4YAJA

Ca. korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 (apo form)
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
461
structure length
461
Chain Sequence
DLERLFNPSAIAVVGASKDPSKIGSQILRNLLSYGFKGKVYPINPTADELMGLKCYPKVSDVPDKVDVAVISVPSDKVLGVIDDCGKAGVKFAVVITSGFKEVGNEELEEELVRRAHSYGMRVLGPNIFGYLYAPARLNATFGPKDVLSGNVAFISQSGALGIALMGYTVVENIGISSIVSVGNKADLDDVDLLDFFDKDPNTGVIMIYLEGIAPGRGRMFIDVASRVSLRKPIIVIKAGRTEVGARAAASHTGSIAGSVAIYESAFKQSGILMAKSVEDAFDWTKALSWNPIPEGERLIVLTNGGGAGVQSTDTFADNGIYLSKPPESLIQEIKKFVPPFASFANPIDITGMAPDDWYYMGTLAALKNPDVDALTVLYCQTAVTTPIGVAKGIVDAIKEAGNSKPVTVGMVGGPEVAEAVSFLNKQRIAAYPTPERASSAMSALYAYARARSYVMKSLAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Korarchaeum cryptofilum opf8
molecule tags Ligase
molecule keywords alpha subunit of Acetyl-coenzyme A synthetase (dinucleotide-
total genus 168
structure length 461
sequence length 461
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13380 CoA_binding_2 CoA binding domain
A PF13607 Succ_CoA_lig Succinyl-CoA ligase like flavodoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 4yajA02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 4yajA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4yajA01
4CM9D 1F8GA 1ML3A 3CKYA 1XR3A 4E31A 4CMBA 1JQBA 3H2SA 3JQDA 4P4LA 3GDOA 2ZTLA 2BRUA 3HSKA 4CQMA 3L6EA 4LRSB 4CMIA 4JXKA 4IDFA 1P33A 4OHUA 3KBOA 3K31A 1TA4A 1PJ4A 1XLTA 2JD2A 4PLPA 4PLVA 2IXAA 5JY1A 4E2YA 4YRBA 4FFRA 4PFJA 1JN0A 1NVGA 1U8FO 3MWDA 1K6IA 2BLLA 3HDJA 3OM9A 4RPHA 3WQSB 3FCOA 1FJHA 5I8WA 1DAOA 4GL4A 2ZIZA 3JD0A 2TMGA 3FWZA 2AEJA 5DZSA 4QECA 3D4OA 1N1GA 1SCUB 3DBRB 3G49A 2WD8A 3LT0A 2R00A 4FOOA 3K6JA 1A7KA 4BGEA 4FPXA 5KNLA 4FFNA 1GV1A 3UCXA 1UXKA 5DP1A 4XJSA 1QORA 3HDQA 2FPGA 3KYCA 3NV9A 1GR0A 1GU7A 1LSOA 4BO0A 3CUKA 3KM0A 4AICA 3GVHA 4CLRA 1ISJA 1QLJA 4UVGA 1GEEA 3PWSA 2X22A 1HDGO 1U4OA 3E8XA 3JQFC 3PGXA 4XQ9A 1ZKMA 3MOIA 5JMPA 1RJWA 2Y1GA 4HY3A 4E6PA 4IGEA 4K28A 2E48A 5FYDA 1ADCA 4WEQA 4YACA 3ABIA 4BO6A 1EQUA 5CEEA 5AXCA 1PTJA 4E21A 2PKQO 1KIFA 2ZCVA 3F5SA 4L9RA 3QWFA 1QG6A 2X86A 4DQXA 2YZ7A 1MGOA 1AXGA 1ORRA 3E03A 5AOVA 5F5NA 1PJSA 2W2LD 1DIHA 4GPD1 2VYND 3Q3CA 1SCUA 3DBRA 4CM3A 2NU9A 4HNHA 1BG6A 4NK5A 1K6XA 2EJWA 3V5NA 4WCFA 1KY4A 4NJMB 2ZTMA 4BMVA 1QYDA 1G0OA 5CG1A 4XQEA 1EZ4A 4Q39A 2F00A 3VPGA 4C4OA 2BH9A 1FMCA 4HX5A 2GRAA 2G17A 1R4NB 4PGFA 2YYYA 1VKNA 2QZZA 2OP0A 2AG8A 4MIOA 3WR5A 5I7SA 3D7LA 1X1EA 4TWRA 4J3FA 2RHCA 2CD9A 3I83A 2BD0A 3O26A 4IDCA 1PZGA 1Y1PA 5G4KA 2YFHA 1IB6A 5K0ZA 4MKXA 3BHIA 3D64A 4CLEA 1LA2A 2EG9A 1SOWA 1ZK2A 1WDLA 5T57A 2JCXA 3I1JA 1DJNA 3MOGA 1L7EA 5EMHA 3ZV6A 1WDKA 1UXGA 4NI5A 4YRDA 1LRJA 2CDBA 3RU7A 8ADHA 1QYCA 1U7TA 4K6CA 1Q0QA 3JQBA 3S8MA 1J0XO 1LRKA 4NU6A 4UUNA 1Z75A 2YJZA 1IZ0A 4YXFA 3FHLA 3UCEA 2NU7A 2NU8A 2W8ZA 3KXDA 3DHEA 4OO3A 3TWOA 5FI3A 4BGUA 3OHSX 4UULA 2V6FA 4W99A 4Y6RA 3UICA 1BHSA 1VRWA 4B4VA 1HDXA 3ONFA 4FGSA 4CMHA 3PJGA 5BR7A 3GY0A 3WGHA 3C7DB 1NQOA 4BNFA 3KB6A 3E82A 5JE8A 4CM5A 2Q2QA 2EXXA 3NT5A 3E18A 1HYEA 4NBTA 1ENYA 3WWZA 1G6KA 4DVJA 4CV0A 4A10A 5U1PA 4INAA 2FZWA 3F9IA 3U9LA 1EDOA 5CG2A 3I52A 4MP6A 1HETA 3JQGB 2X0NA 2GCGA 2FRDA 4KWHA 2VNAA 4ALIA 3JD3A 2A4KA 3OH8A 1UXJA 3GR6A 4M8SA 2Q46A 4GLOA 4OGWA 4RPKA 2H5LA 2X7HA 3S55A 2AHRA 2OBNA 4OQYA 4BKUA 5KCZA 4CMGA 3WDSA 1PIWA 2HU2A 1E3SA 1B16A 3WGTA 3LQFA 3LYLA 3FN4A 1I30A 3NDRA 3HN2A 4KP7A 4IS3A 4XA8A 3UFXB 3U3XA 2FP4B 2DTEA 2NQ8A 4OKIA 4QO7A 1JVSA 4TZTA 3VTFA 4CMJA 3BMQA 1H93A 1PJBA 1ZEMA 2PGLA 2UYYA 1LC0A 4RQTA 5ER9A 2B83A 3PQDA 1T2EA 1MC4A 4E3ZA 1WXDA 3HWRA 2AQHA 3I3OA 4P4NA 2AQKA 4XR9A 3JD1A 5COAA 2O7QA 5IZCC 2HMUA 5F1KA 3JTMA 1HXHA 4DC0A 1ISFA 2X0RA 3WNVA 1J6UA 1IE3A 1B15A 4YT5A 4FN4A 3GVIA 3V2UA 4FFPA 2ZB8A 3QE3A 3PHJA 2EP5A 3RC9A 4AJKA 1KVQA 2VTDA 3PQEA 4DPLA 3LT4A 1FDWA 4JBHA 4QUKA 4U6SA 5JNLA 2XXBA 1LQUA 1I10A 3GA0A 3PLNA 4B8WA 2LDBA 2YHIB 1R6DA 4KOAA 2Z95A 1U2DA 3D0OA 4M86A 4OMUA 1WNTA 5FI5A 1SBYA 2DTDA 3CINA 2EIHA 4EZBA 2QG4A 1WLYA 4NPCA 3TNLA 9LDBA 1M2WA 4RVDA 3I9LA 4BIIA 4MVJH 3DOCA 4H16A 2V6BA 1ONPA 3WBFA 5LDHA 3F4BA 3QWAA 3T7CA 4OKNA 3K5PA 5COQA 3ZNOA 1DHTA 2Q49A 1AE1A 1JAYA 1WMBA 2EJVA 2PWZA 3EC7A 2X9NA 3GEGA 4WECA 5EN4A 5T6BA 3RUEA 1CQJA 5ER6A 2IEDA 1V3TA 4DMMA 1C0IA 3HG7A 3OQ6A 2FR1A 5JAIA 1JW9B 2JKVA 4L73A 3PK0A 4ZRMA 1DIRA 4DBZA 3RUIA 4XX0B 3IMFA 2VT3A 4E5NA 2O3RA 3ETGA 3EVTA 1EVIA 2JCYA 5LCXA 3NDIA 3D5QA 1Y9EA 1WAMA 3FPLA 4IUYA 3DC2A 1OFGA 3AW9A 3PWZA 1HE3A 4MJLA 1IPFA 4OAQA 4RVFA 3KUXA 1X7DA 1XKQA 3DB2A 5JY6A 2I66A 1X14A 2Y66A 2FPIB 3UKOA 2UVDA 2O3QA 1LU9A 1PX0A 4F45A 3GHHA 2VZ8A 4CMIB 3KYBA 2OP1A 3WJAA 3L0DA 3ZWNA 2HKIA 3F1KA 1RWBA 4R54A 3HN7A 1VM6A 4ND2A 1BTOA 4RLSA 5F1OA 4PZCA 1CDOA 5GMOA 5T5QA 5HS6A 3WG9A 1WPQA 3O8QA 3KZVA 4Z9FA 2G1UA 2EF1A 1PS8A 3TZ6A 1XYGA 4UREA 5FFFA 5IG2A 1E92A 4R1TA 1LSUA 4Z0HO 2JHFA 4E30A 4FGWA 2PD6A 4II3A 3AOEA 4Y8VA 2V65A 1NQTA 5IDWA 3DAPA 4MDHA 3PQFA 4BO4A 1E7SA 2YY7A 3KV3O 3GPIA 1B26A 4J0EA 1UP4A 2BGMA 5HM8A 5JW6A 3EZLA 2J6IA 5A3JA 5I9LA 4B7XA 1E6WA 1H6AA 2PFGA 5CAEB 2QX7A 4RQUA 4F6LA 3AUTA 3NAQA 1QSGA 1CRWG 2GERA 5DP2A 1UZNA 4A0SA 5I7VA 1FK8A 3LLVA 3RC7A 1YB5A 2Q2VA 