4YAQA

Crystal structure of a computationally optimized pg9 mutant
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
239
structure length
237
Chain Sequence
ERLVESGGGVVQPGSSLRLSCAASGFDFSRQGMHWVRQAPGQGLEWVAFIKYDGSEKYHADSVWGRLSISRDNSKDTLYLQMNSLRVEDTATYFCVREAGGPDYRNGYYDFYDGYYNYHYMDVWGKGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords PG9_N100FY Fab heavy chain
publication title Redesigned HIV antibodies exhibit enhanced neutralizing potency and breadth.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 237
sequence length 239
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-02-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yaqA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yaqA01
4D0CB 3BP7A 3RGVD 3V4UH 2ZUQC 4JVUA 1RUAH 4JY5H 2WANA 5GRZA 3BEVA 5CINH 2OK0H 4HUUB 12E8L 4UT7H 4G42A 4HUVA 4FN0A 3G9VA 4PJIE 3O11A 2CSPA 5TDPB 3EO1A 1KJ2H 4OZIA 1WSST 4DKEL 1MAML 4RGMC 4L8SA 2PTVA 1FLRH 2DI8A 1DVFB 5IROA 3S3JA 1RPQA 1K2DB 4JREB 5DZLA 1JN6B 4KKAD 2W60A 25C8H 4O2CA 1CLCA 2YD5A 5BRZE 4U31A 1BOGB 1CVSC 2Y23A 5CJOL 5AAWA 1DE4B 5KTEL 3OGOE 4N0CD 1KULA 3V4PH 1BJ1J 5I19L 5IVOA 2IANA 5LXGH 1F4YH 4HLZH 1DBMH 3SDAC 4NKDB 5GRVK 1I7UA 3VG0H 3O4LD 4I77L 4JPIB 1UACH 2CO7B 3BKML 1CR9L 2HT4C 4Q0XH 5GQBA 2W59A 4NHCH 4NNPL 4QRRE 1RIUH 4OKVA 3BGAA 4JRXB 2JJUA 43CAB 3O8XD 1AKJB 3EYOA 3U36B 2NYYC 4PJGA 4NKIH 3PDDA 4OT1H 1REIA 4M1GL 3FRUB 3SDCD 5AD0B 1H3TA 4GAJL 3MNZA 3KPTA 1YJDC 2DTML 5JXAL 1U0QA 3QRGL 4WI9A 5EG6C 5ENWA 4NFBA 3ARGA 1OHQA 4HK0B 2VLLB 5J7CC 5CS7A 4J3XA 4L1DA 1R3LB 1OTUC 4OCRL 2BXZA 3LKRA 4R4BA 4F58H 3E6FA 2HVKB 3VRJA 4KVCH 1KEML 3IFPB 4FZ8H 4BSWA 5DMKB 3QEGH 1W72H 2VRAA 4ONHB 3QUZC 2VXUH 3QZWB 3QA3B 4X6CB 3TYGL 5I6XC 3HG1D 4H26A 4YHOH 4NQUA 4WW2C 5DJYA 4WHDA 4FQXA 2J88L 2Y72A 1Q94A 1QUNA 2XV6B 5FYKL 2DM2A 1JVKA 5F7WC 3LDBC 4NM4H 4S1DC 4BUHA 2X05A 3IU3B 3WXVL 4GH7B 3HAEH 5T1DH 2V2WA 1YA5A 2AJ3B 2VR5A 4MCZA 3N1FC 1ZS8B 2B20A 4QY8B 3RI5K 4R3SA 1Q38A 2OTWB 3EUUA 1ZWIB 3CFKA 2P24A 4KI5C 4Z77A 1CD0A 4K9EL 4KKCC 3OR6B 5F89B 5F21B 5TF1L 1BFSA 2FBJL 4XNUH 5INDB 2BNRA 3TJHD 5HBBA 5LAXB 3D87B 2VLRB 4KZDH 5EZJA 4DVRH 3ARFD 2X7LA 5DD5H 5KBNC 4NJAL 3U0TB 1QSEB 5I1EL 3L5WA 4U6XA 1SJHB 1UWEH 2JJVA 2R4RH 4LOUD 3QXTA 1L7TL 4NQDD 5DA4A 4HFWA 4M6OH 5C0FB 4WO4A 3HZKA 1JPGA 3NOIA 4JJHA 4OLUH 5TGBB 2OP4L 4PRIB 3FO1A 5HHOB 4LQ1A 3HUJE 2OR7A 1S7RB 3GHBH 1MFNA 3TO4D 5EBLA 3WUWA 3H7BB 2E7LA 2A9NL 2I07A 4QRSB 4XBPA 1RULH 3K1DA 1SVCP 5CCKL 2DB8A 5GSRB 5IW6A 1BBDH 4M4PA 1CTOA 1X5HA 4OLWL 1FNGB 4KTDH 1A7NH 4F57L 3U2SB 3VWJB 2UZXB 1F3DH 1INEL 4X8JB 5IFHH 2BJMH 3MUGA 2J8UF 4QCIA 1KYOK 2Y6SC 2XY2A 2BDNH 2QQKL 3QXAA 5HHMB 4LARL 4FS0A 3OKNA 3Q3GB 4QXTB 5GRXG 4M8VA 4GRWE 4DGVH 1BQHA 1KELL 1JF5A 4H5SB 5ALBL 5IF0A 2E7HA 2AABL 4ODHL 3HI6H 5FUCC 1QKZL 4U6HB 4X6FB 4X5WB 5IHLB 2VN7A 3RL2A 4ONGL 3VXMA 2D7TL 4XCNA 1HWHB 3U9PL 1GOGA 3BD3A 4PJ5A 4C59B 5IB2B 2AK1L 4J8RB 4NZJA 4D0DB 2GSIA 1NCAH 1UG9A 3PIQB 1WCBA 5LGJB 1DVFD 1A6ZA 4QTIH 5E8OB 3JTSB 1RZ8A 5FGBA 3PGFH 1FZOA 2YUXA 3AREC 5D71L 1A0QL 4I13B 3KPSA 1CTNA 3QZWG 3FO2A 2NPLX 1F5WA 2HRPH 4L4VA 1B4RA 5KZCD 3DXAE 1YEDB 1IM9B 3ULVL 1G7IB 4KJWD 5EUOF 4E5XB 4KK9C 5AYUL 3W9EB 4LVHB 3TYFB 4LHQB 3ZL4L 3MYZA 5E2TL 5CEYA 3ZKMD 4WV1B 3BE1L 1BM3L 4AYFA 4MB3A 4YGVA 4UB0H 1AKJD 2YD6A 4GXUM 1DDHB 4UT6H 4WUUA 4LVOC 5CJQL 5DD3L 5HDBF 5ADOH 2XG4A 5IFAL 4NJ9L 1VB9A 4GG6F 1CS6A 3HZMB 1KFAL 2Q86A 3G04B 3IRPX 1ACZA 4LVNB 3KLAB 2VZ3A 4JQXA 1ZXQA 5C8JB 1QNZL 4KKLC 1C8PA 2C4FU 3L1OL 1YC7A 3G6DL 4GKNA 4PJ7B 3FB5B 4NKQB 5IEKB 3RJDA 1V7ML 4HHAB 3TEUA 4OZFA 3SN6N 1MVFA 1P1ZB 4AJ0A 3EYFB 3QDJB 3RGVC 2OJZL 3O41B 3GSRB 1KXVC 3BP6B 4CGTA 2IFFL 3FFCE 2HT2D 4L9DA 1DBBH 4UTBH 4JKMA 5DD1H 4O2EA 2Q1EA 5KW9H 3BSZL 3VRLF 3VXUE 3WIIH 1X3DA 1X5AA 2J6EH 3P73A 3PG2A 5C08B 4LCIL 4GW1B 4F7PA 1R5WA 4RAVA 2R69H 3STLB 3MLXL 5GS2H 2UWEE 4BYHA 1NC2B 1VEOA 3C5ZA 3N85H 4FQCH 2ZUVA 5EULV 3MLVL 5IWLC 5D9SB 3BRDA 4P23B 5EZOL 4K3DL 4ZUVB 4WGVB 1T20A 5D2NE 2IWGA 4Q6IA 4U7MA 4JDZA 3D85B 1EFXA 2OCFD 1J0HA 2WAHA 5CMAB 3BIBX 4IIQB 2HJFA 1QSED 5TE6H 3DRQA 4ZMAT 1WV7T 1M7IB 3PHQA 2EDOA 5H2BB 3SKMB 3RIFF 1PD6A 4NRZA 1HHIA 5HPMB 2BRRL 5C0GB 2G9HA 4F7TA 2LU3A 4CDHA 3B9VA 1YPZE 5HI3D 3AAZB 3QEQB 2R2EA 3MPCA 5BXFB 4ODXB 1I1RA 4U6YB 3HE6B 3MLWL 2W9EL 1IC4L 2EE3A 3VWJD 2X6MA 1FC1A 5JHDB 3TPUA 4LPTA 3VFMB 2HH0L 3O6KH 4GXUN 2A6KB 3VFWB 4U05A 1Y0LA 3DGCR 3PWPE 4L8DA 5F88B 1B88A 3KYOA 3RY6C 1VEMA 2XKNA 2WUCH 3SQOH 3MXVH 3CVIL 2GTWB 4XTRC 4JEGB 5HY9A 1I8LC 1B3JA 3FQTB 1EAPA 1S7SA 3X11B 3VFNB 1CI5A 4OF8A 4QRUB 3HRZA 3NACH 5CZVH 4EZMA 3TCLA 2GT9B 3GBLA 4DQOL 4P57B 5F7EL 4P5TB 4CVZB 4XPTH 1HXMB 3L3GA 3NMEA 3PP3K 1CXKA 3V5KB 3BO8A 1CL7H 2W92A 1BWWA 1D5IH 2VZOA 4IRSD 4DKDC 3ARFC 1IM9D 1HYRC 1EEYA 1CT8A 1QRNE 2BVOA 2F53D 1CD1B 4JPVH 3IJSA 3PDOB 4LOUC 2E27L 4K55A 4R0LC 4EI6A 3NFNB 3S35L 3QUXA 3H9HA 4NO5A 3U4EB 1B9ZA 1IC5L 5HHQA 5JORA 4XCFL 1BLNA 3JVGA 5JXED 1KPVB 3TO4C 2HWZH 1LK2B 5E94B 1KLGB 5D72L 5J9PA 1MCOH 1MWAH 3C6LA 4BQBA 2F8OA 2IPTH 1NCWL 1AQKH 2EYTA 3DURB 5J6GA 5D1QB 5D7IB 3UDWA 4N5ED 4GXVH 2JIXB 