4YACA

Crystal structure of ligo in complex with nadh from sphingobium sp. strain syk-6
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
295
structure length
270
Chain Sequence
b'MQDLEGKVAFVTGGGSGVALGQAKVLAEEAQMKVVIADIRQDHLDEAMGYFSQKNVAVHPVRLDLTDRAAYAAAVDEAEQVFGPVDLLCNTAGVSQFGPIEKATFDDWDWQMDVNVNGVINGVMTVMPRMIERGQGGHILITASMSAFVALPTTGIYCTTKYAVRGLAESLRVEMPKYNIGVSLLCPGGEAVFAGLKRVIEHGFDPVDLGRVVLDAVRNDRFWVLPYPEFAEGQKARDQEVIDAMMSYADHPDYARRMKIREQMKRDMPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C alpha-dehydrogenase
publication title Structural and Biochemical Characterization of the Early and Late Enzymes in the Lignin beta-Aryl Ether Cleavage Pathway from Sphingobium sp. SYK-6.
pubmed doi rcsb
source organism Sphingobium sp. syk-6
molecule tags Oxidoreductase
total genus 100
structure length 270
sequence length 295
ec nomenclature
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4yacA01
4IZIA 3LC2O 1BW9B 1IHXA 1MXHA 4DYVA 4J1NA 4R1SA 1HLPA 2EGGA 2UDPA 2Q1UA 2CUKA 1PZGA 2OO5A 3GQVA 3BAZA 2NQ8A 3DHEA 3ZU4A 1E6EA 2D3TA 4JJIA 4GX2A 5T8KA 1AUPA 3BIOA 1V3VA 3LT1A 2CSUA 2RIRA 3GEMA 1EFLA 4IDCA 4OM8A 5EQFA 2JHFA 1GZ6A 5JAIA 2NVWA 1A5ZA 3G1TA 4A2CA 2JFGA 4L76A 2E82A 1SAYA 3W6UA 2PTGA 3HE3A 2UUPA 2QZ9A 2EF1A 2IODA 3GMSA 3ENNA 1P3DA 4QECA 1J4AA 4DGSA 3GZ4A 3GVPA 3MOIA 2X0NA 3AM4A 4CM4A 3PIIA 2DM6A 3OQBA 3ZWYA 1VKOA 4YRDA 1GYRA 2DFDA 3DONA 4DPLA 4BNIA 1UDCA 3KUXA 2VUSA 4L73A 3GPIA 4B3JA 4HUJA 1I3LA 4INAA 4AJNA 4BKRA 1RWBA 3Q6IA 4XJSA 1KYQA 5G0SA 2DPGA 3NGLA 3FCOA 3LLVA 4E2YA 5CDTA 1VSVA 1EBUA 1JU9A 4IGFA 3NDRA 2H6EA 4NK5A 3JTMA 2A92A 2ZTLA 1HE4A 4D41A 2VZ0A 2HMSA 4MJLA 4NBRA 1PZFA 2CFCA 5FYDA 5A06A 2Q4BA 4DQVA 3WBBA 1UXIA 4FJ1A 1OI7A 2FP4A 1UXHA 1X1EA 3ZWAA 3JSAA 3D5TA 2PK3A 2EERA 3NUGA 1FF9A 4BMNA 4TRJA 1P1JA 1O0SA 3WS7A 4R3WA 3AOEC 4XQ9A 4NJMA 4Y98A 1C0PA 3IS3A 2BGLA 2E6UX 3MWEB 5KNLA 2PA3A 1FK8A 1GL3A 3FF4A 5TGDA 3B1KA 4WJZA 2G17A 2X22A 2DT5A 1LLUA 1SEVA 1PU2A 4U0JA 1LNQA 3MCVA 1E5LA 2PWZA 2AA3A 3QA9A 4BMSA 1PJ2A 3GT0A 2NQTA 4XYMA 2O50A 2NVBA 1R37A 1Y8RA 1EQ2A 2ZJ1A 4HP8A 4QQRA 5THQA 4U6SA 3RC1A 3PDUA 3HN7A 4OSOA 5U4QA 4XRGA 4NDNE 2PY6A 2B5VA 2VHWA 4KOAA 3PLRA 2BGKA 2C0CA 2VYVD 3INGA 4J1QA 2W90A 1VE9A 4L4RA 4ZRNA 5AOVA 5KVSA 4R69A 1W4ZA 3E1KA 4DVJA 5B4VA 5IDQA 4L8VA 4WCDA 3M1AA 3ZNPA 1PX0A 1U3WA 1SNYA 4TVOA 1NTOA 3GZNB 3R6DA 4MP6A 1FDSA 5EESA 2BELA 2CVQA 3WTCA 1C3VA 3WLEA 2DU8A 4XRRA 4R41A 1UZLA 1T1RA 3E03A 4RDHA 3FR7A 1ZK0A 1D1TA 5I7EA 3ADPA 2O2SA 1HETA 5KWEA 3PEFA 3KSUA 3MJ4A 3H4VA 4II3A 3BHMA 2W98A 4C4OA 3DMYA 2CDBA 4J90A 2GUGA 5IDXA 3CMCO 4QFDA 3H2SA 1V35A 1DIAA 1LXCA 1N1EA 2NTNA 3EC7A 1GU7A 2AW5A 1LQUA 4NPCA 4ZJUA 2UV8A 3V1TC 2WYUA 2E48A 3CEAA 2I3GA 3STHA 3BA1A 1XQ1A 5DBGA 3B1FA 1VL8A 3WR5A 1ENZA 4BKPA 4DQXA 5A4DA 5B1YA 1EBFA 5CEJA 5TT1A 2YDXA 2V6FA 2BFOA 4YJFB 5A05A 1LUAA 4PRKA 4UREA 4FS3A 4B7CA 4NFHA 1UDAA 3H6KA 1NXQA 4XB2A 1ZJZA 4WCFB 1YL7A 1TB4A 1NPDA 4O5OA 3PLNA 1IHYA 2VNAA 5AXCA 4J2OA 1HDGO 2I67A 1LDBA 4FQ8A 5JCXA 1B15A 1LEHA 4AJKA 5JNLA 1H9BA 1KEVA 1LX6A 2CVZA 3OM9A 1HDYA 3QVXA 4UEJA 4W9NC 3UN1A 1BWSA 3X2EA 5BSHA 4DQUA 1AN9A 4NBVA 2O3TA 3DFZA 5ES3A 1XEAA 1HYHA 4YR9A 1U4SA 2Z1MA 1PGPA 4B7XA 1I10A 1KEWA 4KTTE 4DL9A 2WJPA 4OQYA 2VHZA 1Y9EA 1M2WA 3JQBC 4Z0TA 4RQUA 4BNGA 1Y5RA 1S6YA 4YWJA 2DKNA 2WM3A 4DC0A 3NJ8A 1E7SA 5GZ3A 2AMFA 1U1IA 2O7QA 3IIEA 3LT4A 4PCVA 3JD1A 5JDIA 3QSGA 1T2FA 1NM5A 2UAGA 2BH9A 4P22A 1FXSA 3NTOA 4H15A 4ZRMA 4GVXA 3ROMA 5JW6A 4ND3A 5I8ZA 2PD3A 4G5HA 3GZNA 4IDBA 2IZZA 3AK4A 5HRUA 3DBRB 3FTNA 4LN1A 4BV9A 3KYCA 3CZRA 4WLUA 1LLDA 2D59A 4FFNA 4PFJA 3PQEA 1DSSG 4TRNA 3I83A 1XWFA 4OL9A 4BGVA 4PLZA 3AFNA 4IDGA 2ZB4A 5F1KA 4CLHA 2AEMA 4UULA 3HB4X 1GADO 3S2IA 1ZJYA 3ROKA 3DZIA 3GLQA 4MVJA 1UXKA 3E9NA 4XIJA 1MC4A 3TZCA 4E5MA 2Q1TA 5KJ6A 2Z95A 1U2DA 4GBJA 3U49A 1I2CA 1PSDA 3HG7A 3I52A 1KVUA 1XU7A 4TRMA 4YJHB 2EG9A 3VZPA 4UUMA 1XHLA 3O8QB 3D5QA 2WE7A 3RROA 4PGFA 4A26A 2GRAA 5JY6A 2F00A 3FPCA 5A9SB 4DREA 5A5FA 4DBVO 2IEBA 3U4IA 4MKXA 1UP4A 4MKRA 3F5SA 5T67A 3ZV6A 4J0FA 1ONPA 1SOWA 2DBQA 3MWDB 5ENDA 4E5KA 4XX0A 4R9SA 5L95A 4YJFA 2EP5A 1IZ0A 4QSMA 3G17A 4J2HA 1ZK2A 4M54A 5CDSA 4YT8A 2BGMA 3BMQA 3HN2A 3L07A 3TOZA 3W6ZA 5L51A 1C0KA 4NIMA 1DPGA 1F06A 4B79A 5EJ2A 5ICMA 2XAAA 5L9AA 1DO8A 1KIFA 4FJ0A 3VPGA 3WBFA 4CMIB 1ZZEA 2CF6A 3CMMA 5IDYA 5DT9A 5I7FA 1U8XX 5L53A 3ZU2A 4TZKA 1P44A 2ZJ0A 2GN9A 5JPIA 1AXEA 1N7HA 1YH3A 2EP7A 4ILKA 4EUHA 5A1TA 3JD2A 4EEXA 4MVJP 3G3EA 5JO9A 4PLVA 2EKLA 2X23A 2NADA 2WEKA 1Z74A 5IN4A 4UVHA 3C8MA 4WGGA 3QV1A 3VHRA 4IJWA 3H65A 1PS8A 4CM5A 1YBVA 3NTQA 5BSEA 1PR9A 1UJMA 5IZCA 4IQGA 3D4PA 1N1GA 1Z6ZA 3GN1A 1LDYA 2QHXA 4GL4A 4BO1A 2C59A 4J49A 1HRDA 5FF9A 1E1LA 2QX7A 3AM5A 4GKBA 4YCAA 1R4NB 2DTEA 3NDIA 1JKFA 3FNHA 5G0WA 4XYLA 5A3VA 3N58A 1NVMB 4KZPA 5H82A 2PKRA 3W4JA 1NYTA 4J4HA 3WGQA 3GGGA 1DHRA 1B7GO 2IYPA 1BSVA 3RUFA 1I3KA 1OC4A 2CNBA 1LSOA 1LBEA 3PYXA 4ONEA 4BNTA 4O63O 4Z6KA 3GPDG 3V2UA 3QW2A 1SCUA 1A71A 2VZ8A 1BXGB 1W0CA 4IJUA 3V5NA 4ZQBA 1M66A 1T2DA 1NQAO 3JD0A 4U0KA 5DP1A 1J0XO 1E7YA 1BDBA 3H2ZA 3R1IA 4I08A 2PZJA 3O8QA 1H6AA 4M89A 3ZWMA 