3LT2A 1Q7GA 3WSVA 4CLOB 5DBGA 5B4TA 2D0IA 1NR7A 1IHXA 3PRJA 2DFDA 1YS4A 2VWHA 2OUIA 5K9ZA 2PGDA 3ROQA 2BFPA 2JD0A 4YR9A 4QTZA 4B7UA 4CMKA 4F3YA 2HJRA 1FF9A 4UUMA 3RWBA 3UUWA 4YAJA 2EKPA 2PD3A 5A9SB 4BO3A 2BMAA 3W1VA 4RF5A 1AGNA 3IL2A 4W6ZA 3JQAB 4R1NA 5JS6A 3WGIA 1A4IA 4J90A 4RLHA 1EUCB 2P4HX 2FSVA 3GUCA 4UUPA 5A05A 3SJUA 4CMEC 1N5DA 4AJLA 5A04A 4UVHA 4ND3A 5KKCA 4A5OA 3PZRA 3DOOA 3TZCA 3E5MA 4CL8A 4MVJA 3C3XA 5ITVA 3A28A 4A03A 3NTQA 3GAFA 4L4XA 5T67A 3HB4X 5EESA 4R16A 4XGKA 2C29D 5BT9A 3ZH2A 5THQA 2HCTA 4P38A 4RO0A 2FPGB 4UEKA 3ZU2A 4J2OA 3U62A 1WWKA 3GRPA 4UAGA 4HFMA 3RBXA 2QHXA 5CFZA 3OA0A 3I4FA 2AA3A 1GYQA 3BA1A 4J43A 4W4TA 3DOJA 2HK7A 2YQ4A 3H9JA 2X9VA 5JCJA 2FPPA 1KETA 1QLHA 4OSOA 2Y1EA 5H82A 4WNCA 3T4XA 2I3AA 4BNNA 4I8XA 3NJ4A 1KS9A 3KHUA 4EEZA 4PLYA 4YAEA 2NNLD 3V1UA 4Y9DA 1ID1A 3P5SA 1N7GA 1JLLA 4HXYA 4BNKA 3NTOA 4Z3DA 4OXKA 2DAPA 3ZHZA 1I3LA 1F0YA 3NYWA 5A3VA 3DR3A 4XZ3A 3HE3A 4YA6A 1MXHA 1NNUA 5JDCC 3ENKA 3KETA 1WVGA 3BMOB 1HE4A 2O50A 1VL6A 3INGA 2P5UA 3PIIA 2WWRA 1VKOA 4CV2A 4DIOA 4NDNE 3D5TA 3LLSA 1IL0A 2D59A 3WIDA 2HQ1A 4MVJG 3G1TA 4FC7A 1PGJA 2VZ0A 4XIJA 5EQFA 3ST7A 2DBRA 4FR5A 1B8UA 1NFFA 4B4OA 4L74A 1HLPA 1QXSA 3C7CB 3IC5A 5TS3A 4D79A 3KLPX 1D1SA 4TMFA 4BNZA 2VYVA 5F3RA 3JD4A 5ENDA 4Y6PA 5G4KB 5FEUA 1KEPA 2O7SA 3QA9A 1AXEA 4RJTA 4GI2A 4DPKA 3KYCB 4MVJF 5EIOA 2WD7A 4CLOA 5C37A 3IS3A 3PJDA 1CEQA 3QWIA 4CLRB 2HMSA 4CUKA 5L51A 4M89A 3BAZA 3LVFO 2AQ8A 3UH1A 1HLDA 3JYOA 3TQHA 2OGUA 4DREA 3ICCA 2AXQA 1R4MA 3HJAA 1XU7A 3VVCA 4UVDA 3H4VA 4YAKA 2P5YA 3GAZA 1DOHA 5THKA 2OMEA 3W8EA 2FZEA 1D7OA 3E5RA 1LX6A 1TT5A 5HWSA 2O3SA 3CMMA 4U5QA 2I67A 1U1IA 3UHAA 1YDEA 3HFGA 1SAYA 2HK8A 2PD4A 3U4DA 3ZWVA 2QYSA 3VVBA 1MFPA 4CR7A 3GVCA 4N5LA 3HHPA 3VZPA 4D46A 2VHZA 3L4BC 4HFRA 3RC1A 1BDMA 1P9LA 4OYRA 1KVTA 2GYYA 1KC3A 4EUHA 1PGNA 1LDGA 3MCVA 3F1LA 4LSWA 3QVWA 2X58A 4Q3EA 4U0KA 4QT0A 1GZ3A 3PPIA 3TFOA 3GMSA 3K96A 4Z3KA 3NTRA 1AHHA 4E5KA 2J8ZA 1EQ2A 2I3GA 3CMCO 1O5IA 1R37A 4S1VA 1HTBA 2G5CA 1VJ0A 3Q2IA 2C20A 1CERA 4WOKA 1S6YA 4YBZA 1ADBA 5L7WA 5CAEA 4HKTA 2NVUA 3WIEA 3ETDA 3EYWA 3DDNA 1DO8A 1LLUA 4J91A 1KERA 1HSOA 1E1MA 2J5KA 1JWAB 4DMLA 3H5AA 4M54A 4BQPA 1YKFA 1ADGA 1LEHA 4RGBA 1E5QA 1Q1NA 4J4HA 3PDUA 4J7XA 1MV8A 2YDXA 4EDFA 5BQFA 3TOZA 2GDZA 4KDFA 5A9TA 3B6ZA 2CSUA 4GMFA 4ZQGA 2QW8A 2Z5LA 1YGYA 3VOSA 2PGJA 1ZBQA 3AWDA 1PGQA 3OICA 5CPFA 5KVQA 3ROKA 2HRBA 3MZ0A 4FJ2A 4RPJA 2X5OA 3ZNPA 4XDZA 3BHMA 3JQ9C 4KUEA 4PN3A 3BMOA 2VN8A 4TRJA 3ZHYA 3KOUA 1PJCA 4NJOA 3VZQA 3CPSA 2UV8A 1MP0A 1OC2A 5TC4A 4P8RA 1ZMOA 1LDMA 1ZK1A 3DZJA 1P1FA 3AM4A 3NT2A 3OMLA 4Z9YA 3KSZO 1IULA 3Q11A 1HKUA 3BXXA 3F5QA 5CDYA 1I24A 3TZQA 3ONEA 2VHXA 1R66A 4NBWA 1PL7A 2J3JA 1X13A 4NFHA 1Y9AA 4ESOA 4XIYA 3AUUA 4XDYA 3DEYX 4PRLA 4B79A 1JTVA 4D45A 5F21A 1GPJA 4J7UA 5G2OA 5ADHA 3L6DA 1O89A 4MVJE 2WM3A 5A02A 1X0VA 2R6JA 3E48A 1NPDA 2B5WA 3DHYA 3PHIA 2V6MA 2C59A 1M76A 4OL9A 1BSVA 1E6UA 3DWFA 1GQYA 1PJTA 1U5CA 1NAHA 2GSDA 3KEOA 5DNAA 1A9YA 4LMPA 1KY5A 1KC1A 2VHVA 1NASA 2Y1FA 1H2HA 3GG9A 3PDJA 3W6UA 1HDRA 1HWYA 3MJVA 2VWQA 1GADO 4P22A 3VTZA 5L40A 1IHYA 4MP8A 2JD1A 2W2KA 4BMSA 4X54A 1WMAA 2Y68A 1YBMA 4PLHA 2SCUB 4YEDA 3ZWMA 4CUJA 4R01A 1PQWA 4EW6A 5DN9A 3GZNA 2QRKA 1A27A 5L4SA 2JAHA 3TOXA 5L45A 3ZNQA 5B37A 5EERA 1IYZA 3UXYA 4GGPA 1U3UA 2VRCA 1DSSG 1PS9A 1T1RA 2X8LA 4N54A 1T25A 3FF4A 3SEFA 4BV9A 2VUUA 4IXTA 1GYRA 3PHHA 1ISGA 2YFQA 2AQIA 3RAJA 2WMDA 3D4PA 3K8ZA 5EINA 3VKVA 3ZW9A 4NFSA 2D1YA 2E4AA 1P1HA 2RH4A 2PZMA 3BMCA 4FJ0A 1LUAA 4NZ9A 4XJTA 1H0KA 2GZ1A 2OXIA 2NVUB 4WUVA 2RCYA 4J1TA 2B4TO 1TVEA 2VQ3A 2OBYA 5JCJD 4Q3NA 3IIEA 4OSPA 3BTVA 2B37A 2C0CA 2PKQP 1L7DA 2JCVA 3KVOA 1I3MA 1KVRA 2BI8A 3C1TA 4H7PA 1XA0A 4IM7A 5AVOA 2RIRA 4B3JA 4MVJI 4PZEA 2J3HA 1VJ1A 1B3RA 3EY4A 3GH3A 3A9WA 2O3UA 2YW9A 1BW9B 3WQRA 3GZNB 3ZWWA 4YCAA 1HYGA 2ZJ1A 3VKUA 4II2A 5CHEA 4I9NA 3WGYA 3VPHA 4ZICA 5KWEA 3AOGA 1E6EA 5BNTA 1FXSA 1P1RA 3MJ4A 2GN8A 3GGGA 4QFCA 3RKRA 5L3ZA 4PZDA 2NM0A 3HDHA 4BB6A 5F1PA 3LC1O 4FC6A 2NVBA 2ZB4A 3RJ5A 2TMDA 3QY9A 1H2BA 4YPOA 4BMNA 4WASA 1LDBA 4O1MA 1XSEA 2OOSA 1PU2A 4ZN6A 4IJWA 4GX2A 3FRJA 4W7IA 4QO8A 3PVZA 3VDQA 6LDHA 1UDBA 3WFIA 4ZHSA 3M6IA 2XPCA 3WXBA 1GFSA 3GPDG 5H83A 5DF1A 1BXKA 3TN7A 1I32A 3VPSA 1BWSA 1NQ5A 1VL8A 4J7CA 5TIIA 1LLQA 1PSDA 1Y5MA 4XYEA 4TVBA 4IDAA 4BHTA 3R3SA 2DVMA 4BS9A 3LC7O 4G2NA 1OZAA 4GSLA 5L9AA 3RSHA 4RZHA 1ZFNA 3DXFA 1I3NA 3R3JA 4YJFB 5JAMA 3RUAA 5K6AA 3FNGA 2Q50A 5TSDA 3ETEA 4CM4A 5ENVA 1XDWA 6ADHA 1X15A 3WGGA 7MDHA 2QRLA 4EBFA 3BZUA 3MWEB 9LDTA 1TT7A 3TRIA 2GLXA 2A9FA 1GQ2A 3GEDA 2X23A 2XXJA 4AFNA 3B1KA 3GRKA 3UW3A 1TT5B 1E1NA 4J9VA 1LQTA 1P1IA 3FNFA 3ENNA 1NYTA 1Z6ZA 1DC3A 5AQ1A 1QV7A 3ZWCA 3FNEA 1T4BA 2O2SA 2Y67A 4W9NA 4UEOA 3KRTA 5DCYA 3PHGA 2WEKA 1RM3A 4I9UA 2NWQA 2QIOA 1P1JA 4ND4A 4LRTB 1CIVA 3E6AA 2A94A 4RPLA 5JMWA 3JCZA 4CQMD 5CDSA 3VH4A 4TQGA 2J5RA 1DB3A 3VH1A 1VSUA 1I2BA 2NLOA 3SVTA 3OIDA 2AE2A 4A27A 3E9MA 4A73A 4CQLA 2VCYA 4YRAA 3V8BA 5TQVA 1QKIA 1ZSNA 3VZRA 1Q7BA 1BVRA 3K73O 5ITWA 4ZU3A 1BXZA 4DWVA 1YE3A 2C5EA 4CM9A 4UUOA 3NJ8A 4CL3A 5JYDA 2PLAA 1P45A 4C7KA 4DRYA 4J1SA 1MLDA 4FSHA 4NMHA 2FPIA 3GNQA 3MJEA 4NQZA 4MVJP 4YTEA 