4YACA

Crystal structure of ligo in complex with nadh from sphingobium sp. strain syk-6
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
295
structure length
270
Chain Sequence
MQDLEGKVAFVTGGGSGVALGQAKVLAEEAQMKVVIADIRQDHLDEAMGYFSQKNVAVHPVRLDLTDRAAYAAAVDEAEQVFGPVDLLCNTAGVSQFGPIEKATFDDWDWQMDVNVNGVINGVMTVMPRMIERGQGGHILITASMSAFVALPTTGIYCTTKYAVRGLAESLRVEMPKYNIGVSLLCPGGEAVFAGLKRVIEHGFDPVDLGRVVLDAVRNDRFWVLPYPEFAEGQKARDQEVIDAMMSYADHPDYARRMKIREQMKRDMPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C alpha-dehydrogenase
publication title Structural and Biochemical Characterization of the Early and Late Enzymes in the Lignin beta-Aryl Ether Cleavage Pathway from Sphingobium sp. SYK-6.
pubmed doi rcsb
source organism Sphingobium sp. syk-6
molecule tags Oxidoreductase
total genus 100
structure length 270
sequence length 295
ec nomenclature
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4yacA01
5GY7A 3WIEA 3I23A 4O0LA 1ZK1A 4BMSA 5JAMA 3VDRA 3INTA 3RBVA 4R16A 1EUDA 2GASA 9LDTA 5ICSA 3PLRA 3RUCA 4CJXA 1I5RA 3GH3A 1I33A 3NUGA 4QUKA 2VTDA 2OP0A 4IJWA 1JKIA 4OXKA 1DSSG 2IZZA 1D8AA 4M87A 1DIGA 4AL4A 4QO8A 2LDXA 1N1EA 2CFCA 2D0IA 2CVOA 4AFNA 5IXYA 1CDOA 3A9WA 3WB9A 4OHUA 4OH1A 2P9CA 4BGEA 4XRGA 1NTOA 3DAPA 3H3FA 4XB1A 4CMJA 4J4BA 3QWAA 3DBVO 4MVJE 4NZ9A 1YH3A 1KC3A 3TZ6A 3W4JA 1H2BA 3EDMA 1R6DA 4PN3A 1V3TA 3QQPA 4R3NA 3I6QA 1JLLA 3RKUA 1NWHA 3R0IA 1XU9A 1Y5MA 2IYOA 1P1KA 2XF8A 1MP0A 2BFPA 3ONEA 4DMMA 1VL0A 4IUYA 4OOEA 1UR5A 3E5MA 3VH2A 3TFQA 1E3WA 2AXQA 1GD1O 1IL0A 2BKAA 1TT5B 1RM4A 4BO1A 3SBOA 3MWEB 2AE2A 3ZV5A 3NV9A 3ASVA 3MJSA 1UJMA 1GQ2A 1MXFA 2BELA 4Q39A 5F3RA 2YFQA 1BG6A 2V65A 3GEGA 4NJMB 5EN4A 4PLFA 1YOVB 3RJ5A 5I9LA 3WGIA 2VUSA 5JSFA 4OMUA 2PA3A 2UUPA 4RZIA 3TL3A 3KBOA 3D3WB 1EEHA 5G0SA 1I2CA 3L6DA 3WJ7A 3A4VA 3WLFA 3ZWNA 3RFVA 1YDWA 4IDBA 4EJ6A 3HE3A 3QWBA 2O2YA 2QZ9A 3OSUA 5JAZA 1ENZA 2AA3A 3ABIA 4FD3A 3R3SA 1QP8A 2E48A 1D7OA 4J2OA 4AG3A 2JFGA 2O3SA 1SZJG 2HMWA 2B4RO 3F47A 5CDUA 1EFLA 4DYVA 4PVDA 2J8ZA 1PR3A 2RH4A 3T4XA 1LEHA 2O4CA 1P0CA 1H6CA 2A35A 2TMDA 3TSCA 3VC7A 4CUZA 1J4AA 4FOSA 2EF1A 4R01A 4E2YA 3ZWVA 4Q3NA 3AM5A 2NTNA 4XX0A 1XQ1A 1Y81A 3PQFA 1X0VA 5L7TA 2AQIA 4YWJA 1WVGA 3AI3A 3D7LA 3EW7A 4RV9A 4D3SA 3JQ9A 4BNUA 4D45A 1UUFA 1U8XX 4R5HA 4F46A 4GX2A 1C0KA 4R1TA 2OGUA 2IE0A 4NNJA 3VDQA 1CF2O 1NPTO 1U2GA 1Z73A 3F1LA 2ZB8A 4PIVA 4FB5A 1H2HA 4JROA 4UVGA 4S1VA 1XU7A 1U28A 2Y99A 5DP1A 4FFOA 4HFJA 4JLWA 4ZVVA 5DT9A 3GMSA 4Y6PA 3LC7O 5I8ZA 1NP3A 4I5GA 3RBZA 1X1TA 4N5LA 3B1KA 2GF2A 3BMNB 3QP9A 1TT7A 1E7YA 4DYDA 2IXBA 4BL5A 4GBJA 3ZCXA 5JDIA 3CE6A 2C7GA 1YS4A 4Q3AA 1R0KA 1V9LA 2Z1MA 2HMTA 3E8XA 1KOLA 3ZU4A 4BNKA 7MDHA 4IMPA 1GZ4A 3G49A 3I9JA 2WSBA 1DRWA 3GAFA 4FR5A 3HB4X 3NTQA 1SAYA 3TL2A 1PTJA 4CV0A 2RBEA 3VZRA 4F6LA 1QV7A 1E6UA 1N9GB 1D4FA 1NQTA 3GC6A 4GWGA 1ZJZA 5JAIA 4BO4A 1C1DB 3TZHA 1OFGA 1BDMA 2C0CA 4B3HA 2XXJA 3WLEA 2P5YA 2YUTA 4BNWA 4UEOA 6LDHA 3TFOA 5DCUA 2NU7A 4IIUA 4MIEA 1UXKA 3KV3O 1EQ2A 2H1SA 4R3WA 3F4LA 3FD8A 1F14A 4J4HA 4BNVA 2FPGA 4M86A 4WNIA 3AOEA 1XHLA 3AUSA 4PRKA 2GN4A 3W4KA 1LSUA 1MGOA 3P2OA 2ZK7A 1YONA 3LF2A 2PH5A 3GFBA 1LBEA 4RVDA 4YVFA 1EZ4A 1E0DA 2GGSA 2VHVA 4J1QA 4CV1A 3LT1A 5A3JA 5FYDA 5H83A 5EQFA 4HP8A 1E1NA 4W6ZA 1BWSA 3QWIA 1ENYA 3NYWA 3W8DA 5AYVA 5DZSA 2D2IA 3ICPA 3SLKA 3SVTA 4K26A 2FWMX 2O2SA 3PFFA 4H15A 1PJBA 1GYRA 4UEJA 5FEUA 3H7AA 3VOSA 4CMHA 1I36A 3K96A 2ZKLA 3KM0A 4FSHA 3WOHA 4ZJUA 2QQ5A 3OF2A 3WG9A 1PQPA 3Q3CA 4TQGA 2PZMA 4UUNA 3HG7A 3GN2A 1GQQA 4BUCA 1FXSA 4XGKA 3DZBA 4J90A 2OBYA 1UP7A 3AY7A 3WFJA 2QW8A 3VPFA 1WMAA 4ZQEA 3VAZA 4LRTB 4QTZA 3PEFA 4OOFA 4CM6A 1VC2A 4NBWA 2PGDA 4NMHA 3NGXA 4XRRA 3A1NA 3WGGA 3I4FA 4BMNA 2RHCA 2VT3A 1I32A 3L6EA 4HUJA 4ND3A 3DZGA 3PLNA 3ZI0A 2J3JA 4MO2A 3ZNPA 4OIMA 1G0NA 1KEPA 4JBIA 4XGNA 4CR7A 2ZCUA 4DC1A 3C1TA 1B15A 3QW2A 4LVUA 3ETGA 4U0JA 5CHEA 5A1TA 3IKTA 3KYCA 4RVFA 4PFJA 3KLMX 3PTZA 3AI2A 2G5CA 5G4KA 4KTTE 3WGYA 3LYLA 4OSOA 4UVDA 4RVGA 2AEMA 1T2FA 4IINA 4JBHA 3F6YA 1NXQA 3FF4A 3O38A 2WYVA 5C5IA 2DC1A 2J5RA 4RORA 1LC3A 1JAYA 4R69A 4DC0A 3GVCA 2PD6A 3I9KA 1MV8A 5CPFA 2R6JA 2FMUA 2CVQA 2P9EA 4KDFA 4ZHSA 1R0LA 3G1UA 4QSMA 5J23A 2SCUA 3OMLA 5IJZA 3AU8A 1HYGA 1LU9A 1QYDA 1Y5RA 3GZ4A 4GGPA 4XYBA 2X0IA 2JHFA 4DPMA 4IZIA 4CM7A 2D5CA 4IQGA 1PJTA 3GMDA 1VJ1A 1VPDA 5A9TA 3UUWA 4TRRA 4ROSA 1E3WB 1P1FA 1WDLA 3A28A 3LC1O 4CMAA 5JC8A 5DF1A 4C4OA 3VPXA 3OHSX 3WSWA 4MJLA 3PJFA 5IZCA 3HDYA 4YAIA 1UP6A 2YV1A 4XYLA 1V35A 4XR9A 2O3UA 2Q3EA 3K5PA 3E5RA 3HJAA 1DOHA 4P4GA 5ENVA 4D3DA 1DIAA 3F1KA 3E03A 3FPCA 4FJ0A 1PS0A 4DIBA 3ZWBA 4BHTA 1HRDA 3PWSA 1QKIA 2VZ9A 3F5SA 4NU6A 4RDHA 2B5VA 4XQ9A 4YJGA 4E6PA 1GU7A 3SC4A 3EUWA 3WWYA 4WLNA 1H93A 1R37A 4I9NA 3DMYA 3T7EA 5JW6A 1P9LA 3VTZA 4L76A 4CLDA 5GMOA 4L4RA 2JKVA 5THKA 3DEYX 1NFFA 4XQGA 4KUEA 1IOLA 1A7KA 1VRWA 3RUFA 1QMGA 3HFSA 3WMWA 2VWQA 5C7IO 2HMVA 2I67A 3WGQA 4PZCA 2NU9A 1WXDA 3COSA 3WICA 2GZ2A 3PYMA 3GA0A 3JQ8B 1BXKA 1HZJA 3ZU3A 2HK7A 3U9LA 2VHZA 3IP3A 4NIMA 4UEKA 3DMTC 5BT9A 3K92A 3W8FA 5BNIA 2VTEA 3WNQA 4IIVA 5BSHA 5A9SA 1CQIA 2XAAA 5CEEA 1WZIA 1NM5A 3DOJA 3UVEA 3PFWO 2I65A 