3VKVA 1LDGA 3GR6A 3WG9A 3VTZA 3NAQA 4ALJA 1TEHA 5CDGA 1O94A 2NTJA 3WX0A 2YV2A 5GY7A 1YDEA 3AUSA 3C85A 3UF0A 2B36A 3ROPA 1GR0A 1ZSVA 3AY6A 4E32A 3ITDA 3K92A 3PHHA 4GX0A 4MOWA 2EXXA 4BB5A 4RF4A 1LJ8A 1HLDA 1E3WB 3T4XA 5TQVA 4WE3A 1BHSA 2J5RA 1F17A 3OEYA 4CR7A 2GDZA 2VHYA 1Z7BA 4P4LA 3LF1A 2WTBA 5K6AC 2J5KA 3EY4A 4ALNA 5KJCA 4YA6A 2Y67A 1D4FA 1WZIA 4NH4A 4PLWA 1PIWA 1DRUA 1ISMA 1SZJG 1HSOA 1HE5A 4WKGA 2J3JA 5BT9A 5T6BA 3TZKA 3U9LA 5A9RA 1OFGA 4NBWA 2UYYA 4X54A 1KY4A 4CMIA 3P19A 2ZB3A 2J3KA 3NV9A 4PIVA 3W8FA 2EJWA 3FR8A 5T5QA 5I9LA 2C29D 2E4AA 1T1SA 1PJTA 4FGSA 4JLWA 4AFNA 4Y67A 4DPKA 3OIDA 3WGHA 1P1KA 3NJ4A 4FOSA 3RUAA 3I4CA 2EJVA 1LRKA 2BF7A 4FFPA 5CPFA 4GSKA 1R0KA 1W73A 1U4OA 1YE3A 3DAFA 4IM7A 4CUZA 1SBYA 2C54A 1G0OA 1MFPA 4L74A 4YT2A 3LDHA 3K2BA 2NUAA 4DA9A 1PJ4A 2X5KO 3ICCA 1TXGA 1HTBA 2BFPA 4B8ZA 5C7LO 3SJUA 1NFQA 3DB2A 4D3FA 1GCOA 4P8RA 4ZQFA 1DIRA 3V2HA 4L0QA 2FPGA 4AJIA 4FC7A 3ONDA 1UR5A 3AOEA 1PS9A 2V65A 3QWBA 4XYBA 1YOVB 3TJRA 5DDIP 1WDMA 4R51A 1ENOA 1BXGA 3TNLA 1KOLA 3RASA 3JQGB 3KEQA 3ONEA 1D8AA 3DO5A 4D0SA 1CERA 1GUFA 3LLSA 4CM9A 3TFQA 2ZB7A 2GO1A 1CRWG 1AXGA 2VCYA 3GFBA 1YB1A 3OETA 2FRDA 3GEGA 4IS3A 3RUEA 4JJGA 1YS4A 2BD0A 4YJDA 3RCBA 3UICA 3DTTA 4UUNA 2QIOA 5JSFA 4YACA 1EVIA 4BNNA 3O03A 3U4HA 2Q2QA 1ZH8A 4B3HA 4IINA 1PGNA 3JCZA 3L6OO 3ZN2A 1PJBA 1H2BA 3O26A 4BNLA 2Y1OA 4ND5A 4PG6A 3SVTA 4OIMA 1DB3A 2X4GA 3WFIA 1E3WA 4J9VA 2ZATA 2FPPA 4E30A 3AUAA 3L6EA 3Q1LA 1C1XB 2NACA 4RLSA 1BG6A 5IG2A 3WIEA 2EGHA 2PZLA 4D3DA 3AWDA 3H9JA 1HDCA 1RM4A 4S1VA 3KSDO 4TKLA 3UHAA 1H6CA 2QYSA 3DOOA 1YQDA 3FNGA 2QRKA 3DFUA 3ZU3A 5JFOA 1Q7CA 3DZKA 2ZYGA 3TSCA 1R4MA 5ILOA 2VYVA 3CSDA 4XEHA 3VH2A 4ALIA 3ZW8A 4YAGA 4UVGA 2QG4A 2AQKA 4NMHA 1KS9A 4BO0A 4R1TA 1QRRA 3CZMA 4NI5A 4KDEA 1WAMA 3Q11A 1VM6A 2RAFA 4J1TA 4K26A 3VH4A 5IN5A 1E6WA 3Q2KA 1PQUA 1VRWA 2UUOA 4NZ9A 1NASA 2C5EA 1GCUA 3W8DA 3GG9A 2F1KA 3RUCA 4Z0HO 3ZHYA 2Y0CA 3ENKA 4GAEA 4KMSA 2ZTUA 5JC1A 1SC6A 1BGVA 2JD0A 2VWQA 3D7LA 1HXHA 3PFWO 1MXFA 3HDYA 3AI3A 1AHIA 3L9XA 1J6UA 4E12A 2LDXA 3OJLA 4WK6A 2RH8A 4CLEA 1GFSA 1E7QA 3DZJA 5EMHA 3VZSA 1QV7A 3ZWBA 4E2WA 4QXMA 5FFFA 1F8GA 3VPSA 3MJVA 2IXBA 3A9WA 5F1OA 3IKVA 1YL6A 4TROA 2HMVA 1XQ6A 5HBRA 2RH4A 3TRIA 3QY9A 3I9NA 1JLLA 3L4BC 1U9JA 2PH3A 4H7PA 2DAPA 2X9GA 4MP3A 9LDTA 1BXZA 3BZUA 2DVMA 4RV9A 1XIVA 4YT4A 4U6QA 5GMOA 2Z1NA 2YV1A 3CH6A 4BKOA 1YOVA 1E0DA 1ZSYA 1PJQA 2FSVA 2GN4A 4U7WA 3JQGA 4W9NA 3ROQA 2WD8A 4DMMA 2Y1DA 5G4KB 3UFXA 3UOGA 1ADFA 2DQ4A 1BRMA 3T7CA 3VDRA 5F3RA 3JYQA 3CTMA 4R4JA 5J23A 3GRPA 1Y5MA 2I65A 2GNAA 1C1DB 3AY7A 3ITKA 4ZD6A 3D4NA 3JQBA 2Q2WA 5CEEA 1HZZA 4RPKA 3GGPA 3ZNQA 4YVFA 3D4OA 4J91A 4BO6A 5ITWA 5KVQA 3N7UA 4DMLA 2GN8A 2ZK7A 2JCYA 1O9BA 2BI8A 5TSDA 1DC6A 4CODB 4A0SA 4PZCA 4YXFA 1DFGA 4I5EA 3TWOA 4HFRA 3NEPX 3INRA 5KVCA 3WDSA 3FBGA 3F1LA 3KBOA 1C1XA 2DPHA 2X86A 1U5AA 4DPMA 1NHWA 4E31A 1I3NA 4JBGA 3G49A 4ITUA 2B69A 4OOEA 2GZ2A 4CV3A 1E92A 3IQDB 4XKJA 5L7WA 4MKZA 4XD2A 2YQ5A 2O7SA 3K73O 4O59O 2R6JA 3G0OA 1EEHA 2JJYA 4PLGA 4XDZA 3TQHA 3JYLA 3PJFA 2UVDA 1ZO8A 1YJ8A 5KVVA 3DMTC 4GQAA 4PVDA 3IKTA 4BB6A 3S55A 3I5MA 4N7RA 4ZQEA 4NBUA 3PJGA 4NFYA 1B8VA 7ADHA 1JTVA 2YHIB 1EE9A 4W7HA 4OH1A 1ZMOA 1U8FO 1WMBA 3BMOB 3C24A 4W99A 2J3HA 4K6CA 1NPYA 4LRTB 4M1QA 5C7OO 1XG5A 4LSMA 1H6BA 1IE3A 3C1TA 3U5TA 2EIHA 4K28A 2PD6A 3I3OA 1HZJA 1ULUA 4LVCA 1PQPA 4XGNA 4XQGA 1CWUA 5G0VA 4CL3A 3WJAA 4CMJA 4S3MA 1ZNQO 2PGJA 3DBLB 4XGIA 3RD5A 4Q3BA 4CMKA 4MVJE 3R3JA 4CM9D 1CYDA 1QYVA 1HT0A 1I0ZA 5EIOA 4I1IA 1EUDA 3B1JA 5KOIA 3RI3A 5L40A 2NV6A 5G4KA 3ZWXA 4BO5A 4YQZA 2W2LA 3RWBA 3HADA 4E5YA 1ZSNA 1AHHA 3FTPA 2DUUA 3L6DA 1C1DA 2NM0A 3WLFA 3DDNA 3EAGA 3A06A 4MVJM 4EEZA 2WSBA 3GY0A 4UEOA 1XLTA 3BXXA 3G79A 3EHEA 4RDIA 4DIFA 4J43A 3VPFA 2X0IA 4I9UA 3OICA 1RPNA 1K2WA 3B20A 2DFVA 3ZHBA 2IE0A 4MVJI 1DC5A 3GHHA 1BW9A 6ADHA 3QE3A 3S2GA 1Z75A 4W4TA 3RFTA 3PZBA 2GD1O 1Z73A 4E33A 2EWMA 1MA0A 4D7AA 2B4QA 1GPJA 4RORA 4EUEA 3UCEA 4CMGA 1DEHA 1P74A 2G82A 5A03A 4CPDA 4IMRA 3VZRA 1CDOA 3JYNA 4KTVE 2PNFA 4BIIA 3ASVA 5JO0A 3NKLA 2Y68A 3VPXA 1JAYA 3DR3A 3KYBA 1QYCA 5DBFA 3DZBA 1T2EA 5TLSA 2NTVA 3ON5A 4EYEA 1T24A 3OIFA 1YWGO 2OZPA 4IQ8A 3K2EA 1MLDA 1PGOA 2J8ZA 4TVBA 1ZK4A 3QVWA 5KTKA 5ADHA 1Q7BA 4YJGB 3VDQA 4IS2A 1MV8A 2VT3A 4PVCA 3WNQA 2HJRA 3RC9A 1PWXA 3BMOA 4YTEA 4BQRA 4OAQA 3V2GA 5JLAA 1GQ2A 3NRCA 1IPEA 3F46A 4ZVVA 1HDXA 2G1UA 3WGTA 1ADGA 4DLBA 1H9AA 1PR3A 5JDCC 3U4DA 4BNZA 4CLXA 2YV3A 4ND1A 4CQMD 5B12A 1FDVA 2OBNA 3D64A 1LSJA 1YXMA 1IZ9A 2EV9A 3DZFA 3LT2A 4RZIA 1NBOA 3VOSA 1U5CA 5COBA 3DBLA 1F14A 2C2YA 2EEZA 4IJKA 1TA4A 1XSEA 3HDHA 4UVDA 4IZHA 3ORFA 3ICPA 4IBOA 3IOYA 1E7MA 1RM3A 4CJXA 5BSFA 4J7XA 4N5MA 2C82A 4EI2A 3N74A 3WGIA 1LC0A 2C7VA 2VRCA 1WDKA 3TL3A 1S7CA 4ND2A 4EW6A 1JW9B 2V6GA 3PHIA 1TT5B 4CV1A 4R01A 1M75A 4XYEA 3JQFA 1NHGA 2FR1A 3ULKA 3EZYA 4MIOA 3ZW9A 3E82A 4MVJF 2I66A 3VVBA 2E49A 2AG8A 4BO3A 1LQTA 1PL7A 1EFKA 2BMAA 4OYRA 1P77A 4CMEC 2Y1GA 4F6CA 5JCJD 1TI7A 1DBVO 1R66A 2JAHA 4KDFA 2VHVA 4MPDA 1ZCJA 1SO8A 2NU9A 4A10A 1HYEA 3ZV5A 2JCVA 4AJ4A 1B3RA 2Q99A 2I3AA 4CR8A 1O89A 5MGBA 4OO3A 1NQTA 3QWIA 4Q9NA 3ANNA 3IMFA 4H3VA 