4YAQA

Crystal structure of a computationally optimized pg9 mutant
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
239
structure length
237
Chain Sequence
ERLVESGGGVVQPGSSLRLSCAASGFDFSRQGMHWVRQAPGQGLEWVAFIKYDGSEKYHADSVWGRLSISRDNSKDTLYLQMNSLRVEDTATYFCVREAGGPDYRNGYYDFYDGYYNYHYMDVWGKGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PG9_N100FY Fab heavy chain
publication title Redesigned HIV antibodies exhibit enhanced neutralizing potency and breadth.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 45
structure length 237
sequence length 239
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-02-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yaqA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yaqA01
3MBXL 5DD3H 1FE8H 1YEJL 3GJFB 4KKBC 4OZIB 2HFEB 3RWHA 3GSQB 4I77L 4AG4L 2HFGL 4Z77A 2H2SD 3BHBB 3ZDXF 3S34H 3X3GH 4ODXA 2A74B 1IEHA 5FOBB 1JNNH 1YUHA 3LQAH 4X7EC 1BVLB 2NY4B 1QHOA 3QUXA 1G7PA 3IU3B 4LSQH 3NTCH 3BPLC 3REWB 1FFOB 1S7WA 5IVOA 4RFNC 4BFIB 5GZOC 5D1XA 4XAWL 1FVDB 3P4OB 4MZ2A 5EU5B 2E6JA 1KJMA 3GMQB 3LY6A 3W0WB 1YC8A 3L5JA 1U8JB 4NOBA 3ARYA 2CKBH 1IC5H 2OYPA 2DM2A 1NANI 4KKLC 4K8RC 3NACH 1IC1A 4CVWA 3S8WA 4UQ2B 1P7QA 4X6FB 4RGNE 3QUZD 5ESVB 3CX5K 1MFNA 1AXTH 2ORBH 1DL7H 4JM4L 2JCCA 5DDHA 1ES0A 2QHRH 3BI9X 2DTSA 3TT3L 5HHMD 1A3QA 4NQED 3FT3B 4I5BA 5IF0A 2FHBA 1YEIL 1JGLL 1IGFH 2VIRB 3PQYD 1A6TB 4R97C 1XGPB 2KDGA 5DT1L 4DGIL 1I7TB 2BJML 4M6MH 4U0QB 2A0LD 1NFDA 5C7XL 3NABL 3NH7H 5LCVH 4KV5E 2LU3A 3VXMB 4GS7C 3QDJA 4R26H 4MQXD 4Q7DA 5A2IH 1RD6A 4NQDD 2V9RA 4OZGE 5C0GB 1JHKL 1HI6A 3TZVD 2ZCKL 4DGYH 2DQIH 4Z7UB 1MREH 2WWMD 2ZKHH 4XNXH 2QADD 4LSVH 4KH2A 4NQSA 3MV9D 1YA5A 1GVIA 3GSXA 4UINH 3CDYA 2ADJA 2W0FB 1AFVL 3VFGH 3QEGL 4P23D 2ADGB 1O7VA 3LKPB 1M4KA 1QYGH 2P44B 1MWAL 4ZO9A 3ZDYE 4DN3L 3NZHL 1D9KB 5CIPB 3D2UA 3B9DA 4ZD3L 1TZIA 1NBYB 2YBRA 4WENB 4XAKE 5L2KE 4TRPL 1LHZA 2DQCH 3RVVC 3ARQA 4PJDB 4ONFL 4Y5YA 5EIIA 4M6NL 5DYOB 4ONHA 3QJFB 3EOBA 3EYFB 4O9HH 1EFXB 2GITB 1CDHA 5ICZA 5B38G 1Q9LB 5DJ6A 4Y4HA 3V4UH 5DC0A 1X3DA 4WCYL 3D3VA 5HVGB 5EPMB 2YHGA 1R5VA 3STZB 2ARJA 4KUCF 3VFVB 4BK4A 5KVGH 4P4KB 3U9UA 1P2CA 1KCKA 3VW3H 4O2EA 1OGTB 3EOAA 4GW4B 1FORL 4PLJD 4GOSA 4YBHA 4OCWL 1S5HB 2IBBA 2QQKH 3VWKB 4Z7VA 3VFMA 5DRXA 4JHWL 2DTML 4PTUB 3QPXL 4TSCH 2C1OB 4WFFD 1R3IL 2FX8L 1M71A 1A7RH 2DWDA 4KGJA 5FYJU 3TFKD 3JBG7 5ACZB 3QI9D 3F58H 3PDDA 4LNRA 2A9NL 4PGEB 5J7CC 2BHUA 5MHSE 5F88B 5JLZA 4GMTL 1JVKA 4ZMAT 3WO4B 1R3HA 2X89D 2H2PD 5SWZB 3NPZB 3O2WL 3QIWD 3UPRB 3MXVH 5C2BH 4H8WL 3K4AA 4HF5L 4NUGL 3SCMA 3LPGA 3SKMB 1XT5A 2V7NA 2VWEE 5JA8B 4UTBH 3WUZA 5FM5O 3QDME 4JY6A 1X5GA 2HA1A 4PY7B 1A5FL 4MX7B 3MNWA 1HHJB 1CGSL 3UC0L 1MCKA 1F90L 2OJZH 5DVMA 4QOKE 3K2MC 1L6XA 4LOUD 2UUDH 2NPLX 4IBLT 4R96B 3WE6B 3DRQB 2BC4A 4GAJL 1CICA 4RMUA 3UYRL 4MAYD 5D93B 2V5SA 4PGDB 5LJYH 3VD9A 2O5XL 4LDEB 3N9GH 1DDHB 3GM0A 5FIEA 3FRUA 5I1AA 1DSFL 4LGRB 3JV6A 2OI9C 1AXIB 3SDDB 1BFSA 5L8KB 1AE6H 4JRXB 5E5MA 3CU1A 1I3RB 3QUYA 4XH2B 2GTWA 3MLVL 1R6VA 2XACC 3ULUC 3QIUA 2OL3H 4CVZB 1UT9A 1J86A 1PQZA 4KMLB 2MCPH 3RUGE 3VXNB 4DOHE 1SJHA 2ZCLL 4DZ8A 1PEWA 1ZVSB 1HH6B 5DJ2B 2E7CA 5CJ5A 1AQKH 4NN6C 1U8PA 2C3XA 5HHOB 3FQTB 2O5ZL 2WAHA 3TIEB 3HZVB 3LB6D 3PL6B 1A64A 1GL4B 1VFMA 5D7KE 1WIPA 4JKWA 4NM8H 4FQCL 3PHOB 1UG9A 5E4EC 1CGTA 2D3VA 2HRLA 4NKOA 3CK0H 1KJ3H 3BIKB 4BSWA 4DKEH 3FAWA 5CP7A 3DXAD 4HIXL 1S7QB 5FF6A 3NFNB 2NCMA 3U7AA 1CL7H 1AQDA 1SEBA 1U3HA 1T4KB 3HMXH 3VGBA 1A4JB 4LCUB 1WC7A 1I3UA 1UQSA 4M9PA 2A6DA 4KGLA 1YQVL 1FG2B 3ARED 1CG9A 1A7QL 1XMWA 5AAMA 3ILPA 3WIIH 3RBGA 4KRPD 3RWDB 2BXYA 3C8KB 4PG9A 3GK8L 4D9RE 5J0BA 1WT5C 2UUDK 4NOFA 3VD5A 5E2JA 1FO0L 3MLYL 3MV7A 3VFWB 3OKNB 3ZL4L 3VRIB 1FGVL 4FQIH 4K23L 3RQ3A 5ESAB 4NSKB 1QRKA 5EC2B 3CH8A 5JOEA 2ZSVB 3MLWL 4G6KH 4ZUSA 1QSED 2PO6D 1PKQB 2K9UA 2NY7H 3O11B 1DUZA 4CDGC 2R4RL 2GJJA 1A1OB 3CFCL 3UBXI 5CKAA 5TE7L 5HYQB 5GSRA 3T8XA 4XBEH 5BOPA 3NAAL 2VUYA 4Q2ZA 5INDA 3D0VA 5FCUH 1BZ7B 5AD0B 3WUWB 2HLAB 3I9GH 3ETBF 1XFPA 1FC1A 4RDQG 4TULL 2BVPA 3OMZA 2LAAA 2PXYC 3TV3L 4F9LC 2Q8BL 2FH6A 4JG0H 3DLQR 3BO8B 4OCMC 4J3UA 1A14H 1RHHB 4M5ZL 1KB9K 2Q7YA 3WXWH 5J6HA 2R1XA 1MFEH 3ZDXE 4PRHE 5FHAH 1S7XB 3DUSA 5JDJA 1S5IH 1YEDA 2DKUA 2VLRD 1CIUA 4YBQC 4G6FB 43C9A 1MCRA 1HINL 3FQNB 5J3HC 2HMID 2APFA 3GFUA 3HC0A 1VEMA 4MD0B 5FUCC 4ZYKA 4BFEA 4DFHA 2DAVA 3LHPH 3A6OA 4XB7A 5IB2B 4HMEA 4L3CA 4ZOBA 3HR5A 2NY0B 4L3EE 2GEEA 4WO4C 1DZBA 4OCRH 5J8OA 5FUOL 4J6RH 3ULVC 2FB4L 3OKOA 4LDOB 1YJDL 5DMGD 5C6TH 2AXGA 1G1YA 2R23B 4ONOA 3VE0B 3GHBH 3QUMH 1T1WA 3S5LB 1RURH 4XWOD 2XQBH 1IZJA 5BZWB 3EO9H 1NCNA 4GMSH 1DQJB 4NUJA 3SE8H 4PJ5E 2AK1H 1ITBB 3SGJA 2I9LA 3NPSB 2I9TB 1MHHB 1SM3H 3QDAA 4GRWF 3LRSB 3W9DA 4Y4FB 3OGOE 3OBAA 4LCWE 5HHNA 1ONQB 5A2JH 1RUAL 1XF4B 2VXTH 4FQ1L 3MCLH 1YNTA 4HT1H 5DZLA 3FOLA 1ZLSL 5T3XE 3WFHA 5GS0L 1CU4H 4KJWD 2AEIT 2EE9A 5DFVD 2EYTA 5ECJE 3H9SE 3ULSB 4V1DE 2CH8A 4AQOA 3P0VH 2EDXA 4KTYA 4QXWA 1H5BC 4HMDA 4KVCH 3ARSA 4HKBA 1CLOH 2A1WH 4EDXB 5FHBH 3MREA 5A3IC 5EOQH 4HKZB 4DCQB 3H3KA 1JNHB 2MPAL 3WS3B 1AR1D 3U46B 4XPAH 1XF3B 1Z3GH 1G0XA 