVA 4WLNA 4OHFA 5HJ2A 4RDXA 2CLEB 1Q0LA 4MIOA 1GA4A 1DXYA 3E35A 4LY0A 3KYCA 3IQXA 3RD5A 1ULSA 3EG9A 4KQKA 2FPUA 4RELA 4QRDA 5F77A 3RQIA 3TZEA 5HBRA 4BNLA 1PR1A 2FN4A 2G9ZA 1DKOA 3DOUA 3F97A 3CLTC 3H1GA 4I19A 1OIWA 4Y2VA 3U7JA 1J9EA 5LQRA 5DASA 2BZSA 3WGMA 2AR0A 4WACA 1JDVA 2ZRDA 3AY3A 3L8CA 4UBMA 4UQOA 5AESA 3GBPA 1AUQA 1JDTA 4IQ8A 3QJ5A 2NU8B 3RYIB 5ITVA 5JSUA 2P2DA 1RXCA 1OX4A 2CV2A 2VTVA 3QM1A 3TO5A 3I9NA 2QQGA 4P7JA 4HNAB 3W34A 1ZIOA 4YV2A 3L6OO 4KC0A 2J08A 2OHXA 2Q46A 1WTAA 3M34A 1CIPA 4US1R 5JNTA 5DISB 3G2KA 3K53A 1T5SA 3CUYA 4GZ6A 1FLAA 2JJ2A 4I2VA 3TTYA 3AINA 1H1LB 1B15A 4B6QA 1FFXA 1U2GC 4KUHA 4PVDA 5D51S 2P7HA 3MYYA 3R3VA 2O52A 2QG9A 4MVXA 3W1VA 3UXMA 3WJ7A 1T15A 2W90A 2XLCA 4ECAA 1JWLA 1Z6QA 4L5AA 4NBSA 4EWLA 1YZFA 1LLUA 4DR1B 1UXKA 3C8ZA 2ZUEA 3IYLW 1F3LA 3QMWA 4URXR 1PR9A 4JIMA 3AVQA 2L2QA 4LNHA 1IN8A 4OK3A 4RIGA 4NH0A 2FWIA 2G77B 3JXEA 2FUG6 2GTPA 3B89A 2OV4A 3D0QA 4BAGA 3WGHA 4H7DA 1E2QA 1Y1PA 3P2KA 5J1TB 1HFWA 4BRWA 2BKVA 3U56A 1XCBA 3NGMA 4PCVA 5CK4A 5IKEA 5T4FA 1PYOA 5B58T 3M3HA 1T2AA 4A6EA 1IPHA 3E9DA 2HD4A 4YJ2F 2X7JA 4AIIA 1AQYA 1XTRA 5K3DA 4MAMA 4PV7A 1CRLA 1YA4A 2HMYB 3UG6A 4DYHA 1OTXA 4LVUA 5H80A 3I9FA 1KH1A 2K6GA 2Q3CA 4PBSA 3SNHA 3LTEA 1O94A 1ESEA 1PIWA 4LMPA 1PR0A 2Q3JA 4GXQA 4U0KA 3ZKWB 4OQXA 2BF7A 1CP2A 4AJPA 5KNBH 3AZQA 4IXMA 1RYDA 1EHYA 1QAOA 1ZOOA 1CV2A 2PIDA 3KDAA 1KSJA 5CXSA 4A91A 4R31A 3HSKA 3W6NA 3E3MA 3BKXA 3TVYA 2QJRA 3VSDA 1XTUA 2GZ3A 1VB5A 4TLMB 3PIIA 1YKFA 1R3DA 1NY6A 3HCOA 3ND8A 4QJ5A 5DI3B 1U0TA 3HXTA 5KYWA 1G5HA 4ZV9A 3VC7A 4XPIA 2AMVA 4QYTA 3I6BA 1EFPB 4Z51A 1N9ZA 1SXJB 2PUVA 2VNJA 3RV4A 3SGLA 3KT8A 