3RUGE 1SM3H 4UQ3B 1BWMA 2HJLA 1J88A 3CK0H 3QDJD 1VSCA 2X4UB 4ODSL 4PRPA 4JFYA 4LSSH 3FHQA 3RVWC 4X98B 4HIXL 5E1HB 4HUWB 2A0LD 1MREH 1P2CB 1RMFL 2Z31B 1AY1H 5JPMB 3PHOA 4PJDA 4H88L 5GS0D 4NQTA 2MCPL 5C08D 1NUDA 5DTFA 3RVXD 1DVFC 4LLQA 3FQWA 4JREC 2ICEA 1TMCB 5GRVL 1NC2D 3MLTB 4OF6A 2GUOA 2ED9A 4XPFH 3Q6FB 4JO1L 2X09A 4P23D 2V17H 3O6MH 1KIUA 1OAZL 4OLVL 3EOBB 1JUFA 5IB1B 1T7YA 2X42A 5HYSA 1Q9OA 1QTYT 1RZFL 4FRWA 1KGCD 4X7CC 3QO0B 3D85D 3T0EE 1ZT7A 3OG6B 2E7MA 1NCBL 1RUQL 1PYWA 1IL1A 4LQFH 4Y5YA 4LLDB 3ZKMC 1ADQH 4LLMA 5K33A 1MRFL 1CBVH 1WGOA 5IQ9A 3WSQH 5K9QI 4HH9A 4KMQA 2Q87A 5C7XH 1J10A 4HKXB 1QFWI 1P6FA 1P53A 3S36H 4I2XA 5D5MB 1AC0A 1MQKL 4XMKL 4AEHH 1MPAL 1MCDA 1L0YA 3EDFA 4U1JB 4X83A 1X6LA 3WJJA 4TTGA 3HE6D 4TTDC 3BIAX 4ODTL 1MHHB 5H94A 4ORZC 4U49A 4F9LA 3SGJA 2BZDA 1NUNB 4EDXB 1W72B 32C2B 1DUYB 4PV9B 4U7SA 5DRZA 3KPRE 1HHKB 3OJMB 1U6AL 3CLFL 4HBCH 4GRWH 1XGUB 4QHLA 1U42A 3X3FL 2W38A 2V2XB 4UILH 1FDLH 1C5DB 1FYTB 3VW3L 4LCWA 5J8OA 3SDXE 3PJSA 3MA7A 4G6FB 4PRAA 3HAEB 5HGBB 4GW5B 3OKMB 1NC4B 2B4CL 2JB5L 2MKLC 2MQCA 2BSRB 4OZGF 1FO0H 2VH5H 6FABH 4UU9A 5E99H 4KK8D 3HNSH 4XMLH 4YJZL 2D0HA 5IHZA 2BOCA 4YHZH 2QQNL 4KK6D 1KTKE 3MUJA 5FK9B 5I76A 4P5TD 4BSJA 4M7KH 3HRPA 2VLME 1K6QH 2W91A 2YD1A 2EDBA 3E8UL 1E28B 1NGXA 5F72S 3SOBH 2QQQA 4K3JL 4D9QD 5JW5B 2HFGH 2FATL 1IBGL 4RDQF 4R96A 4G7YH 3CMOL 1YECL 1T3FB 1A6VL 4PV8B 3ET9F 2FD6L 5DDHB 2AV7A 4WI5A 1G9NC 5FGSA 5F7LB 2VMFA 4YNYB 1WEJL 1KCSL 5JOEA 4HLZG 4HIIB 5E00B 1HOCB 3TNMB 5SWSB 3QEHB 2AXHA 3GI9L 3BX7C 3DI2B 1MRDH 1R3JB 4B50A 3MRHB 1MCBA 4ZOEA 1JGDB 1P7KB 4GSDH 3VWJC 2Y5TA 1RZIB 3LOWA 4HQQH 4JM2D 4NRXA 1NFIB 2J3SA 1FHGA 5EN2B 5D1QD 4Q9QL 1LK3H 4XXDB 2EIZA 4Q9BA 4KXZH 3EFDH 2VLJE 4WTXA 4JO2H 1VACB 3KPNA 4IMLB 4NQVB 4RRPG 2J8HA 4U1IA 4GMTH 3I3EA 4RMUA 4F15C 3CIQA 2UYLB 3B6SA 5D70H 1KJ3H 4OI8A 3EDKA 5GRUH 5IQ7L 5FHBH 1CLOH 3TBYA 3ILPA 1ZT1A 5GZND 4Y1AB 5E08L 1DANU 1TZHB 1R5VB 2VIRB 3T8XA 3QUYA 3FO0L 5C09D 2F54B 2C5DC 5FDWB 5KANI 3ZMRA 3AY4C 2DKSA 1JK8A 4YX2H 1TJIL 4ZFGL 3ESUF 1AJ7L 2VR4A 5CWSB 4ZAKA 1A7RL 4FQJH 3HAEG 2AV1B 4HAFA 2ZCKH 4PJAB 1AGCB 2ZSVB 4HK0A 2VLLA 5GGRY 4FP8H 5DFTA 2AJSH 5E6ID 2V5MA 5GGQH 2A6JA 4OCNC 1IMHC 1LEIB 5F9OH 4LVHC 2GJZB 4JFEE 1IEBA 1YEHL 2NQCA 1MFAL 4WV1C 1Q0XL 5E8PB 2B0SH 1WZMA 5EO9B 1I85A 2F58H 4YDIL 4PY7B 5LWYL 4YQXH 4DGYL 3STZA 1XF4B 5BOPA 2QTEA 4JHAL 3DV6B 3EJJX 2DD8H 4LKXB 4QRTA 1T03H 1AIFB 5JXEC 4I3GA 1XCTA 4LFHG 5HGDB 2CKNA 3VD4A 1EXUB 4LVNC 3MV8E 2YPVH 2L4OA 1JE6A 5SWZD 2X4TB 4MLIA 4QY8A 2XG5A 4XNYH 4NZDA 1XR9B 1ORSB 1I1FB 4GJTB 1EHLH 4N5EC 1OP5H 4K07A 1RHHB 5C0AB 4YIQB 2HKFL 4M1DH 5DJAA 5F89A 4GAYA 5CEXA 1XGTB 2AI0H 2JJTA 2BVUA 2DIJA 2PO6A 3BEWA 4L5FH 3ZKXC 3BESR 5HDLA 2A9MH 4QWWD 4UNUA 1OF2B 3P40A 3UXFA 4HWUA 4D9LL 3IFOA 1XFPA 3QPQC 2P5WB 3HC3L 1R3KB 1HQRB 1URLA 5GS0C 4PJCE 2OL3H 1UM4L 5EOCJ 3VMNA 1KXTB 4H8WH 1RURH 4TPRL 3I9GH 3HN3A 3S7GA 4OB5L 3L3DA 2PW2A 3TFKC 3F12A 2D9CA 1WZLA 1MIEL 1D5XA 1CGXA 3KDMA 1S7RA 3O3DB 5C0JB 4ALAL 4P23C 3VG9B 1L0QA 1O7VA 4Q2ZB 1KTLA 5HDOA 4A6YH 4MD5B 3DUUA 4V1DA 5DJCA 5IVXA 5KVDH 2BSTA 2VXVH 4E41B 5EWIH 1NBYB 5J89A 1T1YA 3OMZA 1MFCL 4PJEE 2RB8A 1IKFL 4AY0A 4IIQC 3VE0A 5IBTH 3BPCA 5CJBA 1RI8A 1J1OL 2BVEA 3P4NA 2X4QA 3BPNB 3LEVL 4Z0XB 2ZNWA 4J4PC 4YZFF 2E6JA 4C56B 5FECB 5E8DH 3P4LA 1JBJA 4HCRL 2QLVB 3B2UC 3JWDC 3L5XH 5E9DE 1UQSB 3D39E 3FQRB 2BVPA 1I8KB 2APVA 2R39A 4IBLT 2DQCL 3I6LD 4JN2B 3HE6C 2CMRL 1WBYA 1TJGL 4TUJB 3O45B 1O7SA 1YNLL 2GCYB 1JRHL 2JTDA 2OM5A 1S5HB 2AVGA 4NZTH 5IK3B 3EYSL 3ALXA 4TSCH 1I1YA 4PJIB 3WL9B 3U83A 2PYEA 4PJ9D 5K9JH 4P2RA 1WIUA 2CK0H 2WZPD 3I50L 4XCYB 4XAWL 2XQBL 3D1MC 1T5WA 1A6AA 1T1WB 3TIDB 3VFGH 2Y36H 4W4NA 1U8NA 4JM4H 3W9EA 3SPVB 3TYFA 5BRZB 1YYMH 4LBEB 4KK6C 4WV1A 1IGIH 5C70A 1JPSH 4Y1AD 5HHVH 1EA9C 1P5VA 2YA2A 3B9KB 2EO1A 2H9GB 1NGZB 4KKNA 4HCRA 3T0BA 4ZFOL 3G9AB 4P5TC 3FB7A 2F54D 3UBXI 3X13A 1JYWA 1DDHA 4LAQH 2YRZA 2BHZA 3EBAA 3X3GL 3LZFH 3VXTB 3QHZH 1QLRB 1EV2E 1PKQE 4WEBH 5CSBA 4TVSa 3S3SA 5FO7A 5CGTA 5ALCH 2E9WA 5KVFL 1F4XH 4HIJB 4LIQL 5EU5B 3ZYOA 4QRRB 5I74B 1D5ZB 1Q9KB 4YHMH 3SCMA 3U4AA 2H32H 2Z93B 1UKTA 3HHRB 4XBGA 4QHMA 3O3BA 1P4IH 2R56H 1A6PA 2MPAL 4U1HA 1JZ4A 1ZT4B 3MRIB 4OLXH 2P5EA 4OLZH 2H2SD 5FYLE 3TT1L 2CD0A 3O6FD 3EYFA 4ZOAA 2PR4L 3WMSA 5T1KD 4IRJA 1MEXL 1BAFL 3RZCA 1HHJB 2Y07L 4FFYH 1W0WA 1VGEL 2GITB 4F8QA 3KXFD 1C16B 2V5SA 1JNHB 4NNYB 1KCVL 3VXQB 5DS8B 4ZFOA 4JM2C 1FGVH 1BZQK 3GGWB 4PJXF 3MJ9L 4F7CB 3KNBB 5D1QC 3HA0A 1NBVL 4MDIB 3MLZL 1WC7A 3MACH 2FH8A 4BSVA 1OGAE 2EDQA 2YD9A 4B7LA 5M94B 3CFJB 2XXMB 1RJYB 2O5ZH 5BW7C 5T3XD 3TBSA 3KPPA 2O5XL 4MD4B 3MODH 3MLRH 2R0ZH 1NCCL 2EEDA 5EC2B 5ECJE 4JDVA 3MRLA 2CIKB 3R06B 2Z31C 2OQJA 4NO3B 5GZNC 2WUBH 4XCEA 3BGMB 4GBXD 3SKMA 5HHPB 3VXRD 1SY6H 1HHHB 5EBMA 3ZYZA 1T21B 4KRLB 5FFLA 3CD4A 1MCKA 1S3KH 2XPGA 3SO3B 4WI3A 3C2AH 4KY1H 1ZHKB 1BVLB 1N6VA 5L2JA 5T3ZL 3MNVA 2YK1H 3EOTL 4OCXL 3MJ9A 4X6EA 2EKSA 1FJ1B 4S1RH 4U6YA 3UTTA 1PQZB 5DFWH 3BUYA 4Y16A 3MGAA 4E41D 4UNTA 4O02H 4ZPTA 5SX4I 4JHWH 3SEPA 3FMGL 3VFMA 5MEOB 3MRCB 3HUJB 1HEZB 1K4DA 1U93A 4XVUC 4J1UB 4P9HL 