4YB8B

Ca. korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 in complex with phosphate and adp
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
229
structure length
229
Chain Sequence
SSRDLLLKAKENGRKSLLEHEAKYFISSYGIPVTNIRLAKSEEEAVNFSREIGFPVVLKIVSPQVVHKSDVGGVKVNLRSEEEVRKAYREIIENVKRNVPNAEIEGILVQEFAPPGVELIIGLLRDPQFGPTVMFGLGGVFVELFRDVSFRVAPLSEQDAESMIKEVKAYKLLTGFRGMEPVDIEAIKDALIRAGRIGVENEEIAEMDLNPVIAYPKGIKVVDARIILR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Korarchaeum cryptofilum (strain opf8)
molecule tags Ligase
molecule keywords alpha subunit of Acyl-CoA synthetase (NDP forming)
total genus 70
structure length 229
sequence length 229
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13549 ATP-grasp_5 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4yb8B01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4yb8B02
4MA0A 3VPCA 3R5FA 1GSOA 3RV3A 5IYZF 2YZGA 4O7TA 5FNVF 5HV6A 5H80A 2CNUA 4YB8B 3QFFA 4FU0A 4YJ3F 4I4TF 4DIMA 4DLKA 4E4TA 2R7KA 3ORQA 2DWCA 2QF7A 1KJJA 3DF7A 2NUAB 1A9XA 3K5HA 5JH7F 4C5AA 1KEEA 3HB9A 1M0WA 5JVLA 5BPFA 3V4SA 2W6MA 3KALA 3VPBA 4MV4A 5J2UF 1AUVA 3U9TA 4ME6A 4MV7A 2HGSA 4TV9F 5JVDF 2YZLA 3VPDA 2P0AA 2FB9A 1W93A 2ZDGA 3ETHA 5KX5F 1DV1A 3G8CA 2FPIB 3BG5A 3NUAA 4MV9A 2VQDA 1I7NA 2R87A 4O4HF 3LWBA 3MJFA 3WO0A 1IOWA 2I87A 2IP4A 2XCLA 1KUTA 4ZQIA 2CNQA 1A48A 4O82A 4FFMA 1I7LA 3KREA 4O2BF 2QK4A 1BXRA 3MWEA 3K3PA 3U54A 2NU6B 4MV1A 5LYJF 3MWDA 1KJ8A 1KJQA 2SCUB 2X0SA 2W6QA 1GLVA 4O7RA 1UC8A 4IWXA 2PBZA 2GPSA 4O4JF 4FFNA 2DIKA 2YS6A 4IZOA 2Z02A 2R82A 2Z04A 5K2MA 3VA7A 1WR2A 1E4EB 1VKZA 4O7VA 3UFXB 2GQSA 2C00A 3TIGA 2CQYA 1CQIB 4FFLA 3TW6A 3JRWA 1B6SA 4HNTA 4YBZB 4C5CA 4HQ6A 2R7NA 4XYMB 4HNVA 1EUCB 5BPHA 4IWYA 3VMMA 5HBRB 2FPPB 3R9RA 1CS0A 3HBLA 3SE7A 1JKJB 4O2AF 2CNVA 2NU8B 1AUXA 3JZIA 4I55F 1ULZA 2YYAA 3N8DA 1OBDA 2V5AA 1JLLB 1EYZA 2FP4B 2GPWA 3TQTA 4O81A 5EZYF 5KKNB 2YW2A 5BMVF 1GGOA 1EUDB 5LP6F 2WYOA 3RFCA 1B6RA 2W71A 3V4ZA 3OUZA 3ORRA 3Q2OA 2PVPA 3AW8A 4WD3A 2HJWA 1KBLA 3ETJA 5CA1F 3R5XA 5JQGF 1Z2OX 2V58A 4EG0A 2R86A 2W6OA 4MA5A 4O7ZA 4YAKB 4FGRA 4TUYF 4M9UA 4RZQA 1CQJB 4O7WA 1GSAA 2R85A 1C30A 2I80A 2ZDQA 1SCUB 3Q1KA 2GLTA 2R6FA 3OUUA 5I47A 3U9SA 3G8DA 1BNCA 1M6VA 1DV2A 3R23A 2YL2A 4HNUA 2W70A 2W6NA 2DZDA 4O7SA 4YJ2F 4EGQA 1JDBB 5C1PA 1VBHA 1EZ1A 2FPGB 1C3OA 1GSHA 2GQRA 2XD4A 5CAEB 3E5NA 2YZNA 4IHJF 2R7LA 2VPQA 3R5HA 3TIIA 3KAJA 1IOVA 4XX0B 3TINA 2NU7B 4TV8F 4ZI7F 2R7MA 4QSHA 3GLKA 1OBGA 1E4EA 3RV4A 2W6ZA 2DLNA 3KAKA 2OLSA 3HO8A 4I50F 5DMXA 3I12A 4HR7A 4ZOLF 5LXTF 5C1OA 3K5IA 4C5BA 1UC9A 5GONF 5C8YF 5LA6F 5D8DA 3LP8A 4Y8VB 1CE8A 1KJIA 2NU9B 2YWVA 5CB4F 2YZMA 1W96A 1VBGA 1M0TA 2YRXA 2J9GA 4FFOA 3JZFA 3U55A 4O83A 1KC7A 3N6RA 4NYEA 4L1KA 4O84A 1PX2A 4IIJF 3AX6A 4O7YA 1Z2PX 4FE2A 1KJ9A 4MV6A 4XYLB 4XZ3B 2YS7A 1EHIA 2V59A 4EGJA 5CA0F 4ZHQF 4O86A 4O4IF 4O7LA 1Z2NX 1JDEA 4MV8A 2VR1A 3RUPA 4FFPA 2CZGA 4YAJB 2I8CA 3GIDA 4FFRA 2YRWA 4O7NA 4MV3A 4MAMA 3VOTA 2R84A 1PK8A 5J2TF 3JRXA 4WBNF 5JQWA 2PN1A 1T36A 2W6PA 3WNZA 5LOVF 2ZDHA 4O4LF 3WO1A 1DIKA
chains in the Genus database with same CATH superfamily
2HGWA 1XK5A 5KFOA 3PVXA 4A3CG 4A3EG 4UFZA 5I60A 3MR6A 4MA0A 1K83A 3VPCA 4PDBA 3R5FA 5DG8A 4DUYH 2J6TA 1GSOA 3GTLA 2C35B 3RV3A 4DV5H 2YU9A 3GTPA 5IYZF 2YZGA 2Q2TA 1S68A 4O7TA 4LH7A 2EJ2A 5KFTA 5FNVF 4EBCA 3GTMA 4DR1H 5HV6A 3GV5B 3GB8B 5H80A 4DV1H 3CSWA 5KG1A 5KFMA 4J9RA 2UUAH 4RAZA 1HNXH 3I4MG 2C2DA 5I5SA 2UVRA 2CNUA 4RNNA 3W5OA 2JA6A 1T94A 2W9BB 2R7ZA 4KHPH 2EIYA 4YB8B 3HT5A 3QFFA 4JXUA 5I5YA 3GIPA 4FU0A 4YJ3F 4JI8H 3RJ0A 1N36H 4I4TF 2JEFA 1SEIA 4DIMA 4DLKA 1IBMH 4E4TA 2R7KA 4J9NA 1I1MA 2DWCA 2HGXA 3ORQA 1ZHQA 4RZRA 2UUCH 4O3RA 3QZ7A 1V9PA 3UZOA 2JEGA 2QF7A 1R9TA 1KJJA 3RAQA 2AU0A 4EFBA 2W9CA 4CMDA 3J81W 4AYBE 3DF7A 1Y1WA 5E25A 3EPIA 4WHXA 2NUAB 1A9XA 3GTGA 1TWGA 3K5HA 1SYXB 5JH7F 2R8IA 3N43B 