1PR9A 2DT5A 3DHYA 3VZQA 5TQVA 3TWOA 2DUWA 1J0XO 1GV1A 1LDBA 5LDHA 3M6IA 5I7EA 1T26A 1PJ2A 2BI7A 1HETA 4KMSA 4BKPA 4IBOA 4NDNE 4Q3CA 2Z95A 2PWZA 3JQFA 4Z9YA 3VH3A 1T2EA 3JQBA 3UFXA 3I52A 4PRLA 1PGPA 1DEHA 2PGJA 1ZMTA 1XYGA 2NQTA 1YRLA 3AM3A 1R4MA 3IJPA 1NASA 4JQCA 5ITVA 4Z6KA 2Z1NA 3JYPA 2X8LA 4Y8VA 4GMGA 4XYEA 4UREA 1ID1A 1QLJA 5I7SA 4MVJM 3AFMA 2VT2A 4BOYA 4DUPA 1ZMOA 2OP1A 4RQTA 2Y0CA 2ZYDA 5TSDA 3LVFO 5A05A 3NJ8A 4H7PA 2ZJ0A 5G0VA 3WS7A 4IDAA 3OQ1A 4I5DA 2GYYA 2O3JA 5F1KA 2GZ1A 2A4KA 2EP5A 4PLWA 4FFMA 5IFLA 3GDGA 2GERA 3EYWA 1B26A 4JXKA 4Y67A 1LLQA 2W98A 4YAKA 2ZTVA 4FGWA 1EMDA 4KTVE 3ZWAA 3RASA 4YJFA 3KTDA 3I9OA 3TJRA 2Y1OA 3CSDA 4J1SA 3TF5A 3DC2A 1PWXA 3MJVA 1JVSA 1DJQA 3RWBA 4U5QA 3D3WA 4YCAA 2VZ0A 4CMBA 1U4SA 4BVAA 4MOWA 3GF4A 2O3RA 2HDHA 1UAYA 3A14A 3EAGA 4PG6A 3U4CA 2A92A 3F9IA 4W9NC 3BTUA 4IQ8A 1HF3A 4ND5A 5KJ6A 4IQ0A 1UH5A 4IJUA 4CLEA 1DC4A 3JYQA 4GKVA 4E21A 3HQ4O 2YDYA 1EE2A 5KVSA 3DBHB 4CLRA 3VTFA 1N8KA 4D3FA 4EI2A 4BKOA 2AG8A 3WGOA 1LQUA 3H8VA 3IJRA 1V6AA 5FI3A 4DPKA 4L75A 1OBFO 4YTEA 2Y66A 5A03A 1Q7CA 5GZ6A 3TRIA 2IRWA 1HDCA 2R00A 1KERA 2X5KO 2UYYA 3MOGA 4MVJH 3PYXA 3RUEA 4E2WA 1P1HA 3OBBA 3GDOA 4J9UE 3UGKA 1NNUA 2VN8A 1EVIA 4S3MA 1ZVMA 5L3ZA 4LVCA 2VNAA 3RU9A 4KQWA 1KETA 1J6UA 1GZ6A 4ALIA 5EPOA 5BSGA 2X0NA 2PD3A 3FNHA 1NAIA 4BS9A 3JD3A 4ZQBA 1WAMA 3KSDO 5CG1A 4XQCA 3OECA 4PLGA 2FHSA 3E82A 1ISIA 1VKNA 2J3IA 4HNHA 3H9EO 4TWRA 3AI1A 3HSKA 1U5CA 4MDHA 5F1OA 3V2GA 5A5EA 3HDQA 4ZQGA 2V6GA 3S2GA 3GPDG 4D41A 5T6BA 2F1KA 2P4QA 2BMAA 1WPQA 1DC5A 5G4KB 3ADOA 3DWFA 3KLPX 4XWYA 2JAPA 1K6XA 4TRNA 4ZICA 2G76A 2YHUA 4CUKA 5ES3A 2Y1DA 1I3MA 5T64A 2ET6A 3JV7A 8LDHA 1VM6A 1ZSVA 2E6UX 9LDBA 2R2GA 4N7RA 4MP8A 4URFA 1GR0A 2QRKA 3EVTA 4PLTA 3Q2KA 3GY0A 4RZHA 1D3AA 4UAGA 3C85A 3CMCO 1A7AA 4N18A 1DIBA 2O3QA 4R68A 5FF9A 5JE8A 1YE3A 3JQ6A 5B4VA 1B0AA 4E33A 4YYZA 5ILOA 3JYOA 4FFNA 2CD9A 4LMPA 4QX6A 1HYEA 2P9GA 4I9HA 4ND4A 3TOZA 2EWMA 3M2PA 4XJTA 3AUAA 3BYZA 3PI7A 4MVJG 4IXWA 4L4XA 3K30A 5JC1A 2V6FA 3FI9A 2HO5A 2XPCA 4PG5A 4YB8A 1ZIDA 1FDUA 1W8DA 2X9NA 1HSOA 3P7MA 1HSZA 2RCYA 1KVSA 3JTMA 2HJSA 5IDYA 3SXPA 2H9IA 1T1RA 3H5NA 4JP3A 1NR7A 4IMRA 3ZW9A 2AW5A 1ZSYA 3H6KA 4H3VA 3EVNA 1JQBA 3D64A 4CMCA 4EGFA 4RJTA 4CMKA 1B7GO 1E7QA 1B8VA 2O7SA 3HZZA 2NQ8A 4WK6A 4XDYA 3WFIA 4WCDA 3UCEA 1V0JA 1FDSA 3S2FA 1VSUA 1DAPA 3QVXA 2E82A 3RFXA 2ZQZA 4Q3EA 3CKYA 1M66A 2Y1FA 2EJWA 1GAEO 2Y68A 4YJGB 4FGSA 1HE4A 4LMRA 4NFHA 3ZW8A 1XGKA 3CINA 4XCVA 4A7PA 2AE1A 4J3FA 3ULKA 4J7UA 5U4QA 3U3XA 4R1NA 4YAEA 4DRYA 4FFRA 4BO6A 3PVZA 4FPXA 4NR0A 2VZ8A 5BSEA 1N1GA 3JQGA 3GGGA 2NVWA 1K0UA 4W7IA 1LDYA 3D4OA 4A27A 4W4TA 1BRMA 1O8CA 1SMKA 5BNTA 4NH4A 4WE3A 1LLCA 4CL3A 2HSDA 5T57A 2VYND 4M49A 4INAA 3E9QA 2EIHA 4AJPA 5CFZA 3NT2A 2YY7A 5EIOA 3WIDA 4YXFA 5A9SB 5TX7A 3ZWYA 4C7JA 1E7RA 4L8VA 5CDGA 2IZ1A 3JCZA 4BGIA 1LRKA 2VQ3A 1XA0A 4UUPA 1GPJA 2QYTA 1Y6JA 3DOCA 4JCOA 3OJEA 5COAA 2VYNA 2Y67A 3M1LA 4CLHA 4BGVA 2QYSA 4BO0A 3GK3A 4Z0TA 1PGOA 3PHIA 3WQQA 4Y98A 5JS6A 3TDKA 3RIHA 3JSAA 4U0KA 3PGXA 4CUJA 2DFVA 2WWRA 5F21A 1R4MB 4RO0A 3KO8A 2PK3A 4E5NA 5C3MA 2B5WA 4JJFA 1A4IA 4GX1A 2F00A 3WDSA 5AXCA 1GUYA 3QVWA 2X58A 4DWVA 4GMFA 4TRJA 1KY4A 3BMQA 1J49A 5DOVA 3EMKA 5KJEA 2EEZA 3B1JA 1XG5A 3I1JA 5TLSA 3WSVA 3CIFA 1NWCA 1A72A 4J6FA 5JMPA 1PL7A 2V7PA 3H65A 2POQX 2JFFA 1GCUA 1ZW1A 4BO8A 3RROA 4Z0HO 2AEFA 5I9NA 3QVSA 3PGJA 4BO9A 4YEDA 1OC2A 3IAHA 1FDTA 4YJFB 3Q9UA 1ONOA 4NK5A 1MA0A 4GX5A 4PGFA 4G65A 1SNYA 1LSOA 2VOEA 4O59O 4YT2A 1X7HA 4Q3BA 4F45A 3OEYA 1MFZA 5GZ3A 4DVJA 1DJNA 4B4UA 1BSVA 4OO3A 4EITA 4EEXA 3WQRA 1PZHA 1PGNA 2H63A 4TRMA 4LN1A 5TT1A 4R5MA 1DIHA 3CXRA 3NDJA 4UULA 2YW9A 3IDSA 3PHLA 4QEDA 5A3VA 4NBTA 4CV3A 3PZRA 4A0SA 4CLRB 3E6AA 1MFPA 1EK5A 1KVRA 2A9FA 2Y0EA 4RVSA 4B4WA 5A4DA 4R54A 2V6MA 4R1SA 5ER9A 3NTRA 3ONFA 2WYUA 3JQEA 2W8ZA 1J5PA 3ANLA 4ONEA 2HKIA 1PL6A 3Q0EA 3FBTA 1YVEI 4XR4A 1VL8A 2IDZA 4A73A 3T7CA 3JQ8A 4N54A 1UZLA 5CDSA 5LCXA 4KOAA 2GZ3A 1ZFNA 2CVZA 1BTOA 4NBUA 3G17A 4YJHB 3I4CA 1ENOA 3LU1A 5KKAA 1T2DA 1KVTA 5I7VA 2IEDA 2I66A 1LDNA 1ADGA 1TB4A 4IDFA 5KJFA 4L0QA 1KY5A 1ADCA 1RYEA 1T2CA 4YAGA 1DXYA 1U3UA 1NVGA 1Z74A 4E4YA 4WOKA 3U5TA 5HTOA 1F8GA 2YDXA 1EQUA 1JVBA 2HLPA 4BNYA 4DMLA 3RUHA 4O63O 4XIJA 5B12A 2Z5LA 1NQOA 3K31A 1X14A 4OQYA 4W99A 1GEEA 1U4OA 1Q0QA 3FHLA 3PQDA 3PRJA 4FFLA 4UUOA 4DIFA 5CDYA 5L51A 1ZK3A 1NVMB 2HU2A 4FIZA 2DBVO 1N2SA 4FJ1A 5C37A 1QV6A 4HKTA 3INRA 1M2WA 1E7MA 1RKXA 3GHHA 1IY8A 2HMUA 1GADO 4YAJA 4WCFC 1OOEA 1Y8RA 2HJRA 3BHIA 4BNFA 2CDBA 3TPCA 1KEUA 3C7AA 1H94A 2O50A 5JY1A 5JDCC 2PD4A 5B1YA 3WGTA 2DKNA 4EUHA 5KJCA 2Y0DA 1HDZA 3IQDB 1QYWA 1XWFA 2WE8A 2JL1A 3MTJA 4W9NA 5T67A 3IL2A 1UXHA 3GRKA 4GL4A 1GQYA 3IOYA 2W90A 5F5LA 1E5LA 3RQSA 4A26A 1IPFA 1LDGA 1NBOA 1Q7BA 2C20A 2RHRA 4OXYA 4YPOA 5DULA 3TQHA 3WGZA 1JKFA 2ZQYA 4GLOA 3SEFA 5K6AA 3GEMA 5CDTA 1EVJA 5B4TA 4KDEA 4B79A 1GZ3A 4NI5A 3DBHA 1VKOA 3LDHA 5CP8A 4GVLA 1VI2A 5BQFA 4IDCA 5IF3A 2C07A 3QY9A 4JBGA 2NV6A 4XGIA 3QWFA 2PLAA 2Q46A 4TKMA 3GEDA 1E3SA 4E31A 1YO6A 3O8QA 4IZHA 1UXGA 3N7UA 4CMIB 3AOGA 1E6EA 3QVTA 1ORRA 2HK9A 4BKRA 4AJEA 3JQDA 3EHEA 3PIIA 3ETEA 3ITDA 