4YASA

Hydroxynitrile lyase complexed with chloralhydrate
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
256
structure length
256
Chain Sequence
AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHKLQLTKTKEIAEILQEVADTYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structures of enzyme-substrate complexes of the hydroxynitrile lyase from Hevea brasiliensis.
pubmed rcsb
source organism Hevea brasiliensis
molecule tags Lyase
molecule keywords PROTEIN (HYDROXYNITRILE LYASE)
total genus 94
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 1999-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4yasA00
5AK3A 3STXA 1CUSA 5ALXA 4MXDA 2G63A 1HLGA 3GROA 4EY5A 4XIIA 1TK3A 5BOVA 3QVMA 3WL5A 1D07A 2WHPA 2PKYX 5LP1A 3AUKA 3D4LA 3QPCA 1VZ3A 2GYWA 2VATA 5ALWA 1YSCA 5CT8A 2XQGA 4MWSA 2XUHA 3JWEA 5AHXA 3R3VA 4BP9A 4C6HA 2XQJA 4U2FA 3HSSA 4JEIA 1EB8A 3LP5A 3QMMA 2HA0A 3E0XA 1QOZA 4J0CA 1W4LA 4B9AA 4UBOA 1THGA 2DSNA 3DOIA 3WWOA 3FYUB 5FXMA 5JYCA 5T4FA 1W52X 4X90A 2WIDA 1JJIA 5JALA 1AMNA 3A6ZA 1WCYA 4J0KA 1EDDA 5CT6A 3BF8A 4B0PA 2XI4A 4GLBA 4Y2RA 5FOQA 1CUWA 1UXOA 2XMZA 3T52A 5LZ4A 4C01A 2IX9A 2V96A 3DKRA 5CT9A 5F4ZA 1F6WA 2HA2A 4L9AA 4OB8A 1YA4A 5LZ7A 2HDWA 3R41A 3IA2A 1CUEA 5JAHA 4EY4A 2XMGA 2JGMA 5AOAA 4LKOA 1QIIA 5CW2A 1WB4A 1AURA 1JKMA 1LPPA 4FTWA 4B81A 3WWEA 2PUHA 1BRTA 4PNZA 5C8VA 4GI1A 1J2EA 4AQDA 1UWCA 4UUQA 2PSHA 1LGYA 1OILA 4DLNA 2XLCA 1XKLA 3T4UA 1MAHA 2I3ZA 3L1JA 5AM0A 5JAOA 4LIPD 3YASA 3R3XA 1DT3A 2HA5A 1YR2A 2VJCA 1LPBB 2OPHA 1XRMA 1C7IA 4WFKA 5AKKA 1E8DA 2HFKA 1MPXA 2XQIA 3I6ZA 4PO3X 1ZD5A 2HADA 4EY6A 3C87A 2C7BA 1IVYA 2ZYHA 5EGNA 4X91A 4AN0A 1VE6A 1K5PA 5ALIA 2RHWA 4X97A 3ZLUA 3QMWA 1XRPA 2HM7A 2ACKA 1XZIA 4NVRA 2QXTA 2UZ0A 1LLFA 3BIWA 5HF8A 5D6OA 4M0MA 4U2BA 3LIPA 3RK4A 1PV1A 3D59A 3KXPA 1EVQA 4Y7DA 3FNBA 5AKYA 1LZLA 1XZLA 2OCKA 2QXUA 3ESAA 3ZLVA 2VF2A 1GPKA 4WDRA 2PVSA 1Q84A 1YCDA 1G66A 3DCNA 3WK8A 1QIKA 3WL7A 1MU0A 1YS2X 1TAHA 1U8EA 3B5EA 1UT6A 1OCEA 3IIIA 3AZPA 4B84A 3V1MA 1FFDA 2WIFA 4AO6A 1GXSA 3GA7A 5AI8A 3AJAA 3V48A 1QLWA 4YPVA 2R8BA 4K6HA 5ALNA 4AXBA 2QVBA 2WG1A 1SC9A 3P2MA 4BCCA 3IURA 5AI6A 1DWQA 1CRLA 3STUA 5D3ZA 2JIDA 7YASA 3C5VA 2CBGA 4G1FA 3G7NA 4MEAA 1ZD3A 1MX9A 1M33A 1CLEA 4P93A 1A8SA 2C5GA 1W75A 2YYSA 1P0IA 5JASA 2HA6A 5K5EA 5BV7A 3BJRA 2GBGA 4EY8A 2PU5A 2OAGA 4IH1A 4MWTA 5HF5A 2IITA 5ALOA 2DFPA 3STWA 3DJYA 2JGJA 5AH0A 2O7RA 4UBIA 5AM4A 1ZIYA 3PUIA 1F0PA 3V1KA 4B82A 1HDEA 1XZAA 4YK7A 2WUFA 2IIVA 3VVLA 1TKRA 1VA5A 3HRHA 3H2JA 5AKXA 5AKZA 5K3AA 2VEOA 2XUGA 3AILA 3C43A 5FV4A 4GHWA 2FUKA 3S8YA 1Q83A 1LBTA 3ZI7A 2DHEA 4FNGA 4PW0A 3QYJA 4AO8A 1BS9A 1R9NA 5CT5A 1MX1A 2WHRA 4WDQA 2B4KA 4J7AA 3FSGA 4QDTA 5AI4A 2XUFA 5DJ5A 3CN9A 2QT9A 3WQHA 5FRDA 1ZD2P 3VISA 1ZGCA 2OGSA 3DL7A 3V1NA 4DMHA 1UOOA 1XQXA 1G5FA 1FJ2A 4QNNA 1Q0ZA 4KR0A 3I2KA 4JNCA 5ALVA 3HI4A 3G02A 4HAIA 5EFZA 5AICA 2HIHA 2QUBA 5T4HA 5JD5A 3BE8A 1UZAA 2Y1KA 5I7UA 4RGYA 4U2CA 4X00A 3WA6A 3OC0A 4J0DA 1JU3A 2OGZA 1FFEA 1AKNA 3STTA 4DM7A 2J3DA 2WTNA 4C88A 5ESRA 3G0CA 2BJHA 5JAUA 3CXUA 1XZHA 1JMKC 1IUOA 3QITA 3UUEA 1C4XA 1J07A 5DNVA 5ALLA 4P9NA 2ONCA 2CEKA 2XMRA 3A2LA 5CH8A 4WY5A 2WIKA 1EINA 2ECFA 4MQLA 2JGIA 4Q34A 3BDVA 2HRQA 2OLEA 3K9BA 1HL7A 4X3CA 2PSDA 5HFNA 1R1DA 4B80A 4G4IA 1WPXA 3WLAA 1JJFA 3VXKA 1CV2A 1ORVA 3M82A 2V97A 4CG2A 3I6YA 1K4YA 4EB0A 4GW3A 4WCVA 5AI0A 3VJLA 1F0NA 1EHYA 1ODTC 4RE5A 4JH0A 2XB6A 1N8SA 3MUNA 1AUOA 3IBTA 1SOMA 2ZVDA 2CJPA 2H7YA 3Q0TA 1YB7A 3FVTA 5ISMA 1CUDA 4HVTA 4HXGA 4QWWA 4HZGA 4C89A 3ESCA 4Y2YA 3WJ1A 2K2QB 2AJCA 2WJ3A 1PFQA 3QM1A 3O0DA 3G0BA 2HRRA 4YX9A 4K6KA 1EK2A 3ED1A 5FPQA 4GWLA 3RKSA 1X70A 3AFIA 4JYMA 1MNQA 3DLTA 1XZCA 4HRYA 3AIOA 1PJAA 5LKAA 4FKBA 1R9MA 4BB0A 2W22A 3Q8WA 1BN6A 5I8PA 1UKCA 3WMRA 3KOOA 3C45A 2GBCA 3G9UA 1CQWA 1BU8A 4V2IA 2C0QA 1XQYA 3OOSA 1XLWA 2Y2VA 3D7RA 1NU8A 3AZQA 4IH4A 2XUAA 4C4ZA 2HA7A 4INZA 4WJLA 4H7JA 2OGTA 5JD4A 3O4HA 5E4TA 3ILSA 5JIBA 3QPDA 3A70A 1I6WA 2HU5A 1EI9A 3V1LA 1IZ7A 1U4NA 4ARAA 2CKMA 1LBSA 3DKKA 3WJ2A 3C6YA 2X76A 2B9VA 4EZIA 2EDAA 3G0IA 4Z49A 5AK6A 4J03A 4J0IA 3I2HA 1WM1A 4UHDA 1ZIXA 5HQ3B 5BWBA 2WFLB 3STVA 1ACJA 4EHBA 2DQYA 3G9TA 1YB6A 5JZ9A 5LYYA 3SWWA 4UBKA 2ZYIA 3X3HA 5K3EA 3KSRA 2JEYA 3F67A 3H04A 3ZV7A 3HC7A 4BVJA 1TQHA 3FAKA 5J3JA 3ICVA 3KWJA 1R4ZA 1H2ZA 3R0VA 2WILA 3WL8A 4K5QA 3O9MA 3KWFA 2BKLA 3BJMA 4LXGA 1MN6A 2VT7A 2YASA 5HKBA 3OTQA 1W6RA 1E5TA 3H17A 3WIOA 1GQRA 2XMBA 5T4EA 1CUUA 4HTAA 3D3NA 2WSLA 4MYDA 1YAHA 2X8BA 4QWMA 4FLMA 5EHNA 1HQDA 3H19A 1A88A 4XVCA 2OXEA 1BCSA 5AO9A 5FDFA 1B41A 1QTIA 3DYVA 5ALRA 2WJ6A 1EVEA 3PF9A 4GECA 4CFSA 1DT5A 1XKTA 4JYPA 4OPMA 3AZOA 1SFRA 4Y2SA 4H77A 4X94A 1VE7A 5HF9A 1UOQA 1UKBA 4YASA 4KRXA 2G5PA 1E89A 1H2XA 2QJRA 2JGEA 3WK6A 1XLVA 5EHZA 4H35A 4BRZA 2QS9A 1RYYA 4QDOA 5A7HA 4BC0A 1QJ4A 3I1YA 4OYYA 2E3JA 2WUEA 3HACA 4KRYA 4X92A 5AK4A 5CH5A 5D3KA 5SYMA 3ESDA 4X6UA 5E4JA 4BZWA 5FUMA 3SC2A 4W9RA 3BF7A 2CZQA 3S2ZA 2DQZA 3I2FA 4ARBA 1QFMA 4EBBA 2VT6A 2HU7A 3H1AA 5A7FA 5HZGA 1GKLA 1EA5A 3I6MA 4FLFA 1ZJ4A 4X71A 3ESBA 3LLCA 2BUAA 2QM0A 3WWDA 5AKEA 3W9UA 1CUCA 