3H83A 4KHPB 4OHBA 1EX7A 1OX5A 1VJGA 2WYHA 3F5DA 3KVVA 4S2UA 5AVYA 5C1BA 2H8KA 1VG1A 2DBYA 5B58C 2AG0A 3W9UA 1YZUA 2IPNA 4E46A 2IHVA 2XMGA 3PNPA 2ZS7A 1YV9A 1I3KA 2BGJA 2Q2OA 2ID8A 2YINC 3DE7X 2JASA 3PCRB 3VPDA 1FUEA 2GS9A 3FOAA 2O1WA 2R4UA 3D3NA 2OGSA 1N7HA 5C4GB 3WYCA 4P36A 3SOPA 2FI1A 3QW2A 1RBZA 1BQ4A 3N59A 4QJ3A 3FDZA 3ECSA 4MRVA 4GQAA 1ZWLA 2VYNA 4A16A 4JLWA 4H1UA 2FUEA 3NHSA 5F98A 4BASA 4UKDA 4WOKA 5TXGA 4BNDB 2UUBB 1P7VA 2QSUA 3QYPA 3UA3A 3CZ5A 4H7FA 2ZUCA 4Y2GA 4V0OA 1Y63A 4P0QB 2DUNA 4R54A 4MP8A 621PA 4A26A 1FXSA 4M1KA 1G3UA 3QBEA 4XAQA 4F6RA 3D7NA 5KOHA 3T4PA 1R10A 1I7LA 3FNQA 2BMJA 2PWAA 3HCCA 4YDHB 4HQ6A 3LVRE 4JI1B 4LAFA 2W00A 1NV9A 1EZ1A 1QAMA 1E9AA 3IPRA 3QLVA 2VJYA 1RABA 3KB1A 3NM4A 2F9FA 1YQEA 2W2LA 1P33A 3QXXA 2VPIA 3E0QA 4DVJA 2ISSD 4MGIR 4X1IB 5AVXA 4Y2JA 3OIWA 4OMUA 4HWPA 1AK1A 1SQ0A 4HV4A 3R41A 3VZDA 4N5MA 3G2LA 2C96A 4ER6A 4L22A 1C7ZA 4B3MB 4GYYA 4OLBA 1EWKA 4KQ9A 4J4TA 3CQ9A 4KQHA 1PGOA 4RYLA 1I3CA 2RARA 2WKPA 2AJLI 2XUKA 2QPLA 3G2OA 1VL6A 4CM4A 4D4JA 5CVTA 2BCGY 2OXEA 2YY7A 3DFKA 3HP4A 3I01M 3P9IA 4JDUA 2B94A 1ECFA 3A3YA 5EHIA 2EP8A 3MINB 2OM2A 5FPSA 3KV1A 3ZWXA 3FLMA 4OATA 2ZUUA 5JVDA 1E4VA 1XB2A 4A8HA 3Q7TA 2OXIA 3AG6A 5MN5A 2EGGA 1TO1E 2RBEA 4LF9B 3PT5A 1QH1B 1W96A 4JLUA 3K8YA 3S2ZA 4C5AA 1C1XA 1RVDA 1NJ1A 1MBZA 4O8ZA 5CLIA 5F76A 2HSZA 2ZRQA 2R7KA 1PR6A 3GRPA 5F1KA 1PW5A 2YFQA 1GV1A 1KI2A 2ZG6A 5HJEA 1E1RA 1ZIDA 1MQAA 2XUJA 3MWYW 4PXAA 4V24A 5ALDA 5IJAA 2NPFA 3INGA 4DUPA 5JSZB 1VBMA 5AK6A 2X2OA 2BL4A 1YS9A 3ZCVA 1U63A 3ZTYA 5CEFA 1RFLA 2FWPA 4FIZA 5ALJA 4DDWA 1YVDA 2QTZA 1IPFA 4UPDA 4C0AC 3OEHA 4MEBA 4XB6B 2WICA 3CUWA 