2FY8A 4CLHA 2WD7B 2W2KB 2H63A 2DM6A 1E1LA 1FDTA 3DFZA 4UVEA 5DT9A 2HMWA 2DPHA 1DEHA 4Z0TA 3NEPX 4DQUA 3JQ7A 4Q9NA 1V35A 1SMKA 2Q1SA 2QZ9A 4YJHB 5JO9A 1SO8A 3RJ9A 3FR7A 4OXYA 4FFOA 2DQ4A 4YB8A 1XEAA 2BGLA 4G5HA 5C7IO 4EITA 4RF4A 1KYQA 1V0JA 1V3VA 3UCFA 3JV7A 3AY6A 3GNSA 1EUDB 1IZ9A 4B4WA 4DIFA 3H2ZA 1XCBA 3B70A 3N74A 4L8VA 3JQ8A 3O9ZA 1O6ZA 4Y6SA 1SB9A 1ZK3A 3X2EA 4I5EA 4MKRA 2ZQZA 3BMQB 3JQEA 4AJEA 1NHGA 1R12A 5KKAA 1I2CA 4IJUA 2CMDA 3I9NA 2J5QA 2X9GA 2I6TA 3V1YA 3I23A 5KJCA 2FPPB 3ZWOA 1EBUA 4O59O 4BNWA 3OQBA 1YL7A 4E4YA 4D3DA 5GZ1A 3JQFA 1DRUA 4AJJA 3Q9UA 1DC4A 2ZQYA 1PQPA 3KTDA 3UVEA 3T7EA 4NU5A 2FSSA 4YT2A 5JAZA 3I9MA 5J23A 4BO8A 1IPEA 3AK4A 3EGOA 3UN1A 2NV6A 1UXIA 5DOZA 5KVCA 1M75A 1ISHA 2EW2A 4XCVA 1YQDA 4CM8A 4WKGA 1R0SA 1XQ1A 2EERA 3BYZA 4AL4A 1JDJA 3MJSA 2O4UX 4DGSA 1EUCA 4D0SA 1T2FA 1YH3A 4MVJD 2ZTUA 1TI7A 4YJGB 2P2SA 1VE9A 4Q3AA 1YO6A 4L4SA 2JHGA 2P4QA 3DBVO 5IFLA 5L7TA 4XB1A 1Z45A 4GH5A 3CZMA 5KIAA 4S3MA 5CEFA 5C5IA 5GZ6A 4W82A 1U9JA 2NU6A 1HEUA 3ZU5A 4BQRA 5DBIA 4PG8A 2Q1TA 2EKQA 4Z6KA 3F6YA 2AW5A 2B4RO 3DMYA 1K5HA 4BKPA 3LU1A 4AJPA 3VH3A 4NFYA 4YJGA 3V1TC 1LI4A 1PZEA 4RVSA 3WBBA 5TGDA 3VAZA 1R4NA 2FP4A 4TRRA 4P4GA 5U9CA 4E2ZA 3PFWO 5JFOA 1KEVA 4B3HA 1YOVA 3RUCA 3WYBA 4RORA 1P3DA 1ULUA 4GMGA 2GUGA 4D41A 3KO8A 4GX0A 2Q1WA 3ULKA 1GPDG 3STHA 4IZHA 3T4EA 3NDJA 3QVXA 2O3JA 1L1FA 1EVZA 1JKIA 3AI3A 4E12A 4PLTA 5A5EA 1DBVO 3PI7A 3RUHA 3U09A 3CH6A 2A92A 4XYBA 5JCXA 5HA5A 2X0JA 2J3IA 4ALKA 5BNFA 3RASA 4IY1A 1ZXLA 2O23A 3H9GA 4HUJA 1T2DA 3B1JA 3ZHXA 3MTJA 5A9SA 1TEHA 2H6EA 2IRWA 1HL3A 2XF8A 1A71A 3ANMA 4GVLA 4CR8A 1DRWA 3QWHA 4B7CA 4J2HA 1QYWA 1P74A 1C1DB 1XELA 1J49A 4B3IA 3AI2A 1Z73A 3DZBA 1ZEJA 3RCBA 1P44A 4R5HA 4H3VA 2YV1A 4J1QA 1PR3A 3H3JA 3OQ1A 4U7WA 4WPGA 1Q0LA 3W4KA 3L07A 4C7JA 3D3WB 1MFZA 2UUOA 4NJMA 3QVOA 2H9IA 2VHYA 1E0DA 1SZJG 1W8DA 4K1LA 1UP6A 4FW8A 2GR9A 3MWDB 2HDHA 4XGNA 3WMXA 4JJFA 2ZTVA 4GX5A 3VPXA 3ON5A 3QW2A 2YV2A 3JYNA 4YAGA 3PXXA 1O8CA 3PTZA 3I6QA 4GLLA 1Q0HA 1SEPA 2R2GA 4L75A 5T8KC 4M55A 4OOFA 2Y1DA 3AFMA 4DLAA 4HBGA 2B69A 4KDEA 1O95A 1GUYA 1UZLA 1YB4A 4FFLA 3RBVA 4DYDA 2PZKA 5A4DA 4QSMA 3RROA 2NUAA 2DBQA 3WLEA 1Z74A 2OORA 1OI7A 4QQRA 2ZCUA 2IZ0A 3DTYA 1CYDA 3ZNNA 1LDEA 3F4LA 5B4VA 1U3TA 5JXWA 4RCVA 5L95A 1JKFA 1LSJA 1KVUA 3I6IA 4J9UE 1JU9A 1K0UA 1ZK0A 4IS2A 3GDFA 3QRWA 4URFA 1E7RA 2O4CA 2XAAA 1UXHA 2OL4A 1E1KA 2DBVO 2Q99A 4PLFA 2D4AA 2NUAB 1V9LA 3D3EA 3N58A 1YQGA 1AUPA 4Q3DA 5KOIA 2NU6B 5TNXA 1SB8A 3G0OA 4TRMA 5A9RA 1NWHA 2CVZA 3TPCA 3DMTC 5AYVA 1R16A 5I7FA 2Q2WA 1HDYA 4QEDA 4R1UA 4KTTE 3EHEA 3KYDA 4CJXA 2CY0A 3H5RA 2C54A 1E3IA 2Y93A 3OBBA 1EUZA 1W4ZA 2ZKLA 2D5CA 4XRGA 2Y1CA 4MINA 5TJHA 1VSVA 2IXBA 3NRCA 5BSGA 3I9OA 1F12A 2EHDA 2P91A 2QRJA 3RBZA 3FPCA 2NACA 2FMUA 2JL1A 4MOWA 3A4VA 3BIOA 1R15A 4AJ2A 3IUSA 1P77A 1AHIA 5G0TA 1U28A 3GLQA 2VTEA 5JAQA 1BVUA 3CEAA 4MP3A 4YQYA 3ZU4A 3TFQA 2WYUA 3DHNA 3RQSA 1K6JA 3EVNA 3RIHA 2YV3A 3WB9A 1DJQA 3JQGA 2ZATA 3OEWA 1PL6A 4LW8A 4ZA2A 3C1AA 4K6FA 1VI2A 5IDXA 1QYXA 3GDGA 4A2CA 3L77A 4KUHA 3DZKA 1PJQA 4BO7A 4K9DA 1U5AA 4PLWA 5JDCA 2BFMA 1GEGA 3FTNA 4DXHA 3WLFA 3RD5A 4DL9A 3OJFA 3FD8A 1U8XX 1HSZA 3ORFA 2FOIA 1N92A 4ITUA 3ZU3A 5B1YA 1YL6A 3LDHA 3FSRA 4HP8A 4LVCA 1RM5A 4CUZA 5IZ4A 2DUWA 4BNHA 1A7AA 1WZEA 4PRKA 4CV3A 1E7WA 1YRLA 1ADFA 3DONA 3OIFA 3O03A 4NR0A 2DLDA 3ZDFA 2DTXA 3Q2KA 3OETA 2EGGA 1BMDA 1DIBA 2B36A 4Y67A 1E3LA 1RKXA 4R1SA 3QJ5A 2GNAA 3IKVA 4FBGA 2P9EA 4GX1A 1BW9A 1HZJA 1EEHA 3GQVA 4AG3A 4XWYA 4WE3A 1ZJYA 3TL2A 4DC1A 3GUYA 2VNSA 4IMPA 4GAEA 4E5YA 3QSGA 2YHUA 3UFXA 3ZHBA 3JQBC 1UAGA 3UOGA 5TLSA 1H6BA 4IQ8A 4YYZA 1D8AA 1EBFA 3BMNB 1H9AA 4ZQEA 4CLDA 4FB5A 1HE5A 3RFTA 2IZ1A 4LCEA 2DC1A 1W73A 2VRCD 4E5PA 4XKJA 2Y0CA 3PLRA 2EEZA 3C7AA 4CQMB 4NBRA 3CZRA 3U4HA 5BSHA 1E77A 4GBJA 3RUDA 4MIYA 1ZO8A 1DLJA 1NR1A 4OH1A 4PLZA 4J4TA 2UDPA 5JBIA 3ASVA 4CR6A 2I5PO 1H6DA 3GGOA 1T1SA 4OJNA 3VDRA 1BDBA 4YVFA 4R5MA 1Y81A 4E32A 4Q3BA 2NVWA 2I76A 1C14A 2X1HA 4LMRA 1Y7TA 4N18A 2IDZA 1YWGO 2ZJ0A 4J16A 4IIVA 3GK3A 1GY8A 4XB2A 2C7VA 5TT0A 3VPFA 3ZN2A 1UR5A 4JJIA 5DBFA 4D42A 1JVBA 3RC2A 4BNUA 4B4UA 3H9QA 5C7OO 1YVEI 3P2OA 3OP4A 1SOVA 5L4NA 3HUDA 3S2GA 3Q9NA 4CMCA 3GZ4A 4F6CA 1LLCA 1NAIA 1OBFO 1MXFA 5DCUA 3U49A 5K6AC 3C24A 4J1NA 4BNIA 2BFAA 2IYPA 5BSFA 3H5NA 2OO5A 1RPNA 4NIMA 2WJPA 1DC5A 4Q3CA 4XQGA 1TLTA 1QMGA 1V3UA 1VJTA 2O48X 3V2HA 3GNTA 2SCUA 4MIEA 3DBHB 1PJLA 1DAPA 3PIDA 3GG2A 5U4QA 1EFLA 2X5JO 4JP3A 5JLAA 4JCOA 2JFFA 1M66A 4UEJA 5G0SA 3MJCA 1PS0A 1WP4A 5CDUA 2Y05A 4K26A 1PEDA 2BGKA 4PCVA 4GSKA 5KJFA 1ENPA 1ENOA 1YJ8A 1HT0A 3EW7A 4GWGA 3WSWA 2RBEA 4I5DA 4BUCA 2VOEA 4IDGA 5MGBA 1WDMA 5AXDA 3WOHA 1UDCA 5HTOA 3BMCB 4ZJUA 2VUTA 1MX3A 2CVOA 3LC2O 4AJ4A 1F06A 1DIGA 1N2SA 1X7HA 1Y6JA 5ES3A 1I0ZA 3FI9A 3W8DA 4CMEA 4DIBA 1DRVA 1C0PA 4G65A 4PG5A 2NQTA 5TX7A 4XRRA 5G0UA 2GO1A 3TDKA 2AG5A 1ZCJA 5L7YA 3LF1A 4R69A 1M67A 4CM7A 4WCDA 4L76A 4LGVA 4E13A 1X0XA 3DL2A 4NBUA 2GZ3A 1GYPA 4GWKA 4FFMA 1P31A 1LC3A 3HQ4O 5C3MA 4LVUA 3AM5A 1NWCA 3F46A 3PZBA 3RFXA 3MWEA 4D3SA 2GGSA 3E9QA 2FR0A 4Z0PA 3C85A 1GCUA 2I9PA 4B8ZA 4BNYA 3HNPA 3WS7A 4CM1A 3INRA 3R6DA 2I65A 1DFHA 3IUPA 1VC2A 4FD3A 