2ZJ6A 1E8NA 2ORYA 4F0JA 3E4DA 1XQVA 3EF3A 3AIMA 5LZ9A 3TJMA 5FPPA 2I3DA 1HBJA 1CUVA 4B6GA 4H0CA 4W1QA 4DGQA 1X2BA 3IUJA 4A16A 1DX4A 4Q1VA 1IMJA 4BZZA 2O2IA 1XZJA 2O7VA 3SX4A 3EQ7A 1K8QA 3A2NA 1ODCA 3IUQA 4Y2UA 4H18A 1JFRA 2XQKA 4C4XA 2VTVA 4F5ZA 4BC1A 4U2DA 2QMQA 5JANA 3W06A 2XUIA 4U2EA 4FOLA 4E46A 2XQFA 4X7BA 5CRIA 4MEBA 2WIJA 3PDCA 4KAAA 5ALDA 5LKRA 4UHCA 4PSCA 1EB9A 1HPLA 1N1MA 2ZSIA 1VJ5A 2OCIA 5DWDA 3B3QA 1LPMA 1CUJA 2HL6A 4GBGA 3H2IA 1ZI9A 2Y2UA 6YASA 5DLPA 2RGUA 4CI9A 3RARA 2ZJ7A 3STYA 4XX1A 2HA4A 2ZYSA 5ALTA 5K3BA 4JUIA 4UFPA 1DINA 4ZXFA 3IUMA 2OG1A 1QIMA 2BUCA 1LNSA 4F60A 1UOPA 4ZRDA 4AO7A 2NW6A 2WU4A 3WK4A 3LS2A 4DNPA 2QJWA 4C87A 5A6VA 3DEAA 2OQVA 4FFVA 4QDZA 1KU0A 2Z8XA 3RM3A 2HA3A 4G9GA 4QDUA 4N8DA 1E3QA 2BAGA 2BCEA 1QZ3A 2CMFA 2GBFA 1YAJA 5ALYA 1P0PA 4H7IA 1DWPA 4ZV7A 4DYHA 5BWCA 3C8HA 4U2GA 5CBKA 3W2TA 5JZBA 4L0CA 1EXWA 5CXUA 2QR5A 3W04A 5E2IA 5DNWA 4GDMA 1QIEA 3R40A 4WFJA 4B9EA 3K2IA 1TIBA 1X2EA 1CUXA 4GEGA 2OAEA 4CCYB 2WG0A 4FWBA 1TCCA 1QIGA 3L1IA 5IKXA 2RAUA 5CMLA 4BDSA 1H22A 4Y2TA 1E8MA 1N5RA 1CUAA 1QGED 2WUDA 1AZWA 4ROTA 1VXRA 1F8UA 1YASA 1XRQA 1U65A 5CTAA 1CUGA 3I2GA 1QO9A 3HZOA 4QLOA 3NWOA 3QMVA 4QLAA 3G9XA 1TCBA 3WZLA 5ALUA 5IH7A 3EBLA 4H7DA 1EX9A 2AJDA 4B0OA 2OCGA 1EDBA 2W6CX 3C6BA 1DTEA 4FLEA 3BXPA 3K6KA 3I2JA 2XUJA 4N8EA 3FLBA 5ALSA 2PPLA 5IVHA 4LXIA 3WK9A 5EHXA 1CUBA 5AJHA 2BGNA 4IO0A 5EIHA 3D0KA 5IVKA 3F96A 1DWOA 5AI9A 3FWHA 4BAGA 4OCZA 1MO2A 1MTZA 3FSGD 2V98A 4AB1A 5AKJA 1DQYA 3DL4A 3N2ZB 1VA4A 4I3FA 4P08A 3R3UA 1MAAA 3MVEA 2DCMA 2ZSHA 3GFFA 2VA9A 1YA8A 4KACA 2AXEA 2JBWA 1ZI8A 1WOMA 3WKCA 4KAJA 2WLSA 2JGKA 4KE7A 1T4MA 5JATA 3EIOA 1KU6A 3OG9A 2BFNA 4X85A 2I78A 2WJ4A 2Y6UA 4QZVA 3N0TA 3D2BA 3R3ZA 1CEXA 2PX6A 1J06A 3WK5A 5AP9A 4G5XA 4G8CA 3WKBA 1UK8A 4DSAA 1N5MA 3M3DA 4GXNA 3WKEA 1C7JA 4S0XA 1H23A 4AZ0A 5DTJA 5KWIA 3D5EA 5ALMA 1FFBA 4BAZA 5CT4A 4Y2JA 5ALJA 5LZ8A 2OCLA 4AMYA 1IUNA 4FNMA 2Y6VA 1R88A 3CCBA 3WL6A 4AZ3A 4AN1A 3VJMA 1XZKA 5AK5A 3UUFA 4RNCA 3EQ8A 2XUKA 5D7BA 5AIAA 5AM5A 4G8DA 1SCQA 5A2GA 3D2CA 4HXFB 3C70A 1IUPA 1G42A 5C8ZA 1MX5A 1XLUA 1CUYA 4ETWA 1L7RA 1XZBA 3F8SA 1BEEA 2WUGA 4D9JA 2PUJA 3BDIA 4J3JA 3DNMA 1QO7A 2O2GA 2AJ8A 4TGLA 4UBNA 5JADA 1MJ5A 5SYNA 4TVKA 2JF0A 3B12A 4E14A 2DHCA 5A71A 4BATA 1BROA 1JMYA 5K3CA 4BTLA 4DMCA 3DS8A 1BCRA 1SCKA 3G0GA 3JW8A 2XMCA 5KWJA 5JZSA 3IDAA 4OSEA 5ALHA 4IQ4A 4EY7A 4L3WA 3F9CA 1BEZA 2BUBA 3H2HA 3I28A 4CIBA 4C4YA 1THTA 3A2MA 3BL8A 1VXOA 3JYHA 1LPOA 2GYUA 1KEZA 3D2AA 5AIBA 5AI5A 4UHFA 1LPAB 5A7GA 4BVKA 4H7FA 4FHZA 1UKAA 3HABA 5DTIA 3IUNA 1JT2A 3U0VA 1XZEA 3G9ZA 2J3QA 3FYTA 4M0FA 2RI6A 3QBJA 5ALEA 3HXKA 5CXXA 1QIFA 3CN7A 3IB3A 4W1PA 3PFCA 1GPNA 1LZKA 4CG1A 1QONA 1ISPA 5DYYA 4B7ZA 1T2NA 2XDWA 2RIPA 4KEAA 1GZ7A 2PBLA 4H7KA 3GUUA 3OPMA 1YS1X 4QA9A 2Z3WA 1Y7IA 3KD2A 1U2EA 2C4HA 3H18A 5E4YA 3HJUA 4J0HA 5HCUA 4F21A 4Q3LA 4N5IX 5LZ5A 5FLKA 2WFLA 2WFZA 3WYNA 1O6GA 1A7UA 3MUOA 1DQZA 4NMWA 5AKIA 4OUKX 1CR6A 2OQIA 4E11A 2VSQA 4UHEA 2O2HA 3LIIA 3WA7A 5EI5A 4UPDA 1ORWA 2XE4A 5ALPA 2WQZA 2WTMA 2P8SA 3IVMA 4TPKA 5AM1A 4X6XA 3C8DA 3C6ZA 5ALFA 2C5FA 4J0JA 1K63A 5ALKA 4QEKA 3F97A 4J0GA 5DYWA 2ROQA 1XZMA 2VJBA 1VOTA 2JGFA 5YASA 4H7EA 1P0QA 1ETHA 1JJBA 3WWCA 2FJ0A 2PSJA 1L7AA 1RP1A 5KBYA 1XZDA 1A8UA 3U1TA 2H9YA 3ZWQA 3WZMA 4UBJA 3WIBA 4DNOA 5EIEA 4XWGA 2FX5A 4PQEA 3RLIA 1QFSA 5ALZA 3ICWA 2Z8ZA 2QUAA 1H2YA 5FKJA 3G0DA 1B6GA 3WYDA 1VKHA 3R3YA 1OXMA 3CCCA 2JEZA 1FFAA 1HKHA 2BGRA 1EK1A 2PSFA 1XRNA 4EUSA 5AM2A 1CQZA 3E1GA 4DTCA 3FLAA 4Y9SA 2GBIA 2GZRA 3HEAA 4BBZA 3WK7A 4Y2PA 3FOBA 4BVLA 4KE9A 1Y7HA 5CURA 4UBMA 1P0MA 2H7CA 2PM8A 2PU7A 3VKFA 4OU5A 4LXHA 4BTVA 1CUZA 1WB6A 4AX4A 3WKDA 4KE6A 3IULA 1XRLA 1H2WA 5JD6A 4RE6A 3VDXA 1W1IA 1UFOA 3FLEA 1GPLA 1S8OA 2HHAA 2YXPX 1Q0RA 3O4IA 1QIDA 4B85A 2PL5A 5I9IA 2H1IA 1ZOIA 2Q0XA 1EDEA 2LIPA 1CPYA 4CCWA 4KJXA 2D0DA 3C6XA 4WFIA 4EA6A 4CG3A 1J1IA 4WY8A 1CUHA 4Q82A 4BAUA 1DX6A 4PSDA 1XRRA 1XFDA 1ZI6A 4BYMA 2B61A 4B83A 1UK7A 1JU4A 4L72A 4OB7A 4OU4A 4CIAA 2VJAA 4FFWA 4PV7A 3VJKA 1L7QA 5H3HA 4Y2VA 3LCRA 1K6EA 3R3WA 4BCBA 4LHEA 3O95A 2WHQA 3MGAA 4ZV9A 3PUHA 2G5TA 4UFOA 3QPAA 2EDCA 5HQ3A 1GKKA 3PE6A 4IHAA 2QZPA 5FP0A 2XUQA 4X95A 4MQMA 4HXEB 3W9BA 3FCXA 4KAFA 2I03A 1UK9A 3F98A 3M81A 5C8XA 5K3DA 3HLKA 3PI6A 3H0CA 3OM8A 3WI7A 2XT0A 3TGLA 3ANSA 3M83A 1CIJA 4FBMA 2XUOA 2B20A 2QKYA 4A5SA 3G8YA 1ODSA 1WPRA 2J4CA 3FYUA 4G8BA 3ANTA 1QE3A 2CB9A 4UHBA 4Y2XA 3ZLTA 5JAPA 4OD0A 1BN7A 2XMQA 1LPSA 4UFNA 1CUFA 3AINA 1LPNA 2XMDA 4QDXA 1QIJA 3ZPXA 2GYVA 1JI3A 4IH9A 1DU4A 4CCYA 4BCDA 1AGYA 2C58A 3NGMA 4O08A 2QTBA 4I4CA 4MYSA 3QZUA 5DNUA 3GZJA 1Y37A 2G4LA 4FMPA 5HK8A 2ZJFA 5K3FA 3FBWA 3H2KA 4OYLA 4DIUA 2DR0A 4Q3KA 4UHHA 3FYUC 2WG2A 4ZREA 1WHSA 1UK6A 1AX9A 1ZD4A 4X93A 3GELA 5IVDA 2VAVA 5C81A 3NOXA 5AOBA 4K6GA 2VQ6A 2RHTA 1QIHA 4PF1A 5AOCA 3V9AA 2ACEA 3C5WP 2PSEA 3AIKA 3WKAA 2WFMA 3DQZA 2YH2A 3WWPA 4H7HA 2J4FA 1QTRA 2XMSA 4BRSA 1XROA 1CUIA 1Z68A 1RWQA 1VLQA 4DNQA 3PICA 2HFJA 1EH5A 1W76A 4K2AA 4RPCA 4KYVA 4M0EA 1NU6A 4PSUA 4AMZA 3DYIA 5LLSA 2WU3A 5K3FB 5KREA 2XUPA 3PFBA 4N8SA 2C0PA 4G4GA 4BDTA 