4YACA

Crystal structure of ligo in complex with nadh from sphingobium sp. strain syk-6
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
295
structure length
270
Chain Sequence
b'MQDLEGKVAFVTGGGSGVALGQAKVLAEEAQMKVVIADIRQDHLDEAMGYFSQKNVAVHPVRLDLTDRAAYAAAVDEAEQVFGPVDLLCNTAGVSQFGPIEKATFDDWDWQMDVNVNGVINGVMTVMPRMIERGQGGHILITASMSAFVALPTTGIYCTTKYAVRGLAESLRVEMPKYNIGVSLLCPGGEAVFAGLKRVIEHGFDPVDLGRVVLDAVRNDRFWVLPYPEFAEGQKARDQEVIDAMMSYADHPDYARRMKIREQMKRDMPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C alpha-dehydrogenase
molecule tags Oxidoreductase
source organism Sphingobium sp. syk-6
publication title Structural and Biochemical Characterization of the Early and Late Enzymes in the Lignin beta-Aryl Ether Cleavage Pathway from Sphingobium sp. SYK-6.
pubmed doi rcsb
total genus 100
structure length 270
sequence length 295
ec nomenclature
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4yacA01
2HJSA 5A9TA 1NQTA 4KUGA 1RWBA 1HLDA 5TT1A 1H6DA 4IJVA 1QXSA 1TVEA 4RVSA 3RUCA 1A4UA 3TRIA 1C1DA 5IJZA 1MB4A 3JQGB 1DIBA 1ZEJA 1DXYA 2WE8A 3DQPA 1XELA 3U4CA 4ZQGA 5KWEA 4DUPA 1LSOA 1EVYA 1LDYA 2EP7A 1E3WB 3O8QA 4DPLA 1R37A 1IL0A 4RO0A 4BNJA 3TWOA 3FBTA 3IDSA 3QQPA 4O1MA 4FFNA 2F00A 3GEDA 1OAAA 3IKVA 3VH1A 3V2HA 2IZZA 2CF5A 1PJQA 4LRSB 4CQMD 2DBQA 3ADOA 1EE2A 1BSVA 5JAIA 3BTOA 2C59A 4DQUA 2YYYA 4II2A 3WIDA 1DFGA 2O4CA 2OMEA 2Q49A 3DBHB 1C0IA 4FFLA 2NTVA 4ONEA 5A9RA 3OA0A 4HP8A 5JXWA 2J3JA 1U4SA 1VPDA 1TT5B 1N7GA 4PLWA 1Y6JA 2B4TO 2PFGA 3GG9A 4CMCA 1QR6A 3Q2IA 3PEFA 3DWFA 4E31A 2YDYA 3WB9A 3ZZNA 4J0EA 5A02A 5KVCA 3QSGA 2HMWA 3D4PA 5L4LA 4BMSA 3OBBA 1PL7A 4DQVA 4OOFA 1HDCA 5ER9A 1BRMA 3UN1A 1FF9A 1I3MA 1E5LA 1ZVMA 2JL1A 5L51A 1KOLA 4FD3A 4E0BA 1H94A 4RPHA 2FR1A 1U28A 4CQMA 3TZCA 3AI2A 4DPKA 1U8XX 4PVCA 1PS8A 2GSDA 1QLJA 4OM8A 3ZNQA 2C07A 4CUKA 3E9QA 4WKGA 3DC2A 5JCJA 3GEGA 4HFMA 5DCWA 3TFQA 3W8DA 1RJWA 3M6IA 4FOSA 4WLEA 3DB2A 4QO8A 4I5FA 4JP2A 3PWKA 3WJAA 1HSOA 1RM5A 3ZWWA 3HB5X 2YUTA 3IJPA 4BNUA 2QG4A 3H3JA 3QHAA 3S2IA 3U49A 3JD2A 4UEOA 2VYND 1SB8A 4AJNA 2QRJA 1FK8A 1O89A 4HFNA 5JY6A 4FBGA 2PD3A 1GADO 4WLFA 2D4AA 4FW8A 1MV8A 1O94A 2FZEA 3E9NA 3P5SA 3PWSA 4XRRA 2VHVA 2VWHA 5T57A 3UUWA 5I7FA 2PZKA 3VKUA 5CP8A 3I9MA 1U2GA 1NBOA 2BGKA 4JXKA 4Q3NA 3IS3A 4FIZA 4IM7A 2WWRA 1MG0A 1B8VA 2PTGA 3DZFA 4YBZA 1P1FA 1X1EA 3K8ZA 4LGVA 4QX6A 5GZ3A 4NJMA 1Q1NA 1K6JA 5ICMA 3I5MA 1YJQA 4Q3BA 4EBFA 1RYEA 4CM5A 2Q45A 2ZYGA 4EUEA 1D3AA 3DHYA 3KHUA 3JQAB 4R16A 4QTZA 4ND3A 3GHYA 4UUNA 3CKYA 5G2OA 1U2DA 4Y67A 4YWJA 1Q0LA 4OQYA 1IPEA 4TROA 3E1KA 1ONNA 5AXDA 2Q2QA 4HNHA 4YAJA 5KJCA 2O50A 3BIOA 4KQXA 2AEJA 1C0PA 4YR9A 1YDEA 3WIEA 2OXIA 1PIWA 1EBUA 2O3SA 3H9GA 1CF2O 1Y8QB 1PU2A 4ZRNA 1GZ6A 3TL2A 3VZPA 3KBOA 3U4DA 4J3FA 3OETA 5FFFA 5KCZA 5FI5A 3STHA 4XQEA 4RVDA 3QRWA 1K89A 4QSMA 2VN8A 2Y1OA 4J7XA 5F1PA 2FN7A 5BT9A 3TQHA 4BGUA 4IGEA 5GY7A 1ML3A 3JQFA 3UCFA 3JQ8A 3OIGA 5COQA 3Q11A 5C3MA 3VPSA 1PQWA 3UXYA 4PZCA 4GWKA 1LRKA 4J1TA 4KWIA 5KVSA 1SAYA 4H16A 4DLBA 5G4KB 4N5NA 2VT2A 1EBFA 1HEUA 3ZHZA 4DVJA 3G1TA 3VOSA 5BSHA 1M6HA 2ILTA 1N1GA 5DOVA 3MEQA 3INGA 1WNTA 1KBZA 3GPDG 4IDAA 4FGSA 5JMPA 2E6UX 3I3OA 5TJHA 2W90A 8ADHA 4M8SA 4BB5A 3A14A 5ENDA 2Q99A 1ONPA 4N7RA 4PLVA 3OQ6A 3K73O 2D3TA 1MC5A 4R3WA 4RPJA 4KDEA 4Z0TA 1E3SA 1P1KA 3LT4A 2FHSA 1VJ0A 4MP3A 1PJSA 2RHCA 5H83A 2C29D 2P5UA 1CETA 1P74A 3TZKA 3W4IA 3AU8A 4YAIA 3QWBA 1A27A 5L45A 4Q3CA 2CVOA 1UDBA 3GZ4A 4Y6RA 3CUKA 3KV3O 1BW9A 2NACA 3PQDA 4CMKA 1TEHA 3H9JA 4BGVA 2X0NA 2QW8A 4JJFA 1JU9A 4RJTA 2BMAA 5DBIA 3VAZA 2EKPA 3EVTA 2DQ4A 2FP4A 4IGFA 1JAYA 4J4BA 5AXBA 4BO2A 4GPD1 4D79A 1TLTA 1A71A 3ICPA 3HDHA 1Q7BA 3GVHA 2R6JA 1BDMA 1PL8A 3GDFA 4R1TA 1LI4A 1RM3A 4K9DA 4R1SA 3RC1A 3U5TA 1SBYA 2W2LA 4WLUA 1MA0A 3ZWBA 1PGOA 4D7AA 1J6UA 3FTPA 1K2WA 1UP7A 4BO0A 3VTZA 4IIVA 4IQGA 3I52A 3VVCA 2Q1SA 1YOVB 4B7CA 4BNYA 1IULA 3C7CB 5EIOA 2V7PA 3RROA 3K5PA 3GG2A 5ENVA 4MVJI 4YRAA 4UVEA 3JQFC 4TVBA 2OUIA 1NVTA 3NDJA 4NBWA 3KYBA 2Y0EA 3FPLA 4BO3A 4D3SA 1VJ1A 3ZV5A 1EFLA 1KYQA 4BKOA 1GZ3A 3V2UA 4DYVA 4NJOA 3W6UA 2Z1NA 3JQ6A 4JIGA 2NVUA 1R4NA 4I1IA 3RIHA 1TXGA 3GDGA 3UHAA 1GYRA 4R9RA 4PRLA 2BFMA 5JE8A 3ENNA 1E0DA 4L75A 4XYLA 5TS3A 4C7KA 4WOJA 3FBGA 4QXMA 1OC2A 1Y9EA 3GHHA 5I8WA 5JMWA 3S55A 2WMDA 1GEGA 3ZDFA 4INAA 3WYCA 2AW5A 4CMJA 1WW8A 3LF1A 4ZA2A 2XXJA 2DFVA 1ZXBA 4R54A 3O9ZA 2QX7A 4A10A 4ZN6A 1Y5MA 2B37A 3WR5A 1KVTA 4YAGA 4WE3A 3PWZA 2DTXA 5AVOA 4PG5A 3OM9A 4GVXA 1F14A 1GPDG 4DA9A 1NWCA 3WFIA 4XEHA 3X2EA 1NQ5A 1GUFA 3V1YA 3NEPX 1GQQA 3QE3A 2BFPA 4MKRA 4UVGA 4XYEA 5L40A 3PK0A 3ETGA 4BVAA 1KVQA 3QP9A 1UZLA 1EFKA 1B8PA 1R66A 5L9AA 3JQGA 3V2GA 3I9KA 1GUYA 5F5NA 5DCYA 1G0NA 4BO6A 1PJ2A 1PS0A 3T7CA 3ZHXA 4ZJUA 3GGOA 5EPOA 3UKOA 4DBVO 1QKIA 2FR0A 4DTIA 2C82A 3LSYA 4YVFA 4YB8A 4FS3A 4UULA 4XDYA 5G0WA 4DC0A 4EGFA 4H7PA 1K0UA 1SZJG 2AMFA 2IYPA 4R69A 2UDPA 3IOYA 4CV1A 5JSFA 1JVSA 4U0JA 3V1UA 1P1JA 4CMAA 1AXEA 3QW2A 4DYDA 4D46A 3JYOA 3GZNB 1H5QA 3CIFA 3L6EA 1VKOA 3IQDB 1GCOA 2VRBA 1G1AA 4UVDA 4E5NA 4BNWA 1X0XA 2WSBA 3ST7A 1H9AA 1DAOA 4M87A 3BAZA 5F1OA 3OJOA 3P2OA 1V6AA 2DVMA 4NFSA 4LVCA 5G0SA 4BV8A 3WWYA 