4YASA

Hydroxynitrile lyase complexed with chloralhydrate
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
256
structure length
256
Chain Sequence
AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHKLQLTKTKEIAEILQEVADTYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (HYDROXYNITRILE LYASE)
publication title Three-dimensional structures of enzyme-substrate complexes of the hydroxynitrile lyase from Hevea brasiliensis.
pubmed rcsb
source organism Hevea brasiliensis
molecule tags Lyase
total genus 94
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 1999-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4yasA00
4LYDA 3SX4A 5A6VA 1HKHA 3AZOA 3ESDA 2XUGA 4F0JA 1CUSA 1VKHA 4L9AA 3STXA 1AGYA 4UFNA 5ALPA 4F60A 2WU4A 4G1FA 1U8EA 4H7IA 3H1BA 1QO9A 3SWWA 2C5GA 1TCBA 3B5EA 3E1GA 1JT2A 3OURA 1VXOA 4KE6A 5AI6A 4Y2YA 5AO9A 2HA5A 4D9JA 5JZ9A 3I2HA 5E4JA 1K63A 4GI1A 1F0PA 4EB0A 1TCCA 1GPNA 3BWXA 4BTLA 3IDAA 4BDSA 1EHYA 5BWCA 3N2ZB 4KACA 1ZD5A 1DQYA 4S0XA 3OOSA 3GFFA 1DU4A 2WKWA 2XQKA 2WQZA 1LBSA 2BFNA 3AIKA 3QPAA 1YAJA 5CBKA 3STUA 2JGEA 5K3CA 1MNAA 5LZ2A 5ALTA 4X97A 1XRNA 3QPDA 3DKRA 1TK3A 5ALVA 1GKLA 4BBZA 3R3VA 3TEJA 2WILA 1HL7A 5AI9A 4DTCA 2PSJA 5SYNA 5HQ3B 1GPKA 3LLCA 1EDBA 3BXPA 3G0BA 5AKKA 4EBBA 2WIGA 1K5PA 1XKLA 1LGYA 4BE4A 4WY5A 2WHPA 4KYVA 4FNGA 1CIJA 3WK9A 5AKEA 3VISA 5AM4A 4QNNA 4DLNA 5AICA 3C5WP 3QH4A 1BN6A 5LZ9A 1QIHA 4I19A 4U2CA 1XZMA 2OGSA 3O4JA 4QEKA 5T4HA 2IX9A 3YASA 1ETHA 4J0KA 5JAUA 3JYHA 5K3FB 1CUDA 4IH1A 3D2AA 1XQYA 3FNBA 2OGZA 2HA3A 3GA7A 2XMGA 1EDDA 4ZV9A 3EF3A 3HABA 4UUQA 3K6KA 1YA8A 4G4GA 4IQ4A 3WJ2A 3LIPA 3DL7A 4PW0A 1THGA 3V1MA 4N5HX 1VJ5A 1JU3A 1IZ8A 2OAEA 3STWA 2XDWA 4U2DA 3D59A 2JGLA 4N5IX 2GBIA 1DQZA 1MAHA 1ZI6A 3NGMA 3W9BA 5DTIA 4NVRA 3OTQA 3R3YA 3R3UA 1SCIA 1F0NA 2XT0A 1ZICA 4Y2XA 1PV1A 1YR2A 3R41A 5AIAA 3BE8A 5AKIA 5I7UA 4ZXFA 2QJRA 4B9EA 3AJAA 2EDCA 4X94A 2GBFA 3ESCA 4V2IA 5K3BA 5EFZA 4X6YA 1B6GA 4Y2VA 3LS2A 2XUPA 2BUBA 2ONCA 3WWEA 4AB1A 2B61A 3AILA 4M0FA 4Y2QA 1HQDA 4B80A 2WFZA 1CUJA 3MGAA 4L3WA 3W05A 3OM8A 4NMWA 3A2LA 5LYYA 5JARA 1GQSA 1MNQA 1CUBA 5CRIA 4AMYA 3K9BA 1RYYA 4GHWA 1MO2A 2HRRA 3F8SA 1TRHA 2CUTA 2ZYRA 2H7XA 4BATA 4H7JA 1JI3A 5JD4A 3E0XA 2ORYA 3IUQA 3WI7A 4BZWA 2WIDA 3FSGA 4HXGA 1DINA 3AZPA 3QZUA 3WQHA 2QM0A 1EH5A 5DNUA 4DNPA 4XWGA 3MUOA 3DD5A 2JGFA 2HA6A 5BOVA 3LP5A 2RHTA 4DIUA 1UXOA 2GBGA 1QFSA 1LPNA 2ZYIA 3WKEA 1L7AA 2WG0A 4A5SA 5E4YA 1MU0A 4E11A 4JUIA 1XQWA 4DMCA 1Q0RA 4AX4A 4CIBA 4MJ3A 4U2FA 1ZD3A 4UBNA 3ANSA 4Y7DA 2PUJA 4L0CA 4AZ3A 2HA0A 3G0CA 4H7DA 4RGYA 1Y37A 3VJMA 4X85A 1LZKA 1F6WA 3M81A 4PNZA 5CH8A 2XUJA 1UT6A 4ARBA 4GBGA 3DOHA 2V98A 3NWOA 3TRDA 4LXGA 4UFOA 2AJBA 3IVMA 1ZJ4A 3DEAA 1EVQA 4L72A 1DT5A 4G8DA 5CURA 2J4FA 2BUAA 1ORWA 4FLFA 3VXKA 5DLPA 1K4YA 1JJFA 1XZKA 2BJHA 4E46A 2RGUA 3A70A 4PSDA 4Y2PA 5EHQA 1GQRA 2VTVA 1IUPA 4JEIA 2DHEA 4X92A 3P2MA 5AM3A 1USWA 1EK1A 1X2BA 2WIFA 2XI4A 4DNQA 4BCCA 1HDEA 2HU7A 2XMQA 2HA7A 3V9AA 5HK9A 4BZZA 1SCKA 1XZCA 2J3QA 3G9XA 3I6YA 3BJRA 1CUXA 1WB4A 2I78A 5JATA 3WKAA 1BEZA 3VJKA 3F97A 4TPKA 3C70A 2HADA 1CUEA 1ZJ5A 5KBYA 2PKYX 1QIIA 1FFAA 1EVEA 3WJ1A 3JW8A 4UBKA 1CQZA 3IBTA 2JBWA 1THTA 1CLEA 3ZLVA 4C4ZA 5ALKA 1DX4A 5ALSA 2FJ0A 1TKRA 2XUFA 3KWFA 3CCBA 4BAUA 1EX9A 4M0EA 5AH0A 5HFNA 5J3JA 3WIBA 4IH4A 5AM1A 2VJAA 3HRHA 4OYYA 2C58A 1KU0A 1S8OA 2PL5A 1P0IA 5CXUA 5AK6A 4Z49A 1VA5A 1O6GA 5ALLA 4JYMA 3CCCA 3SK0A 4DSAA 1E8MA 1GKKA 1FFDA 3ICVA 5T4FA 1AMNA 4DNFA 1UOQA 4ZWNA 3VKFA 2RAUA 4CG3A 1YB7A 3FCYA 2FUKA 2XMRA 4WY8A 3BIWA 3EBLA 3QMWA 4KAAA 5HK8A 3RARA 5CT4A 1K6EA 5A7FA 1CUWA 1XZFA 4Y2JA 4OU5A 1VLQA 2EDAA 1ZD2P 2GYWA 5HF9A 4TVKA 2J3DA 5D3ZA 3WK8A 4UFPA 4Q3LA 1CUCA 3K2IA 2HA4A 2QXTA 4WFJA 2JF0A 3H0CA 3H2HA 4XX1A 5LZ7A 2GZSA 2QTBA 2VAVA 4DNOA 1AKNA 4KR0A 2WFMA 3E4DA 5DTJA 4P93A 4B0OA 4B81A 3F67A 4FTWA 5JZBA 2Z5GA 2O2IA 3A6ZA 2G63A 4J3JA 1CVLA 4W9RA 5ALJA 4EUSA 1GPLA 5FXMA 5IKXA 4WCVA 2QVBA 2XE4A 2Z8ZA 2CKMA 2QXUA 4FBLA 2VT6A 3IUNA 2WG1A 3FVRA 1GT6A 2WU3A 3VVMA 4Y2RA 2QJWA 4FLMA 1DWPA 3M83A 4UBMA 1LPAB 5AOCA 2DFPA 3BDVA 3A2NA 1QZ3A 3DNMA 1UKAA 5C7YA 2PM8A 1BROA 4AQDA 1CUIA 5YASA 5DYYA 1XLWA 3AIMA 1H2ZA 1XQVA 1MX5A 2G5TA 2ROQA 3TGLA 5AHXA 1CUGA 3R3ZA 2FX5A 4BDTA 5EIEA 4H35A 4DMHA 2BGRA 2R8BA 2PSEA 2OXEA 2Y6UA 5AJHA 3EQ7A 3BDIA 1KEZA 4LIPD 3WLAA 1JMKC 5LKAA 5JANA 2QZPA 2WFLA 1NX9A 1PFQA 1X2EA 4DMKA 4OPMA 4Y2SA 3DYIA 5AKJA 1J07A 2XMZA 3L1IA 1R9NA 4X93A 2PU7A 3FYUB 5JASA 1MJ5A 4P9NA 1AX9A 2ZSHA 4X3CA 4E15A 1QTIA 1JJIA 3BIXA 4BAGA 2Q0XA 2VJBA 4C88A 3DS8A 4J7AA 1PJAA 2VEOA 2X8BA 1HPLA 5F4ZA 3BJMA 4Q05A 2XQIA 1O6FA 1JJBA 1G42A 5AIBA 1LNSA 2BAGA 4X95A 4W1RA 2PSDA 3N0TA 4Y2TA 1FJ2A 5CTAA 5FV4A 3I2JA 3C5VA 2GYVA 3G0DA 5A71A 5DWDA 2QT9A 4UHHA 3EQ9A 5AK4A 2R11A 4OB7A 4K6HA 3CN9A 2Y6VA 3HEAA 3D2BA 5EI5A 5FPPA 1UK7A 2O7VA 5DNWA 5AKZA 1N5RA 3SC2A 2E3JA 1W52X 3AZQA 1E8NA 4G9EA 2XQJA 2IIVA 1VZ2A 3O9MA 3H2IA 2YXPX 3D0KA 4ZREA 2O7RA 1GZ7A 3GBSA 5EHZA 2JGKA 4PQEA 4ROTA 3AUKA 3F98A 5DYTA 5I9IA 3WKBA 4MXDA 2RONA 1U4NA 4MWTA 4HXFB 4C4XA 2ACEA 1JFRA 1AUOA 1XRRA 1XZGA 1FSSA 1H23A 1QIFA 