4RPGA 5IFLA 2VZ9A 1DLIA 2FY8A 5C3MA 3I23A 4Q3CA 3S2EA 4AJ2A 2R00C 1QYXA 1QKIA 2PKQO 5CHEA 2G0TA 3UKOA 1MC5A 1ISGA 4NNJA 3F5QA 4PLPA 4PLCA 1JKIA 1ISHA 3PHLA 3AU8A 3OJFA 1YO6A 2EKPA 4IGEA 4W7IA 3QHAA 3KOUA 5AVOA 3LK7A 5AXAA 3OJOA 3WYEA 5TC4A 4I9NA 3Q3CA 1VI2A 3TPCA 3ZDFA 1Z7EA 5F21A 4G81A 3COSA 4A73A 1E3EA 4YJGA 4IXWA 5FWNA 3VKUA 2WDZA 2FN7A 4TQGA 1E77A 5HA5A 2Y99A 3KETA 1OMOA 1Y6JA 2VHXA 4L75A 4EBFA 3DBHB 2PFGA 2O4CA 3AM3A 1GQYA 1SOVA 1L1FA 5EERA 1I8TA 3WJ7A 3BTVA 3OP4A 3F6YA 3LC7O 4Z3DA 2FSSA 1KC3A 1O5IA 4FFRA 3RKRA 4RO0A 5ICSA 3CIFA 3JQAB 4LGVA 4J3FA 4XIYA 3CKYA 3PZRA 3VPHA 1Q0QA 1XA0A 4BNHA 4XWYA 1PZHA 1DAOA 1EDZA 3WFJA 8LDHA 1KEUA 2FZEA 3E8XA 4JGBA 1TLTA 2OGUA 4CLRB 1CF2O 5G2OA 1DIBA 2PKQP 3KZVA 4M55A 4XR4A 1Y8QB 3JQ9C 4HKTA 2ZQZA 3RUDA 2W2LD 4N5NA 4D42A 4OMUA 1UXJA 4JJFA 3QIVA 2D1YA 5JMPA 4WCFA 1YL5A 3BTUA 1PL6A 3GH3A 4HY3A 1N5DA 4RJTA 4RF2A 5JBIA 4PZEA 3TZQA 1NFRA 3H9GA 5JYEA 1TT5A 1D7OA 2AG5A 1KVTA 3A28A 3AW9A 3ETEA 3JQ8B 1LDMA 4HNGA 4FD3A 2C20A 2NNLD 3GVXA 4RF5A 3HJAA 5KJEA 5T64A 4F45A 4U5QA 4CLDA 3OECA 3GVCA 4FSHA 1E1NA 1HDOA 2J6IA 3GG2A 4GWGA 4WUVA 3UVEA 4NFSA 1B3BA 2P2SA 2NLOA 3RC2A 3PGXA 3I9LA 4DXHA 4OGWA 2C2XA 3B6ZA 2VYND 1ZK3A 2FOIA 1NP3A 1JA9A 1QLJA 5JAZA 1R6DA 5DULA 1EQUA 2GPTA 1LSUA 4HFMA 2IRWA 1M67A 1B2LA 1O95A 2PLAA 2ZYAA 3ETDA 1TT7A 1X7HA 4YRBA 1LSSA 5T57A 2Q1SA 2B35A 4E2XA 2H63A 3L4BA 4JIGA 4IDAA 2G5CA 3F1KA 1EUZA 4E5NA 3H3FA 4NU5A 1MP0A 4FCCA 3DBRA 3PXXA 1A7KA 3RFVA 4A7PA 5EL0A 1I36A 2IDZA 1KETA 2VRBA 1E3JA 2HLPA 4KUHA 4G65A 4GMFA 1MGOA 3BHJA 1XKQA 5CP8A 3DXFA 1DRWA 4EJ0A 1L7EA 1GAEO 3C3XA 3ZWCA 1R0SA 2X1HA 4WEOA 4AVYA 1EZ4A 1MFZA 1IB6A 3DBHA 5BSGA 4C7JA 2D0IA 3ZGYA 3UUWA 5BR7A 3UCXA 1FMCA 1ZK1A 3WQQA 1J5PA 1PJLA 4YJHA 3JQAA 2O48X 1ML3A 2ZCVA 2ILTA 4CQLB 3SLKA 4IDEA 1IOLA 1GUZA 4RZHA 1QLHA 5A9SA 3WGGA 4GLLA 3JQ6A 3KB6A 3T7EA 4BNXA 1NX6A 1P1IA 2GN6A 1XR3A 2D4AA 3HSKA 3BMCB 4XA8A 2DBRA 2FPIA 4OHUA 1NAIA 3K8ZA 1SEPA 3Q9UA 3RJ5A 4R5MA 4Y6RA 2VRCD 2Y66A 4D3SA 3ZWVA 1ZBQA 3PWKA 3ZI0A 3F47A 4DBZA 1HEUA 4GWKA 1PGJA 4BUCA 4J4BA 1I33A 1O6ZA 4IDDA 4DC1A 2D8AA 5IF3A 3KLMX 4FOOA 2Y0EA 4Q39A 4B4UA 2WD7B 3H9UA 1ENYA 1E6UA 4XB1A 1KEPA 4I5DA 1UXGA 5B4UA 1HSZA 3PQDA 3DMTA 4LVUA 3H9EO 1T25A 3I9KA 1C0IA 1P1FA 1A27A 3IP3A 1T4DA 5ER6A 2HUNA 3NX4A 3RBZA 2ET6A 2ZTVA 3SJ7A 3RFXA 3PIDA 4Z3KA 4ZGWA 3P2YA 2HCTA 2OMEA 4KWHA 4PN3A 1FJHA 2BLLA 4IIUA 2HK9A 1V8BA 3FWZA 3OMLA 5G4LA 3GVIA 1OBFO 3FNFA 1X13A 3WB9A 1ZIDA 4DYDA 3ST7A 2ZB8A 2A94A 4PRLA 4E13A 1XGKA 2Y1CA 4QO8A 2P9GA 2NVUB 4M8SA 2XOXA 3SC6A 3HFGA 5TS3A 1VSUA 1QXSA 4PLHA 1H93A 5CDYA 1GQQA 2HO5A 4Y6PA 3M1LA 1R4NA 2OL4A 5BNFA 2IXAA 3F9IA 2Y1FA 2O3QA 4D79A 4HFJA 3AY3A 3FN4A 4ALMA 2EHDA 1BVRA 1JAXA 3OFSA 3AUTA 5H83A 4FFLA 3SX2A 3WGOA 2H1SA 4RVFA 5DF1A 5MDHA 4FR5A 5FEUA 1IL0A 5DCYA 4CQMB 3PWZA 3FNEA 1U3UA 5JXWA 3QVSA 1TVEA 1WXDA 1WDLA 2X5JO 3RJ9A 3VVCA 3H5AA 1DFIA 2ZIZA 1DXYA 3IAHA 4ESOA 1VC2A 1XELA 3LT0A 3K30A 3ZV4A 2CMDA 4AICA 3EGOA 1I3MA 4LMPA 5GZ6A 4CQLA 4OOFA 3RIHA 2CF5A 3TF5A 1F8FA 4GX5A 3QWAA 1ISIA 2GYYA 3AI1A 5A9TA 4DTIA 2Q2VA 1ID1A 4YQYA 3WNVA 4HFNA 5BQFA 3BMCA 3O38A 4XQEA 4FFMA 5IZ4A 2WE8A 4YRAA 1HKUA 2J3IA 1DRVA 4FBGA 1ZUD1 2B5WA 4IUYA 4WEQA 4EGFA 1XU9A 4JP2A 1LI4A 2X9NA 3OJEA 4J6FA 3GN2A 2CDCA 4BNYA 5TRTA 4Y9DA 1HYGA 1GEGA 1Y1PA 3JD3A 3JQDA 3ANMA 4CMHA 1ZKMA 3DAGA 4GLOA 1B16A 3SBOA 1K3TA 1DAPA 3I6QA 5F5NA 4WNIA 4CUJA 1DC3A 1Z45A 4YAIA 3DTYA 2IZ1A 4W82A 2WD7A 4RVGA 3NT4A 4LW8A 4LCEA 3JD4A 3Q0EA 3EYWA 3P7MA 2V7PA 1ORRA 4CM8B 4DUPA 2AE1A 2H9IA 2VT2A 4I5FA 3MJCA 4PG8A 1GV0A 3LSYA 4BOYA 2DLDA 2O3JA 5TF4A 4BNMA 1MG0A 2P4HX 1KY5A 4NJOA 3JQCA 2YY7A 4HV4A 2PR2A 1IY8A 2HRZA 3DZGA 5FI5A 1A9YA 4JK3A 4XJTA 2HKIA 4WOJA 5K9ZA 1M6WA 2JD1A 3S8MA 1ISFA 4B8WA 1LTHR 3OJ0A 2P9EA 3CPSA 3BYZA 5ENVA 2CVOA 4BL5A 3K9QO 4GMGA 3OEWA 4BV8A 3ZCXA 2QZZA 3JV7A 3DQPA 1L7DA 2BKAA 3QP9A 2P91A 5C5IA 4GH5A 3DHYA 3GUCA 2TMDA 1B0AA 2I6TA 4N5LA 2HQ1A 2OP0A 4AJ1A 3PJEA 2FHSA 1PQWA 3GEDA 3PI7A 2X9VA 2XF8A 3PVZA 3RUIA 3PYMA 4RPLA 4C7KA 1KERA 3BTSA 3A1NA 5CPBA 4ID9A 1UH5A 4JXKA 2AQIA 1VKNA 4HNHA 1U7HA 1R12A 1KVRA 4CQMA 2JCXA 1G6KA 1PZEA 3JQAD 5L4LA 2WMDA 2Q1WA 4A03A 1B8PA 1KBZA 4DLLA 4CL8A 1VPDA 3GHYA 4AG3A 3RU9A 5DZSA 1X14A 3OBBA 4CMEA 4KUEA 3AUUA 4J4TA 4J7CA 4ALKA 3U09A 4ZA2A 3WMWA 4AJOA 4XZ3A 5IZCC 3GA0A 1VL6A 4QTZA 2PD4A 3PHGA 4LRSB 1W8DA 2B83A 4K9DA 2D2IA 4NG5A 3ZU5A 4B4VA 1YB4A 2PGDA 1A4IA 3DHNA 4DIOA 4CMAA 1O8CA 1PJSA 4Q3DA 3KSZO 2YW9A 3TZHA 1LU9A 3MTJA 4HXYA 2WYVA 1EVJA 3K5PA 9LDBA 5THKA 1N9GB 4D45A 3GGOA 1YBAA 4IMPA 3G1UA 1Y7TA 4JQCA 5JCJA 4DWVA 4QO7A 1HDZA 3H9QA 3AJRA 4FFOA 4R3NA 4XYGA 3VC7A 1OZAA 4LCJA 2NU8A 3WGZA 5ILGA 3ETGA 3GDOA 2A35A 3RVDA 4CMBA 1QORA 3C1OA 2DTDA 1VJ0A 3ADOA 4P38A 2R2GA 2XXJA 3K96A 4L4XA 5DCWA 3SLGA 3WWYA 4CM8A 2YFHA 1YQGA 3WIDA 3JQEA 5TT0A 3Q9NA 1E7RA 1ZVMA 4EZBA 1QR6A 2JFFA 3C7CB 4Z9YA 5B37A 2X6TA 3BTOA 3IDSA 4BGEA 2PZMA 4ZHSA 1B14A 1T4BA 3GC6A 1EUCA 2QRLA 1YGYA 3PYLA 4QEDA 2HMUA 4GGOA 2I5PO 3V8BA 1BVUA 5KJFA 3PJDA 1MX3A 3PWSA 4ZQGA 3KTDA 3NTRA 3GMDA 1JN0A 2JKVA 3B70A 3ZWOA 1E1KA 4WLNA 1WVGA 1K0UA 4NQZA 4Q3AA 3X2FA 1A4UA 2Y1EA 4MIYA 