1E92A 1GYQA 4JBGA 4WUVA 1QG6A 3MJCA 4RZIA 3PRJA 2CUKA 1SMKA 3NX4A 1QYDA 1GEEA 1LC0A 2IEBA 4ALLA 2A92A 4UAGA 3Q9NA 1NYTA 2BELA 4LCEA 4BKRA 5IDYA 1DPGA 4E21A 1NQOA 4PCVA 1MXHA 1U3VA 3K6JA 4I08A 2EJWA 4JN6B 4XJSA 1HF3A 3BXXA 3NDRA 1E7YA 1U3UA 3ETEA 4NZ9A 3W4JA 1DRUA 3BZUA 2H5LA 3WFJA 2EGGA 2NU8A 3HE3A 3WQRA 3HHPA 2YQ4A 3LT2A 2J3KA 2HO5A 2QRKA 3N74A 3T4XA 4B3IA 2Q1UA 2Y1GA 1LSUA 1M6WA 4R41A 2VTDA 5JYDA 4JQCA 3LYLA 3W8FA 5A1TA 4KUEA 2Q50A 1DC6A 4NH4A 3KETA 4GGOA 2OL4A 3F1LA 5FYDA 2YV2A 2AQIA 3GVXA 4FPXA 4R3NA 4J4HA 4DL9A 4PLFA 1LSSA 4G81A 3E9MA 3AFNA 2G5CA 3NTOA 2JCXA 1ZSVA 3NTQA 4IY1A 3MJEA 3SBOA 4OKIA 1Z73A 3SJ7A 5B12A 4BO1A 3D1LA 3H5NA 1E6WA 1T24A 4IJUA 4PLCA 4BB6A 3FSRA 3GY0A 3SX2A 5CDSA 4E13A 2ZJ1A 4D44A 3PJFA 2I6TA 4J90A 3GAFA 4FQ8A 1P77A 3PPIA 1J49A 3AM3A 4YJGA 1KY4A 3H6KA 5HM8A 2FOIA 2PZLA 1EVZA 3RBVA 1W8DA 1EDOA 4EZBA 4KMSA 1LC3A 5TNXA 1CRWG 3L6DA 1C0LA 3W8EA 1PJTA 1I2BA 4A7PA 1UP6A 4Q3AA 1LUAA 3DBLB 4LK3A 3ZI0A 3KYDB 5TX7A 4ESOA 4E5YA 3UW3A 1YQGA 1I10A 4Q3DA 4BMVA 5I9LA 2I66A 1C1XA 3PIIA 2Y1EA 1C0KA 4JGBA 4YJFB 3N7UA 1T1SA 1DAPA 2CZCA 1J0XO 2VYNA 2BHLA 4UUOA 4MIEA 2B0JA 2X9GA 2BKAA 3TF5A 4WEQA 4ZRMA 4NIMA 1UDAA 3OMLA 5FI3A 4A73A 4GKBA 4RVGA 3ITDA 4XCVA 4ZQBA 4CV0A 1I2CA 2H6EA 2ZB3A 2PK3A 1LXCA 3OQBA 1GYPA 5C5IA 3DZJA 1HE3A 1BGVA 1E7SA 4IBOA 5C7IO 2FMUA 3BTSA 1MFPA 3RUHA 3BHJA 3SLKA 2D8AA 1NPYA 3LT1A 2DTEA 1HTBA 3ITKA 5TT0A 2NADA 3ETDA 4EJMA 2BFAA 3NJ8A 3H65A 3QWIA 2AEFA 5DBGA 1DIGA 1PWXA 2V6GA 1MC4A 4QT0A 4ZQFA 4L73A 4GX0A 1L7EA 3V1TC 2GGSA 3W6ZA 2QYSA 2GNAA 1T1RA 4ID9A 2EP5A 4I9UA 2PKQO 1Z7EA 2J6IA 3E5MA 4S3MA 5JYEA 5THKA 1DLJA 2A4KA 2WD8A 3EVNA 2WD7A 3K92A 4P22A 3NT4A 5I7EA 3ROPA 4DGSA 4NBTA 5TF4A 5CDUA 1XA0A 1S6YA 2JD2A 3UH1A 4E5KA 1DJNA 1BXGB 4E2ZA 1FDSA 3WNQA 4CM6A 1UUFA 3SJUA 4FJ0A 1PGPA 1T4DA 4I9HA 3HFSA 4Z9YA 3UICA 3VH2A 1P0FA 2V65A 2PH3A 1G0OA 3OSUA 4NHEA 2DPHA 4F6CA 2B36A 4R68A 1PJLA 1OC4A 4P4NA 4F6LA 6LDHA 1ADFA 4IJKA 3PQFA 4AICA 3KUXA 4CUJA 2F1KA 2X0IA 3ZWVA 2NLOA 1P1HA 5A9SA 3GFBA 5DP2A 1I5RA 4Y6PA 5IG2A 3L9WA 1NAHA 3DONA 2I65A 2HMSA 1YQDA 1Y81A 4I9NA 4DRYA 4J1SA 3JD4A 2ZTUA 3L4BC 4WASA 5JS6A 3IIEA 2B4QA 5HRUA 3RVDA 2YW9A 1NFFA 1N9GB 1SOWA 4OGWA 1PL6A 2NM0A 1I30A 2OFPA 1PTJA 1KC3A 2FSSA 3DZKA 3TZ6A 3TSCA 4ND2A 4CM9A 3FD8A 3LK7A 4P8RA 5HWSA 1I8TA 2FR8A 1S7CA 1L1FA 4QECA 4Y9DA 4NK5A 4GAEA 4E32A 2JHFA 4BIIA 3QVXA 1O9BA 1VM6A 2GR9A 2DT5A 2VOEA 4XQ9A 5ADHA 1B2LA 4PG4A 1ENZA 2QZZA 2W2LD 4MVJE 4NQZA 4AJPA 5JC1A 1ZK3A 1LLUA 2IXAA 4ITUA 1HT0A 4E2XA 4YEDA 5CG1A 3VZRA 2OGUA 4AFNA 1LDNA 1O95A 4OOEA 1BW9B 4IDBA 2D5CA 1Q7CA 3WS7A 2GRAA 3GQVA 2XOXA 5IZ4A 1H9BA 3DHNA 2POQX 5ITWA 4BV9A 2PNFA 4RZHA 4XB2A 2PGLA 2YJZA 3E82A 3IUSA 3I6QA 4GQAA 1YKFA 3PJGA 4FR5A 2HRZA 5CAEA 4M86A 2QHXA 3QA9A 1KEVA 4ALMA 4LN1A 2NU9A 5CPBA 5MGBA 1LA2A 4BNLA 1MFZA 1F8GA 4PVDA 2X8LA 4W9NC 1PJ4A 1YVEI 4CM8B 5B4TA 3WXBA 1PGJA 3JYLA 3RUAA 3QLJA 3NDIA 3L6OO 4XB1A 1E6EA 1PZHA 1JAXA 1YOVA 2GYYA 3PYXA 2P5YA 3IC5A 3U62A 2ZKLA 2Y0CA 4R1UA 4U8GA 2ZYAA 3GUCA 3ZHBA 3GC6A 3E5RA 3DZGA 1LDBA 1ZBQA 5JC8A 2P9GA 2PKQP 2VHYA 2IYOA 2FPPA 1V35A 1RKXA 2EW8A 3LC2O 1GD1O 4TKLA 1UXHA 5EINA 1GU7A 2VYVA 4MVJD 1LRJA 3AUTA 4MVJG 3RFXA 3U0BA 4F45A 3WG9A 3PVZA 5T67A 1G6KA 2I9PA 3O38A 5ILOA 5DULA 3LC1O 4MIOA 1V9LA 5ITVA 3I6IA 1D4FA 1NWHA 4OAQA 3ANNA 2DM6A 3PHIA 4G2NA 4ND5A 5I9NA 1DRVA 1E1KA 4GWGA 2VT3A 3ASVA 3ENKA 4FN4A 1CQJA 3M1AA 5DNAA 4WNCA 2XF8A 4WPGA 4PGFA 2PGDA 2J5KA 4UUMA 2C2YA 4EUFA 3HDJA 3TNLA 4TSKA 1I33A 1I0ZA 5JDIA 1I32A 3ZWAA 3GMSA 2X22A 1PZGA 3NKLA 4WEOA 3MJSA 4R9SA 3HB4X 3F9IA 5CHEA 4GGPA 2NU6A 3VZQA 2YY7A 1BXKA 1MUUA 1NP3A 1JLLA 4K26A 1KY5A 4KQWA 4F46A 1E77A 3OHSX 1XEAA 1M2WA 5L7YA 3WBFA 3B70A 2HCTA 2VZ0A 4CM4A 4XQGA 2FY8A 1GCUA 4CLOB 1ULSA 4YJHB 1XR3A 2W2KA 3D3EA 2VWGA 1EK6A 1WPQA 5IN4A 5K6AA 1GDHA 1X15A 4BO9A 1T2FA 1HL3A 4PG8A 3QY9A 2NSDA 2DFDA 3WMWA 4RLHA 3I23A 3K31A 5A3VA 3D0OA 4KTVE 1XU9A 4E12A 4EYEA 3VTFA 4CL3A 1BXGA 2B69A 5CDTA 3RC7A 3CMMA 1A5ZA 4YA6A 4P4GA 3DTYA 3RD5A 3G79A 3F4LA 1DB3A 3DZIA 1WXDA 4AJHA 3PI7A 2OP1A 4CODB 4ALJA 2JKVA 1IUKA 1HDXA 2HSDA 4J9VA 2VCYA 3OP4A 4IQ8A 3WTBA 4G65A 1RPNA 3L4SO 1QV7A 4M89A 3LT0A 3AJRA 1ZZEA 4YJHA 2BD0A 1GFSA 4GMGA 4TRMA 4FB5A 1Z82A 3M2PA 2W4QA 3PJDA 1I01A 2H9IA 2PH5A 3KM0A 3E03A 4U0KA 2Y1DA 1B15A 2VHXA 3D7LA 3RUDA 4CLDA 2IXBA 2QQ5A 3EAGA 3LVFO 1P33A 3ZU4A 4OSPA 1ZJYA 3PTZA 4L4XA 4IMPA 1ID1A 3PFWO 2VUSA 4C7JA 3E8XA 4IDEA 5TJ9A 3ON5A 4AJIA 4CM9D 1LLDA 1PX0A 1T25A 3S2EA 4WCFB 1OI7A 1IZ9A 3GR6A 3X2FA 4FJ2A 1DO8A 5JDIC 4XKJA 4J2OA 3IP3A 1ENYA 1E3JA 4IDGA 1ISMA 2X9VA 5L7TA 2Y0DA 1HYHA 3JSAA 4PZEA 1C3VA 1O0SA 5B1YA 4FFPA 1NQAO 4J0FA 1OOEA 1WDMA 1ZFNA 1EQ2A 3HADA 4YT2A 3PQEA 1NX6A 2PWZA 3WICA 3IP1A 4GL4A 3T4EA 4FJ1A 1I2ZA 4R51A 1HETA 2GO1A 4NR0A 3CH6A 2WTBA 1X1TA 4YT4A 5GMOA 5L3ZA 3FRJA 2HU2A 3GN2A 1NVMB 3VDQA 1YB5A 3JYNA 4YTEA 2YDXA 4HV4A 3U4HA 1J5PA 4EJ6A 5K6AC 3BHIA 1Q0QA 4L4RA 4EDFA 4NG5A 1H6CA 1LNQA 1OMOA 2BI8A 4BQRA 4GX1A 1H93A 2VUTA 3U9LA 5KNLA 1OFGA 2HUNA 4CM1A 2GN8A 1N2SA 3WBBA 3MOIA 4NMHA 3RQSA 3MJVA 3RU9A 3QIVA 1SPXA 1WDKA 1GQYA 2BH9A 2FPGA 4J6FA 5DOZA 2ZCVA 5T5QA 4GKVA 