4YACA

Crystal structure of ligo in complex with nadh from sphingobium sp. strain syk-6
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
295
structure length
270
Chain Sequence
MQDLEGKVAFVTGGGSGVALGQAKVLAEEAQMKVVIADIRQDHLDEAMGYFSQKNVAVHPVRLDLTDRAAYAAAVDEAEQVFGPVDLLCNTAGVSQFGPIEKATFDDWDWQMDVNVNGVINGVMTVMPRMIERGQGGHILITASMSAFVALPTTGIYCTTKYAVRGLAESLRVEMPKYNIGVSLLCPGGEAVFAGLKRVIEHGFDPVDLGRVVLDAVRNDRFWVLPYPEFAEGQKARDQEVIDAMMSYADHPDYARRMKIREQMKRDMPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biochemical Characterization of the Early and Late Enzymes in the Lignin beta-Aryl Ether Cleavage Pathway from Sphingobium sp. SYK-6.
pubmed doi rcsb
source organism Sphingobium sp. syk-6
molecule tags Oxidoreductase
molecule keywords C alpha-dehydrogenase
total genus 100
structure length 270
sequence length 295
ec nomenclature
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4yacA01
3NV9A 3KM0A 4CMHA 2C20A 4J7XA 5CP8A 1Q7CA 3ZWVA 2NTJA 5ES3A 3RUFA 4J16A 5HRUA 4BNJA 2NU8A 4L74A 3DR3A 3WNQA 1YKFA 4GSLA 3ZWBA 2HRZA 3DZBA 3PHHA 2I3GA 1PJ3A 4CR8A 4IGFA 1PJSA 3G1TA 5A1TA 5BSEA 3WGIA 2ZIZA 4XKJA 1HF3A 1X1TA 4BMNA 3DHYA 4R41A 1ID1A 2HJRA 1F06A 3HADA 4CL8A 1EDZA 1P74A 2VN8A 1G6KA 3FR7A 3FRJA 3P7MA 5JCXA 4YQYA 1T1SA 4FSHA 3ZWCA 3GAZA 1PS8A 5EL0A 3WG9A 1DC6A 3G3EA 3GUCA 2PH3A 9LDTA 2DBRA 5ER9A 3PLRA 5L4SA 1GZ4A 2VT2A 2J3JA 1XYGA 2ZTUA 2VWHA 1HSOA 3QLJA 4E6PA 1GY8A 1T25A 2PNFA 4XB1A 4EJ6A 1E1NA 2X5KO 3QE3A 4P4GA 5EERA 3FPCA 2VZ8A 5JAIA 1G0OA 3DC2A 5KJ6A 3FNEA 2R00C 2VCYA 5FFFA 1GCUA 2PKQP 2GD1O 4WCFB 3G17A 1ZK3A 3KZVA 4IZHA 4NNJA 5T57A 3V1UA 4CUZA 3JQEA 4LCEA 1I2BA 3ONFA 1I10A 4NU6A 3W4JA 4CLXA 2OL4A 1E3WA 3E1KA 2G0TA 3AU8A 1PEDA 5DBGA 1LDYA 1EVJA 2BD0A 4R01A 3IS3A 3IKTA 1RPNA 3HZZA 3U4CA 4PGFA 3OQBA 4Q3NA 4CMKA 2J8ZA 4DQXA 1LSSA 3W8EA 3ASUA 4K1LA 3BHJA 5KNLA 1NQ5A 4NBRA 3ZCXA 3WBFA 1P1RA 2Y68A 3HQ4O 1H5QA 4ZJUA 3LVFO 1E7RA 1GL3A 1LI4A 1PJLA 2H5LA 3I9MA 4IGEA 3S2GA 1R0SA 4BNXA 3A1NA 4ND3A 1E7MA 3RFXA 2QZZA 2BH9A 4MVJD 4RVHA 1KY5A 1FDUA 4P4NA 4B4VA 2IEBA 4FFNA 1GYQA 2GNAA 4M54A 4KQWA 4E4YA 5B1YA 3DDNA 3VH1A 5HS6A 1I30A 4GBJA 4PLZA 3HHPA 3PQDA 4AJOA 5G0SA 4OJNA 2PLAA 3QRWA 4AJ2A 5CEJA 4BL5A 5BNFA 4D3SA 2Y99A 1P77A 4YJDA 4YR9A 3B20A 4IDFA 4DL9A 4A10A 1E0DA 1NVMB 1D7OA 1XU7A 2EG9A 5DZSA 2NUAA 1KVSA 4YWJA 2YFQA 5ITVA 5CG1A 1IL0A 1UAYA 4MINA 2IZ0A 1H6AA 3FR8A 5G0VA 1F14A 3LT4A 3D5TA 3PRJA 4Z3KA 5JCJD 3FN4A 3HN2A 3F46A 4IQ8A 1VKNA 4RJTA 4XQCA 2PGJA 3FWNA 5DCWA 4Y6PA 1Y5RA 1QYWA 2NVUB 1KY4A 2DM6A 3DBLB 3V1YA 4J1SA 4RZHA 4PLHA 3ST7A 3RJ9A 3GUYA 2PZJA 4QT0A 3SBOA 4ZQBA 4Z3DA 2YY7A 5I8ZA 4QUKA 2PY6A 4R1UA 4IMRA 4D46A 3KSUA 1ADFA 2IODA 4WCFC 1AE1A 1LBEA 1QORA 2PA3A 1IYZA 3CSDA 4GPD1 4AJJA 1IULA 3I3OA 3VH2A 4J1TA 3U0BA 5C7LO 4ND2A 5AVOA 3U4IA 4F6CA 1A27A 4HFNA 4KDEA 3ZNOA 1JAXA 4E2YA 4E13A 2AW5A 3AU9A 3H7AA 3ROKA 3I4FA 3O8QB 5A06A 4FOOA 2HMSA 1DIGA 1A7KA 1EQ2A 1LLUA 4PCVA 5KWEA 4U0KA 2WEKA 1WMAA 4M8SA 3WMWA 2AA3A 5DDIP 4BNYA 1W8DA 2NSDA 3ASVA 1DLIA 2EKQA 4MVJH 5KJ1A 1YB5A 4K6CA 5EPOA 3LK7A 1UXGA 3ZW9A 2EKLA 5B4UA 1ZSNA 4DTIA 3JYOA 4CQLB 2B4QA 4MJLA 1TXGA 4ID9A 5AOVA 1XWFA 4I5EA 2NTNA 4JBIA 5CPBA 4DPKA 1NHWA 3QIVA 1E7QA 1SCUA 1U3TA 3E9QA 1Y8RA 4E21A 3IJPA 4FFOA 2Q99A 3INGA 1V3TA 2PZKA 1A9YA 1JKFA 1YDEA 1ULUA 4WLVA 4UEJA 1M6WA 1Q7BA 4HNHA 2B83A 1JWBB 2BGMA 4X54A 5JAQA 1PIWA 3L9WA 2RH8A 5C37A 3BMOA 1GYRA 1NR7A 3GG2A 3JQGB 3OEYA 5L45A 1BG6A 5JCJA 3I83A 5TC4A 3GVHA 4CM3A 4ALKA 1E6EA 1PS9A 3Q11A 1RYDA 2DLDA 4R68A 4WLNA 1VC2A 2OP1A 3KBOA 3OJFA 3GY0A 1K0UA 1BMDA 2X7HA 1EE9A 3JQAB 3HB5X 1BDMA 3ZWYA 2D5CA 1DJQA 3ANMA 3QVOA 2E49A 3JQBC 3QQPA 4U6SA 5EQFA 3P2OA 4E12A 3HN7A 2YJZA 3T4EA 4BNTA 4D0SA 1YONA 1YQGA 5BSHA 3N58A 4KTTE 3GLQA 3PTZA 2AE2A 4ALLA 1B7GO 4QECA 3JQ6A 3MOIA 1B26A 1N5DA 1NFFA 1DXYA 3JQ8B 3DMTA 5CAEA 2EGGA 3H4VA 3M2PA 4XX0A 2HUNA 1P1IA 1YBAA 1E1MA 3DTYA 4AJLA 2O2YA 3GDFA 3WS7A 3EVNA 3LZ6A 2NWQA 1KC3A 3ON5A 4U6QA 5COBA 2HDHA 4H16A 4BMSA 1F0YA 2BHLA 3I5MA 4Z6KA 2HMVA 5ER6A 1IZ0A 4J6FA 5TLSA 2P68A 3AI3A 2HAEA 2Q1WA 4NJMA 3HNPA 3PEFA 4U8GA 3L4BC 3CUKA 1CF2O 3QVWA 3U4HA 4YT4A 3MJVA 8ADHA 4YAGA 4I9HA 3B1KA 5AYVA 3LT2A 2VHWA 4AFNA 2HU2A 3M2TA 4MO2A 1B8PA 3IC5A 4XYBA 1DLJA 2DQ4A 2WD7B 1QKIA 4PVCA 5IDXA 5DN9A 4ONEA 4BGEA 4Y8VA 4PG7A 5I7EA 3UHAA 4OXKA 5I9NA 1LQTA 1FMCA 3AUSA 3DWFA 1OAAA 5BSFA 3ONEA 4BQRA 5KVCA 3E8XA 4YT2A 3H3JA 2X4GA 3TOZA 1OC2A 1ZEMA 4IIVA 2NVUA 1ZSYA 1EK6A 3F5QA 4WLFA 4J9VA 4LVCA 1UXJA 2AXQA 3S2EA 1PGPA 2GYYA 4TZTA 2FSVA 2C59A 2DAPA 1N7GA 3WJ7A 1LDMA 3TSCA 2HMTA 3H9UA 3JCZA 1M67A 3GVXA 2C5AA 3DZFA 1SB9A 1NYTA 3OF2A 1ONNA 1O8CA 4TRNA 1F8GA 4ZRNA 2RH4A 2HK9A 4R5HA 3QA9A 4C7JA 4E3ZA 3C7AA 3WOHA 5T67A 3VPXA 1HE4A 4F6LA 3D4OA 3AY6A 5FI3A 3ADOA 2YV3A 5U4QA 3ZN2A 1KERA 3DEYX 3HB4X 3TJRA 3X2EA 4IJWA 1EMDA 4TRRA 4PN3A 2C07A 2RHCA 2E4AA 1NQOA 2JFGA 4CM9A 1V8BA 2C2XA 3EYWA 3TZQA 1ZVMA 1KVUA 2DUUA 3RQSA 4CUKA 4FDAA 2Y1CA 3RUDA 2W8ZA 2NQTA 3MJTA 4DREA 3O26A 1HDRA 3ZU3A 4BO7A 3VPFA 3D4PA 3H3FA 3W6UA 4J4TA 1MB4A 4RLSA 5ADHA 4NK4A 4UVHA 1U8XX 3PWZA 4RF3A 4BNFA 1WZIA 4RLHA 5LCXA 4WLOA 4E0BA 4L8VA 4CV1A 