2W8ZA 4CM3A 4PG5A 3GDFA 3W1VA 3HWRA 3JQ9A 4PG7A 3WSVA 2G76A 4O6VA 5DBIA 3K31A 1X1TA 4YAEA 2AQ8A 3DZHA 3FPLA 1E3IA 4JX8A 4BNFA 1NR1A 1QP8A 1Q0LA 3EZLA 1JQBA 5AXDA 1E5QA 4WLFA 5IJZA 3WTBA 1AE1A 1MB4A 3OQ1A 4Z9FA 1I24A 2X7HA 4R1UA 3HDQA 1UAYA 3C7AA 3MJTA 1K6XA 2Y0DA 4ZU3A 1P1HA 5L7YA 2OHXA 1ARZA 3IC5A 4RCVA 4O0LA 4DLAA 3OF2A 1QMGA 3HUDA 5LDGA 1G1AA 2P5YA 2QW8A 1P33A 1FDWA 3NGXA 4I8XA 2D5CA 2BI7A 4FN4A 1V3TA 2NWQA 2GLXA 4YAKA 3RUHA 1BTOA 4JN6B 1IULA 5EINA 5DCUA 1PTJA 5TJHA 1C14A 2Q45A 3HNPA 4LSWA 3KV3O 4BS9A 3M2TA 1E3LA 4UEKA 3I4FA 4RLHA 5U9CA 2I99A 1QYDA 4F3YA 1N9GA 1Q0HA 3AI2A 1U7TA 4Y6SA 3JQ7B 4TZTA 2C07A 4IIVA 4E6PA 1A9ZA 5F5LA 1GTMA 2P68A 1FDTA 2GGSA 2GZ3A 3KHUA 1T2AA 2VYNA 4CLOB 3IUSA 1QV6A 2RHCA 2RHRA 3L0DA 5AXBA 1VJTA 3ZNNA 4GPD1 2C5AA 3A4VA 3CINA 2PGLA 5JYDA 2P4QA 5DOZA 5DNAA 4MO2A 5B4TA 4TWRA 4AJPA 3TFOA 5HS4A 1IYZA 2BRUA 1NWHA 4RVSA 5COAA 4LK3A 4OKIA 5CG1A 1GEEA 3I9JA 3TOXA 1YBMA 5CEFA 2YYYA 4R9RA 3HQ4O 1XYGA 2YZ7A 1I2BA 5KCZA 2CD9A 4L9RA 3ZNOA 2AEFA 4BGIA 3ZHZA 3Q2IA 4AJLA 4CM1A 3IJPA 5L4NA 4YB8A 4J16A 5I8WA 2YHIA 3E5RA 3W8EA 3K6JA 3KYCB 3EVTA 1DHTA 2JL1A 5I7VA 2ZQYA 4WECA 3GRKA 1N92A 3E5MA 1NWCA 4RVDA 5JS6A 4KP7A 4II2A 3OA2A 4IDFA 3IUPA 4MVJG 3I9MA 3LF2A 4UAGA 1SPXA 3D3EA 3AFMA 2I76A 3F3SA 4L4SA 1X15A 1ZW1A 2Q4EA 1W6UA 1YJQA 4OKNA 3OH8A 4CR6A 1U3TA 2QQ5A 3E9MA 4KWIA 1I32A 1ONOA 5K6AA 4FDAA 4BQPA 3QVTA 3C7DB 4MP8A 2VTDA 3PP8A 3QLJA 3WOHA 1Y81A 5JAQA 4FW8A 4R16A 5KIAA 4TSKA 1CQJA 1JKJA 1DOHA 1HE2A 2HMTA 1LC3A 5IXYA 4YDRA 2BFMA 2POQX 3RSHA 3LZ6A 4BHTA 1SB8A 2GF2A 3WICA 4E4YA 3DWFA 2HK8A 2JHGA 1OOEA 1BDMA 3DOCA 3OIGA 1Y9AA 2NU7A 1KVSA 1A7AA 4BO4A 2LDBA 1NPTO 3MZ0A 2A4KA 2GR9A 5AYVA 3HB5X 1C0LA 3RC7A 1P45A 3SEFA 1P0FA 3MTGA 3BMQB 4GX1A 1LRLA 2O4UX 2W2KB 3JQ7A 3CXRA 2CZCA 3WQRA 1UZNA 1H2HA 1E7WA 4BKUA 3IP1A 1U28A 2YQ4A 3VAZA 3L77A 3P2OA 3KVOA 1GYQA 1YDWA 2D5AA 4BNJA 4CLOA 1EK6A 4XQCA 2IYOA 4CM6A 1P1RA 3ZHXA 4A27A 4AJEA 4ZQHA 3VTFA 1UZMA 4FB5A 3ZWNA 2OOSA 1GZ4A 4BNKA 3FWNA 1GPDG 1DLJA 3EDMA 1LDNA 4M49A 2AHRA 3FBTA 3AU9A 1K89A 3QJ5A 1EDOA 4IPTA 4OXNA 1PGQA 1UP6A 5IAAA 2FWMX 1F12A 1WMAA 4DIBA 4OSPA 3RAJA 2WYWA 3IJRA 3NDJA 4BNWA 4OJNA 2V6BA 4ALLA 1AGNA 1V0JA 1A72A 3OHSX 4H16A 3PFFA 5EPOA 5K0ZA 1X7GA 2DTXA 1BXKA 5JMWA 4UVEA 4F46A 2YDYA 1H0KA 4BNVA 5ER9A 2OXIA 2JD2A 5T8KC 4D0RA 3UW3A 4NHEA 4CM7A 5JC8A 1U3VA 1YQXA 3EK2A 1IPFA 3DAPA 3KO8A 4RF3A 4RPJA 4Y8VA 3M2PA 3LVFO 1HDRA 1VL0A 4ROSA 2QRJA 1I5RA 2Y05A 4N54A 3UAGA 1NQ5A 1QG6A 4PLYA 1KC1A 2O2YA 2AQHA 3H5NA 2RCYA 3LQFA 4YBZA 5EN4A 2FZWA 4UVIA 1VJ1A 2GASA 2E37A 4RPHA 1ADCA 4CMCA 3IL2A 2VTEA 3DEYX 1B8UA 3QQPA 4FIZA 2OFPA 3T4EA 3ABIA 4O1MA 4WLOA 5HS6A 4EJMA 2X5OA 5DOVA 4IY1A 5TIIA 3NYWA 1EVZA 3EMKA 1ULSA 1JDJA 1DIGA 3KEOA 3ZZNA 4JBHA 4YYZA 4N18A 4B4WA 5AQ1A 5COQA 3GOHA 1IUKA 1PEDA 2HJSA 4AL4A 2ZKLA 3U3XA 3NT5A 3ZH2A 5LDHA 1CEQA 5L45A 1V3UA 1YONA 5JAMA 4AJJA 2ZYDA 3M6IA 3SC4A 3S2FA 1X0XA 3RU7A 1LLQA 2W2KA 2VNSA 4FJ2A 3RBVA 3CE6A 1WNTA 3ASUA 3D0OA 1DC4A 5A5EA 1NFFA 1Z82A 2H5LA 2X58A 4TMFA 2VWHA 1Q1NA 2DBZA 1R16A 1H94A 1R0LA 3DBVO 3MJEA 4J7UA 3JYPA 2B37A 1WP4A 3WYCA 1ZXLA 2NSDA 4AJHA 4BO8A 3E48A 4NBTA 1UAGA 2OUIA 4XCVA 3DL2A 4R1NA 5IDWA 2YUTA 2CY0A 1ZFNA 3WGYA 2YFQA 1FDUA 3L4SO 3U62A 1CETA 4YPOA 2VUUA 1PL8A 2EW8A 3S1LA 3ZWPA 1WW8A 3GDGA 1RYEA 5CFZA 1RJWA 4PG4A 1ISJA 3PGJA 4QX6A 4XR9A 2AXQA 3TDKA 5I9MA 3MEQA 3R0IA 4XDYA 2EW2A 4BMVA 1NNUA 2Q3EA 5TNXA 3UCFA 1HL3A 5CDUA 1P31A 1CJCA 4PLFA 4J1SA 4WNCA 2XPCA 4M86A 1Q7GA 3GAZA 2IZ0A 1EE2A 5KJ1A 3O9ZA 4BNUA 2P9CA 4CLRA 4BGUA 4RVUA 1ZEMA 3ANLA 4I5GA 1Y8QA 3H3JA 2X0RA 4E2ZA 5GZ1A 1T2CA 1D3AA 3UGKA 3H7AA 1ZEJA 2O3UA 1JWBB 1X7DA 4Q3NA 1G0NA 5A02A 3NT2A 4FPXA 3RBXA 4GSLA 2JFHA 3VH1A 5G0UA 3ZV3A 3EUWA 1JVSA 1K6JA 3MJSA 3MOGA 1HWYA 1OC2A 2AEJA 8ADHA 1B26A 2BHLA 4EDFA 2GCGA 2O3RA 5HTOA 1MUUA 1N7GA 3JQ8A 3KLPX 4QT0A 1RKXA 1ZXBA 1V6AA 1GYPA 2B0JA 2B4RO 2PH5A 3WSWA 1V9LA 2OP1A 3WMXA 4CV2A 3GK3A 2Q46A 1K6IA 1NVGA 4ND4A 3U4CA 4EJ6A 1BMDA 1PJ3A 1I30A 1HF3A 5BNTA 3WYBA 2VWPA 1UP7A 4BO7A 2WWRA 5F1PA 5FI3A 2X8LA 2DUWA 1GZ3A 2SCUA 1ONNA 2HRBA 3WXBA 5A04A 2VOEA 3D3WB 1R4MB 2O23A 3VZQA 2BFAA 3C1AA 4K1LA 3I6IA 1GUYA 5JE8A 2FR0A 1N8KA 5G0TA 3QRWA 1OAAA 4A5OA 2VQ3A 3V1UA 4J0EA 2IEDA 3JQFC 3QWFA 3I9OA 4R5HA 2OORA 3EVNA 4HWKA 3BHIA 4UUPA 1WZEA 4U8GA 3KYDB 2HMWA 3W4IA 2Q50A 5JY1A 3D1LA 5L7TA 2YHUA 1N2SA 3TZ6A 1XCBA 2NU6A 1KVQA 2DC1A 5KKAA 4D43A 1P9LA 1VLLA 1X0VA 2I9PA 4EUFA 3BMNB 5I9NA 1M76A 4NK4A 4W6ZA 3PPIA 4JCOA 2HDHA 2OBYA 5EQDA 1WLYA 4FGWA 5JDIC 4M87A 4JP3A 1H6DA 3TN7A 1LA2A 2GZ1A 3GF4A 3H5RA 3LU1A 4OQZA 5TJ9A 4MVJD 1GD1O 4PLTA 4R54A 4YEDA 3GFGA 4ZN6A 4Z0PA 4RL6A 1I2ZA 3F4BA 4MIEA 4MVJH 4LISA 2VWGA 4QUKA 3OA0A 4YT5A 5I7SA 3GUYA 1LLCA 1EVYA 2AE2A 2HSDA 3HFSA 1PJCA 2Q49A 3R3SA 4K6FA 4TRRA 4XGKA 1NQOA 2XXBA 3TL2A 4WLEA 5H81A 1YKFA 3SXPA 1MG5A 3ONFA 1P0CA 4PZDA 1GY8A 4BKQA 2GERA 5DN9A 5LC1A 1DFHA 2B4TO 3DC2A 2PZKA 3INTA 1YRLA 2FMUA 1QYWA 4KUGA 4BO9A 5C37A 3FD8A 4GGPA 3GNSA 4OXYA 2DBVO 3KXDA 4RGBA 1E1MA 1I01A 4P4GA 4Z9XA 3FRJA 3GNTA 3UXYA 5KKCA 4R68A 4QFCA 3P5SA 1NVTA 4IXTA 1PWZA 1E3SA 3JYOA 1WWKA 4E5PA 2C7GA 1EMDA 1DDOA 