1YSCA 5ALIA 5C8XA 4AMZA 1UKCA 3PUIA 5JD6A 3I28A 1QO7A 1CUUA 4EY5A 3QITA 3I1IA 2ES4A 4X91A 4B6GA 2WHPB 2ZSIA 2DQZA 1WB6A 4BVLA 1OCEA 6YASA 1ZI9A 2Z3ZA 3IUJA 3PDCA 4BVJA 2DSNA 1XZEA 4J0DA 5ESRA 2HIHA 5LKRA 5LIPA 5C81A 5A7GA 2RI6A 2WUDA 1VA4A 1Q83A 4U2EA 2WG2A 1UOOA 2PVSA 1WPXA 3HLKA 4IH9A 4EY6A 4K5QA 1QIGA 4C01A 4CG2A 1QFMA 1YA4A 3I2KA 5EHXA 1QIDA 3D2CA 3IIIA 2YH2A 1ZGBA 3RLIA 1RP1A 1A8QA 3C43A 3FYUC 3HSSA 2NW6A 4BP8A 3D3NA 3O9VA 5I8PA 2ACKA 1WHSA 1XZAA 2PX6A 3KD2A 2OCGA 3H2GA 3ZLUA 1ZGCA 2IITA 2D0DA 3RKSA 4PSUA 4X6XA 1F8UA 5ALDA 2I03A 5EHNA 2ZJ7A 2WUGA 1XZBA 4YPVA 1Z68A 4QLOA 3G0IA 5CH5A 3D4LA 1XLVA 3G9ZA 3I6MA 2HRQA 1Q0ZA 4BTVA 3M3DA 2C5FA 3T52A 2QRUA 2WIKA 4WJLA 1OILA 1U65A 5ALYA 1ZI8A 1T2NA 5IVHA 1ZIXA 5CW2A 4FFVA 4CI9A 5ALFA 2XLCA 3C8DA 1T4MA 5LLSA 1J06A 2BKLA 4LYEA 2PBLA 4QWWA 1BRTA 1E8DA 2O2HA 5FPQA 3G02A 2EEPA 4M0MA 4KRXA 4K6KA 4MQMA 4KRYA 2V96A 1L7QA 3Q0TA 4EHBA 1ODCA 1X70A 5ALRA 2QR5A 1XZIA 1EI9A 4H0CA 4H7EA 2W22A 4IO0A 5LZ8A 1YS1X 3ILSA 2V9ZA 4X7BA 3NOXA 1BU8A 5AI4A 1ZD4A 3ANTA 3HACA 1C7IA 3I1YA 1QIEA 2V97A 4PO3X 4K2AA 1MN6A 4QZVA 1EB8A 1TQHA 3QMMA 4F5ZA 4LXIA 4A16A 1JMYA 3V48A 2OLEA 1DWOA 5JZSA 5FP0A 3WYNA 1SC9A 1WOMA 2VQ6A 2OAGA 2H9YA 3STTA 1XRMA 1L7RA 2VT7A 3ICWA 1C4XA 3QPCA 4G4JA 5CT6A 1UK8A 4EY7A 4TGLA 4KJXA 1RWQA 1Y7HA 2H1IA 5ALUA 3AINA 3NUZA 3C87A 1QJ4A 3PI6A 3QMVA 1XRPA 1AURA 3H18A 5AM2A 2Y2VA 1SFRA 2QKYA 3DOIA 4W1PA 1YAHA 5HF6A 4HTAA 2I3ZA 4BCBA 1MPXA 1MT3A 1KU6A 1A8UA 5C8VA 2CEKA 2Z3WA 4QE3A 2XMDA 1I6WA 5AOAA 3BF7A 4XVCA 2J4CA 4HVTA 4AO6A 4H18A 4XJVA 3MUNA 2G5PA 4N8DA 5ALMA 5AI8A 3ZPXA 2XQGA 4B7ZA 1M33A 2HDWA 3C6BA 4CCYA 3WA7A 5HKBA 3EIOA 4JH0A 4QDOA 4FDMA 4CG1A 2JGMA 3GZJA 3M82A 2DHCA 4QDTA 3HJUA 5KWIA 3H2JA 5AM0A 5AK3A 3UMJA 1YB6A 2OGTA 2XLBA 1DTEA 3WA6A 4QLAA 4GXNA 1MTZA 2CB9A 2Y2UA 5ALGA 4FMPA 1G66A 1N1MA 2XQFA 2AJ8A 5LZ4A 2C0PA 2HL6A 2XUIA 4J03A 2QMQA 3T4UA 1LLFA 1WHTA 2VAXA 2XUKA 2Z8XA 2XB6A 4ZI5A 3IURA 1E3QA 4QDUA 3WWDA 2WUEA 2XUHA 4B83A 1N8SA 5K3EA 1Y7IA 2WLSA 4YASA 4I4CA 4BC0A 1P0QA 4NS4A 2H7CA 2WHRA 1EA5A 1VE7A 4MQLA 3UUEA 2CBGA 3B12A 4W63A 3GUUA 1LBTA 4MEBA 5K3DA 2DR0A 2VATA 3IA2A 1R50A 4PSCA 1P0MA 1YS2X 1SOMA 1FFEA 3ESAA 4WFIA 3O4IA 4AN1A 4P08A 1BN7A 3FOBA 3EQ8A 3STYA 4KAJA 4AZ0A 3KDAA 4UHEA 3V1KA 5IVDA 5CMLA 4W1QA 2CZQA 2HM7A 2WJ4A 1QOZA 4DM7A 5A62A 2JGIA 3GELA 3H2KA 1DWQA 2Y1KA 3WWCA 1VZ3A 3FAKA 2HFKA 5ALOA 1R88A 5SYMA 5C8ZA 1A88A 1XZDA 1UOPA 4Q3OA 4C4YA 5AP9A 4K6GA 2WUFA 5EIHA 1R1DA 4FOLA 1W75A 4Q3KA 4RPCA 3C45A 3H1AA 4EY4A 4BVKA 4QDXA 5T4BA 3W2TA 2JEYA 3RK4A 5CH3A 1N5MA 4P92A 3H19A 1NU6A 1UZAA 4OB8A 2WTNA 4X71A 1W1IA 1MX1A 5EGNA 2QUAA 2WM2A 1CUZA 4BB0A 1IUOA 4H7FA 5HQ3A 1D07A 5AI5A 1QGED 3WK5A 5AKYA 1UWCA 4FBMA 4H7KA 1EB9A 5FRDA 1TCAA 4GECA 4HS9A 5E4TA 2AXEA 1WB5A 4G8CA 4OCZA 1XZHA 4UBJA 2QUBA 2XUOA 1CEXA 2RIPA 5ALXA 3F96A 4J0GA 5BV7A 5HZGA 2QOEA 2XMCA 3ED1A 5K3AA 5K3FA 2FJPA 3WMRA 4N8SA 1AC5A 3C6XA 3BF8A 3D7RA 2DHDA 1LPBB 4YK7A 4CFSA 2ZJFA 1R9MA 2P8SA 4BCDA 4I3FA 1UFOA 4XIIA 3I2IA 3WWOA 3WZMA 3G9TA 3STVA 1R3DA 3AIOA 3WL7A 5JADA 3LIIA 1CFJA 1XROA 3U1TA 1H2YA 5DYWA 1LZLA 1BS9A 2B4KA 4G5XA 5CXXA 2ECFA 3QBJA 4UBOA 4UBLA 4H7HA 3FLEA 5CT9A 4UHDA 5DJ5A 4OUKX 3HZOA 4JYPA 3QM1A 5FOQA 2AJDA 1YCDA 2HHAA 5HFAA 2OQVA 5AKLA 1CR6A 1A8SA 1E5TA 1ORVA 5AM5A 3FSGD 4NZZA 4OU4A 5JYCA 2WTMA 4E14A 1DT3A 1XZJA 4MEAA 3R3WA 3WKCA 2VSQA 2WFLB 4U2GA 3O4HA 3LCRA 5BWBA 4HRXA 4HZGA 4DSZA 1UKBA 2ZVDA 1VE6A 3FLAA 4G9GA 1FFCA 4OSEA 2C7BA 3PF9A 1W4LA 4FHZA 3DKKA 3Q8WA 5LP1A 3HXKA 4HXEB 4X00A 1WCYA 4AXBA 4FFWA 1QIKA 4EZIA 4UHBA 5FLKA 5ALEA 1TIBA 2HU8A 4GLBA 2VJCA 1E66A 5ISMA 3GROA 1BE0A 4FWBA 3HC7A 1LPPA 1R4ZA 4OB6A 3VDXA 4CCWA 3WL8A 3S2ZA 4GW3A 2C0QA 5HCUA 4UBIA 3WKDA 4J0IA 4B9AA 4RNCA 4KE7A 3BL8A 1FFBA 2PSFA 4KE9A 4BRZA 1UK9A 1JU4A 3OG9A 1XKTA 4CIAA 3G7NA 4UPDA 2GYUA 1HLGA 2PU5A 3IB3A 2B9VA 5D3KA 3KWJA 1LPMA 1VXRA 3O95A 4PV7A 4B85A 2BUCA 4ZGBA 5HF8A 4X90A 3E3AA 2PSHA 3WZLA 2WJ3A 4WDQA 3DCNA 4LKOA 5T4EA 4J0HA 3R3XA 4LHEA 2WHQA 5DNVA 1QIMA 4MYDA 1EINA 4RE6A 4W1SA 3B3QA 1WPRA 4IHAA 1ZOIA 2GBCA 1J2EA 3FWHA 5KWJA 1XRQA 2DCMA 3MVEA 2D5LA 1MAAA 4INZA 4MYSA 3C6ZA 3DJYA 1QONA 3ZWQA 5JIBA 3PFBA 2OCKA 3ESBA 3L1JA 3DLTA 4BP9A 3I2FA 2PUHA 2HFJA 3VVLA 4EY8A 2I3DA 1BEEA 4AO8A 3IULA 5JAPA 1K8QA 3W9UA 2H7YA 3DL4A 1AQLA 1CPYA 3PE6A 2XUQA 2OQIA 3FVTA 4LXHA 4B82A 4ETWA 3G9UA 3ZLTA 2XUAA 5D7BA 3HI4A 4N8EA 3DYVA 2WIJA 2X5XA 2UZ0A 3PICA 2OCLA 2OG1A 4OYLA 2C4HA 4C87A 4KE8A 3PF8A 2B20A 1EK2A 3C6YA 3RM3A 1H2XA 2OCIA 1CUHA 3WIOA 2X76A 1AZWA 1EXWA 4WDRA 4OD0A 2XMSA 2AJLI 3H04A 1NU8A 4MWSA 2ZYHA 5IVIA 1HBJA 4Y9SA 3W04A 2AJCA 1CUYA 5ALWA 4BRSA 1A7UA 5IH7A 3DDUA 5AI0A 4BYMA 3KOOA 3OC0A 5JD5A 2W6CX 1EDEA 4F21A 1W6RA 2YYSA 3L1HA 5A7HA 3S8YA 1Q84A 4AN0A 4KAFA 5JAHA 5CT5A 2YASA 1UK6A 3FYTA 1IVYA 1J1IA 4G4IA 2WJ6A 1CRLA 1CV2A 2G4LA 5AK5A 1ODSA 3U0VA 1U2EA 3VJLA 1IMJA 3A2MA 5EIAA 3I6ZA 1XLUA 1CQWA 3WK4A 5A2GA 4H77A 4X6UA 1SCQA 3FCXA 3R0VA 5ALQA 3OPMA 3V1LA 5AKGA 1GGVA 1TAHA 3KXPA 4B84A 1YASA 3O4GA 1E89A 1ACJA 1OXMA 4PF1A 4J0JA 4A23A 1QTRA 2JIDA 4G8BA 3WYDA 2HA2A 3G8YA 1MX9A 