4L76A 1Y7TA 1ZMTA 3FHLA 2PKRA 3ORFA 1Z7EA 3WYBA 1LLQA 3IJRA 3M1LA 4JJFA 4H15A 1Z82A 4R54A 4GI2A 3VTFA 2W2LA 1ISIA 2VRBA 1PU2A 3K30A 4HFJA 1UZLA 4WLEA 1HE2A 1QSGA 5F1PA 2OHXA 2Q1UA 2QRLA 1LEHA 3CMCO 1VE9A 4FR5A 4I08A 4DYDA 5CDSA 1DIBA 4N5NA 9LDBA 1XHLA 3A9WA 2CF6A 2DC1A 1K6JA 4NH4A 4CMCA 3CZMA 1WZEA 4GMGA 1ZKMA 4Z9XA 2ZK7A 4OOEA 2OBYA 1AGNA 2OGUA 1KVRA 1YB1A 3E03A 3GG9A 3WJAA 3HDYA 4NJOA 3JQ9C 4IINA 4R9RA 5CDYA 4EYEA 3D1LA 5TT1A 1Y8QB 3AI2A 2CVOA 3DAGA 5AXAA 2J5RA 1LDBA 2VWQA 4ZRMA 1U4SA 3K73O 4CR7A 1YJQA 3BMQB 3LF2A 3PLNA 3HDQA 5J23A 2IRWA 3NTOA 1BW9B 4XA8A 4WLUA 5TIIA 3GPDG 4OL9A 5ICMA 2IDZA 1VRWA 1EQUA 1R6DA 3C3XA 1ISMA 1HL3A 2ZYGA 1ADBA 4UEKA 1ZMOA 4XR9A 5F1OA 2HJSA 4UUMA 3PVZA 4J9UE 2FHSA 4PLVA 1ZZEA 1MFZA 3PXXA 1OI7A 4YACA 3PGXA 3UW3A 3TDKA 4BO3A 1O89A 2CMDA 4CM6A 1Y81A 1HKUA 5HWSA 1E6UA 4BKQA 4LSMA 4EUFA 1Y8RB 4OM8A 3CIFA 5DOZA 4PRLA 2ZJ1A 1JN0A 2OUIA 5T6BA 2G5CA 5K9ZA 3IDSA 5DULA 5ITWA 4YJHB 3OFSA 2FR0A 1FDSA 1AXEA 5I7FA 2GZ3A 4OQZA 2IXBA 4B4WA 4FJ1A 1R0LA 2IE0A 4J7CA 4JX8A 1GV0A 3ZDFA 2GRAA 3S55A 4OKIA 2WD8A 3UGKA 1NAIA 4XYLA 3WIEA 2D4AA 5I9LA 4XZ3A 5G0UA 4DPLA 3WTCA 5FWNA 2Y66A 5KTKA 3VPSA 1BVUA 4WEOA 2DTDA 2XXJA 4YT8A 1WVGA 4NU5A 5KKCA 3ZV4A 3L6EA 3AM5A 4UEOA 2Q46A 1XSEA 4BO0A 3G49A 1UP4A 5TQVA 3OBBA 2EP7A 1SNYA 1ZJYA 5JBIA 3HE3A 2ZQYA 5EN4A 4CQMD 1UXIA 1LRKA 2X0NA 3KYBA 3GVIA 1ZK0A 2Y1FA 2VUTA 4HFMA 1ENYA 2GSDA 2YZ7A 4EUHA 1M66A 1JVSA 3AUAA 4IIUA 1PX0A 4JP2A 4R3NA 3LDHA 4GX2A 1ML3A 3V8BA 2ZYDA 1R4NA 1QLHA 4K28A 1E6WA 3NRCA 2JCVA 3GOHA 3P2YA 1VL8A 5LC1A 1H6CA 3BMNB 5JNLA 4YAJA 5TSDA 5BQFA 4OHUA 3JD3A 2V6MA 3AOEC 1DRUA 1GUFA 1VJ1A 1R12A 1JQBA 1KC1A 4PLYA 3WICA 2FRDA 4JP3A 1YE3A 5JY6A 2QG4A 3SJ7A 4BS9A 1T2CA 3L07A 5JYDA 2QX7A 4E5MA 2EJWA 3PPIA 3MOGA 3EAGA 4AJ1A 4LMRA 3FNFA 5JSFA 2PV7A 4IS3A 1E3JA 3C7DB 4TVBA 2YQ5A 5I7SA 5FF9A 3RWBA 3SX2A 1MFPA 1IB6A 3K2BA 3OJ0A 4NDNE 3WWZA 1Z45A 3TNLA 4J49A 1LA2A 3KB6A 2YDYA 2NU9A 2NV6A 3ICPA 4HKTA 5A3VA 5A9RA 3GH3A 2UUPA 3U09A 2BFMA 4GKVA 3FNHA 4FC6A 1PR3A 4QSMA 3PJFA 4XIYA 3EW7A 5H83A 4HNGA 1I3MA 5IXSA 2O3UA 5DP2A 5CDGA 4LW8A 1DIAA 2GN9A 5CG2A 1JAYA 4MKRA 5TJHA 1QR6A 3NTRA 5AQ1A 4Q3BA 3NAQA 4JK3A 3Q1LA 1DAOA 2QW8A 1X0XA 2YQ4A 2ZB7A 4HADA 3V1TC 3OIDA 3ZHZA 2X5OA 3FD8A 4OIMA 4FB5A 3MJSA 4PG6A 1FXSA 3O4RA 4FJ2A 4AG3A 2X23A 3PK0A 1IHYA 2FPPA 2Y67A 3DZIA 3IMFA 4MOWA 2Q50A 1EEHA 2CSUA 4N5LA 1EDOA 1LUAA 4RF2A 4KWIA 4K26A 2YYYA 4YA6A 5B37A 3Q2KA 1GADO 1ZXLA 3COSA 4RVFA 4JJIA 4UUOA 1UDAA 3QWFA 1GQ2A 5U9CA 3CXRA 4YTEA 3WSVA 2PGDA 1EVYA 4YVFA 1EVZA 1J6UA 1D3AA 1WNTA 2X0IA 1B0AA 1O5IA 4E5PA 4D3DA 3EC7A 3UH1A 1W0CA 4CQLA 1QP8A 3V2GA 1B15A 2D0IA 5H81A 3PZRA 2ZKLA 1H93A 5JDIC 4XIJA 4E32A 4PG4A 4MP6A 3WQRA 1XDWA 3LC7O 2DBVO 2WTBA 1ZK2A 2GR9A 2FOIA 1K6XA 2LDXA 2F1KA 1E7YA 1H0KA 4MIOA 1O6ZA 4NHEA 4QXMA 2YV2A 4M86A 4CM8A 1GQYA 4TVOA 5L53A 3HWRA 3ZGYA 2D59A 4G65A 1TT5A 1B16A 3AJRA 3UN1A 4FN4A 1H9AA 1YRLA 3U3XA 4YRBA 4PLTA 1D8AA 5MDHA 3JTMA 2AG8A 1OMOA 3LLSA 4D0RA 2QZ9A 1O9BA 4BGVA 2VHYA 3A4VA 1LSJA 3MWEB 5JLAA 1P33A 3DONA 3JQ7B 4RVUA 4JN6B 5JE8A 5KJFA 3CPSA 5F5LA 3ZNQA 1YGYA 1RKXA 5IZCC 2VOEA 2CUKA 3OQ1A 2C7VA 2DKNA 3BAZA 3DAPA 2JFHA 4KUGA 4U0JA 1ZXBA 5HA5A 4WOJA 1YWGO 4RO0A 4Z0PA 3ZWWA 2EKPA 4MIYA 3QY9A 5C3MA 5EQDA 5A4DA 1EK5A 4XCVA 5C5IA 4C7KA 5BNIA 2G17A 1G0NA 4HBGA 4PLCA 3T7CA 1PGOA 1P0CA 3LQFA 4WNIA 3WGZA 3FPLA 4BNLA 4A27A 2X0RA 1X7GA 3LF1A 2X9VA 4YJGA 5TJ9A 1L7DA 4XWYA 1TI7A 3KLPX 4ILKA 5IG2A 1CQJA 1PGNA 1U5CA 3ANNA 1P31A 1U2DA 2EV9A 3AW9A 5B12A 1ORRA 3LSYA 2HQ1A 3P5SA 4EW6A 1T2DA 2QYSA 5TF4A 4BNUA 4LISA 1GUYA 2B35A 3DXFA 4RPJA 4L9RA 4CV3A 2EW8A 3L0DA 1HRDA 4HP8A 4YJFA 4BB6A 3FTNA 4ZD6A 4BGIA 1CERA 3QW2A 4OAQA 3WGOA 4K9DA 1A71A 1PJQA 1R4MA 2O50A 3B1JA 3GR6A 4KMSA 4N5MA 3S1LA 3CTMA 3TPCA 3ITDA 4BO4A 4XGIA 1U4OA 2YV1A 4EITA 1IOLA 3KOUA 1A7AA 4Y9DA 1GD1O 4I1IA 4FBGA 1ZK1A 4YAEA 1HETA 2Z1MA 4XQGA 2NACA 4CMEC 1DC5A 1PZHA 4ZA2A 1R66A 4OQYA 4XJSA 3D7LA 4FC7A 1UDBA 3TL3A 5L4NA 1Z74A 4OXYA 1E3LA 2W90A 4MVJI 1SC6A 4CMIB 5JDCA 4CLHA 4BGUA 3W1VA 4ZICA 4KDFA 3B70A 4E5KA 3VZPA 3C1TA 5F3RA 3ZWPA 3K2EA 3VVBA 1PJ4A 3PYXA 3TN7A 3C8MA 2PD4A 2WYWA 4I5DA 4RV9A 1PZFA 3W8DA 3JYPA 4IY1A 4XYMA 2D5AA 4URFA 3ZU5A 1JDJA 4W9NC 3IIEA 1GTMA 5I9MA 1E5QA 4IBOA 1FDWA 4IJUA 4QFDA 2X6TA 4JCOA 4WEQA 1NVGA 3GHHA 3HFGA 1YVEI 4GSKA 4II3A 3HDHA 2Q2VA 2AG5A 2PR2A 2RAFA 3BMCB 4CM1A 1U7TA 1SAYA 1PL6A 2AHRA 2Q4BA 2J6IA 1DBVO 3EGOA 3U49A 5JC1A 2Z5LA 4XB2A 5GZ1A 3FWZA 4CLOB 1SZJG 4ZVVA 4DIOA 4Z0HO 5KVVA 3WQQA 4CLRA 3H65A 3WGQA 1BHSA 1M2WA 3QP9A 3CH6A 4FCCA 1LC0A 4BNZA 4R1TA 2VNSA 1EVIA 1T4DA 4RQUA 2V6GA 2W98A 1W4ZA 3BZUA 1MC4A 1PS0A 1K89A 1H2HA 3HDJA 4D43A 2CFCA 3SLGA 2P9EA 1DEHA 4KUHA 3VKVA 1D1TA 4IMPA 4OXNA 3O03A 4Q3CA 1ARZA 3IP3A 4YRDA 5JO0A 4CODB 2GN4A 3I23A 4BVAA 1A5ZA 4J2HA 3PYLA 1HDYA 4N7RA 1WAMA 5A5FA 1T4BA 2AEFA 3QWHA 4GMFA 2VYND 3ITKA 4ROSA 5KIAA 2AQHA 1W6UA 3FCOA 3QVSA 1HDGO 4FIZA 4MVJP 3ETGA 4NMHA 2AQ8A 2J5QA 3RC2A 4A26A 2PD3A 1R0KA 1UXKA 2NNLD 3GF4A 4J1NA 3WMXA 4EJ0A 1V0JA 2JCYA 4LN1A 1TA4A 3AWDA 3BHMA 4OSOA 5IN4A 3KEOA 3HFSA 3HSKA 3KO8A 4JLWA 1R37A 1T2EA 4B7UA 1HDXA 2CVZA 3RIHA 