5KVVA 1R4NB 2JHGA 4OM8A 5JMWA 2X0JA 1KVQA 1ONNA 4AJOA 3JQGB 3A06A 4DQUA 1LSSA 4PZEA 4IS2A 4XEHA 3ZWOA 4UVHA 3UF0A 4J7CA 2EW2A 2CF5A 1I8TA 1VJTA 4WKGA 3NEPX 1I3LA 4ZN6A 1PL8A 4IDDA 1DB3A 3DZFA 4NQZA 3CEAA 4B8ZA 3FWZA 4E2XA 4HV4A 1LA2A 3ROQA 4CLXA 2HAEA 2EV9A 4K6FA 1MLDA 1E1KA 3U4HA 2HMSA 2NUAA 3O9ZA 1HDXA 4IXTA 1DAOA 3V2UA 3WYBA 3HFGA 3KZVA 4J16A 4MKXA 2DBRA 3I9MA 3ON5A 1HEUA 2XXBA 3AU9A 4PCVA 1CETA 4RPGA 3CH6A 3Q11A 1YQDA 3AUTA 2OO5A 3DHEA 3ZWWA 3V1YA 3OA0A 2I76A 3RAJA 3U62A 5G0UA 1HE3A 1BXGA 1YB1A 2YHIA 1UXIA 4TKLA 3RUIA 3MOIA 1OI7A 2Q50A 4AICA 2BF7A 2GLXA 3VVCA 3BMQB 3Q9NA 1CQJA 1X0XA 3EK2A 3VPHA 1P1JA 2AQ8A 4GSLA 3ZGYA 5BR7A 1HZZA 1JA9A 4GGOA 2B69A 2D59A 1NAHA 3G3EA 1KC1A 1TEHA 2D3TA 3AFNA 1LXCA 4L4SA 2CUKA 3E48A 2B37A 5JYDA 1GTMA 1MB4A 1X15A 2YQ4A 3GRPA 4OJNA 1ML3A 4BO3A 2EHDA 1NHWA 2BFAA 1U9JA 4CMEA 1IE3A 1P0FA 4R4JA 2QRJA 3V8BA 3OIFA 4K9DA 1VJ0A 2FPIA 1E5QA 3DBLB 2AQKA 3NAQA 1FMCA 1Y1PA 1EUCA 4BNMA 1X1EA 1SO8A 2OUIA 1O0SA 5DDIP 3RJ9A 1A5ZA 2W2LD 3H9QA 2X5OA 4GSKA 4YDRA 2IODA 4MVJI 4CL8A 2DTDA 5CEFA 3H3JA 5HA5A 1AUPA 4RPLA 3GLQA 4CM8A 4BO7A 1E6WA 2W2KA 1VSVA 1B2LA 3QE3A 4OGWA 5G0TA 3I3OA 3GPIA 4BB5A 1R15A 2W2LA 4LISA 4R51A 3FPLA 4ITUA 2Q2VA 1H5QA 3RFTA 2BGMA 1PZEA 1A4UA 4NBRA 3X2EA 1O9BA 2CNBA 1V8BA 1WDKA 7ADHA 1AE1A 1F8FA 2WM3A 2C2XA 2O3TA 5JBIA 1PZGA 3VH4A 4ZA2A 5TIIA 1LSJA 5CPBA 1RM3A 2ZB3A 1WLYA 5KJ1A 2B36A 3FNFA 3DQPA 1G6KA 3R6DA 3VPSA 1E3JA 1F0YA 4CM9D 3ST7A 4QECA 3I6IA 2IZ0A 2PY6A 4GPD1 1OZAA 4ESOA 2HUNA 4BV9A 4I5EA 1DPGA 2C5AA 3PWZA 4J1TA 3QA9A 5AOVA 5DCWA 2GN9A 3MEQA 2J5QA 2VNSA 1ZNQO 4CM9A 2D5AA 4JX8A 1YDEA 1DRUA 3B6ZA 3D3EA 1E1MA 2OHXA 2EGHA 4YRDA 1F06A 3RCBA 1DLIA 3Q6IA 2DBZA 3ETDA 4AJJA 4BV8A 2YV2A 4AJNA 1EUZA 1LRJA 2VHWA 3H2ZA 5EERA 1Y8RB 4BNZA 4FOOA 3L9XA 2PZLA 4M1QA 3VKVA 4XD2A 5IDXA 3ROKA 1QSGA 3PZBA 1P74A 4UUMA 3F5QA 1T2AA 2CDCA 4CR8A 1B3BA 1P3DA 5IN4A 5L95A 3TOXA 3IP1A 4BNJA 1K5HA 4IY1A 3RU7A 4B3IA 2FN7A 4A10A 1QXSA 3KETA 4Q9NA 4ALNA 4D0RA 5L4NA 3W6UA 4DXHA 2PGLA 5BNFA 1XELA 1K6IA 2X22A 3C1AA 5FI5A 1IZ0A 1F12A 3LK7A 1YBAA 3B20A 2Y1CA 5TC4A 4DLAA 5JO0A 3RBXA 1EBUA 3BMCB 2DFDA 3AUUA 1ZK4A 4J91A 3GAZA 1F17A 1Q0LA 1YKFA 1U5AA 3LLVA 2Q99A 1X13A 4P8RA 1H6DA 5L4SA 4KUHA 1B8PA 1T4BA 3KSZO 2QX7A 4CQLA 5HWSA 3DTYA 2JCYA 1DIRA 2GCGA 2DUUA 3VZSA 1I0ZA 4FS3A 3WR5A 2ZYGA 1LNQA 2FZEA 5COBA 3OJOA 4RLHA 3TZKA 5T8KC 1QYXA 2NTJA 2X9GA 3O8QB 3R3JA 2HRZA 4XYMA 2QZZA 2O48X 1W6UA 4UVEA 1H6BA 3ZV6A 1DHTA 4F3YA 1MXHA 3GDFA 1HDOA 3RD5A 3WYEA 2J5KA 2JAHA 1XCBA 4FC6A 2Q49A 2VHXA 4YJHA 1K3TA 2Y05A 4DPLA 4BGUA 3OP4A 1EFKA 1TI7A 2QRLA 5EESA 4DGSA 3DL2A 2DPHA 2PZJA 3KEQA 4MVJA 4EDFA 5IZ4A 2EW8A 3JD0A 2DTXA 3VZPA 3UAGA 4BNGA 3ITKA 2TMGA 5C7OO 2I9PA 3LT4A 1RPNA 5HRUA 4QFCA 4NK4A 2UDPA 3B1FA 5A02A 1VL6A 2GDZA 3CPSA 3G1TA 1T25A 1NFQA 2I6TA 3NGLA 5AXBA 2VRBA 2C82A 1YWGO 2WEKA 1HLDA 3GQVA 1A9ZA 5T5QA 1PWZA 2Q1WA 4IPTA 1LI4A 1VE9A 2UVDA 1U1IA 4TVOA 5IG2A 2RIRA 1PGQA 2ZTMA 5JCJA 4KWIA 2NWQA 4NFYA 3OIDA 1ENPA 1UZNA 3KOUA 4RL6A 4N5NA 4FDAA 5TJ9A 5KCZA 4IGFA 5DP2A 5ADHA 3GGPA 3FCOA 4W82A 3KB6A 3NDRA 4Y6RA 3VKUA 3N58A 4WEQA 2E4AA 4Z3DA 5JLAA 2XOXA 4PLVA 3F4BA 4WUVA 4Q3DA 3ENNA 3GZNB 3FTPA 3KRTA 4P38A 3DO5A 4EJMA 1EVZA 5L7WA 1BXGB 3H5RA 1NHGA 1C0IA 3NRCA 2ZTUA 2YHIB 3TZCA 4CLOB 3ZWPA 1D1TA 1HXHA 3ZNQA 4E12A 3EGOA 3PHJA 3QLJA 3W6ZA 3WBBA 1I01A 1P77A 4ID9A 3MZ0A 2Q4EA 1R12A 3OH8A 1HT0A 1HTBA 3GG2A 4JK3A 4JN6B 4XYGA 2DPGA 4GWKA 1KIFA 4L74A 3U4IA 1XLTA 2DLDA 5IDQA 1JWBB 2O4UX 1LDMA 3OIGA 4WNCA 4PG8A 4Z3KA 1KBZA 4FW8A 1RWBA 3NX4A 3LT2A 3ZNOA 1GUZA 1N7GA 5COQA 3UHAA 3G79A 3EC7A 5CAEA 3IC5A 5EJ2A 4DBZA 1RM0A 4KUGA 1C0PA 1U8FO 3D4PA 1PJSA 3IS3A 4CMGA 3C3XA 1LLDA 5KIAA 4PZDA 1K89A 2GN8A 3UW3A 3MTGA 4HNGA 2C59A 1PEDA 4ZRMA 3VVBA 1YJ8A 5L9AA 3JQAD 1TXGA 3PHGA 4HWKA 4CMIA 1EE9A 2C29D 1LDEA 1BMDA 1R0SA 4PG4A 4TZTA 4II2A 4CM8B 5C7LO 3EZLA 2VUUA 4RVHA 2W2KB 2NADA 3ASUA 4CM3A 1IB6A 3UOGA 4NJOA 5BSFA 4RGBA 4OAQA 1A71A 3L4BC 5IZCC 1ZKMA 3PJDA 1AHHA 3JQAA 3M2TA 3VH1A 1K2WA 1R4NA 2BRUA 1P1IA 3W4IA 1YB4A 3G0OA 4BQPA 3NT5A 5F5NA 1P31A 2NVUA 1W73A 3BTVA 2X0RA 2B4QA 5DBIA 4BNHA 4I1IA 4O5OA 4WOJA 3ZU5A 3MJTA 1OAAA 1FDWA 3ONDA 2VRCD 2ZYAA 2PV7A 4E30A 4JJIA 4C7KA 4I08A 3CMMA 1QRRA 4XQEA 1S6YA 1HL3A 2WDZA 5JPIA 1AXGA 3OM9A 2P5UA 4TMFA 5CG2A 1ZCJA 4EZBA 3RUAA 3GR6A 2CY0A 3DHNA 3RVDA 3U4DA 2X5JO 3F46A 3GOHA 4ZQHA 1H9BA 3GVPA 2VYVD 2VRCA 4IM7A 2EJVA 4TVBA 4LCJA 2VOJA 4Y9DA 1WNTA 2H5LA 3ZU2A 2BLLA 4FN4A 4U8GA 4ALLA 3JYLA 1EDOA 1SBYA 1SOWA 4MINA 4DLBA 4E0BA 1RYDA 1YGYA 4CODB 2FP4A 3H9GA 3IMFA 4YBZA 1T24A 2VYVA 4E32A 2GRAA 5TGDA 4WPGA 1P44A 5FFFA 1GYQA 2JD1A 3KYDA 2FR1A 3PJEA 3GUCA 2B35A 4D46A 1MC4A 4A5OA 4K6CA 2W4QA 1M6WA 5TRTA 3E9NA 1WMBA 1C0LA 4HXYA 4AJHA 1K6JA 3GGOA 1IUKA 1XEAA 2YJZA 3SC6A 4QFDA 4I8XA 5KTKA 4PLCA 5G2OA 3FR8A 3IUPA 5IDWA 2O7QA 1BW9A 4E13A 1TLTA 1ZEJA 4I5FA 3FR7A 3JQFC 1O89A 2QHXA 3JQBC 1Z45A 2RH8A 4J0FA 4G81A 4J4TA 4JNKA 1G0OA 3K9QO 2EKLA 2G1UA 5A04A 4HFRA 2PNFA 2G0TA 3JD4A 1ZK2A 3DBLA 3O26A 4ZRNA 3UKOA 4FC7A 1EDZA 1LQTA 3MJ4A 2WD8A 4J43A 3RC7A 4EUFA 4GX0A 5JCXA 4YQZA 5K0ZA 4OXNA 3RC2A 2WE7A 3BHJA 3IIEA 4X54A 