4C6HA 1GXSA 2LIPA 1ACLA 3CN7A 1G4HA 4UHFA 7YASA 2QS9A 4JNCA 5JAOA 3TJMA 4HAIA 2VJDA 2PPLA 2DQYA 3IUMA 5JALA 4UHCA 3C8HA 3X3HA 2RHWA 1QIJA 1WM1A 1VOTA 3I2GA 4ZV7A 5AOBA 2BCEA 4QWMA 2OPHA 3G0GA 4DMFA 5FUMA 5FDFA 1CUFA 3FBWA 4GDMA 5LZ5A 4DGQA 3AFIA 1W76A 5AKHA 5ALNA 4ZRDA 5ALZA 1CUAA 4QA9A 4HRYA 4KEAA 4GWLA 1QE3A 1JKMA 3KSRA 1H2WA 1H22A 1BCSA 2JGJA 5D6OA 2XUDA 3W06A 1LPSA 2CJPA 4C89A 4FNMA 1LPOA 2GZRA 3UUFA 4ITVA 2VA9A 4DYHA 4Q34A 3QYJA 2K2QB 4ARAA 4BAZA 2XMBA 3WL6A 2O2GA 3WK7A 4J0CA 1CUVA 3PFCA 5CT8A 3H17A 2BGNA 4BE9A 1G5FA 3ZV7A 4CCYB 2HU5A 4O08A 4RE5A 3D5EA 3R40A 1XFDA 3O0DA 2CMFA 3FLBA 1P0PA 3F9CA 2ZYSA 1ZIYA 3WWPA 1ISPA 3ZI7A 1DX6A 4Q82A 1XZLA 1C7JA 4FKBA 5IVKA 5KREA 3CXUA 5E2IA 3WK6A 4YX9A 4EA6A 3PUHA 5FKJA 3V1NA 2VF2A 4WFKA 3FYUA 3HYSA 5HF5A 4B0PA 1IUNA 4AO7A 1QLWA 5K5EA 5ALHA 3DQZA 1XRLA 4FLEA 3WL5A 5AKXA 2WSLA 2ZJ6A 1XQXA 4BC1A 1BCRA 1IZ7A 4Q1VA 5HKAA 4GEGA 3JWEA 4U2BA 1B41A 5H3HA 2JEZA 4QDZA 4Y2UA 1ODTC 3QVMA
chains in the Genus database with same CATH superfamily
2X5KO 3ZR4B 1X1EA 1FTYA 3SLGA 1JH8A 3R44A 3BXGA 2ETVA 3JR3A 4HQ6A 2OP1A 3M8KA 1MGPA 2H5LA 4XR9A 2AFIB 3HYNA 1VKHA 4AS3A 3KE9A 1JHQA 3R7WA 2RI1A 5AK0A 4XFKA 2LBPA 3UJCA 5HRUA 1U8EA 4GVLA 2AVDA 2VT2A 3ADPA 4RLHA 2P6NA 3QLUA 1P75A 4HVAA 1LA2A 4N5LA 4AZ0B 3ND8A 3LQYA 4D9EA 3VNSA 2JW5A 4LDZA 3Q9NA 3SWWA 5JS1A 3IGFA 2C5GA 3E1GA 3HLTA 4KSCA 3W8FA 2DTEA 3E7WA 4QXAA 5CLHA 4DCVA 3OURA 3MNFA 3W6OA 5BT8A 1CDZA 1PSWA 4EO7A 3LD9A 3DFUA 3GH1A 3LK6A 3NHMA 4Y2YA 1SBYA 5AO9A 1R6XA 4L57A 4FYHA 4CM9A 4D9JA 5IRCD 2V7UA 1VSUA 4ZC1A 1YJXA 1K88A 4EJSC 3MWEB 4UQPA 5J40A 5ICCA 2DERA 3D6AA 1LDGA 2EL9A 1VLVA 3PU6A 3AR4A 4XB6B 1LB1B 2AN1A 2BT4A 2C2KA 2H4ZA 4QOEA 1YH3A 1K08A 1AHPA 4OKNA 4D26A 2QP3A 2FV8A 1DKLA 1T0HB 3REQA 3SHOA 2RGDA 3G2LA 3D1JA 3O38A 3SXUB 1OBOA 3MT0A 4KACA 4BVHA 5BWCA 3T1YB 1UJ4A 1GL9B 2XJ4A 5EAIA 1QVRA 4RENA 1VRVA 5KYUB 4KO8A 2IE0A 3HKEB 3EG9B 4S0XA 3CURA 4QM6A 1IXRC 3DZKA 4UASA 5MN6A 1C1DA 2ZT5A 1DU4A 1JQDA 4LQLA 4PCUA 4YJDA 5BSUA 3GLFE 2PZGA 3QYFA 1F9AA 1ZQ1A 2YC4C 3GMDA 2PDAA 2XTNA 2AOVA 2QAGA 3CSSA 4NESA 3FHLA 2P27A 4BKUA 4DDUA 2VRWA 3IOEA 3D4BA 2E6UX 3AIKA 4MKZA 4MVJA 1ZW1A 1N0IA 3SJ7A 4ARVA 3CEAA 4Q4DA 1M8KA 5CBKA 3EDRA 2VRCD 1UMCB 4HDKB 4NJEA 5K3CA 2JJ8A 1MNAA 1JFFA 4ZAXA 4XGKA 2CLOB 3EHEA 3IEIA 4R2WA 1PEDA 4WXYB 2CJWA 1JG7A 2NSJA 2O9JA 1V4BA 4QC2A 5ALVA 3CJQA 3PL1A 5H0IA 5JNUA 1KQGA 1WMAA 2DECA 2HBYA 3R3VA 4ZVKA 4FZVA 1AY0A 2WILA 1QAQA 3K0FB 4DA8A 2Q21A 4L3VA 1O9BA 2WJAA 4FCVA 1MIHA 3G1TA 2Q5OA 5AI9A 4MTLA 2PSJA 4DTCA 4WBNA 3DKPA 1RYNA 3I5MA 4US0R 3TNDA 2WHEA 3B9PA 3U4AA 3V00A 3ND5A 1XE3A 4N7RA 4JENA 3IE1A 3QX3A 4NSNA 3COSA 1U8AA 3G0BA 5BPFA 4HN2A 5E7JA 4BNVA 1M8PA 2V7WA 4KQCA 5K7SA 1XPJA 3HV0A 1LQUA 2WIGA 3NWPA 2QTRA 2QZJA 1LVUA 4ZAYA 5HBRA 4AJ2A 1D1SA 3KOMA 4C5BA 1QB8A 2GVZC 4DIDA 4WCFA 2EATA 4JV5B 2I33A 3AY3A 2QLJA 2WHPA 5FORA 2HRBA 2NSHA 3TBHA 3E23A 4S3MA 4UREA 5H81A 4TS1A 1GKYA 4B4UA 4R41A 1E18A 3EPJA 4HZUA 1NXPA 3NDIA 3FE2A 4I7EA 5E6UB 2PZEA 5AM4A 1XX6A 2J31A 1NBHA 1UKYA 3CNBA 1R0RE 1XG5A 5AUQA 3BXFA 4EMUA 4WLFA 4YY3B 5D86A 4QO8A 3R5JA 4NBWA 4WJZA 3QH4A 2Y3IA 1PFWA 3QK7A 1H05A 2BV3A 1BGWA 4I19A 5BR7A 4CIXA 3UV7A 5EZ6B 2ZM6B 3ZDQA 1PI3A 2CYAA 3L40A 4QUDA 2GM9A 2VSNA 2ZRDA 1H1DA 3PUVA 4BLUA 3GV0A 1ETHA 1T1JA 2V3VA 3YASA 1R3UA 2WT4A 3L8YA 4YDRA 4Z5XA 2FH5B 3L8HA 5F5NA 2BLNA 4F4IA 2XWSA 2RKWA 4NBTA 3SQMA 1XQYA 3BTSA 1EMDA 1PR9A 2WU0A 3P9SA 3T7DA 4CMAA 4CKWA 5JH7A 1ZUNB 1HMPA 1IPHA 3FNBA 5THXA 4E5DA 2AXPA 4YRNA 4Z4QA 2BRUA 1O96A 3QXJA 2VNKA 1FP6A 1V4VA 2HA3A 3E35A 2XF8A 3I8XA 1D2HA 3GA7A 1E3TA 2Q6LA 1AXRA 1VM6A 3I3SR 1V3TA 1KAEA 1RPNA 1SUWA 2D3WA 2PGAA 3OOEA 4IFEA 3RTEA 1OXUA 2CXTA 3LUGA 1YA8A 4FFSA 5DYGA 4J4TA 1L5MA 1VHWA 1OKKA 1LSSA 2WYOA 4G1CA 1YDMA 3LP8A 1G1MA 1K68A 1X3SA 1M2KA 2BL4A 3K8ZA 1YIAA 1KMCA 5GM1A 4DGSA 3CFYA 1ZM4A 4TT3A 2V8BA 4GRDA 2R68A 4QBKA 1SVUA 3LIPA 2OXCA 3CUTA 4F7WA 3EUEA 5K0BA 4NG5A 1X7HA 3WGGA 1TADA 2IWRA 2FWIA 1Y5LA 1VKJA 1I1QB 1E2BA 2CSXA 4JC0A 2PBFA 3KZMA 3SKXA 5JAIA 1THGA 5LR6A 1IXKA 2IYZA 1Y3DE 4QOIA 4N5HX 1M74A 1U7PA 2XNDD 4NBUA 4GKJB 3P2JA 1DIBA 1I7LA 4UOEA 3AF2A 1P1RA 3IDZA 2Q3MA 4RPKA 3AEKA 2WWHA 3R0JA 3ZKWA 4BUJA 1WR8A 1H8HA 1Q1GA 2J45A 1OVGA 2KX7A 2XDWA 3MJSA 4Q0MA 3AX6A 3IPAA 3TJZA 2H8KA 2G9UA 3D59A 1Q1ZA 3HRIA 1Z0KA 2GZMA 4OP3A 3JQBC 1FLDA 1CVIA 4A0SA 2WJPA 1GDDA 3DTYA 4PICA 1MAHA 1ZI6A 2FF7A 2JAXA 5JROA 3VHXB 1P5FA 1V6AA 4YV7A 3OLYA 1I14A 3GVIA 4PX2A 4QICA 3LY8A 1U11A 3UNXA 3TW6A 1W0JD 3NR2A 3OTQA 2G1AA 3M4JA 2VPYA 3VBEA 5A2QA 2B2XA 3GJ3A 4LTNA 3TLGA 1REQA 2P4QA 4UC0A 4UE2A 1JE1A 1KEEB 4MUNA 3H1EA 1QZTA 4D8UA 4EFLA 2E87A 1SCIA 3A6HA 4RCYA 5DCUA 1G6KA 2W2XA 3JYOA 3HDHA 4RV4A 4Y2XA 1XJ0A 1U81A 1WZNA 4FW8A 2AN4A 1AF4A 2JI9A 5DYIA 3BG5A 5HVNA 2UUCB 4DN6A 4GQIA 4JP1A 2XNJA 2FZ4A 1W19A 3R41A 1X8KA 3ZGYA 2BPOA 1OH5A 4LF9B 1LRKA 3VKHA 2C82A 2O2SA 3Q1LA 2XADA 2CLIB 5I7UA 3TOSA 2FW8A 4OI4A 5EUMA 1PUXA 1V95A 2PMFA 2UXBB 4HAXA 3AJAA 4MWZA 2XXAA 1JILA 1FNMA 1MOPA 3ECAA 4DEXA 3ERCA 4RJJA 3OPYI 1Y3FE 3PEFA 1DJQA 3ESCA 1Q11A 1S1MA 4HAWA 4HY3A 4OP1A 4V2IA 