5CPFA 4OIMA 4H3VA 1PS9A 4D41A 6ADHA 3ONEA 2G0TA 3OECA 3GRPA 3WGHA 2B83A 2PR2A 2WEKA 3KSZO 1ZSNA 3NJ4A 4PLZA 3JYQA 4MDHA 4ZQHA 1AHHA 3LC7O 3GVPA 4XYGA 4D45A 3ZV3A 5BNIA 3GNSA 2TMDA 3AU9A 4Q3EA 3BMNA 4XYMA 3JQBA 5JDCC 3ZV4A 3H3FA 3UF0A 4FFOA 3I9JA 3WOHA 3L07A 5THQA 1WZIA 2DBVO 4ZICA 3AM4A 2E37A 5KOIA 4FSHA 5TGDA 1HLPA 1ZMTA 3KLMX 4IXWA 4AJ1A 3S2FA 5HBRA 2PA3A 4II3A 4EW6A 3HNPA 2WE7A 5K0ZA 3F5QA 3NT2A 1VJTA 4Z0PA 3D4OA 2EG9A 4RGBA 4AJKA 4BQPA 1LRLA 1AUPA 1NAIA 1PEDA 2A35A 5FEUA 4UEKA 3OJLA 4PG7A 3PYMA 1DSSG 4JJGA 5F21A 4AJEA 2HMTA 3KYCB 3AOEC 5T8KA 4RF4A 4TZTA 2R00A 5BSEA 3JQAD 4G5HA 4JNKA 4QEDA 3BTVA 5JW6A 1LDMA 4WLNA 3RBZA 2X5OA 3RCBA 2HRBA 2FPIA 4RCVA 4IDFA 1VSUA 3KRTA 1U3WA 4CM3A 2C20A 4XQCA 5AYVA 2QYTA 3GVCA 3TJRA 1HKUA 1SOVA 2IRWA 3S2GA 3C1TA 3NTRA 1P31A 1HE4A 1IE3A 2AG8A 2WD7B 3RWBA 3AY6A 4EUHA 1EQUA 3ZNOA 1H2BA 3JV7A 4KDFA 2YV3A 3WSWA 3DOCA 4IMRA 2GLXA 3ZNNA 2UYYA 4RLSA 3G0OA 1PGNA 1ISIA 1VKNA 2OORA 3CPSA 3E48A 4OXYA 2I99A 4IQ0A 3UVEA 4O59O 4RQUA 2D2IA 5HTOA 7ADHA 1V3TA 1DHTA 3ICCA 3EYWA 3R6DA 4O0LA 2Q1TA 5H82A 3PGJA 3INTA 5JNLA 4M49A 1AHIA 1Y8RB 1A9YA 3JD3A 1JTVA 1PSDA 3FNGA 3LF2A 3C1AA 3ZU5A 1NR7A 4CR7A 1ZNQO 3NGLA 5EN4A 2VWPA 4B79A 1JQBA 3OICA 4QO7A 2D59A 2X0RA 4YRBA 3WJ7A 1QV6A 4BUCA 4OYRA 3CXRA 3ADPA 3JYPA 2PGJA 1HYEA 4ROSA 3ROKA 1F8FA 3ZW8A 5IDQA 3SLGA 4PG6A 3JQ9A 1B3RA 3HUDA 1C1DB 5A05A 1KEPA 2ZK7A 2JJYA 5BSFA 3AFMA 4XRGA 4EITA 1XDWA 9LDBA 5HS4A 1CDOA 1FDVA 1EZ4A 2SCUA 3DL2A 2QZ9A 3DMYA 2NVUB 1B26A 3WLEA 4GLOA 3KYDA 5IFLA 1E7MA 1NPDA 1H2HA 3QV1A 4PFJA 1FJHA 2GD1O 4BNTA 4Z9FA 1XGKA 1TT5A 3CTMA 3OFSA 3BA1A 1W6UA 2Y99A 3GNQA 5A03A 4WGGA 3AOEA 4J2HA 1AE1A 4MO2A 5T8KC 3GPIA 4RPGA 3DMTC 5U4QA 2E82A 3NT5A 4H15A 1ZK1A 3SEFA 1LDEA 3M2TA 3RI3A 2QRLA 4TKMA 3FNFA 3FCOA 4CMBA 4BNXA 3F47A 4Z0HO 4Q39A 2I3AA 4DIOA 2CVZA 1HSZA 3GA0A 3BMQB 3RSHA 2JAPA 4DLAA 5DF1A 1WWKA 1R6DA 1H6AA 2JD1A 4D0SA 1B8UA 1BG6A 1E7QA 2ZTMA 1AGNA 3O4RA 1MGOA 3OIFA 3QVWA 3ZWCA 2JCVA 3K96A 3W4KA 4Z3DA 4BS9A 4XWYA 1CJCA 1V0JA 2IEDA 4OKNA 2EHDA 4FC6A 1ISHA 3CE6A 2D1YA 1WP4A 4Y6SA 1YH3A 3L0DA 4CLEA 4N54A 3EUWA 2EKQA 2EJVA 4U7WA 3ZH2A 5JO0A 1U7HA 4K28A 3JQEA 5LCXA 2Q3EA 4ALNA 3ORFA 1ULUA 4B4VA 2JFGA 2ZQZA 1LEHA 1P0CA 3W1VA 2O3JA 5CFZA 5CG2A 1T2AA 4B8WA 1XQ1A 1NM5A 2HK7A 2LDBA 3A28A 1GV1A 3I9NA 3MTGA 4BOYA 2EERA 3MZ0A 3GZNA 3JQ7B 1RYDA 1I3KA 1JW9B 1T2DA 1ORRA 5BQFA 4DMLA 3WQSB 5C7OO 1ZK4A 1YB1A 3FTNA 1PR9A 1YBVA 3AK4A 4HFRA 1XHLA 4NDNE 4MPDA 3HN2A 1ZUD1 1R12A 1YXMA 3MTJA 3WX0A 2NTNA 3IL2A 4CLOA 1X7HA 3ZWYA 1HZJA 3TDKA 2HK8A 3WGYA 1PQPA 4Y98A 3GN1A 4BGEA 1HZZA 3B6ZA 5ILGA 1P45A 1E7RA 3D3WB 3FHLA 1P44A 1M76A 4IXTA 3JQBC 3GK3A 2AXQA 2EWMA 4FDAA 1LX6A 1DFIA 3DOJA 1E1MA 3GH3A 3I83A 4RVFA 4W82A 5KJEA 1QP8A 3KXDA 1UXGA 1DOHA 2Y1CA 4RVUA 4A27A 4OO3A 3DFUA 1V3UA 3RASA 2PZJA 5C7LO 1GQ2A 2Q4EA 4RORA 4ND1A 3AW9A 3KVOA 4OSOA 2GN4A 4J16A 2ZIZA 4WCDA 1EUCA 3JQAA 4JBIA 5I8ZA 3RU7A 3VH3A 5KVVA 1NR1A 4GLLA 5GZ6A 4I5EA 3LZ6A 5KVQA 1R4MA 1WMAA 4CM4B 2O2SA 3WLFA 2GN6A 4EI2A 4BKQA 1MXFA 4YXFA 3KYCA 2JAHA 4HFJA 1T2CA 2OHXA 1A7KA 3D3WA 2HLPA 1HE5A 1E3LA 1CIVA 3F6YA 3SXPA 2XPCA 3U3XA 1IB6A 1I36A 3RUIA 3GLQA 3HG7A 3I4FA 4RQTA 1DBVO 2B5WA 2G76A 3KO8A 3WSVA 4NFHA 1UXJA 3DR3A 2Y05A 5KJ6A 1GUZA 7MDHA 3KTDA 4W4TA 1R15A 4CMIB 3H9EO 5A06A 1D1SA 1LQTA 2I3GA 1KVUA 1ZSYA 3PHHA 3L4BA 5IXYA 3LLVA 1ARZA 1GY8A 1SCUA 3JQ7A 1Z45A 1C1XB 4A2CA 2RCYA 1KEWA 1R4MB 2E48A 1WLYA 3NYWA 1T4BA 2C54A 2XXBA 2YHIB 1K6XA 3ZWMA 4PLHA 3HZZA 1KC1A 3HWRA 4AJ4A 2Y1FA 1Y8RA 3K30A 3RC2A 4J1NA 3DTTA 1GV0A 2E49A 2GZ2A 3PFFA 1DC4A 3TOXA 1LLQA 1YONA 2R00C 5AOVA 2OP0A 4GH5A 3Q6IA 4K1LA 4XJTA 4FFMA 3ANLA 1XQ6A 2ZCUA 4CQLB 3DAFA 2J3HA 1T2EA 4PLYA 2NVWA 2ZYDA 4GX5A 3C24A 4CQMB 4IINA 4BKPA 1DRWA 2BGMA 4DPMA 1FDWA 1VL8A 2RIRA 3EC7A 4GI2A 1ZEMA 3GDOA 4IPTA 1JDJA 2VNSA 1QYVA 2CFCA 2JFHA 1LU9A 2VUUA 1JKJA 1VC2A 3HSKA 4J1QA 3Q3CA 3NUGA 4CV3A 4Z3KA 1V3VA 4GVLA 2JFFA 1YO6A 3DHEA 2YHIA 3PJEA 3HJAA 2O2YA 4AJLA 2Q1WA 1QMGA 2IDZA 1VRWA 1Z7BA 4NNJA 3RJ9A 1Q7GA 2O3UA 4R5MA 3HN7A 4YT5A 3PIDA 4JP3A 1EDZA 5G0TA 4MKXA 3A06A 4OJNA 4E2YA 4FGWA 4RV9A 2V6MA 5MDHA 1E6UA 2EV9A 4NFYA 1HDOA 4JBHA 1U9JA 4XX0A 3B1FA 5JFOA 3L9XA 2OBNA 1ZO8A 2YFHA 5HA5A 1XYGA 5BNTA 2VHWA 1NFQA 5L4NA 4HADA 2BLLA 4XZ3A 5EQDA 1VL0A 2AQHA 4CLRB 4NU5A 4TRJA 3BMCA 1QSGA 1Z75A 3AUUA 3I9LA 1F12A 3UGKA 4S1VA 1O8CA 4PLTA 4XGIA 3AI3A 2NQ8A 1E3EA 1YB4A 3VC7A 1VL6A 1XWFA 3EY4A 3ABIA 3VHRA 2P9CA 4DBZA 1NNUA 4E5MA 5KKAA 4ALKA 5JAZA 1YBMA 4BNGA 1R0SA 1DHRA 2V6BA 3EMKA 1B14A 2P68A 1XG5A 4B4WA 2J8ZA 3CSDA 4IDDA 3VPGA 4LVUA 4EEXA 2QIOA 2P4HX 3VKVA 4W99A 4DMMA 1B3BA 2DBZA 4NPCA 4P38A 4A03A 4BNIA 2RHRA 3COSA 3RUFA 3RFVA 4D3FA 5A5EA 5A5FA 5TIIA 3F5SA 3TZHA 4CLRA 2C5AA 4PIVA 2Y68A 4XGKA 3R1IA 4WLOA 2X7HA 1HXHA 1YE3A 1O5IA 4YACA 4K6FA 3ASUA 3OIDA 3ZGYA 4CMHA 2X4GA 5BSGA 1EUDA 2IZ1A 4CM7A 3F3SA 1TB4A 2FZWA 1X0VA 2NUAA 5JAQA 2ZQYA 1IHYA 4BNVA 3OF2A 1I3LA 3FI9A 3G49A 1GTMA 2OBYA 1L7DA 4YPOA 5IZCC 1DLIA 4Q9NA 5K9ZA 2EEZA 5AQ1A 3DBRB 3JQDA 5L7WA 2CDBA 4U6QA 3D5QA 4NBVA 1QORA 3OA2A 3A4VA 2GERA 5A04A 4JX8A 1HWYA 1R0KA 1B7GO 2X58A 2Z1MA 3BMOA 3DDNA 3EGOA 3GF4A 