1C1XA 1HDGO 1RM5A 2ZATA 1MC5A 3BHMA 1XIVA 2VWHA 3KVOA 1YQXA 1U3WA 3DFZA 4DLLA 2EGGA 1UDAA 4N5MA 4E2ZA 1AN9A 3K6JA 1HE2A 3OEWA 4TZKA 2BHLA 1UZMA 4CQLB 3WTBA 3ZWXA 4BNXA 5TT0A 1A27A 1PJCA 4DL9A 2BI8A 1X7GA 5DBGA 1T4DA 3DMTA 1CEQA 1GV0A 1WZEA 3PQEA 3S2IA 3QV1A 3F3SA 1CJCA 1DDOA 3GVXA 3HUDA 2PKQO 4II3A 2Q4BA 3QHAA 4RF2A 4GI2A 5JNLA 2AG5A 4BB6A 3X2FA 1QR6A 3WNVA 3DZHA 2B4TO 2PKRA 3H5AA 4G5HA 3WQSB 1BDBA 1MG5A 1ZSNA 2FSSA 4IJVA 5EINA 1Q1NA 3CTMA 4O1MA 5MGBA 4R1UA 3D0OA 1E3IA 3DXFA 3L0DA 4MIOA 1EBFA 5TNXA 4ZU3A 4CR6A 3I9LA 2J3HA 5A06A 1TVEA 3V1UA 4DQVA 4NFSA 2J3KA 2PH3A 1YL7A 1PQUA 4RPKA 1AGNA 1H6AA 4JIGA 3H4VA 1B16A 5JY6A 1E77A 3ZV3A 4DTIA 3MWDB 5TJHA 2ZB7A 3BXXA 1FDVA 2HK8A 2BGLA 2AEJA 3DZKA 1HYHA 1HDRA 3RSHA 3ZWCA 2R00C 2H6EA 3H2SA 2OORA 3NKLA 4YRBA 4WCFB 2OXIA 1AHIA 5K9ZA 2Y1GA 3I83A 1LC0A 1GYPA 1I3KA 3GNQA 1HDYA 1IYZA 1ZH8A 3WBFA 5A9RA 2ZB4A 1BVRA 3N74A 3QJ5A 1IULA 4FFPA 4HADA 4M89A 4Y6SA 5HS6A 3H9UA 2ZCVA 4OKNA 4R9SA 5U9CA 4MVJP 2NM0A 1E7WA 1T1SA 4G2NA 4OSPA 4MKRA 2I5PO 3MJCA 4RDIA 5DBFA 5ENDA 4BNNA 4BO2A 5CEJA 2PTGA 5EQDA 4CM5A 3FBGA 4WLOA 4HFNA 4RF4A 3QWHA 4D43A 3ZH2A 1YBVA 1IZ9A 3R1IA 1NPDA 2WMDA 4P4NA 3PPIA 4QT0A 4CM4B 3SJ7A 1U3VA 4OL9A 2DM6A 1L1FA 1ZEMA 4AVYA 4GLLA 4K1LA 3QIVA 2VWGA 2X86A 3V5NA 4D42A 1ULSA 3V2HA 3RC1A 3LC2O 2FRDA 4PVCA 3DFUA 5MDHA 2Y1EA 3ROMA 4KQXA 2P91A 4LK3A 3O4RA 4PLYA 1DHRA 4GAEA 2GO1A 1Y9AA 5KKCA 3NDIA 4P22A 1ZUD1 1PS9A 1ULUA 2VUTA 3PJGA 4AJKA 1ZZEA 1GY8A 1Y7TA 3OICA 3UH1A 3BMOB 4E5MA 2J6IA 3BMCA 4D0SA 1EK6A 1KYQA 1M6HA 1N5DA 2FY8A 5JO9A 1JU9A 1UDBA 2GD1O 3BAZA 3DBRA 3NJ4A 2DTEA 1NPYA 4L9RA 4R41A 5T8KA 1ZJYA 1IHYA 2ILTA 4XA8A 4XDZA 4E5KA 3UXYA 1I2ZA 1LUAA 3U49A 1VLLA 3KSUA 3P19A 4XIYA 3LLSA 3K2EA 3OQBA 1C14A 2QIOA 2WD7A 3C8MA 2X23A 5A5FA 3FN4A 4ZQFA 4DQXA 4GVXA 1ARZA 2GUGA 3AY6A 4LCEA 4Z9XA 2VCYA 1A9YA 1GFSA 1Q0HA 1BXZA 2I99A 3OJFA 3ANNA 3AWDA 1OC4A 1Z7BA 3JQAB 3L4SO 1Y8QB 2EKQA 3JQ7B 1I2BA 3E18A 3NT4A 3ZHZA 2NVUB 2OL4A 1YBMA 3D1LA 1DFGA 4BMVA 3KHUA 3QRWA 4AJLA 1SEPA 5JFOA 4F6CA 2Q1UA 1JAXA 5DCYA 4B3JA 1WWKA 1PS8A 4R9RA 5B4UA 3ORFA 4LRSB 3PDUA 1GCOA 2FSVA 2BGKA 2YYYA 4AJ1A 1N92A 3E1KA 2P4HX 3T4EA 3NTOA 4B7XA 1O94A 5B37A 1YXMA 1QG6A 4NHEA 2EERA 2NACA 4CQMB 5HS4A 1ISGA 3M1AA 4GQAA 5AQ1A 5F1PA 1E3LA 4J2HA 4DBVO 2O23A 4YRAA 4MVJF 3MJEA 1WW8A 2B0JA 2BFOA 4MP6A 3S55A 2D1YA 3D4NA 1IHXA 2PR2A 3L9WA 1N7HA 2ZIZA 1PZFA 3FNGA 1YL5A 3Q1LA 3GZNA 5AVOA 1O5IA 3KYDB 1M76A 4B8WA 4CLOA 3UCFA 4RF3A 3HNPA 1KEVA 3VPGA 4BO5A 2I3GA 2GN6A 3HWRA 1HKUA 4RCVA 5KWEA 1NFRA 1HE5A 1RJWA 2VWPA 3AK4A 3RUDA 4D44A 4NG5A 4NU5A 3TN7A 1V3UA 1FK8A 6ADHA 2JCXA 3MCVA 4E5PA 1ISHA 5ER6A 1JTVA 4ILKA 1CIVA 3C1OA 2WJPA 1BW9B 4A03A 2YZ7A 1B8UA 1ZK0A 1P33A 2PFGA 3I9NA 3ICCA 4WGGA 1AXEA 3C24A 1ISFA 3PWKA 1Z7EA 4RQUA 3IUSA 1CERA 1GL3A 4XB2A 1M75A 4CPDA 2OBNA 4CV2A 2QG4A 3K2BA 3WXBA 4YJDA 3HHPA 5U1PA 4BQRA 3VHRA 4HX5A 3FWNA 1DFIA 1ZXLA 2BD0A 1ADBA 5HBRA 1C1XB 2C5EA 2JD2A 3L6OO 4JJGA 1Z82A 1Z6ZA 1NQ5A 1H0KA 3W8EA 2PKQP 3L4BA 1B3RA 4YT8A 3P2YA 3DZJA 4FBGA 1UAGA 4RVUA 1L7EA 4B4VA 3ZDFA 1DRVA 4DIOA 4GKBA 3ENKA 1Q7GA 3LSYA 1SEVA 4ALKA 5TS3A 1P45A 1U3TA 1QYCA 3ROPA 1PJLA 1BVUA 5KVQA 3B70A 1KEWA 3HDHA 4B7UA 2Q1SA 1EVYA 1JWAB 1W4ZA 1PX0A 2CDAA 2Q45A 1E3EA 3D5QA 3FNEA 3L77A 1M67A 1ZO8A 3GNTA 3GVIA 4XJSA 1QORA 2E49A 4YT5A 3AM4A 2GR9A 2FR0A 2CSUA 3KXDA 1S7CA 3WMXA 3SLGA 4E5YA 1DO8A 1PU2A 4ZGWA 2DBQA 5GZ1A 4PLHA 4BNIA 4U6QA 5I8WA 5EMHA 1ADFA 2CF6A 1UXJA 3ZHYA 2FPPA 2E37A 5EL0A 4TSKA 1QLHA 2AMFA 1U7HA 4OYRA 1NQAO 3GN1A 2NU8A 5L45A 4MIYA 1L7DA 1DC3A 2ZTLA 2A94A 3E9MA 4LW8A 1BGVA 3GNSA 1ONPA 5L7YA 2CMDA 4ALJA 2PZKA 4KP7A 4JP2A 3JQ9C 3GFGA 3U09A 5AXAA 5HM8A 2EXXA 2OMEA 2YFHA 3DZIA 4OQZA 1SPXA 1PJ3A 3JD2A 4PLZA 1YL6A 3CZRA 3AW9A 3PDJA 1SCUA 5L4LA 2LDBA 4MP3A 1MG0A 2NU6A 2X7HA 2NLOA 3OA2A 1LTHR 1KS9A 3H9JA 2B83A 5JAQA 3SJUA 1LX6A 3ANMA 2YV3A 5G0WA 3FTNA 4ZD6A 5KOIA 1PJ4A 1GDHA 2P68A 5JDIC 3W1VA 4HBGA 1DFHA 3JD1A 1DBVO 4P4LA 1LLUA 3DONA 3FRJA 4Z9FA 2JCVA 5L40A 3QSGA 3BA1A 3OETA 1BHSA 2FR8A 2HCTA 4QXMA 3WTCA 4FQ8A 4RPJA 2C54A 4Z0PA 2G17A 5LC1A 4YT4A 2NVBA 2JD0A 3HADA 1TT5A 1KVUA 4B4OA 3GHYA 3HN2A 2P2SA 4OKIA 2X1HA 1E1LA 4XKJA 3IKVA 4NJMA 3DBRB 1G1AA 3EY4A 4IGEA 3ZV4A 1YOVA 3C7DB 3BIOA 4U6SA 1PJQA 4TROA 3O03A 4D7AA 3KYBA 2DVMA 4ND2A 5I9MA 1ZBQA 3PYLA 1GEGA 1ZXBA 2Q2WA 3DDNA 3AOEC 2YQ5A 3STHA 1XKQA 2WD7B 4QQRA 4WLVA 4FCCA 4AJ2A 3FSRA 2DAPA 1R16A 4PLPA 4MVJD 2BH9A 1I30A 1WDMA 3TNLA 4M8SA 4YQYA 1D1SA 1ISMA 2AHRA 1XSEA 3DB2A 3LQFA 4W7HA 5ITWA 5K6AC 4I9UA 3UCXA 4WEOA 3ZNNA 5H82A 1FF9A 5IN5A 1E92A 4IS3A 1DC6A 1JW9B 2BFMA 3AJRA 2ZJ1A 2Q2QA 3I5MA 1YQGA 4NPCA 4PG7A 2D4AA 1JKJA 2DQ4A 4BKUA 1I24A 3S1LA 2GNAA 4RLSA 1MUUA 1O95A 3KEOA 4AJ4A 3GG9A 5JCJD 1TA4A 3GVHA 4MPDA 5IAAA 1NR1A 4J9VA 4MKZA 1LRLA 4HFMA 1X7DA 3ZHXA 1JN0A 4KWHA 4WASA 5ICMA 2OFPA 2WYWA 1R66A 2DU8A 3V1TC 1UP4A 3D5TA 4WCFA 3AY3A 4EEZA 5I7FA 3PXXA 1JDJA 5THQA 1WP4A 3P5SA 4UVIA 4EUEA 1DLJA 1P1RA 3PHHA 4J0EA 4BNTA 3OQ6A 3PK0A 4WECA 3WX0A 3WWZA 2IEBA 5TF4A 1OMOA 4IJKA 5JDCA 4J7XA 3WJAA 3OJ0A 5H81A 1GPDG 3HDJA 3PP8A 3BMNA 5AXDA 4E3ZA 8ADHA 2RAFA 3ADPA 2EKPA 2NTVA 2C7VA 3TZQA 