1Z75A 3FNGA 3JD1A 5L3ZA 2O7QA 2NADA 3SLKA 1SO8A 3H9JA 3JQCA 2EIHA 1PSDA 4PLFA 4M89A 2JAHA 4ZN6A 1I24A 3H2SA 3JSAA 3RASA 2UAGA 4IJVA 5L51A 3ZV5A 1ZH8A 3I9JA 4YBZA 2NM0A 1T1RA 3C1OA 3GPIA 3K96A 3VAZA 1K3TA 1MC5A 2AQKA 5THKA 3NUGA 3UKOA 2O4CA 4KWHA 3FF4A 3ZWNA 2FR1A 4CM8B 4MIEA 2AEMA 3ZWXA 1N2SA 3DBVO 4O0LA 4WE3A 4J90A 3SC6A 1HYEA 1L1FA 1YOVA 2YHIA 2OOSA 4IDCA 1I01A 1GV1A 1X15A 2X0JA 5L7YA 2PD6A 2X8LA 4IQGA 2CNBA 1M76A 1JW9B 3D64A 3EHEA 3ETEA 3IQDB 1TT5B 3RCBA 4CL3A 5C7OO 1R4MB 1WLYA 3D3WA 1QYVA 2W4QA 4W9NA 4B3JA 1XGKA 2O3JA 1ULSA 5COQA 1DIHA 1GYPA 3MJEA 1GR0A 2QIOA 4WNCA 1DFGA 2PKQO 5G0WA 2E6UX 1VKOA 5G4LA 4DBVO 1HEUA 3Q2IA 1CYDA 4FOSA 3D5QA 3ZNNA 3KTDA 3TF5A 4YXFA 4LGVA 5A9SA 3ZWOA 2CY0A 3PJEA 4OH1A 2UYYA 3DOJA 4Y98A 4D42A 3IUSA 4OSPA 3FSRA 2GUGA 2UDPA 2I6TA 2EWMA 1E3SA 2VWGA 3JQAA 4LCJA 2QHXA 3WSWA 1CDOA 1LJ8A 4IDEA 1UJMA 3MJCA 1U28A 1IPEA 4RCVA 5GZ6A 3F4BA 3DZKA 3TOXA 3NDJA 2AEJA 2WMDA 3FI9A 3E5RA 2XPCA 3LT1A 4J1QA 4BNWA 4FFLA 1LRJA 3UCFA 3RUEA 3ZV3A 2IZZA 4P8RA 1KVQA 1Z6ZA 2V6FA 2OXIA 3KYCB 1H94A 4GH5A 2NQ8A 1MXHA 4MPDA 4RVSA 5I8WA 3WTBA 1RM3A 3GGPA 3TZKA 1U1IA 1XKQA 3L6OO 1WDMA 1EE2A 3DZHA 4Y6SA 1LDGA 4BO1A 4CMGA 1ENOA 1BSVA 1DAPA 1DRWA 3CE6A 4EBFA 5JY1A 4BOYA 4DRYA 3MCVA 3NEPX 1QLJA 4WGGA 4CM4B 3HG7A 2CVQA 2VHZA 3PHGA 3PIDA 3G79A 3PI7A 3DTTA 4QFCA 4R3WA 3GC6A 3L4SO 3INTA 4O63O 2P9CA 1AXGA 3IP1A 1GDHA 4PLWA 4CR6A 3ZW8A 4FD3A 3AY3A 4ALMA 3IOYA 1HDCA 4PZDA 4IXTA 4JGBA 4HXYA 1ZCJA 3PDUA 1HYGA 3OHSX 4D41A 4A7PA 4DC0A 3W4KA 3C7CB 2H1SA 3DBHA 4BKUA 2XF8A 3BMCA 4B79A 3NX4A 4E5YA 1FDVA 3KSZO 4OGWA 2QQ5A 4IDAA 3KYDB 2BLLA 4UUNA 5CEEA 1C0KA 1QMGA 3IL2A 4CJXA 3WXBA 3I1JA 2HK8A 4RL6A 2HMWA 1EUZA 1C0PA 2Y0DA 2O7SA 3MTGA 4TROA 2VTEA 3JYLA 4B3IA 4LK3A 4HV4A 4D79A 1N9GB 2CDBA 1BRMA 1LXCA 1X7DA 3Q6IA 3BTOA 3UCEA 2B0JA 2YFHA 3RC9A 3AUTA 4BNNA 4DQUA 1ZIDA 2ET6A 1WWKA 3VH3A 3KVOA 3VDRA 1DO8A 1KEWA 1LSOA 1HYHA 2Y0EA 3E9MA 1FF9A 3R0IA 1YOVB 2YHIB 6ADHA 4N18A 3QV1A 1Z7BA 2BGKA 3A14A 3RFTA 2ZB4A 4CM9D 1MP0A 1P1KA 4PG8A 4ZQGA 4UULA 3H8VA 1S6YA 1LRLA 3H9EO 3VZQA 4DQVA 2I9PA 1NFRA 5FEUA 3D3WB 3ADPA 4AVYA 3EMKA 2JHFA 4AJEA 4GVXA 2FWMX 4L73A 2Q49A 4NQZA 4ZGWA 2Q2QA 4FQ8A 2J5KA 3ZV6A 3P19A 4ZHSA 3DOCA 5IXYA 2WM3A 5JFOA 1YXMA 2EHDA 1ONPA 2OMEA 3KSDO 3C24A 2NTVA 1DB3A 4GX0A 4GX1A 1UAGA 5JMWA 4YCAA 5T8KC 3GHYA 1C3VA 3ROQA 3GVCA 2O48X 1M75A 1Q0LA 2TMGA 5HS4A 4PZCA 3STHA 3M6IA 4JXKA 1DC4A 3DHEA 1B2LA 1C0IA 4B4OA 4S3MA 3R1IA 1PL8A 3DOOA 5H82A 3QWIA 3HJAA 1LQUA 1UXHA 2JAPA 3SXPA 4L4XA 3WGHA 4NFSA 4B8ZA 1LDEA 4UVIA 4BO5A 4E33A 4CLDA 2Z95A 1T2AA 3VOSA 3QVXA 1CEQA 4PLGA 4WECA 3GZNB 4HWKA 3KRTA 2E37A 2VUUA 3MWDB 1NPYA 1Y6JA 2JKVA 4DPMA 4BQPA 4D3FA 5DP1A 4J91A 5IDQA 3PZBA 3WX0A 1X13A 4MDHA 4DLBA 2SCUA 4RZIA 3VC7A 4GWKA 1I36A 2DBQA 4KZPA 1KIFA 3W8FA 1QG6A 2ZTLA 4YDRA 5CPFA 2Q3EA 4RORA 1VSUA 1I32A 3RBZA 2BI8A 2P91A 1DHTA 2WYUA 4QO7A 2D2IA 2IYPA 2JCXA 1I3NA 2OBNA 3F1KA 1U3VA 4BV8A 1B14A 1PJCA 1BXGB 2QRKA 4J43A 3C1AA 1IHXA 4II2A 3DFUA 3PGJA 5A03A 4R69A 4RPHA 1NR1A 3OEWA 4MVJA 5IZ4A 3E9NA 3O38A 2BMAA 4IPTA 4GLOA 4RPKA 3WQSB 4BKOA 2O3TA 4DGSA 2R2GA 3GN2A 4IZIA 4CMAA 1AUPA 3CKYA 1WMBA 3TL2A 2DBZA 3NT2A 4A73A 3U5TA 4HX5A 3TZCA 5L40A 1UZMA 2DT5A 3EK2A 4XR4A 1IY8A 4XRGA 1KEUA 1I0ZA 1HTBA 3DL2A 1E92A 1V9LA 3GRKA 5DBIA 4E2XA 2QYTA 4RVDA 5DCYA 4ZQFA 5GMOA 4M55A 1E7SA 3F3SA 1OOEA 2VTDA 3GNQA 4AJKA 1HDOA 3QWAA 5A9SB 3O9ZA 4YB8A 1U3UA 1ZNQO 1TT7A 2XAAA 3TZHA 2OP0A 4JJGA 4QX6A 2Y1GA 3WBBA 3LYLA 1QYDA 4E2WA 7ADHA 1ONOA 1P45A 1PL7A 2GGSA 1ADCA 3TFQA 4K6FA 5K6AA 1B8UA 1OZAA 4TRMA 5JMPA 3OJLA 2OFPA 4H7PA 3H2ZA 4CMBA 1Y9EA 4B4UA 1C1DA 4TMFA 3JQFA 3VKUA 1TB4A 5K6AC 2BF7A 4Y6RA 4R4JA 1NTOA 4DMMA 1K5HA 2X86A 4OKNA 1ZO8A 4OOFA 3NDRA 5CHEA 1VL0A 1HE5A 2HCTA 4B8WA 3RBVA 1NWHA 3K5PA 3GGGA 2B37A 4WASA 1XR3A 2FR8A 1KVTA 2POQX 4R1NA 3BTUA 2IZ1A 4JBHA 3TRIA 4UAGA 2Y93A 4EGFA 4MP8A 4BNMA 1HXHA 4BKRA 2Y1OA 3L4BA 3EZYA 5IAAA 3Q3CA 1RM0A 7MDHA 3E48A 3BTVA 4ITUA 4IXWA 1Q0QA 2YHUA 3WFJA 3RU7A 4L4SA 1J4AA 1CQIA 1I5RA 3UICA 5IDYA 4ZQEA 4W4TA 3ZH2A 4GL4A 2ZTVA 5T64A 4MVJF 4AJHA 5I7VA 4NI5A 3ICCA 4BV9A 2A94A 4JQCA 1YDWA 5LDGA 5MGBA 2FMUA 1KS9A 4AJNA 4A0SA 3OIFA 3ZU4A 4ND5A 1NASA 3H5RA 1Y9AA 2AQIA 3EZLA 3TWOA 2DU8A 1QYXA 3PFWO 4NK5A 2NU6A 1SEVA 3MEQA 1SOWA 4QTZA 5B4VA 3DBLA 1DPGA 4E31A 3K8ZA 3JQFC 3K9QO 4CM5A 4GWGA 4D45A 3DBHB 1P1JA 3AOGA 1E77A 4J4HA 4MKZA 4U5QA 5ENDA 3ZZNA 2HSDA 4DWVA 4TWRA 2HKIA 3NTQA 5A5EA 1X0VA 3WFIA 5JYEA 3JYQA 3VDQA 1D1SA 1ISFA 3UCXA 3VPHA 4A2CA 2GDZA 2ZYAA 4QO8A 1AHIA 3JYNA 1K2WA 3AOEA 4WK6A 4DXHA 3A06A 3H5AA 3SC4A 3OQ6A 3BTSA 4PG5A 3GEGA 4TQGA 5GY7A 3PJDA 1Q2XA 3NT4A 1LSUA 1XG5A 4RPGA 1HDZA 2CF5A 1E1LA 1V35A 1KEVA 5F5NA 3B6ZA 1ZEJA 2DFVA 3GFBA 1AHHA 3OETA 4H3VA 1I33A 1CJCA 2HMUA 1X1EA 1P0FA 1SPXA 2BRUA 4HUJA 3PHLA 1JTVA 1KEPA 1VSVA 4DLAA 1T26A 5TGDA 3NYWA 4TKMA 4MVJM 3L9XA 1UR5A 4PVDA 4DLLA 3VVCA 1HLDA 5DT9A 2G76A 5TS3A 4EEXA 4RVGA 4O59O 3PFFA 2Y1EA 1XA0A 2C82A 3NDIA 5EIOA 2I66A 1YQDA 1PQUA 4M87A 3S2FA 3F5SA 2V65A 2VQ3A 2ZQZA 3SEFA 1DJNA 2V6BA 4CMJA 1LTHR 3RFVA 1H6DA 3GNSA 3W6ZA 4XYGA 1A9ZA 3R3JA 4MKXA 4DBZA 3BMOB 1H2BA 2I67A 