4R5HA 1ZK0A 3TPCA 3EZLA 2P91A 5AXCA 3I1JA 1ONOA 5LDHA 1V8BA 3VPFA 3GFGA 1LJ8A 3ONFA 3AY3A 3EDMA 1SEVA 2P9EA 5EMHA 1A7AA 1EE9A 3WTCA 2UUPA 3ZU3A 5KJFA 2DTDA 3L77A 2YZ7A 1U3TA 5G0UA 1AN9A 2AG5A 1SO8A 3INRA 1K6IA 4UUPA 1EK5A 1PWZA 3SC6A 3I9OA 3H9QA 3DOOA 4TMFA 1OBFO 2VYVD 4MVJA 4XGNA 1LTHR 3WGQA 2EKLA 3AM5A 4OMUA 2G82A 4WCFA 4HWKA 3WYEA 1UDCA 1ZK2A 4OL9A 1QLHA 2HAEA 2PKRA 3NRCA 4KTTE 5JDCA 3BTUA 1H6BA 4ND4A 3WGOA 1HDZA 4M54A 1ENOA 4KWHA 1FXSA 2YHUA 1KETA 3OQ1A 3NGXA 1YWGO 4WK6A 3V8BA 1X14A 3KZVA 2WYWA 2ZTVA 4PLGA 4Y8VA 2VRCA 2TMGA 2YV1A 3ZV6A 3EHEA 4KZPA 2G17A 4DLLA 4RPLA 1P1IA 4C4OA 1UAGA 4TZKA 3KSDO 1HDGO 3MWEB 3OH8A 5JCXA 2CSUA 3H9UA 3JD0A 1X7GA 3AY7A 2DUWA 3PYLA 3N58A 2B4RO 4L8VA 3CZMA 4PN3A 2GDZA 3F4BA 5B37A 4R4JA 3C85A 3QVTA 4L9RA 2RBEA 4BNHA 3RKRA 3VPHA 1SB9A 3FR8A 3MCVA 2X23A 4B4UA 4FOOA 2LDXA 1LBEA 3EK2A 3F1KA 3HQ4O 4BNKA 5TQVA 5ICSA 4HBGA 3H5RA 2HK9A 2C5EA 1W4ZA 5A3JA 4CMGA 3S8MA 1YL6A 4FFRA 3DXFA 1XLTA 3D64A 1X7DA 5LC1A 3FN4A 3BMOB 5GZ1A 4LRTB 4GSLA 2PLAA 4BO4A 1WVGA 1DC5A 4D43A 1P9LA 3DAPA 3DBVO 1FDTA 2W98A 4MVJP 4WOKA 2D5AA 3OEYA 5COBA 4M55A 2C7GA 2GZ3A 1P1RA 2Z95A 4MIYA 3DEYX 3RC9A 3KOUA 3A1NA 1ISGA 4E2WA 5JO9A 1N7HA 1WZEA 2X86A 3K2EA 1IZ0A 3R0IA 3KSUA 1EVIA 3A9WA 4HY3A 3RJ5A 1VE9A 4LMRA 1ZKMA 4YRDA 5I7VA 5F5LA 3DAGA 3PLNA 4UREA 2ZB4A 3PHLA 4BO8A 4WCFC 1GAEO 1ZIDA 1F0YA 1N8KA 1A72A 1RM4A 1E3IA 3PDJA 1UXIA 4RVHA 4D42A 1NASA 2E4AA 3DBHA 4AJOA 1KIFA 3Q9UA 3IUPA 4ZVVA 3SVTA 2HKIA 1B16A 3BHMA 4JLWA 1LDGA 5DBFA 4E5PA 3WGGA 2AQ8A 4YQZA 3KEOA 3G3EA 5IDWA 1QYWA 1B0AA 2ET6A 3IAHA 4HUJA 1R0LA 1MX3A 1BDBA 4F3YA 5U9CA 2GPTA 3E6AA 1DC3A 4A5OA 1SEPA 3QWHA 3VZSA 4B8ZA 4CL8A 3FWNA 2GASA 3PP8A 4DC1A 4WECA 4GMFA 4O6VA 1DDOA 1NVGA 3H5AA 4CJXA 1BMDA 4BNZA 2OZPA 3K9QO 4YYZA 1ZCJA 3PHJA 1DJQA 1U5AA 3U4IA 5IXSA 2NQTA 1H0KA 1O6ZA 3D4NA 5B4VA 1PGQA 1W0CA 1PZEA 2NU7A 3GNTA 3PHGA 3LDHA 3RFTA 4YDRA 3ZCXA 4AL4A 4EEZA 2NV6A 2AHRA 2Q2VA 5COAA 3UAGA 4AVYA 2A94A 1D8AA 1EEHA 3D5TA 5DZSA 2XAAA 3Q2KA 3LQFA 5BR7A 3WMXA 3PZRA 5EJ2A 2DPGA 4URFA 1I3NA 2HMVA 2CDCA 4L0QA 2I76A 4IUYA 1SC6A 1N92A 2ZB8A 2A9FA 3Q1LA 3RBXA 3UFXA 4J49A 4HX5A 1DFHA 2B35A 2VZ9A 4CQLA 1UJMA 1JWBB 1DIAA 1IYZA 3UCXA 1NHWA 4K6CA 4XIYA 1NPTO 4ZD6A 1UP4A 2ZATA 4AJ2A 2V6FA 3QJ5A 5JY1A 4MKZA 2HJRA 5F3RA 5IDXA 4ILKA 3BMQA 3HDQA 4ZHSA 1R4NB 1JWAB 4WLVA 5JAMA 4BNMA 4JK3A 5CDGA 1PJ3A 2ZJ0A 4MVJH 3LU1A 3FPCA 5I7SA 4XA8A 3WQQA 5JPIA 2W8ZA 3I4CA 4XR4A 1PZFA 2YFQA 1K3TA 3O03A 4DIFA 4J4TA 3V5NA 5TLSA 4LCJA 3KEQA 4D0RA 2PZMA 3B1KA 3VVBA 2O23A 2DC1A 3H4VA 3H7AA 1ADBA 2C7VA 5A9SB 1PJBA 1YL7A 3DO5A 1UH5A 3WNVA 4OHUA 3LLSA 1N5DA 3BYZA 1BTOA 3ROMA 2X0JA 4PZDA 1WDLA 2GUGA 3T7EA 1VLLA 3PXXA 3NV9A 2BF7A 4XIJA 4YAEA 5TC4A 5CDYA 4LMPA 5TSDA 1HDRA 1Z74A 4YJGB 1AXGA 4HXYA 5EERA 1K5HA 5G4KA 4YT8A 4RF2A 2PV7A 3WDSA 2O48X 4I5GA 3PLRA 1N9GA 1R16A 4W7HA 4E4YA 5KIAA 2VRCD 2EF1A 4TRRA 3BMCB 3ZWPA 5DN9A 3EZYA 3S1LA 1TT7A 1ISJA 3DMTA 2FRDA 3FF4A 3TN7A 1FDUA 2DAPA 1I24A 4YJFA 4RL6A 2Q4BA 3EW7A 3ZWXA 5JCJD 3GGGA 1TI7A 3RUEA 3DBLA 5T6BA 1NTOA 1XU7A 2O3RA 4UVHA 2X5JO 2O7QA 2OOSA 4N5MA 3R3JA 2VHZA 4TVOA 4CM8A 3FWZA 5J23A 1BVUA 2Y67A 4GX2A 1TA4A 4QUKA 4RPKA 1ZW1A 1EUZA 4XYBA 2JCYA 4W9NA 3G1UA 1FMCA 3QWAA 1XKQA 4ALIA 3FNHA 5TRTA 3ZU2A 1BWSA 1GPJA 4UEJA 2JHGA 3M1LA 3VPXA 2DUUA 4OH1A 2CD9A 2FSVA 2VZ8A 3ZWOA 3ONDA 3WYBA 3JQCA 3DZHA 3HDYA 2GN9A 4IDCA 4WJZA 2IODA 1KS9A 5A4DA 5KKCA 1QYXA 1ZXLA 4RF3A 4L74A 4B3HA 4BO5A 4FCCA 1CERA 5DP1A 2O3TA 1ISFA 1NXQA 3C3XA 4W7IA 2NWQA 2UAGA 1W73A 2DLDA 4J7UA 4YQYA 4B3JA 1YS4A 1CQIA 2CF6A 4UVIA 2EXXA 5ER6A 4B4OA 3TOZA 3H8VA 4MP8A 3WGZA 2P2SA 3GRKA 3SC4A 1D7OA 2Q2WA 1Z6ZA 4CLXA 1WAMA 3U09A 3IJRA 1YDWA 3ZW9A 2OO5A 2HMUA 2VWQA 3MJTA 3KB6A 2DU8A 1XCBA 4MVJF 4B7UA 1MG5A 1DEHA 2WDZA 1XIVA 4NJMB 4L76A 2WYUA 3CINA 2WM3A 1BVRA 4N5LA 3ZWNA 4QFCA 2ZB7A 3GAZA 1HRDA 4J9UE 4OXNA 2GCGA 3H2ZA 3OJFA 5IF3A 1N1EA 1GR0A 1HE2A 2YQ5A 1YQXA 3H2SA 4IS3A 3UOGA 2B5VA 1CYDA 4YCAA 5KTKA 2VTEA 4WNIA 1ADGA 2O4UX 3MWDB 2CY0A 4AJJA 4E6PA 1IOLA 1Y8QA 4CMEC 4KUHA 1LLCA 4LISA 4JROA 4OQZA 5JBIA 4BL5A 2RH8A 2AE2A 3DBRA 2P4QA 4D3DA 3FR7A 3P19A 2CDAA 4NBUA 5L95A 3HFGA 2VOJA 4U5QA 1SNYA 4PLPA 4LSWA 2GF2A 4ZU3A 4EJ0A 1KVRA 1DIHA 3P7MA 4Z9XA 5EL0A 2J5RA 2WYVA 3MOGA 2X6TA 2EIHA 4DWVA 1CWUA 1Q0HA 3CEAA 4TRNA 2I5PO 4XDZA 8LDHA 3O26A 1U8FO 1YBAA 1ZJZA 2I67A 3ZN2A 5EESA 4JJIA 5DDIP 4CLHA 1UXKA 3Q0EA 1M66A 3TFOA 1IHXA 2BFOA 1X13A 3RKUA 4DQXA 2CVQA 4E33A 5C37A 1IY8A 3WGTA 4ZGWA 1YRLA 2NVBA 4L4SA 4IIUA 4R01A 4DREA 5T64A 1PQUA 3PGXA 3IMFA 3OJ0A 1ADCA 2AQKA 2IZ0A 3AOGA 5IN5A 2Y93A 4DXHA 1MP0A 2NTJA 3AUSA 1Y7TA 3VDRA 1A4IA 1HYGA 2PD6A 3PDUA 1BHSA 3ZNPA 3B20A 3QWFA 5ES3A 3JTMA 2RAFA 5DCUA 2X5KO 3RAJA 1E5QA 5HS6A 1LQUA 2HQ1A 5CEFA 1XSEA 2GZ1A 2JD0A 2Z5LA 4I8XA 4J91A 2BRUA 3GUYA 1QRRA 4YAKA 4MJLA 4BKUA 4A26A 4QQRA 3PZBA 2C0CA 4HNGA 4I5DA 4P4LA 3VH4A 4E30A 4J7CA 5B4UA 1JA9A 5FF9A 4NBRA 4CR8A 3C8MA 4X54A 2G1UA 4E3ZA 1PR3A 5AXAA 3B1JA 2AE1A 3E18A 4NU6A 4O5OA 1JKFA 5L4SA 1PJCA 5LDGA 2J5QA 4O63O 2RH4A 4LW8A 1NHGA 3DFZA 1YL5A 2EGHA 3K2BA 1GL3A 4BNFA 1YGYA 2CMDA 3QVSA 4IJWA 3CMCO 2J3IA 1EMDA 1EVJA 2Q46A 3GEMA 