1AGEB 1I7ZB 4XRCA 4FQQB 2CIIA 4P2CG 1NGPL 1YNLL 3QXDA 2HJFB 2VAAA 1J12A 1MJUL 1CCZA 1G7IB 2A38A 1MCBA 4LLQA 2LAGB 3P11H 5BVJB 1YEGH 1J8HE 3SKJL 4HPOH 1X6NA 4RAUB 4OV6F 2QQQA 4XT1C 2DQDL 5C0CD 4GG6B 1K6QL 2YN5A 35C8H 3SDXB 2F5BH 4ZO6A 2IBZY 2UV3A 3F6LA 2ZUVA 3FB7A 3IFNL 4UILH 3P30L 3DMMD 4GG8A 3SJVD 1P7HL 5IBUG 3FQXA 3S35H 4DN4H 3I85A 3HZYA 3PWPA 12E8L 1MFAL 3D18B 1TQBC 3L3DA 4P5TB 3RA7L 2FJFA 3NCYP 4E41B 5EO0A 4PFEA 3WD5H 4HS6B 4LLVA 1HHIB 3C5ZD 1YPZA 1BVKA 5CZVL 3U30C 3UZVB 4RFNB 4UV4H 5C07B 1VERA 4QWWD 3KPSD 4YHKH 3P3YA 2NQCA 4KROB 1R3KA 2ZOLA 2X40A 3OX8B 4G3YL 1ZOXA 3WFEH 4JEGB 1IBGL 1BD2B 3FJTA 4WWKC 2F54B 3OKEB 4XCEA 4XI5C 1JGDB 1RSFA 3M1BB 5D9SB 4QHMA 4OLYL 4LVEA 4U1LB 4LGPB 5I16A 3CMOH 4XPBL 3BP6A 5IVXB 1KIPA 1RZ7L 2B1AH 3IKCA 3ARBD 4IS6A 4X5XA 4X5WA 5B8CC 4FABH 2JIXD 4Z8FL 2EKSA 1MHPH 1MPAH 4BH7B 1AO7D 5DD6A 4JR9H 2LVCA 4R97B 3LV3A 1KJ2L 2BFVH 1DJSA 4NRZA 4WU7A 2X1QA 2DF3A 5ADPH 3KPNB 3QWOA 2XA8L 4J3WA 3S35X 4E5XA 3J7HA 3OR7A 3EGSB 3NIDF 5I8CA 4GS7B 3NFSH 4ZNEA 3CLFH 2JJUA 3RKDC 3CFDA 1A9BB 5IK3A 1RUPL 3EDFA 2PETA 1KIRA 2GK0A 1K85A 3FT4A 3L7FA 5HSFA 5DJ8B 2YMXH 1AGFB 3HE6B 1NLDL 5FDYA 4X6EA 5E1HB 4JY4B 3HMWH 1KLFA 1J0IA 2Q6WA 4OIAA 1RIVL 1KF9B 4PRIA 3OPZL 1FLRH 1HDMB 3IVKB 5D2LA 2H26B 5HI4C 5GRXG 5D72H 4WTWA 1U6AL 2GQHA 5HHME 4NQEE 1N7MH 4UQ3B 3MJ7A 5C0IB 3PQYE 2VDQH 4HIHA 1XZ0A 1T7XA 1BGXL 1P4IL 2P5EE 1WBXA 3L5XL 5JPMA 2X4TA 4NQCA 4QHLA 1U8IA 1KCVH 2PW2A 2UYLB 5L9DL 4NO3B 3QEQB 3ARFC 2NY5L 4RMVA 1DP0A 5FA3B 4OQTA 1GAFL 5DRZB 3HE7D 1T2QH 4G43B 1WWWX 2E7BA 4KJYA 2BNQA 4DJMA 1GGYA 5DHYA 4YE4L 4F9PA 1NAML 2V9TA 4IJ3C 2FWOB 2FJGA 3PABB 3E3QC 4OFDA 1TCRB 3MRNA 3MV9E 1T89C 1MAML 2FBJL 1QO3A 5HYEA 3TO4C 5HGHA 3CFBA 4G8EB 4W4OA 5EBWB 3ZTNL 5GGUA 4LIQE 1OAUH 4YO0B 4Q9RL 2J2ZA 1R24B 4LARH 5HI5D 4JQVC 1QBAA 4C56B 3CDCA 1IGCH 4GW5A 2G75B 4G9FA 3UJIH 3BGFB 3MUJA 1HHGA 4M1DL 1I1YA 4ONGH 4OT1H 5FO8A 4R90H 5SV4A 1PSKH 3KYMB 4JGMA 3ROOB 5FYJL 5KZCD 2IEPA 4OGAD 2LE9A 2QEJA 1N4XL 1ORSB 5D7LB 3IJSB 3MMEB 5BV7C 1DBBL 2B0SH 2YPLA 1DLHA 1QRNB 3SKOB 4N0YL 2GSIA 3BP5B 3WS6A 3RVXC 4WNQB 3TVMC 3WO3B 1BFVH 4YH6A 1YQ2A 2E9IA 1ZEAH 1JGVL 2DQHH 1I3GL 4DZBB 4PRPD 2E3VA 2FGZA 2GJZA 4NO5A 1EJOL 2Y07H 4YXHH 1RZFH 5D1XD 1LO2H 3S9DB 5IFJA 5HVFB 1KB5H 3TYGL 4HLJA 5KSBE 1FJ1A 1L9MA 4XPFL 4Y7MA 3RBSA 2AV7A 2D9QB 1CXFA 1X5FA 4WFFE 3VH8G 3DECA 1VFUA 5GRJL 5IOPA 2G5BA 3RTQB 4LLMB 2XG4A 4KQ3L 2X4SB 3RPIB 2IGFH 3OG4B 4QRPD 3HC4L 1A1MA 3MLRH 3M8OH 3MJGX 4MJIB 4AK1A 4JLRA 3MRHA 4TVPL 1CQKA 4XVJL 5EUKA 2YC1B 1AGCA 1NH6A 1MI5B 4JY5H 4HWNA 1N59B 1EVUA 2HH0L 4OZHB 3BMVA 3CLEH 2EH7L 1CBVL 5D1QA 3BEWB 1YMMA 1K5NA 3AB0B 5I73C 2JJWA 3HAEB 1QHPA 4NN6B 3ZYJA 5HYJB 4MHHG 1PY4A 1KCUL 1A4KA 3QG7H 3DURB 5DUPL 3LIZH 1K4CB 1FFPA 2XWTA 4ZDHB 5F7EL 2YWYA 1OTSC 3DX6A 4ZO8A 5E4EB 4GRWE 4IOIA 2PCPA 3PJSB 4OIIH 4WI8A 1CFQA 4K3DL 5MI0B 3MRMA 4RGNC 3SDCB 2NW3A 1T0PB 3MNVA 3KLDA 4ERSL 4UB0L 3U48A 1JZ8A 1JRHI 3OJ2C 1BQLL 2UWEE 4KQ4H 4L9LC 4XNQA 2J8HA 3MJ8B 1Q0XH 1AGBB 5DJZB 3SO5A 1TITA 1WCBB 1EHLH 1XF5A 3AXLB 1E6OL 4OLVL 3TYFB 1I9IH 4JAMB 3RL1B 4NCC1 5BS0B 2DQFB 1RK1B 3NIGE 5DR5H 3BVNB 3VXRA 2VDLH 3QHZH 1JPFA 5KS9B 4RCAA 2YD9A 3PIQB 4Y4HD 2BSED 3FRPG 1AKJB 3ARPA 4NNYB 4LSUL 1R3JA 2EDYA 3GIVA 3D39A 5DJAB 1SJEA 3TN0A 4X6CA 1CE6A 1CGUA 4POUB 4I18B 4S0TD 1I7UA 3V8OA 1JPTH 3T77A 3ARTA 7CGTA 5E2TL 2R1YA 5C0NC 5CBAA 4XNUH 4NYLA 1FVEB 3QZWG 1H3TA 4OFKA 5I1DB 1IEBA 4U3HA 4HJGB 4M03A 2FJHA 4PTTA 3BKJL 1CZ8L 1WBZB 3RWCB 1Y6NR 1OAZL 2PUQT 4WUKL 1SBSH 4BM7A 1MAJA 5IMOA 3C6LD 2ADFL 2QLVB 3H42H 1SHMA 4ELKB 4GQ9L 4WI4A 5ANME 2R2BB 4L4TE 2MCG1 2EO9A 1NGYA 3EFFA 3IETA 1T21A 3BJLA 1A2YB 5EZLA 4FMFA 4IMLA 4P46B 4EZMA 4OLZH 4IHOB 3SCMD 1U36A 5D6DC 4I0PB 3BGMB 3H6JA 4OZFH 3AAZB 1B4RA 2CLVA 2P24A 4F80A 5J1SC 3O2DH 2PTTA 4NKMA 3S3PA 4K8RL 5C9JB 1EMTH 1AY1L 1MRFL 4GAYA 4XPHL 4WHTA 1F4WL 5DRWA 2BY2A 5DF0A 2YRZA 3D0LA 4PGCA 5JR1L 1CICD 3O4LB 3SKNB 4U4BA 5CD3B 3KPRD 4X7TA 1BQHG 4Z7WA 3MRRA 4MA3B 1I1AC 2EXWD 3MUGB 1IAIH 2BSSA 4PJ9C 4HUXA 5L7XL 2XN9E 1CN4A 4EUPB 1N8ZB 1ZAGA 3JXAA 4HBCL 2NY3B 4PIRF 4B7IA 4Y2DD 3PWJA 3QUYD 4HXAL 3OAUH 5HGDB 2V17L 2VLRE 1RIUH 4F8TA 3PDOA 3TT1H 4HGMA 4LPVA 2J4WH 2JCCF 1FYTB 4XCFH 1CDIA 4MJ6B 2AS5M 2Z92B 2GI7A 1FRGL 3VFNB 2YUVA 4LASH 3NIDE 2VR4A 4PP2B 5IWLC 2W92A 3RNKB 2OJEA 4KK5C 2VWEC 1S78C 4HC1A 5T5FH 1XR8A 3TBWB 5IMKB 3O6LH 2X44D 4HJ0C 1JV5A 1Q94A 1T03H 1T22A 2YWZA 3BUYB 1OAKL 1H5BB 1VADB 4YDKH 3FQWA 3BKCL 1OTTD 5GGSA 2AXFB 1KENL 1FQ9C 1CGWA 3C5SA 1I8IA 3ARDB 4DGVL 1MRCH 4J8RB 1NFDF 5T1KA 1T0NA 3RIFK 3HS0A 1CS6A 4K71C 3TBVB 3NA9L 4HPYL 2F8XC 3OKKA 3H7BA 4JFEB 5CLWA 3SPVA 4Z6AT 2D0HA 4MSWA 3PGFL 4FG6D 1YN6B 1CLYH 3MNZB 1UWEL 1MAKA 4TNVF 3G5VB 4EXKA 1BBDL 1MLBB 3P9MB 4OD1L 1HQRA 5CILL 3CC5B 3S4SG 2D31A 5FKAB 1HN1A 4X6DA 4LMQI 1XCTB 1CVRA 3D5OF 4OQTH 3MV7D 3ZTJG 5IIEB 5HHXL 1MSPA 4ZPTB 5DS8A 1ZWIB 3WIHL 4PJFA 1T1YA 3ARRA 4LKCB 1FNEB 1SYVA 3Q5OA 5KVDH 4L8CA 4QTHB 1U8LB 2I60L 3D85A 1TQBB 3RY6C 4MCZB 3DSFH 4S1RH 5C1MB 1FAIH 2Z8VC 2VZ3A 1QA9B 5KTEH 4AZ8A 5KOMC 2Y5TB 5C0AA 3B2UD 3KS0J 3S36H 4PJEA 3G6JA 2JTDA 4OGZA 