4YACA

Crystal structure of ligo in complex with nadh from sphingobium sp. strain syk-6
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
295
structure length
270
Chain Sequence
MQDLEGKVAFVTGGGSGVALGQAKVLAEEAQMKVVIADIRQDHLDEAMGYFSQKNVAVHPVRLDLTDRAAYAAAVDEAEQVFGPVDLLCNTAGVSQFGPIEKATFDDWDWQMDVNVNGVINGVMTVMPRMIERGQGGHILITASMSAFVALPTTGIYCTTKYAVRGLAESLRVEMPKYNIGVSLLCPGGEAVFAGLKRVIEHGFDPVDLGRVVLDAVRNDRFWVLPYPEFAEGQKARDQEVIDAMMSYADHPDYARRMKIREQMKRDMPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biochemical Characterization of the Early and Late Enzymes in the Lignin beta-Aryl Ether Cleavage Pathway from Sphingobium sp. SYK-6.
pubmed doi rcsb
source organism Sphingobium sp. syk-6
molecule tags Oxidoreductase
molecule keywords C alpha-dehydrogenase
total genus 100
structure length 270
sequence length 295
ec nomenclature
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4yacA01
1E3LA 4GAEA 2NM0A 2QYSA 2RAFA 1BXZA 3OJLA 4INAA 4YRAA 2RIRA 1LUAA 4IDDA 4MP3A 4MVJD 1QYDA 1PJCA 1NFFA 4HKTA 3IS3A 3OETA 4MVJG 1GDHA 4OOEA 5L7TA 4CPDA 1LDBA 3S55A 2CSUA 3G79A 5THQA 4YQZA 1OZAA 1PWXA 4DQUA 1SAYA 5G4KA 1W0CA 2EP5A 3PEFA 4CUJA 3TOZA 4JQCA 3AOEC 5IF3A 4RLHA 4DPLA 4AJJA 2GZ3A 4RVUA 2GF2A 2PD3A 4A5OA 2Y93A 1MFZA 4QFDA 1Z82A 4HY3A 3VAZA 4FBGA 5L4LA 2OZPA 1EFLA 1U28A 3RUEA 4FB5A 4E5YA 4CM4A 2AW5A 1O95A 3KSDO 3ASVA 3GEGA 3JYQA 3OJEA 4D43A 3GA0A 1FK8A 6LDHA 4OL9A 2VQ3A 3GEDA 3DXFA 4W82A 2Q45A 3Q3CA 2AMFA 1WLYA 1GCUA 1DHTA 5CDSA 1JW9B 2WYUA 3M1LA 3M6IA 4M87A 3BTOA 4WK6A 2RHRA 1BG6A 4CM9A 2B37A 3NT2A 4Z3KA 1E3SA 3INTA 2FZWA 3ROKA 4BNXA 3A06A 1VL6A 3NDJA 4NBRA 3ADOA 3EDMA 2B4QA 1GD1O 2PKRA 1SB8A 1B2LA 2BFMA 1SMKA 3NEPX 4CMIA 2VRCD 3DQPA 2I99A 2ZK7A 3GMSA 5A3VA 4MVJI 3QQPA 2YV1A 3GZNA 3VPSA 3C7CB 4D7AA 1DPGA 1MX3A 3AUUA 3RWBA 1PZHA 4F6LA 3BHIA 2O3UA 1Y5MA 1U3UA 3WBFA 1YL5A 3VH3A 1RM3A 2AQIA 3AJRA 3L07A 3VZRA 3E03A 4F6CA 1GV1A 3EMKA 4NDNE 3CTMA 5DCWA 1H6DA 2PD6A 2OGUA 3PI7A 2O3RA 1LQUA 1XWFA 1LBEA 2R00A 4Z3DA 2HCTA 3NRCA 1MP0A 3HDHA 4FFNA 4KP7A 5BSGA 1UXJA 1QP8A 4EITA 4FOSA 1ADGA 2GPTA 4MIOA 3PXXA 1IHXA 1OAAA 3KHUA 4Q9NA 4XRGA 4ZRMA 1ZFNA 2C20A 4ZQEA 3RU9A 1PJQA 2VT2A 5CDYA 1GCOA 1IULA 3I4FA 4GI2A 1X7HA 3PJFA 2ZQYA 3FTPA 1SBYA 2YV3A 3L77A 3MWEB 4ESOA 2VZ8A 1O94A 2GERA 1DXYA 1YBAA 5A06A 3LF1A 4J7XA 3FR8A 3PJDA 5F1PA 1K6IA 3E9QA 3ETGA 1ENZA 1GZ6A 2HJRA 2PR2A 4E5NA 1X7GA 3KOUA 3GNQA 4RVSA 3RBZA 3LK7A 4E32A 1A4UA 4CR7A 3VKVA 4CODB 4CM1A 4FJ2A 4PG4A 1BDMA 4HUJA 3WJAA 4CUZA 5JAIA 3GC6A 1I5RA 5JBIA 5BT9A 4YB8A 1ZVMA 4OSPA 3AY3A 3ULKA 1GYQA 4O5OA 4DQXA 1MC4A 5JYDA 4UUNA 3U4DA 3F47A 5JO0A 1ZXLA 1HE3A 5I7VA 2UAGA 1CERA 3I1JA 4BO2A 1E1LA 4KDEA 3V1UA 4RZIA 3QLJA 3LU1A 5T6BA 4CM6A 1P1IA 4P22A 2FPGA 1EVZA 3N74A 1LDYA 5KJCA 1PL7A 3QRWA 1PJBA 3ITKA 1NTOA 2VHZA 1HDZA 1T4BA 3PYXA 3GPIA 4JBIA 1H6BA 4ZN6A 1XSEA 5GZ6A 3NJ4A 3NJ8A 2NVWA 2Q1WA 4TRNA 3CEAA 4WE3A 3ZWAA 4AJNA 4JJGA 2OXIA 1HDRA 4EDFA 4BNIA 4CR8A 3H9QA 4IIUA 1YB4A 4U5QA 4XX0A 4E6PA 1QYVA 2G0TA 5KOIA 1P44A 4IZHA 3PQFA 2IE0A 3MZ0A 4NHEA 4MKXA 4FJ1A 4ZQFA 3EW7A 3HDJA 1HT0A 2IZ0A 2BFPA 3B6ZA 4YXFA 1EK6A 5ICMA 4IQGA 4Y9DA 4DLAA 2FPPA 4WEOA 4A7PA 3FHLA 2Q4BA 4R9RA 5EERA 2R6JA 1ZCJA 1HYEA 2X7HA 3OEYA 3MJ4A 3GH3A 1D3AA 3LVFO 2C0CA 2BHLA 4TZKA 5A03A 2VNSA 2RCYA 5DCUA 1VI2A 3I52A 3I9JA 4EBFA 5I9MA 4WOJA 3DBRA 4R51A 1BVUA 4HX5A 4IDAA 4FFOA 4J1QA 1U8XX 4E0BA 1QORA 1ZXBA 3L4BA 3ZDFA 4BNMA 1KVQA 1XQ6A 1B15A 4E5PA 3VDQA 5ES3A 2SCUA 4FFPA 2VN8A 2WYWA 3U4CA 4XEHA 4K6FA 3E1KA 4D0SA 1G0NA 2WSBA 3ZWWA 5EQFA 2I65A 5CEEA 4J49A 5IXYA 4TRRA 1LLQA 2Q4EA 3RC9A 4O0LA 1YL7A 1UP7A 3DC2A 5TF4A 5C7IO 3I23A 1XKQA 2C5EA 1T2CA 3LT0A 1IOLA 1GZ3A 2GN9A 3KUXA 1LSSA 3OEWA 3S2EA 1PWZA 3DBHA 2P9EA 2Z5LA 2A92A 1E6UA 4Y6RA 2C82A 3CZRA 3S1LA 3OM9A 1SEVA 4LW8A 3CMCO 1I3LA 2NUAA 2HO5A 5A9RA 1HXHA 3QWAA 2C7GA 3PHHA 4Z9XA 4L73A 4OAQA 2I3AA 3HWRA 1TA4A 3G49A 1U8FO 4K6CA 1I30A 3DHEA 5A02A 1JU9A 1IZ9A 4W99A 3GK3A 1XGKA 3PJGA 4RCVA 4BL5A 5JDIA 1NQ5A 1P74A 3H4VA 4H3VA 3SEFA 2VYND 2PNFA 4BV8A 4YT5A 9LDTA 2YV2A 2WD8A 5KVQA 1TLTA 1A9ZA 3AFNA 3DZBA 4NPCA 4ALLA 4R16A 4CM4B 4PLCA 4XB1A 1LLCA 1LDGA 2VHVA 3CMMA 3Q2KA 2WTBA 2QYTA 3LC1O 5C5IA 3ZW9A 1PZGA 2EXXA 3MJVA 3E9MA 1F17A 1X0XA 4E12A 1G0OA 5FWNA 4AJHA 3BMNA 4OQZA 3IL2A 3F6YA 8LDHA 4J1NA 2VT3A 1PTJA 3LDHA 2X0IA 4BO4A 3VH1A 3K73O 4NNJA 2YY7A 5G2OA 1VSVA 3GVXA 3FR7A 4RPKA 2EKLA 1B8PA 2CDAA 2RH8A 3OQBA 4YDRA 1PEDA 2BI8A 1YB1A 1JKFA 2FPIA 2W2KA 3ZWYA 4ALNA 1UAGA 5K6AC 1PGJA 4BMSA 1VL8A 3H65A 3B1FA 1SO8A 1C1XB 3HN7A 5BNIA 4OXNA 2XXBA 3CIFA 2A35A 5L9AA 1EDZA 4XYBA 2ILTA 4RVDA 4IXTA 1MG0A 1NP3A 2BFOA 3TZCA 2G1UA 5L7WA 1ISHA 3KO8A 4E2XA 4IS3A 3GMDA 2DFDA 2B36A 4Q3EA 2GO1A 4IJKA 2AQHA 5CDGA 2O7QA 4BKQA 1SNYA 3H9GA 1YB5A 5CG1A 3EZYA 1HYHA 4PLTA 3AM5A 3B70A 5T8KC 2E4AA 1U3WA 3WYEA 2P5UA 5THKA 1ZK0A 2I3GA 3KZVA 4K26A 1E7QA 2JJYA 4PG8A 2JAHA 2ZIZA 2D5CA 3TQHA 3H3JA 3FNHA 1UZNA 1JWBB 2ZCVA 1ID1A 3JQFA 3EK2A 4HWKA 3O38A 1DLJA 2C2YA 1K0UA 4ND1A 1LRJA 4B7CA 4BO7A 3ZWVA 4E33A 5IG2A 1I3MA 1DOHA 3JQBC 4Z9FA 3VH4A 2Y1DA 3IP3A 4YAGA 2YUTA 3DBVO 2HMWA 4EUHA 1Y81A 2PKQP 5L7YA 4P4LA 