4HAIA 3DBLA 2VT7A 1Z7EA 2FZKA 3F8WA 3IHWA 1A98A 2OG2A 1KAMA 4DARA 1OI7A 1ZH2A 1UPCA 2DE0X 2OESA 2P91A 4HI0E 1RZUA 4FOLA 2SBTA 5T4EA 3IO5A 1IXSB 1Y1SA 5CDGA 3OI7A 4O1MA 2QZ4A 5A9SB 3WLIA 2P2CA 3W5VA 5C80A 3NU1A 2E6KA 1CY4A 2PGXA 4H4CA 1QO9A 5CX1A 2ENWA 2HLDA 5E9AA 4ACAA 1KFJB 2YHSA 2RHTA 3R0JA 3BB4A 4UBIA 2YBEA 1Z7YA 3BFVA 3FM9A 3UUGA 3BREA 3MN1A 3I83A 3TZLA 4ZAVA 5FBQB 4CNQA 5IAGA 1KU0A 3TX6A 2XQIA 2XGSA 1CJTC 3FWYA 1XROA 3KZKA 3QENA 4M46A 4G4IA 4FFPA 2JGAA 3EEQA 4QAQA 3GC6A 4MV7A 1SBYA 2VBIA 2XV1A 2Y67A 2Q1WA 4M1SA 4Z54A 2AR9A 2E85A 3M2TA 4DV7B 1FW6A 1DO2A 5FRDA 2DHEA 1G2OA 1N8SA 4KLNA 4NCBA 4RVSA 2NSYA 2Q2QA 1FZQA 3KVOA 4N82A 1ZBDA 5DBEX 2P35A 4C05A 3B5EA 2G83A 1DAMA 4UBJA 3FDIA 4XIGS 1JNYA 2B1IA 4KR9A 1NSYA 1MDBA 1H23A 3HLYA 4GKAA 3AI7A 3H5IA 2JGIA 3K5HA 4NI5A 1W0CA 5F7ZA 1KJJA 2IV2X 4DXDA 1IN4A 3C7TA 4H0FA 4LJ6A 4ZYUA 3TD2A 4ZMBA 4ESOA 5JAPA 1KP3A 3LLVA 1G8PA 1M8GA 3GX1A 1UJ4A 1W35A 1DELA 3N53A 3NH9A 1ST3A 1GQ2A 4TX1A 4Z3KA 2DR3A 4ZJZA 3GK3A 1ADBA 2AKYA 1H42A 3AJDA 3WP1B 5AJTA 3V42A 4J76A 4L16A 4O4HA 4JLNA 4I3GA 4LMAA 5A0FA 1UPFA 4HGPA 1NW9B 2BGLA 4BBZA 1XMOB 3LNTA 2ZT7A 5K51A 2IX3A 2VTKA 4M7OA 1BE8A 4H27A 5LQDA 4KK3A 1UADA 3X1DA 5KBYA 3ER9A 4NYIR 4AG3A 2J0EA 2OOKA 3R7WA 4S24A 4CM5A 1M1YA 1TM2A 3F6SA 1Z8NA 3HUFA 3DEHA 4LDPA 4PC1A 4E4RA 4GLFA 4JKOA 3TR5A 2YWEA 4AMYA 1D8AA 1OV4A 2GN6A 2HUPA 4KE6A 2ZULA 3EARA 2JGJA 4RHTA 1L7XA 3O4IA 3IP8A 1HDCA 2CYAA 2J45A 2YRXA 3RUPA 1FVHA 3AKYA 4J7XA 1GDTA 3HP7A 2JGFA 3EDOA 4KXNA 4HKTA 3QKSA 3IEIA 4Z1MD 1A5ZA 4DA9A 5AW2A 1NM5A 4R69A 1UM9A 3H5WA 1S2DA 3ANYB 2WJYA 2CCKA 1H0HA 4R8KA 3W9BA 5I01A 1YBVA 1YE5A 4C2BA 