3W4JA 3ZV5A 1CJCA 3G1UA 1MA0A 4U6QA 1WZIA 1LBEA 5B12A 5L53A 1M6HA 2BHLA 2ZYDA 2OZPA 3A06A 4AJOA 4G81A 4BOYA 2BF7A 1E7YA 1I33A 1E5LA 2JAPA 2W4QA 5EQDA 3DAGA 3FR8A 4WCFB 3ITKA 3DAFA 4ZQHA 1NFQA 1Y8QA 3ZZNA 2CDAA 3GVPA 4FCCA 2NTNA 3WJ7A 1UP7A 3GFBA 3JYPA 2HSDA 3K92A 1C3VA 3R0IA 4PLCA 3KSUA 4BGIA 3SC4A 1C1XB 4NG5A 2HMTA 5JDIC 1B3BA 3W8FA 1D4FA 4BKRA 2OFPA 2LDXA 4RPGA 3IKTA 1TXGA 4J4BA 3JQ8B 3M1LA 4BV8A 5HRUA 4HNGA 3DMTA 4ONEA 3ANNA 3P2YA 1DPGA 3C8MA 3K2EA 4OOEA 4FDAA 3LT1A 2YQ5A 3LSYA 4DTIA 1DXYA 1E3WA 1O94A 4KQXA 3OJ0A 4U8GA 1ZH8A 4HV4A 2FHSA 2BFOA 3GF4A 3RFVA 4YJHA 3IP3A 3FWNA 2HUNA 4N5NA 3RKUA 1CQIA 2ZYAA 4EEXA 1YQXA 2R00C 1PQUA 1HRDA 4JK3A 1GD1O 4CMAA 1DLIA 1B2LA 2Q4EA 1GV0A 1UJMA 4BO5A 1VLLA 2EGHA 3NUGA 1EE2A 3DZIA 1GCOA 3OJEA 5JYEA 4D44A 3Q6IA 3EMKA 4AJ1A 3GN2A 3TJRA 3H3FA 2C7GA 2WTBA 3MJTA 2DUUA 3OEYA 1DC6A 4ALLA 3K2BA 2O3TA 3GVXA 5CEJA 1DIAA 1LLDA 4U0JA 2E6UX 3U0BA 4LCJA 4IBOA 4XYLA 1T4DA 3QV1A 3ICPA 3SXPA 5KTKA 4R3NA 1YB1A 4BNMA 4OXNA 3VC7A 1I3KA 4R51A 4ZQFA 1SEVA 3LF2A 3I9KA 2G82A 4RDHA 2Q4BA 1JLLB 2IZZA 3NGLA 3DO5A 4GQAA 5I7EA 1T26A 4GGOA 3N7UA 3G79A 4RL6A 2DU8A 2ET6A 2WE8A 3ONDA 3DBLA 4TROA 1R0KA 2HJSA 2ZK7A 1B14A 3BTSA 1G0NA 3I9JA 1XQ6A 4DLLA 5A03A 1NFRA 3WGQA 4BNVA 4O63O 1TB4A 3QIVA 3HFSA 4WLFA 5IJZA 3VHRA 4KWIA 2Z1NA 1NM5A 4R68A 4EYEA 5FWNA 3PP8A 4E0BA 1XIVA 3S2FA 1GTMA 3RU9A 2VYVD 3EK2A 5KJ1A 1RM0A 4JQCA 4NK4A 5LC1A 1ARZA 4I5GA 1GDHA 3FBTA 3SBOA 3TZKA 2HK9A 1PZFA 1V6AA 3QP9A 4OM8A 4DPMA 1KVSA 3JYLA 1XGKA 2IODA 4IPTA 2VRBA 4BKOA 1F14A 3DZFA 1P0CA 1LNQA 1H6CA 1HE2A 3AU9A 4YJDA 3W4IA 1ZVMA 4L4RA 2DBZA 3PWKA 1T2AA 2VUSA 5I9MA 1OOEA 5EPOA 2EV9A 5TJ9A 2VOJA 1M6WA 4NNJA 1J4AA 3WNQA 3WICA 4O0LA 3ZWYA 4ROSA 1EK5A 3HZZA 1UZMA 5IN4A 2NU9B 4YT4A 2HO5A 2C82A 1SPXA 4PG4A 4DLBA 3ZWBA 1D1TA 3U4CA 3PYLA 1DDOA 4CQLB 2VZ9A 3ASUA 2ZB3A 2PK3A 3MTGA 4JIGA 1A72A 1UH5A 3JSAA 1KEWA 3AUAA 5IXYA 4FIZA 3W6ZA 3CXRA 2EP7A 1LRLA 1A9ZA 3ANLA 4AVYA 5JC1A 4EUFA 4HADA 1E3EA 2P68A 2PNFA 1CF2O 1MC5A 1S7CA 3PYXA 4NH4A 2EKLA 4E33A 3R1IA 1KOLA 4YT8A 1PWZA 1YONA 2DKNA 2VWGA 3AUSA 4E2WA 4YDRA 2NTVA 1MG0A 5I9NA 3VH2A 2Q45A 4LSMA 3ZWAA 3BTUA 3JQ7B 2WYWA 1LJ8A 1JA9A 2C07A 1I01A 1YBVA 3IDSA 3JYQA 3CSDA 4A7PA 2CF6A 5B4UA 3PYMA 4MPDA 4W7HA 1PL8A 5KVVA 4RZIA 5DCWA 3D3WA 1JKJA 1BXGA 4EJMA 4WK6A 2X0IA 2PZJA 1W0CA 5DULA 4CODB 4KQWA 1YL5A 2FR8A 3S1LA 1KEUA 3IAHA 3OA2A 2OHXA 4CM6A 2W90A 2CNBA 1RM4A 4PVDA 1Y5RA 5JDIA 2H1SA 1OC4A 3AFNA 2V6GA 3PGJA 2HRZA 4I1IA 3TF5A 4KTVE 1NVTA 2DFVA 2DPGA 2GPTA 1YOVB 1ZUD1 1NP3A 1GUZA 4ID9A 3OF2A 1FDUA 3QVSA 2P9CA 4M49A 3WQQA 5BSEA 3PFFA 4D0RA 5EL0A 4XYMA 4FS3A 4I9HA 2DT5A 4HWKA 5G4LA 2I99A 1P0FA 3L4SO 4UVIA 1XHLA 2YUTA 4BO1A 1H5QA 1C0LA 1VL0A 3EAGA 3UF0A 1CQJB 3QVTA 3SC6A 3E1KA 3S2IA 4PLGA 2YDYA 3FTPA 2BI7A 5IF3A 3H6KA 1GUFA 3AI1A 3H65A 4ZQBA 4WNIA 5EJ2A 4PG7A 4JX8A 1GZ4A 1JKJB 1Z7EA 2PR2A 2ZB7A 2XOXA 1U3WA 3A14A 1C1DA 1YBAA 2D2IA 4AJIA 2WDZA 3L4BA 3D4NA 2PTGA 1LDYA 4L0QA 3WGOA 4IMRA 1NPTO 4R3WA 4XYGA 4CPDA 1E3JA 2X4GA 2J3KA 4EJ0A 4KMSA 2HLPA 4ZVVA 1ONOA 4YQZA 1IY8A 3SLKA 4DUPA 1XG5A 1ULSA 3D1LA 3BTOA 1Q7CA 5ILOA 2Y0DA 3GMDA 2Q3EA 2NTJA 1A5ZA 1QR6A 3JQAA 3LZ6A 5JPIA 4BO9A 2E49A 1EUDA 2CF5A 1B7GO 4IINA 3KEQA 1ZK4A 4MO2A 1Q2XA 3PJFA 1B8PA 1Y8QB 2E82A 4IDEA 1P1KA 5GY7A 2ILTA 3B1FA 3DBLB 2CDCA 3GGPA 4J6FA 5G0WA 4XEHA 4ZD6A 1V8BA 3O4RA 3QLJA 1A4UA 4WLUA 3BMNA 1N8KA 3AM3A 4NHEA 4TVOA 3GEMA 3RI3A 1PR9A 1EMDA 2RAFA 4ND5A 4FJ1A 1O9BA 4I08A 1NVMB 2GD1O 4LK3A 5A5FA 3OFSA 4IQ0A 4WCFC 4BVAA 1I36A 3ADPA 3SJ7A 3IJPA 3DZHA 2NSDA 4RDIA 1N9GB 3HB5X 1I8TA 1HF3A 3B20A 2C2YA 4BNGA 4GKBA 3NT4A 2IYOA 4EJ6A 1K89A 5COBA 4BB5A 5DDIP 1J5PA 5CDGA 4JROA 3S2EA 5IZCA 5KJEA 2GN6A 3NX4A 1OAAA 4IDBA 3HADA 2PA3A 3SLGA 3H9UA 1CQIB 1LXCA 5IDYA 3PEFA 3TSCA 3PHLA 4JN6B 1SNYA 4PIVA 4DQVA 2FWMX 1YXMA 3CE6A 1BXGB 1PJ3A 2D8AA 1VPDA 1ZW1A 1XWFA 2GN9A 5F5LA 2W98A 3ZV4A 1I5RA 4EUEA 4WLNA 4CM4B 1B8VA 1LDNA 1QP8A 3OIGA 3P7MA 1EVYA 4PG6A 3DBHA 4E2XA 3ZCXA 3KYDB 1NPYA 3QHAA 4TSKA 7ADHA 3JQAD 4NBVA 4J0FA 3I4CA 2AEFA 3L9WA 1PGOA 5CPBA 3RVDA 3V2GA 5AXAA 1HDCA 3ITDA 3Q1LA 4BKQA 1JAXA 2JFHA 1D3AA 1T24A 3DQPA 5ILGA 5A1TA 1NX6A 4DBVO 3DTTA 3FBGA 4H15A 4XQCA 4BNJA 4RF3A 2D5AA 1WW8A 2UAGA 2YHIA 4ZRNA 1LSSA 5AXBA 3F3SA 4DA9A 1ZZEA 3FNHA 4GVXA 3ROPA 5TRTA 2Y0EA 4IXWA 3O8QB 3GHYA 4LN1A 4MVJM 4Z9XA 1E7QA 4BNLA 3GC6A 3NKLA 1YJQA 4JJGA 5JC8A 3OECA 4JGBA 2E37A 3U4IA 3COSA 2EW8A 4O6VA 3EUWA 3A1NA 4TKMA 1X1TA 1U2GA 1W6UA 4R9SA 4EGFA 5ICMA 3G17A 3L9XA 1ZSYA 1QRRA 3JD2A 3GT0A 1ZXBA 1PZHA 1HZZA 2JJYA 3TZHA 4IQGA 2PV7A 1K3TA 1EVJA 1PJ2A 3WYEA 5LDGA 5CDTA 5HBRA 5L4LA 4KZPA 3I5MA 3IOYA 4CV1A 1PGPA 5IXSA 3WWYA 4CM8B 4W9NC 2WE7A 4XX0A 3QWBA 1ZSVA 4N5MA 3UAGA 4BNXA 4M87A 3ZW8A 2GASA 2D3TA 2QQ5A 1FDSA 1U7HA 1MG5A 5GZ3A 2WYVA 4RVUA 1NQAO 3KSDO 3HDYA 3RUFA 3UGKA 4AJHA 3ZWXA 3WTBA 3L6OO 4PVCA 2AMFA 5I8ZA 2A35A 4WLVA 4WOJA 5C7LO 3QQPA 3AY7A 1OMOA 2GZ2A 2BKAA 3P19A 1N9GA 3PJEA 1UDAA 5JSFA 1CETA 3AU8A 5ICSA 4A26A 1UAYA 3AOEC 2UUPA 1UUFA 1EFKA 5JO0A 1N7HA 4YJFA 4YAIA 5T64A 4R4JA 3AY3A 2W2LA 2EWMA 4LISA 4E5MA 1Z7BA 4QFDA 1SC6A 3ZGYA 4KUGA 2IEBA 3WGZA 2NU7B 2NU8B 1CWUA 4TKLA 1GZ6A 3JQ9A 1NTOA 