5F1KC 1MHPL 2FB4L 1GZPB 1LE5A 4PJBF 1IAOB 1GGCH 3D2UA 2Q6WB 3M1BA 5C3LD 1LP9A 5I1CL 5CLTA 1FGNL 3OF6A 2KQNA 5BCAA 4Z6AT 4HG4J 3NIGE 3MRJB 1VPOL 1MY7A 1HDMB 5SV3A 2NCMA 3QQ3A 3ULUD 3VFNA 1WTLA 5CD5D 1EHNA 4YE4H 2NNAA 1S5IL 4GRWB 5F6HI 1DL7H 1FZJB 1ZEAH 1KB9J 1IAMA 1S7TB 1V05A 4P4KB 2Q3AA 1AGEA 5E7FA 2ITCA 2J8UE 1CFTA 2VLKA 3V4UL 3KG5A 3VFRA 1H3GA 3BQUD 1B0RB 3DRTA 1RUAL 3S96A 2VXSH 5EA0H 4XNMB 4RX4A 3KPQA 2R2CA 2OK0L 1FO0B 1DP0A 4UT7L 3V6BR 4QWWC 4PRNB 2D03L 1KJ2L 4PJ8D 4U1KB 1WT5C 1YNKH 3QDME 1CD1A 3IS0X 5IR1B 4ELME 4PGEB 1FLRL 4M5ZH 5BRZD 2W9LA 3MR9B 2YUVA 2AEIT 2F5AH 2FECL 1IRAY 1PVHA 3ARDA 3QRFM 2MHAB 3B9KD 3NFNA 1S9VA 2XWTB 2FJGA 3DXAB 2EE9A 5FCUL 1RFDH 4K8RH 5L88L 5TPWL 3KYAA 4S0TD 4GAGL 4PREB 4PYHA 5DUMH 3AM8C 4ACPA 3V4PL 4DN4H 1KPVA 5EU7C 5C07A 5ACMA 1S7QB 8FABA 3MREB 1HSBA 1X4ZA 5FAAA 1F11A 2WBKA 1JNJA 4MA7H 3GNML 5LXGL 1F4YL 3SKJL 4IMKC 1DBML 4FHBD 4O51A 3BZFB 1FFPB 3H9SD 1KB5B 4HJJH 4AEIL 4J3VA 1YN6B 3JSSA 3GMQA 4P2CG 3S9DB 5T1MB 2EXYD 4Q0XL 3BHBB 1MLBB 2LAAA 1RIUL 4UV7H 2JIXA 5EUOE 5GGSA 1Y6KR 2BX5A 1YN7B 2E7CA 4M61A 1KJ2A 4TQEL 5H35B 3PWVB 1BJ1H 4LEOB 2V9RA 4YXLL 4AIOA 3T1FA 4OQ1A 4JFOA 3U7YL 4HUWA 4P59H 5I1GH 3UTQB 5KSBF 1XGYH 1QVOB 2DLTA 3RPIB 5F7KC 1QA9B 2JE8A 2YPLE 4JFXA 3DMMB 1OW0A 1HNFA 1NGQL 2WQ8A 4RSVA 5BQ7B 1FP5A 2NX5E 1RZKC 3CFBB 5E70A 4F58L 1T89A 4HDIB 1WFUA 4PGZA 3P4MA 3FFCB 3E0GA 3VFSA 4FZ8L 3MLTA 4HKZA 5EBGA 3QEGL 5MEPB 3F8UB 3GJEB 1HIMH 1ZTXH 1WAAF 3VXUB 3BN9D 2NY4B 3QWOB 3QIWA 1XGQA 3F65A 5DUPH 2A73B 4YPJA 4KDWA 4QRPD 4DKAA 1ZANH 3RX5A 4U3HA 3HMWL 5KS9A 3QDHA 4NM4L 2UWEB 3WYRA 4MB4A 1IGTA 4O2FB 5T1DL 2HFFA 4H0IA 5D6CA 3U0PA 4HC1L 5KJRH 2QBWA 1C08B 4QNPF 2JCCA 4YC2B 4X80H 3MGOB 4GKZB 4QHKI 3Q48A 3RWIA 4KHTH 5D2NB 4RGNE 3RWGB 4AEFA 3WEXB 3VWKA 3D5OF 4HKXA 5GGVH 4L3AA 4PP2B 2N7BA 4K7PH 4KZDL 3MRNB 3T2OA 1T5XB 4OUUA 4OZIE 4OZ4A 4L3CB 5DD5L 5L7XH 3CDGB 2ED8A 3QIUD 3V79C 4NRYB 1MJJA 4XPAH 1UXSB 1NGWB 1YEEL 2Y7QB 1UWEL 1A3LH 3ZDXE 4CJ0A 5C9JA 1DUYA 4BK5A 3QFJA 3AB0B 1MUJB 1EEZA 4PRHD 2AQ2A 4OLUL 1YPZB 1H0DA 3VXOB 2BSSB 1AXSB 4ENED 1FYTA 4W4OC 4BH8B 2DQFB 2IANE 2C3XA 3LKQB 2HMID 1RULL 2X1OA 4X7SH 1CFVH 5ERWA 2GAZB 4HC1A 1H15A 4XNQA 1ND0A 4JB9H 4YFDB 1FORL 4KTDL 1A7NL 4OCWL 1H8OA 3AS1A 4RIRB 2WM0A 1Q8MA 5D7LA 1RZGB 5IFHL 2NLJB 5E1AA 1IVLA 3PWPB 1BZ7A 2DMCA 1HHGB 2BDNL 1FL3B 1FN4B 4KWUA 1IEAA 1U8JB 2JLLA 3UZVB 3CDYA 1B0WA 2RAMA 1FFNB 2E7BA 1R3IH 3NCEB 4PGCA 3HI5L 4ZFZB 5HVWA 3AS3A 1F6AB 1E28A 3OKLA 4GRLB 1ED3A 3WNOA 2VZSA 1Y18A 4ZTPH 1T0MA 4AK1A 3SKOA 2OL3B 4UOW0 3GIZH 4X7FC 3JV6A 3LEXA 1LDPL 3O3EA 1MCWM 3UROR 3RTQB 4JFPB 1NCAL 1U8IB 1G0YR 2HYMA 4PV8A 4XVJL 3WFDH 3IGAB 4NPYA 3FFDB 1KLUA 3SJVA 5DDHA 5GGRB 1HI6B 3EFFA 4QTIL 2E6PA 5EPMB 1N26A 3MUY1 5JUEH 3PGFL 1C1EL 3UJTL 2A1WH 3TNMA 3R1GL 1KOAA 1QRNB 3VG9C 3BP5B 1NFDA 1S7VA 2R1XA 4NZUH 4LSTH 5F97E 2JB6B 2VSDA 1YZZA 3A67H 5J1AB 3BOVA 4JN1H 2VZVA 5EFIB 2CLZA 2IPKA 3HLAA 1IQDA 4Z18A 3Q0HA 2IMNA 3QAZB 1FE8L 1KCRL 1G9EA 4PG2C 2SEBA 3TVMB 3BPNC 4J3WA 2QKIA 5CEZD 2BNRE 4XHQA 3CH1B 1S7UB 2RBLA 2X89A 4GRMA 5EU6D 5I1AB 1C5CH 4ZYKB 1T1ZA 1FCCA 3OKOB 3CFDA 3ULUC 3OKDA 3PWNB 2EEBA 4AM0B 3E6HB 1IKNA 4XB8A 3GSWB 3RUGB 3MNWB 5DUBB 2IFGA 1AGFB 5I71B 2VIRA 4O4YH 3T2NH 3QG6A 2BHUA 1HN1A 2B1AL 2BSED 3MRRA 1F42A 3Q1SH 5FYKE 1RIVH 5DD6B 3BQUC 2FYYB 2VB5A 4XVTL 5DRNB 1X5JA 5HYJA 1MI5E 1OP5K 3K2MC 4WY7L 1F4HA 3DGGB 4UTBL 5DD1L 4OQTH 1AC6A 5D93B 3WN5B 4ETQA 4CN1A 4X6DA 3WIIL 3ISWA 2J6EL 5MENA 3WJLC 3L3HA 3RX8A 4JY6B 2R69L 2YBRA 5FM5M 2W0FB 5I18L 4BFIA 5E8PA 2B39A 3B9KC 1KLFA 1AE6H 5MERA 2VR9A 4Y4HD 2ARJB 2DIAA 4WVRA 4H1LA 4AENB 4DK3A 2GY7B 2H6PB 5HGDA 3T0EB 3VXME 2VDNH 4LHUB 4MJ6B 1EXUA 5DLMH 2H32B 1JGVH 4LNRB 4PJ5E 2X9XA 4G9FB 4QGTA 4P2OB 1VENA 2YRPA 1DQQB 5CILH 4MX7A 5I74C 1J0KA 4EUPG 2FDBP 4M1CD 2ATPB 4ZPVA 5TE6L 1MCCA 4WIQA 4OD2B 4HWBH 1ZE3C 3F58L 1I1FA 1RHHA 4MLSA 4KHXH 4U2YA 2BMKB 3CFIC 1SJEB 3TA3D 1AO7D 3KPSE 4GKSB 4UDUA 3QI9B 1QSFE 3PWLB 4L4VE 3O2VH 4PJFA 1SQ2N 3TZVD 1OARL 1OM3L 3TBTB 2J6EA 1T22A 1A5FH 1EUUA 3QWRA 2W65A 3KHOA 1PAMA 2P5WA 3KPRB 4V2CB 1GPOH 4QYOA 3VD9A 1INQA 1YQVH 3W11D 3MBEB 4AT6B 1CXFA 2NY5H 4K2UL 3O6KL 3W39B 2IH3B 1EFQA 5FGRA 4BQ8A 3SDXB 4WUUE 1P84K 1CZ8H 4HX1B 5DMIH 3V5DB 3D69A 2ENSA 2WIIA 3O3DA 1DLFH 2WUCL 3SQOL 1EJ6A 3K46A 3MRKA 2BXYA 3T3PE 4NUJB 4MD5A 1JWSA 4HUNB 1N2RA 4PLJD 1CF8L 3KPOB 5F7DB 3RX7A 1WFNA 1WWWX 4WTWA 1A6WL 1BMGA 3PNWB 4R7NB 1G0DA 5CZVL 4XPGL 3D25A 3BD5A 1N6QL 3T09A 1NEZB 5I8OH 1UC6A 2EIDA 3KYNB 1P7QD 5B39B 3GKWH 1OCWL 3GSQB 2VISB 4YBHA 3IDMB 4HJGA 4BKLA 5A2FA 1NANH 3ULVE 2FO4A 3BZ4A 4Y5VA 3SO3C 4JZOB 4U33A 2IBBA 1BX2B 1IEHA 3B43A 1J0YA 4ZOCA 1CXEA 1S7XA 1D5IL 1JNNH 3JV4B 1UQSA 5ANME 1RAMA 5IB3A 2YKLH 1ES0A 5EIVA 2XWJB 1U8MB 5IVZA 3AXLB 1I3RB 1H8SA 4CU8A 2Q8AL 4HZAA 4NDMB 2P42B 1DBKH 4M5YH 4WWID 2C7UB 3IXAB 4APQD 1CQKA 4YHPB 4MAYB 4ENEC 5E24E 3TVMD 4IDJH 5HSFA 3HR6A 5GSVB 2HWZL 3VI3F 2HMIC 4N0FA 4PUBL 5FUOH 1D3CA 1MCOL 3QULB 4O5LL 1MWAL 3STBA 3WLBB 2VLJB 1AQKL 8CGTA 5DFVC 2LU4A 4LBEA 2ZCLH 3OKKA 3NA9H 4MHHG 1R3HA 3OX8B 4P4RA 2I5YH 1SM3L 2GEEA 3PDGA 4P4KC 5C71A 