4YAQA

Crystal structure of a computationally optimized pg9 mutant
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
239
structure length
237
Chain Sequence
ERLVESGGGVVQPGSSLRLSCAASGFDFSRQGMHWVRQAPGQGLEWVAFIKYDGSEKYHADSVWGRLSISRDNSKDTLYLQMNSLRVEDTATYFCVREAGGPDYRNGYYDFYDGYYNYHYMDVWGKGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Redesigned HIV antibodies exhibit enhanced neutralizing potency and breadth.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords PG9_N100FY Fab heavy chain
total genus 45
structure length 237
sequence length 239
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-02-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yaqA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yaqA01
4P9ML 1U3ZA 1D5MB 4Z0XB 1LO0L 1FNFA 4KKBD 4ENED 1NJ9A 1FZOB 2Y5TA 2P8PB 2JJTA 4YHYC 2AQ3A 2VAAB 4M3JA 2MFNA 4NWTH 1IAKA 2XTJE 4JPKL 3PF2A 4YWGH 2NY4D 4R2GC 3B9KC 3BAEH 2VLJE 1BD2E 3KYNB 4XWGH 3KYNA 5HI5C 2F53D 2W92A 1NCUA 3MCLL 4ONGL 5CGYC 2ZUXA 4RWYH 1MCPH 1OF2A 4P48A 1T1ZB 1PDKA 1Q38A 2R2EB 4MYWB 4NUGH 3C6LA 2P24B 3CU1A 2DQEL 5E6IA 4P3CH 2X4SA 3WDHA 1BFOB 2MKLC 5E8EA 5HI3C 4LCWA 3GMPA 3DUSA 5IIEA 2ARWA 4PBXA 1KEML 2BSSA 5L8LB 1CLYH 5IJVA 1RVFH 3KPPB 1RZ7H 5LQBL 3SDCA 3ULVF 1FIEA 2FIKA 2DD8H 3VGAC 5EZJB 3EBAA 3V4UH 1EO8L 4HFWA 3RL1B 2H32B 4PRDA 1CF8H 2VRAA 1NPUA 1XCTA 1IM3B 4EUPA 3BPOC 5INDA 2NY5C 5KOMC 5D71L 1NC4B 3K80A 2J6EL 2CLZB 3G6JF 3F62A 1G7IA 4F15B 5GZOD 1UWXK 4QYOA 5C07E 4LEOA 1U8NA 2XXMB 1EBPA 3BP5B 5DMKA 5GSVB 4XHJC 1N2RB 1RJLB 2JIXA 5E2TH 2X4RB 4OM1L 2AABL 4HDIB 2C4XA 3HNSH 5E24E 2A74B 1KPUA 3SCMD 2YD1A 1QFWI 1P4BH 2VYRE 1GIGH 3ARFB 4LVHC 1QBLH 2B2XH 4Z7QF 3HZYA 4OI9A 1KN4H 3N85H 4PRHB 2I9TB 4NRXB 1TZHA 4HS3B 2RB8A 5C08A 1HSBB 1QSEE 2X4NB 4MAYC 4MXVF 2BDNL 2ZUQB 4NO0B 3G5VA 2EDQA 5ALCL 4PRPB 3M45A 3VXUA 3NIFF 2VIRA 5AUMB 3SEPA 3HMWL 2P42B 2X40A 3CC5B 5HHXH 1ZGLA 1BOGA 2QHLA 5DDHA 4KROB 4G3YL 5L6YH 2HN7A 3OF6A 3EYVA 5BVJA 2OLDA 4X4XA 1SBSH 2VN4A 4S1DC 1A7NL 2Y5EA 5EU5B 3RNKA 5EBMB 5BS0D 2DM3A 1JTTA 4LRIA 2DLIA 2NX5B 3I3BA 4LSQH 3GUTB 4JZJC 3WD5H 3W9DB 4NCC1 3C09B 5I1CH 3WHE1 1JV5B 4KQ3L 3U4BL 5GRUL 3SJVB 3PGDB 2IPKA 4MB3A 5TH2A 4HSQA 4PBWD 5HDBF 1UB5A 1A9EA 3P4MB 2P45B 3F7YB 4JFDA 1U9KA 4NC2B 3MBXL 1PQZA 5HGBB 1FFOB 4GBXC 3F5WB 3AS3A 3P4LA 4EQ3A 3QNXA 3B9KB 1UJ3A 1A6AA 1FZKA 4NO3A 2R29H 4BH8B 4M5YL 2IMMA 3GIZL 2E5EA 1GH7A 2DQCH 2EH7H 3MUY1 5E08L 1IL1A 1DLHA 4OZ4A 1FN4A 2G5BA 3RDTD 2QKIA 1FAIH 5IBTH 1TVHA 5CZVL 2Z91B 4F7CA 3ZHKA 4OIIH 4IMLA 3B9AA 4Y16C 1QFWL 1NJ9B 1AJ7H 4G6MH 4LNRB 1CXFA 2ICES 3QDHA 4N8VA 4U1JA 3TEUA 4K7FA 2APTA 3LKPA 4G6AD 5F7MC 4OIIL 5JXED 4C4KO 2A6KB 1GRWA 1FFPA 4QHKI 3DO7B 3O6FB 4MA3A 1Y0LA 1CFSB 1KB9J 2LFGA 1CL7H 2DQTL 1KCVL 4FFYH 2XTJD 3V5DA 4G80A 1SY6L 4FP8H 1YECL 1LO2H 4OBRA 5C6WH 5CIPA 1PEWA 3GBNL 4IRJD 4PP2A 4F9PC 3MYZA 1Z0MA 5M7QA 5MENA 4JFQB 4PV8A 4JFQA 4PV8B 4XXDA 1YJDL 4F9LA 1FLRH 1MRDL 1UB6B 4F15C 5EH1A 3MGAA 4QRUB 2EO9A 1MCWM 5B3JF 3WIFB 2RCSH 4LCUA 5C0GA 1AXIB 4ZFGH 3QI9B 1GGBH 1S9XB 1UGNA 2NY2C 1HOCB 1YQ2A 5I8KL 5IJVB 3G04A 4J3VA 4CNIA 1P5UA 4PRHA 3TIDA 1T5WB 4RA0C 4QGYA 3S35L 3WHXB 4ZNEE 2XQYG 1WLHA 1OGTA 3BXNB 1EJOH 1AHWB 2F54A 2R1WB 2R1WA 4PGDA 1UJ3C 5JHDE 5DJYB 4KKLD 1CD8A 4KTDL 4BZ2H 5L9DH 4WUUA 1I3RA 4QLRA 4GG8A 1ZHKA 3RVTD 2FL5B 4Z6AT 2HG5B 1JGEA 4LAJH 4DN3H 4XRCA 4YXKH 2KQNA 3WD5L 4KDVA 1KB9K 4CW1A 3O41A 2IC2A 3FQNB 3H9HA 4U49A 3WFBH 2C7UA 3BGAA 2PYEE 3SHSA 3PWNA 4EEEA 3D39A 5DD3H 5FKPA 4L1HA 3ALXA 5CCKH 4TQEL 3QUYC 4Q6YA 5B39G 2UWEB 4X4ME 3P9WB 5ENWA 3LOWA 4V2BA 3RTQC 2KPNA 1J18A 1IEHA 5IB3B 4LLVA 1LO3H 4MQSB 2MHAA 1RUKL 3V4PH 4HIJB 3VFRA 5LVEA 4G6ML 1UQSB 1BHGA 1J05B 4MJIB 1A6UH 4PGCB 1JFQH 2P5WD 2VIRB 5AUMA 4O4YL 1CGSH 4RMTA 3LEVL 1R3IL 2F5AH 3LKSB 2GJ6D 4LSUL 4U1IA 3ZHLA 1KTDA 1QQDB 1BQLH 1GL4B 5CAYB 3KPSB 1A1MA 3CDGA 5CBEB 3GIZH 3VGBA 4P3DA 1U8OB 4LOUC 1A02N 4TVSa 4CAGA 2J12B 1JWSB 5HHOD 1J8HD 5A2JH 5J12C 3HZVA 3QJHB 3H2WA 1DLFL 2E27L 3HE7B 1H8NA 2J8OA 4D9RD 4BQ9A 1E4XL 2X44D 4L8CA 5J6HA 4B0MM 2Q3AA 1KPVA 1TJHL 4ELMA 2XQBL 4NUGL 4PR5B 1MY5A 1UB5B 2BSED 1HNGA 3S3PA 4U1GC 3GO1L 4OF7A 3M8OH 3QUML 3BIBX 1T04A 3MGTA 1AO7A 1UA6L 2YUVA 1O0VA 3Q5TA 5I2IA 4NSKA 1K8DB 5IB5A 5IVXE 2NY4C 2HN7B 2HTKD 5I1AB 4FQ1H 3BH8A 3QRFM 2OYPA 2BVQA 3L6FA 3QUZD 4KTYA 3W11D 3OJ2C 3QUKB 4QHNB 4OGXL 2WQ8A 1UWGL 3TWCL 4HGKC 4OZFG 3OV6A 4AMKH 3DIFA 1H8OA 3BP6A 2YD3A 5MEQB 2CIIA 4YXHL 3PQYA 3VGFA 1MFNA 4PJ9D 2NY7H 1NLDH 1DE4A 2JJUA 3E2HC 1FFPB 3FHQA 4HS6B 2AK1H 3U7YL 1PYWA 4ZXBC 3MLSL 2O5ZH 4NWTL 3C2SA 1YNLL 3CXHJ 1MCIA 5I1KL 1L9MA 4HKBB 3MACH 1BBDH 4P2RB 3BRGC 5D2LF 3MRFB 4O9HH 2PXYB 4O00A 1OF2B 2DI9A 1B4JL 1FFQA 1MLCB 5C70A 1H0DB 2R0WL 2VE6A 5A3IC 3C5SB 1HQ4B 4ODXA 3RPIB 1CDBA 5FYKE 3B83A 3HPLB 1AR1D 3TN0A 4GQPH 4K7PH 2YPKB 4EDWH 2ZOKA 2D7TH 4NT6A 3DGGB 4WI4A 5H94B 5ICYA 3MCLH 1N6UA 1NCNA 2G5RA 4JR9H 4PJAA 4M8VA 1OAKH 3BSZL 4M7LT 4NKDA 3RDTC 3ZHDA 1FRGH 5DFVD 5C0CE 2F5BH 1MCDA 2FD6L 4F9PA 1FZOA 3OPZL 4OCRL 1NDMA 4LLQA 3WKMH 2PW1B 4QTHB 2APVA 4WCYH 4QRPE 5IFJA 4PJ5B 5IV2A 3LQAL 4I3SH 1A7PH 4HIXH 3MRNB 