2X4GA 2EP7A 1W0CA 3SX2A 4H16A 3KYCB 3UICA 1YJQA 2OZPA 4A2CA 4WLUA 5LDGA 4DA9A 3ZN2A 1IPEA 4KZPA 4WLFA 4ALMA 1I3NA 1PGJA 3OFSA 4CM4A 4LSWA 3ZZNA 1XR3A 4QO7A 4FJ2A 4AJIA 4DREA 2X6TA 2EG9A 3KUXA 4J1NA 4B7CA 5KVCA 1N9GA 2GPTA 3BZUA 2HQ1A 3Q2IA 4IDGA 1UDCA 4BKQA 2VHYA 4BNLA 2GSDA 1C1DA 4WJZA 1CWUA 5DOZA 1SOVA 2CZCA 1ISJA 1CRWG 3L07A 4M54A 1XQ6A 1LJ8A 1NVTA 4XZ3A 4U7WA 1C3VA 3U0BA 2UUOA 2V6BA 2UV8A 5FWNA 3BMOA 4CM1A 3GUYA 2JJYA 4JGBA 1E7SA 1YB5A 1PSDA 4HY3A 4M55A 5DNAA 1QYVA 1V3VA 3WYCA 1I10A 3EZYA 2FOIA 4RF5A 3S8MA 2IXAA 1HWYA 1MX3A 3RI3A 4EBFA 3DAFA 3BTOA 2Y93A 2HRBA 3HN7A 3QVOA 3DTTA 1SC6A 3CZMA 5G4LA 3C7CB 3INGA 2D8AA 4IDEA 4K28A 3ZWMA 4GH5A 2OOSA 3JQCA 1NX6A 1H9AA 4O6VA 3JYNA 1O6ZA 1GUFA 4LSMA 3WGHA 4CMEC 2FZWA 2UAGA 2WTBA 4D79A 4LGVA 2NNLD 1Y8QA 3RC9A 3JQ7A 5JYEA 2G82A 4NBVA 1CYDA 1B14A 3LT0A 3LZ6A 1SB9A 3PIDA 4EJ0A 3K73O 1FJHA 1XDWA 3DOOA 5DN9A 5ILGA 5JXWA 3CUKA 4EW6A 1PIWA 4YA6A 1U7TA 2C2YA 3HB5X 2IYPA 3K8ZA 3LF1A 4WLEA 2I3AA 3GT0A 4CQMD 1Y9EA 3ZHBA 4L73A 4YACA 5L53A 4BIIA 3S2EA 2X9VA 3RKRA 1PQWA 1Q2XA 1SB8A 2Q1TA 4YR9A 2NSDA 1Z75A 5IXSA 3OJLA 4EYEA 2JFHA 2AQHA 3BTSA 3DAGA 5KNLA 4J49A 4RPHA 4CQMA 4ND1A 3DR3A 3UN1A 1U2DA 1HLPA 1NYTA
chains in the Genus database with same CATH superfamily
1DEAA 2BGTA 1GDDA 2WNHA 3NH9A 3WIEA 4O0LA 4BMSA 2V1UA 2PZ8A 3KDPA 1AUXA 3NCHA 4I4TF 4JAVC 4LTDA 9LDTA 1SKYB 1NRWA 4HGYA 3HGQA 3PIRA 1AVTA 4JUBA 7GPBA 5HYVA 1UKAA 3CNLA 2ES4A 4FQ5A 1NLMA 2OCGA 2OP0A 1P4HA 3TQRA 1JKIA 1O9GA 3BA6A 1PHPA 4R7GA 4ZI2A 1I7DA 2RBGA 3GCWA 4IYJA 1X1RA 2FMHA 4M2LA 1DIGA 3MT7A 3FPBA 1JR2A 2D0IA 5ESRA 3P0FA 5LOVB 1XMJA 2P2LA 1AO3A 3KYIB 2GM4A 1CY6A 4JLUA 4NSNA 2EKBA 3WB9A 4OH1A 1XLUA 2RKOA 1FFEA 2FW8A 2H2HA 1B76A 1GKIA 3AHHA 3DAPA 4CMJA 5EXXA 4ZARA 5IM4A 1LZKA 3N8HA 4GYWA 1NUAA 2GN0A 2OGSA 4Z8XA 1YH3A 3RE1A 3F6PA 1HNNA 2G04A 3EPRA 1SC1A 3RSGA 5J2TB 4J1TC 2BFCB 2VP5A 1Y3BE 3WGMA 3GGSA 1X70A 5T4EA 1R0WA 3DWEX 1H2BA 2QJTA 1R6DA 4RNCA 4EL0A 4PN3A 4BZQA 1KK1A 3KU1A 4TMXA 3I6QA 1TFRA 2C2KA 2QBYA 1VMIA 3AF5A 1WKCA 1XU9A 1Y5MA 2VNHA 2ZRNA 1SC9A 1P1KA 1YRWA 5GVRA 2BFPA 3I1YA 5LWHA 1HLGA 1G8PA 1QVAA 4FHFA 2W00A 4OOEA 1W76A 1GD1O 3OJXA 4B0PA 2M6SA 5BR8B 4OUDB 2N9UA 5FLEX 3ASVA 5F3RA 1MXFA 1QE5A 1XEXB 4P6VF 4MLPA 4XWTA 2P9FA 2QUZA 4H3KB 3JPYA 4HWGA 4D3ZA 3MXOA 4MEBA 4TXHA 1DXQA 3HXPA 2W9XA 5AHWA 2VPYA 5E3JA 1V1RA 3A2LA 3WGIA 1RS0A 1V7QA 2PA3A 3EGCA 3HACA 3ONNA 3V4FA 4BN5A 2X0KA 3L6DA 4IGKA 2MSDB 5KNBH 1FSGA 4IJ6A 2G9VA 1WRBA 1ZOLA 3FW1A 2H2WA 3OEHD 4RADA 3G8BA 3MQ4A 3PQCA 4ZOCA 2IH2A 3GFPA 3EIFA 2NXJA 4YAFA 2DPMA 1A9XB 2A5DA 1R6BX 1HFWA 4ND7A 4Y6LA 3PF9A 1SQFA 3I76A 4FD3A 4EPTA 1QP8A 2GXSA 3BDAA 4C2UA 1D7OA 4DLWA 4DUYB 3FCAA 3RU3A 2Y4OA 4LOAA 5B3JA 4MWBA 2XRMA 2DEUA 2O3SA 1SZJG 2TSYB 3N5KA 2AFRA 3F47A 1YB7A 4S1OA 4DYVA 4A8HA 1PR3A 4P4SA 2PUEA 1QOZA 1DG9A 2FDXA 1KEEB 1P0CA 3TSCA 3V4ZA 1RE1A 4YJ2F 3VR0A 1J4AA 1QGUB 1Q0UA 3EXHC 4Q3NA 2B1JA 3AM5A 4XX0A 3SHQA 3BICA 3VHXB 1UFOA 2CD7A 1X0VA 4QUBA 5L7TA 4L3WA 5H8WA 3D7LA 4UBNA 2J9YB 4RV9A 3EIEA 2ADMA 4D3SA 5HF5A 4G84A 5BYAA 1U8XX 3NM4A 3O7MA 1V5IA 4KPUB 2PN1A 4F46A 3BWVA 3EEBA 3OQMA 1C0KA 1KYXA 1PZNA 3GLGB 2O59A 1AMOA 1KHHA 3UAOA 1CF2O 3VDQA 2D0PB 4F4CA 3TBFA 1NPTO 1Z73A 4E1BA 2FA9A 2VCHA 2NNWB 1WSDA 4EFDA 3BBLA 3F1LA 1OAKA 4PIVA 2XXAB 3A4NA 3DMDA 3K94A 1VYHA 4HFJA 2PJRA 3A10A 3DL4A 5DT9A 4HYEA 1THGA 2CXTA 3GMSA 1WW3A 1YSCA 1JJVA 2A5LA 2OMKA 4I5GA 5E4TA 3T7DA 1JEYB 5LZ4A 1I7PA 1G5QA 3SYNA 1L5SA 1JSLA 3EIWA 1P7VA 1SBHA 1VSQA 2IXBA 3HV0A 2QMUA 4HDKA 4BL5A 4C2AA 3ZCXA 5KO2A 1R0KA 1IBSA 4FMPA 2HMTA 1KOLA 2FDCA 1M6VB 3G49A 1GKYA 3I9JA 2Z2ZA 4IYRA 2J0EA 4K2HA 1GL7A 2WF8A 3B9QA 3IA2A 3JVUA 4U3JA 4V0SA 4WI1A 3WRVA 1BO6A 1L4YA 4CV0A 4DE5A 4BECA 1PFVA 4F6LA 4N01A 1E6UA 3FUVA 3TINA 4WZBE 3F98A 2J3EA 1C1DB 4RIHA 5AM3A 5DBEX 2BZ0A 5BUSA 4C7VA 1LI7A 2Q5JA 3PVCA 4B3HA 1WV0A 4WXHA 2P5YA 3VO2A 4BQOA 3CT4A 1HNXB 3UWDA 2NU7A 2ZS7A 1B8NA 1I9GA 1GRNA 2XVAA 3NWOA 4P98A 1JPJA 2H1SA 2WFAA 5TPWA 3NM6B 3FD8A 4NFLA 1X9GA 4UU1A 2QZPA 2F3QA 2ODEA 1SCBA 5FORA 5FOWA 3CJQA 4CEHB 2XBLA 1DKUA 2FVXA 3I58A 4PRKA 4YIKA 3VU9A 5B6IA 1LSUA 4JI1B 4KITB 2XW6A 1U2ZA 5I5GA 5IKEA 2E0IA 1GNTA 3CLTC 3IP7A 4KBGA 2GZRA 1T3HA 3IDAA 4ZYXA 3O4GA 3SF8B 4OGGA 5K0TA 3T9FA 4TL7A 1XRLA 5BPHA 4ER7A 3FI0A 5DNCA 4W6ZA 1GPAA 4M7OA 3NYWA 1DBQA 4II7A 3PTAA 3T1HB 1GITA 4NJEB 2Z5FA 5AYVA 4RA9B 1XTVA 4D9GA 2Q5HA 2XV1A 2ZWVA 2VTBA 4H0NA 1SVUA 5J4YA 4FMCB 1JX6A 1T2UA 4ZOAA 4C3ZA 1HORA 2C4WA 3AXSA 1FXUA 4OGFA 1TYAE 4NNOA 3SHVA 3VOSA 2P2CA 4W7SA 3K96A 1C50A 1NVWQ 1V8ZA 1VIYA 2RHMA 2VH1A 1ISPA 1XEWX 4WVFA 2FQQA 3C48A 1PTKA 3DV9A 1NN5A 1ULBA 1SFRA 4FSHA 1F4LA 2ODWA 4OFWA 5HFAA 5H1YA 3G5AA 4OLFA 4PWZA 4JY7A 4YAWA 2COEA 1SD1A 2YZMA 2AVDA 2H1FA 3GEPA 1K6MA 4UUNA 3GN2A 3E7FA 3TSAA 4GR4A 5ADWA 1NMEA 3ZJYA 1FXSA 3FY4A 4KGDA 4XGKA 2WMNB 2CKDA 4BVEA 3VUEA 3AY7A 4HWTA 4NDZA 5EPEA 2QW8A 1ODFA 4CIVA 4Y2JA 3MHPA 2W93A 3AERB 3DNMA 4HB3A 4OOFA 3TPZA 3I72A 3RSCA 4NBWA 4ZIRB 1U7UA 2AXNA 5FLKA 3N0TA 3D8UA 1QOQB 3QKSA 3A1NA 3AIIA 4P93A 5E38A 3WGGA 5AI8A 4A6XA 4N8EA 4F8JA 2D1TA 3CF2A 5ANRB 4BMNA 4C1BA 1V41E 1VKZA 2H9AA 4E08A 