2IMWP 3N42B 2BQ3A 4C5AA 1WSCA 4JV2A 3RB6A 4LF8H 4EEQA 4RB2C 4QIWE 4C2MA 4YHHH 1KEEA 3HB9A 1N34H 5DISC 3LMLA 4CKCA 1M0WA 1S0OA 5JVLA 2VUMG 4B3MH 2NVYA 5D1OB 3H0GA 4NZMA 3FKIA 3QZ8A 5BPFA 3RBEA 5EWFA 1JX4A 1K1SA 1KT8A 4DL3A 4DL7A 4Q4DA 5KT7A 3GV7B 3V4SA 4X64H 5KFRA 4LF6H 2W6MA 3KALA 4J9QA 4JI5H 3VPBA 3W1GA 3W1BA 4MV4A 1Y1VA 4DRFA 5J2UF 1AUVA 2QYZA 5FD6A 2XCPA 2JA6G 3U9TA 2WDTA 3J80W 3KHGA 4ME6A 1ZQ7A 2ZJTA 5T14A 4MV7A 2HGSA 3PN1A 4TV9F 3JAMW 3M9NB 3WWIA 1Y14B 5FPOA 5LMUH 5JVDF 4DV7H 4JI4H 2YZLA 3VPDA 5DLGA 2FLNA 2P0AA 2FB9A 5F9LA 1W93A 3T7AA 2VQFH 2COIA 3GJXB 5BWXA 2ZDGA 3ETHA 4K6NA 5KX5F 1DV1A 3GIJA 4ECQA 4EEYA 2DPJA 4DV3H 4CHIA 3G8CA 2FPIB 5L1IA 3BA8A 2UXCH 2HG8A 5FPRA 4QIWA 3BG5A 2Y4RA 3NUAA 4MV9A 4Q45A 2IBKA 1N33H 2VQDA 2VA2A 4LFAH 1I7NA 2OH2A 4O4HF 2R87A 3LWBA 3MJFA 3WO0A 4LH6A 4CC5A 2FKLA 5C3EG 1IOWA 1N48A 2I87A 2IP4A 4JV1A 2XCLA 5BWRA 2W8LA 5KFIA 4IR9A 1UNNC 1KUTA 2KSWA 5A2QW 1L2ZA 5DGHA 4ZQIA 2PMZE 3HOYG 2CNQA 2R8HA 3T1YH 1A48A 3QWUA 2FK3A 1HNWH 3GTOA 4ETSA 1JXLA 4Q43A 4O82A 5BWTA 3TY9A 4FFMA 3VNNA 5BYAA 3KHRA 4DR2H 2W9CB 4Q0YA 1I7LA 4EYIB 3KREA 4O2BF 4AQYH 2QK4A 4ECVA 1BXRA 5FR9A 2WAQA 1CKNB 3MWEA 4E6NA 3K3PA 4UCOA 1E4GT 5BYBA 3EYYA 5IP7G 5IYBG 3UZBA 4J9OA 2A1HA 2FK1A 2EJ0A 3M9OB 5C4XG 3U54A 2NU6B 4MV1A 3WWJA 2ZGIA 5LYJF 2X5RA 4CE5A 3MWDA 4JI2H 1KJ8A 5KFSA 1KJQA 2SCUB 5KT4A 3MFHA 3GILA 4ECRA 2X0SA 2W6QA 1A0GA 1E4FT 4MTDA 2AGOA 4DV0H 3OSNA 5KS8A 4J0MA 2W57A 1GLVA 4O7RA 1UC8A 4ED2A 4IWXA 4K0KH 4I7HA 2PBZA 4Q4CA 3J7AK 3N40P 2GPSA 2UXDH 2R7ZG 5KG3A 5KT5A 4O4JF 5KG0A 2YCHA 3WWHA 5KFDA 4YR2A 1I1KA 1IYEA 3UYYA 4FFNA 4TQRA 1XNRH 4BBRG 2DIKA 1G2WA 2YS6A 4R8UB 5DG9A 1P8LA 1P16A 2DABA 2Z02A 4IZOA 2C28A 4A3LG 4HN2A 1VAJA 5KFEA 1GYFA 2R82A 2Z04A 1O75A 5K2MA 3HKZE 3DTGA 5BWWA 2ZM6H 3HOUG 5KFCA 4B3RH 3PW4A 3VA7A 5EDWA 3SNOA 4PZ8A 4EQ5A 1WR2A 2W7OA 2CW8A 1E4EB 2W9AA 3PO2G 4NZNA 3FDSA 3MR5A 1S0MA 1VKZA 4O7VA 3T54A 3JSNA 4J9KA 3K3VA 3T9CA 2AQ4A 3UFXB 3RTXA 5KG4A 2J6UA 2GQSA 1BJTA 2C00A 5KFVA 2BR0A 4NZOA 3TIGA 2CQYA 1CQIB 2W9BA 4FFLA 3TW6A 3JRWA 3BQ0A 2R8KA 3KHHA 1WH2A 4RNMA 1JIHA 1B6SA 4A2BA 4HNTA 2UUBH 4LFCH 4JUZA 3FKIG 1CKMA 1A0IA 2HIVA 4X65H 4ECTA 3I4NG 4DL5A 2FK2A 1ZHSA 4YBZB 4C5CA 4J9SA 4HQ6A 2R7NA 4ECYA 3GIKA 4XYMB 1CKNA 3NC0B 4UUGA 3MWMA 4A2AA 4HNVA 1EUCB 4QWDA 1XMQH 5BPHA 4M7EA 3NBZB 3T9BA 2XIGA 3V6HA 4PZ7A 4NXMH 4IWYA 5IWAH 1S10A 3T9DA 4F4XA 1TAEA 4LSXA 3RB4A 3VMMA 2WB1E 3BQ1A 5HBRB 2UVUA 4CKEA 1ET0A 2FPPB 2W7PA 3N6XA 3R9RA 4ED6A 1CS0A 3KHLA 3HBLA 4UCTA 1AN7A 2ASDA 3GTKA 2R92A 3SE7A 5KFNA 2HVRA 2JA8G 5DQGA 1JKJB 4UCSA 3CEBA 4O2AF 5I5VA 2CW7A 1BGWA 2CNVA 2Y0SA 2NU8B 4F4WA 1IBLH 4A3BG 1AUXA 2M05A 3JZIA 4DV2H 1J5EH 4I55F 4A3DG 3NGDA 5CM0A 1ULZA 2YYAA 3H3VH 2R93A 3N8DA 1OBDA 2V5AA 2JEIA 4EBEA 4ECWA 1JLLB 1EYZA 1SFOA 4FBTA 2FP4B 2GPWA 4J9MA 3GIQA 3TQTA 3MR2A 4O81A 3Q8RB 3MR3A 3HOWG 5EZYF 3JZ6A 5KKNB 4F50A 1X9NA 5KFWA 4J9PA 2BQUA 1N56A 2DPIA 2YW2A 5BMVF 1GGOA 2CFMA 1EUDB 5LP6F 3CVZA 1HNZH 4A93G 5BWUA 2WYOA 3RFCA 1B6RA 3GQCA 3SI8A 3S24A 4UCRA 5I5WA 2W71A 3V4ZA 4X62H 5KT3A 3BABA 4IR1A 3PR4A 4DR6H 3OUZA 3ORRA 3Q2OA 2PVPA 3TY8A 4PZ6A 3AW8A 4FBUA 4WD3A 4O3NA 4JI1H 3T9AA 5KG2A 2HJWA 5KFJA 1KBLA 3ETJA 2V9WA 2O03A 5CA1F 3R5XA 4O3OA 5JQGF 2VA3A 1Z2OX 2V58A 5DQIA 5IT9W 3PR5B 3RR5A 3HOVG 4YR0A 3RB0A 4EG0A 2NVXA 2R86A 2W6OA 4MA5A 4O7ZA 4YAKB 4ED0A 3HOXG 3RAXA 2EJ3A 5HNEA 3TQ1A 4B3SH 2XCAA 4DR4H 4FGRA 3IN5A 4TUYF 1IBKH 4GLXA 2E2HA 3BACA 4M9UA 5F9NA 2V4QA 4RZQA 3HXLA 1CQJB 4QW8A 1HR0H 2UVVA 2MCTA 4Q44A 2VPSA 4RAYA 4O7WA 3GTJA 1GSAA 2HHHH 2R85A 3T5JA 5EWEA 3SGIA 4RB1A 1C30A 2R8GA 2I80A 1S9FA 2ZDQA 4M0JA 1SCUB 3Q1KA 4GKKH 2GLTA 4QWAA 5DG7A 2R6FA 5KG5A 3OUUA 3C0FB 3Q8SB 2FMAA 3BA9A 3U9SA 2HIXA 3G8DA 5I47A 5DAAA 3G6VA 3T9FA 5KFLA 2C22A 4J9LA 1OWTA 4TQSA 1T3NA 1BNCA 4DL6A 1S0NA 4DL2A 2DAAA 1I1LA 1EKPA 1M6VA 1DV2A 3L4JA 3R23A 2YL2A 1TWCA 2IA6A 