5TX7A 4P4LA 3UAGA 2VOJA 4B7XA 1ZK4A 3K92A 5BNTA 1IE3A 4CLOA 1UUFA 2EEZA 1U7HA 5KKAA 5ILGA 3F1LA 2RIRA 3CZRA 2ZCUA 2PGLA 5ICSA 3DAFA 3ONDA 4B3HA 3JQGA 3V2HA 5HM8A 1O94A 1V3VA 4DMLA 1BXKA 2CZCA 2Y1DA 1BDBA 3LC1O 3GQVA 1MG0A 1YH3A 2BI7A 3PWKA 2I3AA 3JQAD 1MA0A 4W99A 1JWAB 4AL4A 4L75A 2Y0CA 3ULKA 1B3RA 2HLPA 3AFNA 2GERA 4Q3AA 3GEDA 2GN6A 5KJCA 2DPGA 3ZI0A 1DOHA 4Z9FA 3OA0A 3C85A 2CDAA 2ZTMA 1C1XB 1YS4A 1WDKA 1L7EA 1LDNA 2ZCVA 3E5MA 5JXWA 4Z9YA 3O8QA 3KETA 4UVGA 4GGOA 3S2IA 4P22A 3V5NA 3BHIA 5G4KA 4IDGA 5C7IO 3RI3A 1E3WB 4WKGA 1ISGA 1BGVA 4F45A 1N8KA 2HK7A 5L4LA 5EESA 1S7CA 1MUUA 2I76A 4RF4A 5DOVA 2JD0A 3I9LA 1VJ0A 3CEAA 2B36A 4R51A 3UXYA 2EF1A 3LU1A 1KBZA 1J49A 4L0QA 2WJPA 1IZ9A 1FK8A 1I3LA 4INAA 4W7HA 2A35A 1U5AA 2XXBA 4NJMB 3NGLA 4JROA 2ZJ0A 2BKAA 3TQHA 1GCOA 2BELA 4BNKA 3KXDA 3ROPA 5KCZA 2X9NA 4FFRA 5IN5A 4TSKA 4I5FA 2B5VA 5TT0A 3X2FA 4PIVA 1ISJA 1XELA 2V7PA 4RPLA 5L95A 1YBVA 2WD7A 1SOVA 1YO6A 2G1UA 1EFKA 2GZ2A 3H6KA 5F1KA 3U62A 3PIIA 4EDFA 2X9GA 1GEGA 3VPGA 2UUOA 1PQWA 3R3SA 4KP7A 2H6EA 3OH8A 1HSZA 5IZCA 2VZ9A 4YJGB 3MJ4A 5DNAA 1BVRA 1UH5A 2GLXA 4NPCA 1B3BA 2DTEA 4XDZA 3ZHYA 3JD4A 1NM5A 4CUJA 2C0CA 1MX3A 3R6DA 3L77A 4IQ0A 3VHRA 3RUIA 2QRJA 4DIFA 2X1HA 1PWXA 3DMTC 4NIMA 1OC4A 2VRCA 3INRA 1C1DB 1X14A 3D3EA 4RGBA 4IDDA 4A03A 4RDIA 5EJ2A 2YW9A 5KOIA 2I99A 2RHRA 2B69A 1F12A 4YQZA 3GZNA 2JL1A 2Q1TA 2Q4EA 1XQ6A 3RKRA 4G5HA 2UVDA 4AJ4A 4GVLA 2Q45A 3N74A 4BO6A 3EDMA 4J7UA 1K6IA 3JQ8A 1JLLA 3VH4A 1RJWA 1NP3A 3LT0A 1E5LA 5JDIA 1D4FA 1JA9A 4BIIA 5TNXA 2B4TO 2VYNA 1GZ6A 2Q1SA 2FY8A 2PTGA 3NT5A 3RU9A 3QSGA 5JO9A 3GZ4A 3I6QA 1XQ1A 4J2OA 3H5NA 2JHGA 4YT5A 2GF2A 2HO5A 4IDBA 4R1SA 4R9SA 1DRVA 1Y8QA 3KHUA 5ILOA 4CMIA 3QVTA 5JS6A 1E3IA 3DBRA 2DTXA 3AFMA 2J3KA 4YEDA 4XGNA 4O5OA 2FZEA 2NVWA 1NX6A 2TMDA 3AI1A 1OBFO 4UVDA 1T24A 3VTZA 4JNKA 5HBRA 3G1UA 1H6BA 1P9LA 3OIGA 3ENKA 4FS3A 4DIBA 3M1AA 4WCDA 3WDSA 3GMDA 4Q39A 4GX5A 2C2YA 2GZ1A 1Q0HA 3ROMA 3VZRA 4MVJG 3F6YA 4W82A 1XIVA 3PHJA 2R6JA 3GVPA 4PZEA 4AICA 4O6VA 3JD2A 4M49A 4KOAA 3I9OA 1ADGA 4ND1A 1R15A 1V6AA 1JU9A 4Z0TA 5AXBA 3ZWAA 2D8AA 1VJTA 4EUEA 2W2KB 1G1AA 3RVDA 3T7EA 1RYEA 3KUXA 4GGPA 4D44A 4EEZA 5FYDA 1RWBA 1BW9A 2NU7A 2JD1A 3CINA 3SJUA 5CFZA 1YQXA 4AJPA 2J3IA 5IDWA 3PJGA 2P5UA 4J0EA 3GA0A 1J5PA 2P4QA 2EJVA 1LX6A 2JD2A 4FW8A 4J0FA 1HLPA 3S8MA 3UF0A 3TZ6A 4EZBA 3G0OA 4EI2A 2NVBA 5F21A 3WYEA 2E48A 4XYEA 5BSGA 3AM3A 2H9IA 3DHNA 4C4OA 3OM9A 4ZQHA 1J0XO 1RM4A 5KVSA 4RDHA 2AE1A 4UUPA 5L7WA 1DC3A 4YRAA 2GCGA 1E3EA 1JKJA 1UP6A 4FJ0A 3RAJA 3VZSA 1GUZA 1N1EA 2NLOA 3OJEA 5COAA 4Q3DA 5EMHA 1JKIA 4CLRB 5G2OA 1EZ4A 4GLLA 1TLTA 1X7HA 2OORA 3TFOA 4WOKA 3GT0A 4LSWA 3WR5A 1YL6A 2FN7A 4ALIA 2VRCD 3KYCA 5A04A 2JFFA 3GRPA 1NQAO 3QJ5A 1Y5MA 1BWSA 1WXDA 2FSSA 3OA2A 3K6JA 3BMQA 2P5YA 3ANLA 1PJBA 4L4RA 4ESOA 3WB9A 4FFMA 5IF3A 4GQAA 4BNGA 2PFGA 3IUPA 1I3KA 4KQXA 2BFOA 5BT9A 3PWSA 1GAEO 1GFSA 3JQ9A 4G2NA 4NFHA 4LRTB 2J3HA 4YAIA 4W7IA 1QV6A 1NXQA 3FBTA 1U8FO 5U1PA 1B8VA 3WNVA 2PZLA 5THQA 4GAEA 1O95A 3GMSA 2F00A 1VLLA 4OMUA 2DFDA 1DFIA 3AM4A 3Q9UA 1NHGA 1HZJA 2DUWA 1P1HA 2WSBA 3RUHA 1QRRA 5JC8A 1JVBA 2ILTA 2WDZA 5DBFA 5G0TA 3Q9NA 1Q1NA 1I2ZA 1DDOA 3GNTA 1GQQA 1P1FA 3WIDA 4YYZA 5HTOA 1SBYA 4YJHA 3DFZA 4D7AA 3QWBA 6LDHA 3KEQA 1PGQA 2GASA 3F9IA 4CV2A 3I6IA 2VZ0A 3BMNA 3MZ0A 3GDGA 4NFYA 5JDCC 3RC1A 3DMYA 3OECA 2WYVA 4CLEA 2GPTA 3GEMA 4NG5A 1GPDG 1YL7A 1WDLA 2VUSA 3KLMX 4CQMA 2EERA 2P9GA 3GGOA 3WYCA 5LDHA 4I9UA 2CDCA 5K0ZA 1XCBA 2VHVA 3DZGA 4ALNA 4IS2A 2FPGA 1I8TA 4QQRA 5CDUA 1PGJA 2YUTA 1NPTO 4NBWA 3ETDA 2VYVD 3RJ5A 2BGLA 2O3RA 5IJZA 3U9LA 4CM7A 4BO2A 4E2ZA 4BNHA 1Z73A 2FP4A 1FDTA 4JIGA 3CMMA 2RBEA 5TRTA 2IYOA 4LVUA 4CV0A 1GPJA 1TVEA 4CPDA 1NFQA 1PJTA 2P4HX 2C5EA 3UFXA 2Q2WA 4DUPA 5FI5A 4RQTA 4BNIA 1TEHA 3PYMA 4FPXA 4NR0A 4DA9A 2E82A 4UREA 5L7TA 3I9NA 1N92A 1R4NB 1DIRA 3A28A 4WPGA 3H9GA 2IXAA 1ENPA 2EW2A 4BNVA 1GZ3A 1CWUA 1DHRA 1SMKA 4XQ9A 1DFHA 3GAFA 2PZMA 3ABIA 3SVTA 4E30A 1PWZA 3PDJA 5A05A 3ZU2A 4DYVA 4JBGA 3GN1A 1C0LA 3RROA 5BR7A 2OZPA 2O23A 2DVMA 3HUDA 5GZ3A 3FBGA 5EINA 1YBMA 1CIVA 1LLDA 3DB2A 4R5MA 1ZSVA 1N7HA 1MLDA 2FPIA 1F8FA 2I65A 1ZFNA 2VYVA 3E18A 4F3YA 1QV7A 1PQPA 4XGKA 1VL6A 5AXDA 4MVJE 4KTVE 4BO9A 3WGGA 5B4TA 1PJ2A 4NBUA 1ENZA 3AUUA 1A4UA 4EJMA 5CDTA 4O1MA 2ZATA 1MXFA 4BB5A 3L6DA 4YAKA 3ZNPA 2B4RO 3ZWMA 4S1VA 1UP7A 2CD9A 5ENVA 4W6ZA 2H63A 1GU7A 3I9KA 4UVEA 1EBFA 1F17A 1HZZA 2P2SA 3NKLA 4IJKA 3LLVA 2PWZA 5JAMA 3RD5A 2OO5A 1LLCA 2R00A 3F47A 3V2UA 1Y1PA 4M1QA 5JW6A 1XEAA 3ZHXA 2X58A 1I2CA 2X22A 3IAHA 3D0OA 4NBTA 4OO3A 3B1FA 3ZHBA 1YJ8A 4ALJA 1HE3A 1VPDA 2YDXA 2Y05A 3RKUA 2C7GA 4N54A 4FGSA 3K31A 3PHIA 2Z1NA 4Q9NA 3FTPA 8LDHA 1A72A 3AY7A 3OJOA 4AJIA 3N7UA 3WGTA 1XLTA 4HY3A 2X5JO 1V3UA 1KYQA 3I4CA 4WJZA 1VM6A 4ZU3A 5DF1A 2HRBA 1BXZA 1ZJZA 4OYRA 4XDYA 1NWCA 2GO1A 4GKBA 3NJ4A 2A92A 2O2SA 1EFLA 1BTOA 1PTJA 1IPFA 4FGWA 3WLFA 4BO8A 1EBUA 1RM5A 4I9NA 4BUCA 2RCYA 4B7CA 1O0SA 2O3QA 3JD0A 4NBVA 3RUAA 4BKPA 1U9JA 3NGXA 2BFAA 2JJYA 2W2KA 1U3WA 2C54A 1QYCA 4DVJA 3EUWA 3W4IA 4A5OA 4FFPA 2XOXA 5CEFA 1QXSA 4Q3EA 1M6HA 5DCUA 2D3TA 3RUCA 2EGHA 4TKLA 5IFLA 2AMFA 3Q0EA 2WWRA 1PZGA 1UZNA 