3DD5A 4HRXA 1FFCA 2H7XA 4DSZA 4ZI5A 5CH3A 1ZICA 1R50A 2WHPB 3UMJA 3GBSA 3FCYA 1G4HA 1O6FA 5EIAA 1GGVA 5JARA 1GQSA 4G4JA 1MT3A 2XUDA 2XLBA 2DHDA 1VZ2A 4QE3A 5ALGA 5AKGA 4W63A 4ZGBA 2AJLI 4HS9A 4DMFA 4N5HX 4X6YA 3VVMA 1USWA 4OB6A 4DNFA 1WB5A 1AQLA 1GT6A 2WM2A 3HYSA 2GZSA 4NZZA 2HU8A 3E3AA 2QRUA 5HK9A 2FJPA 2ZYRA 4A23A 1AC5A 5ALQA 5AKHA 1NX9A 1BE0A 1TRHA 2V9ZA 2WKWA 2VJDA 3I2IA 4UBLA 3QH4A 4FBLA 4LYDA 2AJBA 3FVRA 3DDUA 4NS4A 4P92A 3BIXA 5DYTA 3L1HA 1XZGA 3EQ9A 4LYEA 3SK0A 2EEPA 1CVLA 4W1RA 4BE4A 4BP8A 3O4GA 1R3DA 3TRDA 2Z3ZA 1XZFA 3KDAA 2WIGA 4ITVA 1FSSA 5IVIA 1SCIA 3NUZA 4Q3OA 4KE8A 4ZWNA 5HFAA 3I1IA 3O4JA 3OURA 2QOEA 4E15A 5C7YA 5HKAA 1ZGBA 2D5LA 3H1BA 4MJ3A 5LZ2A 2JGLA 2Z5GA 5LIPA 4Y2QA 3TEJA 1XQWA 4FDMA 4G9EA 5T4BA 3W05A 1ZJ5A 3BWXA 1A8QA 2X5XA 1WHTA 4BE9A 2ES4A 4I19A 5A62A 1CFJA 3H2GA 5HF6A 3O9VA 2CUTA 5AM3A 2VAXA 4XJVA 3DOHA 4Q05A 2RONA 3PF8A 5EHQA 5AKLA 1IZ8A 1ACLA 1TCAA 4DMKA 1E66A 2R11A 1MNAA 4W1SA
chains in the Genus database with same CATH superfamily
3NEYA 4HDAA 1ZM3A 2JIMA 5D3MB 4UUNA 5ALXA 5KIAA 2MSNA 3H11A 5F2NA 3SSNA 4QRDA 2HB6A 3NBAA 1QNLA 1VYUA 1TK3A 1QQ5A 2C84A 4QJ5A 5JDCC 5BOVA 3EC1A 2ZBUA 1BMFD 3QVMA 4IEFB 3WL5A 3PUZA 4BU0A 3G2HA 2J6HA 1AZLA 2AC4A 4AAYA 4FBGA 4XQCA 1GG8A 1RAIA 1VBNA 2PKYX 2YJTD 5HDQA 1DIHA 3W3AA 3K35A 3KZVA 3V33A 2RGNC 3F7TA 3Q4GA 4HGOA 4P3PA 1P2TA 1P6QA 2I7XA 1O94D 2VHTA 3QP9A 2PVCA 3D4LA 4LY6A 2Q21A 1S7GA 1WD7A 1WNFA 2C04A 4WUVA 5HM6A 5JI2E 2B36A 1VZ3A 5FFMA 1JAYA 1U3FA 1EFVB 2GYYA 4ALNA 5JDIC 5KQLA 3FBTA 2Y27A 2XNJA 2CFOA 5JMTA 1GYRA 4IJ6A 3ORSA 5AHXA 3UJ6A 3IUSA 4B8WA 1A50B 4C1BA 2IY9A 2FFRA 4HFJA 2XNHA 4PQRA 1XP5A 2C2KA 1E20A 3O82A 3WNVA 1A4RA 3BD8A 3AKDA 3Q2KA 4DR5B 1UF9A 3LPDA 2NSHA 1EB8A 2DTEA 3I8XA 1MGPA 3KOUA 3LP5A 1W96A 1WZCA 4JEIA 2E4YA 3NKLA 3BRCA 1J5EB 4BMCA 5KSZA 1UXJA 2FPXA 4YP5A 1DO0A 2MCFA 1CT9A 2BGGA 2JDID 5LN1A 4D3DA 4IW3B 4F1KA 5CCBA 4F9EA 3CJTA 1ZN8A 3HO6A 4IQ0A 1A8HA 3AERA 2CHEA 1N9ZA 4ZCLA 4QJ3A 4L5JA 1AO3A 3G2JA 4R7GA 1UAYA 2ZT6A 1G7RA 3RAPR 3WZ2A 1U28C 2H51A 4BMYA 4IYJA 1W52X 2CHUA 1W9MA 5I7SA 3G82C 2V6JA 1LLCA 1NFRA 1NIJA 1L5HA 2YC4C 3EEQA 4HX5A 4LKRA 1J8YF 4F5YA 3S8EA 5JALA 3OCYA 3GP8A 2H5JA 2OV1A 1GPH1 1B16A 1Q3KA 1QPZA 5CP8A 3PIRA 4J0KA 4FNOA 3C8UA 2G7ZA 1IPHA 5TC4A 1EWQA 3BE6A 1MW8X 1E4YA 1QG2A 3FZEA 1L7EA 4R8MA 3MWDB 1UXOA 2VNJA 1M2NA 3LDUA 4PC3A 4K46A 4LNHA 3U7GA 4U39A 4MRNA 1JJAA 1CQXA 1O95A 3ZIDA 2OCBA 3OUZA 3WBFA 2VDVE 2M6RA 4HFMA 1OFHA 2O07A 1VKRA 1YZYA 2QROA 4PLTA 2PVPA 2IODA 3AHEA 2C2ZA 1CEEA 1WE2A 3LFTA 1U9IA 3QLVC 4P32A 2R6ZA 5CDTA 4YXFA 1H65A 2IX9A 3USCS 2V96A 2ZRBA 1GDHA 9ABPA 1RZRA 2D8MA 3HFJA 1B42A 3PEYA 2AD1A 2C8JA 3NOOA 4JKIA 2ANBA 3S28A 1RQPA 2ECOA 3GQVA 2HA2A 1H85A 2B94A 2I4TA 4DRXB 3AKCA 5IZ4A 1DGQA 1T36A 4IVQA 4RTMA 2F90A 2BVNA 1NM5A 3LBIA 1G5PA 2OKCA 2P9TA 4F5DA 1FNMA 2SECE 1OC2A 2XXJA 3IA2A 3EG5A 1ZY2A 4MS4A 4OJTA 1CUEA 4P4GA 221PA 2XMGA 4Y9RA 5JAHA 3HBLA 1N2GA 2Z1NA 4P35A 1BVHA 4G8JA 4NKRA 3HR7A 4TX1A 4KAXA 1T4BA 1M9NA 4RTOA 4KNYA 2CCGA 3LMKA 2BFBB 1BMQA 3P52A 1EFTA 5TS2A 2WJWA 1K8RA 3OBBA 3C4QA 2RGRA 3MLAA 2EARA 4PNZA 2YXLA 1CDDA 3GGPA 4IIBA 1D5WA 3LUCA 4GI1A 1ISFA 1J2EA 4MAFA 4FJ1A 2EYUA 2PXCA 4Q7JB 1M67A 3IBFA 3LKDA 4K3VA 4U4AA 5ECWA 4LF5B 5FA8A 4UUQA 3IAAA 5FWNA 1VL6A 3ZE1B 1UKVY 4Q18A 4Q00A 1LGYA 3M6AA 3WSWA 3GVIA 2FZGA 3KOMA 3ICEA 4ZCMA 1E2BA 4MS3B 4CPDA 1FVOA 2QD2A 3NNDA 2DFLA 2Q29A 5BV0A 5KWEA 3JRWA 1T3HA 1JR2A 1NJ1A 1P2FA 3QLVA 5E3IA 4Z4CA 2I3ZA 5GZ3A 1QBGA 2DWQA 4LNAA 5D6NA 3ZWCA 1E2HA 2PTGA 2XA2A 5JAOA 4DARA 3YASA 3LLMA 3R3XA 5FO0A 2YXDA 4E5NA 1A5BB 3GVXA 3K20A 1WSBA 4I9FA 3L6EA 1MRZA 1KFBB 1QYDA 5DHTA 1GEGA 3B6MA 3OFSA 3ONEA 4ND7A 2WVAA 4U9HS 3C3JA 2FW7A 4YV2A 2EZ9A 1KEKA 5I6DA 1KRXA 2AX3A 4S1PA 1X1AA 4QQKA 3UPDA 1GZDA 1Z4OA 2YCLA 3G1TA 3GJTA 3DE0X 2WKQA 3AP1A 4KIGA 1E2LA 2X23A 4N0MA 4ME6A 1NBWB 4WFKA 2YNMC 3RSGA 3T7RA 3WLHA 5HVNA 1QP0A 4ZQBA 4BEBA 1RKUA 3B2EA 1DC7A 3PTAA 1E8DA 3QNMA 1UBEA 5IZCA 1MPXA 4AULA 4YRTA 4K8OA 2DFVA 3K8ZA 3H5IA 1L4EA 2R44A 3QKWA 4X45A 1ZD5A 1DKLA 2HADA 2BY4A 4LJYA 3GXBA 3PHCA 2RH8A 3TB6A 5JJKA 1IVYA 1WSWA 3QI2A 4GPEA 4IS2A 1Z13A 5EGNA 2Y8EA 3B36A 2V7PA 4MIYA 1U2PA 3L8ZA 1OLOA 4HX2A 5JJBA 1VE6A 1K5PA 4HGPA 3RYHB 5BNIA 2IEYA 2RHWA 2BKXA 4X97A 3ZLUA 1P61B 3HDQA 2VPPA 1EXVA 2JARA 1ZA2A 4E32A 1JDPA 1FUYB 1N2IA 2FHPA 3OZFA 3BS4A 5IDYA 2Z6QA 4GPIB 2QXTA 5JQGB 1U0RA 4BKOA 1HKUA 2H2FA 5JE8A 1OIVA 3LYLA 4HUQA 1VMKA 1Z22A 1D2EA 4NAVA 4B35A 2W70A 5D6OA 4U2BA 1IXKA 4KX5A 3JD4A 4LMPA 1L4FA 1SG6A 1Y8QA 4UPVA 4KKXB 3ZI0A 2FMXA 1KYYA 3SNKA 2UZ3A 4ZHQF 1P4JA 1UJ5A 2PG3A 1RADA 3ILHA 3PD7A 4YQFA 1EVQA 2Q4RA 2PJZA 4Y7DA 1DDIA 5FPKA 1SY7A 3BM5A 5LD2B 1YRQA 2YJ6A 4LJAA 3IYLW 3VJRA 4TTJA 1EX6A 4ZVMA 2YWRA 2Q0SA 4U7JA 2R0QC 5AFSA 1YGPA 3BCRA 1JG2A 1K9VF 1B3RA 4QGAA 3ESAA 3ZLVA 3GLHB 2VF2A 2REQB 2P9CA 3UAOA 3H9BA 1H2AS 1TF7A 2WU0A 2KQUA 4ZYLA 1KMIY 1MMFB 1YCDA 3OWXA 3V8RA 5EXEA 3W7BA 1QIKA 1W2WB 3TG2A 2I1VB 2QGFA 1FYVA 2ORWA 3M8KA 5KSYA 2BHTA 4FR0A 3SVLA 1MU0A 4YC7A 3GYBA 1TAHA 3KM0A 3ERCA 3E9QA 1E6UA 3N75A 1TC2A 3LCJA 1UBHS 5C18A 3AP3A 