1CKOA 2W70A 4HNUA 4JV0A 2W6NA 5KFKA 2F4VH 2DZDA 4O7SA 2VUGA 3RB3A 1FKAH 4YJ2F 4RB0A 4EGQA 4RUAA 1JDBB 5C1PA 3GIMA 1VBHA 4YY3H 4RU9A 1EZ1A 1Y1VG 3RBDA 2FPGB 1IYDA 1VS0A 4F4ZA 3PW0A 4PBCA 3CQZA 4ED1A 3V6JA 3EPGA 4LFBH 1GO3E 4JI3H 3RGXA 1C3OA 2OWOA 2FLLA 5CE8A 4ECUA 1GSHA 1ZETA 2GQRA 5FD5A 5KG7A 5CR5A 2CKZB 5L9XA 1DAAA 3RGZA 3T99A 1TWAA 3G6YA 2JA7G 4TVIA 4A3MG 2XD4A 4MTEA 2XC9A 5KG6A 4GC6A 1V4YA 5CAEB 2BQRA 1WRVA 2YZNA 3E5NA 2R7LA 4IHJF 3H20A 3OSPA 2VPQA 3G6XA 5KT6A 1XNQH 2C2RA 2VUMA 2B63G 4DAAA 2ATLA 4AYBA 3Q8PB 3R5HA 2JA5A 3TIIA 5L1LA 3KAJA 3T1HH 2WE6A 3N41B 3Q8QB 5L1JA 4DV4H 1IOVA 4ED7A 4LF4H 2C2EA 4JYAH 5DQHA 3OHAA 4XX0B 5DGIA 2NU7B 3TINA 3H4DA 4IRCA 4TV8F 5LMNH 4ZI7F 4APMA 1B04A 2R7MA 3PFFA 2R8JA 1RJQA 2V4RA 4QSHA 5C44G 3GLKA 1RK5A 3BAAA 3GIIA 1OBGA 4DV6H 1E4EA 2ABJA 3RV4A 4YR3A 4O3SA 5I5UA 4G3IA 5FLXW 1I3QA 2ODTX 3UQ8A 4JI7H 2W6ZA 3HOZG 2DLNA 3N44B 3KAKA 4QWBA 2OLSA 5IYDG 1WCMG 4RCNA 3HO8A 2E5LH 1MZBA 4EFEA 1A3GA 2HHFA 5KFPA 3T9EA 4GC7A 4I50F 4GKJH 4ECXA 5KFUA 5DMXA 4ECSA 2JA7A 3I12A 4ECZA 4X66H 4HR7A 3OHBA 2FJZA 5JUMA 4DQNA 4ZOLF 5LXTF 1M7JA 4CMFA 5C1OA 3K5IA 2UVWA 1I50A 2WTFA 4C5BA 2VQEH 1UC9A 5DGAA 2FE3A 3U0GA 5GONF 1XDNA 5FLMG 4A3KG 5C8YF 3MFIA 5LA6F 4HYKA 1RJPA 3T5KA 3PW7A 4LF9H 1I6UA 5I5TA 3NBYB 5D8DA 4LSAA 3LP8A 5EWGA 5D1PA 4Y8VB 1CE8A 2W8KA 2JA5G 2RDJA 1KJIA 2NU9B 3GDEA 5BWVA 3T5HA 3PW2A 2YWVA 4UCVA 5CB4F 4JI0H 1S03G 3FMAA 2YZMA 4YQWA 4BY1G 3BQ2A 4QWEA 1FVIA 1W96A 4FS2A 4LF5H 4NLGA 4U7CA 1VBGA 3KTMA 1DGSA 2RDIA 4R8UA 3DTFA 1M0TA 2YRXA 3H4BA 2Q7DA 1I2KA 2J9GA 4FFOA 2Y0SE 3JZFA 3U55A 4U6PA 1Y1WG 1TWHA 4O83A 4UCUA 4IAJA 3JSLA 4CC6A 1KC7A 3N6RA 3M9MB 1RYRA 5EOYA 5KT2A 4NYEA 2VOBA 2PMZA 1I94H 4QJFA 2WB1A 5D1OA 1TA8A 4L1KA 2AGPA 4Q8EA 4A3GG 4O84A 3TEKA 1PX2A 3L2PA 2Q2UA 4IIJF 3IG0A 5DLFA 3AX6A 2ASLA 3H40A 4FS1A 5DGBA 1EKFA 5KFBA 3TY5A 2E2IA 5K3WA 4O7YA 4LF7H 5KFQA 4GLWA 1Z2PX 1WCMA 4JI6H 4RNOA 4FE2A 1KJ9A 4YP3A 2WAQE 4OX9H 4EBDA 4MV6A 4QWCA 4XYLB 4ED8A 5KFHA 2COJA 5KFXA 2XGQA 5KFZA 2J6SA 4XZ3B 4TM5A 1K1QA 1S97A 2RGVA 2RGRA 1N32H 2UXBH 2AGQA 2YS7A 2FLPA 5KFFA 1EHIA 2V59A 2HVSA 3L4KA 1ZAUA 4LMYA 4EGJA 4F4YA 5IYCG 2ALZA 4IRKA 2B63A 5CA0F 4A3FG 4BBSG 4ZHQF 4O86A 3KXYT 4Q8FA 4O4IF 3LQSA 4RB3C 5BR8H 4DL4A 4A3IG 1RYSA 5KFYA 1B33N 2HDKA 3TW7A 4JV5H 4O7LA 1Z2NX 5C5JA 3RIZA 4NXNH 1JDEA 4MV8A 4CKBA 1RJRA 2VR1A 3RUPA 1KTAA 3AYHB 3F8NA 5L1KA 3GTQA 3BJYA 4DUZH 4FFPA 2CZGA 2R92G 4O3QA 5LL6b 4YAJB 1I2LA 3QQMA 2I8CA 3GV8B 1XMOH 1RK6A 3GIDA 2RF4A 5KFGA 4FFRA 3H0GG 3LULA 4O3PA 2R93G 2YRWA 4RUCA 3DAAA 4O7NA 4DR5H 3KYHC 4FM9A 4MV3A 4MAMA 4ED3A 3M4IA 3V6KA 4A3JG 3PW5A 4B3TH 4BXXG 5KFAA 1FJGH 2HHFB 1EKVA 2R84A 3VOTA 4BWSC 1PK8A 5J2TF 4DR7H 3T5LA 3JRXA 4WBNF 4EYHB 4DR3H 2HVQA 2XGPA 4QW9A 2UU9H 5JQWA 5IP9G 2PN1A 5I5XA 1T36A 3RF2A 4PWQA 1V51A 2W6PA 2COGA 1TWFA 3PO3G 4IRDA 2ASJA 3WNZA 3HKZA 5LOVF 3PZPA 2ZDHA 4R7RA 2QB5A 5FJ8G 4O4LF 4BY7G 3WO1A 2JEJA 1DIKA 3OTOH
chains in the Genus database with same CATH topology
4MA0A 3VPCA 3R5FA 1GSOA 3RV3A 5IYZF 2YZGA 4O7TA 5FNVF 5HV6A 5H80A 2CNUA 4YB8B 3QFFA 4FU0A 4YJ3F 4I4TF 4DIMA 4DLKA 4E4TA 2R7KA 3ORQA 2DWCA 2QF7A 1KJJA 3DF7A 2NUAB 1A9XA 3K5HA 5JH7F 4C5AA 1KEEA 3HB9A 1M0WA 5JVLA 5BPFA 3V4SA 2W6MA 3KALA 3VPBA 4MV4A 5J2UF 1AUVA 3U9TA 4ME6A 4MV7A 2HGSA 4TV9F 5JVDF 2YZLA 3VPDA 2P0AA 2FB9A 1W93A 2ZDGA 3ETHA 5KX5F 1DV1A 3G8CA 2FPIB 3BG5A 3NUAA 4MV9A 2VQDA 1I7NA 2R87A 4O4HF 3LWBA 3MJFA 3WO0A 1IOWA 2I87A 2IP4A 2XCLA 1KUTA 4ZQIA 2CNQA 1A48A 4O82A 4FFMA 1I7LA 3KREA 4O2BF 2QK4A 1BXRA 3MWEA 3K3PA 3U54A 2NU6B 4MV1A 5LYJF 3MWDA 1KJ8A 1KJQA 2SCUB 2X0SA 2W6QA 1GLVA 4O7RA 1UC8A 4IWXA 2PBZA 2GPSA 4O4JF 4FFNA 2DIKA 2YS6A 4IZOA 2Z02A 2R82A 2Z04A 5K2MA 3VA7A 1WR2A 1E4EB 1VKZA 4O7VA 3UFXB 2GQSA 2C00A 3TIGA 2CQYA 1CQIB 4FFLA 3TW6A 3JRWA 1B6SA 4HNTA 4YBZB 4C5CA 4HQ6A 2R7NA 4XYMB 4HNVA 1EUCB 5BPHA 4IWYA 3VMMA 5HBRB 2FPPB 3R9RA 