4YAVA

Crystal structure of ligg in complex with b-glutathionyl-acetoveratrone (gs-av) from sphingobium sp. strain syk-6
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
262
structure length
260
Chain Sequence
PQELTIYHIPGPFSERVEIMLELKGLRMKDVEIDISKPRPDWLLAKTGGTTALPLLDVENGESLKESMVILRYLEQRYPEPAVAHPDPFHAVEGMLAELAGPFSGAGYRMILNREIGKREEMRAAVDAEFGKVDAFLKRYATGSDFLFDDRFGWAEVAFTPMFKRLWFLDYYEDYEVPANFDRVLRWRAACTAHPAAQYRSKEELLKLYYDYTQGGGNGRIPEGRSISSFSPDVDWRTRPMPPRDKWGHAATDAELGLTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase
publication title Structural and Biochemical Characterization of the Early and Late Enzymes in the Lignin beta-Aryl Ether Cleavage Pathway from Sphingobium sp. SYK-6.
pubmed doi rcsb
source organism Sphingobium sp. syk-6
molecule tags Transferase
total genus 83
structure length 260
sequence length 262
ec nomenclature
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
A PF16865 GST_C_5 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4yavA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4yavA01
2HRKB 4V1Ag 4OFMA 2V1MA 4YQMA 1YF1A 4KGIA 4Q5RA 2CX3A 5INYA 2C80A 1GTUA 1ERVA 1XW6A 1EGRA 6GSTA 2GZZA 2PVOC 3EURA 3HY2A 1K0CA 3DIEA 3C1RA 4ZBAA 3N5OA 2I81A 4X1UA 3IOSA 5G30A 3EE2A 4IQ1A 3A3TA 3HA9A 3APQA 3GL5A 2K8SA 3GTUA 2V6KA 4XHMA 3EINA 2GQMA 4WBRD 4NXIA 4BVYB 2GSRA 4WR4A 2HSYA 2GSSA 1FHEA 4OD7A 2B7JA 1VF1A 4O92A 1GSEA 1AXDA 3BCKA 2L59A 3GYKA 1M2AA 1JZRA 3IXRA 5GZZB 1AIUA 3IDVA 3RBTA 1TJDA 1MEKA 4HZ2A 5ELGA 1ST9A 5D8IA 2MYGA 4JZQA 1HNAA 3J7Yk 3IC4A 2GDRA 4JEDA 1MD3A 1ACVA 4GXZA 2KOKA 3GNJA 1V98A 3C7MA 4ZL8A 3KH7A 3PINA 6GSSA 1YJ6A 2IMEA 1GSUA 3G7JA 4ACSA 1ABAA 2FY6A 3LXZA 4MF7A 3O3TA 3HZ8A 4CDOA 2P5QA 5D73A 3F4SA 5EPFA 1IYIA 1YDKA 4PGTA 5JCWA 3GSSA 2C3NA 1FB0A 3H8QA 1B4QA 2GVPA 1AAZA 1FW1A 1ERWA 1J0FA 3FK8A 4I6XA 2B1LA 2CV4A 1YY7A 3HVVA 5CRHA 1HD2A 3VURA 1QUWA 5DCGA 1PX6A 2N5AA 2YJHA 1WWJA 4ECJA 2HT9A 1M0UA 3I69A 2R2JA 4PQIA 2CT6A 3IK7A 2H75A 4J56E 1QK8A 2E2GA 1XWCA 1TP9A 4KDUA 4NAXA 1SJZA 3UVTA 2WS2A 12GSA 1EZKA 2FHEA 4PX1A 5DCHA 2HSMB 10GSA 1X5DA 1X9MB 4MP4A 1PL2A 5ECPB 1DE2A 4FQUA 3ZMKA 3IA1A 1V40A 3G7IA 1ZZYA 3P7XA 2PGTA 1ON4A 2Z9SA 2FA4A 1M9BA 3UBKA 1GSQA 1TI1A 2PUKC 2AAWA 3FZ9A 3ZIJA 3HDCA 3MSZA 3TKSC 4EDYA 11GSA 3EMPA 2R37A 2LS5A 4HU7A 3EYTA 3GKMA 5CNWA 3TKPA 2RM5A 5H5SA 2VD0A 3QD9A 3FZAA 3CSHA 4L5OA 2ON5A 3VI7A 1ZGNA 2PWJA 5IMZA 2REMA 1OVNA 4XTSA 2LNTA 3F3RA 1LJRA 3KTBA 5C04A 2AV4A 6GSWA 3GKNA 4K0NA 1GLQA 2R6KA 2VO4A 3HJMA 3BOAA 4MPFA 1SYXA 4MF5A 5DDLA 4IW9A 4F03A 1NHYA 1O6JA 1A23A 1U6TA 2FUG2 3IPZA 4OWYA 2VCXA 1Z3EA 5B8BA 3FRCA 3VFIA 1GLPA 1KBNA 2N5BA 4XS1A 1OE7A 1X5CA 3RHCA 3Q18A 4BVXB 1T8EB 1V57A 2GS3A 4N30A 2YV7A 2WULA 5ECRB 2CVBA 4L0WA 2C0EA 1YEXA 2V6OA 2GZYA 1Q98A 4XS4B 1PKZA 3KJYA 1GRXA 2BTOT 3D4TA 4H86A 4NPBA 2EIQA 5DBQA 2GT5A 2O87A 5A4UA 4MJCA 4V2LA 3C1SA 4EF0A 1N8JA 1F37A 3GN3A 3SWLA 3S9FA 2MBTA 4G19A 3TB2A 1WMJA 1QXHA 4POMA 2GSQA 2FD3A 5CRGA 5AIVA 5F07A 4V1Ap 2MMZA 4Z7XA 2HRAA 2I9HA 2DSAA 1GL8A 3EWLA 3U6VA 1SJIA 2HRKA 3VI5A 2C3QA 2CVDA 2RUFA 1SK1A 1V58A 3TKSE 4MK3A 2B7KA 4J2FA 2BJXA 4LMVA 5J9CA 1Z9HA 5ID2B 5J3RA 1MTCA 4F0BA 5ECKB 1W4VA 6GSYA 3ZRDA 5GSSA 3HXSA 2WJUA 2PVQA 4MMMA 5G1KA 4I97A 1FVJA 3ZITA 1C72A 3PGTA 4HOJA 2ALBA 4FYBA 4IP1A 4F0CA 3CMIA 3GURA 3Q74A 3ZYWA 1BX9A 4QL9A 1MD4A 2ZUPA 4QQ7A 2YPMA 4ECBA 2J23A 4BVYA 3IRAA 4KAEA 5IMCA 5GSTA 1M2DA 3LXTA 2KP1A 3KM6A 3UBLA 5EVOA 1Y25A 4GF0A 4X0XA 3F6FA 2FWFA 1URMA 4PTSA 4K0GA 4MLYA 1HQOA 2KLXA 1XVWA 3QAWA 5AISA 4ZBBA 2LUSA 5KN3A 1S3AA 2DMLA 1T4ZA 3LORA 2CVKA 2DJJA 3A5WA 5ECQB 1SL0B 1WE0A 5IIZA 4KH7A 3APOA 1SD9A 2WGRA 4FYCA 5LD0A 1CQHA 1Z6NA 5A4WA 4I2TA 4DVCA 3KGKA 1K0MA 3F6DA 2YV9A 1EP8A 2L4CA 2OA7A 1K3YA 2MZCA 2YN1A 1B9XC 2WCIA 1XVQA 3QMXA 4FH8A 5CRDA 5HFGA 2YWNA 5CRWA 5B8AA 2ZCTA 1X0RA 2NBSA 2DJ1A 1ZMAA 4IJ3A 4XRAA 1Z7RA 3A2WA 3VWVA 5LNKe 3FHKA 4JBBA 8GSSA 2FWGA 1A8YA 2JL4A 2X64A 1S3CA 3KXOA 1SL1B 1PA3A 4MCUA 3H4KA 4IVFA 4JRRA 4BWSA 2LRTA 5HR1A 1O73A 4G2EA 5B6NA 6GSXA 3PH9A 2H1GA 5B7CA 2GQLA 4HJ2A 1T7PB 4G10A 5IO2A 3LGCA 3ME7A 3Q19A 2HSMA 2DIZA 2VCZA 2K18A 4POBA 1B9YC 1XWAA 4TR0A 5IPHA 1WJKA 3ERGA 1T00A 2L5LA 3ZREA 5ELAA 2VL2A 2JSYA 1XOBA 3P2AA 3ZVJA 5E59A 4MJAA 4L5LA 2C0FA 4EE0A 2G0FA 3IV4A 2AHEA 3OR5A 2VLVA 20GSA 2XBQA 3UIWA 2IPAA 1SKRB 5G2ZA 3U5RE 1SD8A 3D22A 3FR3A 5D9XA 3NIVA 2IIYA 2XPDA 1TRUA 6GSUA 1A8LA 3K8NA 5GAPD 1EV9A 3TGZA 2IMDA 5IO0A 1EOGA 4K2DA 1X5EA 4WXTA 1G7EA 1I5GA 1TI3A 4EL1A 4MPGA 3ISOA 1BYEA 3C8EA 4ZB9A 1TXXA 3BJ5A 4OFNA 5ENUA 2PN8A 2H1BA 4GQCA 2HE3A 1DSBA 6GSVA 4MZCA 1R26A 2F51A 2CAQA 5IMFA 3GFKA 5G31A 5J9BA 1VF4A 4LLRA 1TOFA 1XXUA 1QGVA 2I1UA 1VF3A 2JU5A 4HZ4A 3GH6A 1ZOFA 1B48A 5IMAA 4OO5A 3IAS2 4BVXA 4J57E 3CSIA 4JE1A 2L6DA 1X9WB 1DBYA 1Y6EA 1PRXA 2YWIA 3HVSA 3CRUA 2H6ZA 1O8WA 2R4VA 2VCQA 3TOTA 2MMAA 4CHSA 2F9SA 4XS4A 4ZIJA 4OMVA 1RQMA 3E9JB 5ECIB 1GSDA 2OE0A 2H74A 1ILOA 1CQGA 3TJFA 2J9HA 3D0ZA 1ZYEA 4WETA 2B1KA 4BA7A 3MNGA 2DMMA 2VIMA 2C8UA 1X9SB 3UEMA 3L9UA 5IPGA 3L9SA 5CO3A 2ZNMA 4E8HA 2YP6A 2H0IA 5FHIA 1KTEA 4XCSA 4RI7A 5JWOB 2C0GA 2NPBA 1QMVA 3HKRA 1YF0A 4KSMA 5DVBA 1BQ7A 1EP7A 1FO5A 4DSSB 2FA8A 1PKWA 3TRPA 1GTIA 5ID2A 4EKZA 2JACA 2LJKA 1SYRA 4I2UA 1OC9B 3TOUA 4TVEA 5IOWA 1TDIA 1VRSD 3DWVA 2VM2A 4WEYA 4WKWA 1UVZA 3GHAA 1E6BA 3H1NA 1V9WA 2P31A 1F6MC 2CAIA 2DJ0A 1F3BA 3GV1A 2IMIA 4EXJA 2FNOA 2PBJA 1K0OA 3TKRA 1TRSA 3QDNA 3RHBA 3EVIA 5ECNB 4FYUA 3O6TA 4GSNA 3UVHA 3FYGA 2F8FA 1OKDA 1A2JA 1Z7PA 5ECOB 3VLNA 3NZNA 4HDEA 2V2GA 2WFCA 4ZL7A 1DE1A 4KX4A 3F63A 5DQSA 2H73A 3QCPA 4D73B 1JLVA 1BG5A 2RIIA 2FWEA 5ECHB 2MMNA 2B5XA 3BCIA 5CYYA 3LYPA 1TKDB 3FZ5A 4OCFA 2G2QA 4TR1B 1OE8A 2KP2A 1K0BA 2EIRA 2R5GA 4AJ6A 1G6YA 1G6WA 4FO5A 3D5JA 2H19A 5BMUA 3ERWA 3KP8A 3ZMLA 4NHWA 2OE3A 2LQOA 1U87A 2YNXA 1YQ1A 5DAKB 4GQFA 1GULA 3VWXA 2YANA 2X8HA 4WBJA 3DEXA 1EEMA 2QGVA 3MDKA 3US3A 4YQUA 1TW9A 5DQYA 4L0UA 2JADA 4HQSA 2K6VA 1U3AA 2MMOA 2OADA 3KTLA 3I6AA 4POLA 3DRNA 3JCML 5ABRA 1GTAA 1ML6A 2HNLA 2LTKA 4ZB8A 5CREA 2E2MA 3ZFBA 4P3YB 3IR4A 3QR6A 5B6MA 4POKA 1NM3A 3TRXA 3J7Yb 3EMXA 1AW9A 5ECMB 2BMXA 4MZWA 1J08A 4O5RA 3QAVA 3VWWA 2CQ9A 4KDXA 4IBPA 2GGTA 1U88A 2C3TA 2P0GA 2O85A 2FLSA 2LEGA 3EU3A 4OCEA 1VGLA 2VCWA 1FG4A 1TU7A 3ZFLA 2O8VB 4L8EA 1EGOA 3EC3A 3FEUA 2KHPA 1SKWB 4RQXA 1NSWA 1DUGA 9GSSA 4KSOA 1YKCA 4USSA 4NWYA 2GQKA 5F06A 4BL7B 1ERUA 3M3MA 2JZRA 4Q5QA 2L57A 4WF5A 4I5QA 4O32A 4TR4A 2X99A 3DKSA 1EEJA 2N5FA 3TUEA 4TN8A 4ML1A 4PNFA 2AUVA 1K0NA 1PQNA 2MBSA 1VF2A 1AQWA 1GTBA 3WYWA 3GUSA 5A4VA 4IP6A 4BPYA 1LBKA 4DEJA 2B5YA 5KN0A 4LMWA 4Q5NA 5G5EA 1HYUA 1MDKA 3GA4A 4MH2A 1PGTA 5J4UA 2LV3A 4V2NA 2CZ3A 3L9VA 1F3AA 2R3XA 1GH2A 5D9WA 3VPTA 1XWBA 3WGEA 1XBSA 2HSNB 2WZ9A 3G7YA 5IOXA 3HCZA 2PERA 1Z5YE 2OBIA 2LJRA 3MAKA 3GMFA 4HS1A 2VLUA 3F8UA 4RI6A 3LQ7A 4NMUA 1O8XA 2GTUA 5HR0A 4BWQA 3W8SA 4G0IA 4KB3A 4JR6A 3UARA 1AC1A 3BD2A 1SJ6A 1PL1A 2LQQA 3A2VA 3ERFA 5CAXA 3HYPA 2VL2C 2C1YA 3IE3A 2HI7A 5ECSA 5IQYA 1RW1A 2H01A 3I43A 1PD21 4MA9A 4IQAA 4YQVA 2DJ3A 3LFLA 2HQTA 4LL1B 2NTOA 5DALB 1PMTA 3KH9A 2L5OA 5EL8A 4DSSA 3HHVA 4PQHA 4ISDA 5COHA 1A24A 2PMTA 3GKKA 4ZILA 1EOHA 2YCDA 3TCOA 2RM6A 4IN0A 2B6MA 3APSA 3CTGA 1JZWA 4RQRA 3ZVJD 4EO3A 2LKUA 3GL3A 1GSFA 2JZSA 5DJMA 3KMNA 1NW2A 4V2MA 1ZYQB 1OC9A 1K0DA 2AJQB 3DGQA 4AJ7A 14GSA 4ID0A 1HNCA 2H1AA 4RUVA 3M9JA 5EY6A 4N0ZA 2C0DA 5H5RA 2B3SA 2GSTA 1PN9A 1KEBA 1T4YA 3CTFA 3DMLA 4IHUA 4KCAA 5GAND 2YJ7A 4AF2A 2C4JA 1XCCA 4K8MA 1GNWA 2PPTA 1XOAA 2IMKA 1UC7A 2HLSA 2FGXA 2DC5A 1H4OA 4K6XA 2AYTA 1ZL9A 2H30A 2LRCA 3WT2A 4D73A 5G5FA 3L4NA 5DJLA 4K1FA 3D6IA 2K9FA 5D93A 19GSA 4K7IA 4GWRA 3PR8A 1M9AA 3R3EA 1GP1A 4ZL9A 2HYXA 3V1WA 3L0HA 2YZUA 4MABA 4TR1A 3RPNA 2TRCP 4G0LA 1WIKA 4IS0A 2V41A 2DBCA 4KCEA 3SBCA 1R4WA 3QPMA 1TTZA 5KN1A 4F9ZA 3F0IA 2TRXA 5DAKA 4DSQA 2VL3A 4G9HA 5D9VA 2IWTA 1SENA 1EV4A 2HZEB 3KP9A 3TDGA 2L6CA 5FWGA 2I3YA 1QFNA 3TJBA 1SU9A 3LJRA 1XFLA 5KEJA 1PX7A 1XWKA 3P90A 1JZDA 4TKYA 3IC8A 1XWGA 2DJKA 4WR5A 3QFAC 1AQXA 1WP0A 2OBKA 1E2YA 4TXVA 1XIYA 1SK2A 3QOUA 1G0TA 3WGDA 2XBIA 1XZOA 2VLTA 1K0AA 3ED3A 3KMOA 4XIHA 1YKAA 4IJIA 2IFQB 3O76A 1RK4A 1UA5A 3DVXA 4ZB6A 1Q4JA 4TXOA 2IL3A 3GX8A 3GSTA 5J5NA 2VUPA 1H75A 4Q5FA 1IYHA 5G1LA 1FOVA 2IN3A 1TRVA 3VPQA 2FWHA 5JCGA 3IK9A 4NV5A 2VCVA 4KUNA 18GSA 2A2RA 3IAM2 4K7NA 3E3EA 1A2LA 1S3DA 2VD1A 2OKAA 2GLRA 4HEA2 2OE1A 4BL7A 2HXKA 4ECCA 4MF6A 1YEPA 2NDOA 3E0UA 5C00A 3CRTA 2LNSA 4KF9A 1O85A 2LJAA 3F9UA 1YZXA 3G9BA 1MDIA 4GRFA 4YAVA 1OC8A 2UZ8A 4AGSA 4F2IA 5FT3A 1WOUA 2HSHA 4HI7A 5AN1A 4I8BA 2RLIA 4FIWA 4ILFA 3M0FA 4MZBA 3FR6A 1GSYA 2IMFA 2YOIA 2O7KA 3ME8A 3GH9A 4N10A 1UN2A 2DLXA 2VAFA 2X8GA 2AB6A 5IMDA 1M2BA 3H93A 5HR2A 3N9JA 2V32A 2DJ2A 2H71A 1O81A 2JZTA 4F82A 4IELA 3FW2A 2L4QA 4PURA 4HU9A 1NHOA 3UL3A 5E4WA 3AY8A 4KE3A 2HFDA 2VOCA 5LCZA 1M99A 3HJPA 2H1DA 4YH2A 3MWHA 1GUKA 1HNBA 1XW5A 2GZPA 5AIXA 1JZOA 2A2SA 2WDUA 4KA0A 3M8NA 3TJKA 1R5PA 2VL9A 4WF4A 3ZL5A 2XHFA 2EIOA 5D96A 3IHQA 1G7OA 22GSA 1QQ2A 4TOPA 4HQZA 1GUHA 4PUAA 5DALA 1EWXA 1THXA 3KEBA 3GTUB 2H76A 2M72A 3H79A 2F3MA 4GSSA 1V2AA 2TIRA 4MH3A 3GX0A 5D9TA 1J9BA 5F8BA 4KNDA 1K3OA 1USBA 1TK8B 4CW9A 4O7HA 3DYRA 2KUCA 3WD6A 2E7PA 3GKXA 2LRNA 2LSTA 3DD3A 5ECLB 3QAGA 3FR9A 1F2EA 3TKSA 3M1GA 1SK0A 3D21A 1OYJA 2GT6A 3ZIVA 4TR3A 1U3IA 2E0QA 2CX4A 3IBHA 2O89A 2PU9C 4GSTA 5HR3A 3HD5A 4ZBDA 2XC2A 4ML6A 4ULXA 1T1VA 3P8WA 3F4RA 3NOFA 2QC7A 5J41A 3FY7A 2QSIA 1OC3A 3HZ4A 3KZQA 1FVKA 3FKFA 3DVWA 2X8CA 4TXOB 2OJLA 2OACA 5H5QA 5IM9A 2VM1A 1T3BA 2XPEA 2VCTA 1M7TA 1GWCA 5IMVA 4JR4A 4K9ZA 1I9DA 3UJ1A 3D4MA 5HFIA 5HQPA 1FB6A 2IJYA 2HRFA 3CYNA 4MJBA 5L71A 2H6XA 3FZ4A 4YAPA 3A2XA 3WT1A 4ZXGA 3LSZA 1BAYA 3RAZA 3TJJA 5JCUA 4PXOA 1R7HA 3UMAA 1XW9A 4HUAA 2CA8A 1N2AA 4GLTA 3KIJA 3LG6A 1XPVA 3CXGA 2F8AA 3HJOA 4E8EA 3F3QA 2RUEA 3ZLPA 2HZFA 2H70A 5JWQB 4EUYA 4KW6A 3LWAA 13GSA 3HVXA 1B4PA 3WGXA 1Z6MA 3CBUA 4LL4B 1WRYA 4EDZA 4G0KA 1B8XA 4PUFC 1A2MA 1TK5B 1F9MA 2CZ2A 4EC0A 3VK9A 1KNGA 2HZEA 3QFBC 3C73A 5AGYA 4NV2A 7GSSA 2WB9A 4DSRA 4N0VA 4PQ1A 3DXBA 4IGJA 3TKQA 2D2ZA 1AUCA 5KN2A 1BEDA 3F4TA 5A5KA 16GSA 2H6YA 3ZTLA 3R2QA 4OO4A 3TRQA 1MDJA 4JU5A 2IFQA 2H0HA 1SL2B 5F05A 2I4AA 4IKHA 2NVLA 17GSA 3W6GA 3ZZXA 2A4VA 2H66A 1SKSB 2M46A 1JLWA 2H0GA 3L78A 2K8VA 3GIXA 2WRTA 1JFUA 1TU8A 3PPUA 1OAZA 3GRXA 2YZHA 3LYKA 1THOA 2ES7A 1A0FA 4ECIA 2YWOA 4HJMA 1K3LA 1AQVA 3TJGA 1TRWA 3UOMA 4MJEA 3UAPA 2B5EA 2H8LA 4PNGA 3KCMA 3Q6OA 1TK0B 3LEFA 2EC4A 4GCIA 2ON7A 1WPIA 4TW5A 2FCHA 4XRDA 1OKTA 1R5AA 2DIYA 2H72A 3VWUA 5HFKA 3KD0A 1BJXA 2P5RA 3RPPA 3RDWA 2YWMA 1GUMA 4GTUA 1GNEA 4QL7A 1ZCPA 1O7UA 3CSJA 4AJ8A 2JSZA 1JHBA 2QKEA 3M9KA 4EVMA 4XS6A 4OFTA 1ERTA 4TRXA 1A0RP 4LA1A 4MDCA 1W89A 3BBYA 5JWRB 5F0GA 4NHZA 3EU4A 4KDYA 2M80A 1LU4A 4N11A 2HRNA 3I9V2 4K7OA 1PSQA 1FAAA 5CP1A 1GSSA 3C71A 3W8JA 4X43A