2PLAA 3GG2A 8ADHA 2Y0DA 1RJWA 5L51A 3C8MA 2HDHA 3QVWA 4ITUA 2E6UX 4R1UA 1ZJYA 3PFFA 3O03A 4I9UA 1EE9A 5CG2A 4XYMA 3ROPA 3T7EA 4BUCA 1EUCA 2HAEA 1NVTA 4BNUA 3JD3A 4PG7A 4D79A 1DAPA 3DBRB 1NQAO 2PGDA 3KLMX 4CQLA 3PZRA 2CD9A 3GEMA 3IJRA 4XR4A 5EINA 1KOLA 2FSSA 4EJ0A 2PA3A 3UHAA 1KS9A 4TMFA 3QP9A 3B20A 1NXQA 3C3XA 4B8ZA 1MG5A 1OC2A 5ER9A 1B3BA 2X86A 3OMLA 1E7YA 2H1SA 3O8QB 3KYDA 1RWBA 4LVCA 1DIHA 5IAAA 4RGBA 3L0DA 1HE5A 3AY7A 3WIDA 1JN0A 1GL3A 3VOSA 4RPLA 5IN5A 1JTVA 5HWSA 5B4TA 4C4OA 3IJPA 2NQ8A 3AU8A 3L9WA 3IIEA 3U3XA 2YDXA 3EY4A 4M54A 3EHEA 1R4NB 3P2OA 3WYBA 1KEPA 2DBZA 1QV6A 4QO7A 1IE3A 3ZV6A 1C1XA 1V3UA 4RQTA 3ZU2A 1BXKA 1PQUA 3RAJA 2FY8A 4IPTA 3ZU5A 4Z0PA 1IHYA 3WICA 4F3YA 4O6VA 3P5SA 4YJDA 4WLFA 3WBBA 4WPGA 1MLDA 3L6EA 2C54A 3K92A 5FEUA 4IDBA 2CFCA 1EQ2A 3DHYA 1H9AA 3ZWCA 2CVZA 5DBFA 4CLRB 3D1LA 3O9ZA 1XEAA 3NKLA 3K30A 2BELA 5FF9A 1B8UA 2Q3EA 4RO0A 1E1NA 3H2ZA 1EUZA 3SX2A 1HDOA 3PTZA 1H94A 1A71A 3RIHA 3C7AA 2AQ8A 2D3TA 4AJPA 2O4UX 4ONEA 4YA6A 4FS3A 2C29D 4BQRA 4YWJA 1TT5A 2Q49A 4OKNA 1N7GA 2IYOA 2OMEA 4J3FA 3U62A 2BKAA 1JAXA 1AN9A 3AK4A 3OA0A 4PLYA 1E3IA 2YDYA 3RFXA 4CJXA 3VTFA 1AUPA 2H63A 4E2WA 3PDUA 4RDIA 2BLLA 5DULA 2WJPA 4BO8A 5IFLA 4PVCA 4CV2A 2ZKLA 4J90A 2TMDA 3UAGA 3C85A 3I6QA 3M1AA 2DLDA 1UDAA 3TPCA 5I7SA 2X9NA 1F8FA 1KY5A 5CAEA 1E77A 5CPFA 4I5FA 4GVXA 4PRLA 1MB4A 1LSJA 2NU8A 2QRLA 2FZEA 4S1VA 4DPMA 3SLGA 1WDLA 5KIAA 1KETA 1P1FA 2HMTA 4BKUA 5JMPA 1CJCA 3P19A 2JFGA 3DMTA 3VDRA 4BO9A 4DL9A 1UR5A 2GN4A 1Z75A 5GMOA 3I4CA 1R0KA 5DBGA 4HNGA 4LCJA 4XGKA 4ALMA 3KEOA 3DBHB 1TB4A 3MCVA 4YJGA 5HTOA 2BGMA 1VE9A 1E3EA 1RM4A 3AM4A 5CFZA 5CHEA 1XQ1A 1YE3A 4DGSA 4IUYA 1UZMA 2GN8A 2UV8A 1GADO 1KY4A 3P7MA 4PLWA 4XGNA 4W9NA 1UXIA 1X15A 3JQFC 3GRPA 4GGOA 3ZHYA 4WLEA 2DVMA 4E31A 1PQWA 2I76A 4MVJH 2YZ7A 4WLOA 5L53A 1U5AA 4YTEA 4FOOA 4AJ1A 1N9GA 3HB5X 5T57A 1E0DA 2BFAA 3HG7A 4XIJA 3RUDA 2O2SA 4GH5A 1D8AA 4BNVA 3RASA 4E2YA 1K6XA 5F5LA 5AXAA 1ZK2A 2XOXA 4J2HA 3JQ8B 2QW8A 2H9IA 5IJZA 5DZSA 1PX0A 4JBHA 4RZHA 1UAYA 2F00A 5DDIP 4DUPA 3ZN2A 4JJIA 4RF4A 5H81A 3HSKA 1WZIA 3IMFA 1OBFO 4L4XA 1ZK1A 1RKXA 1GV0A 5JXWA 1NX6A 4JLWA 4GX5A 1PJSA 3OP4A 4EZBA 5CEJA 2C59A 2DFVA 2J5RA 3GVPA 4D3FA 3BAZA 4CUKA 5TNXA 1DFHA 4IMRA 1N8KA 2EJVA 3L9XA 4GBJA 3ZI0A 3BYZA 2X0RA 3R3SA 3GUCA 3KVOA 2VHXA 1DHRA 5I8ZA 3EZLA 3ZWXA 1OC4A 2WYVA 1HSZA 3DAFA 1XCBA 1WMAA 1AHIA 5G4KB 3E8XA 4GPD1 1UXKA 7MDHA 2NLOA 3ZW8A 1R0LA 1Z7BA 2IODA 4WECA 2JFFA 4DC1A 1P1RA 5JW6A 1N1EA 4R5HA 5L3ZA 2FSVA 4BIIA 3FN4A 5KKAA 2B4RO 5BNTA 1F0YA 1I32A 4MDHA 4B3IA 1A4IA 1ZSYA 2HJSA 3D4OA 5ITWA 3JQ7B 1ARZA 2QIOA 1PJ4A 1W73A 1N5DA 1UZLA 1HDCA 4J1TA 4OMUA 2VOJA 1DAOA 4I9HA 3JYNA 1P1HA 5L4SA 5L40A 3OHSX 1ZSVA 4B79A 5L95A 4E2ZA 5HRUA 3DZKA 4WLUA 4ALKA 4BNWA 2IYPA 1GQ2A 3QVXA 4W4TA 1YO6A 1LX6A 4D0RA 3I9NA 5LC1A 2O4CA 5MDHA 3GT0A 1P0FA 1A7KA 1LNQA 3WGTA 2AEFA 1Q0QA 2PZMA 1YH3A 2GUGA 5ENVA 5EN4A 3BHJA 4OSOA 2AG5A 1X13A 2YHIB 4XIYA 4F46A 1HDXA 1OMOA 4OKIA 5GY7A 5LDGA 1E5LA 3BZUA 4FIZA 4FPXA 1NWCA 1D7OA 1Y8RB 3JSAA 4M86A 2PFGA 2FMUA 4QXMA 1C0PA 3CSDA 1AXGA 4A0SA 3DTTA 2J3JA 3GPDG 4NU6A 4BHTA 1WMBA 4BNGA 4GX1A 3DAGA 4WLVA 2RHCA 2EJWA 4MINA 5I7FA 5DBIA 5IDWA 5BSFA 4BO3A 1BDBA 4I9NA 3GN2A 1YKFA 3W6ZA 1EE2A 4BNKA 2W4QA 4ZQHA 5CDTA 3Q11A 4MVJF 3LYLA 5COQA 1QYXA 1KBZA 3O26A 4IBOA 3C7DB 2AXQA 2ZTVA 3RVDA 3GAFA 3QA9A 3BMCA 4PLFA 2F1KA 2A4KA 4UULA 2P4HX 3BA1A 2V65A 1V35A 4RF3A 5DT9A 4RF2A 1ORRA 1XR3A 3HUDA 3K9QO 1PJLA 1T2FA 1VL0A 3K8ZA 3ZV5A 3I9OA 4CMJA 2G82A 5A05A 3ZNQA 1YBMA 3HNPA 5EPOA 3N58A 3IOYA 3GFBA 3W8FA 1YONA 3MWDB 4J7UA 2O2YA 3WSVA 1GR0A 4BKPA 4YJFA 2JHGA 3JD1A 4IDFA 3UH1A 4CLXA 3H6KA 4YRDA 5K0ZA 5F21A 1H93A 1CRWG 3TL2A 4CQMA 1LI4A 2GD1O 4ND2A 3H5NA 1XDWA 1PS8A 4JCOA 1EBFA 2VWPA 3PYMA 3WOHA 3PLRA 3DZHA 3LZ6A 3F46A 2PK3A 1ENOA 4YQYA 3MOIA 3UGKA 1I10A 4PLHA 4A73A 2GZ1A 3JD2A 4NK4A 3RJ5A 3ONDA 1S7CA 3BXXA 1JLLA 1O5IA 1NVGA 3ENKA 4GMFA 4P38A 4N7RA 1MXFA 4DWVA 4C7KA 2DTDA 4II3A 1PIWA 5C7LO 4R9SA 3DR3A 3VH2A 4TRJA 2X5OA 4KWHA 5JAQA 4JJFA 3I83A 3JQ7A 3DFZA 4NJMA 3IQDB 2VOEA 4A26A 3R1IA 3WFJA 1A9YA 4A2CA 3FRJA 4EEXA 4Q3NA 3T4XA 4XYGA 1PR3A 1E6WA 4I5DA 3RUCA 4FFMA 4Y8VA 4AFNA 4FGSA 3LLSA 2EWMA 5TRTA 4FGWA 2V7PA 1T1SA 5F3RA 3WX0A 3W4KA 2GNAA 3ZGYA 4DC0A 2PGJA 1MC5A 1PU2A 3H8VA 3WMWA 2ZCUA 5TX7A 3A9WA 2AQKA 1BW9B 3VPFA 2I67A 3PVZA 2OBYA 3KB6A 1YXMA 3ONEA 2Y1GA 4BVAA 4ZJUA 4PVDA 5DNAA 3LQFA 4BB5A 4IMPA 3TZQA 1QLJA 3NTOA 4GSKA 4XJTA 2X58A 4YT2A 3FI9A 3GVCA 5T8KA 4ZA2A 3GQVA 2W90A 4XCVA 1NWHA 3VHRA 3BTUA 1M75A 5U1PA 4JX8A 4R1TA 1WNTA 2QHXA 1NPYA 1YJ8A 1YL6A 1T26A 5KJEA 1P33A 1B7GO 2OO5A 3FWZA 4HFNA 4URFA 2D4AA 3CPSA 4B4UA 4CMCA 5HBRA 5BSHA 1GEEA 2XAAA 1MFPA 3SXPA 3IC5A 4AJKA 1PGOA 2IEDA 2I5PO 1BXGB 1GYPA 4IY1A 4RVHA 1GUYA 2EGHA 3F5SA 3QIVA 2AE2A 1I2BA 2J3HA 2YYYA 3DBLB 3NGLA 4CQLB 1F12A 4CMKA 5HS4A 1U4SA 4H7PA 4R41A 5KTKA 1H5QA 4S3MA 5KVCA 5KJ6A 5IDQA 4TVBA 1J4AA 1WDMA 1YQXA 2B5WA 2D59A 2DBQA 3C1OA 3GVHA 3R0IA 4CMIB 3GHYA 3RCBA 4ZQBA 1YQDA 3U9LA 4W6ZA 1ISGA 1NM5A 3TNLA 4XD2A 4QTZA 4D3DA 5KVSA 4BO6A 4U6SA 3VPHA 4KZPA 1JVBA 2B69A 3R6DA 4DVJA 1J49A 3E5MA 3Q2IA 4EYEA 4YR9A 3SC4A 