4Z7VA 1OPGH 4TRPH 3GK8H 4JFDA 3VXTA 2F8VA 4J3OC 1BREA 3WKNA 2IGFL 4KDVA 4IM8A 2LE9A 4LSSL 4CVXA 1WITA 2DQJH 1UH4A 2HTKD 4M7JH 4JFQA 1Q9KA 3S6CA 1FZKA 1AY1L 4LF3B 1KG0B 3TH2T 4OM1H 3T65B 5DD0H 5H8DA 3OAUL 1NLDL 4P5KA 2J12B 5L9DL 3NABH 1S8DA 3RWEB 3SDCA 1GGIH 1S9YA 4R9HA 5DSCB 4YR6B 1JGEB 5INCB 4HWZB 2DQIH 1MCSA 2HAZA 4NOFA 3WKML 1MWAA 4HV8A 1X7QA 3GM8A 3O4OB 4KQ3H 3T0ED 2DM3A 2V17L 4LHUD 2QL1A 4PGBA 5TJWK 4G9FD 1Z3GH 2XIDA 2EEAA 4JFEB 3V6OE 5KG9B 4TSAH 1PSKL 1XF3A 4PJHF 5KSVB 3GGWA 5HD8C 5FF6A 4LLWA 1OB1A 2XNAB 3U4BH 1F3JA 4U6VH 4LQFL 3B2VH 4ZUSA 1ADQL 1CGSH 1CBVL 4R7DB 4MNGA 5EOTB 5AAMA 1LE9B 4X5LA 5C7XL 4WRLA 3U46B 1UM5H 3MV8B 1AGBA 5CD3A 1QBLH 1DBJL 3WS6C 3WNNA 4X8XA 1GYAA 1D6EA 4YDJA 2ZP0T 3C5SA 3S36L 3GRWL 5J6HB 4AEHL 4D8PB 3MRBB 2X1WL 1HH6A 3K4ZA 1WBXB 3BH8B 3KPRD 2EDXA 2F15A 5KAQF 3DMMC 4WW2F 3QYCA 1V3LA 3BGMA 3MBED 3ECBA 2DWEB 4MCYB 1A4KA 1GXEA 4HBCL 3C6SB 4XH2A 2GTZB 1MAMH 4UILL 1FDLL 5D1ZD 2ZG1A 2D31A 1FV1B 2NY4C 4G8FA 2IQ9H 4NGHH 1AGDB 2AGJL 4PJCB 4CNIB 4BFGA 4KI5F 1FJ1A 4HUMB 3RNQB 2WK2A 1JPTH 3FAWA 1PW3A 1ADQA 1D5MB 1FO0L 5IFJB 2VH5L 1U8HA 2ZSWB 3FN0H 6FABL 4NBZB 5E99L 1B90A 1BQUA 3QBTB 5JW4M 2H2PC 2VLMD 4MS8D 5D7KD 3O6LH 4N5UA 3WS3B 5HYFA 1CDGA 2O93L 5D2NC 3GRWA 1LO0L 1W0VB 2NY6D 4I77H 1K6QL 4PRPE 1IAIM 2IH1B 3DUSA 3MRJA 1CR9H 3S36X 3QNZB 4PJEB 3SOBL 3REWA 5T1LB 2C1OB 1F8TH 5GS1A 2HFGL 4LAJH 4XP4H 4P46A 5E8NA 5FHAH 2EYSA 4PJDE 4M1CC 4G7YL 4M1GH 1NH6A 1EO8H 4GAJH 1KF9B 1UH2A 3DBXA 1OAKH 3AB0C 2DTMH 4M3JA 3TA3C 3OL2A 4I3SL 5E9DB 3D39B 4MAYD 2J1KA 4NWUL 1J7VR 4GLRI 2F74B 4JDTH 1E27B 3LMJH 3NPSB 2CR3A 4AH2A 1FO0A 3DX9A 3NCCB 3JXAA 1YYLL 4OCRH 5C0EB 1FVEB 4QT5A 4CVUA 4U1KA 3GMLB 4XXCA 4CN4A 3W11C 3MJGX 4MZ3A 1H3PH 5IIEA 3AS2A 3EFDL 5DJ8B 3L9RB 1P6AB 3DXAA 1I1AA 1A6TB 4R4FH 2J88H 4JJ5B 4K23H 4PREA 5C0CD 1CICA 5CP7A 2ERJB 3LN4A 3WXVH 4GMTL 2PF6A 1J05B 4GRLC 4P2QA 4I2XE 4PLJC 1A3RH 2HJKB 3VXNB 2KL6A 3MV9E 3FONB 4F2MB 3RTQC 5FHBL 4K9EH 5ID1A 4MDJB 4I48B 5LVEA 3QISA 3U30B 1UH3A 4U1NB 1TPXB 1PKQB 1OOAA 1NDGA 4ZODA 4Y8AA 1EH9A 1NJ9A 43C9A 4OV5A 4PTTB 3WV0A 3B4NA 1QBML 4ZNEA 1CE1H 1YUHA 5IHBA 1XH3A 3I6KA 3UTQA 4WDIA 2IAMB 2ZCKL 3EDDA 3OXSB 3RPIA 4FP8L 2OP4H 3F7VB 4WWKD 2AJSL 5JW4N 2I9LA 3I02B 5DF0A 5C6TH 5D6DA 5F9OL 4UQ2A 5CBAB 2VABB 3FFCA 1U8PA 4RWYL 1YEJL 5KSUA 5B4MD 5CCKH 2P46B 2X4RB 2F58L 2BNUB 3QAZC 4OLWH 3TVMC 1CN4A 1IILE 2DD8L 2VO5A 4PB0H 1T03L 1T83A 3LKPB 3LKOA 2G2RA 1QBAA 5I1KH 3PGCA 1XF5B 2QQKH 2WBJA 3UPRB 4LARH 1G9MH 3PABA 3U7AA 1A7PH 3QB7C 5BVJA 4HKBB 2PYFB 1OGAB 1KELH 4OTXH 3VGAB 2AKRA 2AABH 4ODHH 4QKXB 3H3KA 4GG8B 1QKZH 4Z7WF 4XNYL 5I71C 1EHLL 2CLVA 4LSUH 4GKZA 2JJSC 2XFXA 3CFEB 3ZE0E 4ZOBA 3OAZH 3O9WA 5ICXA 3LKNB 4M1DL 3ULSA 1AP2A 3DVGB 3ZZ1A 2VSCA 4Z7OF 2AI0L 3C60A 2V7HB 3QCUH 2X4PA 4L5FL 1Q9LB 1T5XA 3CCHB 4OFYD 5DURB 3VI4F 4H25A 5F96H 3BPOB 3N1GC 5D93C 3WN5C 4LCCA 3F5WB 1UXSA 2Y7QA 2EH8H 1AI1H 5DK3A 2R8SH 2VAJA 2OL3L 4WFED 2N7AA 5EBWA 4OZFH 4H8WL 1LEKB 3I9GL 4NWTL 4E9LA 2OR8A 3CX5J 1J86A 3KLHD 4LSRH 1I7RB 2E3VA 3IVKB 3LS4H 2JK5B 4JANB 4IS6B 2XZZA 5CJXC 5AYUH 3T0EC 3ZL4H 4A6YL 5FUZL 5E2TH 4NYLA 3VFVB 1BM3H 2QADB 2AK4A 4P2OC 5KVDL 2VJXA 5EWIL 2C1PB 2NLJA 4OFPA 4HAGA 5FKAB 2WWKO 5CJQH 5DD3H 2QQLH 5C0ND 3DLQR 3DIFB 4HFUH 3BPLB 2DQDH 2VQ1B 4NJ9H 1KFAH 2VL5B 2BY3A 5DVOA 1WVZA 2K7QA 2OSLA 1VGKB 3HE7B 4JRYA 1HKLL 2ZUYA 3AU1B 1QNZH 3R0NA 3UZQA 4F80A 5E9DD 3UYRH 2YWZA 3QI9C 4Q58C 4RFNB 3RWCA 4DEPB 5E8DL 2HLAB 5CIPB 5HJ3A 1N5AB 3IAQA 4PJBE 4L1HA 4TUOB 5F7FA 2OL3A 4LPCA 2XICA 4HH8A 4EUPA 3SGDH 4AG4H 3WIFB 4EI5A 2ZOLA 1ZSDB 3BRGC 3EIFA 2J8UB 4NO0A 5HPOA 3L6FB 3MBEC 5GJSH 4MD0A 3MXWH 5D1XD 3P0YL 5KVGH 4NHUB 3O3AA 2C26A 4NZTL 4A6YA 4TSCL 3BSZH 3RGHA 1NCNA 3LSOB 1E6JL 5D1ZC 4IRSA 3BXNB 3DHMA 1MJUH 5K9JL 1QRNA 4YHLH 2CK0L 3WHE0 4LCIH 4DOHE 3NN8A 3QDMB 3NGBB 4ELMB 1JRHI 4NP4L 1K4CB 2CDGB 3VFGL 3LQZB 4EOWL 4ZSOE 5A16A 4X5XA 2MCG1 3HR5B 2DQHL 2Q8BH 1YYML 3B3IA 3G6JF 3P30L 5EZOH 2DWDA 3D3VA 5C2UB 1JPSL 4G8GD 5HHVL 4MS8C 1XGRB 1E4JA 4LSDA 3F6LA 2ZPKH 2C3HA 3QUKB 4LAQL 1JTPA 4LEXL 5D7SL 4HMCA 1SYSB 1H3UA 3CH1A 1S7UA 5DK0A 3QHZL 4NFDA 4XMPH 4WEBL 3CSPA 3HNTH 4ZYKA 5ALCL 3OKOA 2XRAH 1S7WA 2AEQH 4AM0A 5E8EA 5LBSL 2AXFA 3GSWA 3MOBL 2QSQA 5EUOB 5I73B 1ZLWH 5FYLD 1P4IL 2VDQL 4S0SD 3GI8H 4KRPB 2R56L 1OGTB 4OLXL 3MQIA 4IOFD 4OLZL 3MA9H 1T1XA 3MRPB 5I8KH 4L3EA 2FR4B 2NW2A 2B1HH 3SDDA 4HXBL 4MAYC 5DD6A 3BW9B 3MLWH 4FFYL 1IC4H 4QTHA 3BWUC 1FCGA 2EYRB 3IKCA 1Z5LB 4C83B 4V1DE 3V6FB 2YPLB 4I0CC 5IVXE 1U8OA 5FYKU 2NX5B 2DYPA 5BJTB 4PBXA 4TVPE 5FYJD 3ZDZF 4F8TA 3RI5F 4R2GB 1A47A 1FGVL 4JY6A 1OGAD 2FJFA 2NY3D 1TQCB 1QLEH 5IVNA 3MACL 4XP9L 5KSBE 1TCRA 1T0PB 1EK3A 4FQ2H 4FTVA 5DJZA 3CC5A 3DX7A 5EUKB 5CJXA 2WWKT 2A6DB 1H8NA 2WLZA 2WNGA 4DQOH 4PD4K 3L5JA 5IJKC 3MODL 3MLRL 3NCYS 1ZA3B 1MSPA 1ITBB 3MJ7B 1E6OH 4LKCB 3KYMB 2ATPA 2KPNA 4HPOH 3BP7B 4RGNB 2WUBL 4CW1A 4Z76A 4K8RC 1BFOA 2YZ1A 1NBQA 1SY6L 3G5ZA 4G42B 4HUVB 1S3KL 2PYEE 3O11B 1HK6A 1T0NA 3C2AL 3EO1B 1IM3A 4KY1L 4OZIB 2ZCHL 4U1LA 5TDOA 1ZGLB 2P48B 4P2RE 4BH7B 2Z91A 1NSNH 5BZDA 3GSVB 1WISA 4LLYA 2XZQL 5EORH 4L8SB 