2HQBA 4J2OA 4EWLA 5J58A 1X94A 2VYQA 1E1LA 3ZWKA 4D45A 1WNTA 4X6YA 3U3MA 1V4NA 4Q19A 1FFWA 2VRCA 2Y1EA 2FMUA 5EZ5A 5FR2A 5FPSA 5K0ZA 1EK5A 4KB5A 4EHDA 4LYAA 4ASUD 1F1BA 2X42A 2NTYC 3AB3A 1AQIA 1KL7A 1ARZA 5EJMA 3ZE0B 1HQDA 1KAHA 2AR7A 2F9FA 4BX3A 1CUJA 1T8RA 2ERCA 1D03A 2DR2A 3CH7A 1T3LA 4R8KA 3GRCA 1EFRA 4OKIA 4LCEA 5K8LA 4L8WB 1EK6A 1NZFA 1YK0A 2JL1A 3ASUA 4F6RB 1SHKA 4ESOA 1YHNA 3S1AA 1Q0QA 1MNQA 1Y80A 1K9VF 3BMCA 4KYTA 5JS6A 1PJQA 4E70A 1WLSA 2PMWB 1LJ8A 4FGLA 5CRIA 4XUDA 5JBQA 4JLMA 2V8OA 3I9LA 3TEFA 5TS2A 3ZBQA 3PVZA 4G3XA 3JQ9C 1RYYA 1UJ6A 4ZDJA 3CMCO 5T3YA 4F2HA 3F8SA 4AJJA 4IGEA 2HLPA 2H7XA 1PT8A 1I36A 2ZYRA 3A4YA 2AG5A 3Q1KA 1F4VA 4N3AA 4RDIA 3TQQA 5CD9A 1FRZA 3E0XA 2ADFA 3HYTA 3DHYA 5I8WA 3IUQA 1R6VA 1LC3A 2IKSA 4ILEA 3TLJA 1UZNA 3WI7A 3CVWA 3BGDA 1XUOA 2WIDA 3FSGA 5AHOA 5CA0B 5L3SA 4CMCA 4HXGA 3QPVA 3HK2A 1DINA 1UAGA 1GUZA 2QX8A 3AZPA 5GOZA 5K0JA 1YZFA 4TXHA 2RHOA 3E7DA 1ONSA 1Y5MA 2XODA 4FMDF 5KIAA 3B52X 3U60B 2PZKA 4PX5A 3DEJA 3H4VA 1NI5A 3KB2A 3MUOA 2OYSA 1ABBA 3EVFA 3FVQA 2FOLA 1QYCA 3LOPA 2FPUA 3FDZB 4JI7B 3G5LA 2PUTA 1CDEA 4LY9A 1RPJA 2A1TR 2FQXA 2PO5A 3IUSA 5ITWA 3F0TA 1DOZA 1DP4A 2QDXA 1G2PA 2JLXA 4ZARA 5BOVA 5KC9A 2UUOA 5KNBH 4F1WA 1JEYB 2A92A 4UM9B 4AKTA 1P8AA 5F9MA 4DLRA 3LTNC 1RTTA 3WFIA 2UZ1B 1SRRA 1KQ3A 2Y0PA 2NYAA 1ZLYA 3E2IA 3PXBA 4L8VA 3ZHOA 5B1EA 5K8VA 4P7FA 4L22A 1QFSA 3UZUA 3QFRA 1EJBA 2M6RA 3R76A 5TQVA 1Y98A 3PGA1 4K9NA 4PX3A 3EK2A 3JVIA 2FSVA 6ADHA 1TM2A 1V5FA 4E11A 2ZT7A 4PQFA 2ZI7A 5IDYA 1XQ1A 3T1VA 1JL3A 1RJ9A 1XQWA 3JWPA 1YA6A 3JWGA 7MDHA 1I32A 4AX4A 1QTQA 1XYYA 5DKFA 4TXLA 2YY7A 3RK0A 5KAMA 1ZD3A 1VJDA 1OBFO 2B8EA 4RL4A 1ZHHA 3S0JA 5HM6A 3KOZA 3T5MA 4ZZ3A 3NBXX 5KOHB 3CPHA 4GD3Q 3AVQA 3OZGA 4CMIA 5KTMA 2NVBA 3AEUA 1ZXLA 1Y37A 2R5NA 3BD9A 2VLIA 3FKSD 1LH0A 1F6WA 1VTKA 1Z7EA 1JG3A 2BMAA 1XP5A 3A4MA 3BIJA 4PNZA 2XUJA 5CH8A 4Z9YA 3HB0A 5ARDA 1RPZA 3VHLB 4N5DA 1C9EA 2B7LA 2YXEA 1KPHA 5TF4A 3TRDA 1Z0FA 3U37A 2PR7A 5DK4A 3CLTD 3DEAA 2QTWB 4DJEC 1PS0A 1O95A 4TVBA 5THKA 4MIYA 4ED9A 4XDHA 4C0LA 4NI5A 1ZCBA 3RFUA 4XDZA 2PUGA 1GZVA 2GN2A 3OQIA 4IZHA 1NYQA 3LDUA 4RACA 1YBMA 4W82A 5CURA 5DTEA 4FYWA 4BFYA 4P1ZA 5LQKA 3WAJA 3W34A 2RB4A 2J3HA 1SCAA 3B7GA 4R31A 3ROMA 1RWVA 5ITZB 1Y5RA 1EGQA 3BSSA 2R6ZA 4DSOA 4OMUA 5TV2A 5JCXA 1DCTA 4DR4B 1XEWX 2I2DA 5CG2A 2PKCA 3IFSA 2MU1A 4O59O 1JJFA 2WUVA 3A70A 3GRRA 4Y2PA 3N76A 1QVZA 4TLBA 4BN5A 1CK4A 1ZA2A 1XPOA 4B44A 4EYGA 1GQRA 3VR2D 3RTAA 1SOVA 1X7YB 5JXWA 5B1DA 3OCUA 1HOTA 2H1LA 3LE8A 3OUUA 4LSMA 4UM7A 1CJCA 2W93A 2R7KA 4GI3A 2EARA 4YAUA 4J7CA 5CIWA 3U48A 1U28C 1JF8A 1PR6A 3T7CA 4EZBA 5H8WA 1I94B 2WIFA 5ITVA 2NG1A 1MAUA 5KX5A 4LISA 4OXNA 4REMA 2P0YA 2NT3A 2D2XA 4PLZA 1VP3A 2XRYA 3FLMA 4DMGA 1O3YA 5DT9A 3V9AA 3RGWS 3V4FA 4TXNA 4JKOA 1ZMXA 2AKYA 1L5FA 4Q4LA 4XTCS 5EPEA 2YZMA 4LHZA 4MA5A 3U16A 1E6CA 3P27A 3RKUA 1XZCA 3G9XA 4C78A 3OHMA 3AR3A 3AU9A 3HFJA 1DQPA 4L2IB 5EKXA 1LX7A 2C4WA 1PYDA 4IJMA 2PYDA 3OZDA 4F85A 2LCFA 3RRNA 1KDTA 5BVGA 3H16A 3HKBA 2OHFA 4DLUA 1JR3D 4TPKA 3CQ9A 4UXHA 3WSVA 1HG0A 4DIBA 4ZI7F 2AFHA 4B3MB 1EJ0A 1PVVA 1NBIA 4FVTA 2GM5A 2GESA 2L18A 3P45A 3L01A 4FQ8A 1NW8A 1ODFA 5LBIA 3OOJA 1EVYA 2ZRPA 4GGMX 3FMIA 4MYHA 1W8IA 3T38A 1A7JA 1QIIA 4Z99A 2H7VA 4X65B 3I34X 5KOJB 5BPHA 3FCOA 2B1QA 1B0PA 4UBKA 4BQOA 1KYWA 2NNLD 2YUTA 1CC1S 4DJTA 5K99A 3BHIA 1NASA 1FSFA 2FPWA 1UWVA 3OKAA 4IF6A 3X1MA 4OHFA 1CR0A 3SJAA 3IS3A 4OAQA 2OC9A 3ZLVA 4C4ZA 1F4LA 5D51S 2WQ7A 1XKXA 1U8TA 3WDMA 3ZWVA 1DX4A 2CMKA 2J9RA 1GL6A 2YWFA 4GL4A 4YCCA 4PHTA 5CB8A 3RWMB 4PRYA 5JNRA 2G3YA 4NHOA 1N5DA 1QO0A 2GT1A 3U4DA 4JD5A 1HI9A 2EU8A 3KWFA 3N3BC 4CF4A 1U7DA 4OAPA 2B35A 4BMDA 2R6R1 4IDBA 3HCWA 1TVMA 5CGQB 1GPH1 3AG6A 3D8RA 2BLLA 2J9FB 2DH5A 3OU7A 3P9YA 1UEIA 4I81A 2IYWA 4JT9A 3VC2A 3UAZA 2H52A 4M0EA 5IXJA 3D6JA 4G0MA 2HLDA 5AM1A 5FWYB 1A9TA 2DWQA 2GBLA 3L9XA 2YX1A 3EVBA 1CERA 3LCCA 3K4QA 1KU0A 1S8OA 1UFRA 5CVUA 1DIGA 3DBHB 5CXUA 2O8CA 2C3MA 2G9VA 1Y1QA 1DB3A 4BEVA 4PPYA 1C3OB 1O6GA 1DL5A 1CQXA 1HT1E 5J23A 2ZI4A 3KZ1E 4F2PA 4OXXA 3AETB 4XD7D 2QMEA 3IPYA 3OZBA 3GVXA 2E1PA 8MHTA 1UDRA 5I7HA 1E8MA 5IM5A 4ZEVA 4P0PB 1CU1A 5FTJA 2MTBA 4KQKA 3BJEA 3U4QB 5IKMA 4L7QA 1WMSA 5DOZA 2PNFA 3ICVA 4PM4A 4RGQA 1DRUA 4JC4A 4LJ6A 4OI2A 3NTXA 3PXCX 3PCRB 2WKQA 2YBDA 3HR4A 4RO0A 5T4FA 2JLAA 3UCEA 4BMYA 1AMNA 3KHUA 2I1LA 4M0CA 5KTNA 2QVZX 1E4VA 3I92A 1RKXA 1SBQA 2FZCA 2Z43A 1EGAA 3A06A 3DR3A 4O0MA 1MJGM 2ZGVA 3E9ZA 1KJNA 3ZHZA 1UDWA 2B3TA 1NV8A 3FKSA 2JLCA 4IVRA 3VZQA 1EXVA 4AJIA 1YB7A 3GLIE 2FUKA 3F71A 4LF8B 2NTNA 4ZC8A 2AEMA 3QMWA 4Q9DA 3SF8A 4BO9A 4IMIB 2IYSA 1KBZA 2P9CA 5HK8A 1C14A 3RARA 2FG6C 1XELA 4JYCA 1IN6A 2DPHA 1UOEA 5A7FA 3AHJA 1YQUA 1ZVMA 2A0YA 5J5AA 3VR4D 1DC3A 2EDAA 1A2KC 3N87A 2GYWA 4RPGA 4ZQBA 1K8YB 4YP1A 3PYLA 5HF9A 3SR0A 4OHYA 2QUKA 3I0NA 5TIIA 1N6RA 5L53A 1I3CA 3WXBA 2GPNA 4K40A 4Q3LA 2GSWA 3V4ZA 2I4OA 2YJNA 2EKPA 1F6DA 1JHRA 3K2IA 1UFKA 4B33A 1DUIA 4JJ7A 4IJUA 3GNQA 1RAIA 1OWNA 2BDUA 3FNRA 3ADOA 3GK3A 3MOIA 4YA6A 5AHRA 4BV3A 4EG1A 4HADA 3H0CA 4XX1A 4W6QA 1EZ4A 1QGZA 2OZPA 3MZ0A 3ESYA 3HGQA 4L7VA 4PLYA 2XGSA 