4BNGA 3RC8A 1ES9A 3FFWA 4CU2A 1YQ9A 4ATNA 2E21A 3M9XA 4RORA 3CRW1 5E1OA 1SC4A 1AKRA 1G6Q1 3MT9A 3NWJA 2XD9A 4I66A 1RJEA 2OMEA 3EFHA 3FMFA 3GZJA 4Q4AA 3DP7A 4GYWA 5IT4A 1UINA 1R2QA 3VPHA 1MAUA 1N4DA 3K4QA 4M87A 1M6EX 3TFQA 1N36B 4OKNA 1Q20A 3A6PC 1STOA 1W47A 1JIKA 1NAHA 1HUQA 1E4EB 3TW4A 3TZ6A 4R1NA 1DAOA 1WXHA 3BXPA 2LVBA 2YH2A 4X6YA 2NVBA 2PZFA 5JJLA 1L7EA 1K68A 3BE6A 3QVXA 5E6UA 3SHOA 3QOFA 4EFMA 4RAOA 2FEMA 4C0JA 2VRWA 4FEGA 4CLHA 1BWRA 2WVGA 5I9IA 4LWPA 1TMGE 1X7XA 3QWAA 3B9QA 4BKUA 7MHTA 2IIVA 3K0FB 3EZ2A 2OVBA 4R1OA 2HZBA 4JQCA 2ZRHA 3HU2A 3QLUA 3CKMA 4F86A 5ALYA 2QTNA 2YCBA 1I01A 3TRJA 2KJQA 1PX2A 4FC7A 4L75A 3WLTA 2X58A 3QYAA 5JJBA 1D2RA 5GIPE 2Q99A 3EPRA 3C6QA 4OQEA 3WDLA 3ZV5A 3AF2A 4L5YA 5T41A 3T5DA 2G76A 4DAOA 3S81A 3ZLJA 1QP7A 4GMDA 1K27A 3EXFB 1M2GA 4LI3X 5HDBB 5JPDA 3OZWA 2EHJA 5AW5A 3JAWA 1OXXK 1NR7A 1PJZA 5FBRB 3II6X 1X9IA 3R6GA 2R68A 3DUFA 3DR5A 4YMGA 4LZZA 1LI7A 1YC2A 4QYMA 1M6WA 4XB2A 2ZT5A 3BD8A 2Q3DA 3MD0A 1LSOA 4GW3A 3ME5A 1XXHE 3OM1A 4YAEA 4F9TA 1E2LA 1JQKA 4XWTA 2I99A 2HF2A 5EGNA 1JKJA 1TUGA 1RHQA 1I3LA 3BPSA 4PLGA 4CUJA 1TJ3A 1GFIA 3EC7A 3KR1A 3D31A 1NTOA 1LBEA 3EODA 3O1IC 1UPTA 1J6UA 1RPAA 5KDOA 3EF1A 1GLNA 4OV6B 1QX4A 1PEYA 5AK5A 5AUNB 1PUIA 1HDEA 1P0PA 5SY6A 2X0EA 5ICEA 5IWAB 2ZUSA 4L7QA 2VFAA 2JBHA 1EINA 4CKEA 2GVDC 4Y8VA 1WZNA 1A4IA 3G3EA 4B7CA 2OP0A 2G9NA 2EIXA 4ML3A 1L4UA 1M74A 3U17A 3ZHVA 2PT7A 2XNDA 2BMDA 4GC5A 4KQ1A 4PSVA 1XMPA 3W1EA 3ZOKA 1HLDA 2ONZA 2G5TA 5JD4A 4XUEA 3WRYA 1MOZA 1KY3A 1CY0A 2QQEA 3FKSD 3V1NA 4MRNA 4CEIB 4IIYA 1ZLXA 2FRXA 1XDGA 1UK7A 1WDTA 4FYPA 2AH5A 2BMEA 4K86A 1DZ3A 4R81A 4IHQA 3B3JA 2FNAA 