4E30A 3PHIA 2UDPA 4I5EA 2FOIA 1IYZA 1E7WA 3GZNB 1U7TA 4EW6A 2O23A 3WS7A 1Y9EA 2Q2WA 2VTDA 1KEWA 1I33A 1JKJA 4YJGB 5KKCA 1HWYA 1V0JA 3QVSA 3STHA 2HSDA 1QV7A 2FWMX 1D4FA 3TRIA 1LEHA 4UEOA 1GUFA 1ZIDA 4II2A 3E5RA 5U4QA 4WOKA 2W8ZA 3QW2A 1CDOA 1DBVO 3K2EA 3KXDA 3PP8A 1ZK3A 3WJ7A 3I5MA 5G0SA 4BO5A 4LMRA 3WGOA 3V8BA 2NTVA 4B3HA 3WMXA 4UUPA 2YQ4A 3ZU4A 4CL8A 4CMHA 5IXSA 3SC6A 3RD5A 1BTOA 5JDCA 5DOVA 1O0SA 1DB3A 2HMUA 3IDSA 1T24A 4R3WA 3D64A 1DC5A 2JL1A 3H3FA 1VJ0A 4GMGA 4N5MA 2W2KB 2UUPA 3GDFA 3NAQA 4RVGA 1H6CA 4BO1A 1RM0A 5JY1A 2D8AA 2VTEA 3CUKA 3TFOA 2YJZA 1HRDA 1LSOA 1A7AA 2Y0EA 4HXYA 3BMNB 5F1OA 1HYGA 1NHGA 3DEYX 4NR0A 3K2BA 5CDUA 1BW9A 4CV3A 4HP8A 4NI5A 3X2FA 3G3EA 1DDOA 1P1KA 4R4JA 4TKLA 4ZD6A 4DQVA 4CLRA 4ZICA 1EEHA 2GYYA 3ICCA 3X2EA 2EHDA 2ZB8A 4K28A 3KSUA 3RC7A 4MIYA 3W4IA 2DPGA 3PQEA 1ADBA 5GZ1A 2O3QA 2O50A 3NT5A 3W6UA 4YT8A 1M6HA 2OP1A 4D46A 5BSEA 3PQDA 5BNFA 2GDZA 4DBZA 4P8RA 2G76A 2VHWA 4XZ3A 4CQMB 5FYDA 3KEQA 1IL0A 1A5ZA 3ZWMA 3NGXA 3F1LA 1KC3A 3RKUA 1AE1A 1NNUA 3CXRA 3RUAA 4NBUA 4XQEA 1WWKA 3ZNNA 3QY9A 5LDHA 1J6UA 3CKYA 1FDUA 3MJEA 3TDKA 3VVBA 5L45A 1KVSA 1J5PA 2NVUA 2EP7A 1T25A 4J2OA 4NFYA 3V2GA 2VWQA 2XPCA 4Y67A 1E7RA 2QZZA 3TOXA 1NAIA 1GEGA 4DTIA 3KV3O 2G17A 1Z6ZA 1H2BA 1HTBA 3PWSA 2Z95A 4C7JA 3V2UA 2HK9A 3UXYA 4E21A 5JAMA 1R66A 5JAZA 3D3WA 3G17A 3GHHA 3JQEA 4RVFA 3DONA 3RC2A 5JDIC 3KM0A 5ER6A 1X1EA 4JXKA 3GN1A 5KJFA 4R5MA 1ISMA 4R69A 1YQGA 4PIVA 4J9VA 1UP6A 4MVJA 1N1GA 1I01A 1XIVA 1PL6A 2ZATA 4J6FA 1XU9A 4Q3DA 4BO0A 4J16A 4D42A 1TEHA 4W7IA 3ZHXA 3HADA 5K9ZA 5BR7A 1NFRA 1Y7TA 3FCOA 1QYCA 4M8SA 4DRYA 2EF1A 5H83A 1PZEA 1ULUA 2JCVA 2PKQO 4O63O 1PQPA 3G0OA 3OF2A 2NU7A 1IY8A 4KOAA 4BGUA 3V1TC 3NYWA 4CM8B 1KIFA 4BS9A 4MJLA 3AOGA 4JP2A 2HLPA 3WIEA 1YJQA 1B3RA 3GLQA 3WB9A 4TRMA 5KCZA 3DMYA 1CQJA 2ZB4A 1LDNA 3O4RA 3INRA 2DU8A 3ZHBA 5I7EA 2DBRA 2DUUA 1GTMA 5DP2A 3MJCA 4FJ0A 1JDJA 2O3SA 4Q3BA 1PGPA 2LDBA 2I6TA 5JLAA 1ZW1A 2A9FA 4XYEA 3UN1A 2Y1FA 2GCGA 2JHFA 4UVHA 1VM6A 2BD0A 5EESA 3FNEA 2TMGA 4EEZA 3D4PA 3L6DA 4WCFA 4OO3A 1P45A 1JVSA 1NAHA 1LQTA 4DREA 2E49A 3DWFA 3TFQA 3Q9NA 3M2PA 4AJEA 1CQIA 1DRWA 1YVEI 3G1UA 1VJTA 2P9GA 3I9KA 1L7DA 4AJ2A 5EJ2A 1ZUD1 4KUHA 1BSVA 1YRLA 5TIIA 1VKNA 2JCYA 2UVDA 3NUGA 3KBOA 3BMQB 2VNAA 3F4LA 2NWQA 4ILKA 1SZJG 2C5AA 4B7XA 1QLHA 2JFHA 2OL4A 3DB2A 3JYOA 3RUHA 4R1SA 1F8GA 3FNFA 4WJZA 3WTCA 5B37A 2IXBA 4OM8A 2PZKA 3LT2A 4Y98A 5DF1A 3GGOA 1F06A 2JCXA 1DFGA 4XWYA 3TN7A 5TQVA 1R0SA 2DT5A 3FSRA 4MIEA 3WQRA 2HMSA 1LRLA 1NASA 5A9SB 1G1AA 1B8VA 2BRUA 4P4NA 1O9BA 1R4NA 3ASUA 4IJUA 4BNYA 3GDGA 5G0VA 3ZZNA 2B83A 4AJLA 3ZU3A 2X6TA 2W98A 5DCYA 1IB6A 4GWKA 5JFOA 3ETDA 4YJHB 2IDZA 4GQAA 3GOHA 5ICSA 4L75A 2IZ1A 5IDYA 1I2CA 4B4WA 3EVNA 2DKNA 3BMOB 1HE2A 4R68A 5F5NA 3JQ9A 3ONFA 1EK5A 1GZ4A 3GFGA 4GVLA 1LDMA 5T67A 1EVIA 4MO2A 3DAPA 1U2DA 1R4MB 1P0CA 3VZQA 3JYPA 5IN4A 1E7MA 1IPFA 3TF5A 3ADPA 2PY6A 1OFGA 1R4MA 1JKIA 2IZZA 1N9GB 5AXDA 3I3OA 1VRWA 4R3NA 4UREA 5G0WA 4WEQA 1NR7A 1AGNA 1MGOA 3QVTA 5G4LA 3ST7A 3DZGA 3EGOA 4DYVA 1N7HA 1U2GA 3JYLA 2JKVA 2V6BA 3ZWBA 2HRZA 2ZQZA 4NJOA 4UEJA 3VZPA 3CINA 4MOWA 3JQ6A 2CVQA 3H9EO 3HE3A 1IUKA 3OICA 3FBGA 2ZYDA 4GLOA 5B12A 1YWGO 4J43A 3OIDA 3AI3A 3OJFA 3BMOA 4IDGA 4RL6A 4F45A 1HDYA 3DDNA 4A03A 1ZKMA 1P31A 1TXGA 3ORFA 4DMLA 1DJNA 3WYCA 4LRTB 1XU7A 5HA5A 4DLBA 2ZYGA 1M2WA 1YBVA 4GX2A 1TT5B 5JPIA 3DTYA 2Y66A 3TZHA 3UW3A 3IUPA 5A9TA 3JQAA 3WSWA 3FPCA 3ZWNA 1Y1PA 3V5NA 1XLTA 1Y8QA 1HZZA 3HJAA 3WQSB 3HN2A 5IZCC 1AHHA 3SJUA 1R16A 5TJ9A 1E3WA 3PRJA 3JQGB 4XDZA 3W1VA 5IZ4A 1DEHA 1SC6A 1QG6A 2EG9A 3WXBA 1C3VA 3C1AA 1HEUA 1I24A 3RKRA 1VJ1A 2XXJA 2J3IA 4IQ8A 4JROA 4ND4A 1YDEA 3PK0A 4L74A 1UXGA 4N5LA 3NX4A 5HM8A 1CEQA 4B4OA 1UXHA 2BH9A 4CLOA 2E82A 3W8EA 4MP8A 2YFQA 1G6KA 4UVEA 3TZKA 2B0JA 3ZV4A 2GGSA 1U9JA 4M49A 4XDYA 1Z74A 4HFMA 4LVUA 4IDCA 2LDXA 3LC7O 4BGIA 1C0LA 3S8MA 4JN6B 4GKBA 3AY6A 2AHRA 4GWGA 3UF0A 3GZ4A 5TT0A 1GPJA 3WGGA 4E4YA 5AXCA 2EERA 3PLNA 1QKIA 4U6QA 4BNTA 3DMTC 3H7AA 2H5LA 4R1NA 1U3TA 2O3JA 5A4DA 4CMEA 4HFJA 3O8QA 3QWBA 4GGPA 4AVYA 4W7HA 2Q1SA 4RQUA 1DJQA 1Z73A 3FBTA 3AW9A 4R54A 9LDBA 1JQBA 3GGGA 3MJTA 4OH1A 3KYCA 4YRBA 2Y99A 4QFCA 2FP4A 1ONNA 3B1KA 3JQ8A 3BTVA 5JSFA 2FR1A 4OIMA 2PD4A 2BI7A 1C1DA 4QO8A 1W8DA 5T5QA 3T4EA 4ND5A 5KVVA 3OJOA 5C37A 5KNLA 1D1SA 4OXYA 2FN7A 1HLDA 2JD1A 1GQQA 3VC7A 1ZEJA 3NTQA 2Q50A 2O3TA 3AOEA 5H82A 1PJ2A 5AVOA 3RC1A 5TLSA 4WGGA 4U0JA 3UCXA 2VUSA 1EDOA 1LSUA 2NV6A 1BMDA 4AJ4A 3JQCA 1BVRA 5I9NA 4JBGA 2HK8A 3NDRA 3PWZA 4DIBA 4YAJA 2J6IA 3GGPA 2B5VA 4LISA 4K9DA 1U4OA 1PGNA 4TZTA 3JQAD 4KTTE 3QWHA 4ID9A 4RV9A 4A10A 5I8WA 2X8LA 3M2TA 2WE7A 2QG4A 1VSUA 5EL0A 3UCEA 4X54A 1EBUA 3MJSA 3DHNA 4O1MA 5FFFA 4H15A 1E1KA 4HBGA 1H9BA 4P4GA 2IRWA 4ALIA 3GR6A 2GR9A 1PZFA 1T2DA 2C07A 2CZCA 4YJHA 4AJOA 4CMBA 1WAMA 4FR5A 2OBNA 4NBVA 3RROA 1SOWA 5MGBA 3QVOA 2ZTLA 4UUOA 4B3JA 1QYWA 1I3KA 3MEQA 2YHIA 3PGJA 4M1QA 1T2EA 1I2ZA 3ANLA 4E5MA 3NDIA 1K3TA 3SLKA 3H9JA 3PWKA 5A9SA 3D4NA 2X9GA 1Z45A 2VRBA 2WDZA 3LSYA 3FNGA 1FDTA 1S6YA 3DFUA 4JGBA 2HMVA 2ZJ0A 4FDAA 2VUUA 4L4SA 4FSHA 2E37A 5JMWA 3H5RA 1YS4A 3UKOA 5JS6A 4N54A 2OHXA 2YHUA 