1CS0A 3HBLA 3SE7A 1JKJB 4O2AF 2CNVA 2NU8B 1AUXA 3JZIA 4I55F 1ULZA 2YYAA 3N8DA 1OBDA 2V5AA 1JLLB 1EYZA 2FP4B 2GPWA 3TQTA 4O81A 5EZYF 5KKNB 2YW2A 5BMVF 1GGOA 1EUDB 5LP6F 2WYOA 3RFCA 1B6RA 2W71A 3V4ZA 3OUZA 3ORRA 3Q2OA 2PVPA 3AW8A 4WD3A 2HJWA 1KBLA 3ETJA 5CA1F 3R5XA 5JQGF 1Z2OX 2V58A 4EG0A 2R86A 2W6OA 4MA5A 4O7ZA 4YAKB 4FGRA 4TUYF 4M9UA 4RZQA 1CQJB 4O7WA 1GSAA 2R85A 1C30A 2I80A 2ZDQA 1SCUB 3Q1KA 2GLTA 2R6FA 3OUUA 5I47A 3U9SA 3G8DA 1BNCA 1M6VA 1DV2A 3R23A 2YL2A 4HNUA 2W70A 2W6NA 2DZDA 4O7SA 4YJ2F 4EGQA 1JDBB 5C1PA 1VBHA 1EZ1A 2FPGB 1C3OA 1GSHA 2GQRA 2XD4A 5CAEB 3E5NA 2YZNA 4IHJF 2R7LA 2VPQA 3R5HA 3TIIA 3KAJA 1IOVA 4XX0B 3TINA 2NU7B 4TV8F 4ZI7F 2R7MA 4QSHA 3GLKA 1OBGA 1E4EA 3RV4A 2W6ZA 2DLNA 3KAKA 2OLSA 3HO8A 4I50F 5DMXA 3I12A 4HR7A 4ZOLF 5LXTF 5C1OA 3K5IA 4C5BA 1UC9A 5GONF 5C8YF 5LA6F 5D8DA 3LP8A 4Y8VB 1CE8A 1KJIA 2NU9B 2YWVA 5CB4F 2YZMA 1W96A 1VBGA 1M0TA 2YRXA 2J9GA 4FFOA 3JZFA 3U55A 4O83A 1KC7A 3N6RA 4NYEA 4L1KA 4O84A 1PX2A 4IIJF 3AX6A 4O7YA 1Z2PX 4FE2A 1KJ9A 4MV6A 4XYLB 4XZ3B 2YS7A 1EHIA 2V59A 4EGJA 5CA0F 4ZHQF 4O86A 4O4IF 4O7LA 1Z2NX 1JDEA 4MV8A 2VR1A 3RUPA 4FFPA 2CZGA 4YAJB 2I8CA 3GIDA 4FFRA 2YRWA 4O7NA 4MV3A 4MAMA 3VOTA 2R84A 1PK8A 5J2TF 3JRXA 4WBNF 5JQWA 2PN1A 1T36A 2W6PA 3WNZA 5LOVF 2ZDHA 4O4LF 3WO1A 1DIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MA0 A;  3VPC A;  3R5F A;  1GSO A;  3RV3 A;  5IYZ F;  2YZG A;  4O7T A;  5FNV F;  5HV6 A;  5H80 A;  2CNU A;  4YB8 B;  3QFF A;  4FU0 A;  4YJ3 F;  4I4T F;  4DIM A;  4DLK A;  4E4T A;  2R7K A;  3ORQ A;  2DWC A;  2QF7 A;  1KJJ A;  3DF7 A;  2NUA B;  1A9X A;  3K5H A;  5JH7 F;  4C5A A;  1KEE A;  3HB9 A;  1M0W A;  5JVL A;  5BPF A;  3V4S A;  2W6M A;  3KAL A;  3VPB A;  4MV4 A;  5J2U F;  1AUV A;  3U9T A;  4ME6 A;  4MV7 A;  2HGS A;  4TV9 F;  5JVD F;  2YZL A;  3VPD A;  2P0A A;  2FB9 A;  1W93 A;  2ZDG A;  3ETH A;  5KX5 F;  1DV1 A;  3G8C A;  2FPI B;  3BG5 A;  3NUA A;  4MV9 A;  2VQD A;  1I7N A;  2R87 A;  4O4H F;  3LWB A;  3MJF A;  3WO0 A;  1IOW A;  2I87 A;  2IP4 A;  2XCL A;  1KUT A;  4ZQI A;  2CNQ A;  1A48 A;  4O82 A;  4FFM A;  1I7L A;  3KRE A;  4O2B F;  2QK4 A;  1BXR A;  3MWE A;  3K3P A;  3U54 A;  2NU6 B;  4MV1 A;  5LYJ F;  3MWD A;  1KJ8 A;  1KJQ A;  2SCU B;  2X0S A;  2W6Q A;  1GLV A;  4O7R A;  1UC8 A;  4IWX A;  2PBZ A;  2GPS A;  4O4J F;  4FFN A;  2DIK A;  2YS6 A;  4IZO A;  2Z02 A;  2R82 A;  2Z04 A;  5K2M A;  3VA7 A;  1WR2 A;  1E4E B;  1VKZ A;  4O7V A;  3UFX B;  2GQS A;  2C00 A;  3TIG A;  2CQY A;  1CQI B;  4FFL A;  3TW6 A;  3JRW A;  1B6S A;  4HNT A;  4YBZ B;  4C5C A;  4HQ6 A;  2R7N A;  4XYM B;  4HNV A;  1EUC B;  5BPH A;  4IWY A;  3VMM A;  5HBR B;  2FPP B;  3R9R A;  1CS0 A;  3HBL A;  3SE7 A;  1JKJ B;  4O2A F;  2CNV A;  2NU8 B;  1AUX A;  3JZI A;  4I55 F;  1ULZ A;  2YYA A;  3N8D A;  1OBD A;  2V5A A;  1JLL B;  1EYZ A;  2FP4 B;  2GPW A;  3TQT A;  4O81 A;  5EZY F;  5KKN B;  2YW2 A;  5BMV F;  1GGO A;  1EUD B;  5LP6 F;  2WYO A;  3RFC A;  1B6R A;  2W71 A;  3V4Z A;  3OUZ A;  3ORR A;  3Q2O A;  2PVP A;  3AW8 A;  4WD3 A;  2HJW A;  1KBL A;  3ETJ A;  5CA1 F;  3R5X A;  5JQG F;  1Z2O X;  2V58 A;  4EG0 A;  2R86 A;  2W6O A;  4MA5 A;  4O7Z A;  4YAK B;  4FGR A;  4TUY F;  4M9U A;  4RZQ A;  1CQJ B;  4O7W A;  1GSA A;  2R85 A;  1C30 A;  2I80 A;  2ZDQ A;  1SCU B;  3Q1K A;  2GLT A;  2R6F A;  3OUU A;  5I47 A;  3U9S A;  3G8D A;  1BNC A;  1M6V A;  1DV2 A;  3R23 A;  2YL2 A;  4HNU A;  2W70 A;  2W6N A;  2DZD A;  4O7S A;  4YJ2 F;  4EGQ A;  1JDB B;  5C1P A;  1VBH A;  1EZ1 A;  2FPG B;  1C3O A;  1GSH A;  2GQR A;  2XD4 A;  5CAE B;  3E5N A;  2YZN A;  4IHJ F;  2R7L A;  2VPQ A;  3R5H A;  3TII A;  3KAJ A;  1IOV A;  4XX0 B;  3TIN A;  2NU7 B;  4TV8 F;  4ZI7 F;  2R7M A;  4QSH A;  3GLK A;  1OBG A;  1E4E A;  3RV4 A;  2W6Z A;  2DLN A;  3KAK A;  2OLS A;  3HO8 A;  4I50 F;  5DMX A;  3I12 A;  4HR7 A;  4ZOL F;  5LXT F;  5C1O A;  3K5I