4G9DB 4Z7UA 2VWEE 4U6XA 3ALWA 4JM2F 4NWUL 4JKKA 2ZG2A 4KGJA 3SE9H 4MLIA 3C5ZC 4RFOH 5GISH 5GIRA 3BVNA 2R4RL 2APFA 1XF2A 4YXHH 3SGDH 1MFDH 2KZWA 3OWEA 3CPLB 1KPRB 1WQVT 3CXHK 1ZLWH 1IAOA 5I75B 1LD9B 3F7QA 3U46A 1QR1A 4E42A 3MV9E 3ILPA 1JPFA 5BMFH 5KSUA 5F9WC 1HN1A 1NGYB 4LCWE 4ZFZB 2YPLA 4D9LL 3VXSE 5JDJA 4MX7B 2IH1B 5E0QA 3HI6H 5FECB 2EDTA 3JTTB 5J12B 5FUOH 4Y4HB 1JUFB 2VXUH 1A7RL 5F97E 4OUOA 1QSFE 4HMDA 1JRHH 2QV2A 3JV0A 1WCBB 5MEPA 3X3GL 4XP6L 2E8YA 4XPHH 1FBIH 1WC7A 2P46B 2VJXA 3MRHA 2H26A 5J7CC 4N0UA 3VI3E 1QVOB 5EBGA 4NQEE 4XP6H 1BOYA 5JDSA 1AY1L 4ZXBD 1XF3A 4MHHG 3BP5A 5GSVA 5EN2B 2GHWB 3O3EB 1K4DB 1FGVH 4K2UH 4P2QE 4X5WB 5GJSL 5T5NG 5J6GA 3UAJD 4P5TC 3JTSB 1F11B 3LV3A 1HQRB 3WLBA 3ULVD 5HGBA 1MCWW 2A9MH 1NBVH 2P8LA 1TENA 2OTUA 2XZCH 4UT6L 4G80B 3JWNC 2VLLB 3E2HB 3L5IA 3O3UN 3QT2A 5I1HL 1RZJC 1BJMA 1F8TH 3KPOB 4MHHI 1D6VH 5IEHB 5DQJA 4ZXBB 5DQJB 5ITFB 1BQHG 2I07B 4YDKL 4ZXBA 3LHPL 5JXEC 1CFQB 5D7IF 4LHUB 1E4KC 3VW3L 5BJTB 3KPNA 4M5ZL 4TVPD 4WY7H 1ERNA 2VLRB 1L7TH 4KDTC 4TQEH 4MCZB 1UKTA 1U92A 1OP5H 3VWKB 5JHDB 5TDNA 4JDVB 1QYGH 5DQ9A 1CVRA 4OCRH 3MRMA 1IZJA 1I1YA 4XNXL 4NJ9L 4PREA 4YHNB 3DX6A 1CGSL 1GOGA 2YD8A 4P2OA 4DN4H 4OLEA 3GMQB 4HWNA 4WTZG 1BF8A 2VB5A 3W2DL 3MRBB 4IRJC 1IMHC 1VHPA 2CMRL 1UM5L 4FFVD 3UBXG 1H3XA 1NLDL 3RIFK 5HDQH 3UO1L 2VO5A 2EE2A 3DYOA 4WEBH 1AGDB 1BVKB 1XGYH 5MP6H 3I2CH 4WUUB 4FQCL 3MV8D 4XXCC 5C86A 2PXYA 4I0PB 2H1PL 1EHNA 1DN0A 3W0WA 3F5WA 4M1CD 2HFEA 5FDYA 3KHOA 3VDBA 1MREH 1FORL 1IAMA 4PLJC 4POUB 5J57B 1LEGB 1I8KA 2EEBA 2YN3A 2E9BA 2GFBB 4DZ8B 2DQDH 3PGFH 3MLXH 1T0NB 1C08A 3V7AE 3D0LB 3MRIA 4A6YB 4AG4L 2R8SL 3C5ZB 4V1DE 4TUOA 5FUCE 2AJ3B 4XVJH 5F9OH 4QRUA 4PJHA 5IQ9A 1FNSH 3X14A 4LCWB 5FKPB 3ARSA 2HRLA 5EA0L 1SJHB 5JXAL 5L2KB 4DQOL 2HTKC 1WZ1H 3L5WA 1ODAA 2NXYC 4H88H 5C8JA 3QJFB 2XQBH 4R6UA 5C6TL 3RWEA 1YJDH 2C3VB 1DN2A 3C6SB 4QRQB 1MEXH 4F2MA 2QADB 4KKAC 4C54A 1DLFH 2YMXL 4HUVB 3WXVH 4GKZA 4J8RA 4FP8L 5FFLA 1OVZA 3QEUB 5I73C 3VD4A 1QUNA 5J8OA 3T1FA 4JO2H 3QUMH 2EZ0C 1BMGA 2A77L 3I50L 4XWOD 5I8KH 1ITCA 4QHUA 4JFOA 4M7ZC 4MA7H 1UG9A 4M4RA 3G5YB 4X8XA 4JM2B 5T3ZL 3QEGL 1A6UL 3DHMA 5D7SH 3NABH 2R2BA 1AKJA 3NN8B 2BCKA 1BQHA 4CJ0A 1SY6A 3GI8H 4DGVL 1IAII 4RFNB 1QSZA 1KB5B 3Q3GB 3WJJA 2NPLX 5IR1B 3MOAL 4GKSA 5I9QB 1UM6L 1RZKL 3MREA 4K9EH 1NGPL 4G8EA 4QF1B 3GFUA 3HE6D 2V17L 4FMFA 3KJ4C 3QFDB 3V6ZA 4ZNEA 2DOCA 3ECBB 2DQTH 3DECA 3KDMB 4PRBA 1U95B 3QXAA 4BSVA 2VLRA 1A3RL 2FBJL 1QD0A 5TDNB 1NGPH 1BQUA 5FO7A 5D6DC 1RZFL 4TYUA 2YD5A 4U33A 3RWFB 4W4NA 5ACZA 1TPXB 2X7LA 1S9WB 5A2FA 1RJYA 3PHSA 2A6JA 5KN5B 3PV7A 1N59B 1OAUL 2XTJC 5CEZD 5EIIA 3IU3A 5E08H 5TF0A 4F37F 5DT1L 4F3FB 5KS9A 3O0RH 1MCJA 3LEXA 1FSKB 2HH0H 2BSRB 1A6TA 3MMEB 3CFDA 4PP1D 1HQRA 2EYSA 4JPIB 5L6YL 2YD4A 1F3DH 1UZ6F 4JFXB 2HT4D 2Z92A 4LPVA 2VL4A 2VXSL 5E70A 2NY5L 4FQQA 3S35H 1DQJA 1VENA 2EKJA 2F53E 1JGDB 4MNQA 1FCGA 4Z7VE 5BCAA 5FDWA 3FT4A 3RWIB 3H6JA 4NN5C 3Q1SL 1LE9B 3K8KA 1A1MB 3CDGB 1EXUA 4E9LA 2GK0B 3D9AH 2BZDA 1KTRL 2MWCA 2OMBA 4WW2B 4P2OB 1OLLA 3ARBA 4MA1C 2KDGA 2OR9L 1WZ1L 2GJZA 3LKOB 4PJ8A 3UYPA 4UTAH 5I76A 1I4FA 1R5IB 4KKCD 3REVB 3REVA 1FYTE 5F6IB 2CD0A 4K3HA 1JPGA 3U0TB 3QISA 4FRWA 4APQB 1JK8B 3G04B 4LLMA 4CNIB 4BYHA 2DQIL 3FFCA 2PO6B 4AG4H 1GGCL 3VXRB 5ABDE 2NX5A 3UBXI 5JOPE 5DO2C 1TVBB 3L1OH 3OKKB 3BHBA 2AGJL 4L3EE 4R97C 2QQNH 2AXGA 3QUYB 4PY8I 5E9DA 3TPKA 2ICEA 5ESQA 4HMCA 1WFOA 1BFTA 2C1OB 4GO6B 3UROR 4L8DB 1KN4L 43C9B 3NGBB 4LLDA 4DGYL 4H88L 1NFDB 1Q1JH 2H32H 4JO3L 3FB7B 4YH6A 4GH7B 2OTWB 3M17A 4E5XB 3K8MA 1BZ9B 4KJQC 5TDPA 3HC3H 5CJOL 5EU6A 4PJ7F 2RR3A 5A2LH 3MLRH 3B43A 5D7JC 3RGVC 3ARDD 3LEYH 1CGWA 1OCWL 4R4BA 2ZCHL 5C09D 1BIIB 1H5BB 2ZUYA 5AG9A 1VACB 2HFGH 3QWOB 5KS9E 4OQTH 1VSCA 1XGQA 2X89A 4JY6A 4HH9A 4ETYA 1UKSA 5BOPA 2VC2L 3V6FA 3ZE0E 1T7YA 1NGQH 4UU9B 4O2EB 3WNPA 1EJ6A 4HLJA 2ED9A 4YIQA 2EH8H 4HPYH 5KVFL 3EDKA 3N9GH 1CLZH 3FQXA 4FQPA 3FQXB 4PLKC 4WUUD 3QEUA 3UPRB 3UYRH 3LH2L 1PZ5B 1ZEAL 4BZYA 4JPWH 3ZDZF 1J5OH 2A6IA 1XR8B 4MNHB 1ZKAA 4WI6A 5GHWL 4HGWB 1MH5A 3UJTL 1K4CB 3AU1A 2ERJB 4YHZL 1FORH 1W72L 4HUXB 1D5BB 4PJDB 3MV7E 3A6BH 3N1PC 5ALBL 5DMIH 1TCRA 3MRPB 4LPCA 1XEDA 1S5HA 1J11A 1FSKC 1WZLA 4Q9RL 4WEBL 5TE6L 1MWAB 5DJ8B 3EFDH 5D9SB 5B21A 4YJZL 2YKLL 5JPNA 1ZAGA 3K46A 2BY3A 4NYLB 3W11C 3O6MH 5FCSH 3ZYIA 1DVFB 2V5YA 3AS0A 3MLTA 1Y18B 3BKJH 4U6HB 1CDGA 1QRNA 3I6LD 4NJ9H 3FN3A 5CJBA 3V0VB 4JY5L 3BT2L 2Q7NA 2BNRE 4UB0H 2ADIB 1NANI 3D69A 5D5MB 2GJJA 1YY9C 5C07B 1NGWB 5IG7B 1TTFA 4MCYA 2WSKA 1OAZH 5LKNA 1SBBA 1LO0H 5DJ2A 1AGBA 4WW2C 4P99A 3T0DA 4H20H 2DBLH 2ED8A 4NQDE 1OTTD 1FZMA 3P11H 3GMMA 4PJ8C 3ETBF 3JV4A 1AXSB 3QDME 4B5EA 5D7IB 4HKZA 4Y16D 3G6DL 5CIPH 2IAND 4ZOBA 5I1JH 4GMSL 5IROA 4HXAL 1JRHL 4HV8B 2FRGP 3K81A 3VA6A 1LP9E 3NZHH 1E6JH 1I7UA 1LE9A 5K93A 4XP1L 3L3IB 4MNGE 3B3IA 1U3HC 2DN7A 1EVTC 2NR6D 4WHDA 3MNZA 4ZUWB 2WP3O 5K9OB 1UZ6E 4JFEA 4X5XB 1V8HA 2C5DC 1ACYL 2QL1A 2Y06H 5FDWB 2KZ1B 4X7SL 5I66A 1U58A 2VLLA 5CWSB 1BZ7B 4JHZA 1R5WB 1NAMA 3HMXH 4L4VE 4K55A 4TUJB 3VD7A 1H3TA 5GZOC 1RURH 1FQ9C 4JFHD 2L4OA 2VABA 3VD5A 3GKZA 4LSRL 1XT5A 3SE9L 