4MKRA 2D0IA 1DC6A 4IIVA 1CETA 2DBVO 1DSSG 3AUTA 3WGZA 4NFHA 1KVTA 4Z6KA 2BGKA 1DRUA 4ROSA 4LGVA 1M6WA 2D5AA 3BTSA 2VHYA 4B8WA 4PZDA 3ZNPA 2Y1EA 3WGQA 1B14A 3D5TA 4HNHA 4J4TA 3F4BA 4IZIA 4I08A 1UH5A 4LSMA 4XGIA 4YEDA 1LDEA 1ADFA 2EIHA 5KJ1A 2D1YA 2X1HA 4TSKA 1XELA 1PJTA 2HK7A 2VYNA 2ZYAA 1E3WB 1HLPA 1SCUA 4JNKA 4HADA 1B0AA 3V2HA 5A04A 2Q2QA 3L6OO 2EGGA 3WG9A 2WD7B 3A28A 1LLUA 3GY0A 3Q0EA 1HETA 1D1TA 4NG5A 3RSHA 1NVMB 2DTXA 4YAKA 3NTRA 3F9IA 3WQQA 4DXHA 2G5CA 1P77A 2RH4A 2Y67A 3I9LA 4GLLA 2FR0A 5J23A 1KVRA 4QEDA 1MA0A 4KQWA 3UVEA 3AI2A 3JQ9C 5JCXA 1DIRA 2OUIA 3PJEA 1H2HA 2OOSA 1Y6JA 1Q7BA 1LTHR 4XR9A 3C1TA 4UVGA 2NACA 4CR6A 1WDKA 4OQYA 4BGEA 4KUEA 4WKGA 3WGIA 2WE8A 3RJ9A 1K6JA 4Y6SA 5CP8A 3TSCA 4B7UA 4PZEA 1BHSA 4PFJA 1HL3A 4YJFB 1W6UA 4KQXA 5F1KA 1BRMA 3BIOA 4QQRA 3U49A 1UDCA 2X0JA 3IUSA 4NBTA 1EUDA 3DOOA 2HRBA 2X23A 2X9VA 4CM3A 1KYQA 2P91A 4UAGA 3EYWA 2PTGA 4FFLA 3E48A 3VPXA 3A4VA 3ITDA 4BNFA 1ZMOA 1T4DA 4LSWA 2VRCA 2PGLA 3D3WB 4FFRA 1NFQA 1NYTA 2X5KO 3W4JA 3DBLA 3FF4A 1XHLA 1MXHA 4IJWA 5DOZA 4YPOA 1SB9A 1BXGA 1ZNQO 1E7SA 1N2SA 2NU9A 5JO9A 4DBVO 1GAEO 4FC6A 1ZH8A 1XYGA 2NQTA 4TROA 3B1JA 4KDFA 1HKUA 3AWDA 3HHPA 1GQYA 4N5NA 1YOVA 3ENNA 2JAPA 1VLLA 1CWUA 3QWFA 4OGWA 5B1YA 1PL8A 3GDOA 4R01A 4J91A 1TT7A 3S2FA 4IINA 4LN1A 4Y6PA 1KEUA 1Y8RA 1I0ZA 2NTJA 3BHMA 3F3SA 3LT4A 2PZLA 3AUAA 1DFIA 1JWAB 1RM5A 3OIGA 3RI3A 3ROQA 1V9LA 2YQ5A 4RORA 1B26A 4WCFC 2CF6A 1PJ3A 4ZGWA 2WMDA 1ISFA 4RJTA 1KC1A 3GAZA 1HZJA 2R00C 3I6IA 2FHSA 5LCXA 3DL2A 4D41A 5IZCA 4E5KA 3ANMA 3H2SA 1UP4A 4RPHA 1P1JA 1VKOA 1ZSNA 3DO5A 4ZVVA 4CLEA 2AA3A 3KTDA 3ZNOA 3WTBA 4IM7A 4PLVA 4U7WA 5ILOA 4TKMA 3U5TA 1LU9A 2CMDA 2BGLA 1DIAA 5CPBA 3OH8A 4XKJA 4PLPA 2HU2A 1M76A 1U1IA 1FMCA 4I5GA 3UFXA 1R6DA 3WFIA 4QECA 1R12A 1R37A 4CM9D 2AE1A 3BMQA 1ZO8A 1RYEA 1I36A 5G0TA 4UVIA 3HDQA 4BMNA 4D45A 4XQCA 4CL3A 4ZU3A 1DO8A 4J1SA 3IKVA 3UICA 3WR5A 1EQUA 3DOCA 4M89A 4NZ9A 5TT1A 1QMGA 4WCFB 1HF3A 3JQGA 3KSZO 4BNNA 1TVEA 2Z1NA 4DYDA 2HQ1A 4NJMB 5COBA 1ONPA 5JY6A 5ADHA 1Z7EA 1ADCA 4J4BA 3VTZA 4J4HA 2IEBA 4TWRA 3E18A 3IKTA 1ENYA 4WNCA 3HFGA 4BKOA 3SVTA 4FC7A 1Y5RA 4OHUA 1NQOA 2HKIA 3VKUA 2PV7A 4Z9YA 5EQDA 1E1MA 3EC7A 3VZSA 2EKPA 2IXAA 3WWZA 3ZWOA 1E5QA 4OOFA 1ZEMA 3C24A 4L4RA 1NPTO 4J0EA 5TSDA 2C7VA 1ZZEA 5IDXA 4JIGA 4YAIA 1ZJZA 3HQ4O 5ENDA 4KMSA 2CF5A 1NQTA 1LXCA 1ZMTA 3OECA 3LF2A 2J5KA 2Y1OA 1EZ4A 3U09A 2Z1MA 3ZV3A 2PZJA 2QRJA 4IJVA 2YFHA 2DTEA 1V3TA 4E3ZA 5L4NA 2J3KA 3PIIA 4BNHA 2GLXA 2J5QA 3A14A 1LRKA 4PZCA 4BNZA 4GL4A 3NV9A 4PLZA 5JC8A 3R3JA 2YW9A 5G0UA 3F5QA 1ZBQA 2PWZA 4BKRA 1LLDA 2ZTMA 3BMCB 3JD4A 1C1DB 2DUWA 3Q1LA 4WLNA 2P68A 4WNIA 2EV9A 4DMMA 2CDCA 3SBOA 1T2AA 4Q3AA 4WCDA 4RLSA 4D3SA 4DIOA 2V6MA 3W8DA 4D44A 3ROMA 2NVUB 4MVJM 5JDCC 4Z0HO 3HDYA 2OP0A 2Q1TA 4FN4A 4OXKA 2O7SA 4G5HA 1YDWA 2CVOA 3GVIA 3ANNA 1DIGA 1X7DA 2GN6A 3JQDA 5B4VA 4FD3A 1DRVA 1E3JA 2H6EA 4L76A 2CUKA 3JD0A 4MVJE 3SJ7A 4ND3A 1WXDA 4QT0A 1NPDA 3JQBA 4WASA 1FJHA 2EW8A 3VVCA 5TS3A 1ISIA 1M66A 3PYLA 3KYCB 4LMPA 4YAEA 5FI5A 2I66A 2GASA 4HFRA 1PSDA 1WZEA 2WD7A 3KRTA 2QZ9A 1A72A 2QRKA 4YT4A 4OJNA 4EUFA 1Q7GA 2RBEA 3ON5A 4Q39A 3JV7A 1XA0A 4YACA 1V8BA 3IP1A 3AUSA 5HS6A 3EAGA 1MV8A 2OFPA 4J7CA 5KWEA 1HSOA 1OI7A 4IXWA 2HUNA 7ADHA 1CF2O 2R2GA 3GF4A 3PFWO 3RBXA 4AG3A 5EMHA 4J9UE 1QR6A 2DQ4A 4B4VA 2DAPA 5C7OO 4PG5A 2J8ZA 5ITVA 5C3MA 2Q1UA 4E13A 2X0NA 5I9LA 4PCVA 4IDEA 1GU7A 1SOVA 3PZBA 2ZTUA 3OBBA 2ZJ1A 4A27A 3WDSA 4CLDA 4CLOB 5COAA 5U9CA 4CMEC 3GNSA 5DN9A 4BMVA 4ZRNA 5JYEA 2Q99A 1DC4A 5ILGA 3ICPA 2VZ0A 4NH4A 4PRKA 4NBWA 5JE8A 1N92A 3ZCXA 1Q0LA 1ZK4A 4BOYA 3GNTA 1WP4A 4DLLA 4AL4A 1O6ZA 1Y9AA 2JD0A 4L0QA 4XYLA 4NMHA 4PLGA 4EI2A 1LJ8A 1Y8QB 3F1KA 4KTVE 1V6AA 1PGQA 3V1YA 1Q1NA 1EVYA 6ADHA 3U4IA 4YVFA 3WWYA 5T64A 2WM3A 1PS0A 4RPJA 4WUVA 2GZ2A 3OSUA 4XB2A 4JK3A 3AI1A 1T1RA 2Y0CA 5K6AA 3WLFA 4G81A 4QSMA 2GRAA 4U8GA 4DPKA 4L9RA 3RQSA 1EFKA 4XRRA 2FR8A 1I8TA 1PR9A 2UYYA 1EMDA 4CM8A 1ENPA 4NK5A 4CM7A 1F14A 2CNBA 1YOVB 2I9PA 3NT4A 3LC2O 3RUIA 3DZIA 4EGFA 1HDGO 3HZZA 4UEKA 4LK3A 4LRSB 1U7HA 1BGVA 4LCEA 3D7LA 4CV0A 3H9UA 2C2XA 4NQZA 4G2NA 1A27A 3JCZA 4PG6A 4EJMA 4YBZA 1EVJA 4RDHA 3E82A 3ETEA 3IAHA 2ZB3A 3OA2A 4XA8A 2V6GA 3CH6A 4RF5A 2P9CA 4GX0A 4MPDA 5EIOA 3D5QA 2NNLD 2NSDA 2UUOA 2NADA 3PIDA 3QJ5A 4M55A 1UUFA 4ALJA 3EVTA 2QX7A 3L4BC 4TQGA 3CE6A 1M67A 1FXSA 3UCFA 4CV1A 4JP3A 1IZ0A 1KEVA 5JCJA 3TJRA 1I3NA 4XJSA 4BGVA 1H6AA 1V3VA 4MP6A 5CEFA 2POQX 5JC1A 4XQGA 1VPDA 4OYRA 5FI3A 4H16A 1QRRA 3OFSA 3S2IA 2EEZA 5JCJD 4IS2A 3MTGA 1K5HA 5A5EA 3ZH2A 3WNVA 3E9NA 3TWOA 3RU7A 1GUZA 2FRDA 3MTJA 2P5YA 4NU5A 3GG9A 1ONOA 4RPGA 3TZ6A 3RBVA 1CYDA 1ISJA 3AFMA 1LC3A 3LT1A 3FWNA 4CMAA 4G65A 3D0OA 1UJMA 4I8XA 1B16A 1QXSA 2D2IA 1C0IA 3RUFA 2WWRA 1OOEA 3UOGA 2Y05A 2Q46A 4MVJP 3E6AA 3ABIA 2BF7A 2E48A 3QHAA 4KWIA 3ZWPA 4CQMD 3QV1A 4BNLA 1HE4A 3GRKA 2V6FA 2VUTA 4O59O 3KETA 4BQPA 3HB4X 3OQ1A 4QX6A 1E92A 1AXEA 3RFTA 1U5CA 3RFVA 4KUGA 3DOJA 1LA2A 3HFSA 2BMAA 1MUUA 3AU9A 3COSA 1SPXA 2AG8A 4AICA 5B4UA 2CDBA 3K5PA 2EW2A 1LC0A 3U0BA 1GPDG 1WPQA 3JQAB 2VWHA 3G1TA 1K2WA 1RYDA 1L7EA 3S2GA 1BWSA 1SEPA 1X1TA 3K31A 4AJIA 4DA9A 1X14A 1Q0HA 