A;  4C5B A;  1UC9 A;  5GON F;  5C8Y F;  5LA6 F;  5D8D A;  3LP8 A;  4Y8V B;  1CE8 A;  1KJI A;  2NU9 B;  2YWV A;  5CB4 F;  2YZM A;  1W96 A;  1VBG A;  1M0T A;  2YRX A;  2J9G A;  4FFO A;  3JZF A;  3U55 A;  4O83 A;  1KC7 A;  3N6R A;  4NYE A;  4L1K A;  4O84 A;  1PX2 A;  4IIJ F;  3AX6 A;  4O7Y A;  1Z2P X;  4FE2 A;  1KJ9 A;  4MV6 A;  4XYL B;  4XZ3 B;  2YS7 A;  1EHI A;  2V59 A;  4EGJ A;  5CA0 F;  4ZHQ F;  4O86 A;  4O4I F;  4O7L A;  1Z2N X;  1JDE A;  4MV8 A;  2VR1 A;  3RUP A;  4FFP A;  2CZG A;  4YAJ B;  2I8C A;  3GID A;  4FFR A;  2YRW A;  4O7N A;  4MV3 A;  4MAM A;  3VOT A;  2R84 A;  1PK8 A;  5J2T F;  3JRX A;  4WBN F;  5JQW A;  2PN1 A;  1T36 A;  2W6P A;  3WNZ A;  5LOV F;  2ZDH A;  4O4L F;  3WO1 A;  1DIK A; 
#chains in the Genus database with same CATH topology
 2HGW A;  1XK5 A;  5KFO A;  3PVX A;  4A3C G;  4A3E G;  4UFZ A;  5I60 A;  3MR6 A;  4MA0 A;  1K83 A;  3VPC A;  4PDB A;  3R5F A;  5DG8 A;  4DUY H;  2J6T A;  1GSO A;  3GTL A;  2C35 B;  3RV3 A;  4DV5 H;  2YU9 A;  3GTP A;  5IYZ F;  2YZG A;  2Q2T A;  1S68 A;  4O7T A;  4LH7 A;  2EJ2 A;  5KFT A;  5FNV F;  4EBC A;  3GTM A;  4DR1 H;  5HV6 A;  3GV5 B;  3GB8 B;  5H80 A;  4DV1 H;  3CSW A;  5KG1 A;  5KFM A;  4J9R A;  2UUA H;  4RAZ A;  1HNX H;  3I4M G;  2C2D A;  5I5S A;  2UVR A;  2CNU A;  4RNN A;  3W5O A;  2JA6 A;  1T94 A;  2W9B B;  2R7Z A;  4KHP H;  2EIY A;  4YB8 B;  3HT5 A;  3QFF A;  4JXU A;  5I5Y A;  3GIP A;  4FU0 A;  4YJ3 F;  4JI8 H;  3RJ0 A;  1N36 H;  4I4T F;  2JEF A;  1SEI A;  4DIM A;  4DLK A;  1IBM H;  4E4T A;  2R7K A;  4J9N A;  1I1M A;  2DWC A;  2HGX A;  3ORQ A;  1ZHQ A;  4RZR A;  2UUC H;  4O3R A;  3QZ7 A;  1V9P A;  3UZO A;  2JEG A;  2QF7 A;  1R9T A;  1KJJ A;  3RAQ A;  2AU0 A;  4EFB A;  2W9C A;  4CMD A;  3J81 W;  4AYB E;  3DF7 A;  1Y1W A;  5E25 A;  3EPI A;  4WHX A;  2NUA B;  1A9X A;  3GTG A;  1TWG A;  3K5H A;  1SYX B;  5JH7 F;  2R8I A;  3N43 B;  2IMW P;  3N42 B;  2BQ3 A;  4C5A A;  1WSC A;  4JV2 A;  3RB6 A;  4LF8 H;  4EEQ A;  4RB2 C;  4QIW E;  4C2M A;  4YHH H;  1KEE A;  3HB9 A;  1N34 H;  5DIS C;  3LML A;  4CKC A;  1M0W A;  1S0O A;  5JVL A;  2VUM G;  4B3M H;  2NVY A;  5D1O B;  3H0G A;  4NZM A;  3FKI A;  3QZ8 A;  5BPF A;  3RBE A;  5EWF A;  1JX4 A;  1K1S A;  1KT8 A;  4DL3 A;  4DL7 A;  4Q4D A;  5KT7 A;  3GV7 B;  3V4S A;  4X64 H;  5KFR A;  4LF6 H;  2W6M A;  3KAL A;  4J9Q A;  4JI5 H;  3VPB A;  3W1G A;  3W1B A;  4MV4 A;  1Y1V A;  4DRF A;  5J2U F;  1AUV A;  2QYZ A;  5FD6 A;  2XCP A;  2JA6 G;  3U9T A;  2WDT A;  3J80 W;  3KHG A;  4ME6 A;  1ZQ7 A;  2ZJT A;  5T14 A;  4MV7 A;  2HGS A;  3PN1 A;  4TV9 F;  3JAM W;  3M9N B;  3WWI A;  1Y14 B;  5FPO A;  5LMU H;  5JVD F;  4DV7 H;  4JI4 H;  2YZL A;  3VPD A;  5DLG A;  2FLN A;  2P0A A;  2FB9 A;  5F9L A;  1W93 A;  3T7A A;  2VQF H;  2COI A;  3GJX B;  5BWX A;  2ZDG A;  3ETH A;  4K6N A;  5KX5 F;  1DV1 A;  3GIJ A;  4ECQ A;  4EEY A;  2DPJ A;  4DV3 H;  4CHI A;  3G8C A;  2FPI B;  5L1I A;  3BA8 A;  2UXC H;  2HG8 A;  5FPR A;  4QIW A;  3BG5 A;  2Y4R A;  3NUA A;  4MV9 A;  4Q45 A;  2IBK A;  1N33 H;  2VQD A;  2VA2 A;  4LFA H;  1I7N A;  2OH2 A;  4O4H F;  2R87 A;  3LWB A;  3MJF A;  3WO0 A;  4LH6 A;  4CC5 A;  2FKL A;  5C3E G;  1IOW A;  1N48 A;  2I87 A;  2IP4 A;  4JV1 A;  2XCL A;  5BWR A;  2W8L A;  5KFI A;  4IR9 A;  1UNN C;  1KUT A;  2KSW A;  5A2Q W;  1L2Z A;  5DGH A;  4ZQI A;  2PMZ E;  3HOY G;  2CNQ A;  2R8H A;  3T1Y H;  1A48 A;  3QWU A;  2FK3 A;  1HNW H;  3GTO A;  4ETS A;  1JXL A;  4Q43 A;  4O82 A;  5BWT A;  3TY9 A;  4FFM A;  3VNN A;  5BYA A;  3KHR A;  4DR2 H;  2W9C B;  4Q0Y A;  1I7L A;  4EYI B;  3KRE A;  4O2B F;  4AQY H;  2QK4 A;  4ECV A;  1BXR A;  5FR9 A;  2WAQ A;  1CKN B;  3MWE A;  4E6N A;  3K3P A;  4UCO A;  1E4G T;  5BYB A;  3EYY A;  5IP7 G;  5IYB G;  3UZB A;  4J9O A;  2A1H A;  2FK1 A;  2EJ0 A;  3M9O B;  5C4X G;  3U54 A;  2NU6 B;  4MV1 A;  3WWJ A;  2ZGI A;  5LYJ F;  