1Z0UA 4TZ0A 3G0GA 5KYUA 2CBZA 2J3JA 4FEYA 1BFDA 2BOVA 3QFFA 4H6WA 1VI6A 2WWVD 3A9CA 1KEPA 5EJAA 4DSAA 2NPIA 3PL5A 2A3RA 4JBIA 1RJFA 3EZFA 5BQXA 5KAMA 3ETGA 2O2XA 3KJFA 3LFTA 4U0JA 2PSFA 2Z5VA 4DRXB 3ASYA 1KAEA 3PA6A 2P6MA 4JLKA 3FDZA 2EFEB 2DSTA 4L72A 3JARA 1WDWB 3NWBA 3PFCA 1NG9A 1ZOSA 5DU2A 4MYSA 3G2HA 3K70C 1C3LA 1SXJB 4UVDA 3RFCA 3EMBA 2FX2A 2XTAA 3BL5A 3F6YA 2ZR8A 1K98A 1NXQA 1MAWA 3TTTA 3OQHA 3O38A 2BSXA 2WYVA 2JS7A 2YW2A 1YI0A 5I9TA 3ONVA 1LC3A 2R79A 2A7XA 2BCEA 3HXTA 3KIPA 1G5IA 3T06B 2KX7A 3GVCA 3M1YA 4V24A 9GPBA 2AFVA 1U7XA 1FFXA 3I9KA 2J3DA 1X8KA 2R6JA 2FMUA 2JLSA 4MVWA 1MEEA 1U0EA 1R0LA 3G1UA 5DHFA 5JEEA 3LBHA 3ZJTA 2SCUA 4MGIR 3AU8A 1HYGA 1J7JA 1QGAA 5CA1F 3QJYA 1EM8B 2OBLA 5L6LB 2JHFA 2FPKA 1YV9A 1RRMA 3FIUA 1JLLB 1KQOA 3R9KA 4CEIA 4XAQA 4IQGA 1RDFA 3K0SA 1TCVA 1IXKA 1UKZA 1VJ1A 4MRPA 3UUWA 4MUGA 3OEED 4TRRA 5DGDA 1JT9A 3R5XA 1VCIA 1E3WB 4NARA 1WDLA 1OKKD 4F1WA 4CMAA 5JFTA 1E2EA 4H7EA 1PT5A 3WSWA 3RT7A 3AG5A 1YZTA 4D56A 5EE0A 1CNMA 1SD2A 4N7MA 3NM5A 2WM9B 3KFVA 2PPVA 4XR9A 4XYLA 1RR6A 1IPHA 2FYTA 1QZXA 2A84A 3BXGA 5EVJA 5AJXA 5REQB 4C7XA 4OFBA 2WU3A 3RS9A 2XSZD 4YHHB 2WPNA 3NMUF 1XVUA 1KBQA 4P4GA 4UE6A 4ZCSA 4Q9JA 1FLVA 2HPZA 4XUEA 2C94A 5ENVA 1W36D 4NE2A 4LTNA 5AH0A 1MH9A 1PS0A 3KQYA 1TLLA 4DIBA 3ZWBA 4BHTA 4CKBA 4D9KA 1NI3A 3A9TA 2A3NA 2A6PA 5K8CA 2VZ9A 4XI9A 1GU7A 1WBBA 4PPFA 4N6OA 4QA9A 4OHZA 5B7QA 2R44A 4I9NA 2C2WA 3BN3A 3DMYA 4MO9A 1UBOS 5ECYA 6ABPA 5JW6A 4NULA 3CW8X 2ZR7A 4JEIA 3ZEIA 5A0VA 3KNZA 1XMVA 1O5OA 1S2NA 4ZAGA 4KKXB 3ORSA 1FUIA 1NFFA 1QZZA 1Y9ZA 2Z6VA 1QR2A 3THSA 1AH2A 2AG1A 3RUFA 2C2MA 2ZI6A 2WAYA 3WMWA 2ZBRA 2VWQA 2ZIAA 4GZMA 4KO8A 5CTJA 4XPZA 1N2JA 4PZCA 3ZHOA 1M1ZA 2NU9A 3ZGVA 2HGZA 2IUSA 3COSA 5K8LA 4B75A 3MUOA 3PYMA 4WFJA 3TIVA 1A9TA 3DLPX 1BXKA 3TTUA 4I6GA 1QAQA 3CR3C 2H57A 4QDXA 1YRBA 2JEYA 2W2TA 3PDIB 1MABA 4JQZA 3IP3A 3AVUA 4Q19A 1KU0A 4IJMA 4UEKA 1M6NA 1UWVA 4FU0A 3MGKA 5ALNA 1N5RA 1V4NA 4KU4A 3Q40A 2Q5EA 3S7ZA 1T6XA 4D9EA 4O2BB 4IIVA 2FFRA 1UC8A 2YMQA 4Y0VA 4U63A 4EW1A 4C2TA 5DYIA 3PFWO 1KMHB 2DT5A 2I65A 4ZYUA 1FFSA 3IDOA 1S2LA 1GV1A 3EDYA 5EY5B 3M6IA 3K0FA 1R50A 3PG5A 4M0KA 3EFOB 2G28A 4L6IA 1QQ7A 3R3YA 2BVNA 4KMSA 1GPYA 4BKPA 2J6HA 3GJ6A 2PWZA 4Z9YA 4HNUA 1T2EA 1CZRA 1YZ3A 2VDWB 3KAPA 4QRDA 3SQLA 1UIMA 1DEKA 1D9XA 1SUBA 1XD2A 1PGPA 5LB4A 1V16A 3N75A 4QPZA 3LRPA 4B3FX 5JYBA 2NQTA 3GLIB 1FS6A 5JVDF 4X90A 3OLZA 1G21B 5IHXA 5LIRA 3EHDA 2EBUA 2TECE 1VA5A 1Z2OX 2HIHA 2OENG 1U0OC 1KRHA 1Z6YA 4GPTA 4S0ZA 3A4LA 3INNA 2VPZA 2IX3A 3V7FA 1YR1A 3GCXA 4H7PA 4XIFA 3TSYA 5G0VA 1NQUA 2IEYA 4MROA 1A0OA 3AHJA 3E9CA 4I5DA 4W1QA 4PTZA 5F1KA 2YZ2A 3R0XA 4JV5B 3GEBA 3H75A 1YS7A 2XMZA 2P67A 4Q4CA 5K6TA 3GDGA 4R98A 5EJMA 4OUDA 3FSGA 4KTVE 1XA4A 1XEXA 4YONB 4QYXA 4YJFA 5C8VA 3T7AA 3C97A 5A4KA 1E2LA 3N07A 3UA4A 5I5EA 1FVHA 4GKKB 2NAFA 4J1SA 3ZI4A 3W9YA 4ESVA 4H6VA 1S9DA 1Z38A 2OKCA 3AMVA 4RETA 5JG7A 4BN0A 2WA2A 1JVSA 1DJQA 3NB0A 2IV2X 2V98A 1VKJA 2J6BA 3CX8A 3IDQA 4YCAA 5FADA 1XMSA 3WGNA 3ZVRA 4BVAA 2X8JA 1W4LA 2XRYA 4G1UC 5FBQB 4IHJB 3ZQ6A 1MNQA 3U4CA 3L8MA 2QD3A 4ND5A 2IL1A 3DKIA 4M0UA 1KQPA 3DMHA 1A9XA 5JCPA 1SWVA 1UH5A 3GB9A 5CFRA 3CNNA 4MPJA 3JYQA 5C5EA 1Q57A 3HQ4O 4B87A 2IE8A 4Q1BA 4RUKA 3OFJA 2A88A 4QOGA 3VTFA 3WLAA 3WRYC 3EWAA 4WXPA 4CLRA 1QHXA 4MQMA 2AI3A 3RTDA 1Q91A 4EI2A 1EXWA 1T6BY 1WSWA 3PUHA 3RH0A 1T5TA 1RYBA 2X2OA 1NF8A 2HBQA 2YWEA 3OZFA 5DGHA 1MRZA 1LQUA 4GPZA 3HJRA 3IJRA 1FOEB 1V6AA 1VXRA 2B78A 3AFIA 4L75A 1OJLA 2B7BA 4I4TB 4S2UA 5SICE 1XI2A 2E89A 2Q9AA 1IC6A 1TU0A 1LV7A 3JAWB 4Z1MA 1O6BA 2IRWA 3A9VA 3P5BA 2LE0A 3VHXA 3CVUA 2R00A 3D81A 2X5KO 2D06A 4JXJA 4MLDA 3RAGA 4MW4A 1ANKA 2WJIA 1SGWA 3NYIA 3KB8A 1SXIA 3HO8A 5KCMA 1PAUA 1KMCA 1RXSA 1DX9A 3GDOA 1BH2A 4J9UE 3UGKA 3NETA 5IT9A 3RARA 5LD2C 3M4YA 5AIBA 3H9BA 3LG2A 1CP2A 4IIDA 5L3ZA 3W1EA 2WRZA 3GBSA 4QVIA 5CX1A 4K6KA 1KETA 4WZ6A 4ALIA 4EEKA 3WNDA 2HRRA 5HEKA 2X0NA 5HMMA 2XXAA 3M7IA 2FK8A 3L1JA 5LL6P 2E21A 3JD3A 4CCSA 5BMVB 3W5BA 1JIIA 5CG1A 2COUA 2AFHE 4IG9A 5JNVA 2VHQA 3A1FA 3TQSA 3OECA 1AKWA 5IULC 4RD6A 2CFOA 1ILWA 3W0LB 1ISIA 3AI1A 2GILA 4KYTA 3HDQA 3P9KA 3S2GA 1YDMA 4TLAA 1Y4UA 2W4MA 1ZJJA 3K0BA 4D41A 3R5SA 5K01A 1DC5A 1BE0A 1C8LA 1EFTA 1M6VA 1VMKA 2C95A 3A9RA 2C8VA 2YCBA 3KLPX 3PQ3A 4ZICA 2H4ZA 2G76A 2QGFA 1U9ZA 4CUKA 1OLUA 1Z5ZA 1UWCA 1M1XB 3NBYC 4RD2A 1NW5A 2Z5GA 2QZ4A 5ES3A 8LDHA 1MZPA 2E6UX 4N7RA 3CUYA 4OG2A 4RIFA 4UCXA 3OT5A 5CUQA 4CG0A 2UVPB 2N42A 2HD4A 3PC8C 5AJYA 2QRKA 4PLTA 5H3HA 3FTQA 1JR3A 2IJGX 4Q93A 4ZHQF 4WERA 4UAGA 4LBVA 4GM0A 3CMCO 5ALPA 4LJLA 1U8UA 2ZREA 5JE8A 4ENSA 2C92A 3TNJA 2GLTA 4YYZA 4PYNA 5JR3A 1J1ZA 3JYOA 5G3YA 3AP3A 4FFNA 4LMPA 4QX6A 5J2UB 1HYEA 4I9HA 4ND4A 1EUQA 3FDIA 5A0TA 2EWMA 3M2PA 2XUDA 1H8HA 4O1HA 4TTSA 4XJTA 1XJWA 4JBYA 4IXWA 4BLVA 4L4XA 3K30A 4ENVA 1B0ZA 2E4UA 5JQGB 2R6ZA 3BIFA 4M9XA 4PG5A 3T7TA 5SZHB 4F9GA 1CUUA 1G5FA 3MELA 3JTEA 3P7MA 2LGJA 4OLBA 4TYQA 3VVMA 1S5PA 1H8EA 3K7EA 4KFSA 1ZCBA 4TSFD 3JTMA 1O0BA 3TPFA 2XT6A 1P17A 1E6MA 1TZKA 3SXPA 1T1RA 2WWHA 4F3TA 1PE0A 3KE9A 4BN4A 2H2DA 4JP3A 2I4MA 4IMRA 2A57A 4M9QA 2AW5A 4HJRA 5BW6B 4BP1A 1T9BA 2G0NA 2I4NA 