4PGEA 5L0QC 5IHBA 1K8DA 1ZLVH 2AXGB 3O8XD 2VDRH 3RIAK 3TF7C 5B38A 4WDIB 4Y19B 1J87A 1T4KB 1A1NB 2DI8A 1Z3GL 1KACB 1GC1H 1BM3L 1GXEA 1HXYA 3HE6B 4NRZB 5BRZD 4NM4H 2AK4A 4MD4A 5FGCE 3SKMB 5IB2A 1KPVB 1JNNL 3Q2CA 1INQB 1LMKA 3SY0B 2H8PA 3PGCA 2JJVA 4TTDD 1KTLA 1U41A 2ITDB 3ARDB 5ICZB 5IHUH 3AM8C 3WEXA 3FB6A 1QTYT 3RVTC 4YHLH 1ZK9A 4GRWH 3H3KA 4LOUD 5TFSL 1BQHB 5TGBA 5I1IH 3MV7B 2HKHH 3ILPB 4K07A 1ZVSA 4GLRH 1MQ8A 1OB1B 3CDFA 4HK3J 5DYOA 2A73B 4KMLB 3VDAA 3UJTH 5F88A 4FMKA 5AWNH 3PDOB 4JB9H 4G5ZH 4S10A 2HAZA 3QDJE 4IJ3B 4OLXL 3FO2B 1KNOA 2J3SA 4N90D 2IPTL 3ARRA 3GKWL 1PSKL 5ILTH 4GQ9H 5I1LB 3HS0A 3RDTA 4YDIH 3V8CA 3F12A 1F45A 2PKDA 3GJFK 3FQRA 5DFWH 1QOKA 1RUPH 4GBXD 4BJLA 5I19L 2EH8L 1T83A 4POZC 1GC1C 4K3DL 3QDMA 4HIHA 4YAQB 1L9NA 1WISA 2CUIA 2EIZA 3V6OE 1RAMA 4YHOL 5FM5M 3N50A 2NTFB 3ZE1F 5E8DL 4R7NB 2ZNXA 1E6OH 1NLBL 1CLOL 5GS1A 4NNXA 4OFYD 4D94A 3DV4B 1DBAL 1BLNB 5IT2H 2Y1VA 3RL2B 4TUOB 1GGUA 1MWAA 5DJ8A 4OZIE 4G9FD 5D8JH 3MX0A 4HLZG 4DGIH 1CLOH 3A6CH 2IBZY 1Z2KA 4QTHA 5K9KA 4FS0A 4XC1H 5JORB 3ELAT 1A3QA 3G6DH 5AYQA 5SX5H 4DEPC 3MRHB 2BFVH 4QHKJ 2LV4A 3SGKC 3BXNA 1HHKB 3MLVL 2ESVB 1G7LB 3PWPB 3RWJB 1KJ3H 5EZLA 4GW5A 1IFHH 5DMKB 1KCLA 4V1DB 5KSBF 4UV7L 3U7WL 2HWZH 5FM8A 1N8ZA 3BT2H 4JY5H 4PG9A 4JFFD 3N1MC 1Q9WB 4PS4H 4OV5B 3GMQA 1ETZB 1CG9B 2DTSA 3O3AA 1FNAA 3WS3B 3TBTB 4KJPD 4JQXC 4HIEA 3W0WD 5KVDL 3TT1H 3LEXB 1KJMB 3V95A 5ESQB 3UCRA 2X70B 3QDMD 2FEDC 3MUGA 5D9SA 2YC1B 4Y88A 1T03H 3T2NH 2B1HL 4I5BA 3OAYK 2JLLA 5HYJE 3QDGD 3BO8B 2UV3A 4LPYA 3IS1X 3VFPA 5C9KA 3DROB 1I7RA 5FAAA 5FO8A 2NY5H 5GGUB 1F5WA 1BOGB 3V5KB 3V6OA 3I85A 3P9LA 1ZVSB 1MCSA 3LEVH 4HWBA 2GJ6B 2BVQB 1OHQA 1JE6A 4JPWL 2R1YB 1ZTXL 4OAWB 3ZMRA 1F6FB 3FFDB 3LSOB 1NUDA 5T1LD 1ZHNB 2A83B 4AT6B 3O3EA 1WWAX 3KXFD 1J8HE 4PRNA 3EOBB 4RFEB 5EFIA 4KTDH 3O9WD 4J4PD 4YBQD 4K71B 4TRPL 5ETUB 4ORZC 5CGYD 4NQSA 5TE4H 4K7PY 1P4LB 1KENH 1IEBA 2VR9A 1WBYA 4CU6A 5MENE 1IAIL 1TPXC 4K8RD 4P2RD 5J6HB 3SKMA 4YHPA 4W70A 1YNLH 4LP4A 3W9EB 4H5SB 2GTZA 4KVCL 4MNQE 1TITA 2RCSL 4FTVB 2LAGB 4P5TA 5ITFA 2XRAH 2XT1B 4KAQL 2JJTC 1BLNA 4X0KB 1OTSD 5DWUL 1RZFH 3DLQR 3X3FL 1MJ7H 4QWWD 4JO3H 5DUPH 1X5LA 1MCEA 4JFFA 4JM2C 43C9A 3GJFH 3WFDL 4JDZA 4M7LH 1ED3B 4LSVH 4RMUA 4BSWB 1CFSA 1AO7D 4D0CA 4WFHD 2LVCA 4L9DA 2Z8SA 3QI9D 2XG5A 5IFJB 3SDXB 1NCCH 1I8KB 1CICA 4XBPA 2WINB 1I1AB 2V2XA 2DLFL 4Z5RB 4HUWB 5C6TH 3MTRA 5E6IB 3DWTA 3SKUD 4L4TA 3D9AL 3LIZH 4UT9L 4GRLB 3GMMB 3MRRA 4MDJA 4A6YH 3BX7C 1VEMA 3SDCD 1XR9A 1AGEB 1F6LL 1S7SA 1IQWL 1S7SB 2A77H 3C5SA 3KYOA 4ZNCD 4NIKB 1FV1A 3HPLA 1T6WA 3EJJX 4OFYA 3SKNB 4GAFB 1NUNB 4QNPE 1J1XH 4M43H 3FRUA 4FFZL 2CO6B 5JUEL 2WUCH 3JV6B 1W8OA 5A40E 4IIQC 1MFEL 5C8JB 3BW9B 3HR6A 1HNFA 2OL3B 4HJJL 4FN0A 1CTOA 4QT5B 4X98A 4O2FA 3DX9B 3ARED 1N7MH 3QXTA 4AEHH 2B1HH 4K3EH 1V3MA 5DK0A 2AV7A 1FNGB 3RZCB 3GSOB 4PJEE 3G6JB 1S7TA 1S7TB 5EU5A 2XA3A 1K8IB 3QEQA 3E3QE 3DUSB 5KOVC 5DRWB 5EO0A 3GI9L 3K74B 1VERA 2ICWB 4N8CL 3EZJB 4IRZH 1KJMA 4MAYB 4NQUA 3OKEA 3RNQA 1FDLH 2B0SL 1SVCP 1BEYH 3CNKA 4MMZC 1CXEA 1JGUH 3D85B 1D7FA 2ID5A 4Y8AA 3O3AB 3U7WH 4N0YL 2P8MA 3AVEA 2BMKA 5HGHA 4OCNC 3RGVD 4WY7L 4MNGA 1P2CB 2H6PB 2X4PA 2YRPA 4KJWD 5CJXA 1ZHLA 1I7UB 1GIGL 3B5TA 3IDJB 4PJEB 4HK3N 3BZEB 4N0UB 3CSPA 2ORBH 4X4YA 5F1OB 4PJFA 3HE7D 1V7NH 3OR6B 4ACPA 1D6EB 4Y1AB 2IEPA 5F6HJ 3IKCA 3U9UA 1C5CH 1LNUB 3R0NA 1RPQA 4U2ZA 5F7KC 2XZQL 1CE6A 2Q87A 5DTFA 4PLJD 4RMQA 1AI1H 1QPPA 2MPAL 2AXHA 2R4SL 1HINL 3WIHA 2ZPKL 4RDQF 3AMLA 1U36A 3SJVD 3MA9L 2ZG1A 4G8GD 5FGSA 4C59B 3I75A 2YMXH 3TNMA 1NMAH 3D18A 3MV8B 2W91A 5MEOB 2P8LB 1ZVHA 5BZDB 4U1KB 4N1HB 1JNLL 5FYLH 5KVEH 4EDXB 2HTLD 1DVFA 1A21A 3MLTB 4XC3L 1NAMB 3ROLB 1FNSL 3FO1A 3I6KB 3L7EA 4HXBH 4PS4L 4Z0BH 2Q86B 5BJTA 2XFXB 5D1XB 5E8OA 1G7PA 3UYOD 2VXUL 4H5SA 2XTLA 4UV7H 5SWZA 3QCVH 1O5DT 1JPGB 3SBWC 5E9DE 4KPHL 1A0QL 3S3JA 2Z31D 3IGAA 1WVZA 1GAFH 5ICXB 2QHRL 3U0WH 1LEIB 2X41A 4GKOA 4GLRI 4B7IA 3UZQA 4H26A 3ZL4L 2O61B 1JWUB 1BAFH 1F3RB 8FABB 1NBYA 1VPOL 3PXJA 4ONGH 4WW2F 5T1LB 1NGZB 4X7CC 4LBEA 4HF5L 3GBLA 2HT4C 3FT2A 5JO5A 1BVKA 4P5TD 5I1GH 4RQQA 4X99A 3VXSA 4PRIE 1A7RH 4ZUSB 1CZ8H 1J1OL 3L3IA 1HZHH 1I3UA 4MJ6A 2ESVA 5F1IA 5JOPD 5C0BA 4UU9A 1UJ3B 3JZ7A 5I1EL 2E3VA 1UACH 5HGAA 4FXGA 3NCBB 4UT7H 1A22B 5BQ7A 1S7RB 4WO4C 2VDKH 4M4PA 3HG1E 1M71A 2XPGB 1F8TL 4G8GA 5DURD 1MSPA 1SEQL 2PTTA 2V7NA 2BSSB 5E2VH 1EGJH 2QJDA 1A3LH 3VRJA 3RL2A 2BVEA 2YXFA 5F7WC 2AXFA 1OTSC 2C3VA 1SMOA 5FUZL 3GMNA 3TBYA 3TBYB 4KZEL 4MA8H 4S11A 4F7MB 1A7OL 3U4AA 4IRSD 5F1KC 3T08A 4KJPC 4QXUH 1X5AA 5B38G 3RZCD 4HCRA 4MQTB 2IH3A 5F3HA 1LO5B 2VLJA 4JZOB 3WL9A 4FA8A 1D9KC 2VXVH 4KQ4L 3UTZB 4YZFE 4CN6A 4W4OA 3MODH 4NN6B 1MHHA 4HF5H 4LPTA 5EZLB 1R3KA 3MRLB 4L4TB 3RY6C 5HGDB 1JPTH 2CK0L 2D31B 4OI8A 4PJ7A 3NCJL 3RTQB 1F90H 1M7IA 4PBVC 1PX4A 3IKKA 1A6ZB 4BA8A 5LGKA 3FB5B 4ODHH 3UJJL 1IC4H 4HDIA 1S7XB 1J0IA 4OUUA 1EX0A 2R15A 1OWWA 4I4WB 3PQYE 3PGFL 5BZWB 1JGLH 5DJZB 5EC2B 4QYOB 4Y2DC 2OXHA 5KSAC 3SE4C 4BH8A 3TO4A 5E56A 4KKAD 1NC4A 4U7SA 2HRPH 5DQ9B 2VL5A 2RHEA 1HKLL 4OCWL 5I30L 4BQ8A 3L9RB 3V5HB 4HIHB 3CCHB 1RUPL 4UNUA 3ARVA 2FNBA 