1ISIA 4ALMA 1XU9A 1NBOA 3M2PA 2WSBA 4BGVA 4BNTA 1C0KA 4EI2A 3BHJA 2PKRA 2QYTA 4YWJA 2VT2A 2AE1A 2JFGA 1G1AA 2F1KA 2GF2A 4J49A 3IJRA 2G0TA 3SX2A 2CZCA 2NADA 4IZIA 3TL3A 4D43A 1R4MB 3OJLA 5KJ6A 3M1AA 2GN4A 2PH3A 4XGIA 5IN5A 1F17A 3H7AA 1C1XA 4AJNA 4WJZA 3JQCA 3CIFA 5G0VA 3EDMA 8LDHA 1B0AA 4M1QA 2PH5A 1R0LA 2Q1UA 4DYVA 2BELA 1ENZA 3WYCA 1ZIDA 5BNIA 3F47A 4CLXA 1QYVA 2FN7A 1MB4A 4IJVA 4BL5A 5A06A 4JBGA 4QXMA 4IDDA 2B35A 1DFGA 2VWPA 3LK7A 3INTA 5CP8A 4BO2A 1U3VA 3O38A 3H8VA 1IUKA 1K2WA 1EK6A 4ND1A 2O2YA 1ZNQO 3VZSA 1FDVA 4WGGA 4RVHA 4QX6A 1EE9A 3X2FA 3OJOA 3IP1A 4IJKA 4JP2A 4OQZA 3EZYA 5MDHA 3KLMX 1JWBB 2X5KO 3ADOA 3DZGA 3C1OA 3K9QO 1EDZA 4IGFA 4N7RA 4JLWA 1YDWA 1E7MA 1Y8RB 1RYEA 1T2CA 4HFJA 2V7PA 4WLOA 1NHWA 3OSUA 3WFJA 1X7GA 2RHRA 4RVGA 4Y98A 1E3WB 5IAAA 1DFIA 2Y99A 3WX0A 2IE0A 3NGXA 3IQDB 4JBIA 4MKZA 2B0JA 3U5TA 2PY6A 1HYHA 2CVQA 3G3EA 1DHRA 3CTMA 4WEOA 4O5OA 2ZYGA 3JQ6A 5T8KA 4D3FA 1O0SA 1GQQA 1GL3A 1ZMTA 3ZI0A 4R41A 5IDQA 2Z1MA 1F8FA 1NXQA 4ALNA 1ISMA 1BRMA 3ZV3A 4GKVA 2P9GA 4F46A 4TRNA 4WLEA 1ZJZA 1HDOA 2CFCA 3ZWPA 1LTHR 2HMVA 3AJRA 2RH8A 3GFGA 1PWXA 1H94A 4TZKA 1N1EA 4XD2A 2C2XA 4JNKA 1Z82A 4R9RA 1QV6A 5TT1A 4ALJA 4I5FA 1BGVA 3MEQA 2G76A 4ILKA 3WMWA 1AN9A 1GAEO 2B5VA 3WTCA 2CUKA 4HFNA 4FQ8A 3K30A 5H81A 2B4QA 4RV9A 4ZGWA 5HS4A 2VYNA 3GOHA 3ROMA 2X6TA 2PZLA 2C5AA 1RYDA 2Y1OA 4IIUA 4RF2A 1Y8RA 1H9BA 3Q0EA 1I2ZA 1ONNA 5TF4A 1HDZA 2HAEA 5DOVA 3DFUA 5KVSA 1KBZA 1MUUA 4D7AA 4FOSA 2VHWA 1IOLA 2POQX 3M2TA 1U4SA 3E9NA 5FF9A 3GN1A 3H9EO 4XR4A 2AEMA 4OIMA
chains in the Genus database with same CATH superfamily
4I66A 3L0PA 4XFJA 1ESEA 4GOLD 5JROA 1D07A 3AJ9A 4RNCA 4E31A 4M1KA 4P4LA 4TL8A 3H11B 2BRUA 2XRYA 1X86B 3AWIA 3HSKA 4MQFA 1ICIA 3GL9A 2JI4A 4YJ2F 4B9EA 2BBWA 4C03A 4MI3A 2CZGA 3E23A 4JXKA 1W85B 1PG0A 1PJ4A 3SKVA 3K4QA 1AU9A 4CGZA 4E2YA 2MT9A 2XYRA 1MCZA 2QZ4A 4LV5B 4N7BA 1DWQA 4RPHA 5B1EA 4AP9A 1T5OA 1JH9A 2FZLA 1KSHA 1FJHA 4CCSA 1DAOA 1RHUA 3LHKA 3M1IA 3L82B 1UBJS 3TKAA 2TMGA 2W2NA 2AEJA 3KQSA 3CW8X 1JFRA 1VCOA 3P9ZA 4O33A 1N1GA 1JPNA 5EZYF 3LT0A 2VJKA 4L28A 3ZWAA 2YJ3A 3VHQA 3AVPA 3DA8A 3K6JA 4QPJC 1X1SA 1GV1A 3UCXA 2FA9A 4XJSA 3P52A 2E87A 3X3HA 1KO8A 2FPRA 3RSOA 5EXTA 3VBCA 3CRQA 3JQPA 4DCJA 1LSOA 5HIIA 3F98A 4ZOLA 4LXUA 1JE0A 4AICA 3GVHA 3JPYA 3TQSA 2FFBA 3WI7A 4CIXA 6ABPA 3X2SA 3RYCA 2BMWA 3PWSA 4Z99A 5D2CA 1HDGO 3E8XA 3R0ZA 1ZN7A 5LM3A 1RMQA 5IVHA 2QXUA 3E22B 4QXRA 2IUTA 1V4NA 3GYGA 2Y1GA 1JQAA 3Q4GA 1OJ7A 2WYOA 5LZ8A 4E6PA 3D31A 3FYUC 1TEXA 1JKMA 2ASEA 2E48A 2J5BA 2ZS7A 1ADCA 4WEQA 4BN0A 4BE4A 3ABIA 4BO6A 5L3SA 1C2YA 1PTJA 1ZYUA 3DAOA 3FVVA 3OTHA 2PN1A 5T41A 1VJRA 2WPNA 1NW9B 1VIDA 3F5SA 1R50A 3I2IA 4K8OA 2HRDA 3K9BA 4L9RA 4NARA 1QGDA 5CM8B 3TTXA 4NWIA 2JRLA 2GJ8A 2DY1A 2YWBA 1VKRA 3HBNA 2ZB2A 5EHIA 2CDNA 2AS0A 4XSVA 1SZCA 2BBSA 1AXGA 1G7TA 2IY9A 3E03A 3SHFA 4C5CA 5AOVA 4UHBA 1OX6A 4K40A 1I6LA 4BEWA 2VYND 5CD1A 4BY9E 2Q2NA 4MQEA 2PMEA 1C3OB 1P4GA 4CM3A 5CBPA 4HNHA 4NK5A 1ZA1A 4BJ6A 2CDRA 3BERA 3NUQA 3IT3A 1RP1A 3LCUA 3O73A 4RKRA 2ZTMA 4Z86A 5ETJA 2ODNA 2JLVA 1NVXQ 2FK7A 3IPAA 2RHHA 4JNCA 1EZ4A 4COOA 2F00A 3GRVA 3K16A 1IJFA 1KDVA 5LNK1 5T4FA 2XVAA 4ZC8A 2PWPA 3W5HA 4PGFA 4ZK2A 4HNUA 1T2VA 1GILA 1Q22A 2HJGA 2VAPA 3DF7A 3GRYA 4U8HA 4BAUA 5A0TA 4JS0A 4ZI7F 3EUAA 2RHCA 1DL5A 4LX8A 3H8JA 3KSMA 5HVNA 3RH0A 5H68A 2JFBA 1PZGA 1FW6A 3NHRA 3SNHA 5K0ZA 3CEPB 5TY0A 3KJQA 4P82A 4BLPA 4OHPA 1QNFA 2R6ZA 2V4UA 1JYFA 1K86A 2ZU6A 3TD9A 5JRDS 1WPXA 2RC6A 1L7EA 1RYBA 3DV0B 3HXLA 3OC0A 5EMHA 1WDKA 1UXGA 4MRMA 1UMCA 5EXDA 2QRZA 3F8SA 1N8TA 2X77A 4LEIA 3Q9SA 3MSXA 3WO1A 3VZCA 3I6MA 3EVBA 4KSCA 1K9SA 1CJKC 3W05A 1V11B 3Q72A 3TTTA 5K03A 2OLJA 3B48A 3LP6A 4JI1B 2PU7A 1FUUA 1XRNA 2YJZA 1IZ0A 3REQB 1YRBA 3SQLA 2J7PD 4RULA 3DHEA 3MOSA 2GS9A 2LBPA 3IE1A 3TWOA 5H4GA 3DE2X 4W99A 1QIHA 1DKOA 1BHSA 4INOA 4CMHA 4FGSA 4BVJA 4L95C 5LR6A 2KE5A 2WJAA 3PJGA 3GY0A 2G9QA 5DI3A 1WB4A 3WGHA 5BR7A 3BBLA 4N8DA 1AG9A 2EXXA 2Q2QA 3HKCB 4YO7A 5AW0A 1ENYA 1G6KA 4U2GA 1L5MA 3RHZA 3RT1A 3PQ3A 2X2EA 3F9IA 3NM6B 1I4TD 1R8QA 3AZQA 3DEAA 3L6UA 3FMGA 3KX2A 5CG2A 2O19A 1DC7A 4MP6A 2EIXA 5DYTA 2R6DA 2GJAA 1WKCA 2WIBA 2GCGA 3HKBB 2FK8A 4KWHA 2BFDB 4ZQCB 4F6CA 4ALIA 1FVXA 4NYIQ 3ZZ1A 2ANCA 2ZBDA 1T8PA 4RH0A 5AUQA 1JA1A 2GPJA 1EM8B 5BQOA 1NNSA 1LZLA 2VH2A 2AHRA 3BKWA 4OQFA 4R8RA 3ZE8A 4L4UA 3EE6A 1SD2A 1SHZA 4BKUA 4CMGA 3WDSA 1RRVA 4IH9A 1GZ7A 2RHTA 5JFGA 3VVLA 1X7YB 3LQFA 5CTAA 4KGDA 2QN2A 4ZVLA 3UJDA 4E4YA 2Q07A 4QPNA 1JVSA 1FP1D 3OP1A 3ICOA 4EGSA 1YUBA 2GBLC 3NHKA 3KR1A 3PX7A 4O4IB 4EVRA 2UYYA 4BFVA 2XMBA 2AD5A 1LC0A 1JFSA 1R5JA 2AYYA 1E6MA 1V47A 2VP3A 3EPPA 3SEQA 4DIDA 1QPZA 1NGSA 1SVWA 5DTEA 1QIDA 3TLXA 3I3OA 2Z2IA 4BWGA 1Z4MA 4P4NA 4EYQA 3FOAA 4XR9A 3VBEA 1EXNA 2WU3A 3LCRA 5LQRA 3DD5A 4FU0A 2XNDD 5IZCC 5K3DA 1D4OA 4L5IA 4HAIA 3BC1A 3AHGA 4IOKA 2VAVA 2QUBA 4I99A 4RMGA 4BJHB 4DB4A 2GLTA 1E18A 4FUQA 1IE3A 2XMSA 1Y34E 4OXXA 2MSCB 3V2UA 1UADA 3QE3A 3JX9A 1KI1A 2EP5A 2O52A 2AUTA 3RC9A 1E0AA 4DPLA 4RNDB 4RJJA 3T9BA 1JVNA 1VMDA 3TNJA 3R3VA 2H9YA 1XLTC 4QUKA 1EHCA 4U6SA 3ZD7A 2EGUA 5JNLA 1G41A 3UENA 2GCOB 3B12A 3EOBI 2H65A 1I10A 3PR2B 5HX7A 2YHIB 1BROA 1R6DA 2MTBA 