chains in the Genus database with same CATH superfamily
2HRKB 4V1Ag 4OFMA 2V1MA 4YQMA 1YF1A 4KGIA 4Q5RA 3HVNA 2CX3A 5INYA 5A1NA 2C80A 1GTUA 1ERVA 1XW6A 1EGRA 6GSTA 2GZZA 2PVOC 3EURA 3HY2A 1K0CA 3DIEA 1TXUA 3C1RA 4ZBAA 2A4HA 3N5OA 2I81A 4X1UA 1S3RA 3IOSA 5G30A 3EE2A 4IQ1A 3A3TA 3HA9A 3APQA 3GL5A 4K5SA 2K8SA 3GTUA 2V6KA 4XHMA 3EINA 2GQMA 4WBRD 4NXIA 4BVYB 2GSRA 2WW2A 4WR4A 2HSYA 2GSSA 1FHEA 4OD7A 2B7JA 1VF1A 4O92A 1GSEA 1AXDA 3BCKA 2L59A 3GYKA 1M2AA 1JZRA 3IXRA 5GZZB 1AIUA 3IDVA 3RBTA 2UV8G 1TJDA 1MEKA 4HZ2A 5ELGA 1ST9A 5D8IA 2MYGA 4JZQA 1HNAA 3J7Yk 3IC4A 4N3ZA 2GDRA 4JEDA 1MD3A 1ACVA 2KOKA 3GNJA 4GXZA 1V98A 3C7MA 4ZL8A 3KH7A 3PINA 6GSSA 4YKGA 1YJ6A 2IMEA 1GSUA 3G7JA 4ACSA 1ABAA 5J4YA 2FY6A 3LXZA 4MF7A 3O3TA 3HZ8A 4CDOA 2P5QA 2O36A 5D73A 3F4SA 5EPFA 2EFDA 1IYIA 1YDKA 4PGTA 5JCWA 3GSSA 2C3NA 1FB0A 3H8QA 1B4QA 2GVPA 1AAZA 1FW1A 3MIXA 1ERWA 1J0FA 3FK8A 3CHXC 4I6XA 2B1LA 2CV4A 1YY7A 3HVVA 5CRHA 1HD2A 3VURA 1QUWA 5DCGA 5J47A 1PX6A 2N5AA 1Y1UA 2YJHA 1WWJA 4ECJA 2DKIA 2HT9A 1M0UA 3I69A 2R2JA 4PQIA 1ZYNA 2CT6A 3IK7A 2H75A 4J56E 1QK8A 2E2GA 1XWCA 1TP9A 4KDUA 4NAXA 1SJZA 3UVTA 2WS2A 12GSA 1EZKA 2FHEA 4PX1A 5DCHA 2HSMB 1SVMA 10GSA 1X5DA 1X9MB 4MP4A 1PL2A 5ECPB 1DE2A 4FQUA 3ZMKA 3IA1A 1V40A 3G7IA 1ZZYA 3P7XA 2PGTA 1ON4A 2Z9SA 2FA4A 4ICYA 4Z2TA 4AKHA 1M9BA 3UBKA 1GSQA 1TI1A 2PUKC 2AAWA 3FZ9A 3ZIJA 3HDCA 3MSZA 3TKSC 4EDYA 11GSA 3EMPA 2R37A 3CQFA 4GDFA 2LS5A 4HU7A 3EYTA 5A34A 3GKMA 5CNWA 3TKPA 2RM5A 5H5SA 2VD0A 3QD9A 3FZAA 3CSHA 4L5OA 2ON5A 3VI7A 1ZGNA 2PWJA 5IMZA 2REMA 1OVNA 4XTSA 2LNTA 3F3RA 1LJRA 3KTBA 5C04A 2AV4A 6GSWA 1M3IA 3GKNA 4K0NA 1GLQA 2R6KA 2VO4A 3HJMA 3BOAA 4MPFA 1SYXA 4MF5A 5DDLA 4IW9A 4F03A 1NHYA 1O6JA 1A23A 1U6TA 2FUG2 2EFHA 3IPZA 4OWYA 2VCXA 1Z3EA 5B8BA 3FRCA 3VFIA 1GLPA 1KBNA 2N5BA 4XS1A 1OE7A 1X5CA 3RHCA 4O5QA 3Q18A 4BVXB 1T8EB 1V57A 2GS3A 4N30A 2YV7A 2WULA 5ECRB 2CVBA 2H1LA 4L0WA 2C0EA 1YEXA 2WW3A 2V6OA 2GZYA 1Q98A 4XS4B 1PKZA 3KJYA 1GRXA 2BTOT 3D4TA 4H86A 4NPBA 2EIQA 5DBQA 2GT5A 2O87A 5A4UA 4MJCA 5BRTA 4V2LA 3C1SA 4EF0A 1N8JA 1F37A 3GN3A 3SWLA 3S9FA 2MBTA 4G19A 3TB2A 1WMJA 1QXHA 4POMA 2GSQA 2FD3A 5CRGA 5AIVA 5F07A 4V1Ap 2MMZA 4Z7XA 2HRAA 2I9HA 2DSAA 1GL8A 3EWLA 3U6VA 1SJIA 2HRKA 3VI5A 2C3QA 2CVDA 2RUFA 1SK1A 1V58A 3TKSE 4MK3A 2B7KA 4J2FA 2BJXA 4LMVA 5J9CA 1Z9HA 5ID2B 5J3RA 1MTCA 4F0BA 2WW1A 5ECKB 6GSYA 1W4VA 3ZRDA 5GSSA 3HXSA 2WJUA 2PVQA 4MMMA 5G1KA 4I97A 1FVJA 3ZITA 1C72A 3PGTA 4HOJA 2ALBA 4FYBA 4IP1A 4F0CA 1FOHA 3CMIA 3GURA 3Q74A 3ZYWA 1BX9A 4QL9A 1MD4A 2ZUPA 4QQ7A 2YPMA 4ECBA 2J23A 4BVYA 3IRAA 4KAEA 5IMCA 5GSTA 1M2DA 3LXTA 2KP1A 3KM6A 3UBLA 4CY8A 5EVOA 1Y25A 4GF0A 4X0XA 3F6FA 2FWFA 1URMA 2WVXB 4PTSA 4K0GA 4MLYA 1HQOA 2KLXA 1XVWA 3FMWA 3QAWA 5AISA 4ZBBA 2LUSA 5KN3A 1S3AA 4FXYP 1T4ZA 2DMLA 3LORA 2CVKA 2DJJA 3MYDA 3A5WA 1YEWC 5ECQB 1SL0B 1WE0A 5IIZA 4KH7A 3APOA 1SD9A 2WGRA 4FYCA 5LD0A 1CQHA 1Z6NA 5A4WA 4I2TA 4DVCA 3KGKA 1K0MA 3F6DA 2YV9A 1EP8A 2L4CA 2OA7A 1K3YA 2MZCA 2YN1A 1B9XC 2WCIA 1XVQA 3QMXA 4FH8A 5CRDA 5HFGA 2YWNA 5CRWA 5B8AA 2ZCTA 1X0RA 2NBSA 2DJ1A 1ZMAA 4IJ3A 4XRAA 1XG8A 1Z7RA 3A2WA 3VWVA 5LNKe 3FHKA 4JBBA 8GSSA 2FWGA 1A8YA 2JL4A 2X64A 1S3CA 3KXOA 1SL1B 1PA3A 4MCUA 3H4KA 4IVFA 4JRRA 4BWSA 2LRTA 5HR1A 1O73A 4G2EA 5B6NA 6GSXA 3PH9A 2H1GA 5B7CA 4E68A 2GQLA 4HJ2A 1T7PB 4G10A 3EPTA 5IO2A 3LGCA 3ME7A 3Q19A 2HSMA 2DIZA 2VCZA 2K18A 4POBA 1B9YC 1XWAA 4TR0A 5IPHA 1WJKA 3ERGA 1T00A 2L5LA 3ZREA 5ELAA 2VL2A 2JSYA 1XOBA 3P2AA 3ZVJA 5E59A 4MJAA 4L5LA 2OT3A 2C0FA 4EE0A 2G0FA 3IV4A 2AHEA 3OR5A 2VLVA 20GSA 2XBQA 3UIWA 4O5UA 2IPAA 1SKRB 5G2ZA 3U5RE 1SD8A 3D22A 3FR3A 5D9XA 2DKHA 3NIVA 2IIYA 2XPDA 1TRUA 6GSUA 1A8LA 3K8NA 2WZSA 5GAPD 1EV9A 3TGZA 2IMDA 5IO0A 1EOGA 4K2DA 1X5EA 4WXTA 1G7EA 1I5GA 1TI3A 4EL1A 4MPGA 3ISOA 1BYEA 3C8EA 4ZB9A 1TXXA 3BJ5A 4OFNA 5ENUA 2PN8A 2H1BA 4GQCA 2HE3A 1DSBA 6GSVA 4MZCA 1R26A 2F51A 2CAQA 5IMFA 3GFKA 4PI0C 5G31A 5J9BA 1VF4A 4LLRA 1TOFA 1XXUA 1QGVA 2I1UA 1VF3A 2JU5A 4HZ4A 3GH6A 1ZOFA 1B48A 5IMAA 4OO5A 3IAS2 4BVXA 4J57E 3CSIA 4JE1A 2L6DA 1X9WB 1DBYA 1Y6EA 1PRXA 2YWIA 3HVSA 3CRUA 2H6ZA 1O8WA 2R4VA 2VCQA 3TOTA 2MMAA 4CHSA 2F9SA 4XS4A 4ZIJA 4OMVA 1RQMA 3E9JB 5ECIB 1GSDA 2OE0A 2H74A 1ILOA 1CQGA 3TJFA 2J9HA 3D0ZA 1ZYEA 4WETA 2B1KA 3CWGA 4BA7A 3MNGA 2DMMA 2VIMA 1BF5A 2C8UA 1N25A 1X9SB 3UEMA 3L9UA 5IPGA 3L9SA 5CO3A 2ZNMA 4E8HA 2YP6A 2H0IA 5FHIA 1KTEA 4XCSA 4RI7A 4EIPA 4K2XA 5JWOB 2C0GA 2NPBA 1QMVA 2EFCA 3HKRA 1YF0A 4KSMA 5DVBA 1BQ7A 1EP7A 1FO5A 2QA1A 4DSSB 2FA8A 1PKWA 3TRPA 1GTIA 5ID2A 4EKZA 2JACA 2LJKA 1SYRA 3IHGA 4I2UA 1OC9B 3TOUA 4TVEA 5IOWA 1TDIA 1VRSD 3DWVA 2VM2A 4WEYA 4WKWA 1UVZA 3GHAA 1E6BA 3H1NA 1V9WA 2P31A 4PHZC 1F6MC 2CAIA 2DJ0A 1F3BA 3GV1A 2IMIA 4EXJA 2FNOA 2PBJA 1K0OA 3TKRA 1TRSA 3QDNA 3RHBA 3EVIA 5ECNB 4FYUA 3O6TA 4GSNA 3UVHA 3FYGA 2F8FA 1OKDA 1S4BP 1A2JA 1Z7PA 5ECOB 3VLNA 3NZNA 2WVXA 4HDEA 2V2GA 2WFCA 4ZL7A 1DE1A 4KX4A 3F63A 5DQSA 2H73A 3QCPA 4D73B 1JLVA 1BG5A 2RIIA 2FWEA 5ECHB 2MMNA 2B5XA 3BCIA 5CYYA 3LYPA 1TKDB 3FZ5A 4OCFA 2G2QA 4TR1B 1OE8A 2KP2A 1K0BA 1I1IP 2EIRA 2R5GA 4AJ6A 1G6YA 1G6WA 4FO5A 3D5JA 2H19A 5BMUA 3ERWA 3KP8A 3ZMLA 4NHWA 2OE3A 2LQOA 1U87A 2YNXA 1YQ1A 5DAKB 4GQFA 1GULA 3VWXA 2YANA 2X8HA 4WBJA 3DEXA 1EEMA 2QGVA 3MDKA 3US3A 4YQUA 1TW9A 5DQYA 4L0UA 4Z2UA 2JADA 4HQSA 2K6VA 1U3AA 2MMOA 2OADA 3KTLA 3I6AA 4POLA 3DRNA 3JCML 5ABRA 1GTAA 1ML6A 2HNLA 2LTKA 4ZB8A 5CREA 2E2MA 3ZFBA 4P3YB 3IR4A 3RGBC 2WW0A 3QR6A 5B6MA 4POKA 1NM3A 3TRXA 3J7Yb 3EMXA 1AW9A 5ECMB 2BMXA 4MZWA 1J08A 4O5RA 3QAVA 2O5VA 3VWWA 2CQ9A 4KDXA 4IBPA 2GGTA 1U88A 2C3TA 2P0GA 2O85A 2FLSA 2LEGA 3EU3A 4OCEA 4Z2RA 1VGLA 2VCWA 1FG4A 1TU7A 3ZFLA 2O8VB 4L8EA 1EGOA 3EC3A 3FEUA 2KHPA 1SKWB 4RQXA 1NSWA 1DUGA 9GSSA 4KSOA 1YKCA 2VKZG 4USSA 4NWYA 2GQKA 5F06A 4BL7B 1ERUA 3M3MA 2JZRA 4Q5QA 1PFOA 2L57A 4WF5A 4I5QA 4O32A 4TR4A 2X99A 3DKSA 1EEJA 2N5FA 3TUEA 4TN8A 4ML1A 4PNFA 2AUVA 1K0NA 1PQNA 2MBSA 1VF2A 1AQWA 1GTBA 3WYWA 3GUSA 5A4VA 4IP6A 4BPYA 1LBKA 4DEJA 2B5YA 5KN0A 4LMWA 4Q5NA 5G5EA 1HYUA 1MDKA 3GA4A 4MH2A 2X4AA 1PGTA 5J4UA 2LV3A 4V2NA 2CZ3A 3L9VA 1F3AA 2R3XA 1GH2A 5D9WA 3VPTA 1XWBA 3WGEA 1XBSA 2HSNB 2WZ9A 3G7YA 4G01A 5IOXA 3HCZA 2PERA 1Z5YE 2OBIA 2LJRA 3MAKA 3GMFA 4HS1A 2VLUA 3F8UA 4RI6A 3LQ7A 4NMUA 1O8XA 2GTUA 5HR0A 4YKFA 4BWQA 3W8SA 4G0IA 4KB3A 4JR6A 3UARA 1ZYPA 1AC1A 3BD2A 1SJ6A 1PL1A 2LQQA 3A2VA 3ERFA 5CAXA 3HYPA 2VL2C 5BMUB 2C1YA 3IE3A 2HI7A 5ECSA 5IQYA 1RW1A 2H01A 3I43A 1PD21 4MA9A 4IQAA 4YQVA 2DJ3A 3LFLA 2HQTA 4LL1B 2NTOA 5DALB 1PMTA 3KH9A 4AKXB 2L5OA 5EL8A 4DSSA 3HHVA 4PQHA 4ISDA 5COHA 1A24A 2PMTA 3GKKA 4BIKA 4ZILA 1EOHA 2YCDA 3TCOA 2RM6A 4IN0A 2B6MA 3APSA 1M3JA 3CTGA 1JZWA 4RQRA 3ZVJD 4EO3A 2LKUA 3GL3A 1GSFA 2JZSA 5DJMA 3KMNA 1NW2A 4V2MA 1ZYQB 1OC9A 1K0DA 2AJQB 3DGQA 4A5PA 14GSA 4AJ7A 4ID0A 1HNCA 2H1AA 4RUVA 3M9JA 5EY6A 4N0ZA 2C0DA 5H5RA 2B3SA 2GSTA 1PN9A 1KEBA 1T4YA 3CTFA 3DMLA 4IHUA 4KCAA 5GAND 2YJ7A 4AF2A 2C4JA 4K5RA 1XCCA 4K8MA 1GNWA 2PPTA 2A2PA 1YVLA 1XOAA 2IMKA 1UC7A 2HLSA 2FGXA 2DC5A 1H4OA 4K6XA 2AYTA 5KOWA 1ZL9A 2H30A 2LRCA 3WT2A 4D73A 5G5FA 3L4NA 4QMKA 5DJLA 4K1FA 3D6IA 2K9FA 2R0GA 5D93A 19GSA 4K7IA 4GWRA 3PR8A 1M9AA 3R3EA 1GP1A 4ZL9A 2HYXA 3V1WA 3L0HA 2YZUA 4MABA 4TR1A 3RPNA 2TRCP 4G0LA 1WIKA 4IS0A 2V41A 2DBCA 4KCEA 3SBCA 1R4WA 3QPMA 1TTZA 5KN1A 4F9ZA 3F0IA 2TRXA 5DAKA 4DSQA 2VL3A 4G9HA 5D9VA 2IWTA 1SENA 1EV4A 2HZEB 3KP9A 3TDGA 2L6CA 5FWGA 2I3YA 1QFNA 3TJBA 1SU9A 3LJRA 1XFLA 5KEJA 1PX7A 1XWKA 3P90A 2O3EA 1JZDA 4TKYA 3IC8A 1XWGA 2DJKA 4WR5A 3QFAC 1AQXA 1WP0A 2OBKA 1E2YA 4TXVA 1XIYA 1SK2A 3QOUA 1G0TA 3WGDA 2XBIA 1XZOA 2VLTA 1K0AA 3ED3A 3KMOA 4XIHA 4EIQA 1YKAA 4IJIA 2IFQB 3O76A 1RK4A 1UA5A 3DVXA 4ZB6A 1Q4JA 4TXOA 2IL3A 3GX8A 3GSTA 5J5NA 1BG1A 2VUPA 1H75A 5J40A 4Q5FA 1IYHA 4X4JA 5G1LA 1FOVA 2IN3A 1TRVA 3VPQA 2FWHA 5JCGA 3IK9A 4NV5A 2VCVA 4KUNA 4W66A 18GSA 2A2RA 3IAM2 4K7NA 3E3EA 1A2LA 1S3DA 2VD1A 5A5HA 2OKAA 2GLRA 4HEA2 2OE1A 4BL7A 2HXKA 4ECCA 4MF6A 1YEPA 2NDOA 5J4VA 3E0UA 5C00A 3CRTA 2LNSA 4KF9A 1O85A 2LJAA 3F9UA 1YZXA 3G9BA 1MDIA 4GRFA 4YAVA 1OC8A 2UZ8A 4AGSA 4F2IA 5FT3A 1WOUA 2HSHA 1PN0A 4HI7A 5AN1A 4I8BA 2RLIA 4PI2C 4AI6A 4FIWA 4ILFA 3M0FA 4MZBA 3FR6A 1GSYA 2IMFA 2YOIA 2O7KA 3ME8A 3GH9A 4N10A 1UN2A 2DLXA 2VAFA 2X8GA 4HSCX 2AB6A 5IMDA 1M2BA 2HSNA 3H93A 5HR2A 3N9JA 4AKGA 2V32A 2DJ2A 2H71A 1O81A 2JZTA 4F82A 4IELA 3FW2A 2L4QA 4PURA 4HU9A 1NHOA 3UL3A 5E4WA 3AY8A 4KE3A 2HFDA 2VOCA 5LCZA 1M99A 3HJPA 2H1DA 4YH2A 3MWHA 1GUKA 1HNBA 1XW5A 2GZPA 5AIXA 1JZOA 2A2SA 2WDUA 4KA0A 3M8NA 5A1NB 3TJKA 1R5PA 2VL9A 4WF4A 2R0CA 3ZL5A 2XHFA 2EIOA 5D96A 3IHQA 2R0PA 1G7OA 22GSA 