1HT0A 1YL5A 3MTJA 1U2GA 4CQMB 3JQ7A 5L9AA 1ZW1A 4U7WA 4J3FA 2W2LD 5KVQA 1NQTA 4XD2A 5AXCA 1NVTA 3OP4A 2DPHA 1C1XA 2EP5A 4PLPA 1IUKA 3PQFA 2FZWA 2D1YA 3IKVA 2ZB3A 1VI2A 3WWYA 5A02A 4KUEA 2A9FA 4F46A 3KYDA 1N1GA 4TRJA 3AK4A 4NZ9A 1EUCA 5G4KB 3EVTA 3I52A 2VNAA 3JV7A 3DQPA 1E1KA 1P3DA 2ZB8A 3H9QA 3D4NA 4TZKA 1PZEA 4CM4A 3BYZA 1ZUD1 4LMPA 4HFRA 4YPOA 4XEHA 2VWPA 2O4UX 4I5GA 3RC7A 3UOGA 2VT3A 1HWYA 2A4KA 3F4LA 4WCFA 3U4DA 4E5NA 3DBRB 1CETA 1T2FA 2C29D 1A4IA 3NJ8A 4LRSB 3T4XA 4R16A 2G82A 5JAZA 1E7WA 3KV3O 4J4BA 1PR9A 1BXGA 1LC3A 5JPIA 3RSHA 3GFGA 1R16A 1MG5A 4MP3A 3LC2O 1NPDA 3PP8A 4RF5A 3BIOA 5A3JA 2I5PO 1ISHA 2LDBA 2EXXA 3UUWA 1SB8A 2O3SA 4P38A 4PRKA 1MV8A 4Y67A 1DSSG 5T5QA 4BHTA 2GN8A 1SEPA 1NBOA 3EY4A 5KJEA 5T8KA 1WW8A 3GK3A 2IEDA 2BFPA 3ENNA 3JQBA 1KOLA 4WUVA 3WLEA 1N9GA 4QEDA 4XQEA 4I8XA 1CRWG 4ND4A 1NNUA 2WE8A 3OMLA 4DC1A 3E6AA 1W73A 1NAHA 1UDCA 1H9BA 4PFJA 3DO5A 3PQEA 1EUDA 4IUYA 4BMVA 4XJTA 4G81A 1XU9A 3DZJA 3E82A 3UVEA 1WPQA 3WGYA 3RBXA 2PH5A 3OSUA 2PK3A 1FJHA 1WP4A 1YB4A 1C14A 3QHAA 3GDOA 1ZBQA 3OICA 4XRRA 3BXXA 4CMEA 1LNQA 1GEEA 1LU9A 3BA1A 3JQDA 2UV8A 4YJFB 1MGOA 2VHXA 1KETA 2B5WA 4IM7A 1P44A 1Q7GA 2WE7A 5A9TA 1OFGA 1AN9A
chains in the Genus database with same CATH superfamily
1QNFA 1W2GA 4OTZA 3EE6A 2YZKA 3NALA 3U39A 1M72A 2GSWA 1L5SA 2R44A 4MWBA 4LNUA 2VHCA 2P6RA 3D43A 3IVRA 4J16A 1A8QA 1JSLA 1LX7A 1K68A 2P8SA 3ESDA 1A4RA 2FZ4A 4BNJA 2NU8A 1SKAA 4LJYA 4F4UA 5F7OA 1CUJA 1YKFA 3AJEA 5LPNA 3BIWA 2HRZA 5LA6A 2BPOA 4EQZA 1OPXA 3WQBA 4WFQA 3DZBA 4FP9A 3M6WA 3WIOA 1ZIYA 1MAUA 4BBJA 4CR8A 5KYKA 2A88A 1Z4LA 5AM5A 2JDIA 3B9BA 2YJ4A 1KDOA 1NVAA 5EG5A 1O57A 3IVAA 1G8AA 1IB0A 2VATA 1DWPA 2GF9A 2Q27A 2FPXA 2VPIA 3JTEA 1WVIA 5DXAA 1XZGA 3W5DA 2P6UA 3QOYA 4YRQA 4KDRA 3G7SA 5BWOA 5LOVB 3OFKA 2M6KA 5BT8A 4BKMA 3HADA 1I51A 2HIHA 2VN8A 3FRJA 1SZCA 2AC2A 2C58A 4YQYA 5JCXA 3AETB 4FSHA 1T9CA 2EBHX 2ZSKA 1UMBB 2CXRA 3EMVA 1PS8A 3QUQA 4KGXA 5EL0A 4G0PA 4BVGA 3QXHA 4MR9B 2PYZA 4Y1RA 3GUCA 3LRPA 5EIHA 5J63A 4QFBA 3LCCA 4EKDA 3EZXA 1O87A 4JL5A 1GZ4A 1XMPA 4COKA 2VT2A 1EA5A 2J3JA 4ZP1A 1EUYA 5F9FA 2VWHA 3A6HA 4X9XA 4X61A 4CKXA 1T25A 4E6PA 4V38A 5AJYA 3WKDA 2XCOA 3IR5A 5KCMA 5JH7F 4KYIB 5BXYA 3QE3A 2J87A 4O08A 1Z6GA 4JI8B 2BR4A 4H60A 1DTEA 1QOQB 2OXCA 1ZM4A 2FPWA 3DC2A 4L9WA 4R0MA 3JAKA 5AJWA 2VNIA 2ARKA 2VCYA 4G9BA 3UUGA 2PSFA 2GD1O 1E3DA 1LK7A 3KSMA 4G4JA 4IJMA 4NNJA 1UQUA 3V1KA 1AO0A 1HL7A 3JQEA 2G9VA 3DFKA 1O03A 2KX7A 1WHSB 3FSGA 2ZVPX 3N39C 1BD4A 4JI2B 5TVKA 4TT3D 1Y1KE 4ZREA 4IUBS 2G4CA 1Q3TA 3Q9SA 3AU8A 5GQSA 3U2QA 1QH1A 1G18A 3KKQA 4MKGA 4RAQA 4QU8A 4A0FA 3OQJA 4RKEA 1OYOA 3PUHA 1WUYA 1O95D 1Y8AA 3BWBA 3L01A 3PC7A 4IIXA 3U4CA 3FJ1A 3KUUA 1E9VA 1JZSA 1U28C 2F1OA 2VK2A 2CLEB 3PXUA 4BP9A 5M7EA 1FUKA 1NQ5A 1RBQA 4NBRA 2IEGA 1RLUA 1WR8A 5DM4A 2V6IA 1LWOA 3HBMA 2DSNA 3OZCA 4JP1A 4TTRA 5ICFA 3TX2A 1E7RA 1L4FA 4EY3A 4WJLA 2FB9A 1UBOS 4GICA 5FLKA 3W8RA 1KEEB 1LI4A 4OK5A 1R0SA 4NZOA 1KOGA 4RVHA 5IWCA 1KY5A 1DWOA 4QYIA 3RVQA 1ZI8A 4XIGS 4B4VA 5BVGA 2ZBUA 4TXJA 3G8YA 4UHKA 3T5DA 4LQLA 4E4YA 5HSGA 1VHDA 4MS3B 4BCDA 4GBJA 3PVCA 5MF6A 4JA0A 2YJ6A 4AJOA 3S99A 5G0SA 1XKLA 4DXDA 1FP1D 3M3DA 2QX8A 1ZI9A 4C0JA 4KFCA 4FWIB 3HL4A 3QF4A 4BL5A 1KI6B 1TE2A 4D3SA 2Y99A 1UFRA 4NZMA 2WILA 4IDNA 2JBHA 2PZGA 4AO8A 1SC4A 2H7YA 3B20A 3KWMA 3QYJA 1JEQB 4TMXA 1ZICA 5EE3A 5BN4B 4LSZA 4X7MA 5JQWA 4G5SA 1NVMB 3BRSA 1NBAA 5DRYA 4Y2YA 2WFLA 4AZ3B 4AN1A 4B3FX 5DZSA 2O5EA 1KVSA 2XMQA 2V45A 5HIIA 5CG1A 2XB9A 4U2FA 5C5DA 2DOKA 4OBBA 2X3YA 4P80A 4MINA 2IZ0A 3M89A 5FHQA 3DEFA 3TI9A 3WSTA 4CYMA 1XMQB 1F14A 3LT4A 2X2OA 5FAXA 2ZP1A 1OB5A 1JZTA 1MA3A 1UADA 1RYZA 1ZD2P 3FN4A 3FX2A 4KQ1A 3WYEA 1CLUA 4DOMA 3CO5A 1E3QA 3P0JA 1Z2DA 2PGJA 4IHJA 5DCWA 4Y6PA 4EEKA 1TRKA 2IYFA 1Y5RA 3BF7A 1KY4A 2ICAA 3DBLB 4PLHA 2WI8A 2PZJA 3BCSA 4IIYA 3SBOA 1R9MA 3LM8A 5FI1B 5JCPA 5I8ZA 1T6YA 3FCCA 1HDIA 1OLXB 3AY0A 3HPRA 4EX7A 1BWQA 1ADFA 4R7ZA 1ZJ4A 2B4AA 1LBEA 1T91A 2PA3A 2YBDA 3CE9A 3PNLA 3OLWA 4LJKA 1EHIA 2ZPTX 2UYHA 3ZJUA 1QO7A 2BOVA 4GPD1 1IULA 1XL1A 3I3OA 3QH4A 4MQFB 3NH6A 1M34E 3U0BA 3VH2A 4ND2A 3X1XA 1EP1B 1XB2A 4F6CA 1A27A 1QHSA 3RHFA 2I7CA 3COJA 1JLRA 2AW5A 3CISA 3F7TA 3K1ZA 2RJOA 5IVIA 3ROKA 4JBXA 1KK0A 1KOJA 5J4VA 3R7DA 5E9JA 1LLUA 2ZUEA 3D5EA 4MVCA 1ZHHA 2WEKA 1W46A 1W8DA 2G1AA 3ASVA 4TKUB 4MVJH 2NZXA 1D09A 3R3ZA 4LWQA 4HH1A 3LK7A 1EFHA 3O1IC 1UXGA 4PQFA 5U4XA 4EHNA 1P4JA 2RGGA 1CR0A 5B4UA 3SXJA 2C9YA 5CX4A 3SHFA 3L2OB 1BOFA 5AVYA 1Z56C 2B3DA 2B4QA 4MJLA 3WC4A 3IKJA 1TXGA 3I58A 4ID9A 4OBXA 4I5EA 4Q9DA 2B8NA 4TM7A 3WLPA 5BYAA 4OGFA 3MWFA 4JBIA 2P6MA 2ONYA 1XC7A 5CVTA 1BCRB 1SCUA 1D9XA 2Q99A 1XMIA 1MAAA 1EZZA 2HMYB 3V48A 1A9YA 2GHTA 2O8DB 3D81A 2CYAA 4AD8A 3EQ7A 4FZ3A 4KREA 4UEJA 1Q7BA 1NVUQ 2XYQA 1TKCA 4TSFD 2B83A 1JWBB 4U3JB 3AV3A 3WLKX 4B6FA 4ZVMA 2XUJA 3E58A 2M6LA 2H07A 1PIWA 2OEPA 5ARCA 5B1IA 2XSZD 2QN9A 3A6LA 4BYMA 5C37A 4EUSA 1EH5A 5LQCA 1NR7A 3OEYA 4Q18A 2FG6C 4WCVA 4LK2A 4GYJA 1BG6A 3HJNA 5JCJA 3N9IA 3FVQA 1ZN9A 1Q16A 3I83A 3GVHA 2OWDA 4CM3A 1R4ZA 5KDDA 1E6EA 4R68A 1E1QA 1RYDA 4D5EA 4ER5A 4NYIQ 4JLUA 3MJRA 1G6OA 5B5SA 2OP1A 5AKGA 4KE9A 