5IFHL 5GGVL 1M7XA 4PGBB 1WIOA 2JELL 2G2RA 3G5XB 2LU4A 2CLZB 2VOTA 3WLBB 3MLSL 5E00A 3T0XA 4YR6B 1ROWA 3VWJC 3DNKA 4NRXB 2AJVL 5EDXA 5I9QC 2FEDD 2YSSA 5I66A 2VKXA 4LAJH 4WWKB 2JE8A 4FQXC 2DQGL 2RBLA 4OB5L 1FGNL 1EUUA 1M7DA 2R0LH 4U6VL 2BRQA 3HI6H 1NCBH 3WFCH 1MHCA 1BIIB 1OL0A 3CZJA 3GB7B 4RRPA 5B8CB 4KMTL 1DBKH 5IB1B 4KI1A 4ODSL 2XZZA 4HKJA 5BO1L 3RZCB 2P5WD 2VH5L 5D1ZA 4Z7OF 5E6IA 2R1WA 4WUUB 3GMOB 4JM2A 3C60C 1MWAA 1E4XH 4GW1A 1D5BB 5JQ6L 3ELAT 4FQHA 3KXFB 4FZEL 3NIFF 3KPSE 1CR9L 2WP3O 5GRZA 1MCEA 2DQEH 4W6YB 4NZRH 1FPTH 5F89A 4CN4A 3RX5A 3S36X 1A7BA 2H1PL 1T5WB 3GSRA 2EZ0C 4L3AA 3SE9H 5CEZH 1K2DA 4C83B 1IMHC 5F7YC 3BKYL 1G7HA 4WV1C 5KSAC 3WV0A 4EI5C 4QTIH 4PJ7F 4Q9QL 1XGQB 2C3VB 5FECB 3IDIA 1CFNA 5C0DA 4Y4KC 3MRCB 2XWBA 1IL1A 1CF8L 4PV9B 2GT9A 2PR4H 5DD5H 3MLUL 4D8PA 1QZ1A 4LSRH 1C16A 3GMMB 2IQAB 5EFIB 2W60B 1C12A 2OR9L 2VLLB 5ENWB 3E6HB 4KVNL 4HXBH 4FFVC 1ACYL 3C08L 2MKLC 5EU4A 1JPGA 2ATKB 3GM8A 1DBML 4Y16C 3FN3A 3V95A 2APXA 5BQ7A 1WZMA 4NO0B 3MOBL 3U9PH 3X3FH 3TA3B 4PLKC 5I1GH 4LF3B 3EKCA 1ZA3B 5DEGB 3BP4A 4IJ3B 5ISZB 3L3JB 5A16B 4LLYB 1MEXH 2WV3A 3OXRA 4X0KA 5FKPA 1TZHA 1BF2A 3AM8A 3UX9B 1L0QA 3V6FA 4QRRA 4YXLH 1V3MA 4I2XA 3TO4B 5HD8D 2AJXL 3T2NH 1UM6H 4XP1H 5K9JH 4EIGB 4R4ND 1JTOA 1PZ5A 2QQLL 3PHQB 3IJYB 3B9EA 2DRUA 2YUXA 5KG9B 3GI9L 1UZ6F 4O5LL 2BMKA 4Y5XB 2AVGA 1J18A 3LS5L 4YDLB 4PJGE 5BCAA 4L4JA 4XNYL 3PL6D 3GGWB 1HH9A 4X4XA 5B39A 1G7LB 3HNVL 1DBAL 2P42B 1AHWB 4ZFFA 2C3HA 4L8SC 1UEYA 3MV8D 5FYKD 1BLNA 4M61A 4HX1A 4G80B 2XV6B 3TVMB 4Z0BH 4H1LH 4AH2A 1EGJA 3EFDH 3FFCB 2HVKA 1I9JH 4YGVA 4X8JA 1Z0MA 5TQ2L 3CSBA 3TBYB 2X9WA 4RX4D 3QJHB 3IFPB 3HRZB 5D6CA 3I6KA 4XP4H 1RZGA 4MJ5A 5JTWA 5BVPH 2R2HB 5D5MB 3FT2A 2VSCA 2VZVA 1UXWA 1UM5L 3FN9A 5AZEH 1EXUA 1QFWI 1KC5H 3P0YL 2EDOA 5CJXC 5F8RC 3ZT5A 4YUEL 4OF5A 1J1OL 1MCQA 3FCTB 1HSAB 4OAWB 9CGTA 5C0FB 3DX9A 3LQMA 3MLPA 4Z18A 4UDTA 5KVEL 1J05A 3VI3F 2R0ZH 2D03H 5GJSH 2F8OA 1Q0YH 2EYSA 1DEDA 1RK0B 1N64H 4MDJA 4YPGB 1CLZH 1KGCD 2YXMA 4JFZL 1WCQA 1Q9OB 5I73B 4HUUB 3NA4A 1NJ9B 1UA6L 3SDAC 2Q76B 3S37X 5IMMB 4ZUWA 2GFBB 5E99H 5DUMH 4EQ2A 3AFLA 4RWHA 5IGXL 2NY1C 4RFEB 2QSCL 3JTSB 4XCNA 2IAMA 3WNPA 4FFWC 5IQ9B 2M8XA 3V9FA 3V0WL 4LHUB 1C7TA 4ZXBD 4LLWB 4U1NB 1T20A 4P2OA 1OM3L 1AC6A 3QUKB 3FB8B 5K93A 4L8DB 4Y5VC 4J7RA 1KCSH 3RZWA 1KPUA 3CH1A 2R0WL 5EU7E 1MUJB 4R2GD 2JCCE 3PV6A 5LBSH 3RVUC 4PRID 4RWYH 4OM1L 4HC1H 4L5FH 1RZ8B 3AUVA 5TQ0H 3OZ9H 1U8MB 1MHEB 3UTTB 4D3CL 5MEPB 1HQ4A 3U0PB 1LE9B 2MWCA 2DI7A 3U6RB 1W0YT 1P9MC 4NQCD 3G6AB 3CSYA 2X1PA 3DROB 5K9OA 2NZIA 1C08B 1D6EA 4GBXA 1NFDE 43CAA 4TVPD 4PJAA 1OP5H 4I4WA 4MA1C 4HSQA 4HWBA 4OZIA 1I85C 4RMRA 3WNOA 2HP4A 3QDJE 1WTGT 2BSRB 3BPNC 2A74A 1CD9B 2Y5EA 2FR4B 3L6FB 4I77H 5T1LB 4R3SB 4AG4H 3J8F7 4HQQL 1BVLA 3IU3A 4OZGB 1LO0L 1DQTA 1P69B 3RI5F 5E8NB 3REWA 3ZE0E 1JWMB 4BFIA 5DUBB 1G6VK 1FVDA 3P4OA 1IGYA 4KTDL 4NFCA 3GMQA 3LS4L 4Y1AB 1L7IL 4XAWH 3KNBA 3GSNA 1A6AB 3FKUS 4Y2OA 3S96A 5ESVA 3CAFA 2C3WA 3ARGD 5DFWH 2A83B 3T65A 1YYLL 1FZMB 4HWZB 4NDMB 1B0WA 2Y6SD 3MCKB 1F58L 1CD8A 4HUVA 4JM4H 3JV5A 1G7MB 1GGIH 5L2KB 4KC3B 4JZOB 1RVFL 3VD4A 3EJYD 1SJVA 1A3RL 1Q9WB 3TT3H 1A6TA 1ZVHA 2L7JA 4GRLD 5D7JD 1S9WA 2QKIA 1YEIH 4MNGB 1JGLH 2E27L 4QRTA 2X4PB 4MQXC 2FEEI 5KSVB 4K3EL 3C5JA 2W07A 3F5WB 3TZVC 4M7KL 4PJCB 4DGIH 1KBGL 2BJMH 3QRFM 4BA8A 2XZAL 5F9WB 1MCOL 4WHYH 5J56B 5ESQA 5C7XH 3NABH 5CJQL 4Z7VE 5C0GA 5JIHA 4JG1L 2XXMB 5EBMB 4CDHA 3X13B 5BZDB 2Z93A 2VDPL 1YPZF 1YEHL 4XVSL 3E0GA 1EEZB 5L88L 1JHKH 4K2UL 4P23C 2IALB 4HG4J 3RPKA 3VXTB 1I1AB 3GZKA 4GRMA 1OP5K 1HIML 1GXEA 3DO3A 4ZNCD 25C8L 2OQJB 3UBXA 2R2CA 2XYCA 1D5IL 3RDTB 1KLGB 1TPXC 4S1QL 2ADGA 4IRSC 3UXFA 1TVHB 2RFXB 3LKPA 5DK3A 4APQC 1JZ7A 2EC9T 1AFVH 1W8OA 3QEGH 4JO3L 3ECBA 4KK6D 3GSOB 2AAVA 1SY6A 1MWAH 2EC9U 4Z7OE 4DN3H 3NZHH 4RBPK 5D1QD 3IFLL 5DJCA 1YMMD 1OD9A 4DKFH 4U05A 1NGWA 4MXQC 1H3PL 2YOCA 3BKML 2W38A 5DFTA 4PJDA 1YEEH 4Z78B 5DYOA 4KJQC 3NIFE 3QJFA 4TRPH 4N0FB 3QDMB 3TPKA 3EYFA 1UADC 3EOTL 3DUUB 1EFXA 4HH8A 1ETZB 4ONFH 4M6NH 2X41A 4RZCB 3QSKB 4QOKB 3STZA 3BUTA 3VFVA 5JW4M 5SV3A 5HGBB 4P57B 5E8EA 4FMKA 1OGTA 4HCRL 3F7YB 3MJ9L 4MMZC 4FXGB 4GW4A 4OKDA 4HULB 3DJ9A 3MO1B 1Q8MA 1P4LA 1E4KC 1NANH 2ICEB 1S5HA 4N8VA 3VWKA 3QI9C 1RZIA 1FORH 4ZQKB 2C1OA 3PDGA 2DQTL 4OFVA 4AIZB 2VLJD 5F7DA 1JHLL 3MFGB 4JHWH 2IPUK 2DTMH 3STLB 1NC4B 5I15L 3QPXH 1R3IH 5C08B 4PGEA 5CBEB 1RZJL 3I3BA 2B1HL 5LAXA 5CWSB 3KLAB 4ODVL 1U91B 4NNPL 2ICWJ 4Q74A 4EI6A 2A9NH 3SBWC 2E7HA 3VXRD 4WTZA 5DI8B 1WF5A 2AJ3A 3RUGB 4DOHB 5FFLA 4KRNA 1P1ZA 3KYKL 1UKQA 3RL2A 1NMCC 3O2WH 4JO4L 3D25A 2B2XL 4KI5E 2H6PA 4H8WH 4PY7A 4MX7A 4NUGH 3OAZH 1GYAA 5DEFB 1KTDB 1EHXA 3O8XA 1FIEA 4MAYC 1AD0B 1S7VB 1A5FH 1EEYA 1WFTA 3AROA 4WI2A 1CGSH 3DRQA 3UC0H 4FXLA 1JWUB 1F90H 5I74B 1G84A 2QJDA 2YRPA 2E7MA 4TPRL 1IGIL 2V2TA 1G9NC 2K3TA 3GBML 3F7PC 3V7MA 3QQ3A 4GAJH 4LQ1A 5BV7L 1UZ6E 4AEFA 1JNJA 1FN4B 3Q48A 3BRGC 4KZDH 4TNWF 5C0RL 5I17A 1BP3B 4U0RB 3WFDL 5F7WC 3MV7E 1SMAA 4LSPL 4FQXB 1IAKB 3S6CA 1DSFH 1KTLB 1T2JA 2RJMA 5IMLB 1QFWM 4XX1G 4RNRB 4TVSa 4PJHF 3MTRA 2CRZA 5F6IB 3DTXB 3V2AR 3MLVH 