1QQ2A 4TOPA 4HQZA 1GUHA 4PUAA 5DALA 1EWXA 1THXA 3KEBA 3GTUB 2H76A 2M72A 3H79A 1SVLA 2F3MA 4GSSA 1V2AA 2TIRA 4MH3A 3GX0A 5D9TA 1J9BA 5F8BA 4KNDA 1K3OA 1USBA 1TK8B 2WVZA 4CW9A 4O7HA 3DYRA 2KUCA 3WD6A 2E7PA 3GKXA 2LRNA 2LSTA 3DD3A 5ECLB 3QAGA 3FR9A 1F2EA 3TKSA 3M1GA 1SK0A 3D21A 1OYJA 2GT6A 3ZIVA 4TR3A 1U3IA 2E0QA 2CX4A 3IBHA 2O89A 2PU9C 4GSTA 5HR3A 3HD5A 4ZBDA 2XC2A 4ML6A 4ULXA 1T1VA 3P8WA 3F4RA 3NOFA 2QC7A 5J41A 3FY7A 2QSIA 1OC3A 3HZ4A 3KZQA 1FVKA 3FKFA 3DVWA 2X8CA 4TXOB 2OJLA 2OACA 5H5QA 5IM9A 2VM1A 1T3BA 2XPEA 2VCTA 1M7TA 1GWCA 5IMVA 4JR4A 4K9ZA 1I9DA 3UJ1A 3D4MA 5HFIA 5HQPA 1FB6A 2IJYA 2HRFA 3CYNA 4MJBA 5L71A 2H6XA 3FZ4A 4YAPA 3A2XA 3WT1A 4ZXGA 3LSZA 2EFEA 5A5HB 1BAYA 3RAZA 3TJJA 5JCUA 4PXOA 1R7HA 3UMAA 1XW9A 4HUAA 2CA8A 1N2AA 4GLTA 3KIJA 3LG6A 1XPVA 3CXGA 2F8AA 3HJOA 4E8EA 5KOXA 3F3QA 2RUEA 3ZLPA 2HZFA 2H70A 5JWQB 4EUYA 4KW6A 3LWAA 13GSA 3HVXA 1B4PA 3WGXA 1Z6MA 3CBUA 4LL4B 3RFRC 1WRYA 4EDZA 4G0KA 1B8XA 4PUFC 1A2MA 1TK5B 1F9MA 2CZ2A 4EC0A 3VK9A 1KNGA 2HZEA 3TU3B 3QFBC 3C73A 1SVOA 5AGYA 4NV2A 7GSSA 2WB9A 4DSRA 4N0VA 2WVYA 4PQ1A 3DXBA 4IGJA 3TKQA 2D2ZA 1AUCA 5KN2A 1BEDA 3F4TA 5A34B 16GSA 5A5KA 2H6YA 3ZTLA 3A5IA 3R2QA 4OO4A 3TRQA 1MDJA 4JU5A 2IFQA 2H0HA 1SL2B 5F05A 2I4AA 4MNNA 4IKHA 2NVLA 17GSA 3W6GA 3ZZXA 2A4VA 2H66A 1SKSB 2M46A 1JLWA 2H0GA 3L78A 4ZB7A 2K8VA 3GIXA 2WRTA 1JFUA 1TU8A 3PPUA 1OAZA 3GRXA 2YZHA 3LYKA 1THOA 2ES7A 1A0FA 4ECIA 2YWOA 4HJMA 1K3LA 1AQVA 3TJGA 1TRWA 3UOMA 4MJEA 3UAPA 2B5EA 2H8LA 4PNGA 3KCMA 2QA2A 3Q6OA 1TK0B 3LEFA 2EC4A 4GCIA 2ON7A 1WPIA 4TW5A 2FCHA 4XRDA 1OKTA 1R5AA 2DIYA 2H72A 3VWUA 5HFKA 3KD0A 1BJXA 2P5RA 3RPPA 3RDWA 2YWMA 1GUMA 4GTUA 1GNEA 4QL7A 1ZCPA 1O7UA 3CSJA 4AJ8A 2JSZA 1JHBA 2QKEA 3M9KA 4EVMA 3HMJG 4AKIA 4XS6A 4OFTA 1ERTA 4TRXA 2X49A 1A0RP 4LA1A 4MDCA 1W89A 3LW9A 4CY6A 3BBYA 5JWRB 5F0GA 4NHZA 3EU4A 4KDYA 2M80A 1LU4A 4N11A 2HRNA 3I9V2 4K7OA 1PSQA 1FAAA 5CP1A 1GSSA 3C71A 3W8JA 4X43A
chains in the Genus database with same CATH topology
2HRKB 4V1Ag 4OFMA 2V1MA 4YQMA 1YF1A 4KGIA 4Q5RA 2CX3A 5INYA 5A1NA 2C80A 1GTUA 1ERVA 1XW6A 1EGRA 6GSTA 2GZZA 2PVOC 3EURA 3HY2A 1K0CA 3DIEA 1TXUA 3C1RA 4ZBAA 2A4HA 3N5OA 2I81A 4X1UA 3IOSA 5G30A 3EE2A 4IQ1A 3A3TA 3HA9A 3APQA 3GL5A 4K5SA 2K8SA 3GTUA 2V6KA 4XHMA 3EINA 2GQMA 4WBRD 4NXIA 4BVYB 2GSRA 4WR4A 2HSYA 2GSSA 1FHEA 4OD7A 2B7JA 1VF1A 4O92A 1GSEA 1AXDA 3BCKA 2L59A 3GYKA 1M2AA 1JZRA 3IXRA 5GZZB 1AIUA 3IDVA 3RBTA 2UV8G 1TJDA 1MEKA 4HZ2A 5ELGA 1ST9A 5D8IA 2MYGA 4JZQA 1HNAA 3J7Yk 3IC4A 4N3ZA 2GDRA 4JEDA 1MD3A 1ACVA 2KOKA 3GNJA 4GXZA 1V98A 3C7MA 4ZL8A 3KH7A 3PINA 6GSSA 4YKGA 1YJ6A 2IMEA 1GSUA 3G7JA 4ACSA 1ABAA 5J4YA 2FY6A 3LXZA 4MF7A 3O3TA 3HZ8A 4CDOA 2P5QA 5D73A 3F4SA 5EPFA 2EFDA 1IYIA 1YDKA 4PGTA 5JCWA 3GSSA 2C3NA 1FB0A 3H8QA 1B4QA 2GVPA 1AAZA 1FW1A 3MIXA 1ERWA 1J0FA 3FK8A 4I6XA 2B1LA 2CV4A 1YY7A 3HVVA 5CRHA 1HD2A 3VURA 1QUWA 5DCGA 5J47A 1PX6A 2N5AA 1Y1UA 2YJHA 1WWJA 4ECJA 2DKIA 2HT9A 1M0UA 3I69A 2R2JA 4PQIA 1ZYNA 2CT6A 3IK7A 2H75A 4J56E 1QK8A 2E2GA 1XWCA 1TP9A 4KDUA 4NAXA 1SJZA 3UVTA 2WS2A 12GSA 1EZKA 2FHEA 4PX1A 5DCHA 2HSMB 1SVMA 10GSA 1X5DA 1X9MB 4MP4A 1PL2A 5ECPB 1DE2A 4FQUA 3ZMKA 3IA1A 1V40A 3G7IA 1ZZYA 3P7XA 2PGTA 1ON4A 2Z9SA 2FA4A 4ICYA 4Z2TA 4AKHA 1M9BA 3UBKA 1GSQA 1TI1A 2PUKC 2AAWA 3FZ9A 3ZIJA 3HDCA 3MSZA 3TKSC 4EDYA 11GSA 3EMPA 2R37A 4GDFA 2LS5A 4HU7A 3EYTA 5A34A 3GKMA 5CNWA 3TKPA 2RM5A 5H5SA 2VD0A 3QD9A 3FZAA 3CSHA 4L5OA 2ON5A 3VI7A 1ZGNA 2PWJA 5IMZA 2REMA 1OVNA 4XTSA 2LNTA 3F3RA 1LJRA 3KTBA 5C04A 2AV4A 6GSWA 3GKNA 4K0NA 1GLQA 2R6KA 2VO4A 3HJMA 3BOAA 4MPFA 1SYXA 4MF5A 5DDLA 4IW9A 4F03A 1NHYA 1O6JA 1A23A 1U6TA 2FUG2 2EFHA 3IPZA 4OWYA 2VCXA 1Z3EA 5B8BA 3FRCA 3VFIA 1GLPA 1KBNA 2N5BA 4XS1A 1OE7A 1X5CA 3RHCA 4O5QA 3Q18A 4BVXB 1T8EB 1V57A 2GS3A 4N30A 2YV7A 2WULA 5ECRB 2CVBA 2H1LA 4L0WA 2C0EA 1YEXA 2V6OA 2GZYA 1Q98A 4XS4B 1PKZA 3KJYA 1GRXA 2BTOT 3D4TA 4H86A 4NPBA 2EIQA 5DBQA 2GT5A 2O87A 5A4UA 4MJCA 5BRTA 4V2LA 3C1SA 4EF0A 1N8JA 1F37A 3GN3A 3SWLA 3S9FA 2MBTA 4G19A 3TB2A 1WMJA 1QXHA 4POMA 2GSQA 2FD3A 5CRGA 5AIVA 5F07A 4V1Ap 2MMZA 4Z7XA 2HRAA 2I9HA 2DSAA 1GL8A 3EWLA 3U6VA 1SJIA 2HRKA 3VI5A 2C3QA 2CVDA 2RUFA 1SK1A 1V58A 3TKSE 4MK3A 2B7KA 4J2FA 2BJXA 4LMVA 5J9CA 1Z9HA 5ID2B 5J3RA 1MTCA 4F0BA 5ECKB 1W4VA 6GSYA 3ZRDA 5GSSA 3HXSA 2WJUA 2PVQA 4MMMA 5G1KA 4I97A 1FVJA 3ZITA 1C72A 3PGTA 4HOJA 2ALBA 4FYBA 4IP1A 4F0CA 1FOHA 3CMIA 3GURA 3Q74A 3ZYWA 1BX9A 4QL9A 1MD4A 2ZUPA 4QQ7A 2YPMA 4ECBA 2J23A 4BVYA 3IRAA 4KAEA 5IMCA 5GSTA 1M2DA 3LXTA 2KP1A 3KM6A 3UBLA 4CY8A 5EVOA 1Y25A 4GF0A 4X0XA 3F6FA 2FWFA 1URMA 4PTSA 4K0GA 4MLYA 1HQOA 2KLXA 1XVWA 3FMWA 3QAWA 5AISA 4ZBBA 2LUSA 5KN3A 1S3AA 2DMLA 1T4ZA 3LORA 2CVKA 2DJJA 3MYDA 3A5WA 5ECQB 1SL0B 1WE0A 5IIZA 4KH7A 3APOA 1SD9A 2WGRA 4FYCA 5LD0A 1CQHA 1Z6NA 5A4WA 4I2TA 4DVCA 3KGKA 1K0MA 3F6DA 2YV9A 1EP8A 2L4CA 2OA7A 1K3YA 2MZCA 2YN1A 1B9XC 2WCIA 1XVQA 3QMXA 4FH8A 5CRDA 5HFGA 2YWNA 5CRWA 5B8AA 2ZCTA 1X0RA 2NBSA 2DJ1A 1ZMAA 4IJ3A 4XRAA 1Z7RA 3A2WA 3VWVA 5LNKe 3FHKA 4JBBA 8GSSA 2FWGA 1A8YA 2JL4A 2X64A 1S3CA 3KXOA 1SL1B 1PA3A 4MCUA 3H4KA 4IVFA 4JRRA 4BWSA 2LRTA 5HR1A 1O73A 4G2EA 5B6NA 6GSXA 3PH9A 2H1GA 5B7CA 4E68A 2GQLA 4HJ2A 1T7PB 4G10A 3EPTA 5IO2A 3LGCA 3ME7A 3Q19A 2HSMA 2DIZA 2VCZA 2K18A 4POBA 1B9YC 1XWAA 4TR0A 5IPHA 1WJKA 3ERGA 1T00A 2L5LA 3ZREA 5ELAA 2VL2A 2JSYA 1XOBA 3P2AA 3ZVJA 5E59A 4MJAA 4L5LA 2OT3A 2C0FA 4EE0A 2G0FA 3IV4A 2AHEA 3OR5A 2VLVA 20GSA 2XBQA 3UIWA 4O5UA 2IPAA 1SKRB 5G2ZA 3U5RE 1SD8A 3D22A 3FR3A 5D9XA 2DKHA 3NIVA 2IIYA 2XPDA 1TRUA 6GSUA 1A8LA 3K8NA 5GAPD 1EV9A 3TGZA 2IMDA 5IO0A 1EOGA 4K2DA 1X5EA 4WXTA 1G7EA 1I5GA 1TI3A 4EL1A 4MPGA 3ISOA 1BYEA 3C8EA 4ZB9A 1TXXA 3BJ5A 4OFNA 5ENUA 2PN8A 2H1BA 4GQCA 2HE3A 1DSBA 6GSVA 4MZCA 1R26A 2F51A 2CAQA 5IMFA 3GFKA 5G31A 5J9BA 1VF4A 4LLRA 1TOFA 1XXUA 1QGVA 2I1UA 1VF3A 2JU5A 4HZ4A 3GH6A 1ZOFA 1B48A 5IMAA 4OO5A 3IAS2 4BVXA 4J57E 3CSIA 4JE1A 2L6DA 1X9WB 1DBYA 1Y6EA 1PRXA 2YWIA 3HVSA 3CRUA 2H6ZA 1O8WA 2R4VA 2VCQA 3TOTA 2MMAA 4CHSA 2F9SA 4XS4A 4ZIJA 4OMVA 1RQMA 3E9JB 5ECIB 1GSDA 2OE0A 2H74A 1ILOA 1CQGA 3TJFA 2J9HA 3D0ZA 1ZYEA 4WETA 2B1KA 3CWGA 4BA7A 3MNGA 2DMMA 2VIMA 1BF5A 2C8UA 1N25A 1X9SB 3UEMA 3L9UA 5IPGA 3L9SA 5CO3A 2ZNMA 4E8HA 2YP6A 2H0IA 5FHIA 1KTEA 4XCSA 4RI7A 4EIPA 4K2XA 5JWOB 2C0GA 2NPBA 1QMVA 2EFCA 3HKRA 1YF0A 4KSMA 5DVBA 1BQ7A 1EP7A 1FO5A 2QA1A 4DSSB 2FA8A 1PKWA 3TRPA 1GTIA 5ID2A 4EKZA 2JACA 2LJKA 1SYRA 3IHGA 4I2UA 1OC9B 3TOUA 4TVEA 5IOWA 1TDIA 1VRSD 3DWVA 2VM2A 4WEYA 4WKWA 1UVZA 3GHAA 1E6BA 3H1NA 1V9WA 2P31A 1F6MC 2CAIA 2DJ0A 1F3BA 3GV1A 2IMIA 4EXJA 2FNOA 2PBJA 1K0OA 3TKRA 1TRSA 3QDNA 3RHBA 3EVIA 5ECNB 4FYUA 3O6TA 4GSNA 3UVHA 3FYGA 2F8FA 1OKDA 1A2JA 1Z7PA 5ECOB 3VLNA 3NZNA 4HDEA 2V2GA 2WFCA 4ZL7A 1DE1A 4KX4A 3F63A 5DQSA 2H73A 3QCPA 4D73B 1JLVA 1BG5A 2RIIA 2FWEA 5ECHB 2MMNA 2B5XA 3BCIA 5CYYA 3LYPA 1TKDB 3FZ5A 4OCFA 2G2QA 4TR1B 1OE8A 2KP2A 1K0BA 2EIRA 2R5GA 4AJ6A 1G6YA 1G6WA 4FO5A 3D5JA 2H19A 5BMUA 3ERWA 3KP8A 3ZMLA 4NHWA 2OE3A 2LQOA 1U87A 2YNXA 1YQ1A 5DAKB 4GQFA 1GULA 3VWXA 2YANA 2X8HA 4WBJA 3DEXA 1EEMA 2QGVA 3MDKA 3US3A 4YQUA 1TW9A 5DQYA 4L0UA 4Z2UA 2JADA 4HQSA 2K6VA 1U3AA 2MMOA 2OADA 3KTLA 3I6AA 4POLA 3DRNA 3JCML 5ABRA 1GTAA 1ML6A 2HNLA 2LTKA 4ZB8A 5CREA 2E2MA 3ZFBA 4P3YB 3IR4A 3QR6A 5B6MA 4POKA 1NM3A 3TRXA 3J7Yb 3EMXA 1AW9A 5ECMB 2BMXA 4MZWA 1J08A 4O5RA 3QAVA 2O5VA 3VWWA 2CQ9A 4KDXA 4IBPA 2GGTA 1U88A 2C3TA 2P0GA 2O85A 2FLSA 2LEGA 3EU3A 4OCEA 4Z2RA 1VGLA 2VCWA 1FG4A 1TU7A 3ZFLA 2O8VB 4L8EA 1EGOA 3EC3A 3FEUA 2KHPA 1SKWB 4RQXA 1NSWA 1DUGA 9GSSA 4KSOA 1YKCA 2VKZG 4USSA 4NWYA 2GQKA 5F06A 4BL7B 1ERUA 3M3MA 2JZRA 4Q5QA 2L57A 4WF5A 4I5QA 4O32A 4TR4A 2X99A 3DKSA 1EEJA 2N5FA 3TUEA 4TN8A 4ML1A 4PNFA 2AUVA 1K0NA 1PQNA 2MBSA 1VF2A 1AQWA 1GTBA 3WYWA 3GUSA 5A4VA 4IP6A 4BPYA 1LBKA 4DEJA 2B5YA 5KN0A 4LMWA 4Q5NA 5G5EA 1HYUA 1MDKA 3GA4A 4MH2A 2X4AA 1PGTA 5J4UA 2LV3A 4V2NA 2CZ3A 3L9VA 1F3AA 2R3XA 1GH2A 5D9WA 3VPTA 1XWBA 3WGEA 1XBSA 2HSNB 2WZ9A 3G7YA 4G01A 5IOXA 3HCZA 2PERA 1Z5YE 2OBIA 2LJRA 3MAKA 3GMFA 4HS1A 2VLUA 3F8UA 4RI6A 3LQ7A 4NMUA 1O8XA 2GTUA 5HR0A 4YKFA 4BWQA 3W8SA 4G0IA 4KB3A 4JR6A 3UARA 1ZYPA 1AC1A 3BD2A 1SJ6A 1PL1A 2LQQA 3A2VA 3ERFA 5CAXA 3HYPA 2VL2C 5BMUB 2C1YA 3IE3A 2HI7A 5ECSA 5IQYA 1RW1A 2H01A 3I43A 1PD21 4MA9A 4IQAA 4YQVA 2DJ3A 3LFLA 2HQTA 4LL1B 2NTOA 5DALB 1PMTA 3KH9A 4AKXB 2L5OA 5EL8A 4DSSA 3HHVA 4PQHA 4ISDA 5COHA 1A24A 2PMTA 3GKKA 4ZILA 1EOHA 2YCDA 3TCOA 2RM6A 4IN0A 2B6MA 3APSA 3CTGA 1JZWA 4RQRA 3ZVJD 4EO3A 2LKUA 3GL3A 1GSFA 2JZSA 5DJMA 3KMNA 1NW2A 4V2MA 1ZYQB 1OC9A 1K0DA 2AJQB 3DGQA 4A5PA 14GSA 4AJ7A 4ID0A 1HNCA 2H1AA 4RUVA 3M9JA 5EY6A 4N0ZA 2C0DA 5H5RA 2B3SA 2GSTA 1PN9A 1KEBA 1T4YA 3CTFA 3DMLA 4IHUA 4KCAA 5GAND 2YJ7A 4AF2A 2C4JA 4K5RA 1XCCA 4K8MA 1GNWA 2PPTA 2A2PA 1YVLA 1XOAA 2IMKA 1UC7A 2HLSA 2FGXA 2DC5A 1H4OA 4K6XA 2AYTA 5KOWA 1ZL9A 2H30A 2LRCA 3WT2A 4D73A 5G5FA 3L4NA 4QMKA 5DJLA 4K1FA 3D6IA 2K9FA 2R0GA 5D93A 19GSA 4K7IA 4GWRA 3PR8A 1M9AA 3R3EA 1GP1A 4ZL9A 2HYXA 3V1WA 3L0HA 2YZUA 4MABA 4TR1A 3RPNA 2TRCP 4G0LA 1WIKA 4IS0A 2V41A 2DBCA 4KCEA 3SBCA 1R4WA 3QPMA 1TTZA 5KN1A 4F9ZA 3F0IA 2TRXA 5DAKA 4DSQA 2VL3A 4G9HA 5D9VA 2IWTA 1SENA 1EV4A 2HZEB 3KP9A 3TDGA 2L6CA 5FWGA 2I3YA 1QFNA 3TJBA 1SU9A 3LJRA 1XFLA 5KEJA 1PX7A 1XWKA 3P90A 1JZDA 4TKYA 3IC8A 1XWGA 2DJKA 4WR5A 3QFAC 1AQXA 1WP0A 2OBKA 1E2YA 4TXVA 1XIYA 1SK2A 3QOUA 1G0TA 3WGDA 2XBIA 1XZOA 2VLTA 1K0AA 3ED3A 3KMOA 4XIHA 4EIQA 1YKAA 4IJIA 2IFQB 3O76A 1RK4A 1UA5A 3DVXA 4ZB6A 1Q4JA 4TXOA 2IL3A 3GX8A 3GSTA 5J5NA 1BG1A 2VUPA 1H75A 5J40A 4Q5FA 1IYHA 4X4JA 5G1LA 1FOVA 2IN3A 1TRVA 3VPQA 2FWHA 5JCGA 3IK9A 4NV5A 2VCVA 4KUNA 4W66A 18GSA 2A2RA 3IAM2 4K7NA 3E3EA 1A2LA 1S3DA 2VD1A 5A5HA 2OKAA 2GLRA 4HEA2 2OE1A 4BL7A 2HXKA 4ECCA 