3MOGA 2WEKA 1JA9A 5JNLA 4BNJA 2XF8A 4NIMA 1FF9A 5AXBA 3KYDB 1H0KA 3JTMA 2PH5A 1J0XO 4CLHA 3GUYA 4U0KA 3L4SO 1C0KA 1X0VA 1ULSA 4K1LA 4L8VA 1O89A 3QE3A 3Q9UA 3FPLA 3KYBA 5TGDA 2NVBA 1KERA 4Z0TA 2GSDA 4BB6A 3N7UA 4J0FA 3WLEA 4CM5A 4BV9A 4YYZA 1O8CA 3DZFA 5A1TA 5TJHA 1KVUA 2CY0A 3OIFA 4I1IA 2VYVA 1NHWA 2AEJA 4UVDA 5A3JA 4Q3CA 4IQ0A 1NBOA 2NU6A 3OQ6A 4CMGA 1JAYA 1E6EA 4FW8A 2A94A 1WVGA 2VZ9A 3Q6IA 4HV4A 2VYVD 3PHJA 3T7CA 2Y68A 3PPIA 5AYVA 3UUWA 3FD8A 5DP1A 3FTNA 3PHGA 3EUWA 4XQ9A 3VPGA 3PGXA 5A5FA 1IPEA 4FCCA 2P2SA 4N18A 4PN3A 1TI7A 1QSGA 5TC4A 1FDVA 1P3DA 3A1NA 1ML3A 4GSLA 1PS9A 1DLIA 2JD2A 1DIBA 1GYRA 1W4ZA 2OORA 2QQ5A 1FDWA 1P9LA 2Y1CA 3D3EA 4IGFA 4IGEA 2AEMA 5BQFA 2PH3A 2ET6A 2B35A 3AM3A 3DZJA 1XG5A 1YGYA 3LLVA 4PGFA 4YCAA 3INGA 3WGHA 4EJ6A 2DM6A 4FQ8A 3OJ0A 2P4QA 4QUKA 1Q7CA 3K6JA 4TVOA 1UDBA 1WW8A 2DC1A 3QSGA 3TL3A 1L1FA 1DC3A 1Q2XA 3QWIA 1K89A 5AQ1A 2NTNA 4ZQGA 2VWGA 2DPHA 2EKQA 3PDJA 3KLPX 4MKZA 4DIFA 4EUEA 2W2LD 3WNQA 1C14A 2VCYA 1NR1A 2X22A 4NFSA 2X5JO 3CZMA 5AOVA 3WGYA 1U3VA 3U4HA 4W9NC 3K96A 1FDSA 1RPNA 4UUMA 1CIVA 3PHLA 2B4TO 2X4GA 4ZHSA 3ZHZA 4GKVA 2O48X 3I9MA 3H5AA 2W2LA 1VC2A 1GFSA 1R15A 3P2YA 2ZB7A 1GY8A 2Q2VA 5GZ3A
chains in the Genus database with same CATH superfamily
2PL3A 4GAEA 2I22A 2NM0A 2QJWA 3INYA 1BXZA 5CH3A 3ZHTA 3D8NA 3LO8A 4WH0A 4IDDA 3Q8KA 1O77A 1QYDA 4ZVPA 2HADA 3O75A 1HMPA 4OOEA 1LVUA 4MVJG 5IUJC 2VBCA 3K15A 1Z2AA 3PPXA 3FI0A 5T4FA 1LDBA 2H16A 1R8QA 3S55A 3QKSA 1M6EX 3GBVA 4IOMA 5J4VA 3TLGB 5CH5A 3MWKA 4X1YA 3LX5A 4IDQA 4IQFA 1W0CA 2ORED 4P2GA 2PLWA 3C3BA 2ZRNA 4GF5A 4CUJA 1CJTC 4DLKA 4G8JA 4NVRA 3TOVA 5IF3A 2BBWA 1CY8A 4RVUA 4X61A 4MRPA 3W3AA 1NXPA 3TTSA 2PSJA 1RIFA 2Y93A 2QTVB 4QFDA 1J07A 4HY3A 5KS2A 1XZPA 3AO0B 1T5DX 2A6PA 1CY4A 2CNWD 4QXAA 1W4LA 3TIGA 1K8YB 4PY2A 1C41A 4HNQA 1AM4D 1R0ZA 1WZNA 1GNQA 3T9DA 1DKNA 5ALZA 3UXEA 3VC3A 1BWPA 1XALA 2H5IA 2B9VA 2AW5A 2VC2B 3FKQA 3KSDO 1TAHA 1CJSA 3ASVA 4EGSA 1XT6A 5F98A 4L22A 1F6BA 3OJEA 2PUCA 1FFDA 4MCIA 3AHGA 1YUMA 4O4LA 1DI0A 1UIRA 1QVWA 1ST2A 1WPGA 4N3AA 1M1YA 3UM9A 2NO4A 2DPXA 4L5YA 3GEDA 2Q6OA 3DXFA 1WTCA 4TL7A 4X7RA 2AMFA 1T8WA 2VHUA 1JIJA 1G4UR 1TKCA 2HHLA 3ENQA 3KEFA 3BTOA 5F35A 2DXIA 2RGCA 1T34A 1BG6A 2RHRA 1JU3A 3ZXXA 3NT2A 4BFZA 3NHUA 2HZBA 4HDQB 1UPAA 1Z0IA 5HCNA 3EXG2 3ZHUA 4LVOA 3BD6A 2FZWA 5M29A 3A06A 2NAPA 3NDJA 3ACBA 4NZNA 5T7BA 2JJ2D 5B6JA 2B4QA 3LV8A 4BVFA 3ZLVA 1V37A 5FLKA 5IC6A 3V8RA 1SMKA 5K01A 1AHNA 2FUG6 3DQPA 1N1DA 3KL4A 3Q40A 1LQ2A 3SJBA 3D2LA 3AIKA 2IXTA 2BMJA 3GZNA 3R6GA 3VPSA 1ZUWA 1Q20A 4X5OA 3SM3A 1S8AA 3ZIAA 4KFUA 4HYYA 1MX3A 1ZAKA 4OKSA 4AROA 3G82C 4P81A 1WA5A 3P9NA 2JAXA 1TJYA 5EZ5A 1F38A 1U3UA 2V7QD 3WBFA 2OGTA 4BNDA 3DL7A 3OPVA 1CJUC 5DLPA 1N8NA 3AZPA 4Z3OA 3E03A 3A6KA 4EBBA 1GV1A 1WV0A 3EMKA 2A88A 3B5EA 5DCWA 5TPWA 2PD6A 3WGNA 1Y1RA 1XEXA 2OGUA 1TC1A 1LQUA 2FPPB 2R00A 4NESA 4C6SA 1CX9B 3NRCA 2JFZA 3O7WA 4G5OA 1DAGA 4MS4A 2V7QA 1ZNZA 3ZK9A 1RCTE 2F1HA 3PITA 4HNVA 4GW3A 4NNOA 3HTXA 3BH6A 4MIOA 4PW0A 2P9HA 4ZRMA 4DCJA 5JZSA 4B2IA 1JQ3A 2G9ZA 5LQCA 4H1TA 1PJQA 5GM1A 1U2RA 5CDYA 4G4IA 2XTNA 1G5HA 4OG2A 5HZHA 1DGQA 4GI2A 2BEUB 3B6JA 2ZQYA 4IZOA 3MQ2A 1XB2A 3WRXC 1SBYA 3OY7A 3SXUB 3TTUA 4DIMA 3DP9A 2C1EA 1YBAA 2ZP1A 4F8JA 1JIQA 5EZYF 2WF8A 5J5VA 3AFOA 3UV6A 5KTSA 3UAXA 1F4PA 1RVDA 2FMXA 1VE3A 1A2OA 2DQKA 4RH3A 4E5NA 3GLKA 4U2CA 3URMA 1T3HA 4L0MA 3KQHA 1U99A 1AKWA 1RDFA 3LK7A 1A4UA 3VKVA 5TMPA 3IUNA 4FJ2A 4HWRA 1MGPA 4XXHA 4HUJA 1NRXA 2XWBF 1YC5A 3AUFA 1PZXA 2YC2C 4NK5A 2PQ6A 5GJVC 3AUXA 4WFIA 4OSPA 3UKDA 3BWEA 3PUXA 1R8YA 3ITNA 4DQXA 4R05A 2XVZA 1ISPA 5JYDA 1KZ7B 1ZXLA 2XCOA 1HE3A 2QUKA 3VBCA 5K3CA 2V5VA 3IULA 4RZIA 4N39A 3V1UA 1XK7A 1NT2A 2WI8A 3CEJA 3NWPA 4M1OA 5K99A 2P4SA 1RW4A 3VZBA 4QUGA 4Y1FA 4D9GA 1LDYA 3H18A 4JJEA 3KZNA 4Q24A 1ZH2A 3LQ1A 1HDZA 3CLVA 1Y8AA 4U2DA 4OXQA 1NZJA 4W1QA 3GPIA 2P3LA 2B78A 4YQEA 1OLUB 3V8PA 1BDJA 2WLSA 2ATCA 2IUEA 1R5BA 1XSEA 2M1XA 3EWAA 3M4JA 2CYCA 4P3OA 5GZ6A 4KR6A 5IJ0A 2W6CX 2NVWA 1FEZA 2Z5FA 2BE9A 1Z6XA 5DBHX 4QQ8A 4RTLA 2ZB2A 2B8WA 2YMMA 4CR8A 1D03A 4DBLE 1RD4A 2P5SA 5IMBA 4U5QA 4ENVA 3FFAA 4FDVA 1L5WA 3PPYA 2G0TA 2IW1A 1P44A 4GPEA 3E58A 1PZMA 4EEKA 3SEQA 4DR7B 3MZ0A 3SNKA 1L6IA 4FJ1A 1WXQA 5JBNA 3QX3A 1G5FA 1XHEA 4F9FA 3TUIC 5LBIA 3OOEA 1T8RA 3DXXA 1SIOA 2XE4A 1ST3A 2JGKA 1E2BA 4P0TA 1KDTA 4IQGA 2HC9A 4KH1A 4B3TB 4WEOA 4FW9A 5SZJA 4KGZA 2VK2A 2XRZA 2PUGA 1O58A 2J0EA 3AINA 3MJ4A 2D4HA 4B71A 1G42A 1D3AA 3LVFO 5KOHA 2J30A 1SCKA 2J09A 4TZKA 4HEJA 5A03A 4MLPA 2OGZA 2QQEA 2WVJA 4K87A 4D9HA 4DUGA 2WSIA 4RK5A 4CIAA 1PT6A 4KKXB 1CUBA 2XNKA 5DX8A 1GTG1 3BJMA 3I1YA 4WOJA 5I9MA 2UZAA 2ZDQA 1RQNA 4HX5A 3A10A 4BVJA 3K6SB 2WUGA 2EFEB 1QORA 2B4AA 3ZDFA 4MUAA 4BNMA 1WSWA 2XB4A 3NVMB 2FFRA 2WAOA 4GO1A 4E1AA 2MYUA 3L84A 2VJBA 2ENWA 5DEOA 1VLQA 2C84A 1ND5A 1B0UA 1T6XA 2G1KA 4GOOD 2QZSA 5GVRA 4S24A 4JLVA 2WYWA 3TS1A 3ZK7A 1FJXA 5DNYB 5BWOA 3E35A 3KDSE 5AKYA 2AEEA 4A8JA 3FOFC 1JAHA 1AUVA 2AV6A 3ZWWA 1T6BY 4FE3A 5EQFA 5AWFC 4LE0A 5HF5A 4WY8A 5CEEA 2HF2A 1JQKA 4FYVA 1KP9A 2Q4EA 3KT6A 3PDIB 4O0LA 1AS2A 1WB4A 1GPYA 5DCLA 1TO6A 2PUTA 2WG0A 1XC7A 5LQUA 4ENTA 