2O3SA 4LMRA 4WPGA 3D3WA 4WLVA 1Q2XA 2P5UA 1YVEI 4OXKA 3PQFA 5JDCA 5L4SA 1UUFA 2Y93A 3KRTA 2Z5LA 3HZZA 4GVLA 4WCFC 4RQTA 4NR0A 4B4OA 2NVUA 4MINA 3GAFA 2VUTA 3HHPA 1ENPA 3QVOA 4G2NA 1HE3A 4E0BA 4NU6A 5DP2A 5BNIA 4B3IA 3AOGA 1RM0A 3F4LA 4UUOA 3PK0A 4CUKA 2EKQA 1T26A 3QWHA 5HWSA 1R15A 4B7UA 3HDJA 2J5QA 4D44A 2W4QA 3EW7A 1RYDA 5A3JA 3KYDA 3PTZA 1GV1A 4CM4B 1QSGA 1DJQA 4URFA 4GI2A 3OSUA 2VN8A 5CAEA 2HAEA 2CDAA 1NR7A 4BO2A 4E3ZA 4TKMA 3CUKA 1H5QA 3DOJA 4YAJA 5LCXA 4EITA 4IQ0A 3L9WA 4ZICA 1JWAB 2V6MA 4GKVA 7MDHA 3BMNA 1U2GA 1NAHA 4I9HA 1ZMTA 5ITVA 3LYLA 3FHLA 1ADBA 1YB5A 3WWZA 4IJVA 5IXSA 3PDJA 5TX7A 5C7IO 5HM8A 3RQSA 3I1JA 1CIVA 2HK7A 3V1YA 2JAPA 4Q3EA 3W4KA 1LDEA 1DIHA 1PS0A 3GVHA 3KM0A 1JVBA 1F0YA 4CV0A 4JROA 4HADA 1CQIA 2A9FA 2HU2A 2GSDA 2R00A 3PRJA 3RKUA 3VH3A 4JNKA 4E21A 2PV7A 1SMKA 3U0BA 4KQXA 4P4NA 4WOKA 3FSRA 1K5HA 1XDWA 4D46A 2ZTMA 4WASA 1GDHA 4NJMB 3O4RA 5CG2A 2X0JA 1M6HA 4DRYA 2YJZA 1RM5A 1DJNA 2VOJA 4JBIA 4RVHA 3ZWWA 2ZCUA 2FR8A 4MDHA 4HBGA 3WQSB 1J49A 4HX5A 4BVAA 3GNQA 3E6AA 2QYTA 6LDHA 2TMGA 3OQ6A 4KQWA 5L3ZA 4FC6A 3PHJA 1UDBA 1EK5A 3E18A 2RBEA 3LC1O 1D1SA 1LRJA 1WPQA 3E9QA 1SB9A 5U1PA 3FI9A 3H8VA 4J9UE 3UH1A 4F6LA 3A14A 1Y8RB
chains in the Genus database with same CATH superfamily
4YFYA 1QH8B 1BW9B 2WW8A 1MXHA 4FFWA 1FFCA 4WXEA 4QHSA 5IJWA 2NQ2C 1JEEA 1HLPA 5BV1A 4OHYA 3R6GA 2UDPA 4RM3A 2Q1UA 3PGLA 3G02A 1PZGA 1WPRA 1GRQA 2Y6UA 1C9JA 1HOTA 1RZVA 2IQIA 1OXTA 1YU9A 1USIA 2P79A 3SWWA 2MIIA 3BAZA 3OQIB 3UW1A 1JR2A 2NQ8A 4Q0MA 1E6EA 4OJKA 5T8KA 3BIWA 4K88A 1V3VA 3KDAA 1TO1E 5LMCA 3P9YA 3GEMA 4IDCA 1EFLA 2MJLA 1B1CA 5EQFA 3K6KA 4NQRA 2OSVA 4F5WA 1JIJA 2IYTA 3LGSA 2PEZA 1R8JA 1YVUA 1A5ZA 5CLQA 2IA5A 3V1MA 2UYQA 3LCVB 1OV4A 2JFGA 4I6EA 4A2CA 1HG1A 5E6SB 1UIMA 3X1WA 2Z9BA 4A0FA 4DV2B 3L5KA 5A4FS 3VC1A 1KI6A 2PTGA 2UUPA 2QZ9A 1L5RA 4AXBA 5HJ2A 1S5PA 3VTAA 3OE1A 4KITB 3N2GB 5BXYA 1J4AA 2RHGB 1ANKA 3GVPA 5LMNB 4DW8A 3KT0A 3W2GA 4X90A 3RNLA 1DG1G 1SC4A 5LL6P 4ZO6A 1KMHA 5EE1A 4AKIA 2DM6A 1E9BA 3FVRA 3HH8A 3ITNA 1QKJA 3OQBA 4MDYA 1VKOA 4YRDA 1GYRA 3VHXB 1PHPA 2Q3JA 4DPLA 2A33A 3ILHA 1ZVKA 4BNIA 1SKUA 3H2GA 1L1RA 2QBYA 2WAAA 3C2QA 1VXRA 5JMTA 3GPLA 5IVHA 1WSAA 4P5DA 3TYXA 4B3JA 1NOJA 2A4MA 2F8LA 2HZBA 4AJNA 1ADJA 2AT1A 2JIOA 3KXKA 3ZGNA 2O5CA 1Z2PX 1P5JA 4WKOA 4R8MA 3CNNA 5TF0A 3B1WA 1NSTA 3A4NA 1JFRA 4R1PA 2V0GA 2O2CA 4O08A 3FHOA 5CDTA 1VSVA 2FQQA 2CUNA 3EJWA 4IGFA 1JALA 3PC7A 4MUKA 1AZSC 3GFSA 3NDRA 5K4AA 5JBNA 2H6EA 3RYCA 1XNRB 4NK5A 3M4ZA 2HWWA 1OE0A 1UF9A 4LKRA 2WM8A 3RO7A 3T4PA 4BB0A 1UMCA 2ZTLA 2D6FA 1ZD3A 2VZ0A 3F7OA 2ZSUA 4IIGA 2JGFA 1TL7C 2OHJA 2WJGA 3FRIA 5K8CA 2YWJA 5FUXA 2RHDA 1T2UA 4HEA1 2Q7OE 2MTBA 1NQUA 1UXIA 2OAGA 4KIFA 3WBBA 1UQTA 1XXHB 1OI7A 4ZAYA 1UXHA 3PX3A 3U44A 1ZGBA 1DAGA 1VLHA 1VHTA 2HCFA 4RFSB 5H0IA 1FF9A 3PXAA 4CKWA 1W30A 4BMNA 1XNHA 4WCVA 5AVSA 2O05A 3PCTA 2SNIE 3G9ZA 3S2YA 3WS7A 4R3WA 3SE0A 4G0VA 2H29A 2C98A 4C88A 1E99A 3Q3JB 1V3QE 3DF7A 4M88A 3SYRA 4LS3A 4FT2A 4JX9A 4KPEC 4CEHB 3B1KA 1PQ4A 3CN7A 1G7SA 2VP3A 1Y6FA 5IUKC 1LI5A 4JL8A 1VQ1A 3BFVA 4WOPA 4IDHA 4KB5A 3RS8A 3U3OA 4L5BA 2Y2UA 3VR6A 1NKSA 3LX5A 1E5LA 2PWZA 2AA3A 3MGBA 4KE6A 1XVAA 3KD2A 4BMSA 5AMXA 1TUEA 1D5WA 2O50A 1R37A 3B2NA 4ENVA 4QQRA 3RC1A 3HN7A 4MYHA 4OSOA 2UUCB 3SIWA 1BHJA 3N87A 1UJNA 4RK7A 4DJTA 5KYKA 3INGA 5FWDA 4E7PA 2AJDA 4C4XA 1N3IA 1VE9A 1V6CA 2QVZX 1N5RA 4ZRNA 1W4ZA 3DOIA 3E1KA 4N7MA 5B4VA 4D25A 1JQ3A 3ZNPA 3V32A 1NI5A 1XHEA 4TVOA 4ZCRA 3MRVA 1X8KA 4MR7A 2UUAB 1T5DX 2CVQA 3BMXA 4QG7A 1KI1A 3WTCA 1HE8B 4NOJA 1VBNA 5J59A 1M83A 2FMTA 1UZLA 3M34A 3ZQJA 4RDHA 1V5EA 4ZPJA 2XB9A 1SU7A 1TZMA 2CXXA 1D1TA 4GVPA 9MHTA 3T4UA 3CH5A 2NPOA 2Y77A 3N6XA 1A9OA 1QGYA 3S7ZA 1DBQA 1HETA 3KOYA 3PEFA 1J70A 2AWOA 3HDGA 3KSUA 4N5HX 3H4VA 4Z1MA 2XTAA 4KX3A 2BISA 4QYWA 1L5NA 2OZEA 4LBWA 2V74B 2W98A 5CVUA 1J56A 1JIXA 2CDBA 1H8HD 5CM2Z 1NY6A 3UJAA 5GPBA 5K1ZA 2X6QA 4XE5A 4CI9A 3ERCA 3JXEA 4MWCA 2ZJ4A 1GP2A 2VJPA 3OU2A 5KTNA 5F9FA 1T2VA 4P31A 1WO8A 3UUGA 1DT3A 1LQUA 4AQYB 4XASA 3W04A 5I01A 1CY2A 1MABB 5H5JA 3OZFA 2WYUA 4OI1A 3V1TC 1XCMA 3PQ3A 1ZU5A 1YR2A 3CEAA 3ORRA 2I3GA 2R87A 3ANXA 4LJAA 3DDZX 2C99A 3L06A 1CUIA 3WWEA 2H2AA 4FZVA 3WWCA 3DCYA 4CCWA 5DBGA 3B3GA 2HDWA 3ME5A 5JASA 4ND6A 4DQXA 4Z51A 3KTAA 3V4OA 1JR4A 5CEJA 4PSUA 1M10A 3A11A 2WHPA 3S5UA 4YJFB 3A4YA 1V11B 1TW3A 4N3CA 4PRKA 1OB2A 4L5CA 2PYDA 3AVTA 4RETA 2YC4C 4JLUA 2WILA 1VPLA 4LCBA 3TKAA 1XRJA 1NXQA 4XB2A 3QNUA 3IR5A 3O95A 3PTAA 1SHUX 3EPKA 1NRWA 2WR8A 4O5OA 5EXPA 2AOTB 4C2TA 2COEA 1C29B 2BFBA 1IHYA 2WKWA 1CQZA 3T0IA 3ZVLA 1Z4KA 1IRXA 1F6WA 4K40A 4N0PA 2LRHA 1ZCAA 2IPAB 5AXCA 4ERXA 2XXAA 1PDOA 3LLCA 2I67A 4PSDA 4ZK6A 2GWRA 1CFJA 3R40A 2VK4A 2FMIA 2JEZA 2VA9A 2QTBA 4S35A 3U7QB 1F51E 4X1IB 5LLTA 3OM9A 1HDYA 3QVMA 2OBBA 1BWSA 2QY9A 2ZYHA 2O8EB 4B4DA 5CFPA 4C05A 7ABPA 1N5LA 5BSHA 2AFRA 2HH9A 2ZJ5A 3HY6A 4WCDA 4DQUA 2REBA 3GRFA 2J0UB 4A5SA 4D3YA 3QPVA 2AZDA 1BU5A 1XEAA 1FMLA 2ZSIA 1ZQ9A 3GLHE 3SGLA 4C0KA 4UTPA 1PGPA 3NTLA 4YR9A 2XI4A 1GGNA 3I8XA 3PPYA 4XSGA 5AHWA 4OQYA 3S27A 3DHWC 2J07A 3T0GA 4JAVC 3DMNA 1VMIA 2G36A 2UVPB 4DC0A 4WH0A 1VJDA 4Y6GB 5F3DA 