4YDQA 5CNMA 2D7DA 4EVSA 2G17A 3B5EA 4LRXA 1UT6A 2F17A 5F76A 3S2EA 1A76A 5EHGA 4RM3A 2R8ZA 2CNOA 4XUEA 5EKUA 2VVTA 2WB4A 4GKVA 1Q57A 4YUWA 2IYPA 3F6EX 1JIJA 1V2GA 4LF6B 3L0ZA 4B84A 5LOVB 2CV1A 5CDUA 2CV0A 4NECA 3FF4A 2VN8A 5LQAA 3GLFA 2CVPA 2UKDA 1OFVA 4L2IA 2WIFA 3O1LA 3MWDA 3BILA 4Z5XA 3MCUA 2CXSA 2N42A 4ASUA 1MQSA 3GA7A 2Q6IA 3AJAA 2XQVA 3W8RA 1GCOA 4N6NA 2QQGA 4ICIA 2XXAA 3GEHA 5F7XA 1QLWA 4YPVA 2BI7A 3WIDA 5BSKA 5ALNA 2QVBA 1KI6B 2WG1A 3KP1A 5EEHA 3QVWA 3W6NA 4DXAA 1SC9A 4BCCA 2Z30A 1CDEA 1CZHA 2WZCA 4H1HA 2BSQA 4DLWA 3A6KA 2TMYA 3MM4A 3L8MA 4Z4HA 1DWQA 2APJA 3KSZO 1CU1A 1SRQA 2Q1YA 3K2QA 1DXQA 2O8DA 2UUPA 3QUBA 2IK8A 3WGMA 4P8RA 2YWHA 4A82A 1GITA 2GCPA 4PYMA 4NV0A 1C9JA 8OHMA 2JFFA 1BE6A 1ZD3A 3UXYA 4MRVA 1CLEA 1NAHA 2WPDD 2GM5A 1FSFA 2WWYA 1TZMA 2FZLA 3SC6A 1RE0A 1T6NA 4QAJA 1W75A 2ZGVA 4OGGA 5CCXA 1E1LA 4AJEA 1Y63A 1C8KA 2EBFX 2Q4TA 3DOFA 1KEEB 1HC7A 2GWRA 3NHAA 2VSYA 4EJSA 3LSTA 5JASA 5JS7A 5IAGA 5AW8A 4JD5A 3VR5H 4PPNA 3W2IA 4RIEA 3VO1A 3EPKA 1Z7YA 4ZEWA 4YQEA 5EE1A 5F9MA 3WLMA 1T0IA 2RIRA 3EGIA 4C5AA 1L9XA 5E7IA 3R9XB 5ALOA 4NIMA 3KEQA 4CEJB 3IHLA 3ZE8A 1V8PA 2J7PA 2B7CA 3RT9A 4D74A 2C5EA 2SCUB 4MNTA 5ESDA 1HEIA 4GM4A 5AH0A 4BWGA 3U31A 4NF2A 3U1BA 2QV7A 1XXHA 2IF2A 1V5FA 2O7RA 2QLTA 2WUVA 1IY8A 2YJNA 3B48A 1VP3A 3JQ7B 4RQBA 4TKUB 6Q21A 3B70A 3REFA 1A96A 4JN6B 2CLSA 3PUIA 4HQ6A 3SOZA 3V1KA 4B82A 5B64A 2JRCA 1I51A 1EUDA 3PJFA 1Y8CA 1PJRA 1SBQA 2A5GA 2FWMX 3EYAA 4YK7A 2I76A 1TD9A 4KUHA 4LE0A 3NHPA 7ABPA 2OP0A 4ZVRA 1VA5A 3UC9A 2BBTA 2J9FA 5IP5A 1Z9BA 2B98A 5HCIA 3LC2O 4IV5A 5AKZA 3N7UA 3OZEA 3OPVA 2E48A 1K2VN 1ICEA 2VDWA 1LBTA 2H9AA 4AKTA 2JFOA 4RYDA 4X5OA 4CV2A 1KYVA 2DHEA 2PIAA 1XTVA 1Q0PA 1TYBE 2O2CA 2YMLA 3IEPA 4RU1A 3TLAA 1R9NA 2FRXA 2QRJA 5CT5A 4ESEA 2I99A 4AF8A 1HE1C 3LYUA 4ZDJA 3IAHA 3VTKA 3AUXA 3FSGA 3VV2A 2IYWA 4HMPA 1FDIA 1DKOA 1QANA 1U81A 2VDNB 2QB5A 3OTGA 3JYLA 4MWGA 1ZSVA 4NH4A 3W6UA 3FFXA 5BSHA 3WQHA 3O8CA 3L1VA 2FPGB 2ZRMA 4Y1RA 3ACCA 1JEQB 3SIXA 3BGSA 2QTNA 3D8NA 3GAFA 5IBRA 3NWEA 4M54A 1FY2A 3L4BA 3VISA 4BLPA 1XEXA 4WA7A 3K8YA 3DL7A 1DX9A 1GZUA 1VBMA 2B1JA 3C3XA 3L18A 3V1NA 1UOOA 2YQZA 5A5EA 4ESVA 1FOEB 2BFFB 3P71T 2NU6A 4ZODA 1FJ2A 4RLFA 4PINA 3TSAA 1Z35A 1K2WA 2GJSA 2J5XA 4LYYA 4QNNA 3AR9A 2LR0A 3MAGA 5IC5A 1PBNA 4JC4A 1ZJWA 5ALVA 2ZYWX 5JPIA 3EIQA 4HAIA 1UBJS 3A04A 4FCWA 5DASA 2X2EA 1PVOA 4CF5A 2XECA 1X0VA 2YWXA 2QUBA 4IHJA 4JJKA 3FD8A 5T4HA 3QVTA 5IKPA 5K0TA 4L5IA 1UZAA 3FRHA 3GPIA 1N25A 1YQTA 5J23A 1W5EA 2GHQA 3TQSA 4X00A 5FEMA 2LCQA 2FZ4A 4CKBB 2HIGA 2ZE5A 4EZEA 3AI7A 3WA6A 1D2MA 2B6NA 2CHFA 4DCMA 4YY3B 3P19A 5JNLA 2YV3A 3CE9A 3QVGA 2IZ1A 3NJ8A 1JU3A 2OGZA 4FE3A 4IPTA 4BV3A 1P62B 5A4FS 2WSMA 4HUQB 4IUBS 2F4VB 4HWTA 2O3TA 4E12A 2WTNA 2F8LA 1CYDA 4C88A 1OB5A 2DU8A 2RKBA 3H1TA 2QRPA 5MHTA 2RD2A 2CL0X 5CA1F 5C52B 1QDLB 2WWTA 3CXUA 4EMBA 1XZHA 3OHMA 4DWOA 3Q6NA 4ZCQA 1IUOA 1HE4A 1S96A 2I91A 4JC5A 3VH1A 1UANA 4EKDA 2J9GA 5DNVA 3TL6A 2D0OB 3N07A 2Y99A 4ZHQB 1TEVA 2C82A 2H17A 2N1MA 2CEKA 2YJ4A 2GD0A 4EHIA 1NV8A 3EXAA 3I58A 1JEJA 1YWGO 1JLKA 2Q3MA 1R66A 2JD0A 4MLZA 5DPMA 3ZY5A 3HJTA 3FMGA 4GE0A 3F3MA 4MVJP 1NAIA 4K88A 4CMCA 1NW7A 2R00C 3KJHA 2F8TA 3CGWA 4OFXA 2ICAA 5JOQA 2I8LA 4MQLA 4XCQA 3QYPA 4O1HA 1JA1A 2C92A 2OLEA 1Q0HA 4PYIA 4CDRA 3TI9A 3C74A 4MYHA 3SJZA 2ZAGA 3JVIA 2XTNA 1NF8A 4IFIA 4EH1A 4G4IA 4CCAA 3H75A 2OA0A 4NYJR 4ZOAA 4PIMA 3ASZA 2QW0X 1ORVA 3C6KA 4JGIA 1NGSA 2B2XA 5I4KA 1H3EA 5LFAA 2WW8A 1SIUA 4D3XA 4WOKA 2RJ3A 1SOWA 4B5KA 1CQJA 3E18A 4PO9A 2W11A 4Y1EA 1HORA 2GO7A 4EB0A 1AKWA 4KXUA 5EJ9A 4D43A 4MLCA 4WCVA 3NBXX 5HUHA 5AI0A 1OZFA 4F9GA 2IY7A 3G8BA 3G1WA 2YW9A 3VJLA 1F0NA 2EJVA 3CUKA 3GDOA 4G5SA 5H4HA 5H80A 5KUTA 1KWKA 5E1OA 4X65B 1MKYA 2BP7A 1P2UA 3OQJA 2Q4OA 3OEWA 4V1CB 2GJKA 2ZIXA 2UYQA 3CLSD 2C61A 1Y1KE 2H1HA 1NBME 1SOMA 2PR2A 2ZWPA 4P3KA 5DSZA 5TX7A 3EG9A 3LPNA 1XDUA 2QE6A 3D6NB 2WAYA 3LQYA 3ICPA 4ZCIA 2CJPA 2H7YA 3B89A 3TD9A 1N0WA 2IZ0A 4RJTA 2HRBA 3CNNA 5JSFA 2Z83A 3D54D 4WCFC 5TS3A 2HIMA 3FNHA 3RWOA 2EFHB 4MQFA 4U02A 4EQ6A 3VOBA 2QN8A 1HFKA 3E9YA 2ZJ3A 3OCZA 4JR2A 4DT1A 3UOWA 1WBBA 2YHIB 3AK4A 1V8BA 1IXYA 2QSJA 2NVUB 4Z4EA 4DQLA 4AJJA 3HXTA 1PT8A 1II8B 3OZAA 5AVOA 1T6XA 1P75A 1EGMB 2G70A 3WJ1A 3FY4A 3G6WA 4DUGD 1ZU4A 2XYQA 1DFIA 2QD5A 2EQ5A 4HEA6 3AHGA 3ZWKA 3M0EA 1KYQA 1NP6A 2R97A 2X15A 4BKPA 2PT6A 1FLNA 1IEVA 5F12A 3TVDA 2YWJA 5SZHB 3O0DA 3W7VA 3G0BA 2HRRA 3R3HA 3VV3A 5DH9A 3E48A 3EDYA 3HB0A 3KQHA 2VJQA 2IYEA 3VUFA 2WT4A 1NVMB 1N0UA 1KR5A 4BVHA 1EK6A 4C30A 1NXTA 1TAUA 2Q5IA 5IFKA 2HSEA 1U3UA 4MI1A 4UE2A 1MNQA 1I0ZA 4MUKA 5A5GA 5JZVA 4DCGA 4DF3A 4MI9A 2J5BA 2COUA 3KNZA 3NDRA 5KCMA 3BJIC 5TPWB 4K0RA 9ATCA 1V8OA 4U3JB 5CK5A 4F4HA 1CIVA 4WZ6A 1UM8A 4AJ1A 4ZYUA 4HCJA 5CCEA 2M1XA 4FDVA 5JCJA 4BB0A 1S7CA 1RYZA 2P9HA 3IKVA 4M88A 1DKMA 4IXDA 5I8PA 5CGQB 4PAQA 1GNQA 2PRZA 2WD8A 3E58A 3FPAA 4F2GA 1TGYA 4GEKA 3TEFA 2R6CA 4G2NA 2ZJ4A 4ISBA 5SY6A 3ZD8A 3O2NA 2H07A 2QVLA 4Z7OB 1LJUA 1MJHA 2WAAA 4LY3A 4CR8A 3C45A 2HOQA 2ODWA 1BU8A 3B7PA 4YAUA 4UQOA 1MOPA 1RJ9B 4V2IA 3O91A 3HA5A 5B36A 5A9SB 3DPSA 1ZMRA 5FOTA 1B74A 