3IKLA 2V55B 5F73A 2QTHA 2OB2A 2ZYWX 3EARA 4B17A 5LYJB 1YTUA 1K0UA 3BGWA 2GLUA 2WAXA 1EE9A 2X7HA 3R7NA 4F3KA 2FEMA 4C9BA 2GZHA 3V1NA 3VKHA 2WUWE 2YC2C 4DC9A 2VDKB 1T9GR 4U63A 4GXQA 3PD0A 3HN7A 4ZVOA 1RSZA 1ULBA 4XWWA 1A3CA 1Z2EA 3REOA 1P61B 1AQLA 5TR9A 2WZDA 5IJ9A 1QONA 1I0IA 1VB5A 4LPKA 4OJQA 3U1TA 3WFZA 3GJRA 1PNRA 1B7GO 2VJAA 4QECA 1YCHA 4D9JA 2BTEA 1WPRA 1ELOA 4GXRA 3JQ8B 3PUYA 3DMTA 1J1IA 1WMSA 1MT3A 1IAQA 4FUQA 4NCHA 4Q7QA 5CAEA 4OLBA 1FSGA 1JQ3A 1XEWY 3FKSA 3ICWA 4O1HA 1QDLB 2I3DA 3K2QA 4XX0A 2AV6A 2HUNA 1P1IA 3EIEA 1YBAA 3DTYA 1N33B 3VPDA 4ZOCA 5JNSA 3E9ZA 1X1AA 2NWQA 3BDIA 5DTIA 3VGJA 1HYBA 4W8HA 2HDHA 5JNVA 1DARA 4Z6KA 3LUJA 2HMVA 3I05A 2PZAA 5TLSA 4PN7A 4AI6A 1T8YA 1OJLA 4HVAA 2E4UA 1L6IA 1FJXA 3FOWA 2ODAA 4U8GA 5JUWA 3RC8A 1CF2O 3O8RA 3QVWA 2WWTA 1K6EA 4BVJA 4C6SA 4YDQA 2R7LA 4I9HA 4PAOA 1P18A 5AYVA 1NI4A 2BW0A 2OHFA 3HL0A 4N9QA 3O4GA 4E1BA 3P4YA 2AN1A 3DP7A 3GLFB 2FQQA 2C0QA 3A70A 3JWPA 3V4SA 2HU2A 1B8PA 3AJDA 1U6JA 1S4MA 4TXHA 3ZDAA 3MMPA 4P0QB 1E89A 3R7WA 1U94A 2QDXA 4RANA 3MRSA 5K3BA 4PVCA 4Z49A 1PK8A 1Y4ZA 3ELBA 4ONEA 2G8NA 1B76A 1G5IA 3KLNA 1HQDA 3EOBI 1CCWA 2FX2A 4RD1A 3ONEA 5LQKA 4YT2A 3KEMA 3ZXYA 1ESNA 3QMWA 2AI2A 3TOZA 4ASUA 1XVIA 2J32A 3L7OA 2NVUA 4IIVA 4LYHA 1EUDB 3BHNA 1KORA 4WLFA 1WO8A 1P7CA 5ERGB 3SNKA 2H2DA 2PIDA 2XA9A 4RFVA 5JNUA 3DMPA 1X7XB 2GBLA 1D4ZA 3MQ4A 4FR2A 4S05A 1Y5IA 2JLVA 1YS9A 1A1SA 1XZNA 2AIRA 2O2HA 3KEFA 3WJ7A 2Q07A 1MBZA 1C3LA 3OF2A 4TRNA 2XZDA 1DWUA 1O8CA 1P0PA 3DC7A 1E0AA 3ADCA 2D5IA 3QZUA 4IXDA 3HM2A 3QA9A 3ZWKA 5HNKA 2DHCA 2HSGA 2VYCA 1W0JD 5E2IA 1YMUA 3CTPA 5IJAA 1RMQA 3COYA 2R85A 3ADOA 5U4QA 3CZPA 4QZVA 4I1OA 3HB4X 2OESA 2WPNA 1BS1A 2C07A 5EWJB 4Y1EA 5AHXA 1FA9A 4I55F 1QQ7A 1V8BA 4NEQA 1ZMXA 4K7JA 4X64B 5HQ3A 2YJ5A 1OXBB 3FYCA 5KYUB 2H2GA 1KVUA 3CZ4A 5DYIA 4I9FA 2MINB 1QIKA 3H5LA 1DUSA 4NAHA 1RAIA 1ECJA 1UT6A 4DREA 5B55A 3DOHA 1ECBA 3R7SA 1BGXT 4FFVA 5F2OA 3RS9A 1ACMA 2OFFA 5KUTA 2JGNA 3C3MA 3ES9A 3H3FA 5BQOA 4M1SA 4ZARA 2V97A 4RLSA 3HI4A 2G9UA 2FPSA 2GCIA 4UVHA 1DDGA 5DNDA 4BNFA 2HF7A 4NYJR 3EPHA 2F90A 1F2TA 1GGJA 1S0UA 1VXRA 4R7TA 4WLOA 3STVA 4M8NE 1B1AA 1GLVA 4MQMA 3IJEB 4B8YA 5ITSA 1Y7TA 1PJAA 3F7OA 3FHLA 1Z7EA 4Q19A 3H2BA 4N0EA 4MWEA 1E6CA 4L7VA 4PZZA 4IDOA 2G9ZA 5IVKA 2FWAA 2PUHA 4R54A 4FT4A 4GI2A 5CTJA 5IJWA 2JDID 3P52A 2QTNA 5LD2C 2VRBA 3U7QB 2OK7A 4HFJA 5I47A 4C0KA 2QBYA 5BW8A 4CEHA 2WHPB 2OV1A 1OPRA 1MRZA 2OPBA 2QRLA 2RGNC 3QNUA 4PYRA 4QAQA 2BIFA 3H1AA 5E9AA 4H7KA 4D2IA 4N5NA 1K4MA 1XHLA 4RKWA 3OOWA 3VHXA 4DXAA 9LDBA 1K6JA 3GGCA 1WZEA 2I4IA 4GMGA 4LRXA 1KO1A 3LKDA 2E1RA 4WSOA 4Z9XA 6ABPA 2OGUA 1FRZA 4DN6A 3BT7A 3GG9A 4JGIA 3BE4A 3L04A 3C0KA 3A1WA 4NJOA 4S24A 3JQ9C 1GZSA 2JRLA 4R9RA 2AWOA 3U44B 4B1FA 2J59A 4DA8A 3GA5A 2ZU6A 3HJBA 4GBED 3RYTC 4BX8A 3D8HA 3MBOA 1LDBA 3WV4A 1QPZA 5ALUA 2BDEA 1Z2NX 2JC3A 2JA1A 4FHGA 1QV9A 2ORWA 3BMQB 3PLNA 4PZ0A 5J23A 2IRWA 3NTOA 3OEEA 3ZVLA 2NU7B 4CNQA 3GT4A 1AUXA 3GPDG 4M0UA 1DP4A 1LTQA 2YVKA 4V3CA 1N0VC 3M82A 1GTZA 4IKOA 4DBLC 1O54A 1V47A 1EQUA 2C97A 1E1CB 4YMHA 1M2EA 1R6DA 1ISMA 1CTQA 1VIAA 3MD9A 3Q40A 3KX2A 4FHDA 1UKEA 5IBPA 5BSRA 1RVDA 4XR9A 4QLBA 1C9YA 1VRVA 4ENQA 4J9UE 4KXMA 1JQEA 4PLVA 3QEAZ 1XALA 1XAHA 3FW1A 2Y1WA 3OY7A 3ROFA 4DG5A 1CLEA 4X41A 1N2EA 3PXXA 4Q9IA 1OI7A 2XHZA 2QRPA 2GD6A 3VU9B 4I81A 3L84A 1RZ3A 1S7GA 4B4DA 3LY9A 3CUTA 1AY0A 1ORDA 2NUPB 5C5CA 3R6TA 5KSWB 4LUCA 3A25A 3LHKA 3BAFA 4OHMA 1EFRD 1JGTA 2FP4B 3JALB 4PRLA 5DOZA 3C97A 4IGKA 1FVFA 4L6AA 3G5MA 1NSFA 3DV2A 3DPSA 4U9IS 4L6IA 3M5WA 2GXUA 3OFSA 3UQZA 2IP4A 2DLNA 3IJ5A 1QBGA 4UM9D 1S8OA 3TAHA 5I7FA 3A4YA 5TVGA 1X1DA 2BR3A 2DQYA 2V4UA 3NVDA 3R4CA 4AMUA 1KQOA 1ONBA 3D8BA 4OMFG 3KTFA 4CCYA 2IE0A 4J7CA 3ZDFA 3A6ZA 4HH0A 5IANA 1H0RA 1VHQA 4OKIA 2ZAIA 4US1R 1NAIA 2BEJA 3WIEA 5I9LA 4K9LA 4XARA 1CZUA 4XZ3A 3ZI4A 3K8QA 4KKXB 2HR1A 5ADWA 1A5SB 3UMMA 4MEBA 1I2AA 1T6XA 3B52X 2J3MA 1WVGA 2B8EA 4NU5A 3K9LA 1XZBA 3S70A 3ZV4A 3MS2A 2RI1A 4OI1A 1IOVA 5BN1A 4EFLA 5JXHA 1S2DA 1G3IA 5IVHA 1NBWB 1SNYA 1H3EA 2G71A 3DFIA 1JIKA 2Q5EA 5FOUA 3TD6A 3WLNA 5HHTA 1TPYA 3KKZA 3AI7A 1UKVY 3HE3A 1EVEA 2W6CX 5EN4A 3SYLA 1K8YB 3E05A 5FEMA 1FFDA 2EFDB 3GJ6A 3ZZUA 5LMZA 4RTMA 2BFNA 4P54A 2UUCB 4B3GA 1IDN1 4FU0A 1VIMA 4EG4A 4N0PA 3S29A 2ZSJA 2P0YA 1AB6A 3Q7TA 2F4VB 5HOQA 2FEAA 4WZBE 2YZ7A 2JLSA 1SVMA 1JVSA 5IEJA 2JK1A 2YWDA 4IIUA 4D80A 2CT8A 2GX6A 2H1OA 2F3SA 5LNK1 3M6LA 1ZAKA 1PZMA 1A9XB 2DR3A 4CHGA 3LBHA 2ZYDA 1E62A 5K1ZA 1LB1B 3HY6A 3DR5A 3GOHA 3KU1A 5LC1A 3GPBA 3NBKA 3PGA1 1NURA 1H6CA 5AVXA 3W0LB 3A4LA 3WBJA 2HLNA 2QVXX 4BFLA 1KOFA 4LFCB 3QPWA 1GQOA 4K2AA 3AOEC 5LZ4A 1Q1GA 4PW0A 2A9KA 2GAJA 1V8OA 3SQXA 1R12A 1WOMA 4JB0A 3WYGA 4DR1B 4F60A 5EPUA 5JY6A 3D2AA 3LOUA 3PNOA 4RL4A 3DLTA 4RNDB 4BS9A 5JZOA 1NMZA 1MHPA 1THZA 4R8VA 1T2CA 4RUKA 3TAXA 1Y4UA 5FPQA 3T7KA 3VDXA 4ZO9A 2GVDC 4X1YB 4RK4A 1X7ZA 3ESXA 3ZZ1A 4R2LA 2Q9CA 4F6RA 4KVZA 5LQMA 4HDQB 5HGXA 1QKKA 1ST2A 4KSCA 2X9QA 4B45A 4Q0MA 1E3JA 4PANA 2F55A 4CEIB 4LRWA 2QEQA 3LY5A 3S2YA 4QGSA 3PFGA 1THMA 2OCLA 2VEDA 4QC2A 4TVBA 1XCLA 2YQ5A 3AEZA 4D4GA 2PKCA 2II6A 1FUEA 3WWZA 2GF0A 1BYUA 1JQDA 3SZUA 3TNLA 4GOOD 