2ICWJ 4AL8H 1I9EA 2KQMA 1WTGT 1U92A 1FNFA 5DK2A 3D18A 4NCC1 2QADD 4LCUA 3KWWA 4WWKC 2W60B 4O2CB 1UCBL 3S35H 1WICA 1PLGH 4AT6A 1IC5H 1EO7A 4G80A 3GDBA 4PBVC 1ZHLB 1NBZA 1TZIA 4CADA 3BDYL 2IANB 5B4MC 3VGBA 2EH7H 4C57C 1MRCH 2A6IB 1I7UB 3HE7D 2AXGA 2DAVA 4JFHE 4JRWA 3ELAT 2OR9L 4OIIL 3MRMA 4JLRA 1H5BA 2P8MA 4N1EA 4XPHL 1J5OL 1SY6A 2B5IB 4X6CF 4YE4L 3EYOB 4TOYL 3SBWA 3NCFB 4M02A 1ZEAL 3WFBH 2P5EE 2BVTA 3PUCA 3MNZB 3H0TA 4D9RE 2VISA 1KCKA 4LPUA 1JMXA 5EO1A 1CGTA 5ENWB 4DW2H 1N0XL 5CUSL 5CKAA 2VXSL 5EA0L 4H88H 3JV4A 2WIMA 3FN9A 3TCXA 4FQHA 1X5YA 4R4BB 3LKRB 1UENA 3VRJB 4BSWB 4N1HB 2XACC 5HI4C 4JQVC 2YOCA 3ARTA 4JO1H 4H20H 2DBLH 4H26B 2C7UA 4OLVH 1RU9L 5DJYB 5HGAA 4FQXB 4IRZL 5GRJH 1RFDL 5F8RC 2UY7A 3QH3A 1MFBL 5DUML 4DN4L 4W81A 1RUQH 2V6HA 3EDEA 1JYXA 2BY0A 4HT1H 5DQ9A 2V2WB 4KPHH 1MRFH 4RAUA 1IGYA 4OF5A 3CFKB 2P24B 4Z77B 4UIMA 4L29A 1EPFA 5JR1H 5E4IA 2BNRB 1JHLL 3CH8A 5T5FH 4UV7L 3RU8H 3TGXA 5GIRA 4LRNL 4FXLA 5EZJB 2X7LB 1MPAH 2VUOA 2BY1A 2VE6A 3BYYA 2DQUL 1J1XL 1SBBA 1I7TA 1L4IA 2NW3A 1OAXL 3HB3C 3L5WB 2P8LA 3NPSC 4U6XB 4LMQI 3RKPA 2YPLD 2VXTL 3UTTE 4HFWB 4JGMA 3NFPA 2NX5D 3CLFH 3HZKB 1JPGB 5JOFA 3MBXL 1XGYL 2AEWA 3AROA 2BHYA 1KG0A 2IC2A 3EGSA 4LF3A 4WNQA 3FO1B 4Y19A 4R2GD 4PR5A 3VW3H 5I15H 5D1XC 3IAPA 1A2YA 2AEPL 1NMBH 5A40E 1D7FA 2ARWA 5DJXA 5EBLB 3WUWB 5BO1L 3HPLA 2I07B 4XBPB 1WIOA 1ERNA 3IDXH 1MI5B 2EIEA 2VDPH 1LP9E 5IW6B 1ZTXL 1O5DT 3RDTD 2FHCA 4FXGA 2KUTA 2YN3A 3FQNB 3TJEH 5F7NC 2ERJC 3MUGB 3MSPA 5DUPL 4JR9H 1D9KD 1ZANL 2R29H 3QXAB 4RMTA 5KG9A 5E6IA 1CU4L 3U0WL 5JHLH 3OKNB 4ZXBA 3MUZ1 1BGXL 1BQHB 4NQEA 5IOPA 2C3VA 1RV6X 1FFOB 2O5YL 4RGND 5IF0B 3DOSA 3U30C 4R7DA 5T3ZE 5HVGB 2X4OA 3RL2B 3VXMB 1DSFH 4MA1B 2VLKE 4PJ5B 3Q6GL 3GSXA 2FATH 3VU2A 2GSIB 4JFZL 5TE7H 3X12B 4WFFE 1WCBB 3BVNB 3RVTD 2FD6H 3N9GL 4D8PA 3ARSA 1HWGB 5L7XL 4WU5A 2IAMC 1RZ8B 1A3QA 3MCLH 2DOCA 4XPAL 1FZOB 4OZHA 5ACZB 3KPSB 4MCYA 1QSFB 5ITFA 3FO2B 4L4VB 5AYQA 4K94H 4IOFC 3BZDA 1AXTH 1AHWA 2W0LA 3UC0L 2IAND 4PJ7F 1DANT 1KPUB 1FZMA 3N1MC 1FNEB 1BJ8A 1LEGB 5C07E 1XIWD 1FV1A 3O2WH 5HXMA 1QFWM 4G6KL 4X7SL 1CFVL 4JB9L 1S9WA 1OSPL 4YGVB 5IFJA 3BGFB 4Z7NF 5I1LA 4WUUB 2F5BL 4POYA 3VGAC 1QR1B 3WFCH 3TN0B 3KHQA 2IADA 2Q86B 2A38A 5B8CB 4M7LH 5F44A 3LH2H 3G08A 5IMOA 4GKNB 3FB6A 4NM8L 4K7PX 3ARGD 5ACLA 3BZEA 1ZOXA 1JI1A 2DDQH 1UEYA 2QSCH 3BI9X 2EECA 4HKJA 3FO0H 4OZFB 2ADJB 5EH1A 5C3TA 3DROA 5AWNH 5FKPA 4ZFGH 1CLZH 4KDTC 1ZA6A 4CKVX 4KAQH 1Z9MA 1A7RH 3DX8A 3WUWG 4LP5A 4ZS6D 5EO0A 3RNKA 2FEDC 2VN4A 3JBG7 3QIBA 4O2EB 5J0BA 4FQXD 1KTRL 1TTGA 1T6VN 4I0PA 3TV3L 1G0XA 3P73B 1TNNA 3EJYC 1TTFA 5IT2H 4F7PB 3U79A 1R5WB 1YEHH 1NL0H 1JPFA 4RAVB 3PL6D 5KS9E 4Y7MA 3Q5OA 1W2KT 4C4KO 2QADC 3C5ZB 2NY2D 3NIDE 3A67L 1P9MC 1DQTA 4JN1L 3SE4C 3ROLB 4JHAH 3S3PA 3AS0A 2JCCE 4JG0L 3BPLC 5ITBH 5E56A 2VDKH 5DJ8A 4MJ5A 4XAKE 4XX1G 4CVWA 4PJ9A 1A6TA 1CE6A 2D3VA 2VITA 4JJ5A 4Q6IB 1CGWA 4JDZB 3ZO0A 4OF0A 3HE7C 1N6UA 1EFXB 2M2DA 5IB5B 4MNQD 4RFNC 4DEPC 1MF2H 3HZVA 2HJFB 3MGTA 3DRQB 4R97B 3T2PA 1C5CL 3PHQB 1N5YL 3FTGA 3SHSA 4TVPH 3FONA 4F2MA 2NY5C 4WO4D 4NRZB 1HHIB 4S1SH 4OCYL 2G9HB 3QFJE 4O4YL 3R4DA 3T2NL 5FYKD 4F7TB 5BS0E 1II4E 1FC2D 1MLCA 1BZ9A 3MV01 3Q1SL 1RIVL 3T04D 3QPXH 4OFVA 1LHZA 1UM4H 5T3XL 5CLWA 1PBYA 3TPUB 4DUXA 4KKBD 3HKFA 3LKSA 3NGBC 4OQTL 3OAZK 4HPYH 2RHEA 5D7LE 3LN5A 3F7VA 3ZTNL 3ARZA 1U95A 1J8HD 2O61A 2PCPB 1Y0LB 2P8PA 4L8DB 3KYOB 2XKNB 2VABA 4OD1H 3O6FA 1NMCB 5T1KA 5HY9B 4LCYB 5F6IB 2YPKA 1T7VA 3SDAD 1AE6L 4Y5XC 4LHJB 3KXFA 1EAPB 5ETUA 1S7SB 4PJ5D 3LKPA 1TLKA 3IYLW 3QP3A 1U8LA 3HRZB 1P5UA 2HT4D 3EYUL 5DLML 3TCLB 1JGVL 4DUVA 3BAEL 2MQ3A 4GUPA 5ILTL 1J1OH 4DAGH 4LPWA 3EO0A 4OZFG 1X5ZA 3LEVH 5DQJA 2QSTA 3DO3A 5I73C 3SJVE 4N0YH 4KROB 3BO8B 4BQ6A 4KRPC 4HCRH 3OJDA 2H3NA 4JM2F 4KUZH 2GW5A 4OQTA 2DQCH 3O2VL 1EEYB 3T0WA 1CT8B 3E2HB 2BVOB 1NFDE 1DQLH 1A5FL 3QQ4A 3QUMH 2EC9T 5EU3A 1GPOL 3EYSH 4EI6B 1OY3B 4GBXA 3UJIH 1U41A 4RDQG 5CBEA 1YQVL 3QUXB 4PFEA 4R2GC 3H9HB 4NO5B 4WUUD 5HHQB 1LEKA 1MCFA 5JORB 1BLNB 1TQCC 3T0AA 3NCBB 1VHPA 1OLZA 1A9BA 2WQRA 4XAWH 2XQBH 4ZFFA 5J9PB 1JTTA 4MXVF 1EBAA 3CU1A 2MTPA 3I6GA 4S1DD 3C6LB 2X40A 3MRGA 1MFDL 2EYTB 4D2NA 2MNUA 5LJYH 2HFEA 1EMTL 3VA6A 4L9LA 1XT5A 1IT9L 2HJLB 3X3GH 1JZ2A 5F70A 3WO3B 2CPCA 2WMPA 3ULVD 4RGNC 2NR6D 4PRPB 1JNLH 3LY6A 1N8ZB 1VFOA 4JFYB 3GKWL 5DQDH 2C9AA 4X4MA 4KJYA 2BP3A 4N8CL 4Y4KA 5B3JF 4Y2DB 3EYVA 3IJYB 3K1KC 3BP4A 1U8QA 4PJDB 1YY9C 4UINL 1JNNL 4L8SC 3GMNB 5ESVB 2MPAH 5DTFB 2NMSA 1YC8A 2ORBH 3FQWB 4LLQB 5IROC 3ZE2F 4X6DE 1X5IA 2ICEB 1CDHA 2YKLL 3H3PH 3TT1H 1B4JL 5MENE 1F02I 1GC1H 1JV5A 3C5ZD 2PR4H 3O3UN 5A2KH 4ZUTA 1BAFH 2J8UA 2GUOB 2Y07H 1QQDA 3ZHDA 4CMMA 2UUDH 1V5JA 1VGEH 4OBRA 3QNXA 5D5MF 3TBVA 3UYPA 4M8QA 1ZLVH 3RKDC 1JUFB 4S2SA 5HYSB 5DWUH 1Q9OB 1ZLWK 2PW1A 1DQDL 1EFXD 1IGMH 1ZT7B 2R4SH 5F1NA 4B41A 1I75A 3MJ9H 3ARPA 3PXHA 4PJ8A 1CDIA 1PYWB 5FUOL 3MLZH 1IL1B 4FOMA 4Y5YB 5ESQA 2MJWA 4NKMA 1I7ZB 4Z8FH 3R8QA 5IQ9B 2B5IC 4POZD 3HR5A 4UMGA 3QHTC 4JG1H 4QHNA 4BFEA 4HH9B 1JYVA 3HC4H 1MAKA 4NSKA 3NA9L 2I5YL 5FOBA 1HXYA 4I2XB 4ODUA 3GK8L 4TRPL 1SYSA 5GRWA 4PJFE 1ZMYA 3ARGC 