1GKYA 1K7YA 3GJ8A 3N8HA 1YFZA 1XQYA 3OOSA 3TO5A 5C1OA 2EV9A 4MRAA 5CX4A 3AZQA 1KVRA 3PRYA 3QX8A 3QUQA 2X7XA 3IO5A 3HJNA 4IH4A 4MA0A 1T0JB 1D2NA 3HJAA 3D7SA 4O5OA 4OBWA 4UE6A 2HA7A 3UT0A 4C4ZA 4WNAA 4INZA 4ZIRB 1TO1E 4MX8A 2XJ9A 5LPNA 1RWKA 3O3CA 3BCHA 4OKSA 1KYIA 4L8FA 1KP2A 2BFDA 1ZGGA 4KVZA 5KOIA 3PIDA 2CLLB 2VPWA 5B7NA 2Q4EA 4OQMA 1U1EA 3T12A 5AK0A 4K81B 4JQZA 2XVYA 4N3GA 2Z98A 2ZU0C 5HXAA 1V5WA 1IBSA 4E2FA 3DO6A 3DT9A 1UXHA 2X76A 3C6YA 3VR2D 3VA7A 1GPBA 2QV0A 5TGDA 2IDMA 4O8ZA 4GMGA 1KYTA 3E22A 4D8UA 4EZIA 2GFQA 3UICA 2K4MA 3MGKA 2JLQA 2FOIA 1IPEA 2VUHB 4PRLA 4HH0A 5L4SA 5LD2C 3ZCSA 2X1HA 1JHZA 1XAJA 4PZ9A 5B3KA 2BFCB 4W7HA 4CKBA 3CUEF 2JGAA 2WFLB 5MN4A 1SQ5A 4YP7A 1H0RA 3UAZA 3HBFA 1ACJA 4ARZA 4UM9B 5B6JA 5AW4A 2DQYA 5GIPE 1SVOA 1AV6A 3R6DA 3WV4A 1XYGA 2HXYA 3JAKA 4UBKA 5KYYB 2ZYIA 2MYUA 4DG9A 2OUKA 1A9SA 1M2FA 1G2PA 5F33A 5P21A 1NUPA 1K68A 3CIOA 1UP6A 2RHLA 3DMPA 1SKAA 3DO8A 3EDRA 3PQ8A 1YRAA 4DLSA 2J45A 2O2SA 3OICA 3KWJA 2V9PA 3LZ6A 1RAHA 1X92A 2QR3A 1QZTA 3B2QA 4UEKA 2DHRA 4ZT6A 3UMRA 4EKEA 1EZZA 1LF5A 2EW1A 3OP4A 3AC0A 4JJAA 1NYQA 1J1ZA 3O9MA 5A1JA 5AYVA 2FPSA 2LKDA 4Q4LA 4PU0A 3RAGA 1DCTA 1GUDA 2RARA 1UP4A 4CT0A 4BQFA 4ZYYA 1O97C 3LGAA 3GLHE 3GWZA 3I05A 4O0LA 2XB4A 4DLKA 3ZS8A 1MN6A 3GT7A 3D4NA 3KVYA 3DEHA 1L6RA 4RS3A 5FPYA 1ZBQA 2J31A 2CVFA 3DDWA 4L75A 3GLTA 2I55A 1HFEL 3W4KA 1G21A 1QTQA 2WYIA 1GQRA 3QKIA 2XMBA 4MDHA 1CUUA 1FFYA 1ZM2A 4S2UA 1PW5A 4XM1A 3ZEAA 2HK7A 4MYDA 1OWOA 2JCVA 2V8BA 2X8BA 4Q4JA 1K5HA 1CR1A 1GLVA 5EHNA 1KJ9A 2P5SA 1DIGA 3AVOA 3H19A 1S2OA 1NLYA 2BFEB 1V4BA 1EFDN 3LPAA 4OHWA 4TZKA 2SICE 4PWZA 5EWJA 3ML1A 2RC6A 3CW2A 1KEVA 3GGDA 4G23A 5F1YA 3R9XA 4C3OB 2BRUC 4MB0A 2IA5A 4LXXA 1RACA 2H1CA 2H7VA 1B41A 5FTWA 3IKJA 4O4HF 1EVEA 3KE8A 4ODIA 1V5IA 2LTAA 2R6GA 3WMEA 1Z36A 4PFQA 3PF9A 5IBCA 5K4GA 5AHWA 4MDFA 1I5OA 2NU9B 1PT7A 2EJWA 1RAAA 2HY7A 2QSZA 3T3DA 3ZY3A 4KBGA 4NULA 4Y2SA 5AJTA 4UD6A 3D43A 3VU8A 5KC8A 1NYTA 4AF6A 5IAAA 1EUCB 5T67A 3TUZC 1JFTA 1E2EA 3WE7A 4XUCA 2GB4A 2HEGA 2M1ZA 2W6NA 1T9HA 3AV3A 4KRXA 5K4HA 4HPXB 3RU3A 3U3KA 3JAMA 3EF0A 3X1ZA 4PYLA 5IAEA 4CM8B 2HPVA 1E89A 2Q45A 5IXYA 2QJRA 2P7IA 3CEMA 1NRJB 1N2ZA 2ZIXB 1QK4A 1YJ8A 2BE7A 1XLVA 2GA9A 5JWRA 3BXXA 2A33A 2ATXA 1GQ2A 1YBAA 3N8DA 3QKTA 4H35A 4RC9A 5H9WA 4AUMA 4DV1B 1NMXA 4H15A 4MW0A 4NJOA 2QS9A 2FR8C 4UCXA 4Q19A 3KE9A 2AE2A 4M0DA 3BKXA 3I1YA 1KZHA 4ZOLF 1BJKA 1WEKA 4D8XA 2WUEA 2EFEB 1Y89A 3HNOA 3EODA 3IOCA 4PR0A 3HACA 2JLYA 1NVVQ 4ND8A 2A0KA 2FVYA 4DLZA 1C1DA 4R69A 5AK4A 1PFVA 3IV6A 4OGKA 3R0ZA 2QJTA 3KB1A 2FU5C 5D3KA 4X6UA 4CMEC 1AGXA 3OQIA 3Q7RA 3ZDAA 4BB6A 2PXAA 3VOSA 2V65A 3W5UA 1SURA 1PBTA 2R1VB 3RYFA 4FMDB 2O3RA 2D5BA 2CZQA 2YFYA 3VKWA 4W82A 1E1KA 4U7WA 4IWNA 4TQ9A 4LF7B 4ARBA 1K3TA 1QFMA 3HVIA 2VT6A 2QRGA 3A3OA 3H1AA 4FD3A 1M0WA 4IDPA 2VHXA 4J2HA 5CAEB 2TECE 5A7FA 3FPFA 4D92A 4F38A 1LQUA 1OYYA 1NW8A 3CV3A 2G1JA 2FCRA 4GGOA 5FNVB 5SZJA 3RS4A 2KM1A 1DBRA 5DHFA 2AOVA 3ESBA 3LLCA 4RY8A 4D8WA 3WWDA 5AKEA 1OQAA 2GN6A 3OOJA 3VSBA 3W9UA 5CFLA 2GLTA 1OC4A 2PD6A 1G3MA 1RW4A 5EJGA 2X0FA 1NRWA 1TJ5A 3VU9B 3ZKWB 4EKYA 1Z5VA 2VJYA 3F7MA 5IN4A 3AEKB 1RQXA 4QOJA 4F0JA 2HSDA 4C7OB 1W19A 3OZVA 1XQVA 2ZSDA 2R7LA 2XGOA 4L95C 3PBKA 2VZLA 2NO1A 3BZUA 3GFVA 1U0EA 1NBOA 3S6JA 1KPHA 2O0LA 16PKA 2IHVA 1IN8A 1WMSA 1XLTC 2FWJA 2JLSA 3M6IA 4ID9A 4UVDA 5AVKA 1DQPA 1XZQA 4KU4A 3EZ6A 4WZZA 5DLQC 5J43A 1CZOA 4CMEA 1Q1BA 1L5YA 2XB8A 1PEKE 2JI4A 4HK4A 3VGJA 3UMFA 1EIWA 4A16A 5AT1A 4MUNA 2J08A 4RMGA 5KAPA 3TSZA 5LBTA 3AYXB 4G5FA 4KFSA 4Q9IA 1P4SA 1JN0A 4NMLA 3UJHA 1C29B 5T3YA 3OZXA 2O7VA 5IDQA 1DEKA 4MVYA 2QORA 3FCEA 1EJ2A 1RE1A 1GL6A 3HDJA 1K8QA 4GPTA 4RD2A 1VBKA 4C29A 4CI0B 3QFRA 4D9IA 4Z6KA 2AMFA 2FEWB 3LRTA 3FDIA 5EWMB 1VLMA 2XKKA 2CLIB 1FLAA 3ISJA 1QWOA 3VOAA 4HHEA 1JFRA 2XQKA 3QK7A 4YT2A 3ANXA 4XLLA 3QVGB 4URVR 2GZDA 3ZDBA 1E5XA 2DWUA 3CRZA 4YAJA 4C0KA 4CJXA 2EFYA 2CNWD 5IASA 1QC5A 3BWEA 2IHTA 3RRYA 4EI8A 2BTOA 5K0LA 3CZ5A 3I72A 4BC1A 4U2DA 4EMUA 5B58C 1E3SA 4D79A 1A9TA 4EHKA 2Q5QA 5JANA 3NATA 2GF2A 1H69A 2ZFUA 4JLWA 1JV2B 1MXFA 1ZOOA 2W37A 4U2EA 4NDZA 4Y8VA 3TRKA 3MG9A 4U6SA 2I6TA 4WJZA 1Q0TA 3LDGA 2ZVPX 4P4LA 3BG5A 3UGKA 1DC8A 4L27A 4X7BA 2ENWA 4EDHA 1REQB 3P97A 2PH1A 3FROA 1SMKA 5EYPA 1BFUA 1N7JA 2WJIA 2OCPA 2FSGA 2WIJA 4KAAA 4BLRA 1CJMA 1FMLA 3OIGA 1ZINA 2AFIE 1HPLA 5KVSA 4PX5A 4X9XA 1O57A 2YJZA 4OLFA 1LPMA 1U8ZA 1VDMA 4TS1A 4J7CA 4IIFA 1QYWA 3I53A 4Q47A 4GT1A 4YACA 3KWLA 3FPSA 3I01M 2QG6A 3SFVA 3T9AA 3F3YA 3UO8B 4DIMA 4QATA 5HWSA 1NVGA 3RARA 3PCTA 3DTNA 4F4JA 1YC2A 1PCXA 3HKCB 2HA4A 4OQYA 4FCVA 4CMBA 2ZYSA 1STOA 2RGWA 1JGTA 2ZR0A 3OFND 3JV7A 5CLHA 4EGSA 3U26A 4BO0A 3B5JA 3DZIA 3FPGA 3MCZA 2VHVA 1E3DA 4JUIA 2XDYA 1FMTA 3VAAA 2PWPA 1X15A 1P9RA 3E8MA 2P62A 2FPUA 3K0AB 4ER3A 4XWKA 5KKNB 1M0EA 4EYOA 2OESA 3FWNA 5EE3A 4M9XA 5HZKA 3MGGA 1QH0A 1LK5A 2A9KA 1GZSA 2LP4Y 1XWFA 5KU1A 1TADA 5DI9A 2WU4A 3TBFA 1QKIA 3WHIA 5HOEA 2AKEA 2R8PA 3PEFA 3M6VA 4DNPA 4EFKA 2QJWA 5KX5F 2ODPA 4OYRA 1T5SA 3UB4A 4C87A 3H83A 4ND3A 4IVNA 1DOZA 2WNIA 2YOGA 4ENWA 2ZXEA 5A6VA 3DEAA 1O0CA 4TSRA 4EPYA 1AZSC 