4MF6A 1YEPA 2NDOA 5J4VA 3E0UA 5C00A 3CRTA 2LNSA 4KF9A 1O85A 2LJAA 3F9UA 1YZXA 3G9BA 1MDIA 4GRFA 4YAVA 1OC8A 2UZ8A 4AGSA 4F2IA 5FT3A 1WOUA 2HSHA 1PN0A 4HI7A 5AN1A 4I8BA 2RLIA 4AI6A 4FIWA 4ILFA 3M0FA 4MZBA 3FR6A 1GSYA 2IMFA 2YOIA 2O7KA 3ME8A 3GH9A 4N10A 1UN2A 2DLXA 2VAFA 2X8GA 2AB6A 5IMDA 1M2BA 2HSNA 3H93A 5HR2A 3N9JA 4AKGA 2V32A 2DJ2A 2H71A 1O81A 2JZTA 4F82A 4IELA 3FW2A 2L4QA 4PURA 4HU9A 1NHOA 3UL3A 5E4WA 3AY8A 4KE3A 2HFDA 2VOCA 5LCZA 1M99A 3HJPA 2H1DA 4YH2A 3MWHA 1GUKA 1HNBA 1XW5A 2GZPA 5AIXA 1JZOA 2A2SA 2WDUA 4KA0A 3M8NA 5A1NB 3TJKA 1R5PA 2VL9A 4WF4A 2R0CA 3ZL5A 2XHFA 2EIOA 5D96A 3IHQA 2R0PA 1G7OA 22GSA 1QQ2A 4TOPA 4HQZA 1GUHA 4PUAA 5DALA 1EWXA 1THXA 3KEBA 3GTUB 2H76A 2M72A 3H79A 1SVLA 2F3MA 4GSSA 1V2AA 2TIRA 4MH3A 3GX0A 5D9TA 1J9BA 5F8BA 4KNDA 1K3OA 1USBA 1TK8B 4CW9A 4O7HA 3DYRA 2KUCA 3WD6A 2E7PA 3GKXA 2LRNA 2LSTA 3DD3A 5ECLB 3QAGA 3FR9A 1F2EA 3TKSA 3M1GA 1SK0A 3D21A 1OYJA 2GT6A 3ZIVA 4TR3A 1U3IA 2E0QA 2CX4A 3IBHA 2O89A 2PU9C 4GSTA 5HR3A 3HD5A 4ZBDA 2XC2A 4ML6A 4ULXA 1T1VA 3P8WA 3F4RA 3NOFA 2QC7A 5J41A 3FY7A 2QSIA 1OC3A 3HZ4A 3KZQA 1FVKA 3FKFA 3DVWA 2X8CA 4TXOB 2OJLA 2OACA 5H5QA 5IM9A 2VM1A 1T3BA 2XPEA 2VCTA 1M7TA 1GWCA 5IMVA 4JR4A 4K9ZA 1I9DA 3UJ1A 3D4MA 5HFIA 5HQPA 1FB6A 2IJYA 2HRFA 3CYNA 4MJBA 5L71A 2H6XA 3FZ4A 4YAPA 3A2XA 3WT1A 4ZXGA 3LSZA 2EFEA 5A5HB 1BAYA 3RAZA 3TJJA 5JCUA 4PXOA 1R7HA 3UMAA 1XW9A 4HUAA 2CA8A 1N2AA 4GLTA 3KIJA 3LG6A 1XPVA 3CXGA 2F8AA 3HJOA 4E8EA 5KOXA 3F3QA 2RUEA 3ZLPA 2HZFA 2H70A 5JWQB 4EUYA 4KW6A 3LWAA 13GSA 3HVXA 1B4PA 3WGXA 1Z6MA 3CBUA 4LL4B 1WRYA 4EDZA 4G0KA 1B8XA 4PUFC 1A2MA 1TK5B 1F9MA 2CZ2A 4EC0A 3VK9A 1KNGA 2HZEA 3TU3B 3QFBC 3C73A 1SVOA 5AGYA 4NV2A 7GSSA 2WB9A 4DSRA 4N0VA 4PQ1A 3DXBA 4IGJA 3TKQA 2D2ZA 1AUCA 5KN2A 1BEDA 3F4TA 5A34B 16GSA 5A5KA 2H6YA 3ZTLA 3A5IA 3R2QA 4OO4A 3TRQA 1MDJA 4JU5A 2IFQA 2H0HA 1SL2B 5F05A 2I4AA 4MNNA 4IKHA 2NVLA 17GSA 3W6GA 3ZZXA 2A4VA 2H66A 1SKSB 2M46A 1JLWA 2H0GA 3L78A 4ZB7A 2K8VA 3GIXA 2WRTA 1JFUA 1TU8A 3PPUA 1OAZA 3GRXA 2YZHA 3LYKA 1THOA 2ES7A 1A0FA 4ECIA 2YWOA 4HJMA 1K3LA 1AQVA 3TJGA 1TRWA 3UOMA 4MJEA 3UAPA 2B5EA 2H8LA 4PNGA 3KCMA 2QA2A 3Q6OA 1TK0B 3LEFA 2EC4A 4GCIA 2ON7A 1WPIA 4TW5A 2FCHA 4XRDA 1OKTA 1R5AA 2DIYA 2H72A 3VWUA 5HFKA 3KD0A 1BJXA 2P5RA 3RPPA 3RDWA 2YWMA 1GUMA 4GTUA 1GNEA 4QL7A 1ZCPA 1O7UA 3CSJA 4AJ8A 2JSZA 1JHBA 2QKEA 3M9KA 4EVMA 3HMJG 4AKIA 4XS6A 4OFTA 1ERTA 4TRXA 2X49A 1A0RP 4LA1A 4MDCA 1W89A 3LW9A 4CY6A 3BBYA 5JWRB 5F0GA 4NHZA 3EU4A 4KDYA 2M80A 1LU4A 4N11A 2HRNA 3I9V2 4K7OA 1PSQA 1FAAA 5CP1A 1GSSA 3C71A 3W8JA 4X43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HRK B;  4V1A g;  4OFM A;  2V1M A;  4YQM A;  1YF1 A;  4KGI A;  4Q5R A;  2CX3 A;  5INY A;  2C80 A;  1GTU A;  1ERV A;  1XW6 A;  1EGR A;  6GST A;  2GZZ A;  2PVO C;  3EUR A;  3HY2 A;  1K0C A;  3DIE A;  3C1R A;  4ZBA A;  3N5O A;  2I81 A;  4X1U A;  3IOS A;  5G30 A;  3EE2 A;  4IQ1 A;  3A3T A;  3HA9 A;  3APQ A;  3GL5 A;  2K8S A;  3GTU A;  2V6K A;  4XHM A;  3EIN A;  2GQM A;  4WBR D;  4NXI A;  4BVY B;  2GSR A;  4WR4 A;  2HSY A;  2GSS A;  1FHE A;  4OD7 A;  2B7J A;  1VF1 A;  4O92 A;  1GSE A;  1AXD A;  3BCK A;  2L59 A;  3GYK A;  1M2A A;  1JZR A;  3IXR A;  5GZZ B;  1AIU A;  3IDV A;  3RBT A;  1TJD A;  1MEK A;  4HZ2 A;  5ELG A;  1ST9 A;  5D8I A;  2MYG A;  4JZQ A;  1HNA A;  3J7Y k;  3IC4 A;  2GDR A;  4JED A;  1MD3 A;  1ACV A;  4GXZ A;  2KOK A;  3GNJ A;  1V98 A;  3C7M A;  4ZL8 A;  3KH7 A;  3PIN A;  6GSS A;  1YJ6 A;  2IME A;  1GSU A;  3G7J A;  4ACS A;  1ABA A;  2FY6 A;  3LXZ A;  4MF7 A;  3O3T A;  3HZ8 A;  4CDO A;  2P5Q A;  5D73 A;  3F4S A;  5EPF A;  1IYI A;  1YDK A;  4PGT A;  5JCW A;  3GSS A;  2C3N A;  1FB0 A;  3H8Q A;  1B4Q A;  2GVP A;  1AAZ A;  1FW1 A;  1ERW A;  1J0F A;  3FK8 A;  4I6X A;  2B1L A;  2CV4 A;  1YY7 A;  3HVV A;  5CRH A;  1HD2 A;  3VUR A;  1QUW A;  5DCG A;  1PX6 A;  2N5A A;  2YJH A;  1WWJ A;  4ECJ A;  2HT9 A;  1M0U A;  3I69 A;  2R2J A;  4PQI A;  2CT6 A;  3IK7 A;  2H75 A;  4J56 E;  1QK8 A;  2E2G A;  1XWC A;  1TP9 A;  4KDU A;  4NAX A;  1SJZ A;  3UVT A;  2WS2 A;  12GS A;  1EZK A;  2FHE A;  4PX1 A;  5DCH A;  2HSM B;  10GS A;  1X5D A;  1X9M B;  4MP4 A;  1PL2 A;  5ECP B;  1DE2 A;  4FQU A;  3ZMK A;  3IA1 A;  1V40 A;  3G7I A;  1ZZY A;  3P7X A;  2PGT A;  1ON4 A;  2Z9S A;  2FA4 A;  1M9B A;  3UBK A;  1GSQ A;  1TI1 A;  2PUK C;  2AAW A;  3FZ9 A;  3ZIJ A;  3HDC A;  3MSZ A;  3TKS C;  4EDY A;  11GS A;  3EMP A;  2R37 A;  2LS5 A;  4HU7 A;  3EYT A;  3GKM A;  5CNW A;  3TKP A;  2RM5 A;  5H5S A;  2VD0 A;  3QD9 A;  3FZA A;  3CSH A;  4L5O A;  2ON5 A;  3VI7 A;  1ZGN A;  2PWJ A;  5IMZ A;  2REM A;  1OVN A;  4XTS A;  2LNT A;  3F3R A;  1LJR A;  3KTB A;  5C04 A;  2AV4 A;  6GSW A;  3GKN A;  4K0N A;  1GLQ A;  2R6K A;  2VO4 A;  3HJM A;  3BOA A;  4MPF A;  1SYX A;  4MF5 A;  5DDL A;  4IW9 A;  4F03 A;  1NHY A;  1O6J A;  1A23 A;  1U6T A;  2FUG 2;  3IPZ A;  4OWY A;  2VCX A;  1Z3E A;  5B8B A;  3FRC A;  3VFI A;  1GLP A;  1KBN A;  2N5B A;  4XS1 A;  1OE7 A;  1X5C A;  3RHC A;  3Q18 A;  4BVX B;  1T8E B;  1V57 A;  2GS3 A;  4N30 A;  2YV7 A;  2WUL A;  5ECR B;  2CVB A;  4L0W A;  2C0E A;  1YEX A;  2V6O A;  2GZY A;  1Q98 A;  4XS4 B;  1PKZ A;  3KJY A;  1GRX A;  2BTO T;  3D4T A;  4H86 A;  4NPB A;  2EIQ A;  5DBQ A;  2GT5 A;  2O87 A;  5A4U A;  4MJC A;  4V2L A;  3C1S A;  4EF0 A;  1N8J A;  1F37 A;  3GN3 A;  3SWL A;  3S9F A;  2MBT A;  4G19 A;  3TB2 A;  1WMJ A;  1QXH A;  4POM A;  2GSQ A;  2FD3 A;  5CRG A;  5AIV A;  5F07 A;  4V1A p;  2MMZ A;  4Z7X A;  2HRA A;  2I9H A;  2DSA A;  1GL8 A;  3EWL A;  3U6V A;  1SJI A;  2HRK A;  3VI5 A;  2C3Q A;  2CVD A;  2RUF A;  1SK1 A;  1V58 A;  3TKS E;  4MK3 A;  2B7K A;  4J2F A;  2BJX A;  4LMV A;  5J9C A;  1Z9H A;  5ID2 B;  5J3R A;  1MTC A;  4F0B A;  5ECK B;  1W4V A;  6GSY A;  3ZRD A;  5GSS A;  3HXS A;  2WJU A;  2PVQ A;  4MMM A;  5G1K A;  4I97 A;  1FVJ A;  3ZIT A;  1C72 A;  3PGT A;  4HOJ A;  2ALB A;  4FYB A;  4IP1 A;  4F0C A;  3CMI A;  3GUR A;  3Q74 A;  3ZYW A;  1BX9 A;  4QL9 A;  1MD4 A;  2ZUP A;  4QQ7 A;  2YPM A;  4ECB A;  2J23 A;  4BVY A;  3IRA A;  4KAE A;  5IMC A;  5GST A;  1M2D A;  3LXT A;  2KP1 A;  3KM6 A;  3UBL A;  5EVO A;  1Y25 A;  4GF0 A;  4X0X A;  3F6F A;  2FWF A;  1URM A;  4PTS A;  4K0G A;  4MLY A;  1HQO A;  2KLX A;  1XVW A;  3QAW A;  5AIS A;  4ZBB A;  2LUS A;  5KN3 A;  1S3A A;  2DML A;  1T4Z A;  3LOR A;  2CVK A;  2DJJ A;  3A5W A;  5ECQ B;  1SL0 B;  1WE0 A;  5IIZ A;  4KH7 A;  3APO A;  1SD9 A;  2WGR A;  4FYC A;  5LD0 A;  1CQH A;  1Z6N A;  5A4W A;  4I2T A;  4DVC A;  3KGK A;  1K0M A;  3F6D A;  2YV9 A;  1EP8 A;  2L4C A;  2OA7 A;  1K3Y A;  2MZC A;  2YN1 A;  1B9X C;  2WCI A;  1XVQ A;  3QMX A;  4FH8 A;  5CRD A;  5HFG A;  2YWN A;  5CRW A;  5B8A A;  2ZCT A;  1X0R A;  2NBS A;  2DJ1 A;  1ZMA A;  4IJ3 A;  4XRA A;  1Z7R A;  3A2W A;  3VWV A;  5LNK e;  3FHK A;  4JBB A;  8GSS A;  2FWG A;  1A8Y A;  2JL4 A;  2X64 A;  1S3C A;  3KXO A;  1SL1 B;  1PA3 A;  4MCU A;  3H4K A;  4IVF A;  4JRR A;  4BWS A;  2LRT A;  5HR1 A;  1O73 A;  4G2E A;  5B6N A;  6GSX A;  3PH9 A;  2H1G A;  5B7C A;  2GQL A;  4HJ2 A;  1T7P B;  4G10 A;  5IO2 A;  3LGC A;  3ME7 A;  3Q19 A;  2HSM A;  2DIZ A;  2VCZ A;  2K18 A;  4POB A;  1B9Y C;  1XWA A;  4TR0 A;  5IPH A;  1WJK A;  3ERG A;  1T00 A;  2L5L A;  3ZRE A;  5ELA A;  2VL2 A;  2JSY A;  1XOB A;  3P2A A;  3ZVJ A;  5E59 A;  4MJA A;  4L5L A;  2C0F A;  4EE0 A;  2G0F A;  3IV4 A;  2AHE A;  3OR5 A;  2VLV A;  20GS A;  2XBQ A;  3UIW A;  2IPA A;  1SKR B;  5G2Z A;  3U5R E;  1SD8 A;  3D22 A;  3FR3 A;  5D9X A;  3NIV A;  2IIY A;  2XPD A;  1TRU A;  6GSU A;  1A8L A;  3K8N A;  5GAP D;  1EV9 A;  3TGZ A;  2IMD A;  5IO0 A;  1EOG A;  4K2D A;  1X5E A;  4WXT A;  1G7E A;  1I5G A;  1TI3 A;  4EL1 A;  4MPG A;  3ISO A;  1BYE A;  3C8E A;  4ZB9 A;  1TXX A;  3BJ5 A;  4OFN A;  5ENU A;  2PN8 A;  2H1B A;  4GQC A;  2HE3 A;  1DSB A;  6GSV A;  4MZC A;  1R26 A;  2F51 A;  2CAQ A;  5IMF A;  3GFK A;  5G31 A;  5J9B A;  1VF4 A;  4LLR A;  1TOF A;  1XXU A;  1QGV A;  2I1U A;  1VF3 A;  2JU5 A;  4HZ4 A;  3GH6 A;  1ZOF A;  1B48 A;  5IMA A;  4OO5 A;  3IAS 2;  4BVX A;  4J57 E;  3CSI A;  4JE1 A;  2L6D A;  1X9W B;  1DBY A;  1Y6E A;  1PRX A;  2YWI A;  3HVS A;  3CRU A;  2H6Z A;  1O8W A;  2R4V A;  2VCQ A;  3TOT A;  2MMA A;  4CHS A;  2F9S A;  4XS4 A;  4ZIJ A;  4OMV A;  1RQM A;  3E9J B;  5ECI B;  1GSD A;  2OE0 A;  2H74 A;  1ILO A;  1CQG A;  3TJF A;  2J9H A;  3D0Z A;  1ZYE A;  4WET A;  2B1K A;  4BA7 A;  3MNG A;  2DMM A;  2VIM A;  2C8U A;  1X9S B;  3UEM A;  3L9U A;  5IPG A;  3L9S A;  5CO3 A;  2ZNM A;  4E8H A;  2YP6 A;  2H0I A;  5FHI A;  1KTE A;  4XCS A;  4RI7 A;  5JWO B;  2C0G A;  2NPB A;  1QMV A;  3HKR A;  1YF0 A;  4KSM A;  5DVB A;  1BQ7 A;  1EP7 A;  1FO5 A;  4DSS B;  2FA8 A;  1PKW A;  3TRP A;  1GTI A;  5ID2 A;  4EKZ A;  2JAC A;  2LJK A;  1SYR A;  4I2U A;  1OC9 B;  3TOU A;  4TVE A;  5IOW A;  1TDI A;  1VRS D;  3DWV A;  2VM2 A;  4WEY A;  4WKW A;  1UVZ A;  3GHA A;  1E6B A;  3H1N A;  1V9W A;  2P31 A;  1F6M C;  2CAI A;  2DJ0 A;  1F3B A;  3GV1 A;  2IMI A;  4EXJ A;  2FNO A;  2PBJ A;  1K0O A;  3TKR A;  1TRS A;  3QDN A;  3RHB A;  3EVI A;  5ECN B;  4FYU A;  3O6T A;  4GSN A;  3UVH A;  3FYG A;  2F8F A;  1OKD A;  1A2J A;  1Z7P A;  5ECO B;  3VLN A;  3NZN A;  4HDE A;  2V2G A;  2WFC A;  4ZL7 A;  1DE1 A;  4KX4 A;  3F63 A;  5DQS A;  2H73 A;  3QCP A;  4D73 B;  1JLV A;  1BG5 A;  2RII A;  2FWE A;  5ECH B;  2MMN A;  2B5X A;  3BCI A;  5CYY A;  3LYP A;  1TKD B;  3FZ5 A;  4OCF A;  2G2Q A;  4TR1 B;  1OE8 A;  2KP2 A;  1K0B A;  2EIR A;  2R5G A;  4AJ6 A;  1G6Y A;  1G6W A;  4FO5 A;  3D5J A;  2H19 A;  5BMU A;  3ERW A;  3KP8 A;  3ZML A;  4NHW A;  2OE3 A;  2LQO A;  1U87 