4M6OL 4HUWA 1O5DT 3VD3A 3WNNA 4NFBA 4D0CB 4O51A 5EO9B 3MUHL 3LB6C 1HH6A 5DJ2A 3V4VH 1A21A 2CDFB 5HHOA 3FQTA 2Y9RT 2ZCLH 3AC0A 3ZYIA 1HSBA 1CL7I 2M2DA 1WUNT 2DMKA 3MV11 4S11A 4F7CA 4UMGA 5E0QA 2O5ZH 1X5IA 4DAGL 3OSKA 3VXSA 2EDEA 3BIKA 3RHWK 1SYSB 4FQCH 1NDGA 1S7QA 3FL7A 3NFNA 3QNYA 4MD4B 3ARVA 2OTWB 2VLKA 1QSVA 1OVZA 3TCLB 1PD6A 5BRZD 4ZS6C 4LVNC 4PJBF 4Q6IB 3VI3E 1U8KB 3LD8C 1A4JA 4LCUA 4WV1B 1NQBA 5KSAB 4FQ2L 2FIKB 4YHLL 4EI5B 3FB6A 1YECL 1CVSC 2YPVH 3OAZK 3HR6A 5I75C 2BNUB 4YEEA 1F4YL 1TZGL 4PRHB 3C8KA 5GRVL 4JZJC 5IBTL 1YQVH 1A7QH 3VFWA 3VRIA 3GK8H 1DQDL 1D5MB 3E6FB 4NSKA 1FO0H 3MLYH 3MRLB 2F5AL 4NRYA 1FGVH 4K23H 3EJZC 5DA4A 5EC2A 1QNZL 2AABH 2Q3AA 4DKDC 5DSCB 4L3EB 5IVZB 2Q8AL 4Y16B 3FN0L 4F7EB 4OKVA 3O11A 5F7FA 3MLWH 4L29B 3EZ8A 5E2UL 1JYWA 5HYQA 1J0YA 3RWGA 3PNWA 5I1HL 1KYOJ 4ZAKC 3W9EA 3WBDA 3LQAC 2R4RH 3CFCH 1I1FB 1LO3L 1BZ7A 2OXGA 2YUZA 3QQNA 4YJZL 3NAAH 3V0VB 3WUWA 4PJ5B 3SQBA 3L3KB 2B20A 2DM7A 1QLEL 1JPST 2RQ8A 2YD4A 2F19L 4YHPA 5EC1A 3QNXB 1MI5D 4J4PC 1PAMA 2Z91B 3GJFH 4LCWB 3ULUD 3Q1SL 1DVFC 4HWBH 1ZXQA 2FO4B 4TULH 5DJDA 4ZS7L 3BO8A 4H0GA 1RHHA 5HYSB 5IW1B 3TV3H 4Z76B 5SX4H 1V8HA 1MCHA 2Q8BH 4G8FA 2OZ4L 3L3OB 5IG7A 3LAFA 4M5ZH 5HYJD 5IR1A 4CBPA 4OI9A 3T4YB 1X4ZA 3FQNA 3H9SB 4V1DB 4NO2B 3U4BL 3V79C 5DQJB 2F58L 1HINH 1RUMH 3JWDH 4PJIA 1F4XL 3OB8A 2VKWA 5IB2A 4LCCA 4YHIA 4CVUA 4EBQH 4OCYL 1ZSDB 1KG0B 3O3UN 1REIA 4XTRC 1EJ6A 4NP4H 4P4RB 1S9YB 1SMOA 1YMHB 3VD7A 2NZ9D 2R23A 3LMJL 3BFOA 3VE0A 1U92B 4X6CF 5CJ8A 3S5LA 2FB4H 1JE6A 1IAOB 4WGVB 5D7SH 5F9JB 2VR9A 1DQJA 2BSTA 3BD3A 3HRPA 1ZANL 3REVB 5C0EB 3G5YA 1NEZA 2I9TA 1MHHA 4YLQT 4HFWB 2B5IB 4AEHL 3WKNA 1J8HB 1N5YL 2FL5A 5DFVC 1A02N 1B88A 5JO5A 4HWEL 3C9NB 1RUAH 4AMKL 5DEZA 4FQ1H 3E8UL 1Z0NA 4QCIB 1ZLSH 4H0IA 5FYKE 5GS0H 3QH3A 3ULSA 3U1SL 3NGBC 4FTVA 3MRKA 3CMGA 1YPZE 4JM2D 4U1GC 2P8LA 3SQOL 1XIWB 4P2QA 4KXZH 4NWUL 1HHHA 1TVDA 3KLSA 5FYLD 1NGXA 3NCJL 4JPWL 1JNHA 1OP3K 3WS3A 1LDSA 3O9WA 2VQ1A 2PXYD 2OSLB 3WLWD 5CIPH 1S7TB 2MPAH 4K3HA 4NGHL 3QWRD 4N0UA 4Z7WF 4OD2B 1BFTA 4F58L 3WXVL 1JL8A 4X9FA 1NGPH 2CIKB 1YNLH 2ZCHL 4M48L 2XTJE 4MVBC 5J3HD 4RAUA 1MJUH 3OAYH 5IROA 2NY2D 3DMMC 4P2YA 5IM7B 1CXHA 3SKJH 1KGCE 1QFUL 1A9EB 1URLA 5E56A 5E08L 1K6QH 2A2QT 4WO4D 4MNQD 5KOVC 3KG5A 4M7JH 3IFNH 4MA1B 3P30H 4RSVA 3ULVD 5EBGA 3X12B 3RGVA 3D18A 4P5TA 3BIBX 3PWVA 4ZNEE 4E41A 3RWIB 2CK0L 3CVIL 12E8H 1MFAH 3MGOB 4QWWC 3RA7H 1OB1B 1F6AA 1R5WA 5FGRA 3SO3B 2X4NB 3BAEL 3GSWB 1I7RA 1A7PL 3BPCB 1EX0A 4QRRD 4LKXB 3LVEA 5CZVH 3QUZB 4PRIE 3LN5B 4NCDA 4U3CA 5D2LE 1LNUA 3OX8A 1BD2A 1EO8L 5H2BB 3OKEA 3Q0HA 1JGDA 1OGAA 3ESUF 3M1BA 4TQEL 4G3YH 2OTUB 3O4OC 5D7IF 1XGUA 5HHMB 4NQEB 4GUPB 4HS3B 4XGZB 5CMAA 4NQCE 4XCYB 3ULUF 4CGTA 5IVXA 3PQYB 4IIQC 4OLYH 4QGTA 2XNAA 1WIUA 4WIQA 3JUYA 4XPBH 4WHCA 1JZ5A 4NJ9L 1MCWW 5F1NB 1RZ7H 5J89A 2CUMA 3U36A 4XX1E 3DETC 4NN5C 2FYYB 3RNQA 1H0DB 1UEMA 1X5ZA 5DK2B 3TPUB 4JO1L 3QG6B 4Z8FH 5CZKA 5KBNC 5DZOA 3HLAA 3F62A 3KPNA 4NQDB 2VZUA 3TZVB 5GISL 3EGSA 3B8YA 3OAYK 2WBJA 2EXYC 2NYYC 2XA8H 2Z35A 1RI8A 4OF7A 1A9BA 3F7VA 3EYSL 2QADB 5AAWA 1N6QH 3MV9B 5CEYB 1TDQA 3QXVA 5FDWB 1A0QL 1X7QB 1RUPH 2WIIB 3AY4A 5CS7A 3HE6A 4MD5B 1C1EL 4P23B 2KH2B 3RKPA 3MRBB 3MR9A 4JY4A 4PJHE 4ZOEA 1IC7L 5JMOC 1NLDH 3LKQA 1HXMB 1FLTX 8FABB 1HDMA 2FSEA 2CSPA 4GKZB 3QFJD 1RIVH 3ZO0A 2VDKL 4CMMB 3RWJB 2YPLE 2ZOKB 3S3SA 1U6AH 5C0IA 4Y8AA 1MJ7H 2XKNB 3GSUA 5IFAL 4D0DB 1A6VL 1GJIA 4HMCA 1P4IH 2UYLA 3L5XH 4NO3A 4HKXB 1H8SA 2IPUG 5DRZA 4CMHC 4UBDC 5L9DH 2XZCH 3IDJA 4PJBE 4JREC 4OGYL 1JGEA 2ITCB 4XC1L 2NY5H 4AEEA 4JJ5B 1GAFH 4N90D 4KJPD 2KQMA 4JM2F 2JJSA 4P2OD 3SOBL 2FWOA 5KSBB 5KVFL 1UB5B 4XI5D 1BFOA 1TCRA 4JQXA 2XOTA 5C70A 5HI5C 4RRPG 3QI9B 4G8EA 4CADB 4KY1L 5EBWA 1MAMH 2X4QB 3O6FC 2D7OA 3IXAA 4F3FA 4EVNB 3OGCB 4NC0B 4X6BB 2XWJB 3ZTNH 3ZE2F 2IPKA 5CEZE 3QIWB 1TQCC 1KFAL 1Z5LB 3A6BL 1YMME 3ROOA 2EDKA 4M1DH 1ORSA 5D7LA 2R56L 3IJSA 3K81A 4BKLA 2VQUA 2BXZA 1NBQA 5FYJH 1WFUA 5DD1L 3MOQA 3V6OA 3SKOA 1YY9D 4F7MB 1N4XH 3QUXC 1OAQL 4POZC 5FGCE 3KYNB 3V4PL 3LEVL 4IRJA 1DBBH 4WNQA 4N0YH 5D1XC 3WDJA 1AD9B 1YN7A 3IDGB 4OTXL 3ULVF 4MAYB 4HIIB 1JGVH 4PLNC 5T3XL 4GRWB 4LPYA 2EEDA 1I3GH 1B4JL 3BXNB 5CD5D 3V8CA 2HLFC 1EJOH 1CXLA 5E8PB 3EYVB 5EU7C 4LRIA 5AEAA 4ACPA 5HI4D 4M3JA 2VLJE 4ALAL 3RTQA 4XPFH 3BDYL 4LLMA 2X4OB 5DRNA 3QA3B 5JPNB 2UWEB 4H25B 5D70L 4C4KO 1UVQA 5MEND 5GRJH 5C0JA 4ZFOA 1CE1L 3B9AA 4KQ3H 1FZOA 2YC1A 5GGSY 5JHDA 3HC4H 3VXRE 4U7KA 1EIBA 5EBLB 1ZV5A 3I6GB 2DQJL 1N59A 2WUBL 3HI5L 3ARFD 4XVJH 5FOJA 5I6XB 4W4NA 4OZHA 1B6UA 1BBJA 2NY6D 1TIUA 3BEWA 5IVNA 2ED9A 2HH0H 3IDNB 3HAEA 3O3DB 2EH7H 2MTPA 4A6YA 1IVLA 1CBVH 3T1FB 3VGGA 4X6CE 5I1LB 4UT6L 1YYMH 4WGWB 2P8PB 2Y25A 4GXVL 1K4CA 5IBUB 2IANA 1NFKA 1KCUH 4ZDHA 1TJGL 3DYMA 3UDWA 5IJVB 2FD6H 3IF1B 4MCYB 4RA3A 1UZ8B 5F7EH 1BJ8A 2VL5B 1PLGL 4JJHA 3PJSA 3HPLB 4P3DA 5DC4B 2O5YH 1X44A 5EB9A 3AREB 1T83A 1VDGA 3SDCA 5LGJB 5B39G 4KRPB 3LD8B 3FO9B 5M7QA 4K3DH 5IHLB 1AGBA 4ERSH 4UB0H 5ANMB 5FEBA 4Y5YC 5EZIL 1WCBA 1BQLH 3AXLA 1HKLL 4JZJB 2P49B 4LAQL 2VISB 1OAYL 3TYFA 3RVXD 4LVOC 3RL1A 2AJZB 3CU7A 2DQFA 2IWGA 