3GOHA 1U7TA 3JD1A 1UZMA 2AA3A 4HKTA 2IE0A 2C2XA 2R2GA 1RM0A 1E1LA 4AG3A 2HDHA 2ZTLA 3ZHYA 3CZRA 3JQ9C 5CEJA 3UCEA 3GT0A 4CR6A 1GZ4A 4LSMA 3F46A 4XD2A 2VQ3A 1CEQA 1U4OA 5BNFA 1YJ8A 4MP6A 4CUZA 3BMNB 1F06A 4MVJM 1Y5RA 2FWMX 3JCZA 4PRKA 1ZMOA 4MINA 4W6ZA 3C7DB 1MLDA 4RDHA 4FC7A 2CNBA 4BNNA 1J4AA 1BXZA 4KP7A 1U5CA 2AEMA 1E7WA 2X9NA 4IZIA 4R1NA 3G17A 3FNEA 4JCOA 4CMIA 1DIRA 1JKIA 1LSJA 5G0VA 2PY6A 3AWDA 5U1PA 4TQGA 4ZQEA 1KVSA 2EW2A 3OJEA 4CV2A 2PD4A 1P3DA 2WJPA 1QYCA 2D0IA 4BMNA 1M75A 4IS2A 4RDIA 3OEWA 5I9MA 2H63A 3ANMA 3TZQA 2DKNA 3GMDA 1A9ZA 1UZNA 1KERA 4BGIA 3R3SA 1Q2XA 2W2KB 2O3QA 2Y66A 1E1NA 3IKTA 5JLAA 1HDYA 1VSVA 2O7SA 2X1HA 3AI1A 5FWNA 3QVOA 3MJ4A 1T26A 1VI2A 3P2YA 1UAYA 1Y9AA 4BHTA 3GGPA 1ZH8A 4Z6KA 9LDTA 1ENPA 1UR5A 3KLPX 5F1KA 4IZHA 4YJDA 1KEUA 1JN0A 3DZBA 2UVDA 1U1IA 1JVBA 4GBJA 4MOWA 3ULKA 1NFRA 3C7AA 5IAAA 5KJ1A 4XR9A 1Y1PA 2NNLD 3GVIA 4A0SA 4KOAA 4NK4A 5CEEA 3JQ8B 4QFDA 4BO7A 3C1OA 2BI7A 4RF5A 4NI5A 3TL3A 4TWRA 4OXKA 5EQFA 1M67A 5L53A 1D1TA 4U6SA 5DT9A 3WGIA 3ROQA 4CPDA 1E3WA 1OZAA 1C14A 2DBRA 3O8QB 2BGLA 3WWZA 4DIBA 1WMBA 4GSKA 4J43A 5IZCA 4CMEA 1IPFA 3NAQA 2H1SA 2UUOA 2UV8A 2VNAA 5H81A 4N18A 3AUAA 1F17A 4B7XA 5G4LA 4M1QA
chains in the Genus database with same CATH superfamily
3TW0A 2HJSA 3WGVA 3U44B 1LFAA 1WB6A 4E1BA 3QBEA 2UXCB 2G71A 3PUVA 1KI3A 1H6DA 2P0AA 4IJVA 4EQZA 2WVGA 4C7OA 2DWUA 2WHPA 1KH1A 2PXHA 2KM1A 2O1SA 1A4UA 4OTZA 5KNBA 1C1DA 1QP0A 1MB4A 1PW5A 3RYTC 3DDUA 1DIBA 3DA8A 2AG0A 2JAUA 3I37X 3R6GA 1F20A 3ZWDA 2BJHA 2P1RA 3N3BC 4AZ0A 4B43A 1LWNA 1UBMS 5IBQA 2F59A 4HQ6A 2J9XB 1TUBA 3K9BA 1SU8A 2DHEA 1L4GA 2WFZA 1JG6A 3ROEA 1EVYA 2QZJA 2EP7A 5KTTA 3FCYA 4DPLA 1R37A 3FFXA 2ZSAA 1IL0A 2VAPA 3O84A 4CG1A 4RO0A 1V16B 1BOOA 4BNJA 3IDSA 5B53A 3IIKA 4FFNA 2OXFA 4Z4QA 1QP4A 1Z6YA 3FAKA 3RSFA 2P9FA 1KQGA 2V5UA 3BE5A 1YS6A 4MQ6A 4QARA 1W4CA 5AUQA 1FA9A 5C4MA 1UWCA 2CF5A 4ZPJA 1VI5A 2BGRA 1V5EA 3FYSA 3LCUA 3ADOA 5E1BA 1ECJA 4D9KA 1BSVA 2OD2A 2OHFA 3G88A 3KBBA 4FGKA 4CTNA 1CJMA 4F2GA 3WIDA 2O4CA 3HJBA 1XHFA 5JXWA 1C0IA 4MHOA 2NTVA 5IK2A 4AS3A 4BMXA 1TT5B 2XUAA 1N7GA 2PRJA 4ZEMA 3DXZA 4G0XA 1Z2EA 4R9NA 4CMCA 5ITZA 1QR6A 5HIIA 3PEFA 4FHFA 1UKZA 1CUBA 2H4ZA 4RIFA 4P7GA 1KI8A 4HVTA 4URVR 5KVCA 2E4UA 3NGMA 1GLNA 5IBRA 2EKDA 1U31A 2GYWA 2C7OA 2VDWA 1DARA 5EHQA 3V7WA 1PL7A 3RRZA 3A9CA 1FSSA 4OOFA 4B9EA 3BT7A 4GM1A 1NBME 4OJMX 3VHLB 2OK8A 5ER9A 4TYYA 3LGSA 4MYTA 2J4DA 1LD3A 3A1WA 1KOLA 4FD3A 2EL7A 1ES9A 4OXRA 2FR1A 3DEFA 5A7FA 3E8SA 4FONA 5FFNA 3B7WA 4DPKA 1U8XX 1R0CA 2GBLA 3CKMA 3CLHA 1GTSA 2GSDA 1QLJA 1P4AA 3ESQA 3LJKA 4M6WB 1BX3A 3W06A 3DC2A 1S2DA 5JCJA 3DDCA 3DMGA 3GEGA 1RJ9A 4HFMA 4R2XA 4RLQA 3IO3A 4HWOA 5BN3A 4JBYA 4IUDS 1RJWA 2ECFA 3M6IA 2UKDA 4R3UC 1MVLA 3KKKA 4JP2A 4MI6A 1VHDA 3NBMA 3V9PA 5IYZB 1KK2A 1RM5A 2C98A 3IJPA 1JSCA 4BNUA 4HQNA 4ER6A 3VNVA 1FSFA 2W71A 3LUGA 1EP2B 1SUBA 1ZMXA 2FUCA 3EMDA 4UEOA 4ZEVA 2JGKA 3AHFA 2PSSA 5FUQA 1GTG1 5EYPB 1VG1A 3LPAA 2HJVA 1O89A 1JFTA 1JTEA 5JY6A 2PD3A 4II2A 4YGYA 3CNQS 2YWFA 3DG9A 2P79A 4WLFA 1MV8A 3PWSA 2G1AA 4B83A 3AHJA 4B31A 2YR0A 4PAWA 3B7GA 3CNBA 2AXEA 1EEXB 4JXKA 4MMYB 4YAUA 2O8CB 2P69A 3IS3A 3DYVA 3KQHA 3D7RA 4QPJC 2PTGA 3DZFA 4YBZA 1P1FA 4TQUS 5EP1A 1X1EA 1Y1RA 2X42A 3K8ZA 5DN6D 4FBMA 5IC5A 2W2VA 3WLKX 2VTKA 5CJ2A 2FFHA 5G02A 3NRJA 4ED9A 1SXJA 1OILA 4GQIA 1RQLA 5AO9A 1RLUA 3V8VA 3FTCA 3VOBA 3LUBA 5KSOA 1RQXA 1YJQA 1L6IA 3MT9A 4Q4AA 5A0FA 4YCDA 3ZK9A 4CM5A 2WTUA 3BGVA 3VKFA 2ZYGA 4EUEA 3NNDA 1I4EB 1X7ZB 2B78A 4YT2A 4QTZA 4UUNA 3GHYA 2V55B 3CKYA 3GJQA 5FHRA 2PWPA 4LBWA 4PU0A 3WL7A 1YVRA 2BBWA 1OTYA 3DE6X 1R4ZA 1NUHA 3BA6A 4IGAA 4JQOA 3E1KA 3QXHA 4NC9A 4TWAA 3SHWA 5BMVF 5CFLA 5LMCA 2PZAA 4HNHA 4CCAA 3FDZA 5HRCA 3KKLA 1YUBA 1G3IA 4Z49A 4G8BA 4AMVA 2PQ6A 4Q21A 3KE8A 3Q3EA 1EBUA 1Y1KE 5AH0A 3WLJA 4IHQA 4PNEA 3H9GA 5BW4A 1Z12A 2H9YA 2VKTA 1A04A 2B3DA 3E81A 1SELA 1BJKA 3DLCA 3TL2A 4E1AA 5BWCA 3K9GA 3ZCVA 3OZBA 3KBOA 4K9NA 3VNUA 2IHZA 5FBHA 1OGIA 2W6JA 3DWIA 1IOZA 4URHA 3LUKA 3TW8B 4DWWA 2P9QA 1A4XA 4XQEA 3STHA 5MF6A 4RVDA 3MUEA 1B8NA 4QSMA 5H7XA 1FNBA 1QMPA 2WOOA 2Y1OA 1BOFA 2OXCA 3GCDA 3ZV7A 2CJPA 5LNK1 2EWVA 4IGEA 2HA2A 2ZTHA 3UCFA 2W93A 3C3MA 3OIGA 5COQA 1FP4A 4HI0E 4RESA 5C3MA 5LQJA 4RE5A 1RIIA 2Y1LA 4GWKA 1NBAA 3LP5A 4KWIA 2GB4A 3S44A 4J75A 2RARA 4F5WA 3CHYA 1WKCA 4NCAA 1O6FA 2VT2A 2Z2KA 4DXAA 1TGYA 1SKQA 2F8MA 2GAJA 2WSSA 5BQPA 3RSCA 5KS2A 2VQEB 2A5JA 4NAHA 5EA2A 2ILTA 4QG7A 3WGNA 1BE1A 1EM8A 3L1UA 1W4BA 2Y9PB 3WHKA 3VDNB 2BR5A 1WNTA 3NV7A 2PL1A 4GC5A 4MRMA 5JMPA 2VCHA 1E18A 2OCDA 4DV7B 4Q37A 2W90A 8ADHA 3M5CA 3QPUA 5DIZA 5AM0A 1R27A 2D3TA 4F4IA 1M7BA 1EH5A 1ZCZA 4AKHA 1P7CA 3LT4A 1Q91A 2PKCA 5C8YB 1OX6A 1D2RA 1VJ0A 4U4AA 2RHCA 1W49A 2CXXA 2NSLA 4AG5A 5ARCA 3FMVA 4TKUB 4GLJA 1FMTA 3FFTA 2X1MA 4GR9A 4A9AA 4D6XA 2AJTA 5J58A 1C7RA 2IYAA 5ALZA 1SZDA 4WXRA 1KZGB 3AUFA 1AM4D 4ANFA 3QWBA 1A27A 2D62A 4Q3CA 1H23A 1G291 2CNNA 3GZ4A 4EX7A 4ZEOA 3Q40A 2NACA 4PQGA 3PQDA 1TEHA 3H9JA 3EPRA 3HLYA 1L4YA 2R5WA 4JJFA 2QU8A 3EF0A 1JU9A 4RJTA 2BMAA 2R48A 3CR7A 5C8VA 4IIGA 5DBIA 2BHSA 5KZMB 3VAZA 3IKJA 1BQEA 3DAHA 3O2NA 1F6DA 2EKPA 2PS1A 1IY1A 