3MV9B 5K9OA 5C0RH 5H94B 3H9SA 3ES6A 1FAIL 5GGSY 4YO0A 2DQJL 2EC8A 3T77A 4X9HA 4MVBD 4JY4A 2E9IA 5DRZB 2J2ZA 4CU6A 2XZAH 4QHLB 1HZHH 4OM1L 5DD0L 3BKYH 2DBJA 5T3ZH 4LCWB 2I60L 3MRPA 1LDSA 3EOTH 3PJSB 3MA7B 4OCXH 1GGIL 4ZS6C 4PRAB 5F7UA 4FQXC 3LS5H 2DQIL 3K0WA 4NBXB 3SKUD 4XC3H 1UB6B 3T3MF 1OSZA 4GG6A 1RK0A 3FMGH 4KQ3L 4UU9B 3V6FA 5C0BD 3HI1A 5IHZB 5K59F 2BOCB 1EBPA 1HE7A 1Z3GL 2D0GA 4P9HH 2NY2C 5I76B 2EE6A 3KS0J 5D4QA 3T0VA 3U4BL 4U6VL 1FGNH 5DEGA 4KROD 3B2VL 3MMEA 2AAVA 1CGSL 1WIPA 1NGXB 3QFDA 3T4YB 4PGJA 4KKLD 5JTWA 2B8OT 3B5HA 2XI9A 4QRPA 5EZLA 1UM5L 1S5IH 5CKGA 1KIPA 2HKHL 4R96B 5CHNA 1XEDA 3T0XA 4MB5A 3TH3T 1LD9A 3QWQB 1RSFA 3HMXH 4UV4L 2X2YA 2YXFA 1PG7L 2IF7A 4WO4C 1BP3B 2ZOKA 4P3CL 3RVUC 3NZ8A 5A2JH 2WINA 5I1JL 2DMBA 2CK2A 4L8CB 4ZQKA 2E7LC 2D03H 3LVEA 3OG4B 5HYSG 1ZGLA 1JF6A 4BH7A 2I27N 3FT2A 5JNYA 3GSVA 3C6LD 1A1MA 2Y5TB 4NRXB 2IQ9L 1U3HB 4NGHL 4KKBC 3QQNA 1DN0A 4K9EC 2VTFA 1JPTL 5FDYA 2EIZB 1MCWW 4NZRH 4Z7OE 1EO5A 4URTB 5FCUH 5L88H 3FN0L 3KPNB 5TPWH 4XC1L 3QEUA 4PRHA 5AZ2H 4HG4K 4GAGH 3ZE1E 1GSMA 5CJ8A 1ZHLA 2IALB 1JP5A 2V7NA 3K4AA 2ZUXA 4OLEA 1MJ8L 4U1IB 1L6ZA 3SO5A 3GNMH 1I3GL 4PJAF 3SKJH 4Z7VE 3O6LL 4LK4A 2A6IA 4JFDE 4MA1C 3B6SB 4MWFA 4AEIH 5I1HH 5D2LF 4HBQA 3X14A 3TBYB 3ILPB 1ZT1B 2Y9RT 1GZQB 1KB9K 1KNOA 1AD0A 2W07A 1JPST 4HS3A 3PHSA 1KENH 4YEFA 3T8XB 1F8TL 3QUYB 3FQXB 4XP4L 5F9AC 2V9TA 3P9MA 5FHAL 5L2KD 2FIRT 5FGBC 3WNKA 4R26H 3ZHLA 1JK8B 4TQEH 3C5JA 1XF1A 2DTSA 1EO8L 4YXLH 1K3IA 1OAKL 2LABA 1VKXA 3RZWA 5MEQA 3U7YH 4YDKH 3DO7A 3CZFA 4ZAKB 4PJBB 1DBAH 4KJPC 1SEBA 1VA9A 4X6BA 4JDTL 1NPUA 1CFNA 2RIKA 3LMJL 3NA4A 3RWJB 1NGQH 2A6JB 4OM0H 1Q1JH 1J0IA 1GOFA 5IEHB 1IEBB 1WCQA 5GISH 3WDIA 2GY5A 2M1KA 1N4XL 1KJVB 4K7FB 3STZB 3DSFL 2Y25A 3MZGB 1V3KA 4I3RL 1JWMA 4QRTB 1AXIB 1MCQA 1H3PL 3BKCH 1XCTB 4MNGE 4XTRD 3MOAH 5C0DA 3TN0C 5D7JA 3F7PC 3V7AG 4DOHB 4JGJA 2VDMH 4R4FL 5B8CC 3HMWH 5CFHA 4ODVL 1GGTA 4K23L 4JQXC 5IM7A 5DA0B 1BQLH 4ZSOB 1L7IH 2OJEA 3UAJD 4HC1H 3K4DA 1A3RL 1S9XA 4OAWB 4RFEB 1PEWA 4KXZI 3GIVB 1DUZA 5IESH 3REVA 5DJAB 4GAYB 5CEXB 3ZKSD 3ULVC 2NR6C 3VFOA 2PO6B 3KPLA 3BEWB 4LCWD 5IV2A 2H8PB 4TUKL 4P48A 4M6MH 5AEAA 3IFOB 3BT2H 5GZOD 3W5MA 3VFTA 1YEEH 1CE1L 1X4XA 1FG2B 1EX0A 2CRYA 4LSPH 1DTUA 3L3DB 2PW2B 1R5IA 3F12B 2YSSA 3C5ZC 1D5XB 4K71B 4G6MH 5C6TL 5DJ0A 3KDMB 5DVNA 4MMXC 2J4WL 3V0VA 3ULUF 4MNHA 1KTLB 1MI5A 5HDQH 3DUUB 4V1DB 4LSVL 4Q6IC 5DJCB 5IVXB 2PTUA 1FORH 4Y4FA 4OCWH 5AUMB 2BSTB 3FQNA 1MOEA 4PB0L 4ERSL 1T1YB 3P0VH 1C12A 1LO5A 5DJDA 5IBLD 1P7HL 3R8BB 3JV5A 3PWUB 5I1KL 3VE0B 2FX9H 3BPCB 4R97C 1G9ML 3CVHL 1A7PL 1YY8A 1I9JH 4PJIF 3P4NB 5KSBB 4POZC 2X4QB 3DUHA 4OTXL 3HI5H 4XP5L 1FFOA 5M7QA 3MV7A 4G6JH 4LSUL 4Y4HA 3RVWD 5IKCA 5E5UB 5F9DC 2BVPB 5DO2C 3L5HA 1LDPH 4YHIB 1QSZA 1DQJA 3FO9A 4L8BA 3GHEL 3QCUL 1WBYB 3X12A 4XVJH 3BVNA 1TITA 1XMWA 4MVBC 3NIFE 5F96L 1BF8A 4PLKD 4ZNCD 3DJ9A 1C1EH 1MCRA 2EH8L 3UJTH 1AI1L 1I1YB 5ACZA 2R8SL 2PYEB 1QSFA 4JZJA 3R1GH 2AJXH 1F2QA 4P2RB 1NMCC 4GQPH 1QHOA 5F6IC 2KZWA 3ZYJA 4LSRL 5T33L 2XYCA 1KPUA 3TZVA 1T5WB 1FNEA 1LEGA 1A6AB 4HJ0D 2K1MA 3LS4L 4HK3N 3CVHA 3V6OC 3CFCL 3FAXA 1MAJA 1U8NB 4P2QE 3ZLQC 4GS7C 3C87A 4QOKA 4JRXD 4PY8I 3FB7B 3X13B 1FE8H 1KCRH 3VGFA 2FNBA 2QQLL 3N1QC 5EOCL 4HFUL 5FM5O 1QR1A 2DQDL 5TDNA 3TN0A 1TQBB 4KROC 3V2AR 1MCNA 5F7HA 5B8CA 5FO7B 1FAKT 4H1LH 1FNHA 4QRQB 4ZAKD 5FCSH 3ESVF 4YEEA 3UYRL 1J12A 1RJZA 2A2QT 4PG9A 3SCMB 4WGWB 4TTDD 4ZNEE 1QR4A 1ROWA 4XBGB 5I66A 4QHMB 3O3BB 3Q5YA 4U1HB 1T7XA 2B1AH 2N56A 4NCDA 2KDGA 2P5EB 2ADJA 2FHFA 2PXYB 4AG4L 1ZHBA 1I4FA 1A14H 4OZGA 2DM4A 3TNNA 4IRJB 1P7QA 4R4NC 2UZIH 3QUXC 3RZCB 5GJSL 4XVTH 1W0WB 1V7NH 3MXWL 5KVGL 3JVGC 3AUVA 4WY7H 4HGKC 2GQHA 5ANMA 3E3QE 2YR3A 2X1XR 2ZKHL 4EXPX 1I1CA 2E9JA 1MJUL 3C6LC 3AMKA 4ZFOB 4YHLL 3ZSTA 2Y1VA 1C5BH 3GO1L 5I18H 3VFUA 1N0LA 1AD9A 4ZG1A 1WC7B 3UDWC 3MFFA 4KI1A 1IC7H 4BSVB 4HS8L 3ROLA 3IDGB 2Q8BL 4BELD 3FB8A 2F19L 3TBSB 3KPPB 3DETD 2PO6D 4R90L 2ZPKL 2XWBB 3H8NA 4ZO6A 3WDHA 2VLRD 2M8XA 5IB5A 4JDVB 3ARBA 3MRLB 3GJFA 3VCLA 3NVQA 4Y2DC 3HUJF 2OQJB 4XMPL 2BNQA 3HNTL 5C1MB 3F58H 4KTEH 4XCEB 1R6VA 2H26A 2XRAL 1ZVYA 3OPZH 1RD6A 2AEQL 1T66C 5I8EB 3S37L 4Z7UF 1EJOH 4G3YL 5EBMB 4ZD3H 4HUKB 3RFZC 3UTSA 5DEZA 1WBZA 4PIRF 3OBAA 2XPGB 4PRID 4J3SA 4P3DB 5HHOD 4I1NB 3GI8L 3DV4B 5I30L 4XCCL 1OARH 2QV2A 4RQQB 4X7TB 3I75B 3MNVB 1OM3H 5L2JB 3MA9L 1A64A 5I8KL 5EIIA 2B1HL 4X6EB 4NFCA 3SE8H 2EKSB 3TLRA 5HYQA 1PZUB 3UTTB 1G7JA 3FT3A 2R23A 3BUYB 4Y16B 1IJ9A 4LASH 4ZPTB 4K2UH 1RJCA 2AK4E 3FOMA 4WFHE 1K4DB 1U93B 5HHMD 4Y5YC 4NN6B 1LE5B 1ZVSA 2PCPA 3D2UB 4ODWA 4MHHI 2OTUA 3GZKA 2DLHA 3M1BB 3MFGB 1LP9B 1QLEL 2ZUSA 4LCYA 5B21A 4JRYE 1CF8H 4FQ2L 2HN7A 1WFTA 3QQ3B 1GRWA 3V6OA 1A6WH 4LGRB 3ZDYE 3WJJC 2RCSH 2NNAB 4ZS7L 4XPGH 3UAJC 1ULVA 4DK6A 1N6QH 1K8IA 1MVUA 4F9LC 3SGJC 4MXWL 1E6OL 1OCWH 1AGEB 5LCVH 3F6IA 4JKWA 4OJFL 4HPOL 1NAML 2ITCB 3RQ3A 1CFTB 4LGSB 2VLKB 3VFRB 2RFXA 3DRTB 5DVKA 2XKUA 3S96B 2LAGB 3KPQB 1UA6H 4P2RD 5FIEA 5JA9A 2VC2H 5CZXC 2V5RA 1RHFA 1OD7A 2DJUA 5B38G 4XZUA 5GZOC 3OKYA 1NSNL 5E7BA 5EORL 1KJMA 2UVEA 4GKOA 3RPKA 3BIKB 4OD3H 2Q8AH 4AL8L 