4NCAA 3N2NA 3A4MA 3WL3A 5EGSA 3GEIA 4M0FA 4RA9B 5CB8A 1VG0B 4TLEA 3PNQA 1KYXA 3VYUB 2O2EA 1OIVA 2AI3A 3J7AC 5ISMA 4FC6A 1PR3A 3VUFA 4RC9A 1M1YE 1RR6A 1FW8A 4Q05A 3AW8A 4HNGA 5IXSA 4BP3A 2O3UA 4YRMA 2UYQA 5CG2A 2YIDA 4F9EA 4YMGA 1JAYA 5TJHA 2I29A 1K5DA 2BGNA 2ZRFA 3V9AA 2I2XB 1V4VA 2VHUA 2R6FA 3GJ7A 1P91A 2VPYA 3NAQA 4JK3A 2ZBFA 4MYUA 5BQ3A 3Q5EA 3X43A 1DAOA 4F04A 3GBSA 3OTHA 1KI3A 3IV9A 1RBMA 2ZB7A 2LKCA 3IHKA 3OIDA 5LKRA 2Q29A 4Q1DA 4ROTA 4FB5A 3MJSA 3QUTA 3LC0A 1FXSA 4FJ2A 2X23A 3IAAA 4ERXA 5C4IA 1QGED 1YOBA 2A57A 1UWVA 1YAHA 4OP3A 5DEIA 5ALYA 4AZ0B 4C0LA 3N8NA 2VS1A 2LWIA 2M1ZA 1UPXA 2Q50A 1PFKA 4GRAA 4WN9A 3IUNA 4DM3A 4MJXA 2JLAA 3NTLA 4RF2A 3AONB 2C00A 1NP6A 2Y0PA 3KQTA 3Q2KA 5FOTA 4UTVA 1GADO 3COSA 2QQ0A 3ZS8A 4IIFA 5HP4A 4JJIA 4UUOA 4ND8B 3IEXA 3SVLA 1QUEA 3CXRA 1EVYA 3GP3A 3WNCA 5HJ2A 4P7JA 3LQ1A 3UUEA 4AAYA 3A3OA 2EAUA 3OOJA 4L5JA 1Y33E 4Q66C 4C1BA 4WX2B 2C4MA 3LQ4A 4LF4B 1MEEA 2F3TA 1RRFA 2X40A 5FFMA 3HSYA 3GMIA 4KNWA 3V2GA 2YOFA 6REQA 1TLFA 2D0IA 4LTNA 2MSEB 4QGGA 1C7IA 2IWHA 5JDIC 1H93A 3G9TA 4AY3A 2PS3A 3WQRA 4KPUB 3QE0A 4FR0A 5E2AA 4NCIA 2ROQA 3E9CA 3MCTA 3QPDA 1H2FA 1UKZA 3OPYI 5DGCA 2IYAA 1ZK2A 2D1SA 1LPOA 2X6RA 4DJFC 2LDXA 2F1KA 1SVSA 2XI4A 3DOIA 4GUDA 4UW9A 5E1MA 1JEQA 2VP4A 2XUZA 4M86A 4M83A 1NI5A 1NI3A 1U0NA 4KE7A 5I4IA 3LVBA 4W5HA 4G65A 1X80B 3L0YA 5BN5B 2L82A 3UHOA 3MTQA 5J4KA 1B6RA 1JJAA 2BEWB 1WA5A 4FN4A 1CBUA 2WJHA 3HDTA 3DV0B 4O4LB 2EQ5A 1F0KA 2ATVA 1L5GB 4YRBA 3AVVA 3NAGA 3JTMA 3DDUA 4D0RA 3EBLA 2QZ9A 4BGVA 5K0BA 3GLGA 2QR3A 1RXIA 2J1LA 2CB0A 2C8JA 1E1CA 2X76A 4P5DA 5BV8A 4HEJA 1OH8A 2R751 1TQ2A 4AU1A 2RE8A 4RVUA 1DCFA 1HV8A 1NXWA 3IPYA 2YMQA 4JN6B 5JE8A 3WRVA 4KPYA 3VXKA 1YVPA 1XZFA 2HY7A 3I39X 2YC4C 4MB6A 4ZCLA 3O91A 1TVKB 3TEFA 1OW3B 2CUKA 3GEHA 3PQ4A 2BFDA 4KQFA 3GCXA 2FUG1 5DHTA 1EVKA 1SG6A 3NBAA 1GQRA 1ZXBA 4BTEA 3AQ4A 4Z86A 1FVHA 1EGQA 1NSYA 2QK4A 5K3AA 3GX1A 3IP5A 2FSUA 2WWIA 4KN9S 2FWJA 1VA4A 1SUIA 4ZU1X 1M2OB 1NJGA 1XRPA 1L5RA 2CNNA 3B1WA 4MIYA 1EFVA 4DLRA 3H2GA 2ODPA 4C5BA 4XSVA 4XH9B 3ER8A 3ZHTA 3AINA 5AW9A 4BECA 3DT8A 3IUMA 5H4GA 5I5EA 1G0NA 3AGPA 4Q4DA 1Q0ZA 2QVCA 4HBGA 5JSZB 1KFJB 3HGMA 1YFLA 4B47A 5CBPA 2HDWA 3LQFA 1B93A 4TXNA 3KU4A 4ER3A 3NP7A 4N3AA 2IEZA 2PG3A 3PCXA 3L1HA 5LM3A 1ZOIA 4A27A 2HX1A 4BE4A 4OHCA 4N48A 4KQEA 3GELA 3Q9LA 4AKEA 2ZVQX 2FQXA 4TLDA 5J2TA 2L0XA 5F78A 3OAAA 4ZT4A 1Z68A 4B2YA 1GO2A 4A82A 1ODFA 2JLWA 2J4DA 1AG9A 1CQJA 2OKCA 1WCV1 4F4FA 5B3JA 3CEPB 4HSEA 4MEAA 2Q4DA 4RY9A 3V6LA 1KXZA 5DTQA 2ZE8A 1ORRA 3A2NA 2Z2YA 2YXDA 2RARA 4AYWA 2QP9X 1ZC3A 4LISA 2Q0QA 4FSXA 4DLZA 1GUYA 5E4FA 5BV0A 1JQJC 1H2AS 1XX6A 3GU3A 2EW8A 4HP8A 1HRDA 4KN5A 4YJFA 2Z8XA 1WB9A 4IFIA 1M5RA 4GC5A 1N0UA 5IT9A 1RLMA 2AFHA 3NU1A 4FW9A 3ZTTA 1C9DB 1PJQA 1MGPA 3B1JA 3HR8A 4M0DA 1IBLB 1QC5A 1PVVA 3M5CA 4QWWA 3MAGA 4AMZA 2WHYA 5KOJB 4RK6A 1VKZA 1A7AA 1V1MB 2ID9A 1NP7A 3I73A 3FJYA 5AWFC 3OHPA 2FSPA 2O8FB 2R8ZA 3NXSA 1OBOA 5EYPB 3ZJTA 3TVYA 2NACA 4Z7OB 3MIIA 5IVPA 1L7NA 4YDSA 3OE4A 4DLUA 4NZZA 5IKXA 3Q85A 3V4PB 4OH7A 4FC7A 3K15A 3HVKA 3CJTA 3OTGA 3L02A 3D8RA 3ZY4A 1NV9A 2FF7A 4MVJI 5FKJA 5DGHA 3W1VA 2ANCA 2GJ8A 3GUHA 4LBVA 4NLLA 3A3PA 2PO7A 3K2EA 2BFFA 2VDQB 4WKOA 4AUNA 5CFNA 3STXA 3C8MA 2SICE 2MSWA 4RHFA 4QNRA 5FA8A 3W3AD 2ON6A 1TC2A 5B3JC 1PZFA 3W2TA 4JC0A 4QSHA 4XYMA 5CLHA 4F3TA 3I2IA 5K6TA 2VCEA 4C0WA 4W9NC 5I7OA 3R8CA 1W4LA 2BFCB 4IJUA 4IILA 2X6TA 4JCOA 4ZDIA 4TUYA 4TS1A 3PL5A 3IUQA 1VBNA 2PR2A 1ST3A 4UC0A 4RV5A 1RPTA 4CM1A 1JFFA 2CGEA 5AM1A 3DVQX 3K8OE 5DN6D 1YZFA 2ZJ8A 2Q4BA 3DWGA 3ROZA 1PKEA 3EGOA 3GEBA 4NBKA 1F4VA 4XB2A 5D87A 5JC1A 2O0MA 4I1YA 3T1OA 4WZBA 2FVYA 4YMTA 4X6XA 4HNUA 5CH5A 4ZVVA 1W5AA 1ZD8A 2WIBA 3ACBA 3WGQA 1M2WA 3QP9A 1QX4A 5ALNA 3H0EA 4AP6A 3DGEC 1QU3A 3D59A 1EB9A 4Q1VA 2NYRA 3FYTA 1LC0A 2HRRA 1VFNA 2JJ1A 2WU8A 4G09A 4I3FA 4NOKA 5AHWA 4YRRA 1NVEA 2W98A 3ID6C 1W4ZA 3LQRA 3NIGB 1VKJA 3QXCA 1MC4A 1PS0A 4GZ5A 4KFTA 3AESB 1YIAA 5JWRA 3IPAA 4NPHA 4TYQA 4NY1A 2P9EA 3SLGA 4XCQA 1VPEA 4QBKA 4X00A 1CY0A 1B6SA 4TYMA 1Z26A 4WD3A 5HKKD 5EFZA 4R2MA 4C2UA 3O03A 1ARZA 4KBYA 4F3CA 5JO0A 3WK7A 5AVRA 4R7GA 3CA8A 1TMGE 2JGLA 3BE6A 1MJNA 3IULA 3CR3C 4J2HA 1HDYA 4KSYA 5FQNA 1ODJA 4FHEA 2OV3A 4N7RA 2VFAA 1IVNA 5A5FA 1CP2A 1OCEA 2ZG6A 2CBGA 1WVMA 4AUKA 1LZKA 2AEFA 1USWA 3ZDCA 3HA5A 1UJCA 1KIAA 4F4JA 2OGWA 1RRMA 3QVSA 4MVJP 3IUBA 3PR1A 4YUVA 1LBQA 1N5JA 3PGMA 3RC2A 3IT1A 3LVQE 1RFGE 4X1IA 5F7XA 2ATIA 4LF9B 2A9VA 3DBOB 2OQ2A 2BY4A 5D5QA 5F12A 1TA4A 3AWDA 4RSGA 1U3GA 4A36A 5BMVF 5KO2A 1NQWA 3HSKA 4ENRA 4JLWA 4ENVA 2HU8A 2XGJA 1C9EA 3C4JA 5C8ZA 5E3HA 4L72A 4NAVA 1CUFA 1LKZA 1JEEA 3BBPA 3BCRA 5L3ZA 4EHFA 1L8LA 3R76A 3H9JA 4LWPA 3SLKA 4BRZA 3HCNA 3PC2A 5M3BA 1JHRA 2JAHA 2FZKA 3H2SA 3RASA 1F8XA 2UAGA 1MO4A 1L5HA 1F4LA 3O8LA 3ZV5A 3I9JA 3KD2A 1FFXA 4AULA 3ZCTA 1JI3A 1XEWX 2QUHA 3R40A 3G2QA 5THKA 1OV6A 2ERCA 2B1JA 2VJMA 1N2HA 4KZKA 2VNKA 3O90A 2BGUA 2H4ZA 1GSIA 2PRYA 2I1QA 3TTSA 3ZWXA 5A3RA 3FUXA 3C7TA 1N2SA 4ADSG 3CVOA 3EWNA 1H3NA 1BE0A 2FJ0A 2GBFA 1JP7A 1TQDA 2XRYA 3SY8A 1L1FA 2G80A 3VAYA 1YOVA 2DX7A 2YHIA 5L3QA 5KTOA 1OB2A 1I01A 2DKOA 5L7YA 1C29B 1W0KD 