4UAOB 1QLFB 5CP3A 4OLVH 1I9RL 1AXSB 4Y4HC 2AV1B 4X4ME 3OHXA 3BVNA 3NZ8A 1QSEB 2PO6B 1FYHB 1DFBL 3A67L 3PIQA 1AKJA 4NNYA 4M8QA 3T3PF 5HY9B 4PUBL 4Z7WE 3BOVA 2FZ3B 4LSUH 1EV2E 5E2WL 1U58A 4I18A 4QHNA 4UUJA 1INQB 3L95A 3VGDA 5BRZE 1PW3A 5ETUA 1XR9B 2X7LB 1BZ9A 3V5HB 3W39B 4LRNL 4AL8H 5E5UB 3K8LA 1FVEA 5I1DA 5DMKB 5E2TH 1U3JA 3P0GB 5F96L 4U1SA 4JN2B 4O2FA 2KQNA 1WBZA 1VEPA 4EXPX 3EHBD 4RGMC 3VJ6A 5T3ZD 4P99A 2EDNA 4HJJL 2FLRT 4IDJL 3BKJH 2HN7B 1CZ8H 2VLRB 1OAZH 4WUKH 4N1EA 4GKSB 4FFYL 1DEEB 3SCMC 4X80L 3CVHA 2ADFH 5BOZG 4JCLA 4QRQB 3R06B 3BP7B 4E0RB 4GQ9H 4G7VH 1FFNB 4P46A 4YHOL 2C4FT 5DK0A 4JFFA 4I0PA 3BGMA 4RAVA 2DJSA 4U1KA 2DKSA 1FNGB 4PJAF 3BT2L 1CFTB 1CICC 2C4FU 3O8XD 4JDZA 3TNNB 1HHKB 4ETQB 1IAII 3KJ4C 1QEWB 3AVEA 4K8RH 5JW5B 1AY1H 1MRFH 4QF1B 4XPHH 3MRJA 1F4WH 2R0KL 4YDVA 5HPOA 4RGND 4LFHD 1X5JA 5JR1H 4LDLB 5D7IE 4CNIB 3FQRB 5CJOH 3GJEB 3MUGA 3QUYC 5JOFB 3WSQH 3ULUE 1ZHKA 4NZTH 4WU5B 4X6DE 3WJJA 1N8ZA 1QR1B 3M17B 1L9NA 3QIUC 4DVBA 3RIAK 5L7XH 4JVWA 2YN3A 5LWYH 4HBCH 4PJFE 3BQUA 5HGDA 1IKFL 2WW8A 2ICWB 2AJSL 4KPHL 5DVKA 2VN7A 4OUOA 5CEXB 4U6TA 4HXAH 1JF5A 2J6EL 2Q20A 1LDPL 3CNKA 1WAAF 2V17H 3CFJB 2Z92A 3VFNA 1Z2KA 4R9HA 4PP2A 1AP2B 1F42A 5T33H 3O3EB 6FABL 3RNKA 3OR6B 1FRGH 4IDLA 4KI5C 3BN9C 4YIQB 4LIQL 1QUNA 2VMFA 1VADA 4OD3L 5F7KC 5DTFB 4F37K 4U1GB 3LSOB 5C0ND 3I3EA 3VXSD 4K7PL 1OAKH 2GTZB 3ARDA 4P48A 3U79A 4J8RA 2ZSWA 1U3HC 3BKCH 1U93A 1H3XA 3DARA 1KENH 3TBVA 3DIFA 2VLKD 3QCTH 4FG6C 4DGVH 2DQUL 5DJ0A 3THML 3HA0A 4FNLL 4HPYH 1IKNA 1GCFA 4LCIL 5HVHB 5LKNA 1YN6A 3CFKB 3V6ZB 3MNZA 5E2VL 5DO2D 3G5VA 3PGFH 3MFFA 3VH8B 5C0CB 3P9MA 4WW1B 5KVMC 1UWEH 1XCTA 4I9WD 1BBDH 4OD1H 3NCBB 5CILH 3DMMB 3HUJF 3PP4L 3SJVB 4ZPTA 5CGMA 4RFOL 1ZWIA 3B9KA 3C6SA 2LVEA 2A6JB 1P7KB 2BCKA 4MA7L 2YUWA 3QO0A 4XP9L 3VI4E 1F2XK 2E8ZA 1NDMA 1DQQA 2ADIB 2I07B 1U8LA 3C5ZB 1YNKL 3KHQA 4MCZA 3UBXG 4EQ3A 5FYLE 3EDDA 3DGGA 5EOCJ 1KJVB 1TTFA 1EVTC 1RJZB 3KPSB 4NBXB 3B5GA 3BW9B 3QXWA 4PJ9D 5I1KL 4WI9A 5D5MF 3KDMB 2VXUL 4PGBA 4WEBL 4G8IB 4M00A 2FEDC 3G5XA 3ZE2E 4K7FB 2VDRL 1ED3B 3WLBA 1N6UA 2UZYB 4YR6A 5IFHH 5GGVH 1F3DH 1TENA 2JELH 3VDBA 4MYWB 3RWFB 4JPIA 3MLSH 1HWHB 2BVUA 4ISVA 3GUTB 3KR3H 4HS8H 4FA8A 4M4RA 3CSPA 1FDLL 4FFZL 4KHTL 2V2WB 1S7RB 5D96C 4YHNB 5IT2L 3O4OB 3ARBB 4XP6L 2HT3C 4G5ZL 4I48A 1XGRA 2JIXB 4KK5D 4QYOA 1BIIA 2DQGH 4OB5H 1AO7B 1FGNH 4BSJA 2VR5A 4U6VH 3GB7A 4MNQE 4OFIA 1E4XI 5IB1A 3DO7B 3UCRA 3B4NA 3CCHB 3K46A 3ULVE 1ZMYA 1G9NL 1GZQB 3LKNB 4HGWA 5MEQB 4PR5B 2P8MB 4KMTH 3RZCA 4NN5B 5EU3A 5F6HJ 1FIGL 1HXYB 4N8VG 1G7JB 4ODSH 3EJJX 3WFBL 5BO1H 2OR8A 3DWTA 1P6FA 4WUUA 4I3SL 2ICES 2Y06L 1OSPL 2VH5H 4JANB 4BZ2L 1XCQA 2BVYA 1D5BA 1VACB 4NN7C 4JRWA 1FNSL 1GGUA 3KXFA 4J3XA 3SGJC 4OFPA 1BOGB 2PKDA 4QRRE 4DUWA 5JNYB 4I2XE 5JQ6H 2XRAL 3EOYG 4FZEH 5FA4A 2ZJSL 2AQ2A 3VXOB 5TGBB 2P45B 2CKBA 4XWGL 3H3BC 2EEBA 3G08B 4WTZG 3INUL 3QPQC 1A6WL 2H1PH 2AKRA 3ZMRA 2C3VA 4B41A 3HAEH 3QZWB 5AYUL 3IS1X 3BKYH 1LK3L 1WTLA 4Q9QH 1IT9H 4W81A 2Q86A 5EUOA 4PV9A 2DKMA 3O2VL 3JUZA 4J3TA 3MJ9A 2H8PB 1NUFA 5D7KD 1I4FB 1CF8H 1X6LA 2IQAA 2VLLA 5ENWA 3E6HA 3BN3B 3HE7B 4FTVD 4JFOB 4BZ1L 5JA9A 5JOPD 5T1MA 5F8QC 4WVRA 3ILQC 2OR9H 4M7ZC 4P2QD 2ATKA 2WINB 3KLHC 3MQIA 4KVNH 5JMRA 1LO4H 1ACYH 1E27A 2V6HA 1JMXA 3GRWL 2PF6A 4ZFGL 1DBMH 4JREB 3TA3A 3O9WD 1I1RA 4LF3A 3RWEB 1ZA3A 3VWJD 4NC1E 5DEGA 1YY8B 3M07A 3MOBH 1P4BL 4I0KA 1LILA 5ISZA 2XZQL 5HD8C 3MRPB 3L3JA 5A16A 1VFAA 1PY9A 4R4NC 3KAAA 1ZLVH 3IDUA 1QLRB 2EC8A 4CW1A 4O02L 5CP3H 3H8NA 1BQHB 4HUKB 1Y18B 3D69A 4OLUL 5KZCB 2AJXH 2HFFB 3AU1B 2P4AB 2QQLH 1IM9A 3S34L 3VFUA 1S8DA 5KG9A 3WL9A 4KKCC 4MB4A 3RWHB 2EECA 4Y5XA 4Z77B 4L8BA 4HZAA 3GI9H 2X9YA 4O5LH 3T3PE 4ODXB 4H0HB 4Y19A 3GGWA 4TTDC 3Q3GB 3OV6A 2XT1B 4U6YB 1QVOA 3LS5H 4NQUA 1YUHB 3C60D 3RGVD 1AHWA 4XNYH 1G7PB 4PRPB 2EIEA 3HNVH 4G80A 1DBAH 1S7WB 5ALCH 4JCMA 5JIPA 1Y0LB 5D1XB 2AK4A 1WBYB 1GH7A 3FFCA 3VGAC 2YK1L 3NACL 1Q38A 4OFYD 2CLRB 5CGYC 1YDPB 4FRWA 4OCSL 4WFHD 5AG8A 3QJHA 4CU8A 2RIKA 1ZS8B 4BSVB 3HRZA 5TQ2H 5K33A 2R2HA 4G9DA 2RB8A 1IAIM 5IB4A 2NR6D 1BWMA 4QRPB 2JCCB 2MMXA 5DDHB 1ES0B 2O61B 4Y4KD 4TOYL 3E2HC 2MNUA 3MLZL 1BWWA 1OGAD 1UM5H 2XTJC 1IGFL 3MX0A 5HYIA 3MJ6A 3P0YH 2J8UA 4NCC2 4JKLA 2Q7NA 1HSAA 2VZTA 1S9VA 1H3UA 5IF0B 5C0FA 4YUEH 2R4SL 1MFCL 5DGQA 1J1OH 4JO2L 4U6XA 2H9GA 3G04B 4PJAE 5SWSA 1MCJA 4OZIE 3NH7L 5E1AA 4U1HA 5IEHB 3S4SB 5KVEH 4R26L 3T4AA 1NFDB 4YPGA 3MXWL 1H15A 4ORGA 1IE5A 1WZ1L 1ZLVK 1CDYA 3LQZB 4DGYL 3QQ4B 4PLKD 1NJ9A 2FEEL 4JFZH 5I1JL 4PJIF 2GFBA 1FBIH 2XQYK 1EUTA 4PB9H 4EUPH 1A47A 4RFEA 3JTSA 3BPOC 1UA6H 2VYRE 5H35B 4BH8B 1EDQA 3IRZA 3V52L 4O00A 4PJXA 2AP2A 5IQ9A 1B90A 5IGXH 4F7TA 2QSCH 3GSXB 5H37H 4LHUA 4LLWA 2PYFB 4PG2A 3QUKA 4L8DA 1EHAA 1QD0A 3V0WH 1OM3H 5IHZB 1MUJA 2R0WH 3HNSL 3KPMB 3VGHA 2YBRB 4LPTA 1QSFA 2IC2A 3I75B 3U0TA 4OM1H 1MHEA 2X6MA 3UTTA 4Y5YB 3U0PA 1LE9A 4ZPVA 2CO7B 3GHEL 3V4UL 3EOBB 1WVZA 2ZUWA 2OL3A 3VFOB 3QFDB 4OCXL 3K2UL 4LVOB 3G6AA 4D3CH 3DROA 2P47B 5DJ6B 4Y4HB 3FTGA 4XNZC 1KPVB 4TUKL 1WITA 3S5LG 1R5VB 3I3DA 2ARJB 1VEOA 4F9PC 3AMKA 3FZUD 4O2EB 1UH3A 3EOAB 2FR4A 1A22B 5DJXB 