2X5R A;  4CE5 A;  3MWD A;  4JI2 H;  1KJ8 A;  5KFS A;  1KJQ A;  2SCU B;  5KT4 A;  3MFH A;  3GIL A;  4ECR A;  2X0S A;  2W6Q A;  1A0G A;  1E4F T;  4MTD A;  2AGO A;  4DV0 H;  3OSN A;  5KS8 A;  4J0M A;  2W57 A;  1GLV A;  4O7R A;  1UC8 A;  4ED2 A;  4IWX A;  4K0K H;  4I7H A;  2PBZ A;  4Q4C A;  3J7A K;  3N40 P;  2GPS A;  2UXD H;  2R7Z G;  5KG3 A;  5KT5 A;  4O4J F;  5KG0 A;  2YCH A;  3WWH A;  5KFD A;  4YR2 A;  1I1K A;  1IYE A;  3UYY A;  4FFN A;  4TQR A;  1XNR H;  4BBR G;  2DIK A;  1G2W A;  2YS6 A;  4R8U B;  5DG9 A;  1P8L A;  1P16 A;  2DAB A;  2Z02 A;  4IZO A;  2C28 A;  4A3L G;  4HN2 A;  1VAJ A;  5KFE A;  1GYF A;  2R82 A;  2Z04 A;  1O75 A;  5K2M A;  3HKZ E;  3DTG A;  5BWW A;  2ZM6 H;  3HOU G;  5KFC A;  4B3R H;  3PW4 A;  3VA7 A;  5EDW A;  3SNO A;  4PZ8 A;  4EQ5 A;  1WR2 A;  2W7O A;  2CW8 A;  1E4E B;  2W9A A;  3PO2 G;  4NZN A;  3FDS A;  3MR5 A;  1S0M A;  1VKZ A;  4O7V A;  3T54 A;  3JSN A;  4J9K A;  3K3V A;  3T9C A;  2AQ4 A;  3UFX B;  3RTX A;  5KG4 A;  2J6U A;  2GQS A;  1BJT A;  2C00 A;  5KFV A;  2BR0 A;  4NZO A;  3TIG A;  2CQY A;  1CQI B;  2W9B A;  4FFL A;  3TW6 A;  3JRW A;  3BQ0 A;  2R8K A;  3KHH A;  1WH2 A;  4RNM A;  1JIH A;  1B6S A;  4A2B A;  4HNT A;  2UUB H;  4LFC H;  4JUZ A;  3FKI G;  1CKM A;  1A0I A;  2HIV A;  4X65 H;  4ECT A;  3I4N G;  4DL5 A;  2FK2 A;  1ZHS A;  4YBZ B;  4C5C A;  4J9S A;  4HQ6 A;  2R7N A;  4ECY A;  3GIK A;  4XYM B;  1CKN A;  3NC0 B;  4UUG A;  3MWM A;  4A2A A;  4HNV A;  1EUC B;  4QWD A;  1XMQ H;  5BPH A;  4M7E A;  3NBZ B;  3T9B A;  2XIG A;  3V6H A;  4PZ7 A;  4NXM H;  4IWY A;  5IWA H;  1S10 A;  3T9D A;  4F4X A;  1TAE A;  4LSX A;  3RB4 A;  3VMM A;  2WB1 E;  3BQ1 A;  5HBR B;  2UVU A;  4CKE A;  1ET0 A;  2FPP B;  2W7P A;  3N6X A;  3R9R A;  4ED6 A;  1CS0 A;  3KHL A;  3HBL A;  4UCT A;  1AN7 A;  2ASD A;  3GTK A;  2R92 A;  3SE7 A;  5KFN A;  2HVR A;  2JA8 G;  5DQG A;  1JKJ B;  4UCS A;  3CEB A;  4O2A F;  5I5V A;  2CW7 A;  1BGW A;  2CNV A;  2Y0S A;  2NU8 B;  4F4W A;  1IBL H;  4A3B G;  1AUX A;  2M05 A;  3JZI A;  4DV2 H;  1J5E H;  4I55 F;  4A3D G;  3NGD A;  5CM0 A;  1ULZ A;  2YYA A;  3H3V H;  2R93 A;  3N8D A;  1OBD A;  2V5A A;  2JEI A;  4EBE A;  4ECW A;  1JLL B;  1EYZ A;  1SFO A;  4FBT A;  2FP4 B;  2GPW A;  4J9M A;  3GIQ A;  3TQT A;  3MR2 A;  4O81 A;  3Q8R B;  3MR3 A;  3HOW G;  5EZY F;  3JZ6 A;  5KKN B;  4F50 A;  1X9N A;  5KFW A;  4J9P A;  2BQU A;  1N56 A;  2DPI A;  2YW2 A;  5BMV F;  1GGO A;  2CFM A;  1EUD B;  5LP6 F;  3CVZ A;  1HNZ H;  4A93 G;  5BWU A;  2WYO A;  3RFC A;  1B6R A;  3GQC A;  3SI8 A;  3S24 A;  4UCR A;  5I5W A;  2W71 A;  3V4Z A;  4X62 H;  5KT3 A;  3BAB A;  4IR1 A;  3PR4 A;  4DR6 H;  3OUZ A;  3ORR A;  3Q2O A;  2PVP A;  3TY8 A;  4PZ6 A;  3AW8 A;  4FBU A;  4WD3 A;  4O3N A;  4JI1 H;  3T9A A;  5KG2 A;  2HJW A;  5KFJ A;  1KBL A;  3ETJ A;  2V9W A;  2O03 A;  5CA1 F;  3R5X A;  4O3O A;  5JQG F;  2VA3 A;  1Z2O X;  2V58 A;  5DQI A;  5IT9 W;  3PR5 B;  3RR5 A;  3HOV G;  4YR0 A;  3RB0 A;  4EG0 A;  2NVX A;  2R86 A;  2W6O A;  4MA5 A;  4O7Z A;  4YAK B;  4ED0 A;  3HOX G;  3RAX A;  2EJ3 A;  5HNE A;  3TQ1 A;  4B3S H;  2XCA A;  4DR4 H;  4FGR A;  3IN5 A;  4TUY F;  1IBK H;  4GLX A;  2E2H A;  3BAC A;  4M9U A;  5F9N A;  2V4Q A;  4RZQ A;  3HXL A;  1CQJ B;  4QW8 A;  1HR0 H;  2UVV A;  2MCT A;  4Q44 A;  2VPS A;  4RAY A;  4O7W A;  3GTJ A;  1GSA A;  2HHH H;  2R85 A;  3T5J A;  5EWE A;  3SGI A;  4RB1 A;  1C30 A;  2R8G A;  2I80 A;  1S9F A;  2ZDQ A;  4M0J A;  1SCU B;  3Q1K A;  4GKK H;  2GLT A;  4QWA A;  5DG7 A;  2R6F A;  5KG5 A;  3OUU A;  3C0F B;  3Q8S B;  2FMA A;  3BA9 A;  3U9S A;  2HIX A;  3G8D A;  5I47 A;  5DAA A;  3G6V A;  3T9F A;  5KFL A;  2C22 A;  4J9L A;  1OWT A;  4TQS A;  1T3N A;  1BNC A;  4DL6 A;  1S0N A;  4DL2 A;  2DAA A;  1I1L A;  1EKP A;  1M6V A;  1DV2 A;  3L4J A;  3R23 A;  2YL2 A;  1TWC A;  2IA6 A;  1CKO A;  2W70 A;  4HNU A;  4JV0 