2FEWB 2K4MA 4YPVA 3E9NA 4MW9A 1HE4A 1MC4A 2DHQA 5HFNA 5REQB 3ROKA 1QRRA 3CZRA 3DMNA 4ZO8A 3TCXB 3TW8A 1T5LA 1P1RA 2JJMA 4UNSA 1ACLA 3B3QA 1XHLA 4Y6SA 4X1YA 4A15A 3ZXUB 2NUAB 3TKYA 3KXKA 3SU8A 5CD1A 1JHAA 2Z9DA 3F6YA 3ZI4A 1OU4A 1GADO 4CF7A 5CVDA 1U1IA 2DLCX 2IS4A 1Q12A 2NXEA 1W49A 3SQDA 1E69A 1PAUA 2GAJA 4PAMA 4F6CA 1EJ6A 5TV2A 1N92A 3NKFA 3IUNA 3DT8A 1NBWB 2PS0A 3E1SA 4QGAA 4YONB 2W6PA 1VYUA 4QSMA 1ZRSA 3J81A 3A11A 4MYDA 1O95C 3IRVA 4GXRA 3QE4A 3JATB 4MI3A 4D9JA 1VZ2A 3A6KA 2IVZA 1VKRA 4JI0B 1HE5A 3SY8A 2DKOA 5A06A 5KS2A 3CX3A 4E2ZA 2Q5FA 3IIJA 4IXNA 4WPGA 1ZOSA 1C3OA 2CJPA 4RJ2A 5DT2A 3T15A 5MGBA 4M8SA 5DGXA 3SS8A 1Q0HA 2AXEA 2FX5A 2YVAA 5EE5B 3QIAA 2FMXA 9LDTA 1W4BA 4F93B 3KK0A 1VIDA 4AZ3B 4P35A 4FSDA 5FNZA 3K94A 1RQXA 5EWLA 2G28A 2ZRFA 3A7DA 2GRUA 1XRPA 2GVZC 3L8FA 4J1TC 1E7MA 1HEYA 5C1DA 5CIWA 1F17A 1YQWA 5I5EA 5K6RA 2O23A 2VJMA 3K8OE 3H87A 4RFVA 5I7OA 1LWNA 2Z8ZA 2YXDA 1NF8A 4KXFB 4GWLA 4PBRA 4CMCA 1LNQA 3OKFA 1RXYA 4QPJC 4RDCA 2A9KA 2PNJA 2VIIA 4CJXA 5FTKA 3N07A 1D6NA 1K4YA 2NU7B 2ZUBA 2VWPA 4FI3F 1VI6A 1PTKA 1R0XA 1I0LA 2HLNA 5AHKA 4COKA 4RIHA 1SC3A 4MP6A 4BLVA 3BEDA 1XVIA 4F3RA 4I3FA 1FFWA 2ADOA 1XAHA 2GASA 2OHJA 1YCHA 1RBQA 4OSOA 3PXUA 5CNJA 3FSJX 3BRWA 1E0KA 3I9V1 1ZD2P 4LWZA 3RWMB 2H63A 3TQIA 2QTBA 6ABPA 4MQBA 1NX9A 4IIDA 4JJ4A 4GAEA 4X44A 2J5RA 2H4XA 1M5UA 2H17A 3BAFA 3QEMA 1N7JA 2QV0A 5CA0F 5TJ9A 1UK9A 1IK4A 3A9RA 2R7MA 3CEMA 1SG6A 1UXGA 4Q66C 4QPZA 5EIEA 1PW7A 3NIDB 4E30A 4UREA 3U3RA 1F6WA 1B6RA 1E9DA 1UFQA 2F1KA 2RI1A 4B5KA 4CM9D 2PAFA 3TE7A 3FPLA 2FRDA 2W2PA 2L69A 3T8YA 1XPRA 1RMTA 3MPOA 4LYGA 2C83A 4RDIA 3OY7A 4ZJYA 3DE2X 4P83A 