4X80H 3QXDA 3T8XB 2R4SH 2ATKA 3VFGH 4RNRB 3ARDC 5C0AD 4V2CB 4YHZH 3SGJC 1F58H 1YEJH 5EBMA 3TBWA 5DI8B 1EO5A 1DQDH 5JLZA 3T0WA 1IGJB 2HFEB 3GJEB 4KK9C 4EI6A 4GMSH 1EEYA 4XPBL 3UTSD 4JN1L 3BOVA 3BI9X 3CFJB 3RI5K 1BZ7A 4JLRB 4XVSL 3R06B 4KC3B 5KTEL 4F58L 5J1AB 2BXZA 4ETQB 1W8NA 3ILQD 1FNHA 2ZPKH 1R3JB 2Z8WC 3LN4B 4XPBH 4NO3B 2CGRL 1BVZA 2V9QA 3GB7A 2ITCB 1BFVH 3T3PE 3ULUL 5J11B 1SYSA 5FYKU 3I84A 2D9QB 5C9JB 1MVFA 1BPVA 3NCFB 5DTFB 5I75C 1XIWD 3P9LB 1NBYB 4U1NB 4U3XA 4YHNA 1K5NA 2GJZB 3LKOA 4NQSB 4OZHB 1B9ZA 3BPLB 2YPLE 3O6ML 1PLGH 4LAQH 4NKIH 1IBGL 4N1CA 1A64A 2BNQE 1JL8A 4LF3A 4XGZA 1VESA 3MJ6A 1EAJA 4JG0H 5C0IB 1ACZA 3IDMB 4NQEB 2IG2L 3QIUA 5I16B 5ALBH 1WEJL 4KWUA 3L3GB 4WJ5A 3TO2B 3SQBA 4NKOB 4C83B 3SDYH 4YAQA 4GG6A 4JVUA 1DP0A 2PYFB 5FA4A 3E0GA 3FQRB 5HHME 3RIFF 1FLTX 3NA9H 4AQOA 5JR1H 1YY8A 4P4KA 2Y06L 3ZKSD 4Z77A 1IC7L 5E2VL 2ZNWA 3U6RB 3HUJE 1EHXA 4DUVA 5DEGA 1E6JL 3GZKA 1HHGA 1Q8MA 2JE8A 3N1FC 4QOKA 3LAFA 1RY7B 1VFBA 2ZUTA 3QFJD 2LVEA 3KDMA 5IMKB 4IDJH 1JHTB 4YR6A 2N7AA 2D0FA 2G60H 1ZT4A 3TA3D 2FBJH 1E27B 1MCNA 1J1XL 1RK0A 2AJUH 4M43L 4TNWF 1JHLH 2FGWL 4R0LB 3VGDA 3WUZA 2J8UB 2A6DA 2YPVL 4KZEH 3O6FD 1X5YA 2J4WH 4JHWL 4MDJB 5D70H 1EK3A 5JIHA 1R3IH 2F5AL 3CH8A 3NZHL 4LSUH 2C3WA 3D87B 5KW9H 1ITBB 3JWOL 4FFWD 4LGPB 2YS4A 3AM8A 1RIHL 2F5BL 3O9WB 3VFWA 2NY6C 5KSVA 1KPRA 4Y16B 1OAQH 1B0GB 3OXRB 1RMFH 3DURA 3S96A 4M7JL 1JWMB 1HHJB 2QTEA 1U8PA 5DWUH 1T1YB 2HVJB 2FH8A 3BJLA 4HKXB 4WHTB 4YNYA 2QHRH 4NQVB 5H35B 3TIDB 2DKUA 4OZGE 3VXMD 1G7QB 1TCRB 5CKGA 4Z78A 4BSWA 3HZMA 3JVGC 3VFVA 4X6DF 4A2LA 2Z8VC 2GAZA 2DQFA 4N0YH 3HNVL 1TJIH 1KB5H 2N7BA 4ZUTB 3DXAE 3MLUL 5FGBC 2B0SH 4QT5A 1OW0C 1U95A 1TCMA 1KENL 1R5VB 4KI1A 4QXGL 2E6QA 4ZS7H 3M07A 4JGMA 4JO4L 4X0KA 5FO9A 2MQ3A 5FA3A 5MHSE 2NX5E 4V1DA 3OKKA 3QUXC 4CKVX 1XR9B 1D9KD 5CEYA 1JZ4A 5T1LA 1Z9MA 2I26N 4RGMC 3FL7A 3TGXA 3CFBA 4NCDA 4HZAA 1OAYL 4Q6IB 1AI1L 1GGYA 2ADGA 1KPUB 4S1RH 4NFCA 2H2PC 2P1YA 3B2UC 4IRJB 1E28A 1AXSA 2EDXA 5B3NA 1C5CL 2Z31C 3RWCA 3H7BB 3BRFA 3NCMA 1CVSC 3BZFA 1I7ZA 4N8PA 3UTPD 4KU1A 3SDXA 3VXNA 1KBGH 4ALAL 2G75A 3WEXB 3HUJA 4ZUUA 1A6AB 2OP4H 4LVOC 3V0WH 5IMMA 3N06B 3HFML 4KZDL 3LKSA 4U1IB 1MQKL 3A0OA 4HC1L 4JHAL 1DR9A 2FR4B 2FR4A 3QG6A 4M6NL 3L5WB 4XVJL 5F9OL 3VMOA 3W5MA 2ILLA 3L6FB 1LK2B 1TJIL 3KS0J 3RU8H 2IADA 3WSQL 1QLEL 2CJUH 2Y07L 1BGXL 1MLBA 4NPYA 3NA4A 4FQ2H 1ULVA 5HD8D 1E4JA 3HHRB 2CRZA 4JVWA 2Q86A 3FRPA 4LLUA 1YJDC 3LDBB 4E0RA 5C0CA 3H0TB 5I1HH 3VFNB 3MSPA 4FZEH 3SGDI 3QZWA 5AZ2L 1Q1JL 3T77A 4M7KH 1I8MB 3AXLB 2LU3A 2Q7YA 2A38A 4TVPH 3V9FA 5TDOA 1SJEB 2EE6A 1S8DB 5DHXB 5HYSA 3WFHB 4ZD3H 2WK2A 1G7JB 1NDGA 4D9QE 2FSEB 1BZQK 4WFEE 2B20A 1NMCB 4LMQI 2SEBA 3VRIB 3FT2B 5JO5B 3VXRE 4P59L 4ELMF 4RSVA 4LLYA 4YPGA 1LILA 4OCYH 4LGRB 4GKNA 5BVPL 3DXAA 1FGNL 1FAKT 1IGTA 3S5LG 4YHMH 3ULVH 5EOTA 4PGDB 4RDQG 2P5WB 2ICWJ 2VDOH 5H2BB 4JGJA 3UXFA 5F7DA 1G6RB 5EA0H 3IFLL 4DVBB 4Z7NF 4EI5C 4LLWB 5ILTL 5DK0B 1MWAL 5CSBA 2A6JB 5KN5A 1C16A 1P6FA 4PJGA 4X98B 2X4OA 5E03A 5JUEH 1CFVH 1YEDB 3D25B 1SM3H 4R8WL 1FNEB 2CH8A 3TNNB 5IWLC 2H3NB 5BO1H 5GS1B 1MH5B 3FQNA 1X5HA 5B8CA 3IDNA 4YHOH 1H3PH 3SDYL 4KK5D 1U3JA 1KLUA 2ADJB 1ETZA 4PJHB 5IQ9B 2AEQH 3MREB 5I1IL 3NCYS 4TNVK 1T20B 2XIDA 3I75B 2PTTB 2GAZB 3MV11 1XZ0A 4DK3A 1NCAL 5FB8B 1X4YA 1TZHB 5IROC 5HI4C 2HVKB 5IHLB 1WT5C 1G0YR 3BKMH 4L8SA 1YN6A 5GGVH 5HJ3A 3S36L 4YDJB 5HSFA 1FJ1B 4QXUL 1UWXH 2DWEB 3ZKMC 5CINL 5EBWB 2V2WB 1W0WA 2OL3A 4E41B 2DQJH 4I0KA 1ZLUK 4I2XB 2D31A 2BSTB 3WXWL 3OJDB 4K8RC 4MXQD 2APWA 1X6NA 1V3KA 5BS0B 1FL3B 1JYVA 4KRPD 5CZXC 3FRPG 3CFCL 4QXTB 5GXBB 4ZS6C 3SDCC 3LHPH 1N5AB 4UMGA 5EO9A 4QTIH 4EN3A 1KTDB 1QQDA 1RU9H 3MGOA 12E8H 1OQXA 4KROC 3D2UA 3BN9D 4NKQB 4WI7A 4HWUA 1U6AL 1DQTA 1A6TB 4N1EA 1JNNH 1A9EB 3P4MA 4FFVC 4QWWC 1KJ2B 5JPMB 4LKXA 3WN5B 5F6HI 3GSVB 4YHKH 5D1QB 1DQDL 3NIDE 1MFCH 3GDBA 3L3HB 1RUQL 5JA9A 3BPNC 1JN6A 1QFHA 4WWKC 4FTVD 1SMAA 1QSEA 1CZ8L 2VLKA 5T33H 4WHYH 2OQJB 4RBPH 2GFBA 5FO7B 4DZ8A 1X5ZA 3PP4L 4HWEH 5H37H 4XMLL 1S7VB 4LU5H 4OGYL 1LK2A 4KXZI 1ZA6A 3ARYA 2DKMA 1WICA 3CC5A 4AZ8A 4YEEA 4EIZC 1ZGLB 2V5RA 3WLBB 3L95A 4NP4H 4RWYL 4RAVA 1MCPL 5F3BA 3QDJA 5MEOA 2ICEB 2OI9B 3EOBA 1JNHA 4CN4A 3IU4L 3A6OA 4JKPL 3BAEL 3H3PH 4LQFL 3QIBD 3JVGA 4L8SC 1IE5A 3ARGC 2DYPA 4PLKD 3ZZ1A 1U3HA 1P7KA 1NSNH 1C5DA 4FQXC 4XPTL 1JF6A 5EZIH 5FHAH 5D2NE 4Y5XB 4P2RA 3T0VA 1JP5A 2Q8AL 4E0RB 1TJGL 1P84J 1A4JA 4DCQA 2AI0L 4Q0XH 1F13A 4M5ZH 1VDGA 2VISB 2VDQH 3OR7B 5BXFB 3CIQA 1E4XH 4PJBF 1OAZL 5C0FA 4Y8DC 4YUEL 3WIFA 3ZKMD 2X1QA 4WHCA 2EYTA 5GS1C 3NACL 3W2DH 5DJCA 4M9PA 1NGYA 2J6EA 3ZLQC 3RWEB 4EUPB 5F1NB 2P48B 4LDOB 2O5YL 5DJDB 1WGOA 3PDGA 4OB5H 1BECA 4OSUH 4C56E 1OSPH 1SJHA 1K3IA 4XP9H 5T3XH 4I18C 1J5OL 4NHUB 1HH9A 4L3ED 5D7LD 3DI2B 2ORBL 3MBEB 1J7VR 3HCVA 5I1LA 3P0VH 3C60D 1SEQH 5DUBA 2P4AB 4NP4L 1S9YA 3CVHB 5CUSH 1FVDB 4MS8D 3WLWC 4YDIL 2R1XB 2R2CA 4HUXA 5HVFB 1L6ZA 3TH4T 5GGQL 1KIQA 1B0GA 3OXRA 2W0LA 1DCLA 2A9ML 4HIEB 3KJ6H 4X7DC 2K3TA 3D85D 4HKZB 3TJHC 3TJEH 3KPQB 3CFBB 3VRIA 1N64L 2EEAA 3FAWA 1DBAH 2AJSL 5IFHH 3RBSA 5C08E 3GMOB 3HG1D 1JUFA 5DQDL 3ZE0F 