1XCPA 1ZM9A 2CNBA 2PD6A 1JW9B 2X8LA 3IT3A 3JVEA 5EWLA 5DO9A 1NVWQ 5DGXA 2HPAA 4JJEA 4CL3A 1PT5A 1DQYA 3KR2A 3PNSA 1FDOA 1PFVA 4B3JA 2IU3A 1YDMA 5HW0A 4L1KA 1PUIA 5A71A 1ULSA 2IY8A 3S7ZA 1UJ6A 1V16A 3U1VA 3C8DA 1JILA 1Z6QA 5CFMA 2AX4A 2J9FB 3KVYA 1J1ZA 1VKOA 3P2KA 4I50B 4MYTA 1SUBA 1AK2A 1E9DA 1U99A 5G4LA 1D4AA 1DCKA 3O9MA 3MQ2A 3Q2IA 4ZI7F 3KTDA 3NS7A 4IGIA 4G5OA 3TF5A 4YXFA 2XMGA 2QDKA 5A9SA 3FPAA 1DMSA 4WXRA 2HDOA 3URMA 2FEOA 3AYXB 4DHEA 4KITB 1SXQA 3MN1A 2AOUB 4D42A 4RU1A 4XVHA 3GLIE 2YIVX 3PDIA 2ACVA 1Z0SA 2EWMA 1E3SA 2VWGA 1U9YA 3H19A 4TKVA 3FUTA 3UPTA 2PU7A 3TW4A 4LCJA 3VC3A 3WLAA 1JFTA 1VJDA 3SE7A 3QVGA 3AERA 2DBYA 4OK3A 1N0WA 2H85A 4IDEA 3MJCA 1JLMA 4GR9A 5KX5A 4FGZA 3F4BA 4OHVA 5KHAA 2PMBA 1NKSA 1E99A 3SSAA 2AEJA 4OQEA 4AF7A 5CDFE 2PUEA 3DHWC 3OY2A 1KIMA 4J1QA 4L8YA 3JVIA 1XO1A 5REQB 2IZZA 1T13A 1KVQA 2V6FA 2R48A 2XTZA 4C1NA 4B3XA 2NQ8A 4Q00A 3IRVA 1UMCB 2ECPA 3T7IA 3SSOA 2NSYA 2Z5FA 5BN4A 1D2EA 4LX8A 1TJ4A 1XKQA 3L6OO 2HFKA 1CJMA 4EM6A 5D6OA 4F4IA 1WDMA 4PQEA 3UOAB 5E4JA 5AKEA 4ED9A 5BOSA 3F74A 1NULA 1WZ2A 3IIMA 2DPYA 1BRTA 5JD3A 3RTCA 1T3LA 3TQFA 1LDGA 3KL4A 3DCJA 1FVOA 1DAPA 1DRWA 3K9HA 2O2IA 4MYSA 4D9FA 2CE2X 4EPRA 1V39A 3CYFA 2AK3A 5JVDF 3C3EA 3MK31 3NI2A 4KACA 4KODA 4QQNA 1L7MA 1LI5A 5FCDA 5EIWA 2P9YA 3PIDA 1RI2A 3PHGA 3G79A 3CGGA 3DTTA 2XKAA 2MJLA 4QFCA 3UTCA 4D8XA 4DY6A 4CT5A 2B98A 4ZYUA 2E3JA 5K51A 4EKYA 1JDNA 1ULTA 1GL7A 3IP1A 4F56A 1KI1A 4J0QA 2XB2A 1M1UA 3AY3A 4FD3A 4UUQA 3IOYA 3LD9A 3BGVA 4HRAA 5JFTA 5B2FA 1K0FA 1XN1A 2CEKA 1TMYA 4PZDA 3RNLA 2RHBA 2G1JA 4JGBA 2VTBB 1P0MA 2Q8PA 4O2RA 2F8LA 3OHSX 4D41A 2QX4A 4A7PA 3A1VA 4G5YA 2VJNA 4BKUA 4D8UA 4JYZA 4FDLA 1P2SA 2BVNA 1FDVA 4BQFA 2QQ5A 2V74B 1FTWA 4W5OA 2EKDA 4HDOB 1TMKA 3F2VA 3FBWA 4M36A 4RMJA 5CEEA 3QEOA 1C0KA 1QPBA 1KU6A 3RIEA 2Z2ZA 2B2XA 2JBWA 4N12A 1DE0A 2HK8A 2C9BA 4RL6A 2XDQB 4X1IB 3ZOKA 2HMWA 1EUZA 2ZFUA 2F43A 3MTGA 4TROA 5H80A 3U3OA 2VTEA 4Q4CA 4W5RA 1YB7A 1DMRA 4LK3A 4P53A 2BCGY 3IEUA 3P0EA 2QMZA 3T5MA 1LXCA 3UJ6A 1A0OA 4B6EA 1M2OA 1TA9A 3P0IA 4QFMA 3F0TA 1A9XA 1C3OB 1AC5A 4BBZA 5AFSA 4BNNA 3BJZA 4DQUA 4A91A 1ZIDA 4AZVA 3LX8A 4UDNA 5FTJA 3VDRA 1DBRA 1KEWA 3QFCA 1LSOA 1VSQA 3F9CA 4PZ9A 1HYHA 1WCWA 4QXPA 5DX1A 3RFCA 5HQ3B 4HWSA 4G1CA 4HXEB 4O4JA 1L9KA 1T9DA 3RVMA 5AHRA 4BP8A 1CP3A 1ZGHA 4LJLA 1CY2A 2ZB4A 1P1KA 3Q72A 1E6LA 2XUPA 4HF7A 1Z0IA 1UIRA 2H92A 1S6YA 1LRLA 3L0ZA 3OM8A 3VZQA 4DCCA 5JZ9A 1VHTA 2YRXA 4ITVA 5TPWA 4D8TA 4C4XA 5BQPA 4CGZA 3G13A 3MINB 1AUQA 2Q5HA 3KAKA 1SULA 1KRXA 3WLLA 2NO6A 1IN1A 2ZSBA 1CQJB 4JLVA 2FWMX 2C3YA 3GIWA 3FPGA 3HB0A 4L73A 4REMA 4ZGWA 1PZXA 3EYAA 3F6CA 4C2BA 4FCTA 4P0PB 1FLNA 3TSOA 4WXYB 4CG0A 4GQBA 3BGDA 4ZXPA 4DV5B 2WM3A 3HA3A 1J2TA 3DYVA 3R9WA 1ONPA 2O57A 4YPVA 1KTIA 3HCAA 5I9SA 2NTVA 2HBYA 5JISA 3ND5A 1NTRA 3V97A 1E79A 3RH0A 3QELA 3ROQA 5JAPA 5LQJA 4EKGA 1BAPA 2WIDA 1M75A 2TMGA 5CNJA 1KZHA 4EQ6B 3M6IA 3OPYA 4JXKA 1DC4A 3RBAA 1Z6YA 3K0FA 4AIRA 3R1IA 1PL8A 1EDBA 1H0HA 2P69A 1BEUB 3HJAA 1LQUA 2HC9A 3FOCA 4ZODA 3GFRA 1GSOA 4NFSA 5D84A 3WGHA 4B8ZA 3KQHA 4CLDA 3PL1A 2Z95A 1RHQA 4LBZA 3QVXA 1CEQA 4PLGA 5M2QA 1EP3B 2Y9PB 4AQYB 1N77A 5CA0A 2PUAA 1Q0PA 1TTTA 4UCQA 1Y6JA 2JKVA 2LRHA 3NZEA 5CGQB 3V3KA 5C1PA 5FWYA 2TECE 1N5LA 4PF1A 3PZBA 4J8PA 3V8EA 4DNXA 3VVLA 3WX0A 4MDHA 4DLBA 2RMKA 4HGNA 2XD4A 3BREA 4HVTA 4ZAXA 4LY0A 1WHTA 4G85A 3FLMA 1E2LA 1JVNA 3K1JA 3ZWDA 1QG6A 1GA4A 4YECA 1VSUA 3X1ZA 2BI8A 3G1WA 2Q7XA 1U2RA 2AYYA 3LXRA 2CLOB 3HBJA 4X3OA 3T7TA 4YREA 1Y5LA 3WE7A 4CFZA 2NZ8A 1YZLA 3PNMA 4JWKA 4BV8A 1B14A 1BXGB 4P92A 3KQSA 1AB5A 1A50B 3L43A 1I0LA 3C5CA 1FFBA 4R69A 4UKDA 2OHIA 3SF8B 2CLMB 3BH0A 2GZMA 4G67A 1KU0A 4HGZA 3E9NA 3WQSB 4MGIR 2FDXA 4GLOA 4RPKA 5HTKA 2XYHA 2O3TA 4DGSA 1O96B 1BCSA 4NBSA 3KD3A 4EAAA 5IHXA 4Y6QA 3VOAA 4NMXB 3UB3A 1ZVKA 1G5FA 1CPYA 3KQMA 1XYVA 4ZCIA 2VKTA 1WMBA 3NBMA 2JARA 1MH9A 2CNKA 2ZIFA 1IK6A 1N6RA 4ZGBA 4HX5A 1SCJA 3HXTA 1EXWA 4X97A 5EKXA 1RXUA 1I94B 1UZMA 3EK2A 4IH4A 1I0ZA 1KYWA 5HJ5A 2W6MA 4X8HA 5BNWA 2XCSB 3KJIA 1U0LA 5DCYA 2M9MA 1EJ0A 1V2GA 3KE9A 3ZOZA 1QE0A 1KQNA 4K9KA 1E7SA 1YZKA 4FFSA 4IIEA 3D7NA 3F3SA 521PA 5L3SA 3GNQA 1Y3AA 3QWAA 3NHMA 5A9SB 5HZHA 3O1HB 4ETIA 5LZ9A 1C7FA 3TZHA 1YI1A 1M2VB 2GTHA 4QX6A 1NZFA 3COWA 3B85A 4MICA 5BYBA 4E2WA 4TWZA 1ONOA 2PX2A 5K2MA 4L8GA 1DKQA 4IO1A 2RH9B 1GA6A 3W9SA 5JASA 5JMPA 1D2MA 2VBCA 4MPRA 1GQSA 1ZCZA 3TPZA 1T8RA 4H7PA 3H2ZA 1J90A 4PX9A 4BGDA 4LI3X 3WRXC 5FLYA 1DKLA 2F48A 1XMJA 2AUMA 1HLFA 3LS2A 5H0IA 3U6KA 2BM9A 3EEOA 1OAKA 2IPMA 1NTOA 2E18A 3EVCA 2X86A 3PGLA 4OOFA 4XLZA 4QDXA 4F71A 3TR6A 3QE2A 4US2R 1NY5A 4ZKEA 4IIDA 3RBVA 3BOSA 4N8EA 2EIXA 3K5PA 2HH9A 4AN4A 2B37A 2XUOA 4FDUA 4YRFA 1AS0A 1XR3A 1FSZA 2C83A 2POQX 1K7XB 3IAS1 3LQ2A 3PV0A 3R8XA 3UA3A 4R1NA 1XRJA 4ZCMA 3Q41A 1KQFA 4RTPA 2Y93A 3UJAA 1INLA 1UBSB 2FXVA 3P0HA 4R1LA 4Z7NB 3EPJA 2JAXA 3LCJA 4BKRA 2IT1A 3MGAA 1QGYA 1HORA 2KB0A 3EZYA 4QAJA 1WV1A 2Q6VA 4ITUA 3BTVA 5EP2A 1G8YA 4IZOA 4JHXA 3GUVA 3HB1A 4LJRA 4L4SA 1J4AA 3GARA 1JQLB 3T7DA 3KOOA 4HGPA 3PCTA 4M1EA 4W4TA 1RJGA 2GPBA 4FK8A 4MVJF 4AJHA 4DB4A 3KDSE 1EB8A 4M9XA 2ZSHA 5IJXA 1GRRA 1K7YA 2ECFA 3HCDA