1NEZG 1NBVL 1A7RL 2UY6A 2DLTA 4W4OC 4AT6A 4HQQH 4LLUA 4X4ZA 3F58L 1G1CA 4WDIB 1JWMA 1M71B 3DSNA 4BQ9A 3W11D 4Y1AA 4QHUA 5KAQF 4LNRB 4KK9C 5GQBA 3C6LB 1U42A 2K1MA 3HMXA 2GSGB 3LS4H 3HUJE 1QSZA 4UOJA 1A6AA 3IDYC 2FX9L 1L7IH 1R3HB 3DUHA 2Y6SC 1T6VN 2A83A 5IB5B 3KYOB 1QP1A 1B2WL 4NDMA 1YYLH 4U1IA 3EJYC 3SCMB 3WS6C 4PJDE 3P4MA 2LV4A 2V7NB 5D2NB 4P3CL 1QTYT 1G7MA 3ROLA 5EU6A 3SDAD 3H3PL 4JZOA 4JY6B 3MNWB 3JVGA 3LKSB 4BK5A 5IW6A 5KAQG 2NY1D 4IRJD 3EO1A 2HFTA 1RVFH 4MNGA 4MQSB 5ELIA 3UO1L 4EN3A 2X4PA 1A3RH 1I8MB 4J1UB 1CICB 4ZSOA 1OCWL 4PJCA 1E28B 2E27H 4XXCA 4K3EH 3WNMA 1DUYA 4M7KH 1IM3B 4PJ7B 1KBGH 5EBMA 3X13A 2D7TL 2CD0A 1AE6L 3RVUD 2YR3A 5BZDA 4BELD 1MCOH 2A6IB 4GAGL 1K4DA 3JV6B 5CJQH 2WP3T 1EEZA 4JG1H 4CUCA 2IMNA 2DD8L 5E5MB 4Y2DB 3VXTA 2P46B 3UROR 5J6GB 1NMAL 3QUYB 5T3ZE 2X70A 1ZGLB 4XVSH 2OQJA 3LRHA 1BECA 2GTWB 5L88H 4K2UH 3RDTA 2XTLA 2CXKA 1HIMH 4KK6C 25C8H 2RFXA 5DMIL 1D5IH 2BDNH 5D1QC 2X09A 5JHDD 3EDEA 4YQXL 5JXAL 4GXUM 4S1QH 5J12C 4GSDL 1AJ7L 1SJHB 5ID0A 2IH3A 3UZEA 1U8PB 4JFDD 1JBJA 2ILLA 1U8QB 4GAFB 4K3JH 4NHUA 1KXQE 1LK2B 1NC2D 2VXSL 1LVEA 3WHXA 5IWLA 3IFLH 1CD0A 3B2VL 4NKOB 1H3PH 3BKMH 5CHNA 3MODL 5DXWA 1MFBL 2IAND 3K1DA 2WBKA 1ZT1A 5C9KA 1JK8B 2WNGA 5KN5B 4RZCA 3HHRB 2D0FA 1AQDB 3BH8B 1U3HB 1X4YA 3QULA 4MAUL 5HGBA 4JKPL 5K59E 4CKVX 3F7YA 2D7PA 3QUMA 1UJ3A 4FXGA 3MO1A 1UQSB 2A6KA 1U8OA 1LMKA 4QXTB 1CG9B 2ICEA 4MDIA 3MJ9H 1W0VA 5ILTL 3ILPB 3VFSB 4NBZB 2C9AA 2QSVA 4YFDB 1FNHA 4W6WB 4AEIL 3P9WB 4AIZA 1QPPA 3MV7B 2P5ED 1T66C 3STLA 4FQLL 2DQTH 1C5CH 5C08A 4OCNC 4L4VA 1LEKB 3KLAA 1U91A 3C8DA 3JWOC 1RZJH 6CGTA 2B1HH 2A77L 4OV5A 5HHOE 4ODVH 3X11A 3U0WL 4XBEL 4TUJA 2FLBT 1UCTA 3R4DA 1J5OL 5EOTB 3TN0C 4QT5A 3T8XB 3VXSE 4YEFA 3KYKH 5F3BA 4MJ4A 5INCB 4UIKL 3CXHK 5DEFA 4JO4H 5SWQA 5INDB 1KTDA 1P84J 4TYUA 2X5PA 2B2XH 5FYKU 5AZ2L 2VLKE 1S7VA 2BVOB 4PRAA 4W6XB 4U1MB 4B7LA 4XZUB 1N0XL 4IRSD 1LEIB 1VSCA 4APQD 4ZOCA 3NCFB 2Q7YB 5J6HB 2R1XB 4TPRH 1IGIH 4LQFL 4MS8D 3GBMH 3EW3B 3DUSB 1YEDB 4HLZG 4LNVA 3FFDB 4I9WE 3GNML 1H3GA 4HDIB 1IAKA 4MXQD 5C0RH 5D96B 3WFDH 5IMLA 3HC0B 3FONB 2CGRL 4KJQD 4LSPH 1SEQL 3LPFA 1GPOH 1AIFB 1HEZB 3DTXA 4JFFD 5F1OB 1OLZA 2P5WB 1ITCA 4J6RL 2LTQC 5EO9A 4M6OH 4J23A 2YXFA 3L5WB 3QDGA 1FL3B 3QAZC 3EO9L 4JFPB 3TNMB 3D1MC 1FV1A 1KPRA 2E9BA 5D8JH 4LSDA 4NUJB 4GKNB 3H2WA 4CU6A 5LXGL 4M1GL 4DAGH 1CT8A 4XVUC 4MD4A 5I1CL 2OTWA 4HT1L 4YHZL 2QL1A 2IPTL 2Y7QA 4Q6IA 4X9HA 1YNTB 2V5RA 5J11C 3IJHA 2FIKA 3WFHB 3BQUD 4NWTH 4LBEB 5HPMB 1O7SA 3B6SA 4FQ2H 4YHLH 1YECH 2AEQL 1MY7A 3QP3A 1CLOL 2VLMD 3SN6N 5J57B 1PKOA 2VL4A 1F4YH 3C87A 4PJIE 4NPYA 2NTFB 4HKBB 2DLIA 1DBJL 5TE4L 1ZE3C 1XH3B 2W0LA 1CGVA 1D5MA 3E6FA 3MREB 5B22A 1Y6MR 3MRLA 1IGTB 3KPPB 2AXHA 1F45A 4P2RD 2X4RA 2IG2H 1DQDH 1CGXA 3Q6GL 4K9EL 5DSCA 4F8QA 4M7ZB 5I30L 1S3KL 2F5AH 2I26N 5IVZA 3BD5A 1KJ2B 1QNZH 5ID1B 1RAMA 4P9MH 5HJ3B 1F13A 4L29A 2Q8AH 4BFGA 4V2BA 2DBLL 3N50A 4PJ8A 2ATPA 1I1FA 5E2UH 2CXGA 5SX4I 3O45A 3LN9A 3V0VA 2VE6A 4LLQB 4KDVA 35C8L 4WJ5B 1LO3H 3SY0B 2NLJB 4UILL 1B0RB 4EIZC 3GBNL 1QLEH 2Z91A 4MNHA 5TF0A 2FO4A 4ZFZA 3ZDZF 2F19H 4P59H 1OF2A 5HYSA 5IW1A 4Z76A 3WN5A 2RAMA 3Q1SH 5JW3H 4ZS7H 4ODUB 3L3OA 3A6CL 4I0CC 3B9KD 2YZ8A 2VXQL 4HAGA 1LGVA 1ORQB 1JGUL 4MLSA 2F53D 4FTVE 1TETL 2FJFB 2OZ4H 5FV1L 3MV8B 2YKLL 5EO0B 3H9SA 4LPXA 5JOPE 4V1DA 4NO2A 4P2QE 1RZKC 3CPLA 4NBYB 1YPZB 3SGDH 1BVKB 2ICCA 4DQOL 2F58H 5LQBL 2NZ9C 1F4XH 2EYRB 5CKGA 4Z5RA 2R29L 2I24N 4QY8B 4P4RA 4K94C 1Q1JL 1R3KB 1T5XB 2ZOLB 4OCYH 4ZS6D 1EERB 3CFEA 1YMHA 4N0UE 4QHKI 5IV2A 2AQ3A 1S7UB 5J13C 1U92A 2QHLA 5I18H 3WKML 1NAMB 1IAOA 2FGWL 3CMOL 3LMJH 4L4TD 4QHMB 3K8MA 2HJLA 5C0EA 3VA2C 5I16B 4UT7L 3E2HB 3L7EB 3BP6B 4RDQF 1CFVL 2NX5A 1MPAL 1ZANH 2DYPA 4HFWA 4RQQA 4IS6B 4X5WB 1OP9A 2BFVL 5DD6B 4AEHH 2YPKB 2DIJA 1N5YH 3EJZD 3JV0A 1JF1A 4KXZI 2XKSA 5D1ZC 5E6IC 4WFED 1UCBL 3ZKQD 3S88L 4JM2C 4R0LB 1UGNA 4AMKH 5E7BA 4D0BB 4LCYA 3L1OL 5L6YH 1LEGA 3E8UH 1T3FA 3MOAL 1KN4L 4ZAKD 3NFPA 5EA0L 3CFDB 5IJKA 2YMXL 2PN5A 3U1SH 1XIWA 3DHJA 3LN4A 1KIRB 4WFHE 3FT4B 4ZXBB 3TH4T 3WLWC 1BEYL 3BPOB 4XBGB 2XN9D 1P53A 3SQOH 4NWUH 5KSBF 4X6EB 1NUDA 1RMFL 2DLHA 3MZTA 1KB5A 4J4PD 4R2GB 2Q6WB 2OSLA 2BNRA 5F7HA 2CKNA 1BD2E 3NCJH 4JPWH 1DVFD 1S7TA 3LOWA 4PRIB 2EICA 1AH1A 1OGAE 3MRFB 5GGVY 2J1KA 2OX5A 2ED8A 5BJTA 4PRDB 2GY7B 3SE3A 1V7NL 2BHYA 3H9HB 4NGHH 2NY2C 2W9DL 4F58H 5IVXE 1XF2A 1UACL 3WXVH 1XZ0B 4Z9KB 2Z31D 4NQCB 2ZCHH 4M48H 4QHLB 5TE6H 1QFPA 1U8IB 3CIQA 2KL6A 3N1QC 5F9OL 4HW6A 3KHOA 1A9EA 4XXDB 3QIBA 4P9HC 4XTRD 4XCCL 2KZWA 5E08H 5DHYB 2ZG1A 4N0CD 4F2MA 4ELMA 3Q5YA 4LPUA 3RWIA 4E42A 4PBXA 1I1CA 3LDBC 5TF1L 3MGOA 2UZXB 1OB1A 1QO3B 2D7MA 2CK0H 5HGHB 2C1PB 1FG9C 3CFBB 3V0AC 3CVIH 4YBLC 5GGUB 3R0NA 2M26A 4ODHL 2DS4A 2W9LA 4GW5B 3QUZA 1LP9A 3LN5A 3BAEH 3MGTB 3ARGB 2OP4H 4PJHB 1HHGB 1I1YB 2UWEF 5FO8B 3VXUA 1E0OB 1ZHBB 1PYWB 1BF8A 5M95B 5J1AB 4IRZL 5H2BA 2B0SL 3IDYB 4R4BB 3W5NA 1IM9D 2OTUA 1RPQA 2J12B 4NQEA 4PD4J 4GUPA 3K1KC 2G60L 1DLHB 1I8KB 4HS3A 5FUZL 5TH2B 4TQEH 2AEPL 1MLCA 4XCYA 4R7DB 3QB7C 3NIGF 4GRLB 3HZMA 5E6YA 5D7JB 1M7IB 3L3GA 1JZ3A 1DE4B 2CJUH 5F1NA 5C09A 4XMLL 