3GA7A 3PXBA 4U02A 3COPA 1FRVA 1ZHFA 3LT4A 3T1HB 3STVA 1Q16A 3A31A 3AWIA 3D2AA 3LIIA 4WZZA 3T0GA 2OORA 3TDNA 3PXXA 1ENZA 3VR4D 1P75A 4Z7JA 3K7EA 4QM6A 3CLHA 1OWOA 1P4HA 1AKUA 2CN1A 4KGDA 1ECGA 1CNFA 2VTBB 2C92A 3KZCA 1EUCB 2VJKA 1XZNA 3HH8A 1H9BA 2NIPA 4YI3A 1P5JA 1HURA 3DBVO 4Q3AA 5P21A 4QQNA 4X24A 1WXGA 1YULA 4I55B 4P3KA 2QX6A 4B73A 3C43A 2QX7A 3UAZA 1EQAA 4EUNA 1N75A 2C8LA 5G02A 1XK6A 3MCZA 1KQPA 2QZPA 1KFKB 4NONA 5E95A 4RPGA 4UCWA 3A2KA 1SRRA 1L8XA 1DV1A 1KVRA 1GPJA 3EG5A 3FTNA 3JQBA 3LQRA 3MVEA 5ECDA 4OO3A 2C4KA 1GAWA 1JFTA 4KIUA 4TLDA 1DO8A 2YXNA 3VISA 1QZUA 3DL2A 1QYWA 1VPWA 2X2EA 2VJPA 3QPVA 5H4HA 2XJ9A 1VJ5A 3AP2A 3KOWA 4H3VA 4CT4B 5BNTA 3CRZA 1EA7A 1PHPA 2PEZA 4PPYA 5K3EA 2F43A 3E7XA 1J8VA 3AT1A 3HKDB 3MOSA 4LQCA 3COSA 3K0EA 3ZU2A 1EBUA 1T2NA 4YUAA 4WJLA 1JR2A 2AL7A 2PL3A 4MP3A 1YBHA 2A9JA 2GCPA 3KZNA 3LKBA 4M99A 3ZJTA 2CNKA 1RMYA 2DG2A 2XSZA 3GRCA 4LRUA 3ZD9A 5H9WA 1KYQA 1OLXA 3BHIA 3U39A 4PIVA 5B3AA 4ZHQF 2P2LA 1UBTS 2WWXA 3KIPA 2E82A 3FBGA 3O90A 2YJ4A 3F5QA 1UWCA 4MR9B 1IMOA 1QC5B 2HXYA 5AXDA 2BUBA 4MWEA 3TCKA 5L8VA 2WTBA 1AQNA 1EXMA 1HZZA 1MT3A 1JIJA 5HTKA 2VF2A 3HJHA 3ND9A 4FJ2A 1DXQA 4J9UE 2RGWA 3T3DA 4BS9A 4Z53A 3N86A 1FPQA 1RLIA 5C7LO 3HY4A 3B85A 5FUYA 3O8LA 5A4KA 5JS1A 2VRNA 3K9WA 2VT3A 4AS1A 2XTAA 3C74A 4HFRA 3JYPA 1JZSA 4M1QA 2CXPA 1UOEA 2NQ2C 1IK6A 3RUDA 4ACBA 1LC0A 4D9MA 4TKVA 1VCMA 3BOSA 3H4VA 1U9IA 4U39A 5ITSA 1SN7A 3AEKB 3GZTB 3T1TA 3HPQA 4ZQCB 1CEXA 1HL3A 2QN6A 4JNCA 2B99A 3QLJA 3SDBA 4OHXA 4DGSA 3NC4A 4DLSA 4FQ8A 4OUDB 5FOSA 1O96B 5H7XA 2W6QA 1TJ5A 3CH6A 5TNXA 4G4JA 3IPXA 4E7OA 1CEQA 3GD5A 4I6EA 2P4SA 2JHGA 2ZUVA 3HCDA 