1JAYA 4UMVA 4IW3B 4B2LA 1IPHA 5UKDA 1SBQA 5DI9A 1Q7BA 4OI0A 2Z8YA 2R6JA 1SD5A 2Y92A 3GDFA 2JRLA 2CN1A 1CUCA 4K9DA 4QICA 4WN9B 1ZOIA 4UBJA 5FA5A 4ENRA 3NETA 1LTKA 1WBJB 1YR1A 1ZITA 1OWNA 2QTZA 2D5IA 3P5BA 4NECA 2J31A 1Q0TA 2QP4A 2R8OA 1IHPA 4IH1A 4MH0R 3UHFA 4KFRA 4BUZA 1G16A 1J6UA 3CLTC 5BW5A 2HW8A 3GIWA 4IMIB 3WYDA 2Q5FA 1VIMA 1UQTA 4I6JA 4N1AA 4BNYA 1IULA 2GJKA 3KFLA 4JP5A 4JQZA 1LB1B 4UBIA 4YFVA 4PGMA 4M1MA 4FHEA 4NG4A 5LA6B 1HQCA 5CXXA 5TS2A 3TQCA 5ENVA 5K20A 1BD3A 5DM1A 1GRRA 1EWTA 2PAFA 3Q85A 3OZSA 4OHWA 5ALHA 5LP6C 5KYYA 2HHHB 3WLNA 4I36A 3NDJA 1NVTA 2VRNA 4LXIA 3MMSA 5HCUA 5JAUA 2W2QA 4HS4A 4XPIB 1Y8ZA 3L0YA 1H2YA 3FPLA 4PYLA 3SMVA 2RHJA 4D3SA 3V8RA 1PR4A 3ABSB 4N3GA 1M8JA 2AFIB 5CVVA 5E6UB 2O2ZA 3RARA 4HXEB 4IUCS 1EZ1A 1NJ2A 3KQYA 1JFLA 1SY7A 2FEMA 3KPWA 3LHIA 4QUAA 2L0XA 3L1IA 4CG2A 2Z3VA 2JGJA 4QLBA 3PQ7A 2H85A 3T99A 1CY1A 2BFMA 4P2BA 5JE8A 1RMTA 2VK1A 5LZ8A 2FTKE 3W2EA 4O4HB 4C7BA 4Q3LA 1E0DA 1JHOA 3IEUA 2J9GA 4IL5A 3ZOZA 4CHTA 2Y4OA 1OC2A 1Y9EA 1MJHA 2CL7X 3GHHA 5JMWA 4ZODA 4YXWA 1F8UA 2AW5A 2A9QA 5DXAA 1DKOA 2Z6VA 1CY0A 2DFVA 4A10A 1QE0A 3O9ZA 4ZN6A 2JZCA 5JV5A 1Y5MA 2Z9CA 4WL0A 2JKYA 5E2AA 1BCSA 1PYDA 4WE3A 2HIGA 4C07A 2AOWA 3OF5A 4PG5A 2B1QA 1L7BA 1NF3A 1E2PA 3WFIA 1F3LA 2VQSA 1IN5A 2BR3A 1XTBA 5LYJA 1GUFA 1PO7A 2GYVA 3HB0A 3UHJA 3UOAB 2G04A 4MKRA 2C4NA 4B85A 4K0RA 3THXB 5ECGC 1KVQA 2R25B 1FDRA 2BDTA 3B1YA 3UWPA 5L9AA 5FTWA 1H3NA 2D1FA 1XROA 3JQGA 3KHKA 5KSZA 1GUYA 5T3YA 4RY9A 1YTUA 3NANA 2GYUA 4RHFA 1PJ2A 1QHXA 3T7CA 3ZHXA 3ZE7A 2F8LA 2Q6VA 4NFLA 2WFAA 2EVWX 2I6SA 4F3CA 4NS4A 5LSAA 1QKIA 2FR0A 4X91A 1GSAA 1KI4A 2BEUB 2FXIA 2J6CA 1V7QA 3FKJA 3LSYA 5I7AA 3FPBA 1VL1A 2RJOA 5TEVA 1RMYA 5FNZA 2ADFA 5BQ5A 3VMFA 4DC0A 1B76A 5KOYA 3M5WA 1M7HA 2V6JA 5AJUA 4DSAA 1E1RA 1JVSA 2I0FA 2Y1XA 4AWBA 2WM2A 3Q5GA 4DYDA 3TCNA 1K68A 4L95C 4NWIA 5YASA 5EHIA 1Z4LA 4OHMA 3TLYA 3H13A 2QPTA 4URZR 1U0RA 3IQDB 3WLQA 1JEYA 3N1UA 3LC0A 1F2TA 1FLNA 2NX2A 4ADSG 1Z83A 3DCNA 1JLKA 1NJSA 4RTMA 2AF3C 4IAOA 2Q27A 4IV8A 3EBOA 1YQTA 1P7PA 2WSBA 2I2WA 1J8FA 1YJCA 3BAZA 4Y6GB 5H8WA 4Y1GA 3OJOA 3HUFA 2DVMA 4NFSA 4WQMA 3ZE8A 4YH1A 4BV8A 1CY4A 1UPUA 4AY6A 3WWYA 2O07A 1E92A 1GYQA 1I6WA 1PV1A 2HSWA 4G2TA 5BSVA 3EGDB 4RGQA 3X1YA 4KQ6A 3DTVB 3U2QA 1GGMA 2F4NA 5JARA 4ALLA 2AUMA 2EARA 2GHIA 3COWA 1UDXA 1TPYA 5KQLA 4FI3F 1E2GA 2BELA 4LCEA 4RTSA 1N25A 3NVAA 5IDYA 1J24A 5LZ7A 1NQOA 1KKLA 1U3VA 3TUIC 4RTPA 3GARA 2YZMA 1HF3A 3X2SA 4AT1A 1HUQA 4L9AA 4EYOA 1XMJA 3N0TA 4DJJA 3VR6H 4NZ9A 3QVLA 1X42A 3WB1A 5A2GA 3P45A 1QR2A 1QLWA 2EGGA 3H1PA 5F7ZA 2NU8A 1JIXA 3QNMA 3TM4A 3U0VA 3F2IA 4RMHA 3WQRA 3G7NA 4PX2A 1OIXA 1NF2A 1TKRA 2YQ4A 3AETA 2BGTA 2J3KA 2HO5A 2QRKA 4KXVA 2MT9A 4LUCA 2I6UA 4RJJA 3T4XA 4B3IA 4B3CA 1LSUA 3IRVA 2WJHA 4GRAA 3AGPA 3FNQA 3S27A 5A1TA 1DBWA 4KUEA 2QJWA 2V97A 1RAEA 1WUIS 4I3FA 5AVJA 1SU4A 3TECE 4OAOA 4I3GA 4HZIA 3PNQA 2FNAA 1XWWA 1MA3A 1P91A 3CH4B 3ZQUA 3LXMA 5HILA 4BJ3A 2RONA 3GVXA 4W63A 4GZ3A 5BUQA 4QGAA 4QOEA 3GAAA 1LSSA 3U7JA 1OLSB 2IGBA 5KEIA 1KK1A 4EHJA 1ZSVA 3NTQA 3K9CA 3G9ZA 4KI0A 1U2PA 2OA0A 4RTNA 2OGSA 2O0JA 3D1LA 3QOXA 7REQA 1E6WA 1L6RA 1T24A 4IJUA 1A7JA 2H07A 2VI5A 5LYJF 3VX3A 3WYFA 5C18A 4HZGA 4B5KA 1C7IA 2C5LA 2I6TA 1VYTA 3FJOA 1ABFA 2QN9A 5DX0A 3K71B 3PEVA 1UBJS 5B58C 5KYGA 3GAFA 3MB8A 3PQ5A 5AJWA 4FQ8A 1CF4A 5IH3A 4X94A 3PPIA 1J49A 3UAXA 4D5EA 4Z7OB 1KY4A 2CLFB 1E3TA 2EFEB 3H6KA 3HCPA 1YZQA 4ZJZA 3W6PA 1Z88A 3SY8A 3CW9A 4EZBA 1W8DA 3H1AA 4O4LB 3EQZA 3HLTA 4NMLA 4V38A 3L6DA 1C0LA 5G1OA 2LGJA 2GZHA 3UAYA 3W8EA 2QN7A 3Q7QA 3H2YA 2J0UB 4LK3A 4LJAA 4XFDA 1R5BA 4ESOA 1JE1A 3LCJA 4HQOA 3WQHA 4E5YA 2I4MA 5I9LA 3GJXC 2J32A 5CB0A 1C1XA 5CA0B 4PGAA 3C3BA 2HHCA 4RKWA 4P35A 4R31A 4BVBA 4OJQA 2F7SA 4DA6A 1DC8A 3IESA 4UUOA 1SXHA 2JFUA 1Z4IA 3QMPA 3TF5A 2F9LA 4ZRMA 1NSYA 4NIMA 1UDAA 3OMLA 4OGGA 3WV5A 1GDTA 4A73A 2ZDHA 1F38A 2W9XA 1W5EA 2YRFA 3VU9A 1OLXB 2H6EA 4N9QA 1Q0PA 2ZB3A 5CA1B 4OHYA 4G1UC 4JEMA 1GYPA 3W6NA 4W8GA 4I4IA 2C0PA 3JR7A 2L18A 3VU3A 1QWOA 4HEQA 5C7IO 1HNNA 2FMUA 4P4SA 3BTSA 1ZINA 3R7BA 3SLKA 2MHCA 3LT1A 4DN6A 1HTBA 5KQRA 1GITA 2NADA 2OCIA 2Y4NA 3U37A 1U0LA 1Q1GA 3PX7A 2E4YA 3UC5A 3NJ8A 3EIWA 3H65A 1U5BB 1NSTA 4TWBA 4MWSA 4PQFA 1OAKA 4X8OA 4TSFD 5F2OA 1XQYA 1Z68A 1S1CA 1TEXA 2DY0A 2XQJA 2YVLA 3L0IB 4QT0A 3RDPA 3QBVA 1UOEA 2W6ZA 2PCJA 1VLZA 3QPWA 4L73A 4X24A 4Q5IA 3STWA 1L7EA 1YHZA 3T94A 4D3YA 3M82A 1Z5GA 2GNAA 1ZNZA 3M5PA 4ID9A 3TIFA 3TKLA 3HI4A 4DA8A 2EP5A 4P5EA 3FIUA 3UJ7A 1P4JA 2A4KA 2EZ8A 5LBIA 4JV5B 1G8MA 4WOCA 3A1FA 4FXPA 2JANA 3D4IA 4EBBA 2IXGA 4C2BA 3P26A 1ZCBA 3BXHA 4NU8X 4EPWA 1XA0A 4EHKA 5LZ4A 2OLEA 1QCCA 2I7CA 2XVAA 4WJKB 3UH1A 1S2NA 3IMCA 1DJNA 2FEOA 3WB0A 1AKWA 1FDSA 4U00A 4DUZB 4WGFA 1P3JA 5JJ5A 3SZRA 4ZI2A 4FJ0A 1JLSA 1PGPA 4IKPA 1WF6A 2PQ0A 2VKQA 2VXBA 1QQTA 3UICA 1P0QA 2A57A 3A9UA 4LOLA 4RQAA 1G0OA 4FFBB 1WBBA 5EE9A 5AW3A 4DCGA 3R9KA 3IIJA 1XZHA 4IJKA 5D84A 1JE0A 2Z4TA 3KUXA 2HV9A 4CDRA 4MJXA 5ADUS 2GXUA 4AZ3B 1T3TA 1DCFA 2R8XA 1XNJA 3ZWVA 3A05A 1D03A 1J2JA 3CS3A 2FAXA 4P36A 1XD2A 2GD2A 4ZO8A 1IBKB 3R6WA 4MB6A 2BMJA 2FRVA 4YRSA 5A9SA 4IWXA 1I5RA 4Y6PA 2OO5C 4HX2A 4Q9KA 