2RHJA 2WSIA 2Z95A 3C3YA 4Y9UA 4UOZA 1ZPDA 5AVSA 1I94B 4CWAA 1KXJA 4KR7A 1P72A 1RQNA 3CINA 4DJ5X 5A2GA 1U1FA 1J25A 2BR5A 1EJ6A 2QG4A 1B42A 4TV9B 2ZUTA 2HLDA 3IKMB 3MS2A 1VCMA 4NPCA 4BRZA 9LDBA 4OH7A 4ZOBA 4MVJH 2VBGA 1YZ3A 1URPA 4R2MA 5TEWA 3GLGE 1ONPA 2R4TA 3JWPA 3PNBA 4PHGA 5CXXA 3OWOA 3T7CA 3MW8A 1FX0B 3TTWA 3K5PA 3H8WA 2IOHA 2WJJA 3EEIA 2GRUA 1DHTA 2OBBA 2Q49A 1JAYA 1WMBA 2EJVA 2PWZA 2EZ8A 3KUKA 3SQOA 3CG4A 2X9NA 2OK7A 3HXKA 2D2EA 2G06A 3GEGA 5EN4A 3SZLA 3R8XA 1AHPA 3THWB 4JI7B 2F8MA 4J0JA 2IEDA 4NBSA 1CFJA 1V3TA 3E5HA 3PS9A 4LC0A 3OESA 1RMTA 1C0IA 1D9XA 2VKQA 4HRVA 4FHFA 3OQ6A 2DQZA 2FR1A 2NZXA 5JAIA 1U2DC 3TVTA 1JW9B 2QG9A 4ZRMA 4PCLA 4J07A 4S2EA 1DIRA 5IABA 1YF3A 3EGWA 1EFCA 3RUIA 3FKSA 2LIVA 2IWHA 1M5TA 4EFMA 1U63A 2JJ1D 3N2GA 4N12A 3EVTA 4YLEA 1WXWA 3Q8KA 3NDIA 3D5QA 3FPLA 8ATCA 3CWZA 4IUYA 4K9LA 3BL8A 3G1WA 3OBIA 1OFGA 3UAOA 1ZCBA 1HE3A 3TLYA 1QP4A 2JI6A 3KUXA 1E9AA 1E9DA 2QN6A 1X7DA 2A0YA 3DB2A 3DYBA 3MFYA 4XJXA 1LX7A 3A6EA 2QDKA 3NO4A 4TKUB 4BNDB 1IY1A 2FFQA 1W93A 3GJRA 4FTWA 4KPGA 3GHHA 2VZ8A 4TX1A 3OMXA 4R8MA 3L0DA 3W8NA 2HKIA 3BJRA 1AN0A 1V6CA 4R54A 3HN7A 2JA2A 3K0AA 1KNQA 4W63A 1NG9A 1U0HC 1V71A 2WIKA 5GMOA 5WRFA 5HS6A 4HD8A 3WG9A 5HQTA 2I7DA 1QQ6A 3DE4X 3OX2A 1QP7A 2OO7A 2E89A 1PS8A 2QVGA 2FLVA 2R11A 3TZ6A 1FMLA 2J9XB 3EPLA 4M21A 4AULA 1B6TA 3KTAA 2LP4Y 1RZRA 3PXUA 3IQEA 3I04A 2WM9B 2E18A 3D3JA 4Y8VA 1TEVA 3COWA 4LUCA 4B3FX 4MDHA 4BO4A 3ZKWA 3FJYA 4ZYXA 3SWWA 4YAGA 1VE1A 3QFCA 1UP4A 2EJTA 3V4VB 4U2CA 5A3JA 3B52X 2Q1YA 1OT3A 4NE7A 2VTKA 1Q57A 2C9BA 2PFGA 2ZQ5A 3HWWA 5HCIA 1P7WA 2XUFA 2GAAA 4XXHA 5KC8A 4V3BA 3Q15C 4XDGA 1A04A 4LX0A 1KI3A 4KO3S 1D7AA 1P3Y1 1PVOA 4QOGA 1PHPA 2QU7A 1OF1A 4EYSA 1EXMA 2QJWA 3PENA 1Z0SA 4A0SA 1UZNA 2JZOA 3OFKA 3R9WA 1KU0A 4PX9A 1QVVA 3WSVA 2WTNA 5DBGA 4UE2A 1JGTA 2IU0A 2JLUA 3PRJA 1L5OA 2DFDA 3MYYA 3C74A 4UOQA 3GLIB 4YI5A 4P86A 3LD9A 4BBJA 2BFPA 1L5KA 3WBJA 2BJHA 2PSEA 4IIGA 3PFNA 4B17A 1VGVA 3FLBA 3N0TA 4UUMA 4HLQB 2W93A 1HL7A 4O29A 4HPWA 1AO3A 3HYRA 4DLWA 2AF4C 1MB9A 1BN6A 2BMAA 3B78A 3IL2A 1L4LA 3V6LA 4B2IA 1GJRA 5AHXA 1IUNA 3OG9A 3KT0A 1JJAA 5AHWA 2YRFA 3LOUA 1PW5A 4R1NA 2VNKA 1NW8A 1YKSA 1DT5A 1A4IA 1JG7A 1KKMA 2B30A 3FCSB 2FSVA 4FMPA 4G4JA 4J90A 1F6WA 1YRYE 3IKLA 4LSGA 4XM2A 5EZYB 2FFHA 3WL8A 2FMTA 2ZWPA 3IAS1 3L6CA 4ND3A 5KKCA 4G9BA 4MW1A 4BQIA 2CUTA 3GJZA 1AZLA 3WXMA 5E1OA 1TYCA 2P30A 1GGFA 1M1ZA 4MVJA 5LYYA 5EE5B 4RJLA 3SF8A 3IBTA 1XDZA 1PK8A 1TJYA 1Z2AA 2W2QA 4M8NE 2XA9A 1Y4AE 3G2PA 3G23A 5IT9A 2BEKA 2XIQA 2HCTA 2FDXA 2ZAMA 3JATA 4K86A 4R8LA 1ZG3A 1C8KA 1K27A 1KDZA 4HFMA 2VXCA 3RBXA 3VR2A 3NOOA 5A4AA 5CFZA 2C4KA 2UYHA 3EDOA 3H99A 2ZJ3A 4WZAA 3ZC3A 5FUQA 1GYQA 1Y1TA 3L01A 2ZULA 1VLQA 1GZ5A 2ZIXA 2ECFA 4XH9B 1KETA 1KY2A 5BYKA 4C5AA 4DWWA 1E3MA 3CPJB 2BMEA 2GOYA 4ZHQA 5KSPA 3N2EA 5BW5A 4I8XA 3HO6A 1QIJA 3NJ4A 4QC2A 5M5BA 4WMLA 3PI6A 1B6GA 3VDMA 4Q3LA 4TMWA 4WZBB 1P2DA 1ZC4A 2XYHA 3QI7A 3R5FA 4Y9DA 4JYCA 4M83A 3MC1A 1KS2A 4WCVA 1JEYA 1VIMA 2YWEA 1ECLA 4EA7A 4HXYA 4QU0A 1FL9A 1KGDA 1ZIXA 3NTOA 4Z3DA 4QDOA 2XXAB 3LW7A 3PEVA 3DR3A 3RPEA 1DTWA 2WJYA 2YMPA 3GFGA 2W4IA 1XYVA 2WW8A 3ENKA 4RVCA 3VSBA 1NT2A 2BFFA 4WKBA 2O50A 5KO2A 1VL6A 2O0MA 2AFHB 3DEHA 1XTUA 5CLFA 1PT7A 2CK3A 4CV2A 4NDNE 1KHHA 3D5TA 3AEUB 1N1DA 1IL0A 2J59A 4JENA 3WJ2A 1XZEA 3MRTA 3QUSA 4QNRA 3ZE1B 5KQPA 3G1TA 4XIJA 1PGJA 3TLMA 1MGPA 3A6LA 3BJMA 5IUJC 3EULA 2GWRA 3DTVD 4AKIA 4JMLA 3B89A 2JFQA 1A96A 3HR4A 1B8UA 1NFFA 4URWR 5FQNA 4B4OA 1HLPA 2V5VA 1EFVA 1JLSA 1EAYA 2VXYA 3C7CB 2A9OA 3ESDA 3IHLA 3LA6A 3MELA 5DU2A 4NOMA 3V1NA 4D79A 3KLPX 2BM9A 1N2HA 4DNPA 1AMOA 1E3TA 2V0CA 1RWMA 1XZAA 2CFRA 2RAPA 4OVKA 1Z0IA 5FEUA 1KEPA 3UT6A 1XKXA 3KZ1E 4GI2A 5FOVA 1EUYA 2E1RA 2WD7A 2GD0A 1PV2A 4M0CA 5C37A 2JGLA 3PJDA 4CHGA 5LP6A 4CTKA 2HMSA 4LJLA 4C4ZA 5LIRA 2ZXEA 3SHQA 1ZD8A 3VHXB 4CUKA 3ROZA 4FDMA 2WG2A 4FZRA 3T5AA 2F64A 2E5WA 2B5OA 3RS2A 2ZE8A 2APJA 1UK6A 3HJAA 1XU7A 2W2XA 2WMNB 3LW8A 4YAKA 1UJ2A 4V0OA 1DOHA 3MBOA 2CNNA 2YWHA 2AFIB 3FVQA 2M98A 3QELA 3S2ZA 3TIXB 3KEMA 2ZI6A 2R1ZA 3T41A 2Q3JA 2G80A 4I81A 4A0FA 1YFLA 4GXRA 1Y3CE 4O2AF 5HWSA 2QN1A 4LYDA 4DCOA 4UXIA 4UCXA 3UHAA 1G3MA 4M60A 4BFTA 2ZETA 3WGNA 5EMNA 3WYNA 3HFGA 3WKCA 3D8TA 3GDWA 3O9MA 1SAYA 1OAOC 2HK8A 3DEKA 2JASA 4ZO6A 3KKLA 1EYZA 2PD4A 3U4DA 1P2FA 3ZWVA 1WV0A 4FYVA 4MGKR 4FEEA 5KYXA 3OTQA 2PKXA 1ZRSA 2WSMA 3OMWA 4W8GA 4CR7A 3BE6A 3GMIA 5D6NA 4ZZ0A 4W5QA 4D46A 3VZPA 2C77A 2RGGA 4FN5A 2WD9A 4M7RA 2ZS9A 4U2DA 3RC1A 1JEQA 1IOWA 3LX5A 2HXSA 1KC3A 4FZ5A 3MCVA 1ZHFA 3F1LA 3QVWA 4LPSA 3GA7A 1GRRA 1GZ3A 1RJGA 3PPIA 5EC8A 1XAGA 4Z3KA 4O3FA 4RD4A 1RAAA 1SOMA 4ZMRA 3HDGA 4S1VA 1FPMA 1HTBA 3B1WA 1X7ZA 3QPAA 1LWOA 1CERA 4ATNA 5KYTA 3D6UA 1ADBA 4YBZA 5CAEA 4P6VF 2JGMA 3IPXA 2NVUA 2ZRHA 3EYWA 3KU4A 4EHAA 1KERA 4POAA 2IIBA 3O6VA 2GF9A 4WXPA 4IFBA 3H42B 1XCJA 4GYWA 4MUMA 4BQPA 2CB0A 3WWEA 1LPAB 1YKFA 4B8YA 2YICA 4RGBA 5IUNC 4N5DA 1VPTA 2R97A 5CFQA 3FPJA 4HNSA 1LPPA 4GYYA 3D3QA 3QYFA 4HCJA 2AL7A 5TQ0B 2GDZA 2QRHA 1LVHA 1OFUA 3B6ZA 3SFVA 3HCAA 4WK0B 5IUKC 4D96A 1V6SA 1PQ4A 1WHSB 1YGYA 4I4TB 3UG7A 2PGJA 4G8DA 1YBFA 2W6MA 5K3FA 4JVMA 2GN1A 4FX5A 3A9CA 1TZJA 4RPJA 1NE7A 