1MKYA 4YJ2B 4FXPA 1Y5LA 5LQDA 1ZC4A 1II0A 4PEVA 1E7QA 2F8TA 1JP7A 4QLAA 2NQ8A 1IK6A 2AJTA 3GJ0A 3KQMA 1XTZA 4BVJA 4WCDA 3LHDA 1V0JA 1Z5UA 3RRZA 2IUTA 4O2AA 4O33A 1U63A 1XXHE 3AXTA 3R3ZA 2ZQZA 4LX0A 3R9WA 4GKAA 4Z54A 4GXRA 2IYNA 1RABA 2OXRA 2EJWA 4GXTA 4XWAA 1GAEO 3IYLW 4YJGB 4FGSA 5IH7A 3AHDA 3I5AA 3OCZA 1TGVA 3ZW8A 1XGKA 2WAXA 4FBLA 4K81B 2AZ4A 4XCVA 3BL8A 3EVEA 3BRSA 2FEMA 1V39A 2FPWA 4MR8B 3ULKA 4O4HB 3UXEA 3U3XA 5I7HA 1DAFA 1IEXA 4LYEA 4Z4GA 4YAEA 5FULA 3P71T 1E66A 1XDSA 4FFRA 4WH0A 4BO6A 3UHFA 5CB4F 7AT1A 1RAGA 3M81A 1JALA 1W4BA 4I4LA 4ZMRA 4ZIRA 2GF0A 1BJKA 5CITA 3DUWA 4DA8A 3JQGA 4OQ4A 4BLQA 1FNSA 2NVWA 4KPEC 3ZDCA 5JNWA 3ZJ4A 1YQUA 3D4OA 3EZ7A 5TGZA 1QX4A 1FXWA 1O8CA 1SMKA 2FXIA 4JVSB 1EFAA 1LLCA 1ZC3A 2ONCA 3BGWA 4OA8A 3FPKA 3FZNA 5F2OA 1C7ZA 3B1ZA 2JAOA 5LXTB 1M7HA 5F9HA 1CTQA 4AJPA 3WAKA 5FNZA 3WKBA 3NT2A 4MPPA 5KYXA 1DCFA 2YY7A 5EIOA 3H11B 2N1BA 3Q15C 1N9KA 4HRAA 2ZYVX 4JJ8A 4C7JA 4DRXA 4E94A 1QYIA 5A9SB 3ZYCA 3TW0A 2IZ1A 1QHFA 1IBLB 3C3KA 4J94A 1LRKA 4EB6B 1XA0A 1MRNA 3DOCA 2QYTA 1Y6JA 2GB4A 2IXDA 1U90A 2OV8A 2H54A 3STTA 4IFTA 3MXTA 1M5TA 2QMYA 3LBNA 4M36A 4MQEA 3UT6A 1CY8A 1XOIA 3EF1A 3DE2X 3UNXA 4ZVRA 1PGOA 3IUJA 3KKLA 3W2FA 5DK6A 4MRVA 4FCWA 1M7BA 2C3OA 1N5MA 2ZVDA 4OU5A 3TDKA 5CVDA 4ZK2A 4CGZA 3H04A 1J21A 4CUJA 2DFVA 4G5QA 4RO0A 5DYGA 3CGWA 1TJ5A 1USKA 2WB4A 4K9LA 1VJ5A 4ND8B 2H7YA 2AGVA 1VB5A 5KEIA 4NECA 3DAYA 2FH5B 3DWGA 3WDSA 3BE6A 1GPNA 3CB4A 1WULS 1SC4A 2OV6A 5TGTA 3E1SA 5KDLA 3OSZA 4WFQA 3I5YA 3G5LA 5CLGA 1SHZA 3RYTC 3FHTA 1MO6A 3DLBA 3B1JA 2FSHA 3I1JA 1E2MA 2FLKA 2RB4A 4U00A 1NIJA 3TW6A 4GBGA 3T0FA 2C42A 3EVGA 1D8TA 2Q1XA 2PA0A 3RANA 1T8WA 1SBCA 2JFFA 4J76A 3FLBA 4LV8B 1QONA 2AEFA 3AR9A 3I5UA 4FKMA 2IUUA 5I9NA 3PGJA 1XA3A 221PA 3B3FA 4YEDA 5ARDA 1FDTA 1W0KD 1ZMRA 2P62A 2AEEA 2WKRA 4U7FA 1CZUA 4DJFC 1K5GA 2P65A 2VJNA 4ZVKA 2ONJA 4EPVA 3MWGA 4NK5A 3BJMA 4F5EA 3ZLTA 4JJ4A 3HKCA 4RTRA 1MW8X 1RBYA 3QPDA 3EPKA 2O05A 3PUYA 2EHJA 1CR6A 5GZ3A 5JRJA 2FF7A 3MGCA 4PAWA 1BSVA 3IBTA 2DUJA 1VYTA 2NN3C 4MH0R 2OZVA 4MZXA 3ZQJA 4HLQB 3VI3B 3Q6MA 2QXTA 3WQRA 1PKEA 1YZHA 5TT1A 4R1OA 3MBIA 3NDJA 3ZX5A 4OIFA 5A3VA 2Q3HA 3VU8A 4RDCA 4LJ6A 2FSPA 2WP0A 2Q41A 1VIDA 4NOJA 4XTCS 3E6AA 1MFPA 5A4DA 2J6CA 4RVSA 4AWAA 5IVHA 3VR2D 2X13A 1GNLA 3AESB 3BE5A 2QTHA 3RABA 5ER9A 4MQBA 5KYWA 1J5PA 1UBMS 3WLPA 3MM4A 4D8UA 4YXWD 5KQSA 4NEHB 5IBRA 3SS8A 1S8NA 1VL8A 1K8YB 2IDZA 2PUHA 4U39A 3MBOA 3DDHA 2D1RA 3QHPA 3RSFA 4A73A 4E5DA 4IF4A 3RIEA 3PXBA 2H5IA 1ZISA 4P82A 3LPMA 1WUKS 3DH0A 3OE1A 3ZCPA 1VE1A 2FZVA 5LCXA 3UK0A 3KOOA 1GL9B 3R77A 3V7YA 4YJHB 1DTWA 3CNBA 2NPOA 4O2BA 1ENOA 5I7WA 1A77A 2OVBA 1FNCA 3SHFA 5KQMA 1AF7A 2IEDA 2I66A 2IQ5A 2QL6A 5BSKA 5KVAA 2AN1A 3CLRC 4BV3A 4UBMA 4IZ6A 4PIPA 2Z8YM 2CHEA 1E9EA 1JHVA 2PIAA 1Z74A 4WOKA 4GUAA 2PMEA 3EFOA 3R0JA 1EZ1A 4L0CA 1OH5A 2I91A 1DTEA 5CA1B 1DT5A 1PG5A 4FGKA 3FNRA 1HBJA 1CDZA 1F6WA 4M7WA 4W99A 5M34A 2Q4RA 1J8YF 3ENQA 1Q0QA 3PRJA 4J0IA 3RVOA 1CZKA 1NVMB 2HU2A 3GLIA 2CZGA 2DBVO 4FIZA 1N2SA 1O95C 2OD2A 5A6SB 1DAKA 1R10A 3IURA 3HK2A 5ALKA 1OREA 4JL6A 1T35A 3B7WA 3QXJA 1PEYA 1BN6A 4FD2A 2ADOA 4NNPA 3GT3A 3N8IA 2OGTA 4WCFC 2H4JA 4BNFA 3DAHA 2YS7A 5HQJA 1GG8A 3WK9A 2Z43A 1KEUA 2QTGA 1MT0A 5BV8A 3Q3GE 2ZUVA 4XM2A 1ZCFA 5AHOA 1DEOA 4KFRA 5BN4B 1EWQA 3R5KA 2O50A 2PO5A 4DJAA 1USIA 3W2GA 4ZAYA 3C3EA 4HAYA 2PSSA 2C3YA 5KJCA 4N9WA 2Y0DA 5HKLA 3UJ9A 3PXUA 1IWBB 1M33A 2QRMA 3D8HA 2NXNA 4MJXA 2TMYA 3MT0A 1KEZA 1KJNA 1CLUA 3OTGA 5EEGA 5T67A 1VDZA 4BLWA 2AKYA 4ENPA 4ZPXA 2XMPA 3GRKA 1HI9A 4GL4A 4KDRA 4EKGA 3S6JA 1UK6A 2OYSA 3FYCA 4A1FA 1N32B 4YRFA 4TM8A 4QDUA 4BMXA 1K2VN 4A26A 1NBOA 4IHJA 1MVOA 3OIYA 3KT6A 4DLPA 3TQHA 1APBA 2YXBA 3WGZA 1CUYA 1HUQA 2ZQYA 4GLOA 5MN4A 1BX1A 2QK4A 2JLCA 3UEOA 3VVBA 3ZE9A 2O52A 2PL5A 4AO8A 1IVNA 1OT5A 3MSCA 3HNRA 4F6RA 3QBJA 1KH1A 4X71A 2JI9A 5B4TA 1EXDA 1GZ3A 4G2TA 4JLBA 4NI5A 1NNI1 1DCTA 3WK8A 3CTPA 1YKGA 3W1WA 2P41A 1C2TA 4GVLA 2LCIA 2QTNA 3CY6A 5LQRA 1QH8B 3ORQA 2C07A 1W88B 4RIIA 1EVQA 1T9KA 2NV6A 4Z86A 4D9NA 4ZV4A 2Q5IA 4XGIA 5JIBA 3QWFA 3Q7RA 3HO1A 4TKMA 3FKSA 4YS6A 4CGYA 2QSJA 1YHYA 4MARA 4QBKA 2CB0A 2G4CA 2W2QA 2BY4A 1UXGA 1BS9A 4MQ6A 3R74A 2PKEA 3AEUA 4XFKA 5DXAA 2ZYRA 2BEVB 4OK5A 5JNTA 3DQZA 1NG1A 4RTNA 1PVVA 1XTUA 2VJCA 2PRZA 1KO8A 1E9RA 1DG3A 1TCUA 2DP4E 1A9PA 1AGXA 4WT7A 4EYSA 2JRCA 1CR2A 4DTCA 2CXPA 4JJAA 2AF3C 3E58A 2VRWA 4OM8A 4EIWA 4ZEVA 4BFSA 1KVQA 2IHZA 2ZXEA 1FPQA 1FFBA 1D07A 3A06A 3GUUA 3H5LA 4FUQA 4UM8B 4DQUA 4PZEA 4XEHA 1ECCA 3C74A 2PYIA 5BQ3A 2EW2A 2PLRA 3IV6A 1I8TA 4WKGA 4B09A 4E7PA 5BMVA 4IDDA 3DDCA 1ZH6A 4JEMA 2H8KA 4YDSA 2IK8A 1Z26A 1DB3A 3DZFA 2CCGA 3HRKA 4IR7A 1MR3F 1OJ7A 2IA5A 5CYOA 2XOKD 3CH7A 5CLJA 3C43A 2O6LA 3FWZA 2HT6A 1Z0SA 3F3YA 2A86A 3L2OB 5HDBB 5SZIA 1CPYA 3ZY6A 4JI5B 1LA2A 2XNSA 3M6VA 2ECQA 2GJ4A 1P8AA 3FPEA 1C4XA 3HCAA 3NBFA 1ZAKA 4Y9UA 2HAEA 4EI8A 2IEAA 5J4HA 2OCYC 1ZLXA 4Y1RB 4BX9A 2XCSB 3O1IC 3AKDA 1MLDA 1E1KA 1NVUQ 4QDKA 4DJJA 5J43A 5C46F 3GPCA 3B82A 5ALZA 1C3OA 5B58T 2ZSEA 3LNCA 4ZO9A 3HFGA 2UVPA 4S12A 1KPGA 2QD2A 3BWCA 3M70A 4OREX 3WL3A 4IFBA 1T2VA 3QI2A 1A82A 3NHRA 4LOJA 3RJMA 4J07A 3R0ZA 