5FL7A 5IKOA 5GZ3A 1D6SA 4L3OA 5JDIA 1CDEA 5MFPA 4RTNA 3DEHA 4F06A 4GL2A 2UAGA 1U2RA 1EK1A 3AETA 4P22A 4H15A 1E9AA 1W29A 2YUIA 3TD2A 5JW6A 3GP3A 2XUFA 2YS6A 3GZNA 4LZNA 1QQTA 3AF2A 1KO7A 3AK4A 4HAZA 2HXYA 4KNWA 4B34A 3R5KA 4W7SA 1Y3IA 4WLUA 3NUQA 3VGPA 2F43A 3TZEA 2A9JA 4DEYA 1YRWA 1BKSB 2HIGA 4EABA 1DSSG 2QF7A 1XWFA 2QW1A 4PLZA 3GEPA 3O8DA 4HMQA 1VDMA 2I1VB 2R47A 3HU3A 4NZMA 4UULA 4V2UA 1EXVA 3HB4X 1JZSA 1P7YA 1XMPA 3CBQA 3NHYA 2IIPA 1SXJA 1UXKA 3EUAA 4XIJA 5C31A 2F8SA 1MC4A 4FDTA 3E2PA 4JLNA 2Q1TA 4BUZA 3LQ4A 1M72A 5JI3E 1V8OA 4GBJA 5EP2A 5BY2A 1E2GA 3TQTA 1KVUA 2PT5A 2XUZA 3EAFA 1XV5A 2EG9A 3FPAA 4TRMA 1VP3A 4UUMA 3D5QA 3SJBA 3EXHA 1KYIA 4K03A 4PGFA 1Q83A 1UADA 2B6HA 3DZDA 3FPCA 2ISQA 4DREA 2FUKA 3KTOA 3SQLA 4HQRA 4QJIA 4BX3A 5KMGB 2F4VB 4MKRA 1BN7A 1XDUA 3C43A 2AMJA 3F5SA 3OKFA 4MKGA 4QZVA 4Q21A 1QP7A 2HK6A 3GX1A 3RAFC 2IU4A 3MWDB 4Q9AA 5ENDA 3ZVKA 2NYUA 4N8SA 4BCBA 1JF8A 4YUWA 5L95A 4TWJA 4ZT5A 4YRIA 3TG2A 1TPYA 3BWCA 1QKKA 4B6FA 4REQB 4WERA 2HHJA 1EM6A 2GPNA 3I6ZA 3G17A 3C6MA 1YIOA 3SQOA 5DMHA 5DI3A 1NKVA 4V24A 1K5DA 4K86A 3LDUA 5L51A 4ZOAA 2Q27A 3PDWA 4NIMA 1R6BX 3BRWA 4HX9A 1F06A 1DAMA 4ZYWA 2DFKB 2QUBA 4B79A 3OPYB 1G6OA 3HKCB 3VR6D 4TGLA 2IV2X 1KIFA 3THSA 3WBFA 1L4BA 5IDYA 2CXNA 2CJWB 4MQLA 4FHGA 5HX7A 3PEUA 3ZU2A 2WG1A 5AW0A 3TRKA 3N59A 5KPDA 5LLDA 2ZJ0A 2GN9A 4RD3A 4WN9A 1FJ2A 1J33A 4ILKA 2P7HA 5A1TA 2HA6A 3JD2A 4EA8A 3IJ5A 1TX4B 3UJ8A 5JO9A 1GGKA 4YDHB 4Q1FA 2EKLA 4O0MA 1KY3A 2V3VA 1LVUA 2QX6A 4KE8A 4NX2A 3V4PB 1FFSA 3EIUA 4RQBA 4EBBA 4UVHA 3U48A 3C8MA 3OE7D 1M1YB 3QV1A 4WGGA 4M0MA 4CM5A 2BHNA 1RT9A 1YBVA 4UHCA 1K8QA 1PR9A 4BBPA 5JSUA 1U1DA 2H51A 1A50B 1Z6ZA 2GEJA 4JQYA 4XM2A 2QHXA 4KYTA 4TV8F 3VR0A 2WTEA 1MO4A 2G9NA 2C59A 4BO1A 3AFGA 3MHPA 3Q4GA 1HRDA 4GC9A 4HDOB 1E1LA 2J9GA 3SHFA 4DABA 4EYKA 3AM5A 3OZUA 2HSJA 1XP8A 3NDIA 2DZDA 2IYSA 4L6AA 4WZAA 3T35A 4LOJA 5JLJA 3FNHA 1KH1A 4JKIA 5KI6A 3N58A 4ENTA 2ONCA 3W4JA 3CQ9A 5KYXB 2ZUCA 1NYTA 1QO0A 1S2LA 1F6DA 2IDJA 3HY4A 4IJQA 4UUAA 4AZ3B 2IYPA 1VJGA 3VNBA 4D2IA 4UPDA 1IM5A 2HADA 4HNRA 5BNWA 3NUZA 5F64A 1OC4A 1U6KA 2CNBA 1KKUA 1G8AA 1UBTS 3OWOA 1W35A 3V2UA 3IDZA 4WNAA 3WFZA 2JH3A 4IJUA 1BXGB 3D7KA 3TNYA 3HCPA 2C96A 1W5AA 1T2DA 3MIIA 5DP1A 1J0XO 3WKBA 4RVCA 3H2ZA 2V1UA 4AN4A 4RA6A 1HNXB 2PZJA 4KG7A 5EUMA 1KI9A 2YL2A 1H6AA 3I01A 3L7LA 4EI9A 1JQ5A 5GINE 1VKHA 2CYAA 1LDGA 3GR6A 3MT8A 1QM5A 3VTZA 3QMPA 5CDGA 3PEWA 1PAUA 2NTJA 1W0JA 1TQ8A 1TGVA 4F2DA 4OL0A 4EJ2A 3DYVA 3J7AC 1GR0A 4L4YA 4MDEA 2IEYA 5CT4A 4E32A 3BL6A 2FH5B 3H1EA 4LOKA 1R4ZA 1L4LA 5EXSA 1NP7A 2EXXA 2PV0A 3E9DA 4BB5A 5DN6D 5EHZA 5EJ8A 1LJ8A 1QG4A 1XTTA 1V26A 4R83A 4X66B 4HH1A 4EIWA 2G09A 1VMKA 4BVHA 4LPKA 2AZ4A 3IPXA 4HPJB 1BHSA 3HO1A 2WJZB 1GOTA 1KRXA 1F17A 1OIVA 3H2YA 1QBKC 2O8VA 3I30X 3IAEA 3ZTTA 1L8OA 1P7VA 2VHYA 4LNUB 5JNUA 5JPDA 2QQEA 3EG9B 5FI1B 1Q1AA 3EY4A 4ALNA 1E9CA 3EVEA 5KJCA 4YA6A 3BF8A 3AIIA 1J8VA 4YRPA 2ZI4A 3SDZA 5FFNA 1HSOA 4YS6A 5KNDD 5KINB 1YA4A 3U9LA 3TZKA 5JHGB 1STOA 3OT5A 4X54A 1IPHA 4Z5XA 2E87A 1KY4A 1ZN9A 3HL0A 1VIAA 2ZRQA 4CMIA 3H6GA 5EMMA 5AUPB 5BN3B 4CEIB 2WJHA 4BBZA 2E0IA 3D59A 1U0RA 5HK9A 5LQCA 3PC8C 4KFSA 2EU8A 2JS7A 3SS9X 3DYIA 3W8FA 3FR8A 3RYIA 4MDFA 4GKKB 2VAPA 5FL7D 1X38A 4Q9HA 4OSEA 2XMBA 1Z5OA 5HGJA 1C3OA 1TMKA 1D9ZA 2BHRA 3AGPA 4AFNA 1ZCZA 2BHSA 3L7KA 4DPKA 4EYOA 5HTKA 5JD5A 1P1KA 3CLSC 1C2YA 2IXFA 3ZDAA 2Z5VA 3I4CA 3P9QA 5IMBA 4HXFB 4LQCA 2EJVA 2GESA 2CL5A 2HSWA 2BF7A 2J0QA 4FFPA 3AESA 4IM7A 1YE3A 4JSYA 2K7FA 5ALFA 1QGZA 3R7FA 4KACA 4IH9A 2IYWA 4MS3B 3RVJA 1LV8A 4DA9A 121PA 2C9YA 2PFSA 2R4TA 2OBXA 4E88A 4JB0A 3B7GA 2WYOA 4JODA 1L1QA 2XYHA 1QQBA 2I6FA 2WT9A 1Z47A 2QJRA 2YFKA 1QS0A 2LZ0A 4FHZA 3KJHA 3GJ3A 4NENB 3HC7A 3OM1A 4D3FA 2TMYA 1H5NA 3MPOA 3TRJA 1TRKA 5I9TA 3T1VA 5K8IA 4LXQA 3BQNB 4L0QA 2FPGA 1Q74A 4AJIA 4BQIA 4BP1A 3D6TB 5E9WA 1N8TA 1GZ5A 4DZZA 5CLFA 4D56A 1E2FA 1SQ5A 1YOVB 2IBMA 3TJRA 4F84A 5JWOA 4R51A 3E9CA 1DMRA 3JQGB 4R31A 3KEQA 2GBCA 3ONEA 4F3RA 1PE0A 1OT3A 1T0HB 1D8AA 5K3SA 4YV2A 3D8UA 3CF0A 4RTKA 5JNSA 3CT6A 3AIKA 3TGWA 3K70C 2XWSA 5ALGA 4Y1EA 4A0HA 3UXMA 3THXA 2GO1A 3R5FA 1L3CA 1RADA 1WCXA 2ZYUX 3D02A 4ZT3A 4FCVA 2NMVA 3N8IA 2ROQA 4IO0A 5KWIA 3OD5A 4C01A 5L3QA 3IURA 5P21A 3KYJB 4CTOA 1FXUA 3BFKA 4UUNA 3EQ7A 4YACA 5JSFA 2JLVA 1EX6A 2XSZA 5G40A 3U4HA 3U80A 4L57A 2HHAA 3BBPA 4MXDA 3IR7A 5EI5A 4BRWA 1ZH8A 4Q05A 4GEGA 3JASA 3V7FA 1HLGA 1IEQA 1P4AA 1Q19A 2K2WA 3JCZA 1P2BA 1XCOA 4IIYA 5KQLA 4PR3A 4ECAA 1FX0A 4IGKA 1B6SA 4AG6A 4HDCA 4AO6A 2QTFA 1MB0A 2RHWA 2QTTA 5IWCA 2O2DA 3JRNA 4XPIB 5JYBA 4C0AC 2VJQA 2WU1A 4O4HB 4C7VA 1KAHA 2QYHA 3GUUA 4H2DA 4IEEA 3AUAA 1FYDA 4OK3A 4Q1BA 4RZUA 1J22A 3KR9A 1BG6A 3DW1X 3AWDA 4GXRA 4TKLA 1RM4A 4CG1A 1GCGA 1W49A 3DOOA 4OB8A 2F3QA 2QRKA 4BAGA 4DMFA 5JFOA 5LQMA 3GLGE 3C5VA 3VH2A 4LG1A 2HOQA 3MGCA 2QG4A 4KC0A 4NMHA 1KS9A 4Q34A 1KEEB 4NL4H 4BO0A 1V7ZA 2CB9A 4YCDA 1WAMA 3B6KA 3BXPA 1K9VF 5CB4B 4TUYB 5DWQA 1ULAA 1S96A 2GYVA 2H7VA 1D0IA 2OCPA 4R6XA 3AKDA 1VRWA 5DWDA 2OA0A 5IRCD 2BYTA 1UMDB 4D8VA 1GCUA 1AS3A 4JGGA 1FSFA 3GG9A 3W8DA 1S3GA 2F1KA 4EA9A 1QGUA 2R84A 1Y0BA 3ZX4A 2Z04A 4O8CA 1VG1A 2QLJA 