5FNVF 3HUUA 2OQVA 5LWQA 3OY2A 3R5JA 3ZJUA 1HK7A 3PQCA 2XWPA 2FPRA 3JARB 2Z8XA 4OM7A 1GFZA 4UUBA 1JQ3A 1G9SA 3GLUA 4NEGA 4YRPA 3RM3A 5BP7A 4Q9HA 1X9GA 3ZZ0A 1KIFA 4MCAA 2EZTA 4C4SA 1IM8A 3EPJA 2WHYA 1JU9A 1RTKA 3Q3JB 2O5RA 4PLHA 5JNSA 3O84A 3R44A 3WYEA 3CW9A 1DEAA 5KNCA 3RC8A 4GC9A 4C3UA 3KHTA 5ECYA 4G63A 4C4PA 3PXDA 4HQKA 2DZDA 1QZ3A 4GBJA 4GS5A 4FYPA 2CUZA 3SZOA 3U3OA 3SS8A 1N4AA 1SB9A 4MYCA 2P5TB 3NCHA 1DWPA 2B0JA 3OY7A 4IBOA 1GLNA 2BV3A 3ZS9A 3HUFA 3KTFA 2V7GA 3GYGA 5IM4A 3FCAA 5DLEA 1TO2E 1EXWA 3C1OA 2NUBA 2ZATA 1CR4A 1J2RA 2PZAA 2GK7A 2QR5A 4ZYZA 4UDOA 3B1VA 2A0FA 2D3WA 4A0GA 3UTDA 5I3ZA 5L95A 1Q19A 2ZJ1A 3OJLA 4Q02A 4OHPA 1QIEA 4ER5A 5JXJA 2FQXA 4HBZA 4M9ZA 2QRVA 4WFJA 1U8AA 1S2NA 4P5DA 3H2YA 1EU1A 5TVKA 4MJLA 2VNKA 2F43B 4GEGA 1ONNA 2OAEA 3BA1A 1V4VA 3BX1A 3L6DA 1U1FA 1AIPA 3WIUA 1ZMTA 3KJXA 4XWYA 2VZ8A 1I3NA 1LTHR 2EKBA 3NP7A 4WXMA 3M2TA 4TTSA 4DA4A 4KYUA 1AOXA 3L1IA 5FTLA 2RAUA 4EPTA 3M6MD 2QAJA 4HNVA 1UADA 4LSGA 4E13A 2I3AA 1WDMA 1W0KD 2P4QA 1PX2A 2V6MA 3GZNB 4FCTA 4NFSA 4C21A 5EJ7A 4FMDF 3CJRA 3NYQA 1Y6FA 3NHFA 1CUAA 3BORA 3RYTC 4IKPA 1AZWA 1KAQA 1IWPB 3TNYA 1HE3A 2ZRCA 4NP6A 3WC4A 4D9CA 2PUGA 3M6WA 1CF9A 5TGZA 4PANA 3NOVA 4JOQA 2ZYDA 4EHHA 1XRQA 3B9QA 4XPZA 4AMGA 2XBMA 5AW9A 2EFJA 2XODA 3CY6A 3I2GA 1PK8A 4HLUC 5EHIA 5EIFA 4BLVA 4CLEA 3BBLA 1QKJA 2ZJBA 2GGSA 4YMIA 3QMVA 3CF0A 4QLAA 2PL3A 4X0EA 3D3EA 4HG2A 3D1JA 5FBQB 1OLUB 2WD7B 3CPHA 2IPNA 5ABPA 1MP0A 3DVRX 1LS1A 2RGCA 4BNDB 4BECA 5ALUA 3CBGA 1ZD9A 2W4QA 3DMDA 5IH7A 1BOFA 5BR8B 3RUIA 3I34X 3MTDA 4LZZA 1Q17A 1ZXXA 4NMHA 1YJ5A 4YGXB 3L5OA 1QFJA 3U13A 2YNMD 5ECDA 1DJPA 2PJRA 4HAYA 3ESXA 4WA8A 2YS6A 5E4FA 3HL4A 2Z0MA 1W5BA 2IDKA 4G1MB 4TYPA 2GJ9A 4B0OA 1NJSA 4Z86A 2E5FA 2ZBRA 3L0CA 3JPWA 4E4RA 3PQ5A 4I8IA 4YIKA 4FW8A 3DFUA 3GG2A 3U4IA 3SYMA 2Y1FA 4QXQA 3T0IA 2XBLA 2XUJA 5HQJA 3SBOA 4RJLA 1QQBA 2IELA 5ALSA 2PPLA 1VSQA 5IVHA 4KQ2A 1DIBA 3GPDG 4QPDA 1U0NA 3EXG1 1W0JD 3B6EA 3F5DA 3QG1A 4LXIA 1YVUA 4RDCA 5E6UA 2A67A 3GJ0A 4ZANA 1ULTA 3WK9A 4ALKA 3THOA 4C78A 1FQJA 3MTBA 5HUQA 1XPRA 5EJ8A 1NNSA 3GI1A 3RYIB 3TM5A 3KBBA 1RCFA 1IFXA 4LE2A 5EIHA 4Q4JB 2XCTB 3H1PA 2QPOA 3F96A 3KZOA 3U7RA 4UZEA 3D7NA 5AI9A 2JFVA 1RFGE 2DY0A 3SM3A 2FPIA 1J99A 5K0BA 2OQRA 4EPVA 5EWJB 4R2KA 1W2GA 1PR3A 3ZE7A 1MO2A 4BNVA 5I7FA 3DDCA 1D2GA 2FI1A 1RRKA 5M5BA 4Q66C 2VWQA 3P9IA 3UHFA 3H8VA 3JY6A 3ZLBA 2IHZA 4FCCA 5K3SA 3T7TA 4C0SA 4PZUA 1QR6A 4I3FA 2Z2ZA 3U4DA 4F85A 3ZV4A 3F3KA 4DMGA 3MVEA 3JXEA 5FUXA 5F64A 1T3ZA 3GFFA 1YA8A 3GHHA 2CNWA 3WRWA 1PHPA 1LDNA 2JBWA 4EX6A 1NWCA 2UUOA 3TZHA 3WKCA 3RUFA 2IZ6A 2Q8PA 3EPRA 2N1BA 2WPDA 3AEXA 2NSLA 3OIUA 1EP2B 3EW7A 4MW9A 2XT6A 4MR7A 3BGVA 3GLSA 1PAUA 4EABA 1T4MA 1RRFA 3MS2A 1N3LA 2ERYA 3W0LB 2YHUA 3K0CA 4BVEA 3RG2A 1A7KA 3DTVD 1R5OA 5L53A 5MN6A 5BV8A 3KKNA 1OXBB 3E9CA 1VP9A 2NO0A 1MAUA 3OPNA 1JPVA 4RKQA 4WOPA 4ARCA 4HZIA 1RI5A 1TEXA 1J9GA 4A1FA 3D2BA 4QZVA 2JLWA 1IN1A 3H2SA 3UJAA 3HE3A 3UMGA 1PIWA 4JUAA 4HVLA 3WK5A 4RZUA 4JDPA 4WBNA 3OQOA 1O77A 1Y3FE 4G8CA 1H8HD 2ZB4A 1GL3A 2BEUB 1K0UA 5CJPA 1UPTA 4BVGA 4QXOA 1C7JA 3DF7A 3BSSA 4AZ0A 3IKTA 4GRAA 3AI1A 3HMQA 1ONBA 3D5EA 3L77A 3P9SA 4CT4B 3SDZA 1PGQA 1FFBA 1S89A 4HFNA 1SUAA 3OT4A 4RMIA 5CT4A 1F5NA 1G19A 4K1LA 1HI9A 2DKOA 4Q1CA 5DTEA 1IG3A 2WJPA 4FQ7A 1B15A 4AMYA 1DUIA 1M8FA 2E9SA 2FFQA 2XCIA 3RRNA 3ZQUA 3RANA 5AXBA 1KZGB 1UZLA 3UPTA 2WI8A 2R751 4G41A 1XZKA 1XVVA 1ECBA 1EG2A 3L0DA 4IQGA 4Q39A 1NFFA 4AJIA 3D7KA 4DBVO 4Q7QA 5CA0F 5DB4A 2XUKA 2QENA 2NO4A 1DC3A 4X1KB 5AIAA 3OTOB 1FX0A 1DRKA 1WS6A 5AM5A 5BUSA 4JVOA 1NBHA 2IU0A 1V9LA 2OCXA 1JJVA 1HYQA 5A2GA 1EKXA 1PT5A 4HXFB 4Q4AA 2YHAA 4YYZA 1IUPA 1G42A 3P5BA 2W6OA 4GR4A 3TWOA 2YOFA 1YOVA 4B76A 1XLUA 3UJBA 2CW5A 4CEHB 1T9GS 1VJGA 2BW0A 2HNAA 2FW6A 2X3UA 4TZTA 2RGXA 4EO4A 3MLEA 3HKBA 1KQFA 1L7RA 1FFHA 1ZHFA 2BKUA 1O54A 2QZSA 3AHFA 2JI7A 3F8SA 3M49A 5HG0A 1E6WA 1BEEA 1PL8A 1GIAA 1V7ZA 3O31A 4WACA 3SXUA 3G6KA 4RLSA 1R74A 2J4DA 3UMCA 1K3FA 3ZBQA 4YRZA 3AUTA 1RVV1 4WESB 1OB2A 3FNQA 3GA0A 3UT6A 1QO7A 2JFGA 2O2YA 3OUTA 2O2GA 5JSQA 2DHQA 5LWHA 4S3MA 1Q1GA 3M6LA 3WYBA 4TGLA 4AZVA 3WB0A 3PJRA 3KYBA 4UNPA 3EH2A 4TVKA 4BZXA 4DIEA 3B12A 3CWCA 3DG9A 1NDHA 2B3DA 4N65A 1QK3A 5JCXA 2YHIA 2DGDA 3GRAA 1BW9B 1XJ5A 5GOZA 3TX6A 1TZCA 5K3CA 3VYWA 1NBMD 2C78A 4BO5A 4DMCA 5GAJA 4EUKA 1DDOA 3DS8A 2TMGA 7ADHA 4CW7A 1SCKA 4U0KA 3DOCA 1NBIA 5C5IA 2IE8A 4PG4A 3RI3A 2OZLB 2ZCVA 3OLQA 3OEHA 3JQ9A 2XMCA 1P5FA 1ZD1A 2HRZA 2I7TA 3DQPA 4JS0A 5FL3A 4BN5A 2V3VA 3H5OA 1HOXA 2B4QA 2BR3A 4PIVA 3IDAA 4OSEA 3THRA 3BYZA 3DWGA 1I4EB 1OZAA 4JR0A 2WIBA 5GY7A 4AZTA 4E4YA 4EY7A 4NHOA 1BQ3A 4BQQA 4R81A 4LW8A 3OVMA 4JELA 1WA5A 2B21A 1I3OA 3H2HA 6NULA 1ZRMA 1E60A 4OAPA 5JYBA 3I28A 4CN8A 4CIBA 3DDZX 4QPPA 4TWJA 4X44A 3S68A 1O6ZA 1L5SA 3B38A 4LQLA 3A4YA 1IB0A 1E61A 4NENB 2GEKA 3WAKA 2GCEA 3WHPA 1K06A 4IRUB 2ZRJA 3AG5A 5DNAA 4J1NA 4Q0MA 4QUBA 2ZUWA 3LFUA 2RBKA 3USES 5KQSA 2GKOA 3D2AA 3PFKA 4CQJA 3DAHA 2IWRA 1L5WA 2F8SA 1Q21A 1LPAB 2HYDA 4BVFA 4JAVC 4LWOA 4ZXPA 1FU8A 2CK3A 3ZCPA 3SXPA 3JQAD 1YBVA 1JWLA 3SIWA 1CF2O 1ZSYA 3IVAA 4Y1GA 3II6X 4FHZA 