A;  2W6N A;  5KFK A;  2F4V H;  2DZD A;  4O7S A;  2VUG A;  3RB3 A;  1FKA H;  4YJ2 F;  4RB0 A;  4EGQ A;  4RUA A;  1JDB B;  5C1P A;  3GIM A;  1VBH A;  4YY3 H;  4RU9 A;  1EZ1 A;  1Y1V G;  3RBD A;  2FPG B;  1IYD A;  1VS0 A;  4F4Z A;  3PW0 A;  4PBC A;  3CQZ A;  4ED1 A;  3V6J A;  3EPG A;  4LFB H;  1GO3 E;  4JI3 H;  3RGX A;  1C3O A;  2OWO A;  2FLL A;  5CE8 A;  4ECU A;  1GSH A;  1ZET A;  2GQR A;  5FD5 A;  5KG7 A;  5CR5 A;  2CKZ B;  5L9X A;  1DAA A;  3RGZ A;  3T99 A;  1TWA A;  3G6Y A;  2JA7 G;  4TVI A;  4A3M G;  2XD4 A;  4MTE A;  2XC9 A;  5KG6 A;  4GC6 A;  1V4Y A;  5CAE B;  2BQR A;  1WRV A;  2YZN A;  3E5N A;  2R7L A;  4IHJ F;  3H20 A;  3OSP A;  2VPQ A;  3G6X A;  5KT6 A;  1XNQ H;  2C2R A;  2VUM A;  2B63 G;  4DAA A;  2ATL A;  4AYB A;  3Q8P B;  3R5H A;  2JA5 A;  3TII A;  5L1L A;  3KAJ A;  3T1H H;  2WE6 A;  3N41 B;  3Q8Q B;  5L1J A;  4DV4 H;  1IOV A;  4ED7 A;  4LF4 H;  2C2E A;  4JYA H;  5DQH A;  3OHA A;  4XX0 B;  5DGI A;  2NU7 B;  3TIN A;  3H4D A;  4IRC A;  4TV8 F;  5LMN H;  4ZI7 F;  4APM A;  1B04 A;  2R7M A;  3PFF A;  2R8J A;  1RJQ A;  2V4R A;  4QSH A;  5C44 G;  3GLK A;  1RK5 A;  3BAA A;  3GII A;  1OBG A;  4DV6 H;  1E4E A;  2ABJ A;  3RV4 A;  4YR3 A;  4O3S A;  5I5U A;  4G3I A;  5FLX W;  1I3Q A;  2ODT X;  3UQ8 A;  4JI7 H;  2W6Z A;  3HOZ G;  2DLN A;  3N44 B;  3KAK A;  4QWB A;  2OLS A;  5IYD G;  1WCM G;  4RCN A;  3HO8 A;  2E5L H;  1MZB A;  4EFE A;  1A3G A;  2HHF A;  5KFP A;  3T9E A;  4GC7 A;  4I50 F;  4GKJ H;  4ECX A;  5KFU A;  5DMX A;  4ECS A;  2JA7 A;  3I12 A;  4ECZ A;  4X66 H;  4HR7 A;  3OHB A;  2FJZ A;  5JUM A;  4DQN A;  4ZOL F;  5LXT F;  1M7J A;  4CMF A;  5C1O A;  3K5I A;  2UVW A;  1I50 A;  2WTF A;  4C5B A;  2VQE H;  1UC9 A;  5DGA A;  2FE3 A;  3U0G A;  5GON F;  1XDN A;  5FLM G;  4A3K G;  5C8Y F;  3MFI A;  5LA6 F;  4HYK A;  1RJP A;  3T5K A;  3PW7 A;  4LF9 H;  1I6U A;  5I5T A;  3NBY B;  5D8D A;  4LSA A;  3LP8 A;  5EWG A;  5D1P A;  4Y8V B;  1CE8 A;  2W8K A;  2JA5 G;  2RDJ A;  1KJI A;  2NU9 B;  3GDE A;  5BWV A;  3T5H A;  3PW2 A;  2YWV A;  4UCV A;  5CB4 F;  4JI0 H;  1S03 G;  3FMA A;  2YZM A;  4YQW A;  4BY1 G;  3BQ2 A;  4QWE A;  1FVI A;  1W96 A;  4FS2 A;  4LF5 H;  4NLG A;  4U7C A;  1VBG A;  3KTM A;  1DGS A;  2RDI A;  4R8U A;  3DTF A;  1M0T A;  2YRX A;  3H4B A;  2Q7D A;  1I2K A;  2J9G A;  4FFO A;  2Y0S E;  3JZF A;  3U55 A;  4U6P A;  1Y1W G;  1TWH A;  4O83 A;  4UCU A;  4IAJ A;  3JSL A;  4CC6 A;  1KC7 A;  3N6R A;  3M9M B;  1RYR A;  5EOY A;  5KT2 A;  4NYE A;  2VOB A;  2PMZ A;  1I94 H;  4QJF A;  2WB1 A;  5D1O A;  1TA8 A;  4L1K A;  2AGP A;  4Q8E A;  4A3G G;  4O84 A;  3TEK A;  1PX2 A;  3L2P A;  2Q2U A;  4IIJ F;  3IG0 A;  5DLF A;  3AX6 A;  2ASL A;  3H40 A;  4FS1 A;  5DGB A;  1EKF A;  5KFB A;  3TY5 A;  2E2I A;  5K3W A;  4O7Y A;  4LF7 H;  5KFQ A;  4GLW A;  1Z2P X;  1WCM A;  4JI6 H;  4RNO A;  4FE2 A;  1KJ9 A;  4YP3 A;  2WAQ E;  4OX9 H;  4EBD A;  4MV6 A;  4QWC A;  4XYL B;  4ED8 A;  5KFH A;  2COJ A;  5KFX A;  2XGQ A;  5KFZ A;  2J6S A;  4XZ3 B;  4TM5 A;  1K1Q A;  1S97 A;  2RGV A;  2RGR A;  1N32 H;  2UXB H;  2AGQ A;  2YS7 A;  2FLP A;  5KFF A;  1EHI A;  2V59 A;  2HVS A;  3L4K A;  1ZAU A;  4LMY A;  4EGJ A;  4F4Y A;  5IYC G;  2ALZ A;  4IRK A;  2B63 A;  5CA0 F;  4A3F G;  4BBS G;  4ZHQ F;  4O86 A;  3KXY T;  4Q8F A;  4O4I F;  3LQS A;  4RB3 C;  5BR8 H;  4DL4 A;  4A3I G;  1RYS A;  5KFY A;  1B33 N;  2HDK A;  3TW7 A;  4JV5 H;  4O7L A;  1Z2N X;  5C5J A;  3RIZ A;  4NXN H;  1JDE A;  4MV8 A;  4CKB A;  1RJR A;  2VR1 A;  3RUP A;  1KTA A;  3AYH B;  3F8N A;  5L1K A;  3GTQ A;  3BJY A;  4DUZ H;  4FFP A;  2CZG A;  2R92 G;  4O3Q A;  5LL6 b;  4YAJ B;  1I2L A;  3QQM A;  2I8C A;  3GV8 B;  1XMO H;  1RK6 A;  3GID A;  2RF4 A;  5KFG A;  4FFR A;  3H0G G;  3LUL A;  4O3P A;  2R93 G;  2YRW A;  4RUC A;  3DAA A;  4O7N A;  4DR5 H;  3KYH C;  4FM9 A;  4MV3 A;  4MAM A;  4ED3 A;  3M4I A;  3V6K A;  4A3J G;  3PW5 A;  4B3T H;  4BXX G;  5KFA A;  1FJG H;  2HHF B;  1EKV A;  2R84 A;  3VOT A;  4BWS C;  1PK8 A;  5J2T F;  4DR7 H;  3T5L A;  3JRX A;  4WBN F;  4EYH B;  4DR3 H;  2HVQ A;  2XGP A;  4QW9 A;  2UU9 H;  5JQW A;  5IP9 G;  2PN1 A;  5I5X A;  1T36 A;  3RF2 A;  4PWQ A;  1V51 A;  2W6P A;  2COG A;  1TWF A;  3PO3 G;  4IRD A;  2ASJ A;  3WNZ A;  3HKZ A;  5LOV F;  3PZP A;  2ZDH A;  4R7R A;  2QB5 A;  5FJ8 G;  4O4L F;  4BY7 G;  3WO1 A;  2JEJ A;  1DIK A;  3OTO H; 