A;  2YNX A;  1YQ1 A;  5DAK B;  4GQF A;  1GUL A;  3VWX A;  2YAN A;  2X8H A;  4WBJ A;  3DEX A;  1EEM A;  2QGV A;  3MDK A;  3US3 A;  4YQU A;  1TW9 A;  5DQY A;  4L0U A;  2JAD A;  4HQS A;  2K6V A;  1U3A A;  2MMO A;  2OAD A;  3KTL A;  3I6A A;  4POL A;  3DRN A;  3JCM L;  5ABR A;  1GTA A;  1ML6 A;  2HNL A;  2LTK A;  4ZB8 A;  5CRE A;  2E2M A;  3ZFB A;  4P3Y B;  3IR4 A;  3QR6 A;  5B6M A;  4POK A;  1NM3 A;  3TRX A;  3J7Y b;  3EMX A;  1AW9 A;  5ECM B;  2BMX A;  4MZW A;  1J08 A;  4O5R A;  3QAV A;  3VWW A;  2CQ9 A;  4KDX A;  4IBP A;  2GGT A;  1U88 A;  2C3T A;  2P0G A;  2O85 A;  2FLS A;  2LEG A;  3EU3 A;  4OCE A;  1VGL A;  2VCW A;  1FG4 A;  1TU7 A;  3ZFL A;  2O8V B;  4L8E A;  1EGO A;  3EC3 A;  3FEU A;  2KHP A;  1SKW B;  4RQX A;  1NSW A;  1DUG A;  9GSS A;  4KSO A;  1YKC A;  4USS A;  4NWY A;  2GQK A;  5F06 A;  4BL7 B;  1ERU A;  3M3M A;  2JZR A;  4Q5Q A;  2L57 A;  4WF5 A;  4I5Q A;  4O32 A;  4TR4 A;  2X99 A;  3DKS A;  1EEJ A;  2N5F A;  3TUE A;  4TN8 A;  4ML1 A;  4PNF A;  2AUV A;  1K0N A;  1PQN A;  2MBS A;  1VF2 A;  1AQW A;  1GTB A;  3WYW A;  3GUS A;  5A4V A;  4IP6 A;  4BPY A;  1LBK A;  4DEJ A;  2B5Y A;  5KN0 A;  4LMW A;  4Q5N A;  5G5E A;  1HYU A;  1MDK A;  3GA4 A;  4MH2 A;  1PGT A;  5J4U A;  2LV3 A;  4V2N A;  2CZ3 A;  3L9V A;  1F3A A;  2R3X A;  1GH2 A;  5D9W A;  3VPT A;  1XWB A;  3WGE A;  1XBS A;  2HSN B;  2WZ9 A;  3G7Y A;  5IOX A;  3HCZ A;  2PER A;  1Z5Y E;  2OBI A;  2LJR A;  3MAK A;  3GMF A;  4HS1 A;  2VLU A;  3F8U A;  4RI6 A;  3LQ7 A;  4NMU A;  1O8X A;  2GTU A;  5HR0 A;  4BWQ A;  3W8S A;  4G0I A;  4KB3 A;  4JR6 A;  3UAR A;  1AC1 A;  3BD2 A;  1SJ6 A;  1PL1 A;  2LQQ A;  3A2V A;  3ERF A;  5CAX A;  3HYP A;  2VL2 C;  2C1Y A;  3IE3 A;  2HI7 A;  5ECS A;  5IQY A;  1RW1 A;  2H01 A;  3I43 A;  1PD2 1;  4MA9 A;  4IQA A;  4YQV A;  2DJ3 A;  3LFL A;  2HQT A;  4LL1 B;  2NTO A;  5DAL B;  1PMT A;  3KH9 A;  2L5O A;  5EL8 A;  4DSS A;  3HHV A;  4PQH A;  4ISD A;  5COH A;  1A24 A;  2PMT A;  3GKK A;  4ZIL A;  1EOH A;  2YCD A;  3TCO A;  2RM6 A;  4IN0 A;  2B6M A;  3APS A;  3CTG A;  1JZW A;  4RQR A;  3ZVJ D;  4EO3 A;  2LKU A;  3GL3 A;  1GSF A;  2JZS A;  5DJM A;  3KMN A;  1NW2 A;  4V2M A;  1ZYQ B;  1OC9 A;  1K0D A;  2AJQ B;  3DGQ A;  4AJ7 A;  14GS A;  4ID0 A;  1HNC A;  2H1A A;  4RUV A;  3M9J A;  5EY6 A;  4N0Z A;  2C0D A;  5H5R A;  2B3S A;  2GST A;  1PN9 A;  1KEB A;  1T4Y A;  3CTF A;  3DML A;  4IHU A;  4KCA A;  5GAN D;  2YJ7 A;  4AF2 A;  2C4J A;  1XCC A;  4K8M A;  1GNW A;  2PPT A;  1XOA A;  2IMK A;  1UC7 A;  2HLS A;  2FGX A;  2DC5 A;  1H4O A;  4K6X A;  2AYT A;  1ZL9 A;  2H30 A;  2LRC A;  3WT2 A;  4D73 A;  5G5F A;  3L4N A;  5DJL A;  4K1F A;  3D6I A;  2K9F A;  5D93 A;  19GS A;  4K7I A;  4GWR A;  3PR8 A;  1M9A A;  3R3E A;  1GP1 A;  4ZL9 A;  2HYX A;  3V1W A;  3L0H A;  2YZU A;  4MAB A;  4TR1 A;  3RPN A;  2TRC P;  4G0L A;  1WIK A;  4IS0 A;  2V41 A;  2DBC A;  4KCE A;  3SBC A;  1R4W A;  3QPM A;  1TTZ A;  5KN1 A;  4F9Z A;  3F0I A;  2TRX A;  5DAK A;  4DSQ A;  2VL3 A;  4G9H A;  5D9V A;  2IWT A;  1SEN A;  1EV4 A;  2HZE B;  3KP9 A;  3TDG A;  2L6C A;  5FWG A;  2I3Y A;  1QFN A;  3TJB A;  1SU9 A;  3LJR A;  1XFL A;  5KEJ A;  1PX7 A;  1XWK A;  3P90 A;  1JZD A;  4TKY A;  3IC8 A;  1XWG A;  2DJK A;  4WR5 A;  3QFA C;  1AQX A;  1WP0 A;  2OBK A;  1E2Y A;  4TXV A;  1XIY A;  1SK2 A;  3QOU A;  1G0T A;  3WGD A;  2XBI A;  1XZO A;  2VLT A;  1K0A A;  3ED3 A;  3KMO A;  4XIH A;  1YKA A;  4IJI A;  2IFQ B;  3O76 A;  1RK4 A;  1UA5 A;  3DVX A;  4ZB6 A;  1Q4J A;  4TXO A;  2IL3 A;  3GX8 A;  3GST A;  5J5N A;  2VUP A;  1H75 A;  4Q5F A;  1IYH A;  5G1L A;  1FOV A;  2IN3 A;  1TRV A;  3VPQ A;  2FWH A;  5JCG A;  3IK9 A;  4NV5 A;  2VCV A;  4KUN A;  18GS A;  2A2R A;  3IAM 2;  4K7N A;  3E3E A;  1A2L A;  1S3D A;  2VD1 A;  2OKA A;  2GLR A;  4HEA 2;  2OE1 A;  4BL7 A;  2HXK A;  4ECC A;  4MF6 A;  1YEP A;  2NDO A;  3E0U A;  5C00 A;  3CRT A;  2LNS A;  4KF9 A;  1O85 A;  2LJA A;  3F9U A;  1YZX A;  3G9B A;  1MDI A;  4GRF A;  4YAV A;  1OC8 A;  2UZ8 A;  4AGS A;  4F2I A;  5FT3 A;  1WOU A;  2HSH A;  4HI7 A;  5AN1 A;  4I8B A;  2RLI A;  4FIW A;  4ILF A;  3M0F A;  4MZB A;  3FR6 A;  1GSY A;  2IMF A;  2YOI A;  2O7K A;  3ME8 A;  3GH9 A;  4N10 A;  1UN2 A;  2DLX A;  2VAF A;  2X8G A;  2AB6 A;  5IMD A;  1M2B A;  3H93 A;  5HR2 A;  3N9J A;  2V32 A;  2DJ2 A;  2H71 A;  1O81 A;  2JZT A;  4F82 A;  4IEL A;  3FW2 A;  2L4Q A;  4PUR A;  4HU9 A;  1NHO A;  3UL3 A;  5E4W A;  3AY8 A;  4KE3 A;  2HFD A;  2VOC A;  5LCZ A;  1M99 A;  3HJP A;  2H1D A;  4YH2 A;  3MWH A;  1GUK A;  1HNB A;  1XW5 A;  2GZP A;  5AIX A;  1JZO A;  2A2S A;  2WDU A;  4KA0 A;  3M8N A;  3TJK A;  1R5P A;  2VL9 A;  4WF4 A;  3ZL5 A;  2XHF A;  2EIO A;  5D96 A;  3IHQ A;  1G7O A;  22GS A;  1QQ2 A;  4TOP A;  4HQZ A;  1GUH A;  4PUA A;  5DAL A;  1EWX A;  1THX A;  3KEB A;  3GTU B;  2H76 A;  2M72 A;  3H79 A;  2F3M A;  4GSS A;  1V2A A;  2TIR A;  4MH3 A;  3GX0 A;  5D9T A;  1J9B A;  5F8B A;  4KND A;  1K3O A;  1USB A;  1TK8 B;  4CW9 A;  4O7H A;  3DYR A;  2KUC A;  3WD6 A;  2E7P A;  3GKX A;  2LRN A;  2LST A;  3DD3 A;  5ECL B;  3QAG A;  3FR9 A;  1F2E A;  3TKS A;  3M1G A;  1SK0 A;  3D21 A;  1OYJ A;  2GT6 A;  3ZIV A;  4TR3 A;  1U3I A;  2E0Q A;  2CX4 A;  3IBH A;  2O89 A;  2PU9 C;  4GST A;  5HR3 A;  3HD5 A;  4ZBD A;  2XC2 A;  4ML6 A;  4ULX A;  1T1V A;  3P8W A;  3F4R A;  3NOF A;  2QC7 A;  5J41 A;  3FY7 A;  2QSI A;  1OC3 A;  3HZ4 A;  3KZQ A;  1FVK A;  3FKF A;  3DVW A;  2X8C A;  4TXO B;  2OJL A;  2OAC A;  5H5Q A;  5IM9 A;  2VM1 A;  1T3B A;  2XPE A;  2VCT A;  1M7T A;  1GWC A;  5IMV A;  4JR4 A;  4K9Z A;  1I9D A;  3UJ1 A;  3D4M A;  5HFI A;  5HQP A;  1FB6 A;  2IJY A;  2HRF A;  3CYN A;  4MJB A;  5L71 A;  2H6X A;  3FZ4 A;  4YAP A;  3A2X A;  3WT1 A;  4ZXG A;  3LSZ A;  1BAY A;  3RAZ A;  3TJJ A;  5JCU A;  4PXO A;  1R7H A;  3UMA A;  1XW9 A;  4HUA A;  2CA8 A;  1N2A A;  4GLT A;  3KIJ A;  3LG6 A;  1XPV A;  3CXG A;  2F8A A;  3HJO A;  4E8E A;  3F3Q A;  2RUE A;  3ZLP A;  2HZF A;  2H70 A;  5JWQ B;  4EUY A;  4KW6 A;  3LWA A;  13GS A;  3HVX A;  1B4P A;  3WGX A;  1Z6M A;  3CBU A;  4LL4 B;  1WRY A;  4EDZ A;  4G0K A;  1B8X A;  4PUF C;  1A2M A;  1TK5 B;  1F9M A;  2CZ2 A;  4EC0 A;  3VK9 A;  1KNG A;  2HZE A;  3QFB C;  3C73 A;  5AGY A;  4NV2 A;  7GSS A;  2WB9 A;  4DSR A;  4N0V A;  4PQ1 A;  3DXB A;  4IGJ A;  3TKQ A;  2D2Z A;  1AUC A;  5KN2 A;  1BED A;  3F4T A;  5A5K A;  16GS A;  2H6Y A;  3ZTL A;  3R2Q A;  4OO4 A;  3TRQ A;  1MDJ A;  4JU5 A;  2IFQ A;  2H0H A;  1SL2 B;  5F05 A;  2I4A A;  4IKH A;  2NVL A;  17GS A;  3W6G A;  3ZZX A;  2A4V A;  2H66 A;  1SKS B;  2M46 A;  1JLW A;  2H0G A;  3L78 A;  2K8V A;  3GIX A;  2WRT A;  1JFU A;  1TU8 A;  3PPU A;  1OAZ A;  3GRX A;  2YZH A;  3LYK A;  1THO A;  2ES7 A;  1A0F A;  4ECI A;  2YWO A;  4HJM A;  1K3L A;  1AQV A;  3TJG A;  1TRW A;  3UOM A;  4MJE A;  3UAP A;  2B5E A;  2H8L A;  4PNG A;  3KCM A;  3Q6O A;  1TK0 B;  3LEF A;  2EC4 A;  4GCI A;  2ON7 A;  1WPI A;  4TW5 A;  2FCH A;  4XRD A;  1OKT A;  1R5A A;  2DIY A;  2H72 A;  3VWU A;  5HFK A;  3KD0 A;  1BJX A;  2P5R A;  3RPP A;  3RDW A;  2YWM A;  1GUM A;  4GTU A;  1GNE A;  4QL7 A;  1ZCP A;  1O7U A;  3CSJ A;  4AJ8 A;  2JSZ A;  1JHB A;  2QKE A;  3M9K A;  4EVM A;  4XS6 A;  4OFT A;  1ERT A;  4TRX A;  1A0R P;  4LA1 A;  4MDC A;  1W89 A;  3BBY A;  5JWR B;  5F0G A;  4NHZ A;  3EU4 A;  4KDY A;  2M80 A;  1LU4 A;  4N11 A;  2HRN A;  3I9V 2;  4K7O A;  1PSQ A;  1FAA A;  5CP1 A;  1GSS A;  3C71 A;  3W8J A;  4X43 A; 
#chains in the Genus database with same CATH topology
 2HRK B;  4V1A g;  4OFM A;  2V1M A;  4YQM A;  1YF1 A;  4KGI A;  4Q5R A;  3HVN A;  2CX3 A;  5INY A;  5A1N A;  2C80 A;  1GTU A;  1ERV A;  1XW6 A;  1EGR A;  6GST A;  2GZZ A;  2PVO C;  3EUR A;  3HY2 A;  1K0C A;  3DIE A;  1TXU A;  3C1R A;  4ZBA A;  2A4H A;  3N5O A;  2I81 A;  4X1U A;  1S3R A;  3IOS A;  5G30 A;  3EE2 A;  4IQ1 A;  3A3T A;  3HA9 A;  3APQ A;  3GL5 A;  4K5S A;  2K8S A;  3GTU A;  2V6K A;  4XHM A;  3EIN A;  2GQM A;  4WBR D;  4NXI A;  4BVY B;  2GSR A;  2WW2 A;  4WR4 A;  2HSY A;  2GSS A;  1FHE A;  4OD7 A;  2B7J A;  1VF1 A;  4O92 A;  1GSE A;  1AXD A;  3BCK A;  2L59 A;  3GYK A;  1M2A A;  1JZR A;  3IXR A;  5GZZ B;  1AIU A;  3IDV A;  3RBT A;  2UV8 G;  1TJD A;  1MEK A;  4HZ2 A;  5ELG A;  1ST9 A;  5D8I A;  2MYG A;  4JZQ A;  1HNA A;  3J7Y k;  3IC4 A;  4N3Z A;  2GDR A;  4JED A;  1MD3 A;  1ACV A;  2KOK A;  3GNJ A;  4GXZ A;  1V98 A;  3C7M A;  4ZL8 A;  3KH7 A;  3PIN A;  6GSS A;  4YKG A;  1YJ6 A;  2IME A;  1GSU A;  3G7J A;  4ACS A;  1ABA A;  5J4Y A;  2FY6 A;  3LXZ A;  4MF7 A;  3O3T A;  3HZ8 A;  4CDO A;  2P5Q A;  2O36 A;  5D73 A;  3F4S A;  5EPF A;  2EFD A;  1IYI A;  1YDK A;  4PGT A;  5JCW A;  3GSS A;  2C3N A;  1FB0 A;  3H8Q A;  1B4Q A;  2GVP A;  1AAZ A;  1FW1 A;  3MIX A;  1ERW A;  1J0F A;  3FK8 A;  3CHX C;  4I6X A;  2B1L A;  2CV4 A;  1YY7 A;  3HVV A;  5CRH A;  1HD2 A;  3VUR A;  1QUW A;  5DCG A;  5J47 A;  1PX6 A;  2N5A A;  1Y1U A;  2YJH A;  1WWJ A;  4ECJ A;  2DKI A;  2HT9 A;  1M0U A;  3I69 A;  2R2J A;  4PQI A;  1ZYN A;  2CT6 A;  3IK7 A;  2H75 A;  4J56 E;  1QK8 A;  2E2G A;  1XWC A;  1TP9 A;  4KDU A;  4NAX A;  1SJZ A;  3UVT A;  2WS2 A;  12GS A;  1EZK A;  2FHE A;  4PX1 A;  5DCH A;  2HSM B;  1SVM A;  10GS A;  1X5D A;  1X9M B;  4MP4 A;  1PL2 A;  5ECP B;  1DE2 A;  4FQU A;  3ZMK A;  3IA1 A;  1V40 A;  3G7I A;  1ZZY A;  3P7X A;  2PGT A;  1ON4 A;  2Z9S A;  2FA4 A;  4ICY A;  4Z2T A;  4AKH A;  1M9B A;  3UBK A;  1GSQ A;  1TI1 A;  2PUK C;  2AAW A;  3FZ9 A;  3ZIJ A;  3HDC A;  3MSZ A;  3TKS C;  4EDY A;  11GS A;  3EMP A;  2R37 A;  3CQF A;  4GDF A;  2LS5 A;  4HU7 A;  3EYT A;  5A34 A;  3GKM A;  5CNW A;  3TKP