2IJ0C 2F53E 2BVYA 5I1DB 1J87A 1BECA 4OV6F 3ARDB 3V4VH 4KUCD 1S9VB 3TESA 2FJGB 1PLGL 1NQBA 4XP1H 4NT6B 3KJ4B 2Z0BA 3D3VE 5I16A 4A2MA 8FABB 2R2HA 5C07B 4NN5B 2Q7YA 2FGWL 3H42H 3K8LA 1HSBB 1F11B 1IZKA 4PUBH 1KV3A 4JFHD 2EH7L 4DTGL 4O5LH 5TFSH 1MRCL 4NOBA 4O51B 1FFQA 5HHNA 3GMOB 2UUDK 3GMQB 4U2ZA 5IBLC 4Z7QE 1S78C 1NAMA 3QJHA 1Q72L 4EVNB 1JTOA 1ZLVK 3V0WL 2P5ED 5GGSB 4Q97A 2FGZA 5J1SC 4D9RD 4M61B 1KTDA 1BOYA 2IGFH 4MA3A 1KJ2B 3WFBL 3T0DA 3IT8D 1N8ZA 2B4CC 3QDJE 1GGYA 4D3CH 2IQAA 4L3EE 3T1FB 4JFOB 4AMKH 2UWEF 3S34H 1CLYL 2ITDA 4Y2DA 2G5BA 3QPQD 4DW2L 3IJYA 3PV6A 4LPYA 3UTPE 3N06B 1ZVHA 2QHRH 1GH7A 4JFXB 1XGPA 1FL5A 2BOBA 2X41A 3GMNA 2ZNXA 5ESVA 4W6YB 3WHXA 4UOJA 3OAUH 2HT3C 1NLDH 1U3HC 1JF1A 5HI5D 3VDCA 5L9DH 3S35X 3P4MB 3TFKD 3VFSB 4PLKC 4HKZB 1PG7W 1OT2A 1SMOA 4DFHA 1HYSC 3C8HA 1F58H 3GM0A 3WKMH 1UJ3A 4H20L 5LQBH 2W9DH 3QIWB 2DBLL 1XGQB 4JO4L 1M05B 1XF2A 5MI0B 4FTVE 1WK0A 3QO1A 3DVFA 5GRJL 3K8KA 4HJ0C 5KS9B 1PSKH 1QFWL 2OBGA 3L3IB 2ZWLT 1KGCE 3BISA 1IGTB 4XWOD 4HT1L 1UWGH 2HFFB 5D6CB 3U0PB 2JCCB 4KPHL 1I7ZA 4DCQA 1FVCA 2OZ4L 3VJ6A 3QUYC 1EIBA 3RWIB 1JL8A 4NNXA 4J4PD 3QXDB 2FO1A 2WW8A 3VWKB 5JR1L 1DBJH 3B2UD 5T5FL 3RU8L 4YDVB 2AJZA 1OWRM 3GRWH 1XZ0A 3QEQD 4OUUB 4ZAKC 4OZ4B 1L0XA 5E2VH 3MV9A 1IC1A 1MJJB 1VESA 3UCRA 5JHDD 2EDNA 3QCTL 5C9JB 3QFJB 1EEZB 2MOVA 4ZUWA 1H0DB 1I85C 2BC4A 3A6CH 4R8WH 5I15L 1PZ5B 3MJ8A 3WDJA 1NMBL 3TO2B 3IFNH 2AGJH 5JMRA 3IDXL 5ERWB 2VDPL 3B8SA 3L95A 1H15B 4NQXA 1ND0B 4XNQB 5IMMA 1X5KA 1UB6A 5D7LB 2OZ4A 3TJEL 1A9EA 3WNPA 5E1AB 4JR9L 1B2WH 1BZ7B 2R29L 3OB0H 3DHJA 1IEAB 1PX3A 5JHLL 3OTTA 4GOSA 5JIIA 1NDMB 3WFHA 4UBDC 1KXQE 3GMRA 4PGCB 1LO0H 1CGUA 1EZVX 1U8KA 2JKXA 3HFMH 2VLKD 1INDH 3OKLB 1RZ7H 2JJTC 1ED3B 3DETC 2PO6C 1DSFL 3ZYIA 4RX4D 2WSKA 1Y18B 4G5ZL 3T4YA 3T2QA 2DQGL 1T0MB 3SKOB 1NCDL 4WFFD 1D6VH 15C8H 2AW2A 3JV6B 1SJVA 1ZAGA 3LEXB 3O3EB 3FOLA 5BMFL 5TE7L 1E4KC 2Y5EA 4NPYB 5FA3A 1KLUB 3SJVB 3EFFB 4EDWH 4JVWA 4PGDA 3SGEH 3ARDD 4I3SH 2ADIA 3IFLH 2MWCA 3MCLL 5ICYA 4B0MM 4K71C 1PJ9A 4NWUH 4PJXA 3KPMA 3ARWA 5KVEL 1PY4A 2DLIA 2AJVL 2YUWA 4K94L 4L8CA 5C07D 1AXTL 1YYLH 2YMXL 3KR3H 1FLTX 4N0RA 1NFDB 1S7VB 3BKJH 3CAFA 2R1XB 4JZNA 3RUGF 2YN5A 2DQTH 3FN3A 4OFYA 2Q20A 3AMLA 3QJFA 3O2WL 2CLZB 1U3HA 5A2IH 4YAQA 2IPKB 3HLAB 1IQDB 1MCLA 1T04A 1T7ZA 1TFHA 3JWOL 4OIBA 5DC0A 1QO3A 1SMAA 4P99A 2ILLA 2JIXD 1RIHL 2ICCA 4ZO8A 2L7UA 2SEBB 4FABL 5I6XB 1HQ4A 5FO9A 2IALA 3IXTA 2QKIB 3WFCL 2CDEA 1AH1A 4GRMB 1CD8A 2VXQH 4IOIB 4M7LL 1T1ZB 3LH2L 3CFDB 1JFQH 4B7IA 3OKDB 4Y0GA 4YPGA 2Z31D 1FNAA 4KTYA 3CSYA 2DDQL 1GZQA 2QSCL 3KAAA 2J7LA 1OTSC 2ATKA 1BQSA 1YNTB 2EIBA 3FQXA 3GSUA 3QG6B 3NZHH 4NQSA 5EU4A 2HRLA 3J8F7 5L8JB 3QXVA 4Z78A 1G7QB 3MRRB 4ONOA 4Y19E 3KJ6L 3L3OA 1OD9A 5C09E 2NY7H 3PQYA 4M3KB 5AWNL 2F8XC 3MRDA 1CLZL 1BIIA 1QBMH 4MJIA 2X4SA 1N3NA 3W0WA 3QIWD 4I9WD 1ZGLP 4KAQL 5HYJB 3C08H 1A22B 4PJBA 3B5TA 1YEIH 4FZEH 3EHBD 1XCQB 4ETQB 3P77B 2OI9B 4X6DB 3OJVC 2NY1B 3RWJA 2LVCA 5MENB 3L3HB 1U36A 5IT2L 5IEHA 5JIPA 1B6UA 1HH9A 1NL0L 2YBRB 4XVUD 4S11A 1UZ6E 3SE9H 4RWYH 4BFIB 1YEJH 3G5YA 4HUXA 4TNVF 1KJVA 3VRIA 1UWXH 4K7FA 1G9NH 4NQEE 4XAKD 3MLPA 5DRXA 5MERB 4H1LB 3P2TA 5ITBL 2VDKL 1TQBC 3G6AA 3IJHA 3V5HA 2YD4A 4O9HH 4RA3A 1I3UA 1RQ5A 1Y6MR 4MX7B 3UZEA 4KFZC 3L3JA 4ZSOA 4DKFL 1MF2L 3SCMC 4ZPVB 4OAWA 3SDXF 4RFEA 4HGMA 1MHCB 1FSKB 2W1NA 3GIVA 5SWZE 4TVPL 2PXYC 4XB7A 4FQPA 4G8GA 4OZHE 5FYJL 4S1SL 4UDUB 1UFUA 2VKXA 4IRJC 3RZCC 4I18A 1FYTD 4PJFB 3GMPA 2H8PA 1T22B 4G6FD 2W65B 3FKUS 4YH6A 3NBNA 4HZLA 4UNVA 1NC4D 3QPXL 1E4KA 4QYOB 1FG2A 5D7LD 1INQB 4F7MA 4RMVA 5F3HA 5AZEL 3QCVL 5DEFA 5HI5C 4NWTH 4EUPH 1G7HA 4QXUL 4HPYL 4G43B 3DTXA 4U4BA 2I26N 3DI3B 4BZ1L 3WNMA 1CDBA 4NN7B 3D69B 2WIIB 4OD1L 3MRKB 5KAQG 4LFHD 2R15A 1TVHA 3VFPA 5FUZH 5IMKA 4M62L 1JWSB 1UADC 4OFIA 5JPNA 1N2RB 4CRPA 5GRYA 1DJSA 1MNUL 5AUMA 1JGUL 4N8VA 2D2OA 3EO9H 3O2DL 3PWUA 2XOTA 4XWOC 3D25B 3OQ3B 3DPBA 4YXKL 4LRIA 2CKBH 4DAGL 3NCJL 2Z8WC 3SJVD 4Q9CA 1EEUA 4TULL 5KSBA 3U9UA 1Z6JT 5GXBB 1HKLH 4HJGB 4BKLB 2FO4B 3BZ4B 4P9ML 4Y5VB 4KRNA 5TQ2H 4N0YL 3GBNL 2UVFA 2RR3A 4YHNA 1E4XH 5SWSD 1E4WL 3PXJA 1S7XB 4X4XB 2VUYA 4MA8L 5BVPL 4X99A 4KUZL 4YHIA 5IB3B 5AG8A 1ES0B 4N9OB 1WAAA 3VMOA 1Z0NA 2BCKA 5IVZB 4Y16C 4HWEL 3I6LE 3CX5K 1DQLL 3JUYA 3P0YH 3QUML 1KBGH 4HGWA 4NN6C 1U58A 3UJIL 1DLHB 1OWWA 2FJHA 3W9DA 1E6JH 2BVQA 2GJ6A 3PV7A 4H1LG 3H9YA 4D0BA 3O2DA 1ORQA 3GMMA 2HA1A 4N0FB 1FL6A 4NP4H 4OKDA 3L3KA 1SHMA 1BPVA 1KIQA 4EOWH 4YFLI 1MJ7H 3VXSA 3CPLA 5JOPE 3BMWA 2DQHH 4JPWL 3P30H 2HFTA 5GS0H 3OKKB 1R3HB 4P4RB 3JTTA 5E2UL 2XA8L 1F3RB 4Z7VB 4LEXH 5D7SH 4DVBB 4JFDB 2F54E 5HGGS 4DFIA 1UJTA 2I9TB 2EC9U 4EBQH 1JNLL 1KN4L 3UEZA 3LQAL 4CVXB 5DQDL 4QRQA 5HYJD 4JFQB 2NY0B 5GHWL 4WU7B 3QUMA 5LBSH 1FZKB 5D96B 3MOBH 4P9HC 2NY1D 4BFBD 4HIEA 2VDQH 5ELIA 5MEND 3O8XB 4DN3L 4P5KB 2ORBL 4JFFA 4UT9H 2PXYA 3UBXA 5D2LE 3H3PL 4MXQD 3WXWL 2R2BA 3ARDC 1S8DB 3SDCB 1GC1L 1S9YB 2X70A 4HXBH 1NANI 5KVMC 4U1SA 3KJ4C 3FCTB 3K80A 4ZDHA 1HCVA 1MWAB 4HV8B 1X7QB 1M7XA 4NN5C 3QDAA 1K5NB 3JWDH 1HSAA 4PGBB 3KXFE 4FQIL 4UDTA 5B38A 1G6RL 5DWUL 1XF3B 1IGML 2R4SL 5BOZG 