4J75A 3SQOA 4OHRA 4XCXA 3HABA 3OE4A 1QHXA 2ZUBA 1CKEA 2JW5A 3U0VA 5FYQA 1KZ4A 4DJJA 3VU0A 4KFTA 1BMTA 4M0FA 3DT6A 3T5AA 3ZUPA 2W4IA 4XA8A 5LQJA 4RQAA 2XTJA 2WJZB 3I1JA 4H4EA 4JBIA 3E03A 1XYVA 4JROA 3P26A 4IEIA 4WMLA 1OA0A 5C34B 1C30A 1QCYA 3CN7A 5U1PA 5K03A 4LF9B 4MCJA 3EMVA 4CM3A 3Q7TA 3V55A 4DIKA 2GHRA 2VP6A 3JD1A 4BEWA 1GPNA 3ZDQA 3BMCA 3PRKE 1BG6A 4GI7A 4XIFA 2QPAA 3A1VA 1AS2A 3CX3A 4LTNA 4JXKA 3TLYA 5DYYA 5LMUB 4EHJA 3RSQA 1ESZA 4B7ZA 3SM9A 4EAQA 4EJSB 3H86A 3ELDA 1OROA 2IZOA 3SHTA 4FXOA 1OYVA 4QTXA 1NQTA 3ZKAA 2PUAA 2OHGA 4Q4DA 1RABA 3IVGA 3ZDFA 1ST2A 1D2RA 1NVUQ 2Z9DA 3Q11A 1JDNA 1G5RA 2FPIB 1MO4A 1ZJ6A 3NKVA 5B57C 1BMFA 1GZVA 4CL0A 3UWOA 2HZ7A 2VT2A 2Q1XA 3GUUA 3OPMA 4LNUA 4ZZ1A 4QA9A 3RIXA 4MULA 2PQ2A 4ZO6A 1NTRA 2ZI5A 1QG0A 3K6SA 1A2KC 2AFIA 1LDBA 3H18A 3HJUA 3PXCX 3PJEA 1O2DA 1U0TA 1IRXA 2P0YA 2QXYA 4JX8A 5FD8A 4RA6A 2WHXA 2W8ZA 3JVDA 3TMKA 3PEWA 2QQEA 3RFVA 4N5IX 2JJ1A 2FKNA 4HTFB 4M0UA 4WY2A 1U8TA 4IV8A 5KTPA 2BM9A 3GLIB 1KQOA 2JJMA 2PGDA 4JA0A 3WYNA 4R0NA 1L1EA 1U0FA 2XF8A 3DOOA 1G3IA 5ECGC 2YUIA 4J7UA 1JEYB 3E7DA 2PMDA 4ZYWA 5EJ6A 3BMNB 3A6FA 4L85A 5E7QA 2FWIA 3MUOA 1JDTA 1LDEA 3RSSA 4Q6WA 3TINA 4YRBA 2QJOA 3ND5A 4OREX 4OUKX 3U19A 1GPUA 1FRFS 5FQOA 1CJVC 5TMEA 4MV7A 4Y0NA 4BGDA 3GARA 1N5LA 4Q03A 4UHEA 3S7ZA 4FGWA 4OF4A 3GFQA 1MH9A 2FQ1A 3LIIA 1VL8A 3HUTA 5G4LA 4UTPA 1JR6A 4JB2A 3EAFA 4BBAA 2P78A 3P2IA 3L8FA 1SA0B 4X7PA 1R18A 1Z4MA 2FHSA 4ZO4A 2BBOA 2GDZA 1SUDA 2W9XA 4F92B 2G4VA 2XE4A 4LJKA 3HXPA 2XYRA 4R7TA 3T3PB 2AW5A 2HREA 2WQZA 1NZFA 3KL4A 4FS3A 2HSGA 4X66B 2GAIA 3K8QA 3KDSE 1N6RA 1C0EA 1F48A 4DVJA 2E5LB 1SELA 4WZBB 3ZI4A 3ZE6A 4TPKA 5LBIA 1N6OA 3E1SA 4ENVA 2VWPA 3C6ZA 1OGIA 4CTMA 4ANFA 1TMKA 4HAOA 4I50A 4QEKA 1EZ1A 1RYMA 1RTTA 2ZSJA 4JEUA 2H5EA 2WSBA 1G6OA 4IJWA 3WB9A 4E5UA 1EM8B 1UJBA 3HJRA 3PPIA 2G4CA 3PNLA 4YJ2F 3SICE 1T9ZA 1AA6A 3LP8A 3OZUA 2AMYA 3FDZA 3VR5D 1FFSA 1T35A 1XLTA 4N47A 5DWQA 5IC4A 1P4RA 3VPBA 2JZOA 4J4HA 5E3HA 3ENZA 4ZK2A 4RJKA 1CFZA 3QVKA 4HY3A 4BWFB 3S1SA 3K0CC 2EW2A 4A1OA 4O4LA 2PGOA 2Q8NA 4QYMA 1P77A 5KBYA 1QNFA 4FFSA 3COVA 4DV3B 2FLVA 3N2NA 1KMNA 1N9GB 1GL9B 3QLUA 2CVOA 4TMZA 4RABA 1A8UA 3U1TA 1QO0A 1SNYA 2H9YA 4JB0A 1ADCA 1B0AA 2J1LA 4HDCA 4JLAA 3VC3A 1B3BA 3ZIAA 5DHAA 3PXEA 3WL4A 1JKXA 1KSHA 4UU0A 2WAOA 2ZI3A 2WHEA 3FTFA 4JGGA 3ZWXA 5H0IA 3TPZA 2Z6AA 5CGZA 1OYOA 2D7JA 1T9DA 3CX7A 4DNOA 4TWRA 4EUFA 1Q1NA 1GFSA 1JR3E 1WP9A 4LHSA 3SFZA 4HNAA 1TJNA 4XWGA 2FYTA 4QL3A 2IXBA 2RBGA 5KYGA 4PQEA 3AY0A 5C8DA 1TLLA 2PKEA 3VU3A 3TXYA 1QGUA 2IUUA 3MXTA 3ICWA 5F7JA 2B8JA 3PDUA 2VDRB 1OAOA 4E94A 1BRMA 5KCZA 3NYWA 4PC2A 4OO3A 4Z1MA 1XPJA 1SR8A 3IJ5A 3G0DA 4OK3A 1W25A 5FIUA 2DWCA 3UH1A 4DJ5X 3IE1A 2BTEA 3R3YA 4OL9A 4MWBA 1J22A 2PRSA 4YONB 4NFHA 3G1UA 2WQ7A 1Q0UA 1H9CA 3FNIA 4L74A 4X63A 3IP8A 3U62A 3UV6A 1HKHA 2BGRA 1S3FA 3EB9A 4FGJA 3TSCA 4AYWA 3EJWA 4GQBA 1AKRA 2PSFA 2BJWA 2BELA 2ZOSA 1SZPA 2ZIWB 3NR2A 5DBGA 2WOJA 2FJUA 4GVXA 3UVEA 4WE3A 1F8XA 3SC4A 3E1GA 4KPEC 3T38A 1GKIA 1K5DA 2JLVA 2G0NA 4REQB 3U3RA 4Y9SA 1NW5A 2GZRA 4BBZA 1QRTA 3WK7A 4MR9A 3IVRA 4Z8YA 1X8XA 2QVXX 3HWSA 1SAYA 4KE9A 1Z5OA 1O0SA 3E61A 3Q9SA 2JPDA 3IAFA 3FTEA 5IJ0B 5CURA 3WGHA 2PLWA 3HXQA 4ND2A 4I46A 5U9CA 1WO8A 2CXHA 3HR8A 3I9NA 1U1DA 4EM6A 2Q2OA 1LVHA 3OZCA 4C7MA 4EGJA 4A73A 4FZ3A 3ZWPA 3ORFA 4PZPA 5AJYA 1ZXBA 5TJ9A 5K9ZA 4KE6A 1AGNA 4BFWA 3ZXXA 5F78A 4FN5A 4BNUA 2NT4A 5K2OA 1FFXB 4TLCA 1MV8A 1PZHA 2HXSA 2P2GA 3COWA 3T06B 3EGVA 3D8HA 1J8VA 1K8YB 4YAIA 5TQ0A 4YT4A 1RVDA 5BORA 2JB9A 3VYUB 5HIJA 7GPBA 2FUG1 3OC6A 3VDXA 3AETA 1A1SA 3FI0A 3FRJA 1PP4A 5FI3A 1PLKA 2Q28A 5ALFA 1H4QA 1SXIA 2EZUA 1NVTA 4I50F 5CX1A 3KQTA 1Q6YA 4NZ9A 3C0KA 3DZFA 1KKLA 1DIRA 1ZAKA 2HHAA 1OAKA 3OFVA 4G4SO 2FGJA 1Y34E 4HAZA 3PFIA 5HMMA 2H4YA 4QSHA 1QIDA 3A26A 3C85A 3CNQS 4WK4B 1WCWA 4GWKA 2PL5A 4WFQA 3I42A 1NWHA 4BS9A 1IK4A 2XT9A 4NQRA 1I24A 3EHEA 4AY3A 4YTEA 5CFQA 3U9LA 1VLHA 4ND4A 4ARUA 2QQ0A 1SIOA 4D9MA 1CCWA 4J94A 3C3CA 4FOOA 3OSZA 3JQPA 4J49A 4K9KA 1GUZA 1EDEA 2LIPA 3HKEB 4CCWA 1QB8A 1EUZA 1I10A 2PCJA 1WETA 4B3BA 2ZE8A 3GJQA 1ZISA 2OWDA 3GRRA 4NBTA 5ERYA 4BAUA 1FDTA 2VF8A 9LDBA 2QYTA 3UUWA 3NFRA 2ESRA 4CUJA 2AXQA 1XRRA 3A1SA 4V0OA 3ZZTA 4POOA 1ZI6A 4M1QA 3O8BA 4UZFA 4DPMA 4RA6B 3CKMA 4B83A 1G5HA 4MA4A 2VL7A 2D2IA 1U2GA 2R86A 1GR0A 2HMVA 2QU7A 3GLVA 1T3LA 2R1ZA 4FW9A 3FSEA 5F23A 2OD9A 5IH3A 3ZGXA 5BN5B 1HTWA 1KO4A 4MUBA 4FJ2A 5F2EA 3RYFB 2MMGA 7MDHA 5BVHB 3PU6A 3TNLA 2VJAA 1XU4A 1EVZA 5AXAA 4FFWA 3MB8A 1UQUA 2JVKA 1YONA 2W00A 3NHKA 5HSGA 5JH7A 2QLLA 4PCUA 2C3YA 4DSTA 1QQ7A 4Y2VA 4ZO8A 3D0QA 4BCBA 4RL4A 2IPLA 4KGZA 3LO8A 4FNAA 2W6QA 3O95A 1AQ6A 3W1WA 4X64B 2LCFA 5JXHA 5L3QB 4C08A 5BSMA 4FSDA 4BQSA 3PUHA 4QICA 4CMIA 3IAM1 4G5HA 1HDXA 1U7DA 2I1WA 1JG3A 2L0XA 1JYFA 4IR7A 4UFOA 3TJZA 4AN4A 3UBMA 1GKKA 3LV8A 4I5EA 1T43A 3PE6A 4OI1A 4DA0A 1ZPDA 3CKKA 3X0DA 4P4SA 1JI0A 1O3YA 2DEUA 3SYLA 3CZ9A 3THYB 1LF0A 1EUCA 1GG9A 3ZH9B 4HO1X 1KBOA 3W9BA 4TXNA 2Y1XA 1LX6A 4AYXA 3KIPA 1CD5A 2FFBA 1WMBA 3FCXA 3VAZA 3W1VA 4L6AA 2ZWAA 3LE8A 4KAFA 5INTA 2JFYA 3P9QA 1R6XA 1ECFA 2Z2KA 3IE0A 1KJQA 1DBPA 