4R8LA 6REQB 2DF8A 3DVQX 4YVFA 2GPTA 1ZESA 3PNLA 2DWOA 4IR7A 1HE2A 2RHJA 4Q6WA 4BFWA 4KR0A 2P2NA 4EPRA 1E2JA 5I5EA 1GGMA 2VTBA 1VQ1A 4WXHA 4B0OA 3PXEA 3C7AA 4FOSA 3WLQA 4IYJA 4Z4IA 5GWXA 3VKGA 3GZNB 2Z5GA 2CDBA 2H4YA 3LT1A 4E0BA 4YDSA 2FEKA 4GOJA 5BWMA 4DBLC 1UBGA 3WGLA 3A0RB 4MS1A 5JQGF 3TZEA 2BEKA 1LTKA 1ZJZA 2X3YA 3L6OO 5GY7A 5LOVF 1SURA 4NU8X 3B53X 4V1CI 4QAJA 4BPBA 4FC6A 1NR5A 1W2WB 2P2SA 4WCVA 4AP5A 1QR2A 3KPYA 1K3FA 2MR5A 2QXUA 2QPTA 1P1CA 1NDQA 1VIMA 2HRCA 3D9QX 3GEBA 3GFVA 3OQVA 5AR1A 3WLTA 3DF7A 4F3NA 2D6FA 1Z4QA 3FVRA 4RUKA 2RCNA 3HEBA 2WU3A 3JD1A 3D5QA 2J0UA 3BTOA 3LPNA 1NP3A 1WF6A 4Y2RA 5FTNA 5KHAA 3TCNA 4PS0A 2WOJA 2YJZA 4PGHA 1CQPA 5MHTA 2UKDA 1OT5A 3WIDA 3TINA 3GQVA 2JZNA 4ND4A 1BCSB 2V5AA 4AZTA 5I47A 4MAFA 1XXHB 3A31A 3N2LA 3BDVA 1X42A 1JAYA 1ML3A 1QZ3A 2QHXA 3A2NA 3A58B 1UC8A 3AUYA 3CLRC 3DCIA 4Y9TA 5JBIA 1LQTA 4AMBA 5BN4B 3ZH2A 5HW0A 1J22A 2QRMA 5C7YA 2REQA 1PGQA 2EYUA 2PM8A 3BBLA 1YL6A 5YASA 4FFRA 1A0OA 1KK1A 1RAFA 3ANLA 3CH6A 2GKSA 3D6FA 2JHGA 3Q11A 3LXMA 3ZS9A 3R5SA 3FPGA 4G41A 5AW6A 2HK8A 3QVWA 4PTLA 5CDGA 1BW9A 3HU2A 3GDFA 5CDUA 1KZHA 5HKLA 3MXTA 3MWJA 1SU6A 2HUNA 3BD6A 1XQVA 3OTIA 2GPWA 3QX7A 4P3KA 4BKMA 2PJZA 1TJNA 2UVQA 2V03A 1VFPA 3N5CA 1U1FA 3QOFA 4XSHA 3VR5A 1DZIA 3QQPA 3TJRA 4OXYA 3PT9A 5LQSA 3UANA 1NG9A 3PHBE 1T5IA 5HE9A 1IWBB 1M7BA 3TGLA 1AUXA 1QQBA 3A4LA 4FQ5A 2DQKA 4GPZA 1UZLA 1LW7A 4G81A 4BMXA 2RSLA 5BV8A 3KQWA 1V26A 1C30A 3NRBA 1AB6A 1CUGA 2ZRCA 2M6SA 3QLJA 2CHFA 3MWLA 1KAOA 3ZLBA 5EIEA 3W6ZA 5CDHA 2BGRA 4ITUA 5J5VA 3KFVA 1D0SA 2PSEA 5JW6A 1FPMA 3A1SA 2IPOA 2OXEA 3EH1A 4ID9A 4LGYA 4ATNA 3PEEA 4C6RA 4E3WA 5BV1A 3C85A 4K8OA 4QEDA 3WOHA 1U2GA 2NYVA 3D43A 3I5YA 4FYPA 4ND5A 1V48A 1LF0A 3K1ZA 4A0QA 2H57A 2EXXA 1N2CA 2WF9A 1ZZGA 2E48A 2O05A 2O0LA 3AFNA 3B48A 3LL4A 4I50F 4M1EA 2RMKA 5AJVB 1ZNXA 3ED5A 4Z0PA 2JH8A 1L5YA 3ELUA 3WLAA 1JMKC 4I4LA 5EXXA 5DGXA 2IODA 5JANA 5LKAA 3ILVA 3ROGA 1PFQA 1CJMA 2JIOA 3B89A 3ESRA 4DCMA 1IM5A 4CVNA 1EQAA 3O8OB 10MHA 4DCSA 4QOFA 4A6PA 1UKVY 3IAEA 1PKEA 1M10A 5TR9A 4O33A 4X62B 2P9TA 4JI6B 3RVLA 4N3BA 2NUAB 1RLMA 3N0WA 2CNDA 4RJ2A 1Y42X 4Y2SA 3I72A 5LP6A 3E3LA 1SKYB 2DPLA 5AKJA 5FTWA 1L5ZA 1EG7A 1L4GA 3L1IA 1R9NA 4DB4A 1XVTA 4HNHA 4OL0A 2JVIA 4MR7B 4PFQA 3D4IA 1T8WA 5JNLA 1UBSB 1OV6A 1U9ZA 5CIQA 4WOBA 3O03A 2XNHA 3DW1X 1AX9A 1KI6A 3H8JA 1Y8QB 1Y89A 4DCNA 4NONA 1VHDA 1Q21A 1ZN2A 2F2TA 4MUJA 1JJIA 4X1OA 3FB1A 1Y6ZA 5JVDA 1RBQA 2AQHA 4H27A 5LNK6 4KW7A 1Z6AA 3IJ5A 2VJBA 2QM3A 3MIZA 2I3AA 3KT6A 3NALA 3GAZA 3PITA 1JUDA 4J7AA 4QU5A 1LDBA 1QNFA 1K3TA 3AEQB 2F1HA 4DNXA 4JWKA 3KTAB 3RYFA 5DNDA 3IE0A 3V33A 2ORIA 3DMGA 3MM4A 3WDKA 4DG5A 4JYZA 1PNTA 1ZM3A 2Y92A 2AWOA 3ABQB 2VBIA 3ZIDA 3MTIA 5DP2A 4ARUA 3DNPA 3KU4A 2KQUA 4HPXB 4EKIA 3MGKA 4MVJE 1O6FA 1Q0SA 2ZSBA 4OA8A 4QL3A 3E53A 1QBKC 4NCAA 3TR0A 1INLA 3NHYA 3EAQA 1IDN1 1G64A 1Y8RA 2Q9AA 3K32A 2BAGA 1HF3A 3K4PA 2BM8A 1KIFA 1Q6YA 1CNEA 3H42B 5CTAA 2JLZA 2AN3A 3C3CA 5CX1B 2C2BA 5LQNA 5AW2A 1OZ0A 2PKEA 1KSJA 1LBQA 4EJ2A 2VNIA 3L04A 4CR6A 6ABPA 4MNTA 2Z1DA 3G0DA 4TL9A 3DHVA 2XB8A 1N4DA 5CP8A 5EOVA 4MV7A 5A71A 3TCKA 1ST3A 5CXQA 1D5WA 4RTJA 4DB2A 5M34A 4INOA 2GPBA 2C1EA 2GCEA 3W5VA 5DCLA 3TLCA 3D2BA 2GEKA 3IXLA 3RU9A 1OFGA 4DCJA 1ECCA 1UK7A 5TQ2A 2HRDA 1A76A 3OEEA 1FXWA 2WIBA 2EAUA 3GDWA 4DR2B 2BFFB 2W0SA 3L0BA 4UUMA 1N5RA 3WQQA 1P1FA 4JR2A 1OIWA 2E3JA 4O2AA 3ZVMA 4KFSA 1GLGA 2Q0SA 4NLLA 5DGCA 2VQSA 3B1VA 4EYSA 3OZCA 1Y5IA 2XQJA 1F1JA 2ZLBA 4HB3A 2XKAA 5JE8A 4CTNA 4KPYA 4ZVUA 3QVGA 2JBHA 4LJ8A 3SMQA 3A6GA 4EOGA 1RIIA 3H2IA 2QRKA 3RYIA 3EULA 3M5WA 3OZSA 5COAA 1JSXA 4KFUA 1M6NA 1FYXA 1VSBA 5D3MB 1H93A 4UTPA 3AP2A 4Q1CA 4BWYA 4Q9KA 3M2TA 5G4KB 4B6RA 5HS4A 1OLSB 5CB6A 3JD4A 3LM8A 3LFUA 4B32A 3UHPA 1A5SB 4MICA 4PQEA 5K6TA 2GFHA 2BCGY 2WMYA 3FPBA 2IEZA 1SVKA 2YKGA 3TUIC 3VPCA 2NXWA 3AUKA 2XTZA 1GGJA 3CX7A 3ITNA 4BP1A 2QG6A 2QSYA 1FQJA 1FTSA 4MXDA 2ZWOA 2I55A 1H0RA 4O5OA 4MGYR 3OEWA 4DEYA 5CB4B 1Q2UA 3RTBA 4RTSA 3A9UA 4LJLA 4H2DA 2ORWA 1XLTA 1ESDA 1BWSA 2OZEA 2IYLD 5K6RA 1XZGA 2R25B 1X7WA 2Z6VA 2B5OA 3EUFA 2XR1A 1C8LA 3OX1A 4P98A 3SE0A 1UMDB 1KEKA 3GJTA 2QGNA 2NQ2C 4AMZA 2VCHA 2GZAA 2PS1A 5EP4A 4FIZA 1OTHA 2IF2A 1QO7A 1PJ2A 2VRBA 1CRWG 5E9JA 1CUUA 3KYCB 2E4AA 1R6DA 3M9XA 3QITA 4J29A 2C9DA 4JLKA 5K0GA 5KOIA 1UDAA 4V02A 4X91A 2ZSIA 2DQZA 4NZYA 4BVLA 3FDIA 1H8ED 1CS4C 1WY5A 1J7JA 1TZ2A 1ZA1A 2EQ5A 3DBIA 3IUJA 3QKSA 1XTIA 1PVDA 1XCOA 2DSNA 2VJMB 1XZEA 3IRVA 5D5PA 4UOZA 1FDSA 4PWZA 2CNNA 2LW7A 2MSNA 1TT5A 1WCIB 1KMNA 1UPCA 1ADGA 2JGDA 2QL5A 4H6WA 5LIPA 4BNYA 2BTEA 1GLVA 3QFSA 3H9CA 4Z3OA 4X8OA 3DDZX 2DB3A 1M1YB 2WUDA 1DIAA 1VA4A 1NVUQ 1LJUA 2AKAB 3RHSA 3T3HA 4LRQA 1UOOA 1F20A 2AF4C 3HLKA 3R3HA 4IH9A 3VNRA 1J33A 1E62A 1Q2XA 2R96A 4P5DA 5G41A 4O4IA 4RVFA 2GARA 4ASUA 1QIGA 4I46A 3N2KA 2J46A 5JSYA 3W5AA 2Y0BA 1H0SA 1ND5A 1QFMA 2IXTA 5T7BA 4FSXA 3COPA 1M2JA 3LO8A 1AMOA 3AL3A 1EGVB 2VF5X 3IIIA 4J0QA 1UBLS 2YH2A 2ZK7A 1JSLA 2EGHA 3ZQJA 5JS7A 1KJ9A 5LYJF 1J23A 3OFNA 4TWRA 4DUPA 1CW2B 3NHBA 4RMGA 1QSGA 3HCDA 3TOXA 1PK8A 2ID7A 1UAAA 3CBQA 3ZWXA 1VI6A 3N86A 3ZGNA 4HQKA 1DQSA 