3TLJA 3I23A 1DAIA 2C5EA 3LT0A 1CIJA 1GZ3A 1C7IA 2R6ZA 3I09A 5I4KA 3RJZA 2SBTA 1PWZA 1DX9A 1JG2A 1OWMA 1X7WB 4LX8A 1E6UA 1W5FA 1I9GA 3FPSA 1JR3A 2C82A 2RAUA 4DXAA 5EMMA 1Z4PX 2CW5A 2QVGA 3S1LA 4HB3A 5J4YA 4KK4A 4LW8A 2V1XA 1JAZA 1W1UA 3ECCA 5TQJA 1DG9A 1OPXA 2HO5A 2ODTX 2XWSA 2YHBA 3QWAA 5EY5B 1YE5A 4Z9XA 2QN8A 2UYOA 3HWRA 1WOYA 3TG2A 1TTTA 2BKVA 4K6CA 3OLXA 5HE9A 1VKHA 1W4BA 5IAKA 2QTVA 3DHEA 4BDTA 3W77A 1IZ9A 4FE7A 4W99A 1XGKA 3JAKB 1BA3A 2WU1A 3IBCA 4KG7A 5HMMA 1GITA 4EA9A 2F1IA 5CM9C 4D4JA 4ZCPA 2H5EA 4FHFA 1QHHB 3AF1A 5AUOB 1GARA 3K5WA 4LRQA 4NYMR 2BWJA 4UHCA 2HJ9A 3OZDA 3N0TA 3B1YA 3DZBA 4NPCA 4CM4B 3EZ9A 2IQ5A 4XB1A 1LDGA 1X70A 3Q2KA 3L0PA 4LTNA 1SVUA 1JLSA 4XVCA 1JG3A 1ZUNA 2XSZA 4L5CA 1PZGA 3QF4A 2EXXA 4N8SA 1F17A 3ZH9B 3NHYA 2OCKA 2YWGA 1KTIA 3V97A 1I1HA 4RTOA 8LDHA 3EVBA 4XUCA 1JI0A 3KWMA 2VT3A 2QM8A 4NPHA 4LTMA 4QRDA 1LV7A 2GAJA 3LDHA 4BO4A 4DRXB 3VH1A 4IH4A 1VPWA 1E9RA 1CJMA 1ZZGA 2CNDA 1VSVA 3DLCA 3FR7A 1WVIA 2PLNA 2EKLA 3GVXA 3NKFA 3PS9A 4FI3F 1R0YA 4RLQA 4Z86A 5E8RA 3FPBA 1NW4A 1CPYA 3TTYA 1G21B 1PEDA 1N57A 2BI8A 2FPIA 3BQNB 1Q19A 3K9WA 3SZRA 3ZWYA 2WHQA 3R7WB 3F7TA 4F72A 1OFUA 3CLUD 4UPVA 3ZD9A 3H65A 5GJWC 1J0CA 1Q12A 1SG6A 1Y48E 3B1FA 3ELBA 4ZMRA 1SO8A 4IWNA 1C1XB 4RY8A 3L7KA 1VI6A 1C3OB 2VHCA 2XXBA 2A35A 1GHTA 4ZOLF 5L9AA 1T8UA 4IKPA 3OLWA 1RZRA 1ZJ4A 5J5CA 3UPDA 2ZCJA 3SKYA 3TZCA 5L7WA 4UNIA 4D92A 3F4KA 5J3JA 3JR3A 4TKZA 2H8KA 4BZWA 1KF0A 1TUGA 5KDLA 2O1EA 3G5TA 2EOAA 4IJKA 1G8GA 4DNOA 1LTQA 1V5GA 3H9GA 1TJ4A 2CMKA 3EZYA 4KQ6A 3R4VA 4A3SA 4OLFA 2E4AA 4QQKA 3B53X 4QRIA 1NIPA 5THKA 1NKTA 3DVAA 4RJLA 2XF2A 1AKTA 2JAHA 3TQIA 4NXNB 3TQHA 3CF6R 4OGFA 4L2IB 4XPIB 1N9KA 1V1RA 3W1WA 1K0UA 2BJWA 3IV9A 2GAAA 5E0KB 3D6HA 2WP8J 4F5WA 7REQA 4W8GA 2YUTA 1F9AA 5B1IA 4EUHA 1Y81A 2ZIWB 1T4CA 5FPTA 3U1VA 1YBHA 4R71A 1EU1A 1RJWA 3DCNA 3ACCA 3C8MA 4WUTA 1WKVA 2HDHA 3QVWA 2ZI5A 1FMTA 1ZIYA 3MBKA 3A9SA 4I9UA 5IBQA 4QJIA 3V4SA 3RTBA 3O4GA 2QAGB 1LPMA 2ZUUA 3DE5X 4KODA 4L7VA 4Q7KA 3ROPA 1EUCA 2HAEA 2GNOA 2BFFA 1NVTA 1DQZA 3BXZA 3EBOA 2AGVA 3L46A 4KQGA 5DMXA 1YDFA 2AJBA 5AKLA 4PG7A 4BNUA 5LQAA 9MHTA 1QJCA 3SK0A 4CQLA 3PZRA 4LPSA 1KEEA 8ATCA 3RGGA 3UGTA 2C61A 4D6YA 2I4MA 3UHAA 2AXEA 4DCNA 2AN5A 1SOAA 1R27A 3LG2A 5HFAA 5CNMA 2WHPB 5LMNB 4TMFA 5ALYA 3ETJA 3G9UA 3LC0A 4DM3A 1IWPB 3Q6MA 4GRDA 5IM5A 3FNQA 4N5DA 1GVHA 3C3XA 3CPJB 4OFXA 4P5DA 4F8YA 4OLBA 3KT0A 1B3BA 1MA3A 1JR2A 3A7EA 1PR2A 3IIKA 4CKWA 3O8QB 1QK5A 4KL8S 4PC6A 4ITVA 1RWBA 5K4AA 1U9CA 1XD8A 4K9PA 5JSUA 5MN6A 5HG0A 3KJHA 2ECPA 5IAAA 1OX6A 2Y2VA 4EIWA 2FUG1 2GEJA 4Z8XA 2R25B 1NN0A 2R7LA 3DHWC 1CY2A 1K6MA 4RPLA 5B4TA 1Z18A 1BKDR 3AU8A 5BN4B 1Q7TA 3LQ2A 3U3XA 2YDXA 2CXNA 2J5BA 2PBLA 1OB2A 3FVTA 1KFKB 3EY4A 4TL9A 2VH5R 5LZ7A 3EHEA 3GGCA 4RKEA 1D2EA 1KFBB 1NMEA 3RJMA 5TXGA 2II6A 3DFIA 3ZLTA 1S8FA 1MZVA 1J8VA 1AF7A 1U2SA 5B2ZA 2A5YB 1C1XA 1NW9B 1S2DA 2IU4A 3H5IA 1BXKA 3PL1A 3HRKA 4FDUA 3RAJA 2RGRA 4L9AA 1C30B 1IHYA 3WICA 2X41A 2MJLA 4YJDA 2JJQA 1UKCA 3H13A 3SJAA 2QRZA 2C54A 5EHZA 4Z54A 3GELA 4IDBA 1MBZA 1EQ2A 1U5BA 1XCPA 1XTVA 4MH0R 1RPTA 3TLMA 4MGYR 1T3LA 1C50A 4DLRA 2N42A 4KFCA 1JG6A 1XEAA 3I9V6 1QVVA 4ISBA 4LNAA 2RD2A 2BELA 2GHRA 2P4EA 4RO0A 1EFPB 2Q3EA 4N9WA 2CFIA 3BM5A 3H2ZA 3KXPA 4OQQA 2X9LA 2QP9X 3JU3A 1FSFA 1TYCA 1TGYA 1KFEB 1KYIA 2D3TA 3ND8A 3BZWA 3V8MA 3H0EA 4NNPA 2VJLA 4UTNA 3KQUA 3VC2A 1BU5A 2Q49A 4OKNA 1L4LA 3HBLA 4J3FA 2WUWE 5HTKA 3OA0A 2GJAA 4ZO8A 4Q1VA 2ZJOA 2GM3A 1RQXA 2J3EA 1X7YB 4KI0A 3VTFA 4B45A 2XZOA 3CHYA 4E2WA 4RDIA 2AH5A 1ACMA 1ZGAA 2F1RA 2Q6TA 2CBGA 4BO8A 2XX3A 5IFLA 1QHHA 2AC7A 3O4HA 4CV2A 1XF9A 2QTCA 2TMDA 2I7TA 3OM1A 1MABA 2C4HA 3MM4A 4M76B 5IHPA 2A1TR 5EKSA 3WLAA 2A1UA 3EARA 4X8OA 1E77A 3FGOA 4Y2PA 4PRLA 3PC6A 2QR5A 1QV9A 1F6WA 5B7QA 2PX0A 5F73A 2P11A 3EGEA 2ZR9A 3R8CA 2FSPA 2AC4A 1P1FA 3NTLA 4AD8A 5J1TB 1CJCA 1DTWB 4AAYA 4X24A 4ZREA 3PUHA 1ZRMA 1PNQA 3VDRA 4OFBA 4F2WA 2Z6AA 1KQOA 5ABPA 3C3CA 4NMMA 5DBGA 3F8WA 4AZTA 1XTJA 3RVNA 2VJNA 1MVLA 2RI0A 6GPBA 4UUAA 1D07A 1TB4A 3F3MA 3DTNA 4GR9A 2K2WA 2TYSB 3C6MA 4E4TA 4BUJA 4OIFA 4IF4A 1XQ1A 4KYVA 2B25A 5K3DA 4IUYA 3EUAA 1GOTA 1HMYA 1XXHE 2F1OA 3C6YA 4FUTA 4TMXA 4X8MA 1RWXA 5DGDA 3SSMA 4P35A 1DZIA 4LGCA 1JIKA 4MUEA 4ARIA 4AS2A 5E6RA 1QKJA 3MCWA 2IZOA 3V4PB 4GGOA 4P4UA 2ZT7A 3GRPA 4GOJA 4WLEA 4Q4AB 3WY9A 1PQWA 1CBUA 2I76A 2I1VB 2Z09A 2FPUA 3JY6A 4G5XA 4MVJH 4UBJA 4XUGB 2WJ4A 3GLTA 3SOZA 4QGSA 5C4IA 2ZIGA 1U5AA 3UAZA 5C8VA 2ZBGA 1XK6A 4QARA 3N8DA 2NGRA 4D82A 2PIAA 2ZVQX 1QH1B 3HG7A 2C4VA 2ROQA 3CPEA 1Q0SA 1AXRA 4TWAA 5CVEA 4MTLA 1D8AA 3LNCA 1ZGJA 4KN9S 1Z4LA 3A1DA 3RASA 1RXIA 1EDBA 2WLTA 1QUEA 1K6XA 3OD5A 2ZBQA 4J2HA 2QW8A 2WA1A 2H9IA 5JJ5A 3GLHE 1I94B 5DZSA 3SZUA 5KOYA 4AZ0B 3NBAA 4YH1A 3F78A 1WETA 3Q7RA 3IV7A 2A1UB 4A6PA 4Z4IA 1KDPA 4I2NA 1NW7A 2J3QA 2OUKA 1R9GA 1RKXA 3BWMA 5LXTF 4HGOA 2Z2IA 4DIDA 4Y9UA 3SQMA 1PJSA 4ZV9A 2PKCA 1CXZA 2C4MA 4DV3B 1W36C 2HW8A 2Y8EA 5IKXA 1XVIA 8ABPA 2BZ0A 5F2OA 1URPA 4PSUA 2OBBA 4IP0A 2A5GA 3AX6A 3GL9A 1E9FA 3OIWA 4XQ0A 2EJVA 3FKSD 1ODSA 3L9XA 1BKSB 2X6QA 3LUGA 5ALMA 4LFCB 3RVMA 3ZI0A 4HVCA 5CX1B 2QTZA 5JD4A 4IIDA 1M8FA 3R3SA 1K7CA 