3OIWA 5IG2A 1A5AB 3DONA 2HMSA 3DV0B 3GMTA 4EO9A 1KZYC 3LVBA 1QX3A 5EP3A 3U60B 1WBDA 2Q1XA 2DMRA 4AXBA 4HB3A 4PXAA 5J5CA 4F04A 4D1YA 3CJRA 3T3PB 4L8LA 1DJLA 4GT1A 4WERA 4EY6A 1XMVA 4KDRA 3RVDA 4AMBA 1NFFA 4OGWA 1WETA 3H0EA 1E2FA 2NM0A 2OFPA 3HO1A 2GESA 3CN7A 4H7IA 3DDWA 3JVVA 3TZ6A 3AY0A 2JAWA 3PC6A 5HKKA 1BRTA 2ORIA 4P8RA 3FG9A 2PQMA 1EE1A 2NPFA 4QTTB 5HWSA 1QBGA 1I8TA 4K6GA 1V95A 1X74A 1L1FA 4ZVPA 2W70A 4GHWA 4QOIA 2X0DA 4R1LA 4BPBA 3R24A 1ZH4A 4BIIA 3UMRA 2WILA 3HWX1 3D6JA 1W35A 3QVXA 3ZJVA 2GR9A 7YASA 1L7RA 2VOEA 4BGDA 1B2LA 1FFHA 2AMLA 4M2LA 1EJ0A 1Z0ZA 1ENZA 2FPSA 3TEFA 3WIBA 2G5PA 4CCYB 4NQZA 4AJPA 2JGDA 1X3LA 5J5VA 1JR4A 2BGWA 3SBEA 4YEDA 2FRDC 1P5JA 1UBEA 4R7TA 1IU9A 1CR0A 1I1HA 3STTA 1BW9B 3SJAA 4B5LA 5FTLA 1QVRA 4LNUA 4KO4S 3W5JA 1AKQA 1XKTA 2ID4A 2O0HA 1T8WA 2XOXA 1H9BA 3BSYA 1WMDA 4MW2A 5IM4F 5DNYB 5A71A 2POQX 7ABPA 4BV9A 1NUUA 3HFJA 1TJ5A 4XB2A 4M88A 121PA 4ETMA 5AM2A 3IUSA 3I6QA 4GQAA 1G17A 4ZV7A 3PJGA 3GRCA 2FW0A 3ET5A 1TYDE 2QP9X 5CAEA 2FGKA 1RS0A 3QA9A 3G0HA 2QWXA 4CKWB 4XUEA 3DT8A 3OE5A 4ZAGA 4Q7LA 3LBNA 1M5RA 4BNLA 1MFZA 1JBQA 4W9NC 5A1JA 1JSZA 1PJ4A 2BKLA 3M1YA 5EE1A 4BQOA 4TTSA 5B4TA 4K9MA 5ES4B 3EWIA 4EFMA 2Z2IA 1D0SA 3E70C 3RU2A 5LJLA 4HLQB 3RUAA 4EMBA 2F3TA 4A1FA 5EWLB 1TCCA 1D2GA 3A7EA 1E9BA 1PZHA 4BN0A 1SRRA 3PYXA 1N2XA 2C4HA 2G8LA 2ZKIA 4LHZA 4LTDA 1RJDA 3T0IA 1HKHA 3ZEIA 1EFTA 2ZOSA 3GUCA 2P3OA 1LW6E 1W2WB 4HCJA 3NPAA 2GCEA 2P9GA 2YJ6A 3R3WA 4DY6A 2GM3A 3N0VA 4ZYYA 2SNIE 2IIQA 3B82A 3RIMA 2ZM6B 5HE9A 2VAXA 3EZGA 1UPTA 3DVAA 2G80A 3GEBA 4LTMA 1LF5A 4RIIA 4TKLA 4MVJD 2Q29A 3RFXA 4F45A 3AUTA 3U0BA 3ZVMA 5CFMA 3PVZA 2BRUC 4DMHA 1ZDMA 5BW6B 1MQ8B 3RVOA 1E6MA 5LVAA 1RXSA 2ZRAA 3K0CA 1QVZA 1RTKA 4ILEA 4KO3S 1PP4A 1EXDA 1V9LA 4GNRA 1GXSA 1SUFA 2PMKA 1ZU4A 4MLCA 4FSDA 4KO8A 5LQCA 1NWHA 4JB8A 4H2DA 3ANNA 4UHDA 3PHIA 1I2MA 3F6SA 3F97A 4ND5A 1KBQA 3JZFA 4L5AA 5CM9C 3ZS8A 3EXIA 4RTRA 2IWRA 3ELUA 1T13A 3PNSA 2YZNA 2VT3A 2Y2UA 4PPGA 2QRGA 1ODFA 1NVXQ 2XUKA 3PPYA 1M9NA 2AOTB 3T9DA 3SZUA 3VJLA 2I6GA 4ENPA 1J1ZA 4O3FA 3ZGOA 4HUQA 4WA8A 3U1TA 2C2YA 2B8TA 5DBHX 4DR1B 5GJVC 4AY5A 2G83A 1U98A 1R9MA 1QFMA 1WDWB 5JDIA 1PNTA 3D2LA 4YPFA 2HM7A 3KP1A 3ZWAA 4GU5A 1Y7LA 1U2EA 1AKYA 1JIIA 1CEXA 1UFRA 2AJCA 1JZTA 1PZGA 2X22A 2M1XA 3HB9A 3EDCA 3LFHA 4OFXA 2GHQA 2OEPA 4M0PA 1M10A 1DNPA 4MB0A 1Y7HA 2F6RA 3M6MD 1E1YA 3TRFA 3QUSA 3DOIA 1ORTA 2BAGA 2XTNA 4G4SO 4KQWA 5EUCA 2EWWA 4C0WA 3OHSX 4WK4B 4YI5A 4U3JA 2QPLA 3P9CA 5GOTA 2HCTA 4CM4A 2M98A 2WF7A 4RA6A 3EW9A 1NQUA 1G5HA 2GH1A 1GCUA 3B6IA 2L2QA 1I5EA 1ULSA 2YV4A 1QO0A 3MT8A 2NV2B 3BD6A 4YJHB 4NXNB 3IRUA 4JGIA 2GXQA 3HKDB 1WPQA 1ZJ6A 2XD4A 3DCYA 2LBPA 4ZQCB 5BWBA 1E0JA 1PR5A 3C43A 3MYYA 3B6MA 2XZTA 3MWLA 4PC1A 1A8IA 4AI6A 2OHIA 3NATA 1G6OA 3GWZA 3U3JA 1HL3A 2AC2A 1G55A 2RHWA 1TPZA 1VE1A 4QDUA 2I2CA 4Q3OA 3MD9A 3WMWA 1EAMA 2XECA 2C7PA 2C5SA 4O2BF 4KTVE 5A3VA 2J9ZB 5DLYA 3SG0A 4OBWA 5BSUA 1Q2UA 4X20B 4ZT5A 3VTFA 2ZGVA 2B69A 4EFKA 2X3YA 1G98A 2XEXA 5FWXB 1O96B 1R6TA 1TM2A 2BM9A 3PF8A 4KMRA 3MTEA 2H11A 5HQ3B 2ONCA 3VSBA 3DTYA 2ZE8A 3MWJA 1JDTA 1OLUA 3PI7A 2OP1A 3ISVA 1RQRA 4ALJA 3FOCA 2JKVA 4DMFA 2ZFUA 2ZWPA 5CX1A 1ZPDA 4HJXA 4J9VA 1GGVA 3SBDA 2XOKA 3HVIA 2Y76A 4E14A 3L4SO 4NDAA 4QOGA 3K1AA 4XD7D 3LT0A 2C8KA 3TR5A 4NTZA 5ESRA 3AJRA 4JCCA 2OCAA 3LBHA 1GFSA 4TRMA 1Q12A 1TIPA 3PJDA 3Q0TA 2W6MA 3KM0A 4U0KA 2C9YA 3TAUA 2XA1A 3D7LA 1F6WA 2ZBQA 4EY3A 4CLDA 2IXBA 1LBIA 2I7DA 1P33A 1XXLA 2GHTA 3J80A 4P0PB 1L3IA 2QMYA 3PU6A 2H59A 4EMTA 1MJFA 2AFIE 4JL5A 5IJ0A 1WULS 3F8SA 1G7CA 2PUAA 4MRPA 1JLMA 3ON5A 4RSMA 1H65A 5JANA 1PX0A 1T25A 2QP3A 2G77B 1ZM7A 2PBZA 5B2EA 1WKBA 3GR6A 3X2FA 4FJ2A 4EUKA 5KYVA 3JTEA 4XKJA 3KVYA 1ZRNA 4N12A 4ZJYA 1YR6A 4IDGA 4Q4JB 2BUAA 1MCZA 4MJ7A 2Y0DA 2QUIA 4P33A 2C2ZA 5LQNA 3KSMA 3KOMA 2WSYB 3IAM6 4POOA 3NHLA 1IEQA 5JZSA 5D51S 9ABPA 1YJ5A 2N1MA 3SQMA 1Z0IA 1OOEA 1WDMA 3G82C 3N2KB 4KFCA 2B4YA 1T5OA 1FPMA 1ZISA 1SCUB 2QW0X 2XQVA 1G5IA 3OESA 3PQEA 5LBTA 3UGTA 1U1DA 4C0XA 1KFCB 3IP1A 3R0XA 4A8JB 3PXGA 4FJ1A 1I2ZA 3ENZA 3T4EA 5L3QA 1U1CA 4LFBB 4ZXFA 3G2IA 1PRYA 3SCZA 3ZGNA 3HL4A 2GILA 4J07A 2HU2A 3RHTA 4OM7A 1OT5A 4YJKA 3H5TA 1KY2A 3H97A 3H3XA 3JYNA 3ECAA 3KOWA 3I6ZA 4HV4A 1J5PA 3CX6A 4EJ6A 5K6AC 4BQQA 5EHZA 2FG7C 4L4RA 1S0UA 1TTHA 1QGAA 4NG5A 1LNQA 2E9SA 4GEGA 2BI8A 2PJDA 4ML3A 4R40A 5DNEA 1R6XA 2LIVA 3HXTA 5CGZA 2HIAA 5BOSA 1EPUA 5T4FA 5KNLA 4I55F 1T5DX 3GL9A 3UQZA 3OJXA 2Z2XA 4BBJA 4G5OA 2XRZA 3O8CA 1WCV1 3SZOA 4ZI7B 5KNDD 3KJFA 1TM5E 4ECAA 1NJ5A 1SPXA 2ONKA 2SKEA 2IYUA 5T5QA 3V00A 4HN9A 2ZJOA 2CJXA 1K4KA 4JQYA 4OIMA 1VIDA 4H3VA 4TVKA 3RVJA 1Z0KA 1BEEA 2G0TA 3G8DA 1IXKA 2QVYX 2GJAA 3T3GA 2FQQA 1VSBA 4EKIA 3SVLA 3CA8A 2PR2A 2F1HA 4KXNA 3DM5A 4MR8B 3RAEC 4KIUA 3BM5A 4EM6A 1ZSNA 3NJ4A 4QUDA 4US1R 2QX8A 1AHHA 3LQRA 2VTBA 4M0CA 4PQEA 3QKSA 5IRCD 3RV3A 3ZV3A 2AKYA 1KU6A 2ZQ5A 5BNIA 2IYZA 3GNSA 5LQUA 4GZ6A 4Q3EA 3BMNA 4PHGA 2F2TA 4K86A 3TXYA 4NESA 5K8JB 1TW2A 3L07A 2WHXA 5THQA 2QLMA 1BYIA 2WW8A 2Z1DA 1WZIA 1K7XB 2E37A 2GCOA 5DLPA 1FSZA 2PMBA 1P0PA 2QRZA 2QUZA 4Y2JA 3CONA 4ZO9A 5TGDA 4MKHA 5EKTA 3IEPA 4AJ1A 1SOUA 3S2FA 5U4XA 1IXRC 2PA3A 