3AJ8A 4KR2A 5FFFA 1YH3A 3ZIAD 3H4MA 4MQMA 4NHOA 1YRHA 5L95A 5ICSA 2IEYA 1D2MA 3DCNA 2E4VA 4IDQA 4NTZA 4QPPA 3ZDFA 5C1OA 1MFZA 2HJGA 4DLYA 4HZUA 4YV0A 3WBJA 2H5IA 4MDYA 2AWOA 3I53A 4YTEA 1EUDB 4H59A 1E2EA 4P5EA 2NSJA 1PNTA 1UWVA 2ZUDA 1CW2B 3PUXA 4R2MA 2A3NA 4Y6LA 3WWOA 3EXIA 5IVKA 1W4ZA 2O2DA 2ZVQX 3QGMA 4MRRA 4TN5A 4Z99A 3K1AA 3DKRA 3OZ7A 2G9UA 5ES4B 5E0OA 3T0FA 3CRMA 4RADA 1Q6ZA 1Y1QA 1V1RB 4UDXX 3QVVA 3SJUA 4JSRA 3ZW7A 3M3PA 4DLPA 1HNZB 5CT9A 3PNLA 4IRUB 4F9EA 4I50F 1E6KA 4EG4A 1K2WA 2WYUA 1FB5A 4NBKA 5AKGA 2XUGA 5EQTA 3LOPA 2HY7A 3AH8A 3TJMA 1LF0A 2H2IA 3EWNA 4KH0A 4QUBA 3WRXA 2FDCA 1EIWA 3KO8A 3JD2A 1UEJA 4JBHA 1QWOA 2O2ZA 4IOJA 1UZNA 3T7IA 2YHIB 4CR6A 2EX4A 1NMEA 2NTYC 2CBXA 4F2GA 3C45A 4NMHA 1J06A 2PA3A 1RWQA 2WTMA 4YJFB 4CGZA 3NDIA 2MINB 3ES9A 3TE6A 1AMUA 3PQ5A 1GNQA 2X22A 1GL9B 1YDEA 3HNRA 3PUVA 2BELA 4G5HA 3DPSA 3UK1A 4YROA 3FTPA 3T5AA 4YN3A 1F60A 1OAKA 2GILA 4G0QA 4TUYA 5K03A 1W2HA 4E5YA 1AF7A 4BLQA 4FMBB 2UUOA 3GLTA 3S44A 1ZH0A 5JATA 3W5DA 4PAGA 2I80A 2PKQP 2QENA 3RVJA 5DX0A 3M2PA 1TF5A 3HJTA 4LRXA 1SUBA 1HLFA 1W7AA 2C2KA 3O4RA 1L7OA 3EK2A 4ZALA 3EQ8A 4QO7A 3BMQA 1AH2A 1O6GA 4JYMA 3ROZA 4OLAA 3TZQA 1EXWA 3GHHA 4NFHA 4YA6A 3BL8A 3ECCA 1SNYA 3EXAA 2WF9A 1ND6A 3W4KA 2NXWA 5DHAA 4CG2A 1LPBB 1T1IA 2D7JA 5GONA 2MCFA 2CXOA 3TR0A 4DRXA 3U44B 1FXWF 3DQZA 4NBVA 3HJGA 2IFTA 4XCXA 3FR7A 5EHXA 5ER6A 3CG0A 1EP2B 2EXXA 1QFXA 1H1TA 3VO2A 4QM7A 4YRPA 4DCVA 3HI4A 2FPPB 2DTEA 1D6JA 3VOBA 4ZVRA 3WLHA 5LP6B 2QR2A 1FMJA 3PFGA 3TB6A 4HL6A 4Q3LA 3L41A 3VSEA 3FTFA 1NBOA 1OH8A 4ENQA 1HYEA 3O3OB 3ZEIA 3ANLA 3WP0A 1L5HB 4ZTBA 1WLYA 3JX9A 5FA6A 2HQBA 3HWX1 3OLXA<