3PGA1 2VHXA 4ZVKA 1IN4A 5LMUB 3W7VA 1IVSA 1DAEA 1SCUB 1OC4A 2K87A 2WYVA 1HSZA 3DAFA 4XFDA 3J7TA 3BJZA 1RQ7A 1SVSA 3E8XA 4GPD1 4ZPJA 1UXKA 2Q28A 1HFEL 2NLOA 3JWJA 1R0LA 3O82A 4GMXA 4PBTA 1E4EA 4TTAA 4ZPXA 1KEZA 4ZOBA 4HC4A 4CU5A 4FFSA 4EJSC 2FSVA 3L2OB 4Y2SA 4D97A 4NRDA 2CE7A 5BNTA 2CK3A 1SKYB 1HZZC 1I32A 4MDHA 4LXGA 4G0VA 2OO3A 1BKYA 3WV5A 1A4IA 1G2OA 4JYMA 1XMPA 3W5SA 3FRHA 1ARZA 3MMPA 1PJ4A 4DHWA 1POXA 4EAAA 3RRFA 1J2TA 3FG9A 1DAOA 3HXTA 4I9HA 1QX4A 4NYJQ 4HB2A 1B74A 5E3IA 4DA7A 3KQYA 3OHSX 4ZXPA 1YMUA 1HG1A 2LKDA 5BQ3A 3DWGA 5L95A 1ULTA 2E4UA 4E2ZA 1B00A 4PNZA 5HRUA 1WU7A 2D2VA 1U9IA 3THSA 4D0RA 4A8HA 3TLXA 4C7XA 1F48A 1WABA 5WRFA 4Z4QA 1JMVA 4Q1AA 1N0IA 3WGIA 4DGQA 1COWA 3BC1A 3GJ4A 3M4NA 5AJHA 2Q7DA 3TE6A 4KO1S 4BJ3A 2JVIA 2R1VB 3M6VA 1YH3A 1W4AA 5E7MA 2AVNA 4E5VA 2E4WA 4QFBA 3HBNA 4YHBA 4QUIA 2MMCA 5FUMA 3N2GA 1X13A 2CVHA 2YHIB 4OHBA 1OMOA 1ZX1A 4RIEA 4R8SA 2BTEA 1OGJA 5LDGA 1E5LA 3SSAA 5I48A 4FPXA 1HDEA 4CZ2A 4OB6A 2PFGA 2HMAA 1Z4KA 1C0PA 4QXMA 1D2RA 1R00A 1T3SA 2Z5GA 2YXNA 4BHTA 4DLYA 4YXWD 2ISCA 2G4LA 4BNGA 1NSFA 2VJKA 2B2CA 3DAGA 4S2EA 3VMFA 2NP7A 1NKVA 2BFFB 1UKBA 1PWYE 4MPRA 5KQMA 3V3TA 4GDFA 4F4FA 1XRQA 2JAOA 5AKJA 1S2OA 2NYAA 4YRQA 4PGMA 1RI4A 1EE2A 4BNKA 1BJKA 4ZQHA 4E7OA 2Z8YA 3ZI4A 1PJAA 4G63A 1UODA 4TQ9A 5AVKA 4EK9A 3H04A 1QYXA 1YS1X 4XJXA 2PM8A 4HXFB 3O26A 5K3FA 3NXKA 2AXQA 7REQB 5I6DA 3RF6A 4A8JB 3SHVA 4IKEA 3FPGA 3QA9A 5T4HA 3U31A 3T5AA 3HJCA 4HUQA 3ROXA 4R8VA 3BA1A 2V65A 1V35A 1MU0A 1C4OA 4JJZA 5DT9A 4OMFG 5HQTA 4YN3A 4EDHA 3HLTA 1E1RA 3BSYA 3K8ZA 5B5SA 1SHZA 1KDRA 1H42A 1L7QA 1Q1QA 3HVUA 1VLHA 1Y3CE 2IF0A 2G0NA 3PGKA 2B4YA 4NSNA 1RZVA 4C1BA 3G5UA 3ZNQA 3V8VA 5CVUA 4PSDA 4FHDA 5M2QA 1QHSA 1XL1A 2XMSA 1XJWA 1H69A 2EX0A 2R8BA 1SOMA 1GR0A 3DL4A 1EPUA 3VSDA 4HGQA 3WSVA 1TZCA 4M4SA 4Q7EA 3VYWA 4M9QA 1CK4A 2AKEA 4B33A 3IP7A 4QBKA 2QU8A 1AKQA 2EC5A 5IBRA 2HCFA 4WN9A 1RJ9B 2FN4A 1DKUA 1MOQA 1FSZA 2VSQA 1T8TA 2VWPA 4YAFA 3H05A 1FU7A 3DZHA 3F46A 3LZ6A 2PK3A 3EVDA 3UAOA 4MI3A 1J1UA 4MWCA 1JWLA 5L6MB 1MENA 3IUBA 3A6FA 2IYUA 3O4VA 3ONDA 1D8TA 4JA2A 1BFKA 1S7CA 3BXXA 4FLFA 3RJ5A 1JLLA 4TLAA 1E5VA 5JJKA 1FP4B 2OG2A 3I6YA 4GMFA 4ZV7A 1VLMA 3OZEA 4WK0B 3S1SA 5I4IA 4U5XA 3T0IA 2IXGA 1FE8A 1GNLA 2AOTB 3A25A 5AM2A 2NYUA 1DMSA 2CEAA 3O90A 3CNBA 2EX4A 4R9SA 4REMA 3UWOA 4B4KA 4GPIB 1UWCA 2CYBA 1N5KA 1AZLA 1MC8A 1UBJS 2H1CA 1ZICA 3CRZA 4FYPA 5JAQA 3I6BA 1NC3A 1PFUA 3NAMA 3O5AA 3F96A 2GDJA 4M8LA 2OEPA 1AJEA 1RRPA 5EEGA 1FQOA 2WY2D 3WFJA 2FWNA 2XBMA 5ADWA 3BGOS 1D5WA 4Y1EA 5AHRA 3RE1A 2QLMA 3T4XA 1SXIA 5J2UF 1E6WA 3OPYI 1OBHA 4KHZA 4Y8VA 3KZMA 2NXCA 4FGSA 3W2HA 5BUZA 5LIPA 2EWMA 5AK4A 2FLWA 4ZOCA 4M38A 1INLA 1T0UA 1T1SA 2Z5VA 1IJKA 4IH9A 2Y4NA 4MUGA 4Y6GB 3V48A 2QTAA 4PCAA 1IDN1 1R64A 4DC0A 2CBXA 2PGJA 3H8VA 1PU2A 3PTAA 1M0EA 3WMWA 1VG0B 2F6RA 3CG0A 3L43A 5TX7A 2XDAA 3CM0A 5HKOA 1CRLA 1RYHA 2I67A 3E9YA 5T4BA 4YS6A 3TNJA 1FZTA 4QYIB 3VPBA 3ILSA 1CS0B 5ESRA 1SBQA 3DLAA 3NTOA 1XTTA 2X58A 5BP7A 3L0IB 4U9UA 1L5QA 4JLPA 2B8TA 3AHDA 3FYTA 5A6SA 3BTUA 2HCJB 4LBZA 1CUJA 5A7GA 3I2JA 5U1PA 3WMGA 5HSGA 2X42A 1IHUA 5ALFA 5AD1A 3T1YB 1T26A 4MYTA 1Z68A 3C5EA 5KJEA 2XMPA 5BXYA 3F6PA 3OZXA 3MF4A 2EYUA 2FX2A 4H3HB 2OO5A 5B3JA 2O8DA 1JZSA 2FKNA 2PRKA 4DSUA 2LW7A 5ALKA 1NBWB 4CMCA 3S0JA 4DLTA 1JHOA 5BSHA 1GEEA 2H7XA 2I4LA 2NZWA 3ENZA 3MWYW 5FWXB 2R62A 4AJKA 4Q02A 4IEFB 3HM9A 1IU9A 3GV0A 5A3RA 4Z7QB 4FNMA 2EGHA 2WIJA 3DKPA 3Q2OA 4DMKA 4FBLA 3L6CA 4MRRA 1L5MA 1NXXA 1XLVA 2J3HA 1SUFA 2V96A 1F12A 2YYYA 1TL7C 2YYSA 3DBLB 3MAAC 3IAFA 4GKAA 3M5CA 4H7PA 4FYIA 5DTJA 5KYYA 1H5QA 2R48A 1ZG3A 5KVCA 1FNSA 2PSDA 5KJ6A 1N6KA 4TVBA 1K5DA 1YB6A 1J4AA 2W6OA 4S1WA 1QFXA 3AHEA 2WT8A 2AF3C 2B30A 3GVHA 1AHPA 4Y2RA 3UK0A 2WJYA 1YULA 4CMIB 5CFNA 2M32A 3GHYA 3A3KA 3R5JA 3D54D 4YCDA 1HV8A 4GMHA 5F7ZA 4W6ZA 3NP9A 1XI2A 1Y80A 4MW4A 5DYWA 4B48A 4C4XA 5HMLA 1DJOA 4KZPA 1JVBA 1YB2A 3R6DA 4DVJA 4IEIA 3FWYA 1IN7A 1LI7A 3G5LA 4PO8A 1SZDA 2IYEA 3KKEA 4JELA 1G2PA 4NMLA 3PHIA 2UDPA 4E30A 1G291 3WKDA 2HR1A 4QM6A 1G6HA 1UBKS 1U2TA 3AJEA 2O23A 3GZNB 4L2IA 4XPIA 1EG7A 5C8YA 4D6PA 4KLNA 1Y9EA 3QPAA 2UYQA 1KEWA 2GBLC 1SXJE 3GCDA 1I6KA 2X3YA 4FEEA 1ZRNA 4PSVA 2XEDA 4V1CB 3BN3A 4YMLA 3ZGZA 3TIIA 2ZTHA 1BMTA 1LEHA 1TPZA 2BTOA 1ZD9A 2QY9A 1KWKA 1ZIDA 3OF3A 3HYCA 4KXLA 3E5RA 3KR0A 1QB8A 4II2A 2OK8A 4UASA 2PXXA 2O6LA 2EFDB 2A9JA 3QW2A 2I62A 2D7JA 4WOKA 2H9YA 3RGWS 4V0ME 3PP8A 1PSZA 4JQZA 2RKBA 4IGIA 1TA0A 4LYAA 1ZK3A 1PNTA 1LPOA 5IYZB 5FBVB 3GB9A 1ETHA 3NNNA 4EG5A 5FI0B 1O6FA 5IXSA 2XWJI 4FXPA 4O1HA 4CMHA 4YV2A 3SC6A 1Y6QA 1BTOA 5JDCA 1JP7A 3LDUA 1O0SA 1AA9A 2AI3A 3IDSA 1RLTA 3EPHA 1CUHA 1JPNA 3D8SA 1HBJA 4QICA 4GM0A 3PNVA 5DRYA 2A58A 4R3WA 2FN3A 1NTRA 4JKYA 5JPCA 2IUTA 4GMGA 2AWOA 2UUPA 3LECA 3MAJA 3NAQA 3E4CA 1L7VC 4NH0A 1BE1A 2YIJA 4BO1A 2PX3A 4GLJA 5L8VA 4OJYA 4ZHQB 4WZBA 3OMWA 3QOWA 3CUKA 4RZSA 2WFLA 2YJZA 1LSOA 3I2YX 4DN6A 3GQBB 3GUHA 1NHGA 3DEYX 4KACA 5FTJA 3EZFA 3K2BA 4LDQA 2UVPB 1GA4A 1S1MA 3B9PA 1EGMB 3PFBA 3SU8A 5HFJA 1OIVA 1U8AA 4NI5A 4RTSA 3G3EA 1P1KA 3PD7A 2XOKD 4ZD6A 5DIZA 2ZW9A 2OZKA 4DQVA 1EEHA 3R9XB 4M36A 1HKHA 3X2EA 2C3MA 