1YB5A 1VYUA 2E5FA 4TTIA 1A7AA 3O9VA 3NBFA 1KZYC 2PX6A 3ZLUA 1T6ZA 2PYIA 1KVQA 3KJIA 1KEWA 1PR4A 2V0CA 2IITA 3EIQA 2G88A 2D0DA 3CZQA 1FNBA 1UEJA 4MLCA 4N12A 4GX2A 2ZR0A 3RKSA 4X6XA 3WC4A 1TQDA 2MDTA 1OZAA 3IUYA 2BDEA 1UBFA 1E98A 1F8UA 4E1VA 5IS2A 2I03A 4PAGA 1QZUA 2W98A 1V45E 4N7MA 3VKWA 1Z68A 1L8QA 3P9PA 4URWR 4DDVA 4L6CA 4KTVE 4ZZ2A 5FLYA 1P2SA 3G9ZA 4J0EA 1N75A 5CVJA 2I7TA 2HRQA 3G7UA 2LGJA 1YE3A 4RH0A 4FZ5A 3N7UA 3M3DA 4ZAWA 3KT8A 1IK4A 4MULA 5ELXA 2PAFA 1OILA 3PJEA 1PT6A 4X3OA 1I30A 3ZCRA 1M67A 2F43A 3SYLA 1ZI8A 4E7PA 1T2NA 5LDGA 3CX4A 3ZHSA 2HMVA 3AY7A 4KMOA 4K86A 1C9DB 2C92A 4QBGB 1QDUA 4BGEA 1QDLB 3SI7A 1UC4B 3SVTA 4CI9A 5C8DA 1MO4A 2V0NA 4B6FA 2PEZA 3C8DA 5EWMA 2BTOA 4OQYA 4CLXA 2XOKA 2PZMA 2ZRHA 1E4EA 1QG4A 3BORA 4LYEA 1R6AA 1MRSA 5IAGA 4HYEA 1YQEA 2VQ3A 1G8HA 1CF2O 4DQDA 1KH3A 4M0MA 4KRXA 3C4QA 5K4AA 3CRVA 1YQTA 4MQMA 3GU3A 5G40A 4KRYA 3T7IA 2J0EA 3TQIA 1Y1PA 3O3OB 3I09A 1P4AA 2O52A 5ENDA 5AJYA 4JFAA 4IYRA 1ODCA 2G5CA 3I2YX 2YHSA 4WXPA 5JRDS 4M9SA 2QR5A 5G1PA 3SN6A 1BWQA 1U4OA 9ABPA 1B2RA 4O2BA 1Z4IA 3ENQA 2JA1A 5CVDA 4H7EA 1JHAA 1GIAA 2QV7A 1WVGA 3F6BX 1LV8A 4DJ5X 1FQKA 1BTOA 1QKKA 5JSKA 3GL9A 5B12A 3HHEA 1KDYA 4MUGA 1VHJA 1V9CA 2L19A 4XQEA 5DX1A 4WZ6A 4CT4B 3BRWD 3K1TA 4O1HA 1NA5A 1ZD4A 2B94A 2P9YA 1XVVA 4O8ZA 1XYGA 1U9IA 3I1YA 1G8GA 3RUAA 3P0JA 5BMVB 2HEGA 1U8ZA 3GFOA 1S3FA 1QIEA 1ZIDA 2A0XA 4U7WA 3TNYA 4D6YA 2V97A 1NOKA 2QY6A 3NZEA 2ZB2A 4AP9A 4JI8B 4CF6A 3GUYA 4URXR 1SZCA 3LC7O 4QZVA 4COOA 5BV2P 1QDEA 3NI2A 2QU8A 3T6KA 1TL7C 1VG9B 3GI1A 3SZGA 3PHJA 5IBCA 1KOFA 4JVMA 1H69A 4AVYA 2VZEA 1QV6A 2R00C 4NBLA 4TV8A 3KV3O 5K8CA 1N0HA 5DCWA 4WZAA 3HB5X 3TWOA 2OLEA 3QFFA 3FI9A 4XAQA 3ROZA 1ZO8A 5JYBA 1OB2A 3R9WA 3DMNA 3U7RA 4L08A 1VRWA 1Y33E 5FP0A 1SC9A 3L7AA 2WM8A 1MUUA 3AFMA 1TJPB 2L69A 3H9JA 1G7TA 4KIUA 2OHVA 2H9YA 3GA0A 4FONA 4I9UA 3EYWA 1P29A 2FEAA 3STTA 3OQOA 3A9RA 1H0HA 2PKWA 1YZ3A 4KGVA 1AKRA 1Z2PX 5TARA 1ZCJA 2RG7A 3ICWA 3WMFA 3IQFA 1SA0B 1KR2A 3DZCA 2H5JA 4TWIA 1PT5A 1JSZA 1I2CA 3MOGA 3CRNA 1DMRA 4DYVA 1L2TA 1WZ2A 2H08A 1A4UA 1XMSA 3UAGA 1QGAA 2H11A 1OD6A 3LLSA 4IXMA 1Z38A 2H1IA 4MMZB 4QGSA 1EDZA 4YN3A 4B2YA 1CS0B 3AINA 3NUZA 3C87A 3CLUC 1VMDA 1QJ4A 3VOTA 1C2YA 3TD2A 1C0KA 1EIZA 4K26A 4AT1A 2IH2A 1V9LA 4II7A 2IP2A 4NYJR 1A2BA 3EIXA 3PI6A 2C9ZA 3QMVA 4LRTB 3NX4A 4QTTB 1PDOA 4WLOA 5KYXA 5AM2A 4KGDA 5JDCA 1G21E 1O94A 1SFRA 2X2PA 2MJLA 4M46A 4NXNB 3NPMA 1C41A 2IZOA 2QKYA 3U26A 5JAQA 4AJOA 3D3EA 2EBHX 1JR6A 2F48A 2X23A 4XXHA 4Z8YA 2NU8A 5JAMA 1J0EA 1EG2A 2G77B 2H51A 2ZTVA 4NATA 4ZTBA 5LQMA 3Q10A 1E20A 3SEZA 5EJ8A 3FFTA 3L0IB 1MPXA 5KWEA 4CLRA 2E1RA 1I6MA 1QQAA 3N8HA 3LHDA 1X3LA 4QT0A 4PSVA 4YJHB 2A9PA 4EG5A 4U39A 3NBQA 4K0KB 2XMDA 4LKRA 2PXCA 4GBMA 5AOAA 3P5BA 4J6FA 2J4CA 4AO6A 2BM0A 4XJVA 5DXFA 5FWXB 4JJIA 5JLJA 4N8DA 1RYDA 2XYVA 1W30A 2ZT6A 1IRIA 1YRHA 1SH7A 1V7CA 4Y1FA 5A4MS 4NFYA 3PQFA 2ECKA 3B1KA 3EVDA 3M6WA 2EGGA 1YQQA 3R7AA 1WXXA 4DMLA 4LK2A 3FROA 4ZOLF 1J25A 2FPSA 4F84A 2BM1A 1HYGA 2IUUA 4QT4A 1M6VA 2HDWA 5K51A 1UT8A 1UJBA 3IHLA 3R8CA 3GVCA 3V8RA 3X2FA 5I48A 2BMWA 2FPPA 2X41A 1UP4A 4P6VF 4Q03A 3AOGA 5CLIA 2RC5A 3EQZA 2C7RA 4EKDA 1O89A 1LNQA 3IIEA 5BUCA 2O5CA 1K7FB 3NGLA 4EPYA 5FL7A 4QDOA 1AXEA 1ZS9A 4CV3A 1OZHA 2PL9A 1EVIA 2JGMA 4JUDX 3Q8KA 2I2WA 2DHCA 1YOBA 3LDHA 4MWEA 3GP8A 1HYQA 3H2JA 2A9JA 4KVZA 4ZYZA 4DM4A 5AK3A 4YDHB 3UMJA 3JRNA 2UZIR 1Z7YA 1DTEA 2V3WA 5DISB 2AFHE 2ONZA 2ZAIA 5EL0A 3UFXA 4YT4A 3L6UA 3O8LA 2P0AA 3DMPA 3FKQA 1FLVA 4FMPA 4CKBB 4AKIA 1GG8A 1MA3A 3QGMA 5DE3A 2G67A 2PT7A 2XQFA 3AERB 1P0CA 3JQRA 5GAJA 3X1XA 2AJ8A 2X14A 3U5ZB 4J2TA 3T5BA 3O73A 1RBMA 4ECAA 4OOFA 2P1DA 2NAPA 3QG1A 2YWEA 4BP3A 5EG5A 4Z0TA 4ENUA 3DT9A 2BBWA 1HDIA 2PRYA 2FMFA 5LWHA 2BCJQ 4EGFA 1HA3A 1XEAA 2D1SA 2O0MA 2ZAYA 2VAXA 3L0YA 2JFUA 2DQSA 1GYRA 4GM4A 4OGWA 2FGKA 2Z8XA 4XEUA 5DW3A 1SXJB 5HCNA 1FNCA 1S89A 4ZI5A 5AVRA 3UV6A 3O93A 3VRHA 3IURA 1E3QA 3M4ZA 4WT7A 3SZUA 2XUHA 3WWDA 1N2IA 3VX4A 3I73A 5AHKA 2K7ZA 2O2DA 3TG2A 5K3EA 4GL2A 1FYWA 2Q28A 1IQRA 3PNKA 1A77A 2G4CA 2D5IA 2NVOA 4GPD1 3RYCA 4I9NA 1KTVA 2A8YA 4GP6A 3UICA 4KYIB 3REFA 2OFWA 3V8VA 1AK2A 4I4CA 3AO0B 3AW8A 2GCNA 4NJMB 5JC1A 1DVRA 3OQNA 5GVSA 4BTEA 1L5QA 1ONBA 2R7MA 2ODAA 2ZU0C 3R9KA 3HQ4O 4NS4A 1JX6A 1ZP6A 3EVTA 4HSEA 2XQVA 2QX4A 2OZKA 3OCZA 4B1FA 4FU0A 1NQAO 2EEZA 2VDNB 1Z2CA 2PRJA 5EWJA 3HN7A 4Z4HA 4LZPA 1QP4A 4CTMA 1NMYA 4ENPA 2HO4A 4H3SA 4NDAA 3PC3A 3TNLA 1E9EA 1ULUA 2CBGA 4QFMA 3AV3A 1XB2A 4HLUA 3EQ6A 3HU5A 4W63A 4GICA 1C9KA 1N77A 4KR2A 2ZP1A 3ML1A 4DDWA 1CE8B 2XCQA 2BOVA 1ADCA 2YN2A 2FPXA 3DUFB 3ETHA 3K0HA 5C35A 1RI3A 1BA3A 4I4TB 1R50A 2DKFA 2YHIA 3QKRA 4JYBA 4NE9A 4NENA 1YS2X 3LAWA 4PSCA 3W5HA 3O4IA 4RTLA 1NUHA 4M8KA 4MW0A 3D4NA 3AIIA 1W5EA 2VDLB 1BN7A 3D3WA 5EP3A 2FMKA 4OHOA 3STYA 3V2GA 3ZD6A 4UHEA 4TV9A 1EK0A 4P35A 5CA1A 4W1QA 4G86A 2H2FA 1P74A 4UNSA 1RI5A 4CLEA 1QOZA 5A62A 1RJWA 2JGIA 3IQGX 4TUYF 3GELA 4U7HA 5E4FA 4JLAA 4RPIA 5LQAA 2RFLA 2QSJA 4M0UA 1B76A 3R7SA 1QHHB 5HZHA 5M5BA 2Y1KA 2ZI3A 4RD1A 4G0OA 1WWKA 5EWLA 5C31A 1E2DA 4X1YA 3HN2A 4KVFA 1MFPA 2C7OA 1GUYA 2R4UA 4XIJA 5FBRB 