3IDNA 5FF6B 4LLWB 1OB1B 1F3JB 2HLFD 1ACYH 4ZUSB 4XP9H 2G75A 4MNGB 3GSNL 4WI4A 2JF1A 3KGRA 5C0AD 4Z8FL 3OAYH 4JG1L 3IDGA 1A4JA 3HC4L 4HIHA 1QG3A 4PJCF 1AGBB 1FFRA 5LGHH 5CD3B 2ZZUT 1D6EB 4YDJB 2XWBA 4RGOH 3C5SB 4YBQD 5EZIL 5T3XE 3SE3A 3QWRD 5AG9A 3HC0A 1HH6B 3CZJA 2P5WD 5GS2D 2OS7A 5C0RL 2D4FA 1OW0C 1F6FB 1LNUA 3ECBB 5I8EA 1I8MB 1G7PB 1A4KB 1T4KA 1A6UH 4G8IA 1T89C 2XZAL 3VXRE 1JZ7A 1HZHL 2XN9A 4XH2B 2PTTA 3DVIA 4P3DA 2ZCHH 3DV4A 1G6RA 3BKYL 1DEEA 4WHTA 4RQQA 4X7TA 3I75A 2D31B 3RVVC 2XZQH 4G8FB 3WNLA 1OTTD 1QSVA 3LPGA 3QIWC 5JW3L 4Q6YA 4V2BA 5SWQA 1MH5A 2DQEL 4RFOL 3EHBC 5DYOA 3LS5L 4ZTOH 4OIAA 1UCBH 4XC3L 4NO2B 3GSNA 1U8HB 4OCSL 4ORGA 1FRGL 4Y8DC 5F3BA 4E41E 2VL4A 3QXWA 2V5TA 3BDYH 5KSAA 1MQ8A 2A83A 4WW1A 5FB8A 4LLVA 5FGCE 3BDXA 5F7YC 2Z4QA 4C56D 5E03A 3DUSB 1QLFA 3VWKC 4RISL 2OR9H 4OIIH 3RDTA 1QEWA 4X4ME 2I25N 3REWB 3S88L 1BD2A 4NKOA 4XPHH 1J5OH 5GS1B 1D9KA 3HS0A 1NUFA 5E8NB 4P46B 4TOYH 2AERT 2EYSB 3F7QA 4W70A 3P4OB 4I4WA 1X44A 3VH8B 4KMTL 3CU7A 2APBA 3DBXB 3HMXL 3SKNA 2C3GA 3KS0H 5E5MA 1N0XH 5CUSH 3SGKA 1RUPL 3QDGA 4XPBH 4AH2B 3DX9B 4FFVD 5ISZA 2L7JA 4QT5B 3MRQA 5FO8A 2DKUA 5E5RB 1J9CT 5CP3A 4EN3A 3OXRA 1RY7B 4LPVA 4XBEH 3AFLA 2X9WA 3RWDA 3EOAA 3BIKA 4QF1A 3V9FA 5K9KA 5FV1L 5I1DA 5F1IA 5IIEB 1RU9H 4NZRL 1CWVA 1FIGL 3F62A 4JKPL 4NC0B 1I1AB 4IRZH 4NT6A 1CFQB 5AZ2L 5KZCB 1MFBH 4J23A 5I17A 4JFDD 1CICB 5CP7B 5GGUB 3OR7A 4X0KA 3LN4B 2V2TA 7FABH 5DHYA 3TT3H 1GL4B 4P2QB 1XIWA 4YHYB 1AQDB 1U3ZA 3G5XA 2ESVA 5I1HL 5DJ6A 2NY0D 3DX6A 3GMOA 3HMXA 4QRRD 1WJ3A 2FBOJ 3H9SE 3OKEA 5GGVY 1RZJL 1UVQB 5ID1B 4EVNA 4K7PY 4TNWF 1JHLH 1KENL 1S9KC 4DWHA 3NAAH 4LRNH 4TN9A 1NDGB 4MSWB 4R26L 2DQUH 1J1XH 1NJ9B 43C9B 4OV5B 1M7DA 1MCPH 3H9ZA 1OAXH 2P4AB 3RAJH 1Q9WA 1YUHB 4YDKL 3MO1A 2AJUL 2VXTH 2D0FA 1XH3B 1A21A 1DBAL 3I6KB 3V0AC 5HDBE 2H45A 4WDIB 3MBXH 4Y88A 4X9GA 4GG6E 2Z8SA 3G5VA 2I9LB 3HNVL 4OM0L 1Q1JL 3RHWF 3GB7A 4UQ2B 4BA8A 5GISL 2AEPH 1QFOA 1U8PB 3RWHA 3C9NA 3IDYB 5BO1H 5IBUG 5KSUB 1QRKA 1ZLUH 4F9PA 4DZBA 2J8OA 4MJ4A 1QZ1A 1MELA 3LKOB 1UB5A 3BKCL 2G2RB 1M05A 3MOAL 5CSZB 3I2CH 3PGCB 2VDML 1ZK9A 2WBJB 1CU4H 1YMMA 4F33A 3PABB 3U0WH 3MLUH 3BDBA 4QRPE 1Z9SA 5ESAA 5BVJB 3L3IA 1CK0L 4H0HB 1BQLL 1BGXH 3CSBA 1IKNC 3PL6A 3UPAA 1L7IL 3OHXA 3HCVA 1YDPA 2O5YH 2AKRB 3VH8G 1IFHL 3EYQC 4NUGH 2CLVB 3VRLE 3FQUA 1CXHA 2XFXB 1VFAB 3Q6GH 3O9WB 5ICXB 5IESL 3QXDA 1MY5A 3ULSB 1AP2B 2A74A 2L0DA 3CUPA 4JFZH 3I3DA 3F7YA 5FOJA 3C60B 4WENB 3IB4A 3OB0K 4TSBL 4YDVA 5KN5A 2X4PB 4MNQA 3N9GH 4F37F 4FQLH 3CXDH 4M6ML 1G7LB 2MSPA 4H25B 1JHTA 3QHFH 3BT2L 4LCCB 2OI9C 2BK8A 2NY1C 3MCKB 1BVKB 4P49A 4LSPL 3NIGF 5EBWB 3UYOD 3QR2A 2ADGA 1K85A 1A1OA 5BS0A 4MXQC 2FZ3A 5IMLA 2CO6B 3UC0H 4PRHE 4RWHA 4G6ML 4YFLF 5ADPH 4LL9A 1PZ5A 3TO2A 1A8JH 4Z7UE 3P3YA 4G6KH 3PWJA 5HDQL 4NYLB 1YJDL 2AK4B 1OSPH 2B2XL 4GT7A 2DI9A 4P46D 3P0VL 2F5BH 5FM4A 3L7EA 5DFVD 3OZ9H 3U7WH 2FX9L 2HLFC 1J8HA 4M43H 1RZKH 1ZV5A 1NDMA 1I9JL 1GHFL 1LO4H 1FSKC 1FVDA 4P4KD 4X9FA 4XP6H 2OSLB 2NTFA 4JRYB 4XNZB 3DVNA 4F15B 4NM8H 4WUKH 4LLUA 4ELMF 3A6BL 3RWCB 3SDAA 1G1YA 1ZHNA 4G6JL 5HJ3B 5IG7A 4YBQC 1TCMA 4JAMA 5IW3A 1V3JA 4EUPB 3RIAF 3CNKA 4G8EA 4WHYH 4EI5B 2DLGA 2ZOLB 4RBPH 4NO0B 4X9IA 4MD0B 2VERN 1WWAX 4J12A 3O3AB 3ZT7A 4LVEA 1RK1A 5DHVA 4PJHA 3CDFA 4A6YB 1P4LA 3DXAD 4MGXA 1I1AD 1K3ZA 4N9GA 4NN7C 1TVBA 3TV3H 2AJXL 4IRSB 1CICD 1OTTC 3NN8B 3WD5L 3U82B 4HMDA 1AR1D 4P2QD 2ID5A 2F53B 1CXLA 5JA8B 4KVNL 2CKBB 1CYGA 5FXCH 2R0KL 5A16B 5J11B 1GAFL 5HD8D 4HWNA 4X5XB 1TJHH 4JG0H 4EJ1C 3B3IB 3PE9A 5IB4A 2DWDB 3D3VB 2IG2H 3QUZA 1BEYL 1SEQH 1P4BH 5DRWA 3LRSB 3C8KA 1RJLA 4Y5VC 4WW2A 4FQQA 1IGJA 1KC5H 5DK0B 3ZT6A 2VAAA 4IOIA 5CEZE 2P45B 1UCTA 1N5YH 3SY0A 1YEGL 1S7WB 5EU6E 1UWXK 5E8EB 1T2QL 4G9DA 3U6RA 2AXFB 3BH9A 1PDKA 4MZ2A 1CFSA 1M71A 1LO2L 4OCYH 5DJ2A 3DMMD 1YNTA 1CG9B 2XQYK 1LO3H 3ROOA 1G7QA 2Z8VC 3FFCD 4NCC2 1T1XB 4OUOA 3GFUA 1A14L 4L3EB 2NW2B 3SDDB 2UZIL 2XQYG 5DMGD 3ZKXB 1V7NL 4L4TA 3OGCB 3VXUD 2NY4D 4QTHB 3ALWA 3M45A 3IKCB 5T3XH 4FFVC 1U8OB 1XCQA 2DYPB 2WBJD 3P77A 3ZTNH 1UXWA 2XY1A 4KQ4H 1A7OH 3BFOA 3SGDI 2N4IA 1HINL 2FJFB 2Z8RA 1C5BL 4KKAC 1BHGA 2H2PD 4M7ZB 2R1WA 3X17A 1IC7L 1TCRB 5I2IA 4OZIF 4Q9RH 3LV3B 3ARYA 2NXYB 4FTVB 4N0CC 5DJZB 3O9WD 3CC5B 3DX7B 4XX1E 3MV7E 3Q2CA 2CDFA 2G5RA 3EYUH 4PRDA 3ZDXF 1I9IH 3BWAA 3BAEH 3C60D 5ILTH 2XXCB 2LTQB 1W8OA 4U6TA 2NY0C 1YMHA 5D96C 3QNYA 4NQCA 4X7EC 1OQXA 1NKRA 3EJZD 1JZ8A 2YEZA 4PD4J 4CW1B 4KTEL 3O8XC 1MHCA 4Z76B 3OPZL 1BFOB 1EJOL 2Z35A 4ZD3L 1L9MA 1ONQA 3G5ZB 4HLJA 4XT1C 3SDCC 2Q76B 3QG7H 1IGCH 1T0NB 1IM3B 4U1LB 5TDOB 1AO7E 3PP4L 2X5PA 2Z91B 3P9LA 5BZDB 4LLYB 1VFBA 4K3GA 5F9JA 3SE8L 5C0IA 4PJGF 1U92B 5DK2B 3D18B 2AK4D 4LCUB 4WFHD 3KWWB 3ULUH 3MX0A 4X4YA 3TWCL 4LASL 1TXKA 2BRQA 4G80B 1A7BA 4QOKE 3PWPD 4G43A 1NBZB 1TZIB 4CADB 3AREA 2FX7H 2DRUA 2CUIA 1F6LL 1OAYH 4P5MA 4JRYD 2AXGB 2W0PA 2YD7A 5DMYA 5TF0A 4GRLD 1MFDH 4M6AA 2RQ8A 2PN5A 3MRMB 1H9VA 2HG5B 4JLRB 1H5BB 2P8MB 3HPJA 1EMTH 5C0BA 1IT9H 2RCSL 3NFSH 3RTQD 2AXJA 2FX8L 4EI5D 4L4JA 4NO0D 4OGYL 4BK4A 3H0TB 2WV3A 4M7LT 4OZGE 2KBGA 5LCVL 5EO1B 4N8CH 3TJHC 4Z0BL 3ZSSA 5ICZA 4UINH