3CH6A 4H1HA 1X7XB 1IQRA 1XDGA 1L6IA 2BZ1A 4D9HA 3HDTA 2BH2A 2WWGA 3V1YA 1AT1A 2FXVA 2I76A 3A6GA 3MYYA 4J75A 5J2UA 1Y6QA 2I3DA 4JT8A 3O7WA 2DWCA 3I32A 2FF5A 3M6UA 5JQGA 4TS3A 3MOIA 1OI7A 4OMCA 2BF7A 4XEUA 1WY5A 1CQJA 1E1CB 3Q9NA 4B17A 1P1JA 2AQ8A 4GSLA 5BR7A 2C4HA 16PKA 3DCNA 3QYAA 4FOTA 4X94A 3RYHA 3NRJA 4LI3X 2D59A 1E2GA 1QHEA 2ZT7A 1P0MA 3U7EB 4IH4A 4EFLA 3OF3A 1LXCA 4F8EA 2FEOA 1L8AA 2B37A 3TLAA 5JYDA 1GTMA 2J3LA 3UTDA 1E8DA 1MB4A 2YQ4A 1QDUA 3Q7IA 1LLFA 3DTVD 4OJKA 3ZIDA 2F1JA 1IE3A 5TVKA 1S2GA 1HURA 2IHBA 3U26A 2FGJA 4HZGA 4XUDA 3OIFA 3VAAA 1VJ0A 2IV7A 5IVDA 1E5VA 1GLVA 3A4YA 3L0ZA 2HV8A 4FYVA 3ZI7A 2MMGA 5CK4A 1FP1D 1SD5A 2G09A 1G20E 1Y1PA 2PJDA 3ML1A 1SO8A 3TJMA 2OUIA 3PS9A 1FRVA 1A5ZA 2QAGC 3P97A 2QD5A 5ALUA 3WL5A 3PLAE 3N1UA 2JIOA 1X2EA 4C2BA 2QJRA 3WK5A 5JWOA 2KQUA 3IRUA 1C7JA 4WBXC 4ZOLF 3OZGA 3BRWD 3U1BA 4RPLA 3IE1A 3DE3X 4KXYA 3ESYA 4YCSA 5ICGA 1QFMA 3IEKA 3QE3A 1T0JB 3NC4A 4K7JA 1XYVA 2W8BA 3A2MA 3V4LA 3K0EA 1UXOA 1N0HA 3CZCA 3I0MA 2E6KA 2QVBA 1CJUC 4R51A 1P4RA 1QIFA 3RVPA 4D6YA 4M8KA 1AC5A 3HJTA 3KPJA 3SZUA 4FYPA 1PZEA 3W7AA 2Q29A 1QX3A 5HOQA 1H1LB 5K3BA 3S70A 1O9BA 3BMXA 1XTKA 1U81A 4LGYA 3G89A 1AE1A 4JYCA 4NABA 1GGHA 2REXB 3WK6A 1YUBA 1TF5A 2O3TA 1RZVA 1ZM7A 3VH4A 4BQQA 2GEDA 3MBKA 1L5FA 5F5XA 4O2AF 1Q3HA 4HRVA 2RI0A 3UY4A 3KVVA 5LXTA 3DEKA 1HQYE 1VIAA 4LCBA 2GD2A 3FOWA 3OTHA 3T0IA 1ZU5A 3N7TA 3H11A 1SIBE 3NLLA 4ZYTA 1WLYA 2GHIA 3V9PA 1RRPA 5EHZA 2I2FA 3DQPA 3B3GA 3JRWA 4N8SA 3PT9A 2IBSA 1NE7A 3R6DA 4OQQA 1E3JA 3LLUA 1F0YA 1ORVA 1Z15A 1FCJA 5GM1A 2ZUTA 1XRJA 3T1QA 4TLCA 1YGPA 2HNBA 2PY6A 3TB4A 1TJNA 1P39A 1FRFS 3Q7PA 2C5AA 3AR4A 3PWZA 1CJMA 4ETWA 5FNVA 1T5SA 4J1TA 2DQYA 1CNFA 3OZRA 5GP1A 5TMBA 3WYAA 4ARAA 3HBAA 4C9BA 2AG0A 3F4KA 3E0XA 3Q4GA 4B3SB 4UW9A 1AUOA 2VNSA 1ZNQO 1N6OA 2DPYA 4CM9A 4FCTA 4GHWA 3WISA 4Q3OA 5AKZA 3WB2A 4JSRA 1E1MA 3FPSA 3RYIB 5JSZB 5I01A 1RFLA 5NULA 4LDNA 1DLIA 2JFWA 3CF6R 3O83A 1O6GA 2Q3JA 3B8EA 5IAEA 3GRAA 5AVKA 4AJNA 1EUZA 2FFAA 2ID7A 1LRJA 1Z06A 2P6NA 4FYYA 4G4JA 1U2GC 4PO9A 2P9ZA 3RM3A 3QU2A 4ZAVA 3UJDA 1JA0A 3D8NA 5FPHA 3O4JA 3RUPA 3WLIA 3KVYA 3DD1A 3WWPA 3LW8A 1DDIA 4LNHA 1P74A 2G1JA 4XSHA 2CDCA 4DXAA 1P3DA 2DX7A 4FZ3A 4IDHA 5FI1B 3IP1A 3LO5A 1GAWA 1XVVA 1K5HA 4C1NA 5AVYA 1I1HA 3TTXA 4IWNA 2NZ2A 3V2IA 1QXSA 4Q9NA 1RQ7A 3HRHA 4MQLA 3F7NA 1NT2A 1ORTA 1DJMA 2PGLA 1EFVB 4EI7A 5K05A 2QEQA 4IUBS 2FE1A 1QS0A 3IXMA 4M9CA 4FI3C 4KKVA 1TIPA 3MN1A 4X85A 1DCMA 1T6NA 3NVMB 2H08A 1YBAA 3MRVA 1P8JA 4LOHA 3VKGA 5EEHA 1M83A 3B20A 1NULA 1ZVVA 2Y1CA 5TC4A 4E3WA 1PG2A 1KI1A 1ZVKA 2N1MA 2YY5A 2DHEA 2PM8A 3SU8A 2N47A 2XTNA 3SYRA 4J91A 3AUUA 3KQQA 1MJNA 1ZUHA 1ODLA 4MNTA 5K7SA 4CTOA 1GRRA 2JFUA 4X1IB 3ZGLA 4NS1A 1U5AA 3LHIA 4IWYA 3EXHA 2OLJA 4QODA 2Q3CA 3ZD9A 4CL2A 1NY6A 3AESA 1H6DA 2AOXA 3R7AA 1T4BA 5T3UA 3FOCA 1JE0A 2AZTA 2JCYA 2ZPAA 3PFIA 4M9SA 3MQFA 3VZSA 1ST3A 4C4XA 1FMFA 4FS3A 3WR5A 3T15A 1FYDA 1UPCA 3IUEA 3OJOA 2G7MC 1JQEA 3LBIA 2Q9UA 4RLHA 4WAUA 1QYXA 2NTJA 4D0NA 2RH9B 3MCWA 1ZGBA 2OILA 1JGTA 1L9XA 2BFEA 3CGGA 3K1AB 3MJFA 3PGA1 2OHJA 3CN9A 3KQVA 1P9WA 1XNRB 1H6BA 1MZVA 1JU3A 1P9OA 1X86B 2O0MA 1Q3KA 1HTTA 2OUKA 1MXHA 4MTCA 3ZDZB 1J07A 4ERXA 1HDOA 3RD5A 5BYKA 2AI1A 2B8WA 2J5KA 2ZJ2A 3CLSC 1Z8DA 2NUTB 3DOIA 2YIVX 3BRQA 3NOXA 2VHXA 3OQIB 4TV8F 4AMBA 4YJHA 1G7TA 4HGQA 4DPLA 1MJHA 1A1VA 3WKCA 1Y7HA 1XFAA 2IEIA 2R5FA 3IMCA 1EFKA 3B12A 1TM4E 1TIKA 3DL2A 2V7QA 2DR3A 1MDBA 2EW8A 1JEAA 1F2DA 1K4KA 5FOQA 2DQZA 3LT4A 1GRVA 1NL3A 1RPNA 2Z0MA 1S7GA 5F9FA 3M34A 2YR0A 3P96A 4NK4A 1RE0A 1ZL0A 3OE4A 1RT9A 3MJDA 4O25A 2XYQA 3B1FA 1SRRA 5B55A 1W5SA 3H4TA 4F7WA 4ZO4A 2GEJA 3MWDA 4KB5A 4DJ5X 3IVGA 3WLOA 2CJFA 2WF5A 5DSXA 4L5JA 3DDWA 3AO0B 4B6EA 4F8YA 3KZKA 4OMDA 3KZCA 5AXBA 5BQPA 4R9VA 2AOUA 1GILA 2MYPA 5EJFA 4B31A 1HLDA 1I14A 4EAAA 4C29A 2Q1WA 1JR4A 1LI4A 4HCJA 5JSKA 2I2CA 1F4VA 1GSIA 3SVZA 5ETJA 4RK4A 2RIRA 5JXJA 2ZTMA 1U0GA 3GW8A 4KWIA 1BMFD 2RHDA 2XQIA 1UZNA 2VHJA 4N5NA 5AW6A 1UCFA 3OPYB 1RWPA 1HMPA 1W1WA 3W5AA 1WEHA 2QTCA 2WU4A 4W82A 3HDGA 4CU2A 5G1PA 3MB8A 4RZUA 4ASUA 3RSOA 4F5DA 5JLAA 1UJ2A 3TR0A 3X1WA 2DMRA 2BBTA 3ND8A 3QGMA 4FGZA 3LZDA 3EOZA 3ENNA 3GZNB 2DLNA 3FTPA 3KRTA 4M53A 2EARA 4REOA 2G63A 1EVZA 5ALRA 3SOPA 4EJMA 3TZCA 1C0IA 3NRCA 2G70A 3ZWPA 2NO1A 3TAXA 1D1TA 1HXHA 4UFNA 5CVEA 3ZNQA 3EGOA 3QLJA 2C5GA 1KO5A 1P77A 4JJEA 1THZA 1JLMA 1WY7A 2WTEA 3C41J 4XYGA 1GQFA 1HT0A 2DFPA 3GG2A 4JN6B 5COQA 4OBXA 2DPGA 2FKNA 1P7YA 5ERXA 3W05A 2AH5A 4M37A 1KIFA 2PWBA 4L74A 1N0UA 4GXNA 4ZYZA 4JHXA 1LPNA 3HZHA 1JWBB 2EDCA 4ZGBA 1ACJA 5IDQA 1CSEE 3QBDA 4WNCA 4GOKA 3NQ41 3SZLA 1R0BA 2QMEA 3DT9A 3NHFA 4KI0A 3ZNOA 2E4ZA 5J5AA 4QNRA 1YRAA 2AZXA 2XT0A 5E7MA 5LZ8A 5IYZB 1XL1A 1OBOA 1XP8A 2PX8A 3IC5A 4HS9A 2FW1A 4DDMA 3KV1A 1H1TA 2FPIB 1U8FO 5LN1A 2ZRFA 1PJSA 4BU1A 1EGHA 3U81A 1P80A 4PGGA 4C76A 2MSCB 1LLDA 5DX8A 1K8QA 3H84A 5KIAA 1UOPA 4PQFA 4C78A 2P3QA 5C2JB 2YZKA 4WN3A 4ZVOA 1XVIA 4MQ4A 2B8NA 3NP9A 3L7KA 1X39A 2L0XA 5BRAA 1LDEA 1R0SA 2GPYA 3HH8A 2GVNA 2PXHA 3EZLA 4N9QA 5BMOA 2W2KB 1DKPA 4CM3A 5HZHA 1N8TA 3IXQA 4JT4A 1IB6A 1XQYA 4NJOA 4UJ5A 5BSFA 1FUUA 3D0RA 4E5UA 4Z4EA 1TO6A 4UAUA