2FYYA 2GJZB 1H0DA 4M62L 5DK2A 3TPUA 3QG6A 3VFTA 1JIBA 5GS2H 1CD1A 1CDCA 2Q3ZA 5D71L 1C5BL 3MRIA 4NQDA 4PJBB 3ZKXC 3BH9B 3HZKB 1W2KT 2AV7B 4NC1C 4MMXC 5GRWA 1L6ZA 2G5BB 3QEHA 4KAQL 2J6EA 5GISH 2JLLA 2VO5A 3GMLB 4JFYB 5E94A 3I84A 1X7QA 4MVBD 2WIIA 4TTGA 3EYSH 7FABH 4MD5A 3HG1D 3MRHB 3MRBA 2ZG2A 1A0QH 1QR4A 1VCAA 4RMWA 5C71A 1FC2D 1C1EH 3BZFB 1RHFA 8FABA 1QOKA 1IC7H 5D7LE 5D1QB 5SWSD 2ZNXA 1YMMB 3GBLA 3QG7L 3RWJA 3V6OE 2NXZC 3SGKA 2AI0H 1HYRC 2ZOKA 2XA3A 4PRBB 4Z7QF 2VDKH 4XBPA 1A4KB 3DX7B 3BPLB 4HD9A 4OZFA 1FFPB 2XKNA 4LK4A 1L7TL 4UT9L 3O2DA 4D0DA 3K80A 2IAMC 3DX6B 4J3OC 1NCAL 4HKXA 4PREB 1GHFL 4KJPC 3EO0B 1A6VH 4P2OC 4IOIB 5HGAB 4TUOA 2PCPB 1F11B 3JV4A 1W0WA 5GIRA 2PYEA 2ITCA 4NJAL 3C8HA 3R8BB 4JJ5A 5FCSH 1CFQB 1UC6A 3LZFL 2SEBB 4OGYH 2NW3B 4XC1H 1PJ9A 1QFHA 1UB5A 4JE4B 4XNQB 3SGEH 3IFOA 4AM0B 3SOBH 4DEPC 4N9GA 3OF6A 1MQKL 1IGML 2VLJB 1I9IL 5KVFH 1XF5B 1W72B 1CI5A 1QSFD 4E9LA 1DR9A 5JHDE 2VDLL 2FIRT 4KY1H 3OGCA 4X6BA 2X89A 4ZODA 4GBXC 4OZHE 4JFDE 3VXRB 3QIWA 1T0MB 3DETD 1KV3A 1YY9C 3FO2B 1VENA 3B9VA 4C59B 2DOCA 4LMQE 5JW4Q 1UJTA 5I8EA 1KFAH 1R3JB 4YXKL 4X99B 3GIVB 3T0WA 2NY4C 3GMPA 3ARXA 4F7MA 2IBGA 2R56H 2IANE 4X6CB 2EXYD 4R7NA 2NYYD 5DD1H 1CWVA 3OG6B 4NZUH 1I7UB 1WV7T 3T77B 3JWDC 5CD5C 3IDGA 1KEGL 3LEVH 1JZ2A 1KLUA 4MXVF 2CK2A 5GXBB 4HUNB 4CL7A 5E7FA 4OTXH 5DQ9B 3ZDZE 5T3XH 5FYKL 4FQPA 1B4JH 3BDBA 5E8DH 5I76A 3QA3A 5HHQA 5JPNA 4OLZL 1NGYB 3EFFB 4H25A 1T21B 2EDQA 4ALAH 3FOMA 3K7UA 4U7MA 3BDYH 4FP8L 2ITDB 4IMLB 4FZ8L 4PGJA 5C2UB 3KJ6H 3OWEA 1EMTL 1BX2A 2NY6C 1NBZA 2NNAB 3SE4A 1NGZA 2FATL 5EU6D 1CE1H 5HTSA 3I6GA 2WWKO 4GAYB 3HCVB 4GXUN 3WNLA 4WHTB 4X7SL 4UBDD 2RCSL 1G9ML 2DQJH 2WUBH 2LTQB 3IDNA 1A6PA 4AENA 4B53A 3O3DA 5F7LB 1DCLA 1QKZL 5CAYB 5I1LA 5KANI 5I8KH 2R39A 2V9QA 4R4FL 5C0BA 4Z7WB 3MRRB 3DXAA 4AIXA 3T2QA 1I9EA 4UT6H 1MH5B 2R9HC 5IJVA 1TVBA 4I3RL 3OKYA 5F70A 2BSSB 3DX8B 4GXVH 4M5YL 5BRZB 4LEXL 3UTZB 1UZ8A 1TJGH 2V7HB 3O6FD 3OAUL 2VL5A 3PWJB 3HPLA 5E9DA 3EDKA 4TN9A 5A1AA 1BREA 1PLGH 3AREA 1JN6B 2H45A 2C3GA 4KRLB 1KT2A 3ARUA 3IU4L 5EOCL 1E6JL 4YDKL 3QUXD 4JFFE 1XR8B 5EN2B 4POZD 4ENED 4HEPG 2HG5A 5ITBH 5EZIH 4OLXL 1HKLH 1QLFA 1V05A 5GGSB 2E7LA 4LAQH 1OAYH 2VJXA 1QSEA 2PO6A 3C5SB 3UTQA 1I8IB 1INEL 1I9RH 1T0NB 1MCIA 3HS0B 1OSZA 3OL2A 4M3KB 5HHVH 5GRUL 5DZNA 1P7QD 2HLFD 2QBWA 4NQVA 4TSBL 5HY9A 1DFBH 2P7TB 3A67H 5GGRB 3VWKC 2ESVA 4OZ4A 3Q5TA 3SPVB 2OI9B 4DK6A 4MSWB 4PUBH 1J11A 3N85L 3P9LA 5D7IB 2X7LA 3WNKA 1G6RB 3EHBC 4OQTL 3V5HA 1JYVA 3VDCA 3OKLB 3W39A 1HQRB 1MRDH 5DURB 4X6DB 3FO1B 4JN2A 4U6HA 5EIVA 3UP1A 3U7WL 5I19L 1MJ8H 2FDBP 3WO4C 2DDQL 3PWUB 2KUTA 5EORH 1F4HA 4L4VD 2VLME 2HN7A 2XG5A 3LRGA 4PJFB 1T1YB 1LE5A 2Y36L 3BZDA 5CSGA 3QDJD 4HJJH 1DEEA 1GOHA 5ICXA 4BUGA 1SYVB 1VGKB 3DSFL 3MC0A 4QRQA 1MY5A 3BP7A 4FFYH 1OQOA 1T80A 2HT2C 4P2RE 4X80H 4Y8DC 4JRYA 3ALWA 3O8XC 1VKXB 1JPSH 3KPLA 1GZPA 2BY3A 4YHOH 4JQIL 1FNGA 1HHKA 4ETQA 4HV8B 2G2RB 1QEWA 3BT2H 1JNLH 2DIAA 1AGDB 4QF1A 3BWUC 4N5EC 1F6FB 1K8IA 3D2UD 3OKMA 3VXQA 3UZQA 1RULL 5J13B 4CNIA 3FQRA 2R0KH 2QTEA 1OARH 3WFCL 4YDJB 3GJEA 4OUUA 4HIEA 3TBSA 4PYGA 3FAXA 1MHCB 1QR1A 3M17A 4J12A 1ZT7B 3VU2A 3BZEB 2YA2A 3AS3A 3IT8D 4XP5L 3K74B 4PRNA 3D3VD 4PJGF 5HXMA 2F53E 1OLLA 2XFXB 5CEXA 5MP6L 3HNTL 3CD4A 2CPCA 4KPHH 2QSTA 2AJSH 1AI1L 3GMNA 1IQDB 5D1ZB 2GUOA 1AP2A 2J6EH 3L3HA 1LDPH 4JM2B 1M1SA 1FFRA 3RVTC 1DN2A 3QDGD 4GW1B 5E8OB 1SQ2N 1CDJA 1FPTL 4FQHB 1XGTA 6FABH 4X98B 4H1LA 4NFDA 3AGVA 3BE1L 1UWGL 3LSOA 4LIQH 3MLTA 2PXYB 2GTZA 3ZT6A 4P3WA 2EKJA 4DTGL 3KYAA 3GSRB 5JIIA 5FB8A 2FECL 3H9YA 1K2DB 1KIQA 4K7PH 1F3JA 2XKUA 2HAZA 1WEJL 3G5ZA 3BIAX 3IDIB 2IFGA 5DO2C 1NMBL 5C0DB 2DQUH 4LLDA 1GGBL 3QEUA 1U8HB 1IL1B 1HOCB 3CFKA 3V6ZA 4HUMB 1JCKA 4QO1A 4Z7QE 4OM0H 4LCIH 2BY1A 2NY2B 3QXTA 5C0CA 2OTPA 4WW1A 2H32B 1N0LA 2YD8A 1OQXA 5E2VH 1C12B 4BQ8A 1NSNH 2VDOL 1WZKA 1D5ZA 2N56A 1J0HA 2E5EA 4WO4B 4WFEE 4MNQB 2HKFL 3SJVA 3VFPB 4F57L 1JPGB 4G6ML 4HIJA 3U9PL 5T5NF 3PP4H 4ZUUB 4RFOH 2W65B 1BM3L 1H8NA 4JN1L 3L9RA 4DUVA 1KEML 2I07A 2DJ4A 1W72L 3F12A 2DWEB 4MA7H 3L5IA 4XP9H 3KXFE 3C5ZA 4ZTOL 1EAJA 4YXLL 3MRGB 4PS4L 5FGBA 4PJ8D 1UM6L 4PV8B 3LDBB 5K9JL 1TZHB 1ND0A 1YNKH 4Q58C 2B4CC 3BW9A 4QRRB 3V6FB 4ODBD 2PTUA 2MQCA 1NCDL 3KDMA 3JWOL 3QIUD 1PZ5B 4K7PX 5TDNA 1ED3A 5T5NG 3VRLF 1FZJB 2GIYA 2VXUH 4CVXB 4WEBH 5CJBA 2V5MA 2BMKB 2VDRH 1DLFL 4Z7NF 3GUTA 5MEOB 5EUOE 1ZTXL 3U7YL 4YHML 3S37L 2V2WA 1S7RA 4C4KT 1HH9B 3ARBA 1FH5L 4X4XB 2Y1VA 5B39B 5EZOH 2JIXA 2XICA 4KHTH 4KI5D 4ZUVB 3BN9D 1AO7A 3EFDL 5IT2H 4LCCC 4XP6H 3T04D 1BLNB 4HX1B 4Z0XA 4GRWH 2L0DA 4MXVE 5HHPA 4D9LL 3CCHA 5TDPA 4IOFC 2D4FA 1GZQA 3LKNA 4X8JB 5FXCH 2OK0L 5MEQA 1QQDA 1U3HD 2BERA 3JTTB 2DJUA 1CDGA 1G7JA 1G9NH 3ISWA 3Q2CA 3GKWL 4HK0B 1NCWL 4HFUL 3R8QA 3ZKXB 5ISZE 2YS4A 3ZE0F 5GZNC 1VACA 2ZPKL 4DUXA 1U95B 2Z0BA 4I3SH 4X9GA 2Y06H 1OSPH 4HHAB 4BZ2H 1MFDL 1ODAA 1FNSH 4G42A 3O0RH 2HKHL 3DX9B 3K8KA 5C8JA 3G08A 4EOWH 2XRAH 2NX5D 2DYPD 2ZJSH 3QFJB 1GIGL 1N64L 4XWGH 2F8VA 2RHEA 2EYSB 1F3DJ 3INUH 3QZWA 3VRJB 1A6WH 4Y19E 5CSZA 1HILB 2MHAB 4IMKA 1KXTB 5AYUH 3TM6A 1LK3H 3DV6A 3T3ME 5JXEA 2DM4A 