5IWAB 5EHIA 2F9MA 1XZDA 4YRQA 1T8UA 5AP9A 1TVCA 2UV8A 5TGDA 4FYYA 1VDZA 1E2PA 1YF3A 1US8A 3DOCA 3CVJA 5IYZB 5DIZA 3LPMA 2GTHA 1PSZA 4RPCA 4ZT7A 3W0LB 1JVSA 2Q5JA 4RV5A 5A05A 4B3DA 2J0QA 3H1AA 3THYB 3O0TA 2X5JO 3MSCA 1KY5A 5BNZA 1QK5A 2ZRKA 2ZRAA 1YBVA 2C4KA 4JDPA 5F51A 1CR4A 2JEYA 3BGSA 4QPZA 5DM1A 1N5MA 3RT9A 3SE7A 3WBFA 3H05A 1T3HA 2OR3A 5FYDA 1M1ZA 2YS6A 3CWCA 4UNRA 2V5UA 3D7SA 1UWLA 3CTPA 3OY2A 1VIAA 1KVSA 2KB0A 2PRIA 2UZAA 3L8GA 4YCBA 4S1VA 1I1NA 3L4BC 1NF3A 2RKOA 2W6ID 2O2ZA 3NEJA 4X71A 4ZEWA 2PL3A 3GJ8A 4JZKA 3R75A 4ZZIA 3W1EA 3ZI4A 5DXJA 4QU8A 2C4VA 1F2TB 2DX7A 3PP8A 4RGBA 2OAP1 4J94A 4HAOA 4HLCA 1CVRA 2J85A 1AKQA 4NJOA 4WK0B 4XPIB 1CUZA 2QN2A 4JBHA 4TS4A 4WACA 3G88A 1L6RA 1QGED 3DV9A 4TM7A 5AI5A 5TMBA 4HEQA 4V0MA 2JFHA 2W90A 3PE3A 4OJQA 5AKYA 5G1OA 4EJ0A 1H1TA 1D4ZA 3GD5A 3MFYA 4EVQA 1DTSA 4CM8B 4B46A 1ZAYA 4M6WA 4I55B 4OL9A 2ZIEA 3R5TA 4H7KA 4IHJA 5FRDA 5HMMA 1MRNA 3KKLA 3OC6A 4GECA 5DBIA 5EY5B 1RZRA 2FWMX 2WBLC 3R7DA 5J2TB 3CNLA 1E3WA 4OLHA 4ETIA 5BVHA 4G8CA 4NE2A 2QIPA 4OCZA 2BHTA 1EFHA 2X3UA 1G6OA 1A5AB 4IDEA 4PLPA 2CBZA 3H65A 2VXYA 3THOA 1XF1A 3HCBA 1N36B 3QU7A 2RIPA 4IP0A 1I4LD 4L8YA 4OQDA 2FUNB 3H2BA 4E5UA 4JI1B 2Q1YA 5HGXA 4OI1A 2MCFA 3U19A 4KN5A 1Z18A 1WMFA 4OHVA 4LE0A 1MJFA 5IBPA 4ZVTA 5HZGA 3MMZA 4OK5A 3KQOA 4C9BA 9LDBA 3ED1A 5A3RA 5KYYA 1K6XA 1U0JA 3L6RA 5JXHA 3ABOB 3HBMA 3VJRA 2VAWA 3CH5A 2G9ZA 4FKMA 4H59A 5M3BA 4WVFA 4YMVA 2ZCVA 1UBHS 4DIKA 4CM6A 4Q3EA 2Z2XA 2QSUA 3WMRA 3LGAA 5JWOA 4KQIA 4RD6A 1UBMS 3IXQA 1A8HA 1C3LA 3T7RA 1FRVA 4J49A 3RSZA 3QE4A 2J09A 4MKRA 3TRFA 1RHMA 3BB1A 2FZGA 1DDOA 4CEIA 2Q5LA 2VHUA 3L82B 3N07A 1BHJA 1OBVA 1BO6A 1I3NA 2BSAA 3O8BA 1Q5PA 4JI3B 1T5OA 5KYTA 1GPYA 1TEXA 2GX6A 5G53C 3TD6A 2CVHA 2V7XA 2ZDGA 2VUSA 3B8EA 3O4VA 4G1UC 5HIMA 2AZXA 1P7CA 1CLUA 2ZWIA 3DD1A 4A91A 1NLYA 1N2CE 2CDCA 3JYLA 3W6NA 1R8SA 1GNLA 2WYIA 4I3FA 3SP1A 4ZK2A 3HWX1 8GPBA 4GWGA 4ZRMA 3T9FA 1U9YA 2WB4A 2GQ0A 1L8OA 3E2PA 1L5RA 3PHCA 5IC6A 4V2UA 3WWOA 3HL4A 1OGIA 3WZMA 4HFRA 3STVA 1SVMA 1UM8A 2NU7B 1E3MA 2G09A 5DCYA 1YL5A 5HNKA 3AIOA 3SSNA 1Q1AA 5JADA 3MMXA 2EGUA 5E38A 5DGIA 5DVZA 4C03A 1S7CA 1L4FA 3KQKA 4OEHA 1PJ3A 3IEXA 1NW3A 3NBYC 1BQ4A 1HURA 1H2YA 2CMGA 2IYVA 2FN9A 3OCJA 4EW1A 5KKNB 1BS9A 1N0WA 1YVRA 2B4KA 2D59A 2Q5EA 7MHTA 1LRLA 1M2FA 1SHZA 1YZVA 1E3JA 2UVDA 3JWIA 2AHRA 2WT9A 3KZXA 3BK1A 1S0UA 4LYGA 4LZJA 3ZN2A 2FMTA 1MVLA 3NHWA 4A8JA 2CLDX 4PYLA 2O7NA 1NULA 5DNCA 3FLEA 1SXIA 4PZEA 4R71A 4JLWA 4RVGA 4UHDA 1JA1A 4KQ9A 3CH4B 3S2FA 1PZXA 2ZR8A 4JJAA 1YZLA 3EGCA 3RRYA 2PJUA 2A3RA 3VKUA 3ZEAA 3LBAA 1NQ5A 2E7ZA 2P7IA 1KIAA 2IYUA 4G5OA 5GONF 5HIKA 2O4CA 2BFMA 2BFBB 3WIEA 1FCJA 3QKWA 3TPFA 3DDOA 1Q20A 2GD0A 5EMKA 3E84A 2VSXA 2RJNA 3DTVA 4TLAA 5LLDA 3RFVA 3TECE 5JH7F 3I8OA 4OJKA 5T67A 1JH9A 1N2OA 2PXAA 3KYDA 1VE1A 1N7GA 3EXAA 3C41J 2AN5A 3PUWA 4LXYA 4BVEA 5BQPA 4OU4A 5JYCA 3AF0A 5ADHA 1JSRA 1WZEA 2X7HA 2WTMA 4EHKA 1SU7A 4NE7A 1GITA 3WB1A 1DMSA 1TEHA 1W96A 1H3NA 1XZJA 4Y18A 4CM5A 2JC3A 1BYUA 2C59A 3MS7A 2VPXA 2IYPA 2J3JA 3K0CA 4U2GA 5GZ6A 2FRVA 2F3QA 5CTJA 4ABTA 1Z5ZA 1YJAA 4M9QA 2E4WA 2YDYA 4QXQA 1XDDA 4B17A 4HGZA 4HRXA 3ZCTA 2W6IA 2OEPA 2XYPA 3KU1A 4RA9A 821PA 2W8BB 2EG9A 1MEOA 1UKBA 4WOPA 4DSZA 2MINB 4LQCA 5BR1A 2QX6A 1DAHA 1Z75A 5KOJA 2HH9A 1N25A 2JJ1D 4HNSA 1IN7A 1WP4A 1E9SA 1T9BA 2JCGA 1DAFA 3AEXA 1TA9A 3CRZA 3DXXA 3EZ9A 3K0EA 2WVHA 1Z4KA 5CAEB 4D92A 2FPIB 4OSEA 4LPSA 4YQFA 1Z4JA 4FOOA 1TA0A 4FJ0A 3Q7SA 1F51E 3PI7A 3WRXA 4R84A 4FHZA 3DKKA 3IVCA 3Q8WA 5LP1A 2BH9A 3UWOA 4QJ5A 5H4GA 4NZOA 1OTYA 1XZQA 2RHDA 4D3YA 9ATCA 3M0EA 2PMEA 3WSTA 3F1KA 1N92A 4KIWA 4XGNA 2WM3A 1G4AE 3D3JA 4Q02A 4Q3BA 4HHEA 4UHBA 5H02A 3NTRA 3Q3CA 2BFWA 4P7KA 3T3PB 1VMAA 1C8BA 1XDGA 2BR4A 2I2CA 1ZIOA 5ALEA 1G9SA 5FIUA 4D4JA 5JT1A 3P0HA 1LSOA 3AR9A 2XCSB 1LFAA 4GLBA 2VJCA 3V5NA 4HWSA 4JOQA 2ZETA 2P9QA 3OPYB 3LXRA 4NPCA 4P34A 4RHUA 5E2BA 1XCLA 1WPQA 4ZVLA 3ZK9A 3T3DA 5IJ0B 1NNUA 2R1UA 4PRLA 2JAQA 3TSYA 2O5VA 4DVJA 1ZD8A 4OQFA 3UBMA 1JEEA 3EIUA 2JDIA 2V9PA 4JBYA 5KTPA 1AQNA 1JZSA 1RDFA 3TX6A 1MMFB 4N7JA 3TG8A 3RPEA 4KIJA 3IMFA 4MVJI 4KITB 3SOPA 4OB6A 2IOFK 2P5SA 2VOEA 4HNAB 1LI5A 1PZMA 2AOUA 1T9ZA 1VE3A 2WV7A 2P77A 4NL4H 4QTZA 5CPBA 1U5BA 3FWPA 3KEQA 3NONA 3OICA 4QJIA 2FEMA 4UBIA 4Z9AA 2EP8A 3EGXA 1E1RD 4O63O 4WOKA 2PUDA 4I08A 4ENSA 5J47A 3Q8XB 4RNCA 1HYBA 2R1VA 3GVPA 2EIHA 2Q4RA 4ZODA 4X64B 3L0PA 5AUNB 3EFBA 5T3UA 3W6PA 3LLVA 1JHPA 3OZIA 1GAQA 1JU4A 1NQVA 1WE2A 2MWMA 2PN1A 2FGJA 2YWRA 4M86A 3VDNB 4BPRA 1KIMA 4TVSA 1L5WA 4URYR 3HE3A 4JVOA 1SXJD 4PNHA 1C0IA 2YN0A 4KDRA 1VXRA 4HGQA 2FPLA 5D00A 5FNVF 3KVYA 5K0CA 3EZGA 5IKEA 1FSPA 4AFNA 1E2QA 4TQUS 1EFLA 4DJFC 1EUCB 1T24A 2GK6A 1G8MA 1XMPA 3JQ7B 3OE7D 5T4EA 4C3UA 1KO8A 3O5AA 1BU5A 2GERA 1HDCA 3FCSB 3M4YA 4FHGA 2EX0A 3IUEA 4LHEA 4ND1A 4DE5A 3RSHA 4OLFA 4QHYA 5FBWB 5F23A 4BNUA 3EFOA 3I1JA 4N6GA 1NMXA 2YHAA 4JY7A 1ZOIA 1L1FA 1IZ0A 1SUEA 3NBAA 4Z3DA 1V11A 1J2EA 2CXQA 3F4BA 2RBEA 3KUCA 5REQB 1KQFA 2QTLA 1Z6TA 3HYLA 4EF6A 2HZ7A 3G2OA 1X0VA 1XVUA 2X4IA 1ZMBA 2VT3A 3CUWA 3DDSA 3ELBA 4MUMA 4C0AC 2BGTA 2PGXA 2VHCA 5HQTA 1Y9JA 