A;  2RM5 A;  5H5S A;  2VD0 A;  3QD9 A;  3FZA A;  3CSH A;  4L5O A;  2ON5 A;  3VI7 A;  1ZGN A;  2PWJ A;  5IMZ A;  2REM A;  1OVN A;  4XTS A;  2LNT A;  3F3R A;  1LJR A;  3KTB A;  5C04 A;  2AV4 A;  6GSW A;  1M3I A;  3GKN A;  4K0N A;  1GLQ A;  2R6K A;  2VO4 A;  3HJM A;  3BOA A;  4MPF A;  1SYX A;  4MF5 A;  5DDL A;  4IW9 A;  4F03 A;  1NHY A;  1O6J A;  1A23 A;  1U6T A;  2FUG 2;  2EFH A;  3IPZ A;  4OWY A;  2VCX A;  1Z3E A;  5B8B A;  3FRC A;  3VFI A;  1GLP A;  1KBN A;  2N5B A;  4XS1 A;  1OE7 A;  1X5C A;  3RHC A;  4O5Q A;  3Q18 A;  4BVX B;  1T8E B;  1V57 A;  2GS3 A;  4N30 A;  2YV7 A;  2WUL A;  5ECR B;  2CVB A;  2H1L A;  4L0W A;  2C0E A;  1YEX A;  2WW3 A;  2V6O A;  2GZY A;  1Q98 A;  4XS4 B;  1PKZ A;  3KJY A;  1GRX A;  2BTO T;  3D4T A;  4H86 A;  4NPB A;  2EIQ A;  5DBQ A;  2GT5 A;  2O87 A;  5A4U A;  4MJC A;  5BRT A;  4V2L A;  3C1S A;  4EF0 A;  1N8J A;  1F37 A;  3GN3 A;  3SWL A;  3S9F A;  2MBT A;  4G19 A;  3TB2 A;  1WMJ A;  1QXH A;  4POM A;  2GSQ A;  2FD3 A;  5CRG A;  5AIV A;  5F07 A;  4V1A p;  2MMZ A;  4Z7X A;  2HRA A;  2I9H A;  2DSA A;  1GL8 A;  3EWL A;  3U6V A;  1SJI A;  2HRK A;  3VI5 A;  2C3Q A;  2CVD A;  2RUF A;  1SK1 A;  1V58 A;  3TKS E;  4MK3 A;  2B7K A;  4J2F A;  2BJX A;  4LMV A;  5J9C A;  1Z9H A;  5ID2 B;  5J3R A;  1MTC A;  4F0B A;  2WW1 A;  5ECK B;  6GSY A;  1W4V A;  3ZRD A;  5GSS A;  3HXS A;  2WJU A;  2PVQ A;  4MMM A;  5G1K A;  4I97 A;  1FVJ A;  3ZIT A;  1C72 A;  3PGT A;  4HOJ A;  2ALB A;  4FYB A;  4IP1 A;  4F0C A;  1FOH A;  3CMI A;  3GUR A;  3Q74 A;  3ZYW A;  1BX9 A;  4QL9 A;  1MD4 A;  2ZUP A;  4QQ7 A;  2YPM A;  4ECB A;  2J23 A;  4BVY A;  3IRA A;  4KAE A;  5IMC A;  5GST A;  1M2D A;  3LXT A;  2KP1 A;  3KM6 A;  3UBL A;  4CY8 A;  5EVO A;  1Y25 A;  4GF0 A;  4X0X A;  3F6F A;  2FWF A;  1URM A;  2WVX B;  4PTS A;  4K0G A;  4MLY A;  1HQO A;  2KLX A;  1XVW A;  3FMW A;  3QAW A;  5AIS A;  4ZBB A;  2LUS A;  5KN3 A;  1S3A A;  4FXY P;  1T4Z A;  2DML A;  3LOR A;  2CVK A;  2DJJ A;  3MYD A;  3A5W A;  1YEW C;  5ECQ B;  1SL0 B;  1WE0 A;  5IIZ A;  4KH7 A;  3APO A;  1SD9 A;  2WGR A;  4FYC A;  5LD0 A;  1CQH A;  1Z6N A;  5A4W A;  4I2T A;  4DVC A;  3KGK A;  1K0M A;  3F6D A;  2YV9 A;  1EP8 A;  2L4C A;  2OA7 A;  1K3Y A;  2MZC A;  2YN1 A;  1B9X C;  2WCI A;  1XVQ A;  3QMX A;  4FH8 A;  5CRD A;  5HFG A;  2YWN A;  5CRW A;  5B8A A;  2ZCT A;  1X0R A;  2NBS A;  2DJ1 A;  1ZMA A;  4IJ3 A;  4XRA A;  1XG8 A;  1Z7R A;  3A2W A;  3VWV A;  5LNK e;  3FHK A;  4JBB A;  8GSS A;  2FWG A;  1A8Y A;  2JL4 A;  2X64 A;  1S3C A;  3KXO A;  1SL1 B;  1PA3 A;  4MCU A;  3H4K A;  4IVF A;  4JRR A;  4BWS A;  2LRT A;  5HR1 A;  1O73 A;  4G2E A;  5B6N A;  6GSX A;  3PH9 A;  2H1G A;  5B7C A;  4E68 A;  2GQL A;  4HJ2 A;  1T7P B;  4G10 A;  3EPT A;  5IO2 A;  3LGC A;  3ME7 A;  3Q19 A;  2HSM A;  2DIZ A;  2VCZ A;  2K18 A;  4POB A;  1B9Y C;  1XWA A;  4TR0 A;  5IPH A;  1WJK A;  3ERG A;  1T00 A;  2L5L A;  3ZRE A;  5ELA A;  2VL2 A;  2JSY A;  1XOB A;  3P2A A;  3ZVJ A;  5E59 A;  4MJA A;  4L5L A;  2OT3 A;  2C0F A;  4EE0 A;  2G0F A;  3IV4 A;  2AHE A;  3OR5 A;  2VLV A;  20GS A;  2XBQ A;  3UIW A;  4O5U A;  2IPA A;  1SKR B;  5G2Z A;  3U5R E;  1SD8 A;  3D22 A;  3FR3 A;  5D9X A;  2DKH A;  3NIV A;  2IIY A;  2XPD A;  1TRU A;  6GSU A;  1A8L A;  3K8N A;  2WZS A;  5GAP D;  1EV9 A;  3TGZ A;  2IMD A;  5IO0 A;  1EOG A;  4K2D A;  1X5E A;  4WXT A;  1G7E A;  1I5G A;  1TI3 A;  4EL1 A;  4MPG A;  3ISO A;  1BYE A;  3C8E A;  4ZB9 A;  1TXX A;  3BJ5 A;  4OFN A;  5ENU A;  2PN8 A;  2H1B A;  4GQC A;  2HE3 A;  1DSB A;  6GSV A;  4MZC A;  1R26 A;  2F51 A;  2CAQ A;  5IMF A;  3GFK A;  4PI0 C;  5G31 A;  5J9B A;  1VF4 A;  4LLR A;  1TOF A;  1XXU A;  1QGV A;  2I1U A;  1VF3 A;  2JU5 A;  4HZ4 A;  3GH6 A;  1ZOF A;  1B48 A;  5IMA A;  4OO5 A;  3IAS 2;  4BVX A;  4J57 E;  3CSI A;  4JE1 A;  2L6D A;  1X9W B;  1DBY A;  1Y6E A;  1PRX A;  2YWI A;  3HVS A;  3CRU A;  2H6Z A;  1O8W A;  2R4V A;  2VCQ A;  3TOT A;  2MMA A;  4CHS A;  2F9S A;  4XS4 A;  4ZIJ A;  4OMV A;  1RQM A;  3E9J B;  5ECI B;  1GSD A;  2OE0 A;  2H74 A;  1ILO A;  1CQG A;  3TJF A;  2J9H A;  3D0Z A;  1ZYE A;  4WET A;  2B1K A;  3CWG A;  4BA7 A;  3MNG A;  2DMM A;  2VIM A;  1BF5 A;  2C8U A;  1N25 A;  1X9S B;  3UEM A;  3L9U A;  5IPG A;  3L9S A;  5CO3 A;  2ZNM A;  4E8H A;  2YP6 A;  2H0I A;  5FHI A;  1KTE A;  4XCS A;  4RI7 A;  4EIP A;  4K2X A;  5JWO B;  2C0G A;  2NPB A;  1QMV A;  2EFC A;  3HKR A;  1YF0 A;  4KSM A;  5DVB A;  1BQ7 A;  1EP7 A;  1FO5 A;  2QA1 A;  4DSS B;  2FA8 A;  1PKW A;  3TRP A;  1GTI A;  5ID2 A;  4EKZ A;  2JAC A;  2LJK A;  1SYR A;  3IHG A;  4I2U A;  1OC9 B;  3TOU A;  4TVE A;  5IOW A;  1TDI A;  1VRS D;  3DWV A;  2VM2 A;  4WEY A;  4WKW A;  1UVZ A;  3GHA A;  1E6B A;  3H1N A;  1V9W A;  2P31 A;  4PHZ C;  1F6M C;  2CAI A;  2DJ0 A;  1F3B A;  3GV1 A;  2IMI A;  4EXJ A;  2FNO A;  2PBJ A;  1K0O A;  3TKR A;  1TRS A;  3QDN A;  3RHB A;  3EVI A;  5ECN B;  4FYU A;  3O6T A;  4GSN A;  3UVH A;  3FYG A;  2F8F A;  1OKD A;  1S4B P;  1A2J A;  1Z7P A;  5ECO B;  3VLN A;  3NZN A;  2WVX A;  4HDE A;  2V2G A;  2WFC A;  4ZL7 A;  1DE1 A;  4KX4 A;  3F63 A;  5DQS A;  2H73 A;  3QCP A;  4D73 B;  1JLV A;  1BG5 A;  2RII A;  2FWE A;  5ECH B;  2MMN A;  2B5X A;  3BCI A;  5CYY A;  3LYP A;  1TKD B;  3FZ5 A;  4OCF A;  2G2Q A;  4TR1 B;  1OE8 A;  2KP2 A;  1K0B A;  1I1I P;  2EIR A;  2R5G A;  4AJ6 A;  1G6Y A;  1G6W A;  4FO5 A;  3D5J A;  2H19 A;  5BMU A;  3ERW A;  3KP8 A;  3ZML A;  4NHW A;  2OE3 A;  2LQO A;  1U87 A;  2YNX A;  1YQ1 A;  5DAK B;  4GQF A;  1GUL A;  3VWX A;  2YAN A;  2X8H A;  4WBJ A;  3DEX A;  1EEM A;  2QGV A;  3MDK A;  3US3 A;  4YQU A;  1TW9 A;  5DQY A;  4L0U A;  4Z2U A;  2JAD A;  4HQS A;  2K6V A;  1U3A A;  2MMO A;  2OAD A;  3KTL A;  3I6A A;  4POL A;  3DRN A;  3JCM L;  5ABR A;  1GTA A;  1ML6 A;  2HNL A;  2LTK A;  4ZB8 A;  5CRE A;  2E2M A;  3ZFB A;  4P3Y B;  3IR4 A;  3RGB C;  2WW0 A;  3QR6 A;  5B6M A;  4POK A;  1NM3 A;  3TRX A;  3J7Y b;  3EMX A;  1AW9 A;  5ECM B;  2BMX A;  4MZW A;  1J08 A;  4O5R A;  3QAV A;  2O5V A;  3VWW A;  2CQ9 A;  4KDX A;  4IBP A;  2GGT A;  1U88 A;  2C3T A;  2P0G A;  2O85 A;  2FLS A;  2LEG A;  3EU3 A;  4OCE A;  4Z2R A;  1VGL A;  2VCW A;  1FG4 A;  1TU7 A;  3ZFL A;  2O8V B;  4L8E A;  1EGO A;  3EC3 A;  3FEU A;  2KHP A;  1SKW B;  4RQX A;  1NSW A;  1DUG A;  9GSS A;  4KSO A;  1YKC A;  2VKZ G;  4USS A;  4NWY A;  2GQK A;  5F06 A;  4BL7 B;  1ERU A;  3M3M A;  2JZR A;  4Q5Q A;  1PFO A;  2L57 A;  4WF5 A;  4I5Q A;  4O32 A;  4TR4 A;  2X99 A;  3DKS A;  1EEJ A;  2N5F A;  3TUE A;  4TN8 A;  4ML1 A;  4PNF A;  2AUV A;  1K0N A;  1PQN A;  2MBS A;  1VF2 A;  1AQW A;  1GTB A;  3WYW A;  3GUS A;  5A4V A;  4IP6 A;  4BPY A;  1LBK A;  4DEJ A;  2B5Y A;  5KN0 A;  4LMW A;  4Q5N A;  5G5E A;  1HYU A;  1MDK A;  3GA4 A;  4MH2 A;  2X4A A;  1PGT A;  5J4U A;  2LV3 A;  4V2N A;  2CZ3 A;  3L9V A;  1F3A A;  2R3X A;  1GH2 A;  5D9W A;  3VPT A;  1XWB A;  3WGE A;  1XBS A;  2HSN B;  2WZ9 A;  3G7Y A;  4G01 A;  5IOX A;  3HCZ A;  2PER A;  1Z5Y E;  2OBI A;  2LJR A;  3MAK A;  3GMF A;  4HS1 A;  2VLU A;  3F8U A;  4RI6 A;  3LQ7 A;  4NMU A;  1O8X A;  2GTU A;  5HR0 A;  4YKF A;  4BWQ A;  3W8S A;  4G0I A;  4KB3 A;  4JR6 A;  3UAR A;  1ZYP A;  1AC1 A;  3BD2 A;  1SJ6 A;  1PL1 A;  2LQQ A;  3A2V A;  3ERF A;  5CAX A;  3HYP A;  2VL2 C;  5BMU B;  2C1Y A;  3IE3 A;  2HI7 A;  5ECS A;  5IQY A;  1RW1 A;  2H01 A;  3I43 A;  1PD2 1;  4MA9 A;  4IQA A;  4YQV A;  2DJ3 A;  3LFL A;  2HQT A;  4LL1 B;  2NTO A;  5DAL B;  1PMT A;  3KH9 A;  4AKX B;  2L5O A;  5EL8 A;  4DSS A;  3HHV A;  4PQH A;  4ISD A;  5COH A;  1A24 A;  2PMT A;  3GKK A;  4BIK A;  4ZIL A;  1EOH A;  2YCD A;  3TCO A;  2RM6 A;  4IN0 A;  2B6M A;  3APS A;  1M3J A;  3CTG A;  1JZW A;  4RQR A;  3ZVJ D;  4EO3 A;  2LKU A;  3GL3 A;  1GSF A;  2JZS A;  5DJM A;  3KMN A;  1NW2 A;  4V2M A;  1ZYQ B;  1OC9 A;  1K0D A;  2AJQ B;  3DGQ A;  4A5P A;  14GS A;  4AJ7 A;  4ID0 A;  1HNC A;  2H1A A;  4RUV A;  3M9J A;  5EY6 A;  4N0Z A;  2C0D A;  5H5R A;  2B3S A;  2GST A;  1PN9 A;  1KEB A;  1T4Y A;  3CTF A;  3DML A;  4IHU A;  4KCA A;  5GAN D;  2YJ7 A;  4AF2 A;  2C4J A;  4K5R A;  1XCC A;  4K8M A;  1GNW A;  2PPT A;  2A2P A;  1YVL A;  1XOA A;  2IMK A;  1UC7 A;  2HLS A;  2FGX A;  2DC5 A;  1H4O A;  4K6X A;  2AYT A;  5KOW A;  1ZL9 A;  2H30 A;  2LRC A;  3WT2 A;  4D73 A;  5G5F A;  3L4N A;  4QMK A;  5DJL A;  4K1F A;  3D6I A;  2K9F A;  2R0G A;  5D93 A;  19GS A;  4K7I A;  4GWR A;  3PR8 A;  1M9A A;  3R3E A;  1GP1 A;  4ZL9 A;  2HYX A;  3V1W A;  3L0H A;  2YZU A;  4MAB A;  4TR1 A;  3RPN A;  2TRC P;  4G0L A;  1WIK A;  4IS0 A;  2V41 A;  2DBC A;  4KCE A;  3SBC A;  1R4W A;  3QPM A;  1TTZ A;  5KN1 A;  4F9Z A;  3F0I A;  2TRX A;  5DAK A;  4DSQ A;  2VL3 A;  4G9H A;  5D9V A;  2IWT A;  1SEN A;  1EV4 A;  2HZE B;  3KP9 A;  3TDG A;  2L6C A;  5FWG A;  2I3Y A;  1QFN A;  3TJB A;  1SU9 A;  3LJR A;  1XFL A;  5KEJ A;  1PX7 A;  1XWK A;  3P90 A;  2O3E A;  1JZD A;  4TKY A;  3IC8 A;  1XWG A;  2DJK A;  4WR5 A;  3QFA C;  1AQX A;  1WP0 A;  2OBK A;  1E2Y A;  4TXV A;  1XIY A;  1SK2 A;  3QOU A;  1G0T A;  3WGD A;  2XBI A;  1XZO A;  2VLT A;  1K0A A;  3ED3 A;  3KMO A;  4XIH A;  4EIQ A;  1YKA A;  4IJI A;  2IFQ B;  3O76 A;  1RK4 A;  1UA5 A;  3DVX A;  4ZB6 A;  1Q4J A;  4TXO A;  2IL3 A;  3GX8 A;  3GST A;  5J5N A;  1BG1 A;  2VUP A;  1H75 A;  5J40 A;  4Q5F A;  1IYH A;  4X4J A;  5G1L A;  1FOV A;  2IN3 A;  1TRV A;  3VPQ A;  2FWH A;  5JCG A;  3IK9 A;  4NV5 A;  2VCV A;  4KUN A;  4W66 A;  18GS A;  2A2R A;  3IAM 2;  4K7N A;  3E3E A;  1A2L A;  1S3D A;  2VD1 A;  5A5H A;  2OKA A;  2GLR A;  4HEA 2;  2OE1 A;  4BL7 A;  2HXK A;  4ECC A;  4MF6 A;  1YEP A;  2NDO A;  5J4V A;  3E0U