5HBRA 1KHHA 1X77A 3F4KA 4EW6A 1NBEA 3HNPA 2JIQA 5I6DA 3RYFB 3PFIA 3F5QA 3NT2A 3ACDA 1F4VA 2JIDA 1ACLA 3KLBA 3PUXA 5K3EA 3NOQA 3E2IA 4MDYA 5IUNC 5AQEA 5FEUA 4D4LA 3OJLA 5K0BA 2GZAA 1GPNA 1YZGA 3HJHA 4BLOA 1E5TA 3OZDA 3CSSA 3DS8A 5EAIA 4ZCIA 1ECCA 3THWA 2HTFA 5T8KA 4TV9B 3OLCX 5H5JA 5BSEA 4G5HA 4V0QA 3L0ZA 1AHPA 4UFNA 3ENWA 1U63A 1AGYA 1YQWA 2VUHB 3RCBA 2HRBA 2V03A 2XMGA 2QSUA 3KRTA 4IDFA 4DCTA 5FOQA 4CM3A 1GCGA 5AP9A 2B8EA 3IPLA 2C20A 4FS8A 4DLSA 2QYTA 3ZW7A 1WVIA 7GPBA 4GWLA 2ERXA 3OFNA 3ZI4A 2C7QA 1OU4A 2EQAA 4MQBA 3HO6A 1HE4A 1L4UA 1IE3A 3PFKA 2KWIA 4L5BA 3SE7A 3DEIA 3K6SB 3QEAZ 3R7WB 2JHPA 3ZNOA 3JV7A 3D6HA 4WBNB 2AI1A 2HPZA 4KDFA 2PSEA 3WSWA 2JAOA 1JPNA 3LQYA 4P54A 2EQBA 4EPXA 1PGNA 1YI1A 3HUTA 4AC9A 4E5SA 4F84A 2JHAA 2DQSA 3OE7A 1T8PA 3P8ZA 3SFVA 2G25A 5EJIA 5JSKA 2PKYX 2QTVB 1CUSA 3QU4A 1VE5A 2PU7A 3ZGXA 4CF4A 4AW9A 1YZKA 4KC0A 3IVCA 3MQ2A 4JR2A 1UDRA 2Q1TA 3ET4A 4JYMA 4O0LA 5REQB 4DCOA 5JNLA 1AHIA 4DR4B 5K05A 3SOZA 4HS9A 1JTVA 1P3Y1 1PSDA 1EYZA 3FNGA 3I01M 4FILA 2XGGA 4QU9A 1V37A 4U9UA 2P62A 5FL7D 1AQLA 4D99A 1UC9A 2GARA 5J3JA 1OFUA 2O2IA 5EN4A 2QRPA 4RACA 1AK1A 1C8VB 1MB3A 1BJTA 3PEUA 4BUCA 1UM9B 2CEKA 2O2JA 3MJDA 1WZCA 2YXEA 4F9GA 4GR4A 2IOQA 2PGJA 2VDRB 2YN0A 1E4EA 3AL3A 5DTIA 1F8FA 2C31A 3KVRA 2DJ5A 4F6RB 2QS9A 3S5JA 3U19A 2X8AA 1MB2A 1YJAA 1B3RA 2A78A 2C3UA 2IT1A 3FWPA 4ZOLB 3F2VA 5F2KA 3L05A 1BQ4A 4PW0A 3EX7C 3BBLA 2G88A 1W36D 1U2DC 3VNAA 3D4BA 9LDBA 4BJ1A 1FDVA 2FW6A 2PEYA 4HSEA 1EZ4A 2O20A 2SCUA 3DMYA 3H6HA 2NVUB 4D56A 3HDGA 3MILA 4GLOA 3KYDA 3D9QX 3FPFA 3QV1A 5IFLA 4PFJA 4DG8A 4JYBA 1O5TA 4Z9FA 1XGKA 2FWPA 3I12A 4MGEA 5H9VA 1TT5A 4BLPA 4QDTA 3OP1A 4RXMA 2UYCA 1W6UA 4ZKDA 1JG1A 1PG5A 3C6MA 5A03A 1CE8B 4QFBA 2EFDB 3GPIA 1BD4A 3ORHA 1PFKA 5U4QA 4H15A 3PPVA 4WAUA 3UMFA 3E23A 2VNKA 1Z4OA 1ZK1A 2CXTA 3SEFA 4EI7A 3M2TA 3RI3A 1JBKA 3ZZMA 4TKMA 4X1YB 1GKIA 4CMBA 2P1DA 1H2XA 1MOZA 4IQFA 1A9XA 3BMQB 2HD4A 2JAPA 2R96A 4KJXA 5DF1A 5PNTA 1GQSA 3RSHA 3UAWA 4CIYA 3IB3A 1B8UA 2YZGA 1E7QA 1QANA 3SR3A 2OCBA 3G7UA 2BKEA 3W9UA 1LBQA 5FBKA 1KTVA 1L3CA 3AERB 3TDMA 2V7UA 1T5TA 1WW3A 2BUBA 3AEYA 3KG2A 3LO5A 3EH1A 3EXFA 4LC0A 4A8JA 1DZ3A 2NSYA 4OKNA 2RB4A 3X44A 4FC6A 4OA5A 1N2JA 3V1NA 2IP1A 3MINA 2F62A 2NXEA 3SQWA 4Y2HA 4BFXA 3BB3A 4OGLA 4ZIRA 2O59A 1YH3A 4EAQA 3L0DA 5ICCA 2D00A 3ZZUA 1G7TA 2QVCA 5BNWA 2EJVA 3QXJA 2ZTSA 3VYUB 3F5MA 1FZQA 3WWDA 4MWZA 3ORFA 1ULUA 4B4VA 4U39A 3L4KA 1P0CA 1RWPA 1MO2A 4NOKA 3DDSA 2O3JA 4OMCA 4D8UA 1JIKA 4QYMA 1VLVA 4ZP1A 5CG2A 2JIMA 3DE0X 4MEJA 4CFZA 4W1RA 3I9NA 2LDBA 5HCIA 3BH7A 3U6KA 4GKKB 3P97A 4QBFA 4OHRA 4XWKA 1ESDA 4BOYA 5DRYA 2WK1A 2C2HA 1B41A 2IYFA 2WIKA 4V2UA 4EA8A 1I3KA 2R47A 3QOWA 3N7AA 3UKJA 1KDOA 2DHDA 2PO7A 2WZDA 1N5JA 3AKYA 3O8BA 3ONNA 4LJ8A 4Q9IA 2WIBA 4DMLA 4UJ5A 5BQFA 3PKZA 3WQSB 1ZK4A 1YB1A 2PH1A 3QEMB 2C3YA 3FTNA 1GPUA 1VHQA 1MH9A 1YBVA 3VHXB 1OH8A 3VZCA 3SAJA 4FGJA 1QIDA 4C2TA 2HRCA 4UJ3A 5JT1A 1X7HA 3RVRA 1IN6A 1HZJA 5C32A 3VA7A 3JVEA 3GN1A 5HDBB 1Z2PX 3B6ZA 4GGMX 3EB9A 3GLHA 3TR6A 1TAUA 1E5XA 5F64A 1JQEA 4B4DA 3FHLA 4YV2A 1P44A 4UM9D 5CMLA 3N8KA 1I1OA 2QTTA 4NS1A 1XHEA 3OX1A 3PQ8A 4EB3A 2WNIA 2ZBGA 2O6LA 5JASA 3KAJA 2P0YA 1CQZA 2W8BB 3GK3A 3X1ZA 2AXQA 1I4WA 5JCPA 1DFIA 3O1HB 1E1MA 3AKDA 1OWOA 2IHJA 4WFKA 3KD2A 2C5BA 4E5UA 1UXGA 2XRMA 2Y1CA 4D6YA 4ZZ2A 2C5GA 2XBLA 3NP9A 2AZ4A 3R74A 2V3WA 2AR7A 3AG6A 1GQ2A 3I9V6 4HO1X 3RASA 1ZI8A 13PKA 2Q4EA 2CW5A 2IX3A 2WVAA 3ZXIA 2V9PA 2VT6A 3TX6A 4HATA 3MM4A 2YWJA 4J16A 4C4AA 2DWQA 1EUCA 3JQAA 3RU7A 4H18A 3CX8A 3JARB 5IJWA 2HA7A 2HNBA 4GXRA 5LN1A 1TL7C 4PYRA 4LRXA 4JI7B 1FP7A 4EI2A 5FFMA 1Y7IA 3KYCA 3QK7A 2FX2A 2J46A 1CKEA 3BK2A 3HXPA 4F2HA 1A7KA 2IHKA 3KAPA 1RBMA 3D3WA 4P0TA 4TLBA 4HDNA 1HE5A 1YB6A 2AOXA 4NABA 1CX9B 4RQBA 3WGLA 3DLAA 2XE7A 3SX4A 4B3FX 3P9IA 2I6QA 2CJWA 5CNMA 3LVRE 4L02A 1AUXA 1JDBB 2ODAA 3H84A 3X0DA 2FWIA 2JEYA 1DBVO 2G76A 3I4FA 3KO8A 4MW6A 2FSUA 2W11A 3CC8A 3K1YA 3DR3A 1ISPA 3MK31 1E79A 3N5KA 4M8KA 5LXTF 3KJIA 3I01A 2Y05A 5KJ6A 2OWEA 2EIXA 4URUR 2R86A 2XMSA 4MLZA 1R15A 2PLFA 4EVIA 4OJTA 1Y98A 1RYFA 3H9EO 4FNMA 3RLFA 1LQTA 2R1VB 3QXXA 3EUAA 4RJIA 4ZVKA 4W9MC 1KVUA 2WDPA 4CTMA 1H5NA 3ONVA 1ARZA 4UDXX 1W0JA 1TFRA 1Z45A 4A2CA 5IKMA 1WTAA 3MJHA 2RCYA 1R4MB 3G5AA 1VJCA 1T4BA 3KD3A 3D6FA 4CKEB 5LB4A 2V7BA 1MR3F 4IGKA 4RHCA 3T54A 1YFJA 4PZLA 3A2KA 3OQPA 5HXAA 1PYGA 1KTIA 2ODBA 4UTVA 2BGGA 4S1PA 2Y1FA 1HDIA 2G07A 2XNKA 4W5JA 2AI2A 3IVMA 1J0CA 3KEFA 5DWDA 1M2FA 2OILA 4DCVA 3TOXA 1X7XB 3EGXA 2LCIA 2R00C 1HZZC 2W6QA 2A67A 3MYRA 3N2GB 3Q6IA 4Y30A 1SG9A 4F7WA 2D7DA 1UOOA 4JI2B 3ANLA 3IA7A 4HNAA 2FPLA 3DAFA 4DAEA 4YHHB 2NVWA 3C24A 4CQMB 4RKQA 3UMMA 5IHXA 4BKPA 3RB8A 5FV7A 2BGMA 4DPMA 3VBEA 5C8YA 2RCNA 1AA9A 3E53A 1BO6A 1JDJA 1MB0A 3T1YB 2CFCA 1HM5A 2JFHA 2IX9A 1T2UA 2VUUA 1VC2A 1MT3A 4H7EA 4F2DA 5AUNB 2XDQB 8ATCA 4GBMA 4Q9JA 3TD6A 4Z3KA 2W37A 4Q1VA 4O2BA 5JBQA 3PQ6A 1YAJA 2GCPA 4Q9AA 5I4IA 1V1RA 3GP8A 3OU7A 1G8YA 3LKZA 2NXCA 4KQEA 3A9TA 2IDZA 3LL7A 1Z7BA 2GFQA 3RSOA 1JDSA 4B2IA 1A8UA 1QQAA 2P0EA 1II8B 2ZAIA 3BJEA 4WZBA 4JP3A 2A3NA 5G0TA 3LOQA 4OJNA 1DKLA 2SKCA 3F5DA 3ND5A 2E5FA 3GJYA 1XTRA 2JF0A