#chains in the Genus database with same CATH homology
 4MA0 A;  3VPC A;  3R5F A;  1GSO A;  3RV3 A;  5IYZ F;  2YZG A;  4O7T A;  5FNV F;  5HV6 A;  5H80 A;  2CNU A;  4YB8 B;  3QFF A;  4FU0 A;  4YJ3 F;  4I4T F;  4DIM A;  4DLK A;  4E4T A;  2R7K A;  3ORQ A;  2DWC A;  2QF7 A;  1KJJ A;  3DF7 A;  2NUA B;  1A9X A;  3K5H A;  5JH7 F;  4C5A A;  1KEE A;  3HB9 A;  1M0W A;  5JVL A;  5BPF A;  3V4S A;  2W6M A;  3KAL A;  3VPB A;  4MV4 A;  5J2U F;  1AUV A;  3U9T A;  4ME6 A;  4MV7 A;  2HGS A;  4TV9 F;  5JVD F;  2YZL A;  3VPD A;  2P0A A;  2FB9 A;  1W93 A;  2ZDG A;  3ETH A;  5KX5 F;  1DV1 A;  3G8C A;  2FPI B;  3BG5 A;  3NUA A;  4MV9 A;  2VQD A;  1I7N A;  2R87 A;  4O4H F;  3LWB A;  3MJF A;  3WO0 A;  1IOW A;  2I87 A;  2IP4 A;  2XCL A;  1KUT A;  4ZQI A;  2CNQ A;  1A48 A;  4O82 A;  4FFM A;  1I7L A;  3KRE A;  4O2B F;  2QK4 A;  1BXR A;  3MWE A;  3K3P A;  3U54 A;  2NU6 B;  4MV1 A;  5LYJ F;  3MWD A;  1KJ8 A;  1KJQ A;  2SCU B;  2X0S A;  2W6Q A;  1GLV A;  4O7R A;  1UC8 A;  4IWX A;  2PBZ A;  2GPS A;  4O4J F;  4FFN A;  2DIK A;  2YS6 A;  4IZO A;  2Z02 A;  2R82 A;  2Z04 A;  5K2M A;  3VA7 A;  1WR2 A;  1E4E B;  1VKZ A;  4O7V A;  3UFX B;  2GQS A;  2C00 A;  3TIG A;  2CQY A;  1CQI B;  4FFL A;  3TW6 A;  3JRW A;  1B6S A;  4HNT A;  4YBZ B;  4C5C A;  4HQ6 A;  2R7N A;  4XYM B;  4HNV A;  1EUC B;  5BPH A;  4IWY A;  3VMM A;  5HBR B;  2FPP B;  3R9R A;  1CS0 A;  3HBL A;  3SE7 A;  1JKJ B;  4O2A F;  2CNV A;  2NU8 B;  1AUX A;  3JZI A;  4I55 F;  1ULZ A;  2YYA A;  3N8D A;  1OBD A;  2V5A A;  1JLL B;  1EYZ A;  2FP4 B;  2GPW A;  3TQT A;  4O81 A;  5EZY F;  5KKN B;  2YW2 A;  5BMV F;  1GGO A;  1EUD B;  5LP6 F;  2WYO A;  3RFC A;  1B6R A;  2W71 A;  3V4Z A;  3OUZ A;  3ORR A;  3Q2O A;  2PVP A;  3AW8 A;  4WD3 A;  2HJW A;  1KBL A;  3ETJ A;  5CA1 F;  3R5X A;  5JQG F;  1Z2O X;  2V58 A;  4EG0 A;  2R86 A;  2W6O A;  4MA5 A;  4O7Z A;  4YAK B;  4FGR A;  4TUY F;  4M9U A;  4RZQ A;  1CQJ B;  4O7W A;  1GSA A;  2R85 A;  1C30 A;  2I80 A;  2ZDQ A;  1SCU B;  3Q1K A;  2GLT A;  2R6F A;  3OUU A;  5I47 A;  3U9S A;  3G8D A;  1BNC A;  1M6V A;  1DV2 A;  3R23 A;  2YL2 A;  4HNU A;  2W70 A;  2W6N A;  2DZD A;  4O7S A;  4YJ2 F;  4EGQ A;  1JDB B;  5C1P A;  1VBH A;  1EZ1 A;  2FPG B;  1C3O A;  1GSH A;  2GQR A;  2XD4 A;  5CAE B;  3E5N A;  2YZN A;  4IHJ F;  2R7L A;  2VPQ A;  3R5H A;  3TII A;  3KAJ A;  1IOV A;  4XX0 B;  3TIN A;  2NU7 B;  4TV8 F;  4ZI7 F;  2R7M A;  4QSH A;  3GLK A;  1OBG A;  1E4E A;  3RV4 A;  2W6Z A;  2DLN A;  3KAK A;  2OLS A;  3HO8 A;  4I50 F;  5DMX A;  3I12 A;  4HR7 A;  4ZOL F;  5LXT F;  5C1O A;  3K5I A;  4C5B A;  1UC9 A;  5GON F;  5C8Y F;  5LA6 F;  5D8D A;  3LP8 A;  4Y8V B;  1CE8 A;  1KJI A;  2NU9 B;  2YWV A;  5CB4 F;  2YZM A;  1W96 A;  1VBG A;  1M0T A;  2YRX A;  2J9G A;  4FFO A;  3JZF A;  3U55 A;  4O83 A;  1KC7 A;  3N6R A;  4NYE A;  4L1K A;  4O84 A;  1PX2 A;  4IIJ F;  3AX6 A;  4O7Y A;  1Z2P X;  4FE2 A;  1KJ9 A;  4MV6 A;  4XYL B;  4XZ3 B;  2YS7 A;  1EHI A;  2V59 A;  4EGJ A;  5CA0 F;  4ZHQ F;  4O86 A;  4O4I F;  4O7L A;  1Z2N X;  1JDE A;  4MV8 A;  2VR1 A;  3RUP A;  4FFP A;  2CZG A;  4YAJ B;  2I8C A;  3GID A;  4FFR A;  2YRW A;  4O7N A;  4MV3 A;  4MAM A;  3VOT A;  2R84 A;  1PK8 A;  5J2T F;  3JRX A;  4WBN F;  5JQW A;  2PN1 A;  1T36 A;  2W6P A;  3WNZ A;  5LOV F;  2ZDH A;  4O4L F;  3WO1 A;  1DIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...