1I3GL 3TVMA 3BPLC 1X4ZA 3SGEI 2OR7A 1AGEA 1ZLWK 5IBUG 4XNYH 1G84A 3OQ3B 2VLKE 3K0WA 4O2EA 2GIYA 3TT3L 4ZDHB 3RWDB 4Z7VF 4S1SH 4KHTH 3F6LA 1CE1H 4KJQD 4HBCL 1RFDL 4Z8FH 5L2KD 1NAKL 1LK3H 1HHIB 4LHUG 2YBRB 3UBXA 1BP3B 3PWVB 2IJ0C 1C16B 3MRLA 3BYYA 5KJRL 1ZHBB 4QHUB 2OSLA 1I1FB 5F8RC 2BXYA 5F9JB 3TP4A 5E00A 5JOEA 2AV7B 2X7LB 3BESR 1UCTA 1RSFA 4XNMB 1XF1A 4U1SA 5JW5A 3DURB 3OL2A 4LKXB 5IM7A 3O3DB 5FEBA 5KVEL 5B4MC 4L29B 5DHVH 1HSAA 1WAAF 1AQDB 2OI9C 2NXYB 4BSJA 1FLRL 3MCG1 3D39E 4WI8A 3BP7A 4I0CC 5DR5H 3EDFA 4G8EB 4TTDC 3DUUB 4IRSC 4ZQKA 5FYKH 3PHOB 3O9WC 4XH2A 4CVXA 3WO4B 2GITB 2EECA 1W2KT 2AV1A 3OKLA 5IGXH 5C2BH 2EC9U 5C0DA 4O2CA 2BHYA 1V7NL 4UDUA 5SV3A 4JKLA 1IGML 3KVQA 3K1KC 1VACA 1NFDF 3MA7A 1DDHA 2IALB 2ITCA 3O0RL 3K2UH 4LLYB 5EU6E 5GGVL 2BJML 5D72H 2Y7QB 4GS7C 1NBZA 2B4CL 2DQGL 4Y19D 5EOCL 4D0CB 2AW2A 3LPGA 1MPAL 4DKFL 1KT2B 4L1DA 3EYFA 3T4YA 3IRPX 2VDKL 4ZS6D 4XNQB 1FO0L 2FX9L 1PBYA 1RK1A 3FCTA 5ERWA 4K23H 5BVPH 3CXDH 4JFXA 1YECH 2YZ8A 4LHQB 4UT7L 5DMJB 5C0JA 1BBDL 5IHZB 3LZFH 3DMMD 2BVUA 2DQJL 2QQQA 4NKOA 4C83A 2EIZB 2ARJA 3GI9H 2DQUH 3IETB 5CP7B 5GGSB 2JK5B 3O8XB 5D1XD 2W0FB 2DAVA 5IOPA 2B4CC 3KPPA 2D7MA 3C5ZA 1JF1B 5DVLA 3CLEL 1GGIL 3MLZH 4IJ3C 2XFXA 3VXRA 4WWKD 5GS2H 2VLME 4M62L 3DVIA 4GG6F 3PIQB 3GMPB 1X44A 4OQTA 4J6RL 1M7DB 1T1WA 5BW7C 3BW9A 2CRIA 4OLVH 2FO1A 1FYTA 1K5NB 2A73A 3OBAA 3P0GB 1AGFA 4R26H 3X11A 3MXVL 3MRKA 4I48A 5K9QG 1H3VA 4P23A 5LWYH 1OQOA 3HMWH 5D7JA 3GIVA 3LN5A 1KC5L 3O3BB 1IGFH 1OM3L 4UV4L 4P2QB 4OV6F 2R56H 3ARTA 1LO4L 3VXSB 5D1ZC 4PJGE 4JREB 3QIBC 5D7LE 1ZS8B 2FX7H 1U93A 3C8KA 4JJ5A 3U0PB 3G5XA 5DJ0A 3UTSA 1QHPA 2WBKA 1XIWC 1Q72L 4HKBA 5DD1L 1KEGH 1KIQB 3AREC 5DS8B 3OTTA 3KPTA 4HCRH 4JZJB 3BPOB 3P73B 5F6IC 2CDGA 3RZWA 4OCYL 1S5HB 4KUCF 5GGRB 2H9GA 5EORH 3GRWA 4JCMA 5D7LB 4MVBC 5IB3A 3C2AL 3L5HA 2QR0B 3QIUC 4LLAA 2CRMA 5HVHB 1PG7X 3BDBA 4I5BB 4ELKA 1N4XH 5J1SC 2PCPB 1HH6B 1QLEH 3H9SB 3MRQA 1T21B 2AJZA 1QRNB 4PRBB 2EKSA 3GMRB 1Y18A 5CSZB 4W6XB 3WNOA 1KIUA 2HT2D 4S1SL 5ACLA 4ZOEA 3SE3C 4CMHB 3RVWC 3QSKB 4D0DA 1FZJA 3BIAX 5ISZD 4YEFA 5EN2A 1I1FA 3MRPA 2YK1H 2Y7QA 4LCCB 5CEZL 3CFEA 1FL3A 1I9JH 2DM4A 2DMKA 3OGCA 3QZWG 4PY7B 3KG5A 4F7EB 4H0GA 3OKMA 1FDLL 3OG6B 3FO9A 4YE4H 2VLRE 1JJUA 3HAEB 1LDPH 4JFFE 4DZBB 4HULB 1YN6B 2NY3D 3P77A 2EXYD 3VGGA 4Y1AD 3ULUC 4CJ1A 4BUGA 2UVFA 4IMKA 1JPSH 4AIZA 5ADOL 4IDLA 1QSFD 1CXKA 1D6VL 5CFHA 3WE6A 2BOCA 2JELH 3FN0H 4OFIA 1AR1C 1NGWA 1U8QB 3BKYL 4XVSH 3TZVA 1G7IB 5GRZA 4PJCB 5EUKA 4I8DA 1JYXA 3ABZA 1XFPA 3GSQB 4JGUA 5MERA 5I71B 2VZSA 2VAJA 1U92B 3GSNL 3DXAD 1N4XL 3L1OL 2J4WL 3C9NA 5KBNC 5SWSA 3QCTL 5CKAA 4YO0B 1CXIA 5B38B 3UTTB 1INDL 1T4KA 3GUTA 4HGMA 1E4KA 1BD2D 2G60L 4WU5A 4KK6D 4LRNL 5E5MA 5MHSD 3U0TA 4PJBE 4I3RH 1IM9A 4U6TA 32C2A 5D2NA 1TQCB 1V3LA 4OLWL 4P57A 4XTRC 2P5EE 5A2IH 3U4EA 4NO2A 1EPFA 1T1ZA 3L3GA 3HUJB 1NEZA 4XCNA 2VDMH 1AHWC 1MFBL 3THMH 5FGBA 5I2IB 4UOW1 4M93C 4R7DB 1OP9A 3V52L 4P46B 4M7LL 4U31A 4P5KB 2R1YA 5DEZA 5I8CB 5A43C 1W0VB 1XIWB 1DDHB 2IALA 4LKCA 1MJUH 3DRTB 5IMOA 4NQCE 4KI5F 3R8BB 3HUJF 4IDJL 2NY6D 2OR8A 5IMLB 1EEZB 1NCBL 3PGDA 5K9KB 4MJID 1OY3B 4XWOC 5F7HA 3FKUS 4HHAA 4LLUB 2YA1A 5GRJL 1UM5H 2DYPB 3W5NA 4M6MH 4WGVB 5FUOL 3LQAH 1UVQA 5DZLA 1A3RH 2YPVH 4EBQL 4GRLC 3DSNA 4X7SH 4PD4K 4S2SA 1X5KA 3ORJA 5I17A 5T3XL 4AYFA 3EFFA 3O41B 5E8DH 4MAYA 2BOBB 1I8LC 4PJIB 4LGSB 4WJ5B 3CX5J 1I8IA 4N5UA 2HFFA 4LRIC 1CFTB 4MQ7B 5EO9B 2FIKB 1BD2A 1IKNC 1Z9OA 5DJZA 3VFMA 1A7PL 3LMJH 1NGXA 2GY5A 1ZT1B 1WK0A 4JN1H 2I9TA 5EPMB 3VCLB 5GJTL 3BGMB 5EIVA 1OARL 4OLXH 4AEFA 3WN5A 4UB0L 2KL6A 1O7VA 3QP3A 3V6BR 1FH5L 1ZSDA 2GSIA 3PHQA 1KFAL 5JORA 3RWDA 3B6SA 3GSQA 1NSNL 3OKLB 3DTXA 5TQ2L 3X12A 5JZ7D 4PRPE 1MI5B 1MI5A 3UPRA 1DBJH 5FO9B 1DBKL 3BP4B 2FO4A 3FFDA 1U2HA 3QHFH 2VZ1A 4JM2D 3TWCH 5C3TA 4OF8A 3MLWH 3GHBH 3SE4A 4YX2H 1HSAB 4EI6B 4MQXD 4EJ1C 1B6UA 3SGJA 5JW5B 5D2NB 4UINL 3X13B 1FHGA 2HTLC 4FQ1L 1U42A 4ELKB 4R96B 1M05A 1QSFB 4J4PC 2RFXA 2I07A 4OCSL 1RZ7L 3KLAB 2JJSC 3ROOB 4X6BB 3ROOA 1I9IH 3V4VL 1JN6B 4MVBD 1G7HB 2FDBP 3S97C 1MCQA 1C12A 4HFUH 3MLVH 4O2FB 1M6OA 3HB3D 1WZMA 3C5JA 3UC0L 4CDHA 5KTEH 2YRLA 3RJQB 2AAVA 4PJEF 3OKDB 3P0VL 3FOMA 5I18H 4K3DH 2V9RA 3HAEH 1TJHH 4J1UB 4OCWH 1B4RA 3EDDA 4AENA 1LP9A 3CZFB 1R5WA 4GRLD 3ALPA 4RGOL 5I1AA 4M93B 1WJ3A 3QUMA 4IEFB 1PSKH 4QXWA 3IJSA 1GZQB 2DIBA 3RPKA 4XGZB 2XZAL 4JO1L 5L88L 2XZQH 3WKML 1MAMH 1PFCA 4TN9A 4HKJA 5L2JB 5EZOH 5DJAB 2EIBA 2Q1EA 3ZT5A 1CIUA 2HJLB 1H3UA 2M1KA 3F7YA 4JFDB 4M7KL 1AP2A 1CS6A 4KY1H 4XPGH 1OSZB 5EU3B 2JCCF 2OL3H 5M94B 6FABL 3RHWF 2X1OA 5B22A 4U6YA 4Y5YA 1XGUB 1JF1A 1NCAH 3WJLC 4FQIL 4KRPC 5D1XA 4Z77B 1QFOA 4JRYA 2GEEA 1JTOA 2NZ9C 5CP7A 1BD2B 3NGBC 3EYVB 3QDJB 4J3TA 1UB6A 1MVUA 2CKBH 5JA8B 1A9BB 3LN9A 3TH3T 2F19H 1U8LA 4AH2B 1AGCA 4KK5C 1ONQA 4J7RA 4ZTOL 4WWKA 3SJVE 3T4AA 3I02A 1KUMA 5SX5K 4NGHL 1FC1A 4PGBA 1B2WL 4PGBB 5I8OL 4PRHE 5CJQL 3MFFA 1RIVL 1MHCA 3I6LE 1KJVB 2DQHL 6CGTA 2AEQL 5DD3L 5E2WH 1XGRA 4NO5A 3KYMB 1GAFL 1X5JA 4KJYA 4FHBD 3OHXA 1T89C 1EJOL 5D6CA 2VDNL 4P5MA 4XTRD 5HVGB 1WWCA 1AH1A 4TOYH 4CW1B 1S9VA 3Q6GL 3C8KB 4XCYB 2LTQC 