1UB6A 3T0EA 1JHTA 1I4FA 2VSDA 3LEXB 3NCCB 3I02B 2BVTA 4J3VA 3HPJB 3O2VH 3L3IB 4ZUWB 3AS0A 3HE7A 3U30B 2AK4E 5A43C 4EEEA 1K9TA 4PLOB 2P43B 3R0MA 1E4WL 5FO7A 3O9WC 3AS1A 1N2RA 4BZ1H 1ZA6B 4P2OB 4RGOL 5F3HB 4Z7VF 5LBSL 2C5DC 5J4MA 4HC1L 3GRWH 2DMBA 2BNRD 4ZFGH 1M6OB 2HRPL 3HG1E 2D9CA 3BEVA 3MRPA 3SKUD 2J8UE 1QLRA 4DEPB 1V3JA 1P4BH 3IGAA 2JB6A 2XZQH 2HT3D 5CZXD 2BHZA 5IROC 4MZ3A 1Y18A 2IADA 4BQBA 2ID5A 4O02H 5SWSE 4MB3A 3CSYB 5TDOB 2GY5A 5K9OB 3LKRA 4WY7L 5I71C 43CAB 1A1NA 1U3YA 4PJAB 4QKXB 4I4WB 1D6VL 4OLUH 2G9HA 2KKQA 3RGVC 3QIBD 4P5TC 1UENA 3UAJC 4C54A 3HI1A 4D9QD 1G6RL 3MLXL 1IQWL 4NKDB 3Q3GA 4U6YA 2YD7A 4PB0L 5DWUL 3MYJB 3ULUL 5A40E 4BQ6A 2BOCB 4J2XA 4M6AA 1S7SB 4AQ1B 4PRPA 2OR7A 4XMKL 4PJXE 2HTKC 1Y0LA 1IGYB 1WBYA 3ARWA 4KROC 2CLRA 2R8SL 4S1SL 1YDPA 1JTPA 1GGCL 3KNBB 1CFBA 2NR6C 3GSNB 3U4AA 1DQML 2YK1H 1ZS8A 3QPQD 4BSVA 1CQYA 1TMCB 5AUMA 3TIDB 1WK0A 2V2XB 3S96B 4KTEL 4OCSH 3FHAA 2WZPD 4ZO7A 3SDYH 3T65B 5ITFB 3VXUD 5MENB 4QRPA 1QSFE 2O61A 1GGIL 1RZKL 2EIZA 2CDGA 3MA9H 3UTTE 3DPBA 4HUVB 4N8CL 4JHZA 4OSUH 5EH1A 4TOYH 4XHJD 3MLZH 3IAPA 3RX7A 4U2ZA 3ARFB 2QSQA 4RIRB 4UOW1 3G04A 2NY6B 3O6ML 4K94L 3ZSSA 1S9WB 2QKIB 5BXFA 2R4SH 5GGQH 1MFCH 4IOSD 5IEHA 3ILQD 4QRTB 4H26B 3S4SA 3VXPB 4JO2H 1GOGA 5C09D 2YEZB 3KLHD 2CQVA 3C5JB 3UTSA 1NGQL 1RUKH 2CDEA 4KI5F 3LQZA 2WBJC 1PFCA 3QQ4A 3V5KB 5ESQB 3MYZA 4NKIH 3MXWH 1WZ1H 1XGYL 3MROB 5BW7A 2Z93B 3UJJL 4KDTA 2ENSA 3AY4C 1MCFA 3HE6C 5ADOL 1NLBL 5I1JH 5H35A 4BH8A 1CXKA 1QFOA 4Y1AE 3HFML 3WJLA 4GRMB 4ODTH 5HDQL 5HYSG 3UBXB 4JPVH 2PYFA 3V52H 2E9JA 4N1HB 2GJ6A 4DKAA 4WW2A 4LPCA 1FHGA 4QRUB 3HUJB 3RAJL 5IHZA 4OJFL 3LH2L 1RJCA 1S9XB 5BV7B 4KKCD 4DKFL 5I1IL 3ECBB 2VABB 4HG4K 3ZLQC 3PWPD 3KPMA 5IHBA 5FYLL 1MNUL 3PUCA 1YEEL 3IS0X 5DJCB 5EU6E 3I75A 4TTDD 1NGWB 3HNSH 1NPUA 1D5XA 1ZHLA 5JORA 3PWLA 3WEXB 3MRDB 3VFOA 4BJLA 3QFDA 4MNGE 4ZUTA 3FZUC 3GHEH 4DK3A 4ZSOE 1KPVA 4PJCE 4OCXH 5GS1A 1Z9MA 3K2UH 5CGYD 1J1PL 1UXSA 2JJSC 5ABDE 5E8EB 3QQ9C 5FGSA 4TUKH 2PYED 5J1TC 3VG0L 1P5UA 5DJXA 5AG9A 1P4LB 4JQXC 2L4OA 5I1EL 5LGHL 4N8VB 3OXSA 3W11C 1RZIB 3ESVF 4D2NA 2COQA 5K9KB 1NBVH 4UDUA 1HCVA 3BESR 4WDIA 2XTJD 3OF6D 5F7DB 3ULVL 1WQVT 4LHJB 2ARJQ 3BGFC 2DL9A 3V6BR 4P9HL 3C6LA 5LAXB 2GSGA 4UV7L 5H8DA 1FL5A 4EI6B 1YZZA 4UIMA 3UJTL 5DVOA 5IB5A 2AJ3B 4JPKL 3DVIA 3V6OC 1P1ZB 1QPXA 2FX9H 3KYOA 4P5MB 3Q6FB 3RL2B 1NAKL 32C2B 1T1XA 4QXUH 4IRJC 5D2NA 5L0QC 3D25B 3BMWA 4Y0GA 4YHYC 1B2WH 2H6PB 1Z9SA 1LD9B 3LEYL 1JI2A 1FO0A 1KTKE 3LKSA 4GQPH 4P3CH 2C7UA 3O8XB 2IMMA 4G8GA 3H3PH 4F33B 2ZWLT 3BWAA 1B6DA 1EEYB 5CFHA 1CLCA 5F71A 1I8MA 4J1UA 1J1XL 3MBEA 4S1DC 1E28A 3UYPA 3UO1H 4RGNB 3VRLE 4LRIC 4BFBD 4ELMF 2V2TB 3KPRA 1LO5A 4KZDL 3QQ3B 5IQ7L 1OCWH 4L9LB 1IM3A 3RTQC 4PJ7A 1N5AA 3OJVC 4Z7NE 2E6PA 3P73A 4F7PA 3KPOB 2A6IA 5I17B 2FHCA 4NQXA 2VITB 5DQDL 4DW2L 1EGJL 2D7TH 4Y2DA 5J6GA 3NN8B 1ZGLA 4GAGH 3PWNB 5C08E 3ZE1F 3KWWB 4L4VE 1LP9F 2DD8H 3GJFA 4OLEA 3QR2A 1NMAH 1TFHA 2HFEA 3GSQA 1A6UL 3V4VL 1Q72L 3BHBA 3D9AL 4HUWB 2F15A 3T0VA 3MBXH 1YEJH 3TGXA 4O51B 1U41A 2FBOJ 3AB0C 3QO1B 3MACL 5FOBA 2HFGH 2BNQD 5DMIH 1TXKA 2EDFA 4YQXH 5JXAH 4GSDH 4NM4L 1AJ7H 1U8QA 1HSBB 3CX5J 3DVFA 1LK2A 3IAQA 4KHXL 1FFOA 4F7CB 3DRTB 2EH8L 2W9EL 5DLML 3UDWC 5EU5A 5T1DL 3VXSB 1JUFB 4UNTA 3W0WA 5IBLC 1U8JA 2VXSH 3X14B 5C0BD 1FNFA 1X5LA 1NDGB 4YNYB 3B2VH 3QNYB 1D3CA 1JK8A 4UQ2A 5KN5A 3ORJA 4X6FA 2VLKB 3MODH 4NZJA 1MFBH 3BH8A 4G9FD 4KK9D 5MI0C 1GRWA 1T83C 2YPVL 3SDCC 3H0TB 5E9DD 2I5YL 3WHE1 4MAUH 3FB6B 4JKPH 4QXTA 4CU7A 3FT3A 3W81A 2ZG3A 3VFSA 2YPLD 4P5KB 4WEMB 2VIRA 5ILTH 2N7BA 1XGPA 3D3VE 2P48B 4CRPA 3VMPA 1WFNA 1I7TA 2AABL 3RFZC 5HDBE 4AEIH 1BQSA 1LEKA 5DT1H 4NRYB 2APBA 4WFGD 1FL6B 3CXHJ 4FQLH 3RJQB 3VXMA 4JVUA 3RIFF 2CMRL 4MXWL 3N06B 3QDGE 4N0RA 3CX2A 4WI5A 1WWBX 3OKDB 4OKVB 4B50A 2A77H 5EOTA 4Z7UA 3IDMB 3RWGB 3PNWB 3U0WH 2ZCKH 4I18C 1NUGA 2MJWA 3W9EB 5INCA 1J5OH 1R3LB 4PJ9B 2ESVD 5TFSL 3MZGB 8CGTA 2XPGB 2W0FA 3QISA 3ME0A 4UIKH 3FHQA 2BVOA 4HWBL 4YHPB 5EC1B 4ZTPL 3S97C 2Y23A 1D9KA 5AZ2H 4U1MA 5CIPA 4MS8C 4XZUA 1KYOK 5DJDB 4U33A 5CEZD 1LEIA 1JWSB 1NBYA 2OCFD 3AMLA 2WQ8A 3H9ZA 1IGJB 4ZD3H 4G8FB 1N0XH 2DIBA 3C09C 4JHAL 1B0GB 5IG7B 4OZFG 3QXAB 2EDTA 5IR1B 4KKAC 3FFDA 4LQFH 3PE9A 4P46C 4HDIA 1RUML 3JWDL 2GITA 4I0PC 3CFIC 2N7AA 1Q9LA 3FONA 4EBQL 2OMNA 3GNMH 3GSNL 3DVNB 4N8PA 4PJIB 2CUHA 5EPMA 1AIFA 1HEZA 4JRYD 4LCCB 4YHIB 4P4KA 4NP4L 2CGRH 2P5WA 4WCYH 1SEQH 4K71B 2YRLA 5IKCB 4LU5L 1GC1C 3L5WA 2DLEA 5D7SL 1FL3A 4JFPA 5BMFL 3NCEB 4OCWH 4PTUA 3EZJB 3TNMA 3VMOA 3EYQD 2WQRA 5CCKL 2BSTB 4GKNA 5ACZA 5A2FA 3IKKA 3WJJC 1BQUA 2FX8H 3G5YB 2NY3C 1NEZB 2ENYA 2EDJA 5F88A 5GPRA 5D2LF 3ZKMC 1T66D 3QCVL 2FL5B 2A9ML 5LXGH 2BRRL 3BQUC 4M1GH 1JZ4A 5HDLA 1CYGA 5SWZA 4GMTH 5I1CH 1V5JA 3V7AG 3UPRA 1PBYA 1VHPA 2OBGA 5JO5B 1V3KA 4YHZH 3BZ4B 3ZTJH 2IPTH 2F74B 3SKMA 4LBEA 5F1SA 4LL9A 1RJLB 5HPMA 3D39D 3HB3D 1FCGA 2W0PA 3BSZL 3QH3B 4HF5H 4M7LT 1HHJA 3IAGC 4M8VA 3TN0D 2EDBA 1KSRA 4FTVB 3MRKB 1H8OA 2AEQH 2NTFA 4R96A 2P8LB 3WE6A 1XH3A 4P2QB 1VPOL 1IRAY 1HHHB 4FQJL 3ARDC 1IGTA 3KPPA 1G9EA 1DBJH 5TE4H 1DQLL 4PGDA 1NGXB 1MVUB 1CK0L