A;  5C00 A;  3CRT A;  2LNS A;  4KF9 A;  1O85 A;  2LJA A;  3F9U A;  1YZX A;  3G9B A;  1MDI A;  4GRF A;  4YAV A;  1OC8 A;  2UZ8 A;  4AGS A;  4F2I A;  5FT3 A;  1WOU A;  2HSH A;  1PN0 A;  4HI7 A;  5AN1 A;  4I8B A;  2RLI A;  4PI2 C;  4AI6 A;  4FIW A;  4ILF A;  3M0F A;  4MZB A;  3FR6 A;  1GSY A;  2IMF A;  2YOI A;  2O7K A;  3ME8 A;  3GH9 A;  4N10 A;  1UN2 A;  2DLX A;  2VAF A;  2X8G A;  4HSC X;  2AB6 A;  5IMD A;  1M2B A;  2HSN A;  3H93 A;  5HR2 A;  3N9J A;  4AKG A;  2V32 A;  2DJ2 A;  2H71 A;  1O81 A;  2JZT A;  4F82 A;  4IEL A;  3FW2 A;  2L4Q A;  4PUR A;  4HU9 A;  1NHO A;  3UL3 A;  5E4W A;  3AY8 A;  4KE3 A;  2HFD A;  2VOC A;  5LCZ A;  1M99 A;  3HJP A;  2H1D A;  4YH2 A;  3MWH A;  1GUK A;  1HNB A;  1XW5 A;  2GZP A;  5AIX A;  1JZO A;  2A2S A;  2WDU A;  4KA0 A;  3M8N A;  5A1N B;  3TJK A;  1R5P A;  2VL9 A;  4WF4 A;  2R0C A;  3ZL5 A;  2XHF A;  2EIO A;  5D96 A;  3IHQ A;  2R0P A;  1G7O A;  22GS A;  1QQ2 A;  4TOP A;  4HQZ A;  1GUH A;  4PUA A;  5DAL A;  1EWX A;  1THX A;  3KEB A;  3GTU B;  2H76 A;  2M72 A;  3H79 A;  1SVL A;  2F3M A;  4GSS A;  1V2A A;  2TIR A;  4MH3 A;  3GX0 A;  5D9T A;  1J9B A;  5F8B A;  4KND A;  1K3O A;  1USB A;  1TK8 B;  2WVZ A;  4CW9 A;  4O7H A;  3DYR A;  2KUC A;  3WD6 A;  2E7P A;  3GKX A;  2LRN A;  2LST A;  3DD3 A;  5ECL B;  3QAG A;  3FR9 A;  1F2E A;  3TKS A;  3M1G A;  1SK0 A;  3D21 A;  1OYJ A;  2GT6 A;  3ZIV A;  4TR3 A;  1U3I A;  2E0Q A;  2CX4 A;  3IBH A;  2O89 A;  2PU9 C;  4GST A;  5HR3 A;  3HD5 A;  4ZBD A;  2XC2 A;  4ML6 A;  4ULX A;  1T1V A;  3P8W A;  3F4R A;  3NOF A;  2QC7 A;  5J41 A;  3FY7 A;  2QSI A;  1OC3 A;  3HZ4 A;  3KZQ A;  1FVK A;  3FKF A;  3DVW A;  2X8C A;  4TXO B;  2OJL A;  2OAC A;  5H5Q A;  5IM9 A;  2VM1 A;  1T3B A;  2XPE A;  2VCT A;  1M7T A;  1GWC A;  5IMV A;  4JR4 A;  4K9Z A;  1I9D A;  3UJ1 A;  3D4M A;  5HFI A;  5HQP A;  1FB6 A;  2IJY A;  2HRF A;  3CYN A;  4MJB A;  5L71 A;  2H6X A;  3FZ4 A;  4YAP A;  3A2X A;  3WT1 A;  4ZXG A;  3LSZ A;  2EFE A;  5A5H B;  1BAY A;  3RAZ A;  3TJJ A;  5JCU A;  4PXO A;  1R7H A;  3UMA A;  1XW9 A;  4HUA A;  2CA8 A;  1N2A A;  4GLT A;  3KIJ A;  3LG6 A;  1XPV A;  3CXG A;  2F8A A;  3HJO A;  4E8E A;  5KOX A;  3F3Q A;  2RUE A;  3ZLP A;  2HZF A;  2H70 A;  5JWQ B;  4EUY A;  4KW6 A;  3LWA A;  13GS A;  3HVX A;  1B4P A;  3WGX A;  1Z6M A;  3CBU A;  4LL4 B;  3RFR C;  1WRY A;  4EDZ A;  4G0K A;  1B8X A;  4PUF C;  1A2M A;  1TK5 B;  1F9M A;  2CZ2 A;  4EC0 A;  3VK9 A;  1KNG A;  2HZE A;  3TU3 B;  3QFB C;  3C73 A;  1SVO A;  5AGY A;  4NV2 A;  7GSS A;  2WB9 A;  4DSR A;  4N0V A;  2WVY A;  4PQ1 A;  3DXB A;  4IGJ A;  3TKQ A;  2D2Z A;  1AUC A;  5KN2 A;  1BED A;  3F4T A;  5A34 B;  16GS A;  5A5K A;  2H6Y A;  3ZTL A;  3A5I A;  3R2Q A;  4OO4 A;  3TRQ A;  1MDJ A;  4JU5 A;  2IFQ A;  2H0H A;  1SL2 B;  5F05 A;  2I4A A;  4MNN A;  4IKH A;  2NVL A;  17GS A;  3W6G A;  3ZZX A;  2A4V A;  2H66 A;  1SKS B;  2M46 A;  1JLW A;  2H0G A;  3L78 A;  4ZB7 A;  2K8V A;  3GIX A;  2WRT A;  1JFU A;  1TU8 A;  3PPU A;  1OAZ A;  3GRX A;  2YZH A;  3LYK A;  1THO A;  2ES7 A;  1A0F A;  4ECI A;  2YWO A;  4HJM A;  1K3L A;  1AQV A;  3TJG A;  1TRW A;  3UOM A;  4MJE A;  3UAP A;  2B5E A;  2H8L A;  4PNG A;  3KCM A;  2QA2 A;  3Q6O A;  1TK0 B;  3LEF A;  2EC4 A;  4GCI A;  2ON7 A;  1WPI A;  4TW5 A;  2FCH A;  4XRD A;  1OKT A;  1R5A A;  2DIY A;  2H72 A;  3VWU A;  5HFK A;  3KD0 A;  1BJX A;  2P5R A;  3RPP A;  3RDW A;  2YWM A;  1GUM A;  4GTU A;  1GNE A;  4QL7 A;  1ZCP A;  1O7U A;  3CSJ A;  4AJ8 A;  2JSZ A;  1JHB A;  2QKE A;  3M9K A;  4EVM A;  3HMJ G;  4AKI A;  4XS6 A;  4OFT A;  1ERT A;  4TRX A;  2X49 A;  1A0R P;  4LA1 A;  4MDC A;  1W89 A;  3LW9 A;  4CY6 A;  3BBY A;  5JWR B;  5F0G A;  4NHZ A;  3EU4 A;  4KDY A;  2M80 A;  1LU4 A;  4N11 A;  2HRN A;  3I9V 2;  4K7O A;  1PSQ A;  1FAA A;  5CP1 A;  1GSS A;  3C71 A;  3W8J A;  4X43 A; 
#chains in the Genus database with same CATH homology
 2HRK B;  4V1A g;  4OFM A;  2V1M A;  4YQM A;  1YF1 A;  4KGI A;  4Q5R A;  2CX3 A;  5INY A;  5A1N A;  2C80 A;  1GTU A;  1ERV A;  1XW6 A;  1EGR A;  6GST A;  2GZZ A;  2PVO C;  3EUR A;  3HY2 A;  1K0C A;  3DIE A;  1TXU A;  3C1R A;  4ZBA A;  2A4H A;  3N5O A;  2I81 A;  4X1U A;  3IOS A;  5G30 A;  3EE2 A;  4IQ1 A;  3A3T A;  3HA9 A;  3APQ A;  3GL5 A;  4K5S A;  2K8S A;  3GTU A;  2V6K A;  4XHM A;  3EIN A;  2GQM A;  4WBR D;  4NXI A;  4BVY B;  2GSR A;  4WR4 A;  2HSY A;  2GSS A;  1FHE A;  4OD7 A;  2B7J A;  1VF1 A;  4O92 A;  1GSE A;  1AXD A;  3BCK A;  2L59 A;  3GYK A;  1M2A A;  1JZR A;  3IXR A;  5GZZ B;  1AIU A;  3IDV A;  3RBT A;  2UV8 G;  1TJD A;  1MEK A;  4HZ2 A;  5ELG A;  1ST9 A;  5D8I A;  2MYG A;  4JZQ A;  1HNA A;  3J7Y k;  3IC4 A;  4N3Z A;  2GDR A;  4JED A;  1MD3 A;  1ACV A;  2KOK A;  3GNJ A;  4GXZ A;  1V98 A;  3C7M A;  4ZL8 A;  3KH7 A;  3PIN A;  6GSS A;  4YKG A;  1YJ6 A;  2IME A;  1GSU A;  3G7J A;  4ACS A;  1ABA A;  5J4Y A;  2FY6 A;  3LXZ A;  4MF7 A;  3O3T A;  3HZ8 A;  4CDO A;  2P5Q A;  5D73 A;  3F4S A;  5EPF A;  2EFD A;  1IYI A;  1YDK A;  4PGT A;  5JCW A;  3GSS A;  2C3N A;  1FB0 A;  3H8Q A;  1B4Q A;  2GVP A;  1AAZ A;  1FW1 A;  3MIX A;  1ERW A;  1J0F A;  3FK8 A;  4I6X A;  2B1L A;  2CV4 A;  1YY7 A;  3HVV A;  5CRH A;  1HD2 A;  3VUR A;  1QUW A;  5DCG A;  5J47 A;  1PX6 A;  2N5A A;  1Y1U A;  2YJH A;  1WWJ A;  4ECJ A;  2DKI A;  2HT9 A;  1M0U A;  3I69 A;  2R2J A;  4PQI A;  1ZYN A;  2CT6 A;  3IK7 A;  2H75 A;  4J56 E;  1QK8 A;  2E2G A;  1XWC A;  1TP9 A;  4KDU A;  4NAX A;  1SJZ A;  3UVT A;  2WS2 A;  12GS A;  1EZK A;  2FHE A;  4PX1 A;  5DCH A;  2HSM B;  1SVM A;  10GS A;  1X5D A;  1X9M B;  4MP4 A;  1PL2 A;  5ECP B;  1DE2 A;  4FQU A;  3ZMK A;  3IA1 A;  1V40 A;  3G7I A;  1ZZY A;  3P7X A;  2PGT A;  1ON4 A;  2Z9S A;  2FA4 A;  4ICY A;  4Z2T A;  4AKH A;  1M9B A;  3UBK A;  1GSQ A;  1TI1 A;  2PUK C;  2AAW A;  3FZ9 A;  3ZIJ A;  3HDC A;  3MSZ A;  3TKS C;  4EDY A;  11GS A;  3EMP A;  2R37 A;  4GDF A;  2LS5 A;  4HU7 A;  3EYT A;  5A34 A;  3GKM A;  5CNW A;  3TKP A;  2RM5 A;  5H5S A;  2VD0 A;  3QD9 A;  3FZA A;  3CSH A;  4L5O A;  2ON5 A;  3VI7 A;  1ZGN A;  2PWJ A;  5IMZ A;  2REM A;  1OVN A;  4XTS A;  2LNT A;  3F3R A;  1LJR A;  3KTB A;  5C04 A;  2AV4 A;  6GSW A;  3GKN A;  4K0N A;  1GLQ A;  2R6K A;  2VO4 A;  3HJM A;  3BOA A;  4MPF A;  1SYX A;  4MF5 A;  5DDL A;  4IW9 A;  4F03 A;  1NHY A;  1O6J A;  1A23 A;  1U6T A;  2FUG 2;  2EFH A;  3IPZ A;  4OWY A;  2VCX A;  1Z3E A;  5B8B A;  3FRC A;  3VFI A;  1GLP A;  1KBN A;  2N5B A;  4XS1 A;  1OE7 A;  1X5C A;  3RHC A;  4O5Q A;  3Q18 A;  4BVX B;  1T8E B;  1V57 A;  2GS3 A;  4N30 A;  2YV7 A;  2WUL A;  5ECR B;  2CVB A;  2H1L A;  4L0W A;  2C0E A;  1YEX A;  2V6O A;  2GZY A;  1Q98 A;  4XS4 B;  1PKZ A;  3KJY A;  1GRX A;  2BTO T;  3D4T A;  4H86 A;  4NPB A;  2EIQ A;  5DBQ A;  2GT5 A;  2O87 A;  5A4U A;  4MJC A;  5BRT A;  4V2L A;  3C1S A;  4EF0 A;  1N8J A;  1F37 A;  3GN3 A;  3SWL A;  3S9F A;  2MBT A;  4G19 A;  3TB2 A;  1WMJ A;  1QXH A;  4POM A;  2GSQ A;  2FD3 A;  5CRG A;  5AIV A;  5F07 A;  4V1A p;  2MMZ A;  4Z7X A;  2HRA A;  2I9H A;  2DSA A;  1GL8 A;  3EWL A;  3U6V A;  1SJI A;  2HRK A;  3VI5 A;  2C3Q A;  2CVD A;  2RUF A;  1SK1 A;  1V58 A;  3TKS E;  4MK3 A;  2B7K A;  4J2F A;  2BJX A;  4LMV A;  5J9C A;  1Z9H A;  5ID2 B;  5J3R A;  1MTC A;  4F0B A;  5ECK B;  1W4V A;  6GSY A;  3ZRD A;  5GSS A;  3HXS A;  2WJU A;  2PVQ A;  4MMM A;  5G1K A;  4I97 A;  1FVJ A;  3ZIT A;  1C72 A;  3PGT A;  4HOJ A;  2ALB A;  4FYB A;  4IP1 A;  4F0C A;  1FOH A;  3CMI A;  3GUR A;  3Q74 A;  3ZYW A;  1BX9 A;  4QL9 A;  1MD4 A;  2ZUP A;  4QQ7 A;  2YPM A;  4ECB A;  2J23 A;  4BVY A;  3IRA A;  4KAE A;  5IMC A;  5GST A;  1M2D A;  3LXT A;  2KP1 A;  3KM6 A;  3UBL A;  4CY8 A;  5EVO A;  1Y25 A;  4GF0 A;  4X0X A;  3F6F A;  2FWF A;  1URM A;  4PTS A;  4K0G A;  4MLY A;  1HQO A;  2KLX A;  1XVW A;  3FMW A;  3QAW A;  5AIS A;  4ZBB A;  2LUS A;  5KN3 A;  1S3A A;  2DML A;  1T4Z A;  3LOR A;  2CVK A;  2DJJ A;  3MYD A;  3A5W A;  5ECQ B;  1SL0 B;  1WE0 A;  5IIZ A;  4KH7 A;  3APO A;  1SD9 A;  2WGR A;  4FYC A;  5LD0 A;  1CQH A;  1Z6N A;  5A4W A;  4I2T A;  4DVC A;  3KGK A;  1K0M A;  3F6D A;  2YV9 A;  1EP8 A;  2L4C A;  2OA7 A;  1K3Y A;  2MZC A;  2YN1 A;  1B9X C;  2WCI A;  1XVQ A;  3QMX A;  4FH8 A;  5CRD A;  5HFG A;  2YWN A;  5CRW A;  5B8A A;  2ZCT A;  1X0R A;  2NBS A;  2DJ1 A;  1ZMA A;  4IJ3 A;  4XRA A;  1Z7R A;  3A2W A;  3VWV A;  5LNK e;  3FHK A;  4JBB A;  8GSS A;  2FWG A;  1A8Y A;  2JL4 A;  2X64 A;  1S3C A;  3KXO A;  1SL1 B;  1PA3 A;  4MCU A;  3H4K A;  4IVF A;  4JRR A;  4BWS A;  2LRT A;  5HR1 A;  1O73 A;  4G2E A;  5B6N A;  6GSX A;  3PH9 A;  2H1G A;  5B7C A;  4E68 A;  2GQL A;  4HJ2 A;  1T7P B;  4G10 A;  3EPT A;  5IO2 A;  3LGC A;  3ME7 A;  3Q19 A;  2HSM A;  2DIZ A;  2VCZ A;  2K18 A;  4POB A;  1B9Y C;  1XWA A;  4TR0 A;  5IPH A;  1WJK A;  3ERG A;  1T00 A;  2L5L A;  3ZRE A;  5ELA A;  2VL2 A;  2JSY A;  1XOB A;  3P2A A;  3ZVJ A;  5E59 A;  4MJA A;  4L5L A;  2OT3 A;  2C0F A;  4EE0 A;  2G0F A;  3IV4 A;  2AHE A;  3OR5 A;  2VLV A;  20GS A;  2XBQ A;  3UIW A;  4O5U A;  2IPA A;  1SKR B;  5G2Z A;  3U5R E;  1SD8 A;  3D22 A;  3FR3 A;  5D9X A;  2DKH A;  3NIV A;  2IIY A;  2XPD A;  1TRU A;  6GSU A;  1A8L A;  3K8N A;  5GAP D;  1EV9 A;  3TGZ A;  2IMD A;  5IO0 A;  1EOG A;  4K2D A;  1X5E A;  4WXT A;  1G7E A;  1I5G A;  1TI3 A;  4EL1 A;  4MPG A;  3ISO A;  1BYE A;  3C8E A;  4ZB9 A;  1TXX A;  3BJ5 A;  4OFN A;  5ENU A;  2PN8 A;  2H1B A;  4GQC A;  2HE3 A;  1DSB A;  6GSV A;  4MZC A;  1R26 A;  2F51 A;  2CAQ A;  5IMF A;  3GFK A;  5G31 A;  5J9B A;  1VF4 A;  4LLR A;  1TOF A;  1XXU A;  1QGV A;  2I1U A;  1VF3 A;  2JU5 A;  4HZ4 A;  3GH6 A;  1ZOF A;  1B48 A;  5IMA