4HG4K 5I8CA 2SEBB 1U6AH 2X9XA 4ZFGL 5EUOF 4YXKL 4PD4J 1CDUA 1E4WL 1IT9L 5CD3B 2HT2C 1YYLH 2UYLB 4GS7B 5IF0B 2BC4A 1BX2A 4LBEB 3QH3A 1K2DA 3SO3B 5HHQB 2F58L 4OTXL 1LE5A 4NZTH 2VDLL 2FJHA 4YHML 2EYRA 1F02I 5T33L 4N68A 4EKXA 3EYQC 5C0AA 1KB5L 1YEHH 5CINH 4AEEA 4XPAL 1DANU 5IVZB 3ULUD 5IG7A 3T8XA 3BGFB 3RTQD 4JQVA 1J12A 1HHHA 5IQ7L 2NY0B 3E1F1 3ESVF 1TNNA 3BPCB 5F9DC 4HW6A 2WANA 4D9RE 4HUMB 3T04D 3X3FH 3LY6A 1NFIA 3VWKC 3N1QC 1T21A 2AJZB 5JNYA 5E5UB 2F74B 4XNMA 4GKSB 3MJ9L 1C12B 2IQAA 4WI9A 5HYSG 3BD5A 3QCUL 3B3IB 3MR9B 4TSAH 4U6YB 5IVXA 4RCAA 5JMRA 4QRTB 1GSMA 1Q9OA 3OJDA 4UOW0 1LNUA 2UZIH 2W1NA 2PYEA 3QIWB 3QIWA 4Z7UF 4ZAKC 3U0PA 3MNWB 3FQWB 1MHHB 3ZE1E 3FFCE 4MWFB 1FZJB 3C60A 3AREB 1NC2A 3WNMA 2I9LB 5JZ7C 4MCYB 5DZOA 5TF1L 4WWID 3Q6FA 2VDOL 3L3JA 2ADFL 2OM5A 3ZTNL 3MRGB 3QCTH 4U1MA 4ZG1A 3MRBA 4KRNA 5BO1L 2WUCL 3F8UB 1YZZA 1FFOA 5GHWH 3PNWB 2HKFL 1JMXA 3MBXH 5DGQA 3LKQB 4IIQB 1IGCL 3L7FA 5D96C 3QEHB 1ZEAH 1SQ2N 2IG2H 5BOZG 4D8PA 3QIUD 3KPOA 2PO6D 4FTVA 1B2WH 4DOHE 5I8OH 2W0FA 5AZEH 2NW3B 1CIDA 5IOPB 2VISA 5HYJD 5T1DH 4BUHA 1LEGA 3IJHB 1HILB 3EJYC 3ZTJG 3HRPA 3T3ME 5LXGL 1S9KC 3QG6B 3MO1B 4TULH 3R1GH 2D7QA 4HJJH 5BZDA 3CD4A 1DEEA 2EE9A 5HHQA 5DYOB 3EHBC 3FN9A 4D0BA 5T1MA 3E6HB 3S7GA 4WEUD 4GRMB 1RK1B 1CFNB 2VLJD 3HR5B 4ZUSA 2JIXD 3SDAA 1TZGH 4LVEA 5A3ID 2NLJA 5L7XH 2IFGA 1KV3A 3BN9C 3LN5B 3O3BA 2MKWA 4HUKB 2I60H 3IDYB 4R90L 2ZCKH 5IKCA 4JLRA 3ULUF 4NOBA 3VWKD 2IFFL 3BZDA 4P4KC 4J6RH 1XF5B 2NTSP 3HI5L 4KZDH 4NZTL 3HNTH 1I8MA 1MJ8H 1V7ML 3KPMA 3S4SG 3IFOB 3BQUA 3T3PF 4HUNB 4FABL 5HGDA 1A4KA 1J86A 4CADA 5IK3A 2B5IC 4XBPB 4IOIA 1F6AB 3DGCR 4HT1H 3RX5A 1FFNB 1ZOXA 5C2BL 4Y7MA 4TVPE 4G9FE 4P46A 1ZT1A 1IGFL 3L3KA 1IGCH 4JFPA 5HHMD 2CK2A 2K7QA 2A9NH 4CDGC 3T09A 3QNYB 1A1OA 2P8MB 4PTUA 4I0PD 4AM0A 4LSVL 2AEIT 3L3OB 1MCLA 1K6QH 1DQML 2HJFB 5EULV 1QA9A 3DYMA 4GAJL 1M7XA 1ZLSH 1IM3A 3IJYA 1XCTB 4P2OD 5AYUH 2MCG1 3ESUF 1RUAH 4EIGB 5DT1H 1M6OB 1TQCC 3F7VB 3IXTA 3EYOA 2DD8L 1TFHA 4U6XB 3T2PA 1TQBC 1LEKB 2ZUQC 3OB8A 5IESH 2B8OT 3BUYB 3SE8L 4LVOB 3WKNA 4TSAL 4MWFA 5IV2B 5I1DB 2VXSH 1F00I 3V7AG 4G5ZL 3DX9A 4HG4J 2F8OA 1JWMA 1QKZL 1T1YA 1WBZB 2HVJA 4L4VA 1YEHL 3K4AA 4UDTB 4DKEL 1QVOA 2VITB 4ZODA 2P24A 4PB9H 1MREL 4P9MH 5FOBA 2A74A 2Z8RA 4Y16A 4PJ7B 4R9HA 2NCMA 5H94A 4LCCA 5ICYB 4HKJB 2UYLA 4MGXA 2K9UA 5L2JA 3IXAB 5DR5L 4RAHA 5F7UA 1AIFB 4H0HB 2MMXA 4AL8L 1DBJL 1NCWH 4MX7A 5K9JH 3RWIA 1RUMH 2IQAB 4Q7DA 5FECA 1G1YA 1RZIB 3UEZA 1IT9H 4NQED 4DW2L 2DQUL 3QO0A 2YEZA 3WV0A 1RK0B 4GSDH 4P23C 1BWWA 2Z31B 1P6AB 5DJYA 3GK8H 2X2YA 2XACC 5CSGA 2P7TB 1XGTA 4RGMB 3L3DB 5D70L 3V5KA 3VWKA 4TOYL 1M7IB 4M6OH 3VH8A 2J1KA 1Z3GH 4G42B 4JQIL 2EDLA 2FX9H 4G6FB 2BVPA 5GIRB 1CFQA 3AMKA 1XCQB 1XCQA 1MPAH 4XNUL 2YUZA 2XKNA 3F6IA 3RX8A 4XMPL 3U1SH 4FQLH 1A5FL 1ONQB 3FFCD 4NNYA 3S4SA 2RBLA 3DIFB 4HKXA 4NQXA 2J8HA 3W0WE 2R0WH 4KHXH 2XNAB 3QEGH 1X7QA 1A7QH 2HRPL 4P2RE 3TBTA 3QYCA 3VXPA 4O9HL 2F19L 3FCTB 2C3HA 5ERWB 1KG0A 2RJMA 4ZUVA 4HFUL 3HC4H 3DPBA 3O6FC 4MJ6B 3VXME 5ADPH 1G9NC 4MSWB 3WIHH 5IT2L 1CD0A 1JRHI 1KLGA 2OZ4H 5DFVC 5FYKL 4Y4HD 2AKRB 2RIKA 4K3JL 1T0NA 2I5YL 4LARL 3IB4A 4BFBD 4O58H 4KRLB 2ERJC 1LQSR 3DX6B 3N85L 2YN5A 3EYSH 4BFGA 2P8PA 2JB6B 5F72S 2XI9A 1XGQB 3TA3A 1SVZA 1IGTB 1P4BL 2OL3L 4M1CC 4JG0L 3I2CL 3CK0H 4QOKB 4YK4C 1T2JA 3QI9C 1SJXA 2XOTA 2J5LB 5DQDH 1J1PH 4MMXC 4Y4FD 4S1QH 4KGLA 1WAAA 4FQQB 2VZ3A 3BP6B 4BFIB 2OTUB 3VFSB 4HXBL 4JAMA 2V7HA 3CFJA 3C6SA 4MQXC 3IFPB 1WFNA 4R7NA 4P5MB 3BFOA 1T6VN 4R2GD 1IC1A 5C0ND 3B9EA 3PP3H 3S88L 3OB0H 2DB8A 3BVNB 4ZUUB 2FB4L 2CLVB 5ISZE 2R4RH 4Q2ZB 5I17B 3IJHA 3SDCB 3C60C 1PY9A 2CIKA 4I18A 3CUPA 4FFWC 4MS8C 4DVRL 3RBGA 5IB1B 2VXQL 1L7IH 4HJGB 3B9DA 3NPSC 1DANT 1F58L 3CH1A 5KZCD 4XCCH 2L7UA 4PJ9A 4EI5B 4HHAB 5BRZB 1S5IL 5F7DB 2AABH 5IW6A 3STBA 3U2SB 1U8HB 2M2DA 5FGCB 4AEIH 4N8VB 3BQUC 3MYJA 3OPZH 4JO1H 5DJAA 5CJ5A 5BV7C 2DIJA 2NMSA 4XCCL 4YBLC 3V6ZB 3F7PC 4XP5H 3X17A 3D3VB 2NY3C 3KS0H 2X4UB 1YPZB 2HLFD 4QF1A 5T5FL 5T3XE 1SYVA 1JGEB 2D2OA 3HLAA 3IF1A 3KYKH 3FT3A 5D2LB 1BJ1J 1I1AD 4AENB 4NQDA 2R0ZH 4PPTA 1L6XA 2PYED 1UXWA 4YE4L 3BRDA 2CDFB 4PV9B 1YC8A 3DMMA 3OGCB 4ZPTA 1HKFA 2BX5A 3QWOA 3VG9B 2F8VA 5KSBA 3TBWB 3VGEA 1G9ML 1H3GA 5EIIB 3HZMB 1MIEL 4ZYKA 3LS5H 3O6LH 5GJSH 4CU7A 3PHOA 2NY7L 1P9MA 1KLFA 1RUML 3QUXA 1RJZA 5B39A 1DBKH 3HE7C 3MLWL 3JBG7 4BH7B 1NDMB 4CVZB 1D5XA 4S0TD 1A8JH 3GMNB 4U1GB 1KIPA 1OL0A 2WWMD 3O4OC 3OSKA 4GAJH 3O9WA 2EO1A 3VFWB 5FV2A 2CKBA 2QSQA 2R2HA 2VXVL 3LD8C 4KQ4H 4LRNH 1A0QH 2FIRT 2O5XL 1KCUH 4NM4L 2X4OB 5E9DD 4FQHB 3JSSA 4H1LA 3ZSSA 2VUOA 2GUOB 3UTTD 4XRCB 5HHOB 5LGJA 1I7TB 1KT2A 1FG2B 3CFIC 4Y4KD 3G6JA 4GRWB 2BNRB 5DF0A 15C8H 1CTNA 2IBBA 1DSFL 1ZANH 2VAAA 4MDIB 4DZBA 2VH5L 3RGVA 1FP5A 1A7QL 4S1DD 5SWQA 2OR9H 4ZFOL 1JNLH 4Y5VB 1KJ2H 4YK4B 1ZLSL 2HJLA 4JN2B 1MAKA 1TLKA 3MBEC 2EC8A 4NZRL 1QLFA 1QNZL 5C09A 3DSFH 3PWUA 4DUXA 4L8SB 5HJ3B 5I8EB 1IL1B 4M48L 1MJUL 2AVGA 2PF6A 2G5BB 4XH2B 1R3JA 4CVXB 4N5ED 1HIML 4QRPB 1NCDH 2QBWA 1TETH 3ES6B 5TDOB 3TYGH 4Y4KA 3HC4L 2PYFA 5FA4B 4OJFL 5DVNA 1Y6NR 3GK8L 4PREB 3ZYZA 5I1JL 4GBXA 2NY6B 1Y6KR 