4JX9A 2EHDA 2ZB8A 3QEJA 4X63A 1QOZA 3CYFA 3HJUA 3ABRB 3RAGA 3RC7A 5KTMA 1FMFA 4ZCMA 3PX3A 5GAJA 5DN6A 1CJVC 4X8HA 2ZBEA 1UIMA 1ADBA 4PRYA 4TYQA 1TK2A 2FE1A 1G8AA 1ULAA 2HIGA 3W6UA 1QTIA 3SSOA 4YT8A 4D46A 3RHZA 3SN6A 5FTMA 1JV2B 4GNRA 1YMVA 1L8AA 1I1QB 2WUVA 2XA2A 4R9VA 2JJ2A 2VHWA 1NQVA 1VIYA 3BXOA 3O3OB 2QVBA 4CQMB 4YJ2A 5AVVA 1IL0A 3O47A 1EP9A 1W4RA 1JSXA 3HB7A 4M0EA 5JXGA 1OKKA 4RQAA 1QF6A 2PCLA 3RUAA 4NBUA 4BAZA 1WWKA 3P9YA 3Q1KA 4OU5A 1IFXA 4JHXA 2H1HA 1XVVA 2GHQA 3AWIA 2IV7A 3IVCA 3U3OA 1O96A 1GU1A 3MXTA 1EWYA 3MJEA 3Q7TA 4FFVA 3MT0A 1KVSA 1GTVA 3LNTA 3QFHA 3VR4A 1MR3F 5L45A 5EJAA 3K6SA 1IXZA 3EPJA 2XR1A 2EP7A 4C0XA 3I39X 4HOYA 2XT6A 3V2GA 1NA5A 1Y7IA 5CCXA 1EFRA 1KS2A 2GAOA 4Y67A 4RVCA 4ZANA 2IEAA 3AC0A 3RWMB 1F7UA 2QZZA 3FCYA 1WR8A 1M2GA 3KV3O 4Z9AA 5ADVA 4UXIA 1H2BA 2MSNA 4LWOA 1XD2A 4LJLA 3MS2A 4L6AA 4TKUA 2DFLA 2ZJ5A 1U02A 4E21A 1IEXA 2HQRA 2I3ZA 2FX3A 3AR6A 1BA2A 1GNPA 3D3WA 3G17A 2WWGA 4RVFA 2H2GA 3ROTA 5AFSA 3KM0A 3FB4A 1H2EA 4HLNA 3GN1A 3TR0A 2C8VA 4L8FA 4X93A 3AEYA 3EBPA 1Z37A 4R69A 5CRIA 4DV2B 4YRFA 3GMIA 1QCYA 1Z4JA 4QGAA 4UBKA 2ZZKA 4XE5A 2NP6A 1OASA 5NULA 3E5NA 3WISA 3QUBA 2QROA 3EULA 1W35A 1N6OA 4YI5A 1N1GA 1O5OA 4Q3DA 1X8XA 1ZITA 4WK4B 3L4EA 1ECLA 3OEHD 1B6RA 4TT8A 3DEHA 2A7XA 1FTQA 3G7NA 3NRBA 4BO0A 3U7GA 3TLYA 3INNA 3ZHXA 4UMVA 2HDOA 2ZIFA 5CBPA 3K4PA 2OV6A 5AJVB 4M8SA 4BQNA 5JBQA 1IBCA 1X1AA 1W52X 1NMXA 2PYZA 4QDKA 4DRYA 1JT9A 1O6GA 2ENUA 4KYTA 1APBA 5H83A 3CRMA 1PZEA 2TMYA 3L7OA 2CV1A 2JCVA 2IPOA 5EJ5A 4YALA 2SNIE 1N3BA 1PQPA 2HL6A 5CLHA 2HXSA 3WLPA 4KN5A 1Y3AA 1SQGA 2A1TS 1MOZA 4EGJA 2ZU6A 2F43B 1G18A 2PH7A 4E6EA 4BS9A 1M1XB 3VNSA 1XDGA 1MEEA 2NIPA 2XTAA 3PC8C 3BWYA 3WB9A 2YCLA 4ZC8A 3DMYA 3E1SA 3TVYA 1LDNA 3INRA 3THWA 4JQSA 2DUUA 4ISCA 3FHOA 3IQEA 2NXNA 5REQA 1OLXB 3HKBB 3MJCA 4P4SA 3VX3A 1C8VB 4JLUA 4Q3BA 2CJPA 2O3SA 3EFHA 4O4HB 3KTAB 5FP0A 3A9CA 3H2JA 2LDBA 1MF7A 1XN1A 2AC2A 3LVQE 3HDGA 1OFIA 2A9FA 2R2AA 3UN1A 3LTNC 2JHFA 3P9XA 4HGRA 4LFAB 1N5JA 2OD9A 3BB4A 3BRCA 4GI7A 3FTCA 4JASB 5HK9A 3AJ9A 2G06A 1UBUS 2ZBFA 1R9JA 4OYHA 1EX9A 1UOOA 3BWVA 3D4PA 2EBFX 3IEPA 3L6DA 4NONA 2VXYA 4OO3A 3WE7A 1NAHA 3U19A 4EHHA 2E49A 2HBRA 2KM1A 4TV9F 3K32A 3TFQA 2VXBA 3Q9NA 4GU5A 1CQIA 1DRWA 1O9HA 3G1UA 2P9GA 1UM9A 3P2KA 1L5KA 4J1TC 4N65A 4Q7JB 1B23P 4DDMA 1M2KA 4KUHA 2JLRA 2V0CA 1VKNA 1OXTA 1QZXA 3ODPA 4RDCA 4ILKA 1H3FA 4B7XA 3DB2A 4R1SA 3VPCA 3FNFA 1QRSA 5EP2A 4WZBB 4QLOA 1EFRD 1XRJA 4NV0A 5B37A 3VOAA 2IXBA 3EN0A 3AVWA 3DNFA 4WKNA 3L0BA 4Y98A 3P45A 1F06A 4B3RB 4H7DA 2I8LA 4G97A 3TFWA 1BXRA 4BLRA 3N8IA 1ZM9A 3PUIA 4FMPA 4IVNA 3S28A 1GDDA 4D8UA 3FSRA 2CL6X 5JMOA 4AM8A 5BSWA 2HMSA 1FX0A 3MGGA 5CB4F 5KREA 4ZVTA 4LGYA 3T1QA 3VU1A 1MT3A 2MDTA 4O2BF 1OH8A 3LX6A 1O9BA 3NFYA 1R4NA 3ASUA 1M7GA 5KTPA 4LOJA 5G0VA 4QJ4A 4C9BA 2AMYA 1UXOA 1XP5A 2H4ZA 3R0JA 1PRYA 4AJLA 4ZAXA 3ZU3A 1OTYA 2W98A 2YWXA 3R77A 4GWKA 2YRWA 4YJHB 1QIEA 2FDCA 3FBWA 1DPFA 1L0BA 3MILA 4MI9A 3STWA 1G20E 5ICSA 2IZ1A 4Q01A 1XWWA 2AJLI 5IDYA 1N8SA 2IZ5A 4GXRA 2C2MA 3L49A 4OAPA 2NZ2A 3NRJA 1JU4A 3F6BX 4JUCA 4PIPA 4FONA 5FAKA 3KR9A 5J4KA 3BMOB 2CXQA 3RRNA 1VL1A 3V9AA 1X74A 1XEXB 2QPOA 2WV9A 3AP2A 5IJXA 3G6KA 5LUAA 2WZCA 1MX5A 3HYSA 4RCYA 5G02A 4HDMB 1CB7A 3T3IA 1JB9A 1Q6YA 2ONZA 2NZXA 3H5WA 3CWZA 4LK2A 1AX9A 3VC1A 2VO1A 3PPWA 2V5UA 4K0KB 4UM5A 1UDRA 3IDQA 4MQ5A 1L5NA 3JYPA 2QSYA 1KMIY 2C7RA 1VG9B 3F6CA 1E7MA 4BLQA 1JR3D 2E3JA 3S27A 4DCMA 1XDZA 1GKYA 4BV3A 4J0DA 1CF4A 3FPEA 3OJCA 1K27A 2EJBA 3I3OA 2GBLA 2NSHA 2ONYA 2VJYA 1LX7A 2FXVA 1SCAA 1KAQA 2REBA 3V8NA 1XZMA 4LS3A 4BC0A 1AGNA 4DSOA 3WAKA 3QVTA 1ODCA 1P5RA 4IUCS 3T1HB 4PC7A 5G4LA 5I4BA 2VHTA 3IQIX 1N7HA 2Y1WA 3JYLA 2XMRA 1PR4A 3ZWBA 2GBPA 3PXGA 5K0EA 3WRYC 2GETA 2DRIA 1OZHA 1M2NA 3GFTA 1TO1E 4X41A 5BVGB 5LJLA 2JEZA 1VPVA 3CINA 3JQ6A 1AMUA 1JZTA 3S1AB 4FOLA 1BWRA 4MCAA 4TLBA 3L4JA 4AN4A 1IUKA 1U7DA 3F97A 2V6JA 2ZYDA 4GLOA 5CLLA 4MWGA 3OZ7A 3A3YA 4S0ZA 1EI9A 3OIDA 1RTKA 2JFQA 3D02A 3MMSA 3Q87B 3C74A 4IDGA 4F45A 1XCOA 2C8LA 4NOKA 3D59A 4RHEA 4NARA 2EU8A 1PK9A 1KNQA 1JJ7A 1I5EA 4DUGD 1OIXA 1EP2B 2Z8XA 2YJ6A 3CX8A 2C7OA 1GT91 1XU7A 2VDRB 2WM8A 2FFJA 4RHCA 2JAQA 4BU0A 5BQXA 3Q41A 3WK5A 3IH5A 2X0EA 5BW4A 5JPIA 3DTYA 2Y66A 3AR3A 4FGKA 1XLWA 4QXRA 5ALTA 3H1PA 5A9TA 3UW3A 3B6EA 5DM70 2C5HA 3C5VA 3I6ZA 2BCGY 1DG3A 3KB1A 2JLZA 1XLTA 1Y3FE 2RI6A 2REQA 2Y0PA 2BSXA 3ZY3A 5HCIA 3PRJA 1VPTA 1IB0A 4UU1A 1SC6A 1VSQA 2VBFA 3CJQA 2OC9A 3CZ5A 5AKZA 2XZDA 4YK7A 1CQWA 2KYRA 1VJ1A 3IPXA 1ANKA 4JI0B 2R60A 3P71T 4F12A 1L8QA 3UMJA 3PK0A 4L74A 2V9ZA 2CXHA 1A2QA 4V0KA 4QEZA 5JECA 1U3FA 2C96A 2GRUA 2PZFA 5D00A 5EXTA 2J4FA 4X1KB 5HM8A 4F5ZA 3HCCA 4KW7A 5AW1A 2CJWB 3C97A 1T1JA 1S0UA 1H2WA 4MV1A 1K8QA 4XOIA 3TMAA 4C6TA 2PMEA 3QVMA 3CVVA 1HPLA 2FN8A 1F2UB 2GGSA 1US8B 3ZE7A 1G60A 4JYPA 2HJVA 4M49A 4TN1A 3QMMA 3LC7O 3CBGA 3C41J 4PZZA 3V7WA 2F3PA 4RFLA 1XV5A 4JN6B 4DE5A 1KMCA 2R6AA 3AY6A 2AHRA 4ZO6A 5B1EA 3WGGA 4DR3B 2QX9A 3N59A 4R1MA 3WJ2A 2EERA 4NS4A 1JEQA 1CUVA 1XMSA 1PD0A 3PLNA 1CQJB 4M0PA 3W34A 4BNTA 2GFIA 1NW5A 1P29A 3QX7A 4I46A 5EI5A 4CE6A 2ZYRA 3WAGA 4BEJA 3PEWA 3ITEA 5L3VA 3HJNA 1RQRA 2BEKA