1USVA 1SUFA 3UOAB 2GI4A 4R4JA 1XZ8A 2AEFA 4I1IA 4MYSA 2HCRA 1FNDA 1HYEA 4AY3A 1FVOA 2PFSA 5SY6A 1QONA 4J75A 5JIBA 1I7DA 4MVJH 4C7OB 3TIVA 4BP9A 4RD2A 1A5TA 4PLGA 3LNTA 5KB3A 4QFDA 2II6A 2Y1LA 2WA2A 4IRMA 3S2SA 3VVLA 4EY8A 1OW3B 1VLLA 2NZXA 3IULA 5F2KA 1XJWA 2O8BA 4IQ0A 1NIPA 4Q00A 3TYXA 1E2KA 2V7GA 2PUVA 3W9UA 5I7WA 1J24A 2P62A 1MJNA 3TSAA 3BQNB 1SO8A 4MPDA 4HB0A 2HTEA 2IVFA 1CPYA 2C57A 1KJZA 2X9VA 2OV3A 1X15A 3DGFC 2QYSA 4EAQA 4S1OA 4ZCMA 5A6SA 2W6PA 3FJOA 3EGIA 3RCBA 2CWDA 2ZBPA 4B34A 1XVIA 3SM9A 1NVBA 5DGDA 1XYVA 4J16A 5DSZA 5TC4A 3GN1A 4B82A 1E94E 5CCXA 1Q57A 1XRJA 4UUOA 2BMFA 1N78A 2VDRB 1JEJA 5AXCA 3FFBA 4WN9A 5D7BA 4O1MA 3NXKA 4D5EA 3LBFA 2WIJA 3HJTA 3JR7A 2I8AA 3PICA 2OG1A 3AKEA 4B48A 1DUVG 4C87A 1VBKA 2Q0QA 3JZMA 3PF8A 3C4JA 4CQLA 2W0MA 4NRDA 3D7MA 3H8VA 5EIBD 1EK2A 3VPSA 3C6YA 4XPZA 2CCJA 4OJNA 4P4TA 4XASA 4ZEOA 4IS2A 4U3JB 4TYMA 3BSFA 3C3WA 1E9BA 1AJEA 2JJ1A 4JLDA 3V2UA 2ST1A 2FQWA 2ZJ0A 2VHZA 1N8KA 3CUEF 5DP1A 1EXWA 3COYA 3PT5A 4W5QA 3LRTA 4HDNB 3KJXA 4OD0A 4UEWA 2XMSA 1BJKA 1RR6A 2I6TA 1QGOA 4N76A 1A9SA 2PX2A 1G41A 3P94A 3QFTA 2BGIA 5EXTA 1HBJA 2ZUWA 1X7ZB 1VI5A 4YHBA 2JH9A 2Q1XA 3BYZA 4RMHA 5BV0A 1KQNA 4TSFA 2G0AA 3GF4A 1I9CA 2JIQA 4QYIA 5AMXA 1C0PA 5CK5A 2JLSA 2OBFA 5C37A 2FK8A 2QMYA 3OC0A 4HVCA 5JD5A 3KVVA 5HJEA 1IHOA 2HMAA 4RVHA 3WGYA 5KPJA 2I54A 3VX3A 3FPEA 4DL9A 4EJMA 4INAA 1HSOA 4YYZA 4ZYXA 5KDDA 2Q1TA 3S8YA 5FEUA 2O3JA 3D7LA 1WHSB 1L5HA 3ZNPA 4GLJA 3KK0A 4NOLA 4OBBA 1M72A 3ZH9B 4F8JA 1QTNA 3CNEA 4UVDA 5DX0A 1R0BA 4I1VA 3B2QA 3A2KA 2CVPA 1GVNB 3DWGA 3EMKA 1BNCA 3PD7A 4RY0A 1FYDA 1QBGA 4KO4S 4B3RB 4KODA 4TMZA 5AVZA 1IVYA 2XCRB 3HKCB 2NZUG 3HUUA 3CT4A 3IMEA 4G4IA 3BA6A 3DT6A 1JYSA 2WAMA 1CV2A 2G4LA 3IP5A 3QYAA 5J59A 4F9TA 1JNYA 3VJLA 3SNHA 1PR1A 5EIAA 1PU2A 2IUTA 2Q27A 4OQQA 421PA 3GG9A 2W6JD 2UXDB 1M5RA 1CQWA 2OBLA 4INPA 1VDMA 5KX5F 3QEKA 1A7KA 1XTPA 2IOYA 5ALQA 2A0KA 1C4WA 4MW5A 2I76A 5EZSA 1GRCA 4RHYA 3ZQKA 5BURA 1YQWA 5A06A 4DDHA 3G9QA 4E88A 1JLRA 4B84A 2H1WA 3PGXA 1VJTA 1YACA 3HL0A 4ZGGA 4OI0A 4YPFA 4PANA 1DNPA 2QTHA 3UB4A 1TVKA 4PF1A 4RZSA 1OLXB 4OQ4A 3IJRA 4WADA 4O02B 3X0DA 4A23A 2NTJA 2JIDA 2UU9B 3LZCA 4FMDB 2BBTA 2ZVPX 4L8LA 2NQ8A 4G97A 3C15C 4EGCB 2EWMA 1OYOA 1MX9A 1UFVA 4RA6B 3QUTA 3W7AA 4NEGA 1P7YA 1ATIA 2FDCA 3K1AA 1ACLA 3TIXB 4BLWA 4HN9A 3LA6A 4CM4A 3H83A 3LPCA 7YASA 1ZHOA 5JQGA 1C1YA 1JDBC 8ABPA 1QLHA 4HD8A 1IPFA 2BSQA 4IM7A 3AKCA 3BILA 1ZYUA 3VPFA 2PGJA 1WZCA 3SYTA 3TJMA 2IUFA 3U13A 1GKIA 3GDGA 1RT9A 1Z2OX 5F7OA 4TMKA 5K0FA 1V71A 3VMMA 3IUMA 3C8HA 3NIWA 2C1ZA 2IPXA 1H1LB 4BVBA 1FF9A 2OB1A 4WLUA 1NQOA 2IEYA 3G5TA 4D0LB 1WM1A 1ORRA 5KYKA 1ID8A 1GQOA 4OHBA 3DUWA 3BFXA 2IY7A 4NV0A 1W44A 4UAJA 1P7PA 2X8WA 1NVVQ 4MR8B 4F3KA 4RIEA 3ZCUA 1WU7A 1AA9A 2A14A 2A4MA 3EXHC 3N3AC 3OT1B 4JGIA 1FPQA 1KO4A 5H3CA 1ONPA 4GMFA 3CVVA 1VGQA 1E0DA 4Q3NA 4DMFA 2C9OA 5ADVA 1V1MB 1L4UA 2WNHA 5FUMA 2PFGA 4KZPA 2ZRIA 4F04A 5KDOA 1GSIA 2MR6A 4GI7A 2QMUA 2NTEA 3IHTA 4MVJM 4LE1A 5BQXA 3PEYA 3I9V6 1M2EA 4PE5B 4A8PA 5AOVA 4RQTA 1EZZA 2EG5A 5TGZA 4NFLA 1OFUX 5B36A 3P0IA 3P0RA 1LI4A 5FUBA 3UGQA 5BXQC 1W76A 5CPFA 4YI3A 3I45A 4Q4HA 1EBUA 4ZCQA 2F90A 4ZRDA 3QKIA 2WZCA 4B87A 1DKPA 2IHZA 1U99A 3HLYA 2C2HA 1M2VB 5CIYA 5EKSA 4QA9A 5DH9A 3WYBA 4I9FA 1E5DA 2GKOA 4HRYA 4R8RA 4A6EA 2B0JA 5JVDF 4WOJA 1DIHA 5ES4B 1WKCA 3MIIA 1MC1A 3AHHA 3M49A 4YAWA 1NUSA 4IKPA 1QE3A 2ODPA 1M34B 1KXZA 2ZIXA 4CJXA 2AWNA 4QTYA 5CDYA 4U0JA 1E58A 3MCUA 4U9UA 4KQ6A 3BMQB 2R65A 3AR6A 3HJCA 4OUDB 2ZT8A 5H70A 3ZDYB 2W83A 4XQCA 4EEKA 4OATA 4RPHA 3MT9A 1E1CA 3X43A 4UDNA 2O6LA 2Y05A 4YLYA 4P4SA 5JNSA 3BVPA 4QECA 1JTFA 5FBKA 3FBTA 5HDBB 4ZZ0A 3JQCA 4HN4B 3JQBA 3VYWA 4A27A 1XAJA 1H2BA 1YKGA 4PG5A 4D0SA 3UUFA 2VA9A 3BDAA 1E2LA 2EZTA 4LNHA 2WF8A 2C9YA 5E7IA 5D3QA 4TTQA 2JFYA 5EINA 1ZN7A 3JY6A 3WL6A 2IGBA 3OJCA 4BKRA 1IEXA 1GV0A 2NO5A 2PZ8A 3P9KA 4L4SA 4DUGA 1Z36A 2O2GA 1T1IA 4F3TA 3L6CA 4KBGA 5K09A 4Q7LA 3QV1A 3CC8A 3FTNA 3R9XA 5CVVA 1XL0A 2G7ZA 1C80A 2NUPA 5KVVA 3UQZA 4RTMA 3RIMA 1OR8A 3FYHA 4MP8A 1YV9A 3VOBA 3ZWCA 3MJRA 1WABA 3LYUA 1K7SN 3MBKA 5KDLA 1PJSA 4S1WA 3SHWA 4BE9A 2K87A 2W9XA 3DE3X 3AK4A 3MQ4A 3HVIA 2PH3A 1PFYA 2FMXA 5ED4A 4O08A 5FI1B 2VJPA 2YNMD 1WOYA 4ML3A 3NVDA 1S2NA 3OU2A 5F98A 2AOTB 3O0DA 3UK0A 1OC2A 4US1R 3GNSA 3AJ9A 2IYAA 2Z83A 1K8XB 3GHYA 4YAEA 4PC2A 4CKEB 4HQFA 2EJTA 1QRSA 4J4HA 4CUZA 1DELA 2UYQA 4IXTA 2YYYA 2BMDA 4I2NA 4W5WA 4YJ2B 2W6JA 3PEVA 3B36A 2QRLA 5ESXA 4FSHA 2Z9DA 2AK3A 3L1VA 2ZE7A 4GSYA 4F9EA 5IF9A 1EWKA 4MDYA 4WNCA 4DA4A 2P69A 5LJLA 4MHSA 3LHSA 3A04A 3L18A 5F35A 3SNKA 2CWWA 3AVOA 3BWCA 1ZITA 3CXUA 1N6LA 4HB4A 5DEIA 5F73A 3RSLA 4KX3A 3H2ZA 1TCVA 4PZ0A 2DT8A 2J67A 4FEAA 4GPTA 4LECA 5BYKA 3CVYA 3GJ4A 5CGZA 3RUEA 1MG0A 3Q6MA 3RWOA 5C7OO 2FZLA 1ZJWA 3PUHA 2QX7A 5EJ2A 3GLHA 3D8TA 4ER6A 5FKJA 5J4KA 2VF2A 5KYVA 2QLBA 4F3YA 5FPKA 4IJ5A 2BFPA 2WD8A 4QSHA 5HF5A 3ETNA 5DHQA 4ZXPA 3KE8A 1IUNA 5K5EA 1FX1A 3E9MA 3DKIA 5ALHA 4FYVA 2GFQA 1TUEA 2F3RA 1XNRB 2BP7B 4G36A 1MBZA 1N57A 4CKZA 3NHKA 1WEKA 3C8ZA 5CLFA 4C7JA 2WSLA 3X1KA 2QEQA 3DZJA 4L8FA 1TF7A 2M1ZA 2Q2QA 4PAQA 1YI1A