A;  4OO5 A;  3IAS 2;  4BVX A;  4J57 E;  3CSI A;  4JE1 A;  2L6D A;  1X9W B;  1DBY A;  1Y6E A;  1PRX A;  2YWI A;  3HVS A;  3CRU A;  2H6Z A;  1O8W A;  2R4V A;  2VCQ A;  3TOT A;  2MMA A;  4CHS A;  2F9S A;  4XS4 A;  4ZIJ A;  4OMV A;  1RQM A;  3E9J B;  5ECI B;  1GSD A;  2OE0 A;  2H74 A;  1ILO A;  1CQG A;  3TJF A;  2J9H A;  3D0Z A;  1ZYE A;  4WET A;  2B1K A;  3CWG A;  4BA7 A;  3MNG A;  2DMM A;  2VIM A;  1BF5 A;  2C8U A;  1N25 A;  1X9S B;  3UEM A;  3L9U A;  5IPG A;  3L9S A;  5CO3 A;  2ZNM A;  4E8H A;  2YP6 A;  2H0I A;  5FHI A;  1KTE A;  4XCS A;  4RI7 A;  4EIP A;  4K2X A;  5JWO B;  2C0G A;  2NPB A;  1QMV A;  2EFC A;  3HKR A;  1YF0 A;  4KSM A;  5DVB A;  1BQ7 A;  1EP7 A;  1FO5 A;  2QA1 A;  4DSS B;  2FA8 A;  1PKW A;  3TRP A;  1GTI A;  5ID2 A;  4EKZ A;  2JAC A;  2LJK A;  1SYR A;  3IHG A;  4I2U A;  1OC9 B;  3TOU A;  4TVE A;  5IOW A;  1TDI A;  1VRS D;  3DWV A;  2VM2 A;  4WEY A;  4WKW A;  1UVZ A;  3GHA A;  1E6B A;  3H1N A;  1V9W A;  2P31 A;  1F6M C;  2CAI A;  2DJ0 A;  1F3B A;  3GV1 A;  2IMI A;  4EXJ A;  2FNO A;  2PBJ A;  1K0O A;  3TKR A;  1TRS A;  3QDN A;  3RHB A;  3EVI A;  5ECN B;  4FYU A;  3O6T A;  4GSN A;  3UVH A;  3FYG A;  2F8F A;  1OKD A;  1A2J A;  1Z7P A;  5ECO B;  3VLN A;  3NZN A;  4HDE A;  2V2G A;  2WFC A;  4ZL7 A;  1DE1 A;  4KX4 A;  3F63 A;  5DQS A;  2H73 A;  3QCP A;  4D73 B;  1JLV A;  1BG5 A;  2RII A;  2FWE A;  5ECH B;  2MMN A;  2B5X A;  3BCI A;  5CYY A;  3LYP A;  1TKD B;  3FZ5 A;  4OCF A;  2G2Q A;  4TR1 B;  1OE8 A;  2KP2 A;  1K0B A;  2EIR A;  2R5G A;  4AJ6 A;  1G6Y A;  1G6W A;  4FO5 A;  3D5J A;  2H19 A;  5BMU A;  3ERW A;  3KP8 A;  3ZML A;  4NHW A;  2OE3 A;  2LQO A;  1U87 A;  2YNX A;  1YQ1 A;  5DAK B;  4GQF A;  1GUL A;  3VWX A;  2YAN A;  2X8H A;  4WBJ A;  3DEX A;  1EEM A;  2QGV A;  3MDK A;  3US3 A;  4YQU A;  1TW9 A;  5DQY A;  4L0U A;  4Z2U A;  2JAD A;  4HQS A;  2K6V A;  1U3A A;  2MMO A;  2OAD A;  3KTL A;  3I6A A;  4POL A;  3DRN A;  3JCM L;  5ABR A;  1GTA A;  1ML6 A;  2HNL A;  2LTK A;  4ZB8 A;  5CRE A;  2E2M A;  3ZFB A;  4P3Y B;  3IR4 A;  3QR6 A;  5B6M A;  4POK A;  1NM3 A;  3TRX A;  3J7Y b;  3EMX A;  1AW9 A;  5ECM B;  2BMX A;  4MZW A;  1J08 A;  4O5R A;  3QAV A;  2O5V A;  3VWW A;  2CQ9 A;  4KDX A;  4IBP A;  2GGT A;  1U88 A;  2C3T A;  2P0G A;  2O85 A;  2FLS A;  2LEG A;  3EU3 A;  4OCE A;  4Z2R A;  1VGL A;  2VCW A;  1FG4 A;  1TU7 A;  3ZFL A;  2O8V B;  4L8E A;  1EGO A;  3EC3 A;  3FEU A;  2KHP A;  1SKW B;  4RQX A;  1NSW A;  1DUG A;  9GSS A;  4KSO A;  1YKC A;  2VKZ G;  4USS A;  4NWY A;  2GQK A;  5F06 A;  4BL7 B;  1ERU A;  3M3M A;  2JZR A;  4Q5Q A;  2L57 A;  4WF5 A;  4I5Q A;  4O32 A;  4TR4 A;  2X99 A;  3DKS A;  1EEJ A;  2N5F A;  3TUE A;  4TN8 A;  4ML1 A;  4PNF A;  2AUV A;  1K0N A;  1PQN A;  2MBS A;  1VF2 A;  1AQW A;  1GTB A;  3WYW A;  3GUS A;  5A4V A;  4IP6 A;  4BPY A;  1LBK A;  4DEJ A;  2B5Y A;  5KN0 A;  4LMW A;  4Q5N A;  5G5E A;  1HYU A;  1MDK A;  3GA4 A;  4MH2 A;  2X4A A;  1PGT A;  5J4U A;  2LV3 A;  4V2N A;  2CZ3 A;  3L9V A;  1F3A A;  2R3X A;  1GH2 A;  5D9W A;  3VPT A;  1XWB A;  3WGE A;  1XBS A;  2HSN B;  2WZ9 A;  3G7Y A;  4G01 A;  5IOX A;  3HCZ A;  2PER A;  1Z5Y E;  2OBI A;  2LJR A;  3MAK A;  3GMF A;  4HS1 A;  2VLU A;  3F8U A;  4RI6 A;  3LQ7 A;  4NMU A;  1O8X A;  2GTU A;  5HR0 A;  4YKF A;  4BWQ A;  3W8S A;  4G0I A;  4KB3 A;  4JR6 A;  3UAR A;  1ZYP A;  1AC1 A;  3BD2 A;  1SJ6 A;  1PL1 A;  2LQQ A;  3A2V A;  3ERF A;  5CAX A;  3HYP A;  2VL2 C;  5BMU B;  2C1Y A;  3IE3 A;  2HI7 A;  5ECS A;  5IQY A;  1RW1 A;  2H01 A;  3I43 A;  1PD2 1;  4MA9 A;  4IQA A;  4YQV A;  2DJ3 A;  3LFL A;  2HQT A;  4LL1 B;  2NTO A;  5DAL B;  1PMT A;  3KH9 A;  4AKX B;  2L5O A;  5EL8 A;  4DSS A;  3HHV A;  4PQH A;  4ISD A;  5COH A;  1A24 A;  2PMT A;  3GKK A;  4ZIL A;  1EOH A;  2YCD A;  3TCO A;  2RM6 A;  4IN0 A;  2B6M A;  3APS A;  3CTG A;  1JZW A;  4RQR A;  3ZVJ D;  4EO3 A;  2LKU A;  3GL3 A;  1GSF A;  2JZS A;  5DJM A;  3KMN A;  1NW2 A;  4V2M A;  1ZYQ B;  1OC9 A;  1K0D A;  2AJQ B;  3DGQ A;  4A5P A;  14GS A;  4AJ7 A;  4ID0 A;  1HNC A;  2H1A A;  4RUV A;  3M9J A;  5EY6 A;  4N0Z A;  2C0D A;  5H5R A;  2B3S A;  2GST A;  1PN9 A;  1KEB A;  1T4Y A;  3CTF A;  3DML A;  4IHU A;  4KCA A;  5GAN D;  2YJ7 A;  4AF2 A;  2C4J A;  4K5R A;  1XCC A;  4K8M A;  1GNW A;  2PPT A;  2A2P A;  1YVL A;  1XOA A;  2IMK A;  1UC7 A;  2HLS A;  2FGX A;  2DC5 A;  1H4O A;  4K6X A;  2AYT A;  5KOW A;  1ZL9 A;  2H30 A;  2LRC A;  3WT2 A;  4D73 A;  5G5F A;  3L4N A;  4QMK A;  5DJL A;  4K1F A;  3D6I A;  2K9F A;  2R0G A;  5D93 A;  19GS A;  4K7I A;  4GWR A;  3PR8 A;  1M9A A;  3R3E A;  1GP1 A;  4ZL9 A;  2HYX A;  3V1W A;  3L0H A;  2YZU A;  4MAB A;  4TR1 A;  3RPN A;  2TRC P;  4G0L A;  1WIK A;  4IS0 A;  2V41 A;  2DBC A;  4KCE A;  3SBC A;  1R4W A;  3QPM A;  1TTZ A;  5KN1 A;  4F9Z A;  3F0I A;  2TRX A;  5DAK A;  4DSQ A;  2VL3 A;  4G9H A;  5D9V A;  2IWT A;  1SEN A;  1EV4 A;  2HZE B;  3KP9 A;  3TDG A;  2L6C A;  5FWG A;  2I3Y A;  1QFN A;  3TJB A;  1SU9 A;  3LJR A;  1XFL A;  5KEJ A;  1PX7 A;  1XWK A;  3P90 A;  1JZD A;  4TKY A;  3IC8 A;  1XWG A;  2DJK A;  4WR5 A;  3QFA C;  1AQX A;  1WP0 A;  2OBK A;  1E2Y A;  4TXV A;  1XIY A;  1SK2 A;  3QOU A;  1G0T A;  3WGD A;  2XBI A;  1XZO A;  2VLT A;  1K0A A;  3ED3 A;  3KMO A;  4XIH A;  4EIQ A;  1YKA A;  4IJI A;  2IFQ B;  3O76 A;  1RK4 A;  1UA5 A;  3DVX A;  4ZB6 A;  1Q4J A;  4TXO A;  2IL3 A;  3GX8 A;  3GST A;  5J5N A;  1BG1 A;  2VUP A;  1H75 A;  5J40 A;  4Q5F A;  1IYH A;  4X4J A;  5G1L A;  1FOV A;  2IN3 A;  1TRV A;  3VPQ A;  2FWH A;  5JCG A;  3IK9 A;  4NV5 A;  2VCV A;  4KUN A;  4W66 A;  18GS A;  2A2R A;  3IAM 2;  4K7N A;  3E3E A;  1A2L A;  1S3D A;  2VD1 A;  5A5H A;  2OKA A;  2GLR A;  4HEA 2;  2OE1 A;  4BL7 A;  2HXK A;  4ECC A;  4MF6 A;  1YEP A;  2NDO A;  5J4V A;  3E0U A;  5C00 A;  3CRT A;  2LNS A;  4KF9 A;  1O85 A;  2LJA A;  3F9U A;  1YZX A;  3G9B A;  1MDI A;  4GRF A;  4YAV A;  1OC8 A;  2UZ8 A;  4AGS A;  4F2I A;  5FT3 A;  1WOU A;  2HSH A;  1PN0 A;  4HI7 A;  5AN1 A;  4I8B A;  2RLI A;  4AI6 A;  4FIW A;  4ILF A;  3M0F A;  4MZB A;  3FR6 A;  1GSY A;  2IMF A;  2YOI A;  2O7K A;  3ME8 A;  3GH9 A;  4N10 A;  1UN2 A;  2DLX A;  2VAF A;  2X8G A;  2AB6 A;  5IMD A;  1M2B A;  2HSN A;  3H93 A;  5HR2 A;  3N9J A;  4AKG A;  2V32 A;  2DJ2 A;  2H71 A;  1O81 A;  2JZT A;  4F82 A;  4IEL A;  3FW2 A;  2L4Q A;  4PUR A;  4HU9 A;  1NHO A;  3UL3 A;  5E4W A;  3AY8 A;  4KE3 A;  2HFD A;  2VOC A;  5LCZ A;  1M99 A;  3HJP A;  2H1D A;  4YH2 A;  3MWH A;  1GUK A;  1HNB A;  1XW5 A;  2GZP A;  5AIX A;  1JZO A;  2A2S A;  2WDU A;  4KA0 A;  3M8N A;  5A1N B;  3TJK A;  1R5P A;  2VL9 A;  4WF4 A;  2R0C A;  3ZL5 A;  2XHF A;  2EIO A;  5D96 A;  3IHQ A;  2R0P A;  1G7O A;  22GS A;  1QQ2 A;  4TOP A;  4HQZ A;  1GUH A;  4PUA A;  5DAL A;  1EWX A;  1THX A;  3KEB A;  3GTU B;  2H76 A;  2M72 A;  3H79 A;  1SVL A;  2F3M A;  4GSS A;  1V2A A;  2TIR A;  4MH3 A;  3GX0 A;  5D9T A;  1J9B A;  5F8B A;  4KND A;  1K3O A;  1USB A;  1TK8 B;  4CW9 A;  4O7H A;  3DYR A;  2KUC A;  3WD6 A;  2E7P A;  3GKX A;  2LRN A;  2LST A;  3DD3 A;  5ECL B;  3QAG A;  3FR9 A;  1F2E A;  3TKS A;  3M1G A;  1SK0 A;  3D21 A;  1OYJ A;  2GT6 A;  3ZIV A;  4TR3 A;  1U3I A;  2E0Q A;  2CX4 A;  3IBH A;  2O89 A;  2PU9 C;  4GST A;  5HR3 A;  3HD5 A;  4ZBD A;  2XC2 A;  4ML6 A;  4ULX A;  1T1V A;  3P8W A;  3F4R A;  3NOF A;  2QC7 A;  5J41 A;  3FY7 A;  2QSI A;  1OC3 A;  3HZ4 A;  3KZQ A;  1FVK A;  3FKF A;  3DVW A;  2X8C A;  4TXO B;  2OJL A;  2OAC A;  5H5Q A;  5IM9 A;  2VM1 A;  1T3B A;  2XPE A;  2VCT A;  1M7T A;  1GWC A;  5IMV A;  4JR4 A;  4K9Z A;  1I9D A;  3UJ1 A;  3D4M A;  5HFI A;  5HQP A;  1FB6 A;  2IJY A;  2HRF A;  3CYN A;  4MJB A;  5L71 A;  2H6X A;  3FZ4 A;  4YAP A;  3A2X A;  3WT1 A;  4ZXG A;  3LSZ A;  2EFE A;  5A5H B;  1BAY A;  3RAZ A;  3TJJ A;  5JCU A;  4PXO A;  1R7H A;  3UMA A;  1XW9 A;  4HUA A;  2CA8 A;  1N2A A;  4GLT A;  3KIJ A;  3LG6 A;  1XPV A;  3CXG A;  2F8A A;  3HJO A;  4E8E A;  5KOX A;  3F3Q A;  2RUE A;  3ZLP A;  2HZF A;  2H70 A;  5JWQ B;  4EUY A;  4KW6 A;  3LWA A;  13GS A;  3HVX A;  1B4P A;  3WGX A;  1Z6M A;  3CBU A;  4LL4 B;  1WRY A;  4EDZ A;  4G0K A;  1B8X A;  4PUF C;  1A2M A;  1TK5 B;  1F9M A;  2CZ2 A;  4EC0 A;  3VK9 A;  1KNG A;  2HZE A;  3TU3 B;  3QFB C;  3C73 A;  1SVO A;  5AGY A;  4NV2 A;  7GSS A;  2WB9 A;  4DSR A;  4N0V A;  4PQ1 A;  3DXB A;  4IGJ A;  3TKQ A;  2D2Z A;  1AUC A;  5KN2 A;  1BED A;  3F4T A;  5A34 B;  16GS A;  5A5K A;  2H6Y A;  3ZTL A;  3A5I A;  3R2Q A;  4OO4 A;  3TRQ A;  1MDJ A;  4JU5 A;  2IFQ A;  2H0H A;  1SL2 B;  5F05 A;  2I4A A;  4MNN A;  4IKH A;  2NVL A;  17GS A;  3W6G A;  3ZZX A;  2A4V A;  2H66 A;  1SKS B;  2M46 A;  1JLW A;  2H0G A;  3L78 A;  4ZB7 A;  2K8V A;  3GIX A;  2WRT A;  1JFU A;  1TU8 A;  3PPU A;  1OAZ A;  3GRX A;  2YZH A;  3LYK A;  1THO A;  2ES7 A;  1A0F A;  4ECI A;  2YWO A;  4HJM A;  1K3L A;  1AQV A;  3TJG A;  1TRW A;  3UOM A;  4MJE A;  3UAP A;  2B5E A;  2H8L A;  4PNG A;  3KCM A;  2QA2 A;  3Q6O A;  1TK0 B;  3LEF A;  2EC4 A;  4GCI A;  2ON7 A;  1WPI A;  4TW5 A;  2FCH A;  4XRD A;  1OKT A;  1R5A A;  2DIY A;  2H72 A;  3VWU A;  5HFK A;  3KD0 A;  1BJX A;  2P5R A;  3RPP A;  3RDW A;  2YWM A;  1GUM A;  4GTU A;  1GNE A;  4QL7 A;  1ZCP A;  1O7U A;  3CSJ A;  4AJ8 A;  2JSZ A;  1JHB A;  2QKE A;  3M9K A;  4EVM A;  3HMJ G;  4AKI A;  4XS6 A;  4OFT A;  1ERT A;  4TRX A;  2X49 A;  1A0R P;  4LA1 A;  4MDC A;  1W89 A;  3LW9 A;  4CY6 A;  3BBY A;  5JWR B;  5F0G A;  4NHZ A;  3EU4 A;  4KDY A;  2M80 A;  1LU4 A;  4N11 A;  2HRN A;  3I9V 2;  4K7O A;  1PSQ A;  1FAA A;  5CP1 A;  1GSS A;  3C71 A;  3W8J A;  4X43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...