3KCQA 3DEKA 4FU0A 4GAEA 2QMYA 1SC6A 3LWDA 1EFAA 3BXEA 2Q4OA 1AZTA 5MN5A 3B6MA 1YUMA 3AI3A 2VBFA 3L9XA 1J6UA 4E12A 5LP1A 1ZHFA 2LDXA 3EGWA 1TAGA 3E7WA 4CLEA 2WLSA 4EELA 3DZJA 4E2WA 4FE4A 1CNMA 4UD2A 5FFFA 3NRBA 3MJVA 1VHLA 4LJ9A 4TXLA 3LA6A 4X20B 1O95C 1NVAA 3VHQA 3GQBB 4BWVA 1XQ6A 5HBRA 5JR3A 3AG6A 3FFWA 4OMCA 4QUEA 3I9NA 5M04A 4P5EA 2XZLA 4OKSA 1LB1B 3HGMA 5HE8A 2DAPA 3GT4A 2WVJA 3X1DA 2B1GA 3HBLA 5FWXA 1CT9A 1I5OA 2LW7A 5GMOA 2BSQA 1AHNA 3ZJ5A 1EJBA 3CH6A 3V33A 1RRVA 5LBTA 2ECKA 2ICAA 1PJQA 1U9ZA 1FFBA 1I1OA 3ROQA 4U7WA 1EU1A 1RWKA 4IHQA 2XLBA 3KAQA 2AC7A 4X24A 4DMMA 4OREX 5G4KB 3UFXA 1A9SA 2ILVA 4YYEA 2P69A 1ADFA 1E61A 2DQ4A 2EJCA 4AK9A 3T7CA 1DEOA 4DTCA 2N1MA 3IAAA 4N01A 1TADA 2BE9A 4D74A 1YRQA 1F8YA 3AY7A 1AY0A 2FX5A 5DX8A 4DFDA 1AX9A 4I1RA 5FLYA 4X45A 3OCXA 4ZD6A 2PCJA 1PF7E 4C2UA 2KI5A 2Y6VA 3KEGA 4P7GA 1G19A 4KXWA 1E58A 2NUTB 4HVLA 2I3ZA 2BTQB 1AQLA 1RYZA 1ZD5A 4BO6A 4YJ2B 4X94A 3W06A 1YAJA 1AU9A 1WXWA 3CEHA 3OZSA 4KK3A 3IMKA 4DMLA 2YR0A 2ZK7A 1O9BA 4BJ5A 1DC6A 4CODB 4A0SA 4LDAA 3L8CA 4X91A 1TF7A 5F4BA 3LI2A 5C2JB 1X7YB 1DFGA 1C7FA 4I5EA 2NT3A 3UAYA 3NEPX 3INRA 5FV4A 3X1XA 3F1LA 4HUQA 4YCJA 5EJFA 1TYEB 1Z22A 2ZJAA 2GCEA 4MQUA 4TVKA 4BEBA 3S3TA 4ARVA 2B25A 2BUAA 4ZU6X 4DPMA 4AKHA 4PFQA 4L8GA 4E31A 4MVWA 4ZALA 4D5EA 1YJXA 2B69A 4U7HA 5EJAA 3K1AB 4IGAA 1UFVA 1RC1A 4ML3A 4P80A 4NMMA 3IQDB 1QFYA 2EJTA 2OE2A 1H3FA 1P80A 4Q18A 1N78A 1ZL0A 3K73O 4O59O 2BKEA 4A8PA 1K5GA 1QUFA 2HTEA 1EGQA 1BJKA 3ZOZA 3B6JA 4RXTA 2MYPA 4DM4A 5DJ5A 3L4JA 2G9ZA 1A4RA 2CLMB 3FA2A 1MZPA 1ZO8A 3FG9A 3N8HA 4HAYA 2DQYA 1G20A 3C3BA 1NZJA 3EGCA 3SHTA 2C2BA 3TW8A 4DZRA 2FF7A 1N36B 5D5HA 5BV0A 1M34A 5EWLB 4AP5A 3I2KA 3IKTA 3S55A 2B4AA 3AERB 4QPZA 1UC9A 3LZCA 4RY2A 2XT9A 3ZPXA 1E2UA 1YE5A 4RM2A 4ZQEA 5DYNA 5A3RA 1BJRE 4JHLA 2RC5A 1QUEA 1FZTA 3PV0A 4R3UC 5AJXA 3HHEA 3K0CC 2RHHA 1JTFA 3QBDA 1JMVA 2YHIB 5ETJA 2DY1A 3Q8LA 1ZMOA 1WTAA 1JEAA 3WSTA 3RC8A 2FOXA 2RKOA 2WB4A 1UBHS 4Z0NA 3RRFA 3CNLA 3H18A 4AC9A 5JJ5A 2A6PA 3NIWA 5ULLA 2JCBA 3HLYA 1J25A 4HK4A 3NWBA 1PNRA 1XG5A 4LSMA 4H1VA 2XT0A 3SM3A 3ZY3A 2R7LA 3WRVA 4MR9B 4K28A 2BWJA 2PD6A 4LVCA 4BY9E 5CLLA 5TEVA 4Q37A 4XQGA 2ZPTX 1H1LB 4ZT2A 2Q3MA 2PXCA 2GHRA 4MI9A 4IMJB 4XAQA 5AUNB 4OGKA 3D2AA 1CIPA 4CMKA 4ZVRA 4UQLA 1KI2A 2J59A 1AO0A 3SEQA 1FS6A 1G2OA 2YH2A 1TAHA 2DQZA 3CCFA 2VQSA 4Q01A 4WW0A 5JG7A 4FHCA 3ZKWB 1JT2A 4NDAA 4YRGA 1KEKA 5FBHA 5C46F 4HTFA 4BO5A 3Q6MA 3SIRA 2Z6UA 3DWGA 5DBEX 4U63A 2DUUA 1X1BA 1H66A 4YK7A 2ZE6A 3NQ41 2N0SA 2Q0XA 1XZBA 2A1TS 2C5LA 2IKQA 5KOJB 3ZDCA 5KEIA 3RS9A 3PNQA 4MYRA 1QIIA 4O4JB 1I6KA 3OTGA 3FLAA 3PE4A 3MPUA 1OTHA 2EZUA 3BXXA 3EHEA 1RWWA 3FUUA 1YOBA 4DIFA 5KOYA 3QYPA 1W47A 1UKAA 2CFRA 3OICA 3PL5A 2F1JA 5ADUS 4H4CA 4B6SA 7REQB 4GZ6A 4BMPB 1ABBA 3F74A 3MCZA 5C8YA 3OZIA 4MVJI 1QH8A 1BW9A 2ZRHA 1IVSA 1OWNA 3O8RA 3QE3A 1COZA 4JP5A 2WIJA 2JBAA 3CISA 4U02A 1XC7A 4YMWA 5AD1A 4LOHA 3BRCA 4EHNA 4D4GA 2E5LB 2XECA 2EWMA 4AF8A 1MA0A 3OQIA 2GAFA 4ZOBA 5CFQA 2WF7A 5KC8A 1TTQB 2QLTA 4RORA 3T5MA 3DQZA 4CMGA 1O2DA 3GWZA 2PX3A 1SELA 4KVFA 4AZSA 3EPJA 4IMRA 3QE2A 4I1PA 5SZJA 1SH7A 2XZOA 4KTVE 4NU8X 5ITZB 4BQNA 1NDQA 2PNFA 5JO0A 2Y68A 1JR3A 2DCMA 3CUSA 3THOA 5BYKA 3DR3A 3KYBA 4R2JA 2E55A 1ZESA 1QYCA 5DBFA 4UDNA 3FNRA 4OGGA 1BN6A 3IO5A 5AP9A 3IO3A 4DILA 1NW3A 1VG8A 3NTUA 4X5OA 5AK0A 1XTRA 2OZPA 2P4EA 3FMVA 2B2XA 1MLDA 4PPFA 4R2WA 4TN1A 1DJPA 1UBRS 4BN0A 5K01A 3AF5A 2FG6C 3O92A 5GONA 3VHXA 4DY6A 3THWB 4F85A 5LNK6 3EMVA 3A2NA 2R2AA 3R09A 4EDHA 4YUAA 4V0NA 1Q3KA 5FPHA 4TL7A 2VDPB 1OH8A 1SVUA 5C8XA 4G2TA 3BMOA 2QI9F 3BDAA 5DYGA 3A58B 1JDZA 1CNFA 2X3YA 4NULA 1U2ZA 3IELA 5DX1A 4ZVVA 3VYSB 4PIMA 1OASA 2HNAA 3Q3GE 5JDCC 4GT1A 4WIAA 1GJRA 5KNBH 1OLXB 3FTFA 4CQMD 4CDGA 1Z39A 2R6ZA 3Q0TA 3LXMA 2OBNA 4EMSA 1YXMA 4TLEA 2PUHA 2BGGA 4UDXX 3GLSA 1CP3A 1UKEA 4RZIA 1YVPA 1D6JA 1UWLA 3S2ZA 3RF7A 2C2YA 3HDHA 4IZHA 3ORFA 4IOMA 2OECA 2FLWA 1OLUA 2P0AA 6NULA 1XXHA 4M76B 4N5MA 1LC0A 2GEDA 2H7YA 2JKYA 3FZYA 1GN9A 5CVVA 4KHZA 3TL3A 4LXIA 1N32B 2DJIA 1BZYA 2QL9A 3F9CA 3BXOA 2IYQA 1M75A 4XYEA 4PQRA 1Z3CA 1QTNA 2GEVA 2FYTA 2ZXFA 3JQFA 3GEEA 3T7SA 3N5KA 2PJUA 2JLCA 3UJCA 1GPKA 3ZW9A 4B85A 4BC0A 5CA1B 1JAIA 4EPRA 1TGYA 3RIMA 3TINA 3LYAA 2E49A 2J1LA 3WLMA 4H7FA 1FP1D 2AG1A 3Q9SA 2Y1GA 4XIIA 4DJAA 1DBVO 1R66A 1W46A 2DSTA 3TKLA 2I9KA 2Y1WA 3AM1A 2VHVA 3CVXA 5F23A 1ZCJA 4Y0AA 3FXAA 5A2QA 1I2AA 5IVDA 2HYIC 3IT1A 3I01M 4L9AA 1R8YA 4OTZA 4G9EA 3ZV5A 1P5ZB 3WK7A 1G17A 1JMYA 3FMOB 4FDVA 4OO3A 3QWIA 1NURA 3AEXA 2QM0A 3PX2A 4BRSA 4TLCA 4D9MA 1P4GA 1S01A 2V97A 2FY8A 4J6EA 2YJ4A 4FYXA 3ZTWA 4BE7B 4I3FA 1DBPA 5FUVA 1GPYA 1L6IA 1DUVG 1JPVA 1SVMA 1TU0A 1YR7A 1NU6A 4GPZA 1X9IA 1CUUA 4EKYA 2OGZA 4ZC1A 1T6YA 3N0WA 3TJZA 5CHEA 1RWQA 1Z0FA 2G0TA 3U4MA 1WMEA 2Z2XA 4MROA 5D7BA 4PXYA 2C7OA 1NW5A 2DCUA 4Y1GA 2H1OA 4JEIA 4X1KB 1RIIA 1M2GA 1RYNA 2CZQA 2AUMA 2D13A 3B5EA 2BW0A 4W7IA 3QHAA 1FLAA 2AIRA 3ZR4B 4HXGA 1UBUS 4FGLA 2WIKA 4I1YA 4LECA 1CR6A 2L17A 2B2NA 3OJOA 3WYEA 1M7GA 4I9NA 3QEMB 4X41A 1ZBDA 3Q3CA 1VI2A 3B9PA 4I5IA 5A4IS 2AZTA 2GN1A 3FHCB 3ZDFA 4G81A 3COSA 2D7DA 4PSCA 2C58A 1UBNA 2A5GA 3EMDA 4YJGA 2UYOA 