5HW0A 3MG9A 5A5GA 3JQ9C 1TF5A 3OHPA 2NUTA 1CHDA 1K75A 4TRJA 3SN6A 3UIEA 3Q8LA 4QDUA 4NJOA 2QTVB 1ODIA 2ZVQX 5JAUA 4KV9A 5IF9A 3HJGA 1VSTA 4GPAA 3WQHA 1SPBS 3L8MA 5TE9A 4LJKA 3HB9A 1D2NA 3FYTA 1WCWA 2QTZA 3O4VA 3O5AA 3R8CA 2L17A 3OE7D 2C5SA 2F3UA 1IULA 1HFJA 1PSZA 3OFJA 3UNXA 1WR8A 1I0IA 1VMIA 4ZIRB 4LKOA 3TZQA 2P9YA 3K0CC 2ZWVA 4R7ZA 2ZIFA 2OTCA 1TW2A 1E1QA 5JATA 2DT8A 1Y9AA 3NHZA 5CA0F 4XIYA 4R84A 2PZEA 3AUUA 3UWSA 4KE9A 3R3WA 2ZSFA 3R5HA 1TTTA 4JT8A 5F21A 2QLTA 4J7UA 1BS2A 3R74A 1SCQA 3V8EA 2ACKA 4P3XA 4ARIA 1O89A 2PL1A 1TCVA 2F3QA 2VPWA 3MUNA 2WNHA 3E70C 1R5BA 5DV9A 1P73A 1BSVA 1UOPA 2OVBA 1ML4A 3IQGX 4FX2A 1SA0A 2OXRA 4NOLA 3VRHA 3DWFA 2JIBA 3GQBA 1GQYA 3OM1A 5EMLA 5AWFC 8AT1A 2ZZKA 1T5DX 4BZPA 2IZOA 3GRFA 4MUFA 2VHVA 2RHDA 3IH5A 2LNDA 4G5XA 1R2QA 1H2HA 2AFIA 4FT2A 4QBHA 2IH2A 5LP6F 4PPQA 1EGAA 1HWYA 1TVKB 2JHCA 3AJ8A 2VWQA 4KQ1A 4OHYA 5GQSA 5HFNA 3EA5A 1YA4A 4MP8A 4QYMA 4AWXA 1DQSA 1E3DA 2W2KA 5U4XA 3OZDA 4X54A 2J9ZB 5K8CA 4O0MA 1HLGA 1PZNA 1W88B 2XT6A 5CLQA 5IAJA 3ZWMA 2BVNA 3D6AA 1PQWA 4R01A 4N0QA 5H7XA 6PFKA 3OQMA 3MFQA 5SY9A 1NV8A 1O5TA 1S02A 2YZGA 5L4SA 4FI3C 2ZIGA 3L84A 4RLFA 3AF1A 3MILA 4AG6A 1M10A 3R7WA 4Q4JA 1XJ0A 5EERA 2OCAA 4O4LF 3UXYA 4MITA 2X8LA 1I51A 3KZCA 1SXJE 4PO8A 5EWMB 2VUUA 3D0RA 1P5JA 4MYDA 2ONJA 4W5HA 3SD7A 1LFAA 1NU6A 4Q9KA 1Q74A 4FMBB 4RPCA 1RTTA 5LBUA 3VKVA 3ZW9A 2AMLA 4NLLA 3V9AA 2HMYB 4LY3A 2D1YA 4KVFA 1ESZA 1P1HA 2RH4A 4FE4A 5GVRA 4UHHA 4XJTA 1H0KA 2NVUB 2ECPA 1H2AS 4RZ3A 2B4TO 1N5KA 5JNVA 1TVEA 5JCJD 4G4GA 1A8IA 1NURA 2JAXA 5J1SB 4OSPA 3ABZA 1G21B 3KT8A 1E69A 2PKQP 3CRMA 4TWJA 4FYMA 3E3LA 2GA9A 1OSNA 3LCMA 3PXDA 3RVLA 3UWPA 3GU3A 3DDUA 5CYFA 2VVTA 3W5IA 1NW6A 2IS2A 3IDZA 2F17A 4PZEA 4B3GA 2XX3A 2J3HA 3G9UA 3KJEA 4F38A 3MN1A 4M9SA 3KSBC 1B3RA 3EY4A 3IUEA 3CVUA 2E5LB 1HMYA 2YW9A 4DYHA 4WX2B 1OILA 3EC2A 1PP4A 4NYIR 2Q5QA 4JI3B 3UK1A 4YGYA 1O2DA 3ESBA 4LZZA 3O8OB 4JOBA 4V1CB 2VRNA 1WZNA 3AOGA 4RZ2A 3W9BA 4ZOQI 5CK5A 2XUDA 3WL6A 4E14A 1FXSA 1IIBA 2DHDA 4IUBS 2I4RA 3IDOA 2GN8A 1CC1S 3GGGA 4URYR 5GONB 1TAGA 1P81A 2HI0A 4QFCA 5DLQC 2CXTA 3AVVA 4LOIA 3SYLA 2IUEA 2BUCA 4O4JA 3RU2A 3QU2A 2ODBA 4IHJA 2PFSA 8ABPA 2L82A 2QL7A 2RGBA 1W9MA 2GEKA 4HH0A 4IWXA 4KCGA 3W1WA 4E46A 4ZARA 1AKVA 4IG9A 2A5GA 5KI6A 3A9SA 1DKMA 1TL7C 2Q9UA 3QY9A 4N5HX 2HWKA 3ZY3A 4BBPA 5DK4A 4CETA 5KX5A 2O2DA 4MHTA 4JYMA 3I53A 4BMNA 2UXBB 1JJBA 5JD5A 2FCRA 2OOSA 4ZN6A 1Z8NA 1YV9A 3P32A 2QNIA 3C6YA 2UZ4A 2JG3A 2VLIA 2WKQA 1UDBA 2OUKA 3O83A 3FTDA 1Z5GA 1CZKA 2P2LA 2QD3A 3FPGA 3RTAA 2BC9A 3WFIA 1D6NA 4LCBA 1FTGA 1DKRA 1C30B 1UOOA 1ECCA 2WT9A 3B2NA 3GPDG 4R0NA 4X85A 4BVEA 1B76A 4NYJR 5IK2A 1BXKA 3U81A 4C4XA 1NLUA 1N3YA 1ZVKA 2AOVA 1L7QA 2PQ0A 4B3XA 2NSJA 1LLQA 3IB6A 2HWYA 2C1ZA 3HA7A 3KVNA 1U0OC 2P78A 4PQYA 3R3SA 4BS9A 4RELA 1JIUA 4G2NA 4GSLA 1H5UA 1VHJA 2VFAA 5JRZA 1H0SA 4OD0A 1Q16A 3GELA 1W47A 3A1TA 4MV1A 2UZAA 1FTNA 4OHXA 4RZHA 1XT6A 5J2UF 1QFXA 1PLJA 1XLUA 1XF1A 1E2PA 2OXEA 4MRNA 2HHJA 5JAMA 5HF9A 1PVDA 1AKQA 4H0NA 4S0ZA 3VGPA 4I4CA 1W75A 4DMHA 4QKQA 1Z7WA 3QXCA 4FINA 3ET5A 1FLNA 4REOA 1YR8A 2NUPA 2HIAA 1TGYA 3TRIA 4DLKA 2A9FA 3LHFA 4X1IA 1KR2A 4TQAA 1RR6A 2GZMA 4NEHB 1TUEA 1SC9A 2HJWA 2PEZA 2X23A 2XXJA 2LRHA 4AFNA 3RBAA 3UW3A 2WUFA 1TT5B 3I2HA 4XTRA 4FDTA 1O7JA 1Q15A 2HEGA 2ORIA 2XMDA 4MKFA 4AF8A 3FNFA 5BRAA 1DUIA 3ENNA 4M1MA 1Z6ZA 1KP9A 2ZM5A 3P2MA 5ADWA 2CCJA 3F49S 3DM9B 2VP6A 2O2SA 2Y67A 4KE6A 1ZIPA 4W9NA 4AZ3A 4YV0A 4OHFA 3SS7X 4GKAA 2V96A 4PS1A 4E09A 4ENPA 1KF0A 4I9UA 4ND4A 3FXAA 1CIVA 1QZZA 1Z4LA 2J4CA 2QUIA 3E6AA 3O21A 3JCZA 5JG7A 4CDGA 3ZU6A 3EPKA 3VH4A 1FZTA 3PT5A 2J5RA 4DJDC 1RRPA 1VSUA 4PSAA 2XNCA 4A27A 3E9MA 4AZWA 4MDFA 4U6NA 5IAEA 2Y4NA 2GCPA 3QQ5A 3EUFA 5TQVA 2H3HA 4L02A 1YOBA 4WXYB 2GAIA 1BVRA 1JR3D 3ISVA 4ZU3A 1BXZA 1KSGA 2IPOA 1NJ2A 3A6GA 3IODA 3L7BA 4JEMA 4KH0A 3MAAC 2GAOA 5AM0A 3P2IA 1XX6A 4HZIA 3SMQA 4P7GA 5JYDA 4G3XA 4NMLA 4X6UA 4D81A 4RIGA 2DFTA 5F35A 4C7KA 4F96A 5HG0A 1RQPA 2A78A 2O54A 2BBTA 1A5BB 1QWSA 3L0ZA 4NMHA 3PNYA 2A9RA 4OK6A 1FDOA 2E4YA 3GI1A 3MWKA 4NQZA 2FY8A 3QEOA 4P84A 4CLHA 4WOCA 5F9FA 5HFAA 1GITA 1FFXB 3A3PA 4M9RA 1Y0BA 1O97D 1PNVA 2YXPX 5DHQA 2HMWA 2DPHA 1RQ7A 1U9IA 2O07A 3HVIA 4LJSA 4Z0TA 2FWIA 4Q9NA 1V35A 3RV4A 1L9KA 4C9BA 2ZIXB 5SY6A 2QZ9A 5JO9A 1OH8A 1P8AA 2VDVE 3O4GA 3HO8A 3N8DA 3RJ9A 1TA0A 4FFOA 2AC7A 1RZ3A 3FGNA 2FMKA 4KR6A 3GP5A 2BGLA 3GT7A 3KT6A 3MT0A 4GOXA 2QXYA 4O25A 1FYXA 1B0UA 2ATXA 3BB4A 3QE4A 4X6YA 4BWYA 3FMIA 3IVCA 4L8VA 3O9ZA 2Q6VA 4P36A 4ERNA 4W5OA 1O08A 4MW4A 1ZK3A 3M82A 3VO9A 4FHDA 2XKAA 5EJ9A 4AJEA 2Z6AA 2YW2A 3BILA 3TEFA 3NG1A 2HREA 2B4KA 3CUUA 3QBEA 3PC2A 2QLFA 1JQEA 4LNUB 3V7WA 4OU5A 3ZQ6A 2XEXA 3VFDA 1NMYA 2G07A 2XDAA 3WGUA 4RC9A 2X9GA 1BX0A 3QPVA 5KJCA 3I23A 4S24A 4RJ2A 2BJVA 4LWZA 1VYTA 1SCIA 3AJEA 1YAJA 2UZ1B 1DV2A 1Q0RA 1UKBA 2PRKA 2QE7A 3JQFA 4R8SA 5C2JB 3K15A 1HFWA 1JHMA 2HLNA 2YVAA 1DC4A 5LZ4A 2Q7OE 1H42A 2FSSA 2R7AA 3I9MA 4NE9A 4CUJA 4RMNA 4MQBA 1IPHA 1RS0A 5JZBA 1ULHA 1IPEA 1W5TA 3AK4A 1AX9A 1P2BA 3T0IA 3LOQA 2YNMC 4HX9A 4M0DA 3G59A 3WRYC 1KJNA 3ASYA 3E8MA 4AZSA 1M75A 1DEAA 2A1UA 4XCVA 5DLDA 1ZNXA 3ILHA 3SHWA 2F4VB 3EGEA 1N9KA 4LXQA 1XQ1A 3TD6A 