1VPOH 3X14B 4EZMA 1A1OB 4MCZA 3UJIL 4PTTB 1NC4D 5D1XC 4F3FA 3V4PL 25C8H 3GMLA 4WU5B 4PUBL 1AJ7L 1CGYA 4RNRA 5HVWA 1EEQA 3TPUA 3FFCB 3EOAA 4K3GA 5F7NC 3U36B 1UWGH 3OKNA 1B3JA 5CMAB 4ZAKA 2DTML 2VSCA 5HHVH 1HEZB 4WTXA 3WLWD 3KHQA 2EXYC 1YEGH 2P5ED 3LKQA 5IHZA 5BV7B 3S37H 3RUGB 4U1KA 3R1GL 1YMHB 2ZCHH 1S7QB 4DW2H 4K9EL 3U7YH 5F7EH 2VKWA 4NC1E 1NKOA 5DA4A 5CD5C 4JZNA 4MD0B 1T04B 2H41A 1S8DA 3GMOA 1CFNA 4HCRL 3FQUA 5F3BB 1N26A 5IW3A 2W9DH 3HZYB 4PJIE 3MRMB 3U0WL 1VKXA 4ISVB 4PB9L 3RVVC 2P5EA 2VC2H 5T1KA 2R9HC 2C4FT 4JY6B 1P7QA 5IMOB 3VFUA 4ZSOA 4IRSB 1C5DB 1J0HA 3MR9A 2R1XA 2CJUL 3KNBA 5J3HD 1VFAB 1QBML 1AD0A 2Y23A 3UX9B 1MWAH 1GGBL 1UKQA 2ADIA 3BKYH 4H1LB 4YZFF 4GKZB 4WVRA 4NNXB 5BVJB 2Z0BA 3WFCL 5AG8A 1BZ9A 4LDLB 3V0VA 1EERB 4N9GB 3HC0A 2GCYA 1WWBX 2GCYB 4MXWL 3BEVA 3WIIH 5JOFB 4B7LA 1AXTL 5IM7B 5EZJA 1F4YH 4NNYB 4A2MA 3BH9B 2CR6A 2ZCKL 5L8KB 4YDVB 1UENA 3PL6D 2Q8BH 5IR1A 4RISL 5CJ8A 3MOBH 2GTWB 3GSUB 2XPGA 3CVIH 1G7QA 3UDWA 4Z78B 5BZWA 1LDPL 4R96A 5FV1L 4BZ1H 1CU4L 2RFXB 3L3HA 4NZUH 5KJRH 3RKDC 4WHTA 4YNYB 3S5LB 5EUOA 3QEHA 3OR6A 5EU7E 4U2YA 4L4VD 3QXAB 4BSVB 2VZUA 4K71C 4KXZH 1CD9B 4XP4H 1P7HL 2R2EA 3DRQA 2Z91A 4F7CB 1VGEH 1XF4A 2ZCLH 3PUCA 3JWOH 2FO4B 4DN3L 4BK4A 4Y2DB 4Y2DA 2BNQB 5LCVL 4FQ2L 5F3HB 1IRAY 2AGJH 3BUTA 1MCHA 5ITBL 5DRZA 2VQTA 4KK9D 4HMEA 5F96L 1JNHB 3A67L 1J0KA 4CN1A 5DHYA 3K4ZA 3M1BA 4J23A 1DBBL 4JPIA 5FYLD 3VXPB 1ZE3C 4TSCH 2VDNH 4Z7QE 5CD5D 3D0VA 3S98A 4R26L 3BIKA 1QHOA 2WMPA 3D48R 1H15A 5DC4B 1QLRA 2P49B 3OX8A 1DL7L 4OD3L 4X9FA 3VFVB 1QFWM 2JCCE 1QSFA 1RMFL 1J8HB 5ID1B 2EDYA 4LPUA 3ARGA 5J13B 4I0PC 4YFEA 1X5IA 1FIGL 2CLVA 2X4TA 2XV6B 3T0AA 4JFDE 2X4SB 1SBSL 1CBVL 1EAPA 3LS4L 4KDWA 4HJ0D 3FMGH 4UUJA 2WIIA 2Q76B 4OV5A 3VXOA 5BRZE 1CGXA 4G8FB 4X5WA 1WAAE 4M3KB 4P23B 4H1LH 3FJTA 2PW2A 4Z7UE 4Y4KC 4Z95H 4JO4H 3V6OC 2Y5TB 25C8L 2H8PB 3PGCB 1CDIA 1Q9LB 4JKWA 4OD1L 1YUHB 5EC1A 3UTSE 2VH5H 4NC1C 2V2TA 4FQJH 1IEBB 3GBNH 3GEWB 1MCKA 5EO1B 5EO1A 5LG1A 5DD5L 3ISWA 3G5XB 5DJ0B 4M8QB 4CMHC 4M61B 3STLA 2VQUA 3RAJH 1CICB 1ND0A 1YEGL 3CXDL 3FQUB 1EUTA 3VFMB 5IEHA 4R4BB 1S9XA 4ETQA 2FSEA 1NGXB 4JZNB 3FB6B 4MD0A 3DVGA 3DX7A 4L5FL 3FB8A 3TJEL 4MAUL 5CBAA 3LSOA 2PR4L 1KGCD 2B4CH 4F58H 5TE4L 2XA8L 4RAVB 5IB4B 1RFDH 3QFJE 1UEMA 1IKNA 3WIIL 1CXLA 3VD3A 4HFWB 5D1ZA 1QA9B 3ARWA 4RAUA 1I1AC 2MCPH 4XNYL 3QG7L 4HH8A 3UC0H 2B39A 4LAQL 4NKIL 4PTUB 3KPSD 1MHCB 1MIEH 2CDEA 4PJFF 1FNGA 3RZCA 4JG1H 4LSTL 4NBZB 3BPNB 5KVGH 2ZWLT 3I6GB 1G6RA 2Z35B 4M48H 4DCQB 3QWQB 3P4NA 3WXVL 1R3HB 1BQSA 1YDPA 3BMWA 4PV9A 5DHVA 4P3CL 3KPMB 2WQRA 1MF2L 3VW3H 4QKXB 1CG9A 2XYCA 4NQDB 1KN2L 4ZAKD 5JXAH 2D7PA 3RIAF 1DUYB 2ICCA 2XY1A 1I75A 5JIPA 3GSXA 2B2XL 4GG8B 2BMKB 4C4KT 1C5BL 4CVUA 1J05A 5EBWA 4HPOL 5FM5O 1FL6B 2A0LC 3C87A 3QUZB 4LNVA 4E41A 4EVNA 4M7ZB 2HWZL 5AEAA 5JPNB 5C92A 2HVKA 1J0JA 3BO8A 5GGQH 1JI2A 3VFPB 1FG2A 4NN7C 3T2NL 1XH3A 3IU4H 5CILL 2XICA 3ULUE 4DTGL 1RJYB 3MBED 3UTTA 1N59A 3AFLA 3O2WH 3B2UD 2RAMA 5D93B 1MCOL 4RFNC 4WFGD 1Z0NA 1NUFA 1Q94B 1IJ9A 2GJ6E 4N5EC 5KSUB 1AQDA 4NQCB 1O7SA 2MNUA 1KFAH 5DHYB 2KH2B 2WZPD 1PKQB 3WS3A 4OLYL 2MSPA 3MGOB 1D5XB 4NCC2 4R97B 3QUXB 3P0YH 3M8OL 1FC2D 1ZMYA 2LU4A 3QDGA 1BIHA 5AD0B 2DDQH 1T22B 3H8NA 2OSLB 3DVNB 5CUSL 3ZYOA 2Q20A 3VXUE 1G7LA 1FVEA 5CS7A 1FYTD 3MNWA 1W0WB 3BQUD 5EWIL 3REWA 3GKWH 3REWB 4I2XA 1ROWA 2XWTB 4FQXA 4U6VL 4MDIA 3O4LD 1G7MB 2FHFA 4JB9L 3MV7A 5ANMA 3RGVB 4QTIL 4JFDD 2NYYC 5J0BA 1ZANL 2X4RA 2QQKH 3VXRD 4RFEA 2W38A 5EFIB 5D7KD 3UP1A 1AGDA 4KI5C 3CDCA 1AO7E 3KPRB 4GAYB 3HPJA 4O51A 3VXTA 1ADQA 4OZFA 5AWNL 4OBSA 1E6OL 3TLRA 3WXWH 4UAOB 4MNGB 1ZLUH 4RX4D 4L9LB 3WO3B 3P9MA 1FRGL 4GG6B 2VDQL 4XPFL 1YEIL 3OHXB 5I18L 1HKLH 4P57B 4HIJA 4YUEH 1T66C 2KBGA 3RVWD 1RU9L 3BH8B 5GPRA 3DUHA 4P2OC 2AK4B 3O4OB 4I3RL 3KPNB 1T7ZA 3MGTB 4XMLH 4FG6C 3VG0L 1JCKA 5I74B 4WFED 1OAXH 4G8GB 4QHLB 5IBUB 3GMLB 3MZGB 3RA7L 2DLTA 3ZO0A 2F9BT 3DV6B 1MFBH 4ZPTB 4TPRH 4U4BA 2ZJSL 1F4AA 5IESL 5I76B 3LS4H 3NH7L 4XC3H 4Y0GA 4HJ0C 3MV8A 5T1KD 1OLZA 5GJTH 4NKDB 2OP4L 3VFSA 3WBDA 2DIAA 2HLAA 2QQLL 1NMCC 1OP3H 3EO1B 3EO1A 1TVBA 5FYJE 3FN0L 1ZHKB 3MQIA 2VR5A 4F57L 2NW2A 2HYMA 5E4EC 3GNMH 3MRCB 3QNXB 4Y4HC 2VE6B 3NFPB 1NBQA 3CFCH 1V3JA 3SQOL 3T65B 1A4KB 1VADA 4MJ5B 5DMGD 3FMGL 4JRXE 3VFNA 3MROA 1T1WB 5DD0H 1I1AA 3TO4D 1YDPB 2J88H 3NCEB 1INEL 1RZJL 3CH1B 4NN7B 2E8ZA 4XVUD 1YEFH 3IDUA 3CLFH 4JEGB 4PJ9B 4EI5A 3BGMA 5FYJL 3LQMA 4FQJL 3JTTA 4M6ML 3CUPB 5HTSA 1CK0L 1T2QH 5FM4A 5GS0H 2PN5A 3C08L 3I3DA 4H25B 3GO1H 2DLEA 2IQ9H 4H8WL 4TVPL 5TPWH 3LKRA 2YPLB 4FNLH 4ZTPH 4G6JL 3EHBD 3PWNB 3BP7B 4PJ7E 4FZEL 4PJFE 1WSST 4WO4A 2PXYD 4ZFOB 4ZFFB 4TSCL 3KAAA 5CZXD 2F54E 3HA0A 2X1PA 2H32A 4PRDB 2X4TB 3EOTL 1AD9B 3E8UH 1NKRA 4NZUL 1MI5D 4GSDL 5E8NA 4IRZL 4Y4FA 3S9DB 3O6KL 4G9DA 3IU3B 4S1QL 3LEYL 3MOBL 1LVEA 1EHLH 4RGND 1DVFC 3NMEA 5GGRA 2CKNA 3GSOA 2DLHA 3IAPA 4L3EA 4FABH 4X9IA 3H9YA 3PWVA 5CJOH 5KSBB 2R0KL 5JDSB 3X13A 1ZHBA 2R2BB 3IKCB 3U9UB 3MRJA 3HI5H 4PIRF 4WFFD 4OD1H 4JHAH 5FYLL 1UXWB 3EYUL 3BIKB 4KUZH 1EUUA 1KEGL 4WFGE 5E6ID 4K8RH 5HHNA 1VKXB 4NFDA 5ETUA 4KPHH 1GJIA 3PWJA 4GMTH 