2OZLB 2I2DA 1YAHA 2WDZA 2V1XA 3R7WA 4UKDA 2EFJA 4IEIA 5KVAA 3L8ZA 3KETA 2AGVA 1SXIA 1ZYUA 1TCVA 2VHXA 3R5JA 4L75A 4HB4A 3ZCSA 3AM3A 3N7TA 2FFRA 3WJ7A 2NXWA 3BTVA 3B6IA 3DD1A 4QULA 5FDFA 1KC3A 3ETCA 1BXRA 3M6WA 3RKRA 4RO0A 3CIFA 3PTLA 5DW0A 4D4KA 4CHTA 2G0AA 2GDJA 1Q0QA 1P75A 4ANFA 3IERA 4XWYA 3UJHA 2GD0A 1N2ZA 2O57A 3LKBA 1DAOA 3E53A 4TKVB 5D3QA 1SXQA 3G5UA 1NBIA 3K6RA 3E8XA 5CNJA 2YXBA 3ZHCA 4F3NA 3AR3A 1SVWA 3LLMA 3MMXA 4I1SA 3WIVA 5AJZA 3KVVA 3KZVA 1E2HA 2P0YA 2WF9A 1O8BA 3OMWA 4PZ9A 2ZFUA 3ZZ1A 5CURA 3DVSX 4DBLE 3T3EA 5K4GA 4KGDA 3N0XA 3RVBA 1TE2A 1NXXA 2QA5A 4RXUA 1KO4A 1U99A 5ANRB 3HXKA 3C3AA 1M0EA 3QEKA 5H3CA 2VKQA 4K2AA 4FYVA 2Y4OA 3QF4B 3ZDXB 5K45A 3EEYA 3FWPA 1OB5A 2V7TA 4RF2A 3T5PA 1BKYA 2FGJA 2KSQA 3U6KA 4D97A 3TZQA 3EQZA 5JYEA 2ZU6A 1IN8A 3FHJA 4GC5A 5J4HA 3NFYA 1EK2A 1TVCA 1DQNA 2ZWIA 3JQ8B 2VF7A 5F2KA 3T1YB 1KO8A 4GU5A 4FD3A 2NNLD 4HLDA 4DXAA 4X1IA 2VP5A 2IHNA 5SYMA 5DLEA 2VDWB 3NIDB 4YX9A 4S2UA 2VP2A 1NT4A 2NOAA 4GWGA 2L0XA 2WICA 4ZOCA 4FONA 5LQRA 4NFSA 3R20A 4G8BA 1N2IA 3Q72A 1HQDA 3PGA1 3FWHA 2GJSA 4TWAA 1JQJC 2HRCA 3N2YA 4JJKA 3TECE 2VYND 3DMFA 1W4CA 2OKCA 4H6PA 4M7WA 4CIYA 1W4RA 4A0RA 4QHYA 2A1IA 2XQVA 4HBZA 5DULA 1EQUA 4AY2A 3ICEA 1IEXA 3HWX1 1XJQA 3VPDA 4UHHA 4NXMB 1WKBA 3JPYA 1OBVA 1O95A 2QD2A 3ETDA 3FKQA 2VJAA 1SG9A 2VJCA 1LSSA 1RKQA 3C39A 4GM1A 3G7SA 4HWSA 2Q1SA 3W5UA 4QTXA 4E2XA 3CLHA 3ZDZB 1JQEA 2YCBA 4JDUA 3H3FA 3ILXA 4J2TA 4REMA 1K88A 1MP0A 3PXXA 1E1QD 3H05A 4DGQA 3I76A 2R7AA 3KR0A 5K8JB 3RIXA 1KI8A 2H48A 5AI0A 4EO7A 5CDFA 1ZA1A 1E3JA 1L4HA 1WR8A 2KLHA 2FN3A 5DGCA 1DQYA 1E79A 3X43A 4AZVA 2F9MA 3BGVA 1JEYB 3BHJA 3TUIC 1DRWA 4BLTA 2XMCA 1OILA 1GAEO 1PR4A 4RABA 2HZ7A 3A4IA 4PYKA 4MV7A 2WVHA 5C1BA 3QTLA 1CZHA 1WX1A 4HB3A 4C7JA 5M34A 1JSZA 2D0IA 5BR7A 3UCXA 1ZK1A 4N0MA 1J5PA 1DC7A 1S3SA 4W9RA 4CIVA 3JQAA 1OFTA 3KJNA 5DW3A 1TJNA 2O48X 2PWBA 5LUAA 2Z2KA 1GUZA 3CNOA 1QLHA 3GELA 5CT5A 4EFMA 4ZOQI 3WGGA 4GLLA 5DTIA 3JQ6A 5KMGA 3H4TA 2PUAA 3M4XA 3DFIA 2GN6A 1XR3A 2OC4A 1DAFA 1SCKA 2FPIA 1T8UA 1KF0A 3MWDA 4OHUA 1F7VA 1NAIA 3U40A 1OH6A 1X1QA 1RAGA 1VLZA 3K0EA 4MQFA 2UKDA 3ZWVA 1XTUA 4L6CA 5KDDA 1HEUA 1P1BA 3JWJA 4FFBA 1PGJA 4REQA 4Z49A 1YS9A 4OX9Y 3M4NA 3N76A 4XM0A 1ABFA 1LQ2A 3VC3A 1Q1BA 1O6ZA 5HF6A 2UYHA 2D8AA 3BRQA 3RSOA 2G7MC 4KXUA 5PGMA 3EAQA 3BG5A 1A82A 4PNPA 5K0CA 3CLSD 3N86A 3E27A 2Y0EA 3OPYA 2PXAA 2WD7B 4LZOA 4Q39A 4B4UA 5A7FA 1OSNA 3CX8A 1UXGA 1Q84A 4OHOA 2C1ZA 2AI2A 5B6JA 4K9OA 5L3SB 4V1CI 1SD1A 3A6GA 3LP6A 2Y1LA 5IU6A 2QRZA 4AMBA 3MBOA 4GYYA 3BBLA 3EEFA 3GUHA 1XKTA 3IP3A 1Y48E 4LDNA 1NF8A 2ET6A 4UM9D 4CHGA 3L05A 2BZ0A 4Z3KA 2OHIA 1KMQA 1SUCA 3K0CA 5LNK1 1QVZA 1RKUA 2X13A 1FUEA 2BR5A 1U8AA 2HCTA 3JWGA 3EGXA 1FJHA 2BLLA 1V8BA 2WQ6A 3GVIA 2XW6A 4YJ3A 1QQ7A 2OUKA 1ODKA 3D0RA 4EGAA 5FBZA 3I3SR 3BDIA 3JWHA 5A5GA 1T0PA 3FRHA 2QRPA 4KODA 4ROTA 3KOWA 2Y1CA 2QG6A 3NFRA 2PX8A 2CLCX 3GWGA 4CF5A 3T61A 4QU9A 3MMNA 4UHJA 1NQWA 1SCJA 3MMZA 4KAJA 4UBNA 1TEZA 1IB0A 2IHVA 1VSUA 4PLHA 5IABA 1RJDA 3FVWA 2H18A 3JSXA 1NW9B 4Y6PA 3WL3A 5C9ZA 3ED5A 3K70D 3ND9A 1RHJA 1WXXA 4XM1A 2ZJ7A 4D79A 4HFJA 3AY3A 3LOPA 2FSFA 4XDHA 4OUDB 5JZOA 3LP8A 1FU4A 2SBTA 1BVRA 3ROEA 5KYXA 4DV5B 4FFVA 4WRRA 5H83A 5G41A 1GAWA 2IPMA 1EFUA 4TMWA 1QRUA 2H1SA 1ZNWA 4BU1A 1CEYA 5MDHA 1JZTA 3DOFA 3KR1A 2DR2A 1IL0A 5DCYA 4CQMB 1AKWA 3PWZA 3SIXA 5JXWA 1DIOB 1WVMA 3IXLA 1PNTA 1N7JA 5EZYA 1DTWA 3OURA 2BEVA 2X5JO 1GFIA 1A4XA 3TLJA 3H86A 3KPJA 1T9AA 2HW8A 1C8VB 3ZUGA 3OM0A 3MXOA 2C92A 4MYSA 4G4SO 2R4UA 3E1SA 1XELA 3N0TA 3K30A 4RJJA 4TTVA 3SR3A 2YWHA 1KMIY 2V0NA 3ELWA 4OOFA 3TF5A 4GX5A 3TLXA 3A3KA 1E2LA 1EX1A 4DTIA 2B3TA 4HATA 2HFJA 4HCJA 4TN5A 1NF9A 5EFZA 1N5KA 1GNTA 2B98A 3IV7A 4TYYA 1IVYA 2BEWB 1YZQA 1GPNA 2ZIFA 4TS1A 4HFNA 1WQ4A 3BMCA 1T9HA 1BRTA 1XTBA 4FFMA 2WE8A 3HJFA 1HKUA 2WSSA 5YASA 5BV2P 4MPPA 4ZVTA 3RVOA 421PA 4BMZA 5ALQA 1BFUA 3HU1A 1XU9A 2JHCA 1NULA 4L51A 1IK6A 2EL7A 1LI4A 2D7CA 4J6FA 3FPSA 3GN2A 1QIJA 2QVBA 3DC7A 2VPPA 2O2GA 4Z9AA 5TRTA 1ZRMA 3QQ5A 2P65A 1Y1PA 3UENA 3JD3A 4G25A 4ZHQA 3K0SA 5AUQA 1M5TA 1T5BA 1Z5WA 3ZGOA 1N1MA 5EMNA 2NU8B 3V9PA 2FZ5A 3T9AA 1K3TA 1SVIA 1DAPA 3G0DA 4LNUA 2YS7A 1J2TA 2H5JA 1DC3A 3EG9A 1QO7A 2Z6VA 3O8LA 4P36A 2ZM5A 1Z45A 2O8FB 3F3KA 2J9ZB 3P2KA 6PFKA 2IZ1A 4W82A 4AROA 3BIFA 4RVGA 1TIBA 3LQQA 4LW8A 4ER5A 2OYCA 3JD4A 1UOQA 1YQ9A 2V7PA 2C5FA 2QQGA 3EYWA 4C2AA 4YC7A 4DUPA 2AE1A 2YJNA 4GD3Q 5JS1A 5BN3A 4IR7A 1UDRA 1USKA 4ZO9A 3P2IA 4EWLA 1M2JA 4B47A 1YRYE 4KQ2A 5TF4A 4MS4B 5LM3A 2YOFA 1QFZA 2CLKB 1E1RA 5AW1A 1NOIA 1O95D 2ZWVA 2PMKA 3G0BA 1M6WA 1DQZA 4ACAA 1ISFA 4ARBA 1Y8ZA 2FMXA 2NXJA 1VG0B 1QE0A 2ATIA 2C3YA 4LXYA 3QELB 4GMGA 3CUEF 4HAWA 3R75A 3ZCXA 4DIEA 2BMDA 2QZZA 4L8FA 1J0CA 3UB3A 2PUDA 1JXAA 2F3UA 1L7DA 2BKAA 3AVYA 4B71A 1VOTA 2IUFA 3C3EA 3DHYA 1U3DA 2E3JA 4WXPA 3H17A 2TMDA 3GEHA 2OCAA 3K4PA 3S7TA 4UXJA 2FHSA 4TM8A 5CNMA 4CRWB 1MAHA 2XF8A 1FDOA 2RGRA 1Z4JA 3N6VA 3RUIA 4YP9A 4YV0A 4RAOA 3BTSA 3LVRE 3TSZA 5JOQA 2V54A 2EKBA 1IN4A 1DOZA 3IXMA 2F8MA 4ID9A 4E51A 1UH5A 5IT9A 1O6CA 2CYCA 2G08A 4ARCA 2WJYA 3BDVA 1IBCA 1VKNA 4N5IX 4XH9B 3RTAA 5HF8A 3RFFA 1CUJA 2FFHA 2VT7A 4TT3D