1JDJA 1M8PA 3MYRA 3OM1A 3UJPA 2FPOA 1J5PA 5FL7A 5G0VA 5KTSA 5LOVF 1NOJA 3DW1X 3ET4A 3C3MA 4EW1A 1I5EA 4GOJA 3P9CA 3R7DA 2RAPA 1CIJA 4EQZA 1JAHA 4IYRA 3ZE9A 2JNWA 3DF9A 3GMIA 1JHPA 4MA5A 4KDEA 5DN6D 3B1YA 4QTZA 1GG5A 3UGJA 5AVYA 1VB5A 3FUUA 1G8JA 3HLYA 3E7FA 5AVXA 3IEMA 2GNOA 2CF5A 3KPVA 4Y9UA 1BE1A 4TMKA 5JLAA 5EMMA 1C9NA 1NMYA 1XTQA 2OZVA 2EAUA 3CLUC 1WXWA 2MSCB 5KJFA 4G8BA 1K08A 5F7ZA 4E6EA 3R9WA 3T61A 2BGJA 1M2GA 2O8FA 5CHYA 4YWHA 4ABYA 4OI0A 3HY3A 2QZJA 5JAPA 3QVSA 4OD0A 1LI5A 1RHKA 2QM8A 2VHEA 3A3NA 3INTA 4GGPA 4RAQA 4WK2B 4CIDA 4D6XA 5B7QA 1IY0A 5FLXA 4Q1DA 5BR4A 5KNDA 4RVSA 3ISTA 2IYFA 4QOGA 2P4UA 3HPRA 4QVIA 1A1VA 3KZ1E 3W5IA 1C30B 3PXAA 2WY2D 2QW1A 4PGAA 4KZPA 5ICMA 3G3EA 3GX1A 4WOBA 5JFTA 4ENTA 1RXIA 4LA4A 3ZPXA 9GPBA 1M10A 4CM9A 1NBMA 1KYZA 2Z57A 1R8SA 1ZJJA 2BSXA 4C3VA 2GPSA 1Y3BE 3NHMA 3RC3A 3ZXSA 1I7PA 3NGMA 4XW2A 4CCSA 4CIVA 4O08A 5F9FA 1Z15A 2Y1GA 3I0ZA 3I5AA 4I6EA 4I4CA 2QMEA 3ZWMA 5DNUA 1HR0B 3PZBA 4NJMB 3BXHA 1W4RA 2G4LA 5HE9A 4FSXA 5FHRA 2ZJFA 3MHTA 3E3NA 5FO1A 1K4KA 1UC5B 4E3ZA 3IEUA 4FFOA 2JBHA 2NO7A 2VSFA 1HFWA 2QN7A 4PAGA 4X1OA 4DIUA 1EGAA 2AKAB 1LW7A 1GG2A 2DR0A 3MWFA 4RPGA 1PJLA 5LP6A 4O59O 4DREA 3ZDXB 2V4UA 1OZ0A 2XCOA 2WG2A 2IYOA 2Y1CA 1FRVA 4KTVE 1DUVG 1QLHA 3NTRA 2PX8A 3DMYA 1ECLA 1LVUA 1RPJA 3LOUA 5TGTA 4FMCB 2YRXA 3A1EA 1EZ4A 5K4AA 5BXYA 1UK6A 2IXFA 3KQYA 3OWHA 5ITSA 4EJSC 1H9AA 1ZD4A 3WLJA 5PGMA 4EVIA 3KT6A 2D1RA 2NT3A 1PJTA 4P31A 4LRWA 4RA9B 3ZQ6A 1QE0A 1U3DA 1XTIA 3IUPA 4M98A 5B5SA 5CFZA 2AJTA 1CX9B 2UU9B 1MO5A 4UNRA 4YFVA 5TQJA 1F4PA 3VNAA 2VQ6A 1NBEA 3UAYA 4BNDA 4DABA 1OAOC 2IXEA 3D8UA 2X0EA 5DNDA 3VZBA 4HEHA 4I55F 4BNFA 4BO1A 3ZDZB 2OV3A 3P94A 1LRJA 2B37A 3H97A 4K6OA 1E9DA 4LMBA 3BOSA 4NAUA 4EG3A 1ZP6A 1MAWA 2ACEA 1OBFO 3CHYA 1YV9A 1TYCA 3FPKA 4FDUA 5DHQA 4QT4A 3C5WP 5GZ1A 2PSEA 5FJJA 2IUYA 3AIKA 2F55A 1UMKA 4MRPA 2X1VA 2AQIA 1C1DB 1DEOA 1Y9DA 1Z26A 1ENOA 5FAKA 1E6CA 2PT5A 3L05A 2X14A 2WF8A 1RBQA 1LV8A 2YINC 4P53A 1C7RA 2XZDA 1Z68A 4KXWA 4ZI7A 1IYZA 2V59A 1XA3A 3K4QA 3OZIA 3ZC3A 1CJSA 3K9QO 3FOAA 1NUTA 4UU8A 2VWHA 1R5NA 4PPFA 4K2AA 3HBNA 2EXXA 1DMRA 4RGQA 2H0QA 2GN2A 3RSLA 1PGJA 5GQSA 3QKRA 5EEGA 5CNKA 2XUPA 1Y1QA 3K30A 1H0HA 4TQGA 4MVJD 4XIJA 2K7FA 3G7SA 3JQGB 2J3KA 2WMDA 4G4GA 4KQCA 4ZT7A 1QH1B 3GPCA 4HRXA 4KPUB 5DLYA 1FFCA 3GB9A 4GO1A 4E51A 4JI7B 4LJSA 5CA1A 2IYLD 3JTMA 5CH3A 5CPBA 4ZI5A 3V3TA 3N8KA 4MUFA 4MQFB 1M2JA 2FP4B 1E59A 3OF2A 1R50A 1HG1A 2AEJA 2V03A 2WHPB 4ND5A 2G08A 1J4AA 3R9KA 3GJXC 1VFPA 2V0CA 3VTAA 4EGCB 1CIPA 3FCYA 3P9PA 2NVUA 2I8CA 3PB3A 1ZWLA 4OL0A 4RSGA 1XCGB 3FI9A 3NUGA 5EIAA 4KQFA 2ZUCA 2BGLA 5JARA 2IHBA 4D99A 1D03A 1Z4NA 1GQSA 2DBRA 4PLGA 2C4MA 4G4JA 2QSUA 3OJ0A 2XUDA 3PP8A 1GJRA 5ESXA 1N5KA 4GGMX 1ZH0A 3V46A 2DHDA 5ENVA 3I6BA 1KPGA 2QPLA 2REOA 2YVAA 2QMOA 4COKA 1X8LA 4OA5A 2FN4A 3HCPA 3MCTA 4UD2A 4MWCA 2X6QA 5ALGA 2I2DA 1SVUA 5AKGA 1UT8A 4V0QA 4CGYA 1CY1A 1HT3A 4QRHA 3V8EA 2X19A 4ZGBA 4NE9A 2QBYA 1E64A 2AJLI 4ZQEA 3JYOA 2C59A 5KC9A 2KMLA 4GZ3A 4C7OA 2RCNA 1ZCBA 3DBIA 3C3PA 1FQKA 3FDFA 1FRZA 2UVDA 4I1YA 4QQRA 4DZZA 2W6IA 5FUVA 1T8WA 2O3SA 4I14A 1J39A 1JXMA 3R0XA 2H1LA 4DNFA 1MA3A 4FINA 1CE8A 3MTJA 5C4MA 2WM2A 5EFOA 2A58A 4D9BA 2YN0A 2WF9A 2O8FB 3AWDA 1P5JA 4I7EA 4C22A 3SPXA 4ZKEA 2XRFA 3DHYA 3VKHA 4A0HA 2DJIA 2HCJB 5JS2A 1KZ7B 3SOPA 3C15C 8AT1A 1OH6A 4MZDA 4B3RB 3D1LA 1OX4B 3LX8A 5IZCC 4G09A 1DQRA 5F5NA 4B5LA 4YMWA 3E3AA 1M2VA 1QV6A 1UDCA 2QAGA 4JJGA 3IQXA 5EMJA 2RHCA 3F5SA 3O6VA 4GOMD 4J90A 4ZRNA 4E2WA 2DQ4A 2G1AA 2FJPA 3P5SA 3RHZA 1E3JA 5ALQA 4A23A 4DC0A 1PS9A 3CIFA 1TRHA 3COYA 1W46A 4F97A 3H1EA 4UBLA 3OJWA 4D9KA 2XYPA 2F43A 3P4UA 5CB0A 1KP9A 3REGA 2IVFA 4BUZA 3FVRA 1M0TA 3DDUA 4YDSA 2BCJQ 1E2GA 1G41A 3HCCA 5E6SA 5E2BA 3ZBUA 1QYXA 3GGJA 1XZGA 2CVQA 1D1QA 3EQ9A 3L1HA 1N6NA 2EKPA 4H31A 2OZKA 1DARA 2BONA 1JQLB 2N47A 4PPGA 3TZKA 4ASUD 1KOJA 4CKEB 3NETA 2Q6TA 2GPAA 4R98A 5HE8A 3FCOA 5BN3A 3V1YA 2RH5A 4W9NC 3K09C 3QVJA 3RRFA 4II7A 4DIDA 4HV4A 2I4MA 1UZNA 1T1IA 1YJQA 1QQTA 1SCIA 5L9AA 4IHKA 4Q3OA 3QELB 5I9LA 4DYVA 4AY2A 3ZHOA 4L8LA 3IJRA 4BPBA 1MLDA 1G5TA 1KJIA 1NLMA 4Q3NA 3W5SA 3I1IA 4TUYA 5JMOA 4TSFA 5EWLA 4G5GA 1Q92A 2YVUA 4HB4A 5ELLA 1V7QA 4DLRA 4E15A 1T2FA 4KXVA 1OLUA 2WD7A 2ZRDA 3NDPA 1G2OA 4WNCA 1YDEA 3K72B 1NM5C 1PYOA 4XAQA 5DBHX 2R1TB 4TZ6A 3DBRB 1HZZA 1PS8A 1U94A 1Z5PA 4H1WA 4FDMA 2EG9A 2PANA 5T4BA 1T5LA 3N39C 5HKOA 1F12A 2AMVA 1ZJ5A 2OV4A 2JD1A 2E1RA 3K6RA 1D6JA 3QG5A 4IUDS 4N40A 5G41A 4I3GA 4A2QA 1WHTA 4W9NA 4BE9A 3C2QA 1PLLA 2X0DA 5ERXA 3Q5DA 1H2FA 4IF4A 3W6OA 3ZGOA 5HX7A 2PYIA 3X2FA 1N1GA 5EJAA 3SLGA 3G85A 2HU2A 2C4NA 2DR3A 1VDZA 5BOSB 2YYZA 3PGXA 1N2XA 4MS1B 4A4DA 4IIEA 2CN1A 3AF0A 1IZ0A 2KS6A 3PFWO 3TN7A 5A02A 4DOMA 3V7FA 3QXSA 5C53B 2O0HA 3OQ6A 1SHUX 4O2BA 4DV5B 2PGJA 2B92A 1PGPA 1TCAA 2CL7X 4LQCA 3DQQA 3TBHA 3TNFA 3RBVA 4AUKA 3PYMA 3THSA 4C2BA 1E66A 3SN6A 2AH5A 2QVYX 3FIJA 3PEEA 4Z9AA 1MNAA 3KSDO 3TIGA 1GT91 2VDWB 1C8BA 1RMTA 3E5MA 3FGPA 4EB8A 3H8SA 3OHSX 3TQRA 4KSCA 4CHGA 1N5OX 1TL7C 4O0MA 1WUTA 2BZ1A 3JYPA 3NTOA 3TLXA 3RYCA 5A06A 4KWEA 1A9RA 3GCGA 3OP1A 2OFXA 1QJCA