3HZVB 4PJEA 3CFKB 1EXUB 2PETA 2OZ4L 4FTVE 5SWZE 2W60B 3TYFB 1FZKB 1AC0A 2N1KA 1LP9B 2NZ9D 3DBXB 3DTXB 4EXKA 3GMRA 3MRFA 4JREC 3RVVD 1P4IL 4S1RL 4HC1H 3QQNA 1K9TA 2WUBH 3C6LD 4MJIA 1T83C 5DD1H 2LTQB 4NQCD 1YEEL 3IGAB 5AYUL 4JHBA 5L2KE 2G9HA 2EDEA 3MXWL 4JQXA 2BVOB 5DRWA 2IFFH 4UQ3A 3GJFA 5F8QC 3T0XA 5LAXA 5LAXB 4AQ1B 3SPVA 4PRID 1HINH 4XX1G 1YEEH 2CIIB 1WITA 4OF5A 4EI5D 2K1MA 3BEWB 1KXTB 1XGPB 4LSSL 5E95B 3O6KH 4LLQB 5GGSY 3M17B 4E5XA 2E9IA 4XVUC 4RISH 5C0JB 4HS8H 2FX8L 1BEYL 5DFTA 1IC5H 2Q3ZA 4JAMB 5D1QD 3EFFB 1VGKB 4U0RB 1PG7H 2IGFH 5IB5B 3VMNA 1EFQA 3O4LB 4A6YL 1DLHB 2FEEI 3N9GL 4XAWH 4YGVA 1Q9KA 5LJYH 4DGYH 1CI5A 4AL8H 1HQ4A 3RPIA 3OB0K 3TN0B 3PP3K 4KAQH 3WUWB 4PJHE 3VI4E 4M7JH 3W9EA 2BK8A 1CGVA 1A2YB 4MJ4A 3K2UL 2GKIA 5EU4A 4K7FB 4BQ6A 4F37K 2O26U 4KTEL 2D0HA 5IMKA 2J88L 4FFYL 5GSRB 5IW6B 4LNRA 4QOKD 4GW4A 4BKLA 3QJHA 5C0AE 4I0PA 2VLKD 5IGXL 1HHGB 3EIFA 5JW3H 3MRCA 1DQQA 3CJJA 4XAKE 3SDAD 1TTGA 4F57H 4M6NH 5GGVY 2LE9A 4I13B 4J8RB 3CSBA 3TN0D 5CGMA 3QBTB 3GHEH 2Q7YB 3JWDL 5TQ0L 4W68A 1QFUL 2V7HB 3DX8A 3PG2A 3BKCH 4OFPA 5KS9B 4XCEB 1WWWX 1UYWL 4HEPG 4LPXA 4GAGH 2M26A 3SQOH 4JFED 3L3KB 1OAYH 2R39A 1NH6A 4CGTA 2AJ3A 5D6DA 4HS3A 2R69H 2J8UE 2YHGA 5TF1H 5DD0L 5C0FB 2CIKB 3WUWG 3BKCL 3RWHA 2Y25A 1KCUL 3GSRA 3RVUC 3D39D 3RGHA 5E7FA 5E8PA 2D4FA 4P4RB 1W72B 3ZDYE 3WHE0 5F88B 4I77H 4XCFL 1Q9LA 1UADC 43CAB 3S34L 3JWDC 5F71A 2BRRH 3QO1A 4LP5A 4TPRL 3SDXF 1IEAB 1WUNT 1MHPL 4HWZA 4HWZB 2X1XR 4IMKC 2AJYL 3NH7H 1KOAA 2WM0A 1D5IH 1NC2B 1R6VA 1F4XH 2FL5A 5E99L 1NCDL 2VWEC 4NN5B 3DRQB 1U8MB 3GSNA 3MJ9H 4NOFA 5HHNB 5EU6D 1IFHL 1S7XA 5FOBB 4HBQA 4KUZL 3SOBL 2X89D 1A6ZA 1WTGT 3HZKA 3TH2T 1FO0H 1IGJA 4DJMA 2O93L 4HQQL 4HWBH 2F58H 3SKOB 4DEPB 5FB8A 3U83A 3QDGB 4PUBH 5I0DA 3QDGE 4U1LB 3STZB 1Z9LA 1MNUH 4NJAL 5JHLL 1YQVL 3E3QC 1EVUA 2PO6C 1C7TA 4JHWH 2VSDA 1P2CA 5JIKA 4OD2A 1LGVA 4JJHA 3I6KA 4F7MA 1N64H 3B9VA 1IKFH 2Z93A 4XVTH 3NIFE 2P7TA 4OKDA 3SN6N 2YZ1A 5FUZH 5F9WB 3C8HA 4CVZA 4OSUL 1U3HD 3LDBC 1TETL 3HKFA 4MZ3A 4QRRE 1T0MB 1JHLL 2FGWH 1OAKL 3BSZH 4ZPVB 1N5AA 4Z76B 3DVGB 5CBAB 4Y19E 4YFLI 2BNQA 3O6FA 3PWLA 5J6GB 5FCUL 2BFVL 5F9JA 1E4WH 3NABL 4APQA 3ZDXE 3CLFL 1ZTXH 4JN2A 1IVLA 1EO8H 3EYQD 1A6PA 3HAEA 5HDBE 3LS5L 1GZPA 1P4LA 3P40A 2FWOA 3D0VB 5ESVA 1IC7H 1XAUA 2VZTA 5CEXA 2HP4A 4WUKH 5EBLB 4QRTA 5GGTH 2ICWI 1CLYL 1C5BH 4Y4FC 5D93C 3WUWA 5J56B 2WIMA 3DVNA 5HDLA 4F7PB 3WFHA 4UZGA 4XXCA 5DGRA 1QBBA 3QI9A 4YGVB 4R3SA 3KYKL 5TDPB 1NEZB 5EU7C 2HFFB 4D0BB 9CGTA 3GHBL 2JB5H 1NMBH 1RI8A 2DBJA 5T5FH 4HC1A 1T0PB 4H26B 4HBCH 4JDVA 4GG6E 2O61A 4UUJB 3MYJB 2Q8AH 1YA5A 2FBOJ 3RL1A 1R24B 4DN4L 3LKRB 2GYSA 5DI8A 1U0QA 2FLRT 5C0IA 1U8IA 3PP4H 4HWEL 5EZOL 2B7DT 3O6LL 5GRWA 3U6RA 1CWVA 3MFFB 3MV01 2C1PB 4XPAH 2C1PA 1QZ1A 1KNOB 4CU8A 3KNBB 5D5ME 5C0AB 3PQYB 5ID0A 1NAMH 4PRAA 4YHKL 4F8TA 1A4JB 5ESAA 2CR3A 1S7RA 2CDFA 5BV7H 5EG6C 1YEKH 4JPVH 1TQBB 4FXKA 3UTSB 1IM9D 2CRYA 4JR9L 5C3LD 3FB8B 4RIRA 3LPFA 1XR8A 4MNHA 3SGEH 5KG9A 3PE9A 1HXMA 4YPGB 3T3MF 3TA3C 4QRRA 1G7JA 5HGGS 4I3SL 4GQ9L 5MI0C 1KB5A 4XWGL 2XZAH 2ZUWA 3HRZA 4NRXA 4WUKL 2OXGA 3GRWL 4OUUB 3TV3H 4HV8A 2BY0A 2QQKL 5E94A 1AKJB 1KEMH 3EJZC 4JPKH 1ZV5A 1JWUA 5IMLA 1YMMA 3CGTA 1P9MC 3KYMA 3KGRA 1IC4L 1CDCA 1VFBB 2FECL 2NYYD 3T65A 3GNML 4OQ1A 4BFEA 3LRSA 2IAMB 4YPJA 1RUKH 1NMBL 3NCJH 1MNUL 2EDWA 4LPWA 1OWRM 3RVXC 4GW1A 4LCYB 4NGHH 4D2NA 5DJ2B 1S9WA 5JXEA 5I30H 4LEOB 2I24N 4ZPVA 1NCBH 4Z76A 2APXA 4PGEB 2NY2B 3WYRA 4JQIH 5CCKL 5I74C 3NZ8A 2WWMC 5FKAA 1FBIL 3HI6L 1JPFB 5EIQA 2O5YH 3IDNB 2VLRD 1PD6A 4O5LL 2IPUG 4NQCA 4Z7WB 1UXSB 3ARBD 2XZZA 4U1MB 1WFTA 3CPLA 4RA3A 5E99H 5CZKA 3RA7H 5BMFL 3K4DA 4EN3B 2HKHL 5D2LE 1OARH 4PRPA 1EV2E 5K9OA 3QPQD 4KHXL 3BE1L 5DLML 4AIZB 3TESA 3BZFB 4NC0B 1H15B 3AUVA 3WDJA 2R9HD 2AJVH 2OS7A 1CQKA 1DL7H 1PY4A 1HHIA 2E7CA 2WLYA 4CMMB 4DAGH 4XPHL 5EOCJ 4YQXL 1RURL 1H3PL 2JB6A 1G1CA 1VADB 4K3JH 3DBXA 1OGAE 2WWKO 3JV4B 1PG7W 5TGBB 5C9JA 3O2DA 2XQYK 1A7OH 3BN3B 1BJ8A 3Q6FB 35C8H 1QEWA 1QEWB 3EZ8A 3I9GL 1MRFH 4PRPD 3PWJB 5FGRA 1ZHNA 2A83A 4QRRD 3CFKA 3HR5A 4GXUN 3R8QA 1KG0B 3HMXA 4HPYL 3S35X 1UWEL 1HDMB 4G8IA 1U3YA 3TO4C 2E7LC 3CFDB 3UTOA 1BAFL 1XGPA 3LKNA 1RULL 4KK8C 5DD6B 1KJVA 1EBAA 4OZFH 2LQRA 3CSYA 1INDH 3MLYH 3K7UA 3RKDD 1MUJA 3P4OA 4WTWA 5E8OB 3ZDZE 3OX8B 3ZT7A 5CHNB 4BZ1L 5CEZH 2FLBT 4X83A 3GJFB 3U9PL 3RAJL 4WU7B 5IW1A 3PWPE 2ARJQ 2PXYC 1R24A 3V0AC 2NY0C 1N6VA 4JE4B 4QCIA 5AZ2H 5AAWA 2X5PA 4XP4L 3GSWB 2AK1L 4XB8A 3RY5A 5L2KA 4LCIH 4Q9QH 2EYTB 2PR4H 5F7FA 3P11L 1F97A 3MJGX 4P2QA 4M6AA 4RGNC 3ULSA 3RDTB 4P23D 4O51B 5HBBA 2XN9B 2EH7L 4DVBA 2OJZH 3ARBC 5D4QA 3NFSL 4YXLL 1IAIM 1FE8H 3BD4A 4ODVH 3TBSA 1INQA 4BM7A 4MJ5A 3U7AA 4Z7WE 3H0TA 3QCVL 1YUHA 2IAMC 1KYOK 1XF5A 3P4NB 4ODUB 1DN0B 3W0WB 4UDTA 3LCYA 2QADD 5CLTA 2E6PA 4NBXB 4KMTH 1S78D 1AGBB 2BRQA 3MLPA 1KTKE 3NFNB 5HI5D 5DSCB 4RX4A 2VR4A 3G6JE 1RZ8A 5FCUH 1BBJA 5C0GB 4TNWK 3MXWH 4JFZH 1ZT7B 1AKJD 3VGHA 4YC2C 2E7LA 3RX7A 3QRGH 1U8JB 3IJYB 3VG9C 1KLUB 5INDB 1MFEH 2ZUSA 1ZWIB 3MA9H 4G3YH 4ZFFA 3L3OA 1MHEB 1KIPB 4HX1B 3DROA 5ID0B 3QRGL 2DJUA 5I66B 4WI3A 4X6CA 5KS9F 4I9WE