1RC1A 1UOQA 2QPLA 2ZGVA 4XTCS 1UWVA 3AB8A 1EDDA 1RI4A 1GTVA 1X3SA 3L93A 4HB2A 4E07A 3D4BA 3OOYA 3EF0A 4LQCA 5E2BA 5E9AA 2ZXFA 3LQQA 1Z5UA 4LZOA 4MVJD 4LY0A 1TI7A 1J0BA 1VE9A 4L4SA 1H1LA 1OHHA 5C1PA 1L4EA 2JHGA 5SZHB 4AXBA 2KHZA 4TPKA 2YMMA 3CR7A 3RJTA 2FSVC 3C97A 4GIBA 4DM7A 3DBVO 3ASZA 1U7UA 5FWXA 3QM1A 1L5LA 5L7TA 1FS5A 3HJNA 4LIPD 1EFAA 2WJ4A 3NYRA 3RS0A 4B4DA 4GI1A 1JZQA 2YJNA 5BUQA 4I6EA 1W2WB 5EE0A 2JJ1A 4TYMA 3AP3A 3DMYA 5BUCA 2WWYA 4AJPA 3VH3A 4NFYA 1T8RA 2R751 2ZBRA 2WZQA 4PWYA 1LI4A 4RVSA 3V1TC 1N7IA 4TRRA 5AK4A 1W87A 3KLNA 2HBRA 5U9CA 3PFWO 3ZEIA 1RI3A 4DNFA 4KIJA 4RCYA 5JFOA 1AURA 1UPUA 2B1JA 4I50A 2V03A 3RSFA 4B3HA 4WKNA 2Z4RA 3RUCA 3WYBA 4RORA 4Z4CA 3U4AA 2GUGA 2FUEA 1NUPA 1CRLA 1GCGA 2HU7A 1JYEA 4DBLC 3VDXA 3PFGA 2O3JA 1Y80A 2QI9F 3NXSA 3TTYA 3NHPA 4PLTA 4E6EA 1GVNB 3C8ZA 3E7XA 1DRKA 3PI7A 3CUTA 4YMVA 3U09A 1E32A 3QKSA 3KQLA 5HA5A 2ZROA 4PYIA 1NKSA 3C3WA 3FZYA 2QBYB 3IPRA 2SNIE 5HXAA 3CVYA 4KN6A 1RLTA 2O23A 1SULA 3H9GA 4EA9A 4YRMA 3ZHXA 3MTJA 1J7KA 5TV2A 5JJBA 4RBNA 2BGUA 3CSUA 4X9XA 5DJ5A 3VI3B 3ZD9A 1PUXA 3DMPA 4M4SA 3NEYA 4MGZR 2FSGA 2C2MA 3B7PA 4NCJA 1DRWA 2XZDA 3QWHA 4Q3KA 4CR8A 2HHAA 1SHKA 5JISA 4RGVA 1C1DB 1CIPA 1KU6A 1XELA 3K0AB 1NN5A 4X97A 5IYZB 3O4FA 4KXVA 5DM60 2VEOA 3P0RA 1GPMA 4C4YA 3AI2A 1DQYA 4W1QA 2BV3A 3SQWA 4R5HA 2YV1A 1DAIA 4J1QA 1ESNA 4C14A 4U7WA 2QVLA 3AUKA 3VKWA 2QAGB 3A1CA 3U9TA 5A6VA 4BGDA 1WXQA 3EX7C 1XZQA 5FL7A 1JIXA 3IAEA 3JQQA 3SICE 4NJMA 4ETNA 4RTMA 2ETXA 4H35A 3U7JA 2F9MA 1SZJG 4K1LA 4HPXB 4FW8A 2ODAA 3MWDB 4XGNA 1NT4A 4V0RA 3ZJYA 4QRIA 3CUEF 3PXXA 4JYPA 5B64A 1R0BA 1XMXA 3I01M 3F7MA 3I6QA 2XT9A 4GLLA 4DA7A 1QHSA 2R2GA 3RVPA 1I1HA 2XUKA 1S0UA 1YJCA 3OLCX 2QYHA 4GEGA 3W2TA 5E8JA 1YB4A 2AFRA 2PGOA 2X14A 4ZXFA 5A4DA 1DOZA 3S1SA 1TLLA 3C8HA 3AHEA 1TK3A 3DKRA 1AKYA 2NUAA 3RROA 4I4TF 1DWOA 1Z74A 3U7IA 4OB8A 1J2UA 2WKWA 3V80A 4MPRA 2HO4A 3ZNNA 1LDEA 3SIXA 3A8TA 5B4VA 1IBLB 4EW1A 1A88A 1LSJA 2XUHA 4IJMA 1KVUA 3I6IA 4ZO9A 5L95A 5G3YA 3B3JA 5JNWA 2KB0A 4URFA 4EY6A 5JCOA 2XAAA 4YRPA 2RONA 4LRXA 4QBTA 1E1KA 5B6PA 3SSAA 3MAJA 3EIXA 421PA 5B57C 3D3EA 4Q3DA 3VNBA 1GNLA 5DNYB 4OAPA 5M3BA 2DWUA 5ESXA 1SB8A 4TRMA 1NVUQ 5A9RA 1NWHA 2AKEA 1OZGA 4IIJB 5AYVA 2XHZA 1R16A 1SQGA 4D9EA 2Q2WA 1FBTA 4DIKA 2Z9DA 4ZZIA 3NB0A 3QMMA 1AB6A 5CCDA 3EHEA 3KYDA 1QHHB 4CJXA 1HZZC 3EOZA 1Q14A 1OBVA 2C54A 4R0MA 3B51X 2Y93A 3MS4A 1OFTA 3OBBA 3PUJA 1EUZA 4TVSA 2ZKLA 3BCHA 1CU1A 5GV7A 1Y1KE 2P27A 4IDQA 5K7SA 3FPHA 1YZVA 2FPOA 1K6EA 2PT7A 2QRNA 2Y1CA 4MINA 4MR7B 1T8TA 2ZSHA 3H8SA 4MW2A 4OBWA 5FOWA 1HI9A 5KPDA 2GB4A 2EJUA 1W48A 4IHKA 4PONA 2QRJA 3UK7A 4IMIB 4F97A 2FMUA 1DX9A 3WNDA 3A4VA 3F9RA 1R15A 2I2DA 3NIDB 3Q6NA 4MUHA 3TGPA 3HI4A 3U1VA 1PFKA 2EDCA 4IIDA 1NF8A 3OU2A 4QTYA 2CNLA 3T9FA 2OWEA 2XOKA 2JLZA 1YQUA 1RADA 2JFYA 4JWTA 2PSHA 4O4HB 2FETA 4LJ9A 3A26A 4BECA 4YDQA 2CK3D 5BV1A 4FCWA 1K6JA 2O0LA 3EVNA 2YV3A 5BUZA 1DJQA 3JQGA 3WWOA 2Y1LA 1PL6A 1YB2A 3EWAA 3S6JA 2NXWA 3OPYI 1Z2CA 3IQXA 1DUVG 5EJ4A 4N03A 2M6RA 3AYXB 3W5CA 2CJYA 3GDGA 4A2CA 1M5UA 2F7SA 1S8OA 3NATA 2AOTA 3D59A 4L2IA 4OF4A 5B1IA 1IXYA 1LBIA 4PLWA 3RFCA 2BFMA 3WAJA 4DXHA 3NQ41 4DL9A 3KPJA 2QTGA 3PQ8A 2ERYA 1DT3A 4JUCA 4LI0A 3U2QA 5AJXA 5E7IA 2DCMA 3NW9A 3UMMA 1HSZA 2VK2A 3H1GA 4DC9A 1SXJA 5EQJB 2VK4A 5TQ2A 5B1YA 4WINA 1N5JA 5JALA 2AFHA 2XCUA 1Q50A 3AL0C 2DUWA 2I34A 4BNHA 1WZEA 4WQMA 4CV3A 1T0PA 1WUYA 4O2AB 4KI0A 4DEVA 3DWEX 3ZDFA 3MF4A 1EK2A 1HTWA 1KZ4A 2P6PA 4G6ZA 5JJIA 1OZ0A 4IXMA 2EGGA 3O93A 4U2BA 2PT9A 1OROA 2O05A 2PLRA 3DPIA 3H04A 1DIBA 5HHTA 1OWPA 2J0QA 5K0EA 1CR6A 3O1LA 3ZS8A 3T3OA 1EXDA 4K0KB 1U0EA 2JLAA 2F1JA 1NN3A 2GNAA 1U9YA 4GX1A 4MV8A 4N39A 4RJIA 1ZM3A 5CLGA 1VP9A 4A15A 1T6BY 3GUYA 4I3GA 4V0KA 4G0PA 5J3JA 3W6OA 2ZUUA 4PBTA 2RJNA 1SBIA 4E5YA 2IYRA 2YHUA 4B47A 1E79A 4U9UA 3UOGA 3VYTB 2VC2B 1GVHA 5FTWA 4YYZA 1F38A 1D8AA 4ZQEA 5FJIA 4FB5A 1IEWA 1MU0A 3K6KA 3JR7A 1GPAA 3ENVA 4D0LB 4QLBA 5CFOA 5K5EA 1W73A 4XKJA 1JSZA 4MPJA 3TLZA 5AW6A 2OG1A 2DLCX 1W94A 3B9QA 4NBRA 4GOND 4YJ3A 1O96B 1WQ4A 3OT5A 3RSZA 3K6RA 1E77A 3VR6D 5BURA 4HYYA 2K7FA 2ZBGA 3DT9A 4JDPA 3BGDA 1EBBA 1PLLA 1QHYA 2QUKA 4YCNA 1JILA 1NR1A 1XJCA 4WZ6A 3ZV7A 2Q3MA 3AONB 2JGDB 2C3MA 2OPBA 4K05A 1E5DA 4KZKA 1JDVA 2Q4DA 4AZTA 1QK3A 3COPA 1BDBA 2JAOA 1GN9A 3NOXA 4CFSA 3EZFA 3HA3A 4R5MA 5DLYA 2P65A 4E32A 1OXSC 2A7QA 2XCLA 3F3YA 2MINA 2NVWA 3ANSA 3O9VA 4S12A 1SQ5A 2WY2D 1Z0KA 1U8CB 1QLWA 1EGQA 3FX2A 3N6XA 4F2PA 4DCVA 2REOA 1W46A 2V7GA 4B3CA 4NYMR 3KOMA 4RIHA 2W43A 2BFCA 1MC1A 4B6GA 5AM2A 5LN1A 3GRZA 4ZO4A 1IDOA 1UIMA 3VPAA 3TK1A 2QQ0A 5LOVA 3QLUA 1JVBA 1AGRA 2YHSA 3BM5A 3IAUA 4X6XA 5C7OO 1E5XA 4D8TA 1G5RA 3W7AA 4MRPA 3P2OA 4PQEA 5FO1A 4EB0A 1TMOA 3HUDA 2PMFA 1SM4A 1H05A 2VCHA 4D4HA 3GZ4A 2HPAA 3QLVC 3LWBA 4H3HB 4LJYA 2I78A 4JJ6A 3CU5A 2Q4RA 3JVEA 4JVSB 1MXFA 3P9XA 4MI9A 4OGKA 4P4SA 4BATA 4S1OA 4DS3A 5JLJA 4CTNA 1XVVA 4J1NA 1PW7A 1AGXA 3EXEB 2R5FA 3H2YA 4RZSA 3H5NA 5TQ0A 4F3CA 4NIMA 1DC5A 1W0KD 3ZK9A 3ZXSA 3BSYA 3B1ZA 1TMGE 3HXMA 2SCUA 2PSSA 3F2IA 3CLSD 3DBHB 1RQ2A 3P9KA 4OHOA 4QELA 1AVTA 2KYRA 4ASUD 5LXTA 4HQOA 3FZGA 1LS6A 3NBQA 3QBDA 4PYQA 3ZVRA 4EPVA 3GG2A 4H6XA 4RD3A 5U4QA