4YB8B

Ca. korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 in complex with phosphate and adp
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
229
structure length
229
Chain Sequence
b'SSRDLLLKAKENGRKSLLEHEAKYFISSYGIPVTNIRLAKSEEEAVNFSREIGFPVVLKIVSPQVVHKSDVGGVKVNLRSEEEVRKAYREIIENVKRNVPNAEIEGILVQEFAPPGVELIIGLLRDPQFGPTVMFGLGGVFVELFRDVSFRVAPLSEQDAESMIKEVKAYKLLTGFRGMEPVDIEAIKDALIRAGRIGVENEEIAEMDLNPVIAYPKGIKVVDARIILR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha subunit of Acyl-CoA synthetase (NDP forming)
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Korarchaeum cryptofilum (strain opf8)
molecule tags Ligase
total genus 70
structure length 229
sequence length 229
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13549 ATP-grasp_5 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4yb8B01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4yb8B02
5KKNB 5H80A 1IOWA 3QFFA 3ETJA 4MV4A 4C5AA 3N6RA 4YAJB 1CS0A 2R6FA 3KALA 4MV7A 4EGJA 5HBRB 4YBZB 3MWDA 2W71A 2I87A 3WO1A 4IWYA 3UFXB 1JKJB 2I80A 2DLNA 4XZ3B 1E4EB 1UC9A 2FB9A 2GQRA 1SCUB 1ULZA 2W6ZA 3K5IA 2YZGA 1AUXA 4HNTA 4EGQA 4O7WA 2YZNA 4O7RA 3KAKA 2SCUB 4M9UA 2R86A 4IHJF 5J2UF 2PVPA 2DIKA 5C1OA 5C1PA 5CA0F 2NU8B 3U9SA 1IOVA 5JH7F 1JDBB 2Z04A 2QF7A 3R5XA 3MWEA 2R7NA 3VPCA 2V5AA 3R5FA 4HNVA 4FU0A 2FPPB 4O7SA 4IZOA 4C5CA 4EG0A 4FFRA 1KJIA 4MA0A 4IIJF 5LYJF 4ZI7F 1Z2OX 2FPIB 4TV9F 2XD4A 2GLTA 2NU6B 1Z2NX 3VA7A 2FPGB 1CE8A 4O2BF 3TIIA 4O7NA 3LP8A 3JZIA 2R7LA 4O4IF 4L1KA 1Z2PX 3V4ZA 1B6SA 2CNUA 1GLVA 2W6OA 3TINA 5LXTF 1AUVA 2YS6A 5C8YF 4RZQA 3SE7A 2R84A 4TV8F 2YWVA 3AX6A 3VOTA 4O83A 1CQJB 2ZDHA 4O7YA 3VMMA 3RFCA 1KJQA 5CB4F 3VPBA 1KUTA 1M0WA 4E4TA 2NUAB 5KX5F 1GSHA 2R87A 5HV6A 3VPDA 4O86A 4XYMB 2R7KA 1EZ1A 2W6MA 1I7LA 3R5HA 5JQGF 5K2MA 1KJJA 3V4SA 4I4TF 3G8DA 1KJ9A 2IP4A 1JLLB 3OUUA 4FFMA 5EZYF 3Q2OA 4FFPA 1KEEA 2GQSA 1WR2A 2V59A 3NUAA 5DMXA 5JQWA 1VBGA 2YW2A 3K5HA 2YS7A 2P0AA 1BNCA 2CNQA 2YZMA 1JDEA 3JRXA 3RV3A 2Z02A 3I12A 2PN1A 3U54A 5LA6F 4O4LF 2DWCA 2VR1A 3E5NA 5D8DA 2PBZA 3U9TA 4FFOA 4ME6A 4Y8VB 4YJ3F 1M6VA 4HQ6A 2YRXA 5CAEB 1VKZA 2NU9B 2VPQA 4XYLB 4HR7A 3GLKA 3OUZA 3G8CA 2I8CA 3HB9A 2HGSA 2W6PA 4FGRA 4O4HF 2XCLA 1PK8A 3TW6A 4NYEA 2YRWA 2HJWA 5BMVF 2R7MA 2X0SA 2W6QA 3KREA 5LOVF 1T36A 1OBGA 4O7ZA 4ZQIA 2QK4A 3KAJA 5FNVF 3AW8A 1KC7A 1GSOA 2ZDGA 1UC8A 2R82A 4C5BA 3ETHA 2C00A 4YAKB 2GPWA 5I47A 2WYOA 2CQYA 1PX2A 1M0TA 3N8DA 3LWBA 2DZDA 2VQDA 4WBNF 4O7LA 5BPFA 4TUYF 3U55A 3JZFA 1EYZA 4O81A 4MV1A 2CZGA 1A48A 3TQTA 1I7NA 3WNZA 3HBLA 3MJFA 1OBDA 1DV1A 4MA5A 1EUCB 4MV3A 1A9XA 1EUDB 4O84A 1KJ8A 3JRWA 3RV4A 2OLSA 4YB8B 5IYZF 1EHIA 2J9GA 1KBLA 3R23A 5BPHA 4MV9A 4MV8A 4HNUA 2V58A 1W93A 4O4JF 4DIMA 4O2AF 1GSAA 3RUPA 4FFLA 2FP4B 1C30A 2ZDQA 1DV2A 1CQIB 1C3OA 2YZLA 3Q1KA 2CNVA 2YL2A 5CA1F 1B6RA 3DF7A 4O7TA 4ZHQF 3ORQA 4O7VA 5JVDF 4XX0B 3HO8A 4MV6A 5LP6F 5J2TF 1VBHA 1BXRA 4QSHA 2YYAA 3WO0A 4MAMA 1E4EA 2W6NA 4I55F 4DLKA 4FE2A 4ZOLF 1GGOA 4YJ2F 1DIKA 3ORRA 3R9RA 4WD3A 2NU7B 5JVLA 1W96A 2GPSA 3BG5A 4O82A 4IWXA 2R85A 3TIGA 3K3PA 4I50F 4FFNA 5GONF 2W70A 3GIDA
chains in the Genus database with same CATH superfamily
2EJ2A 5KKNB 5L9XA 1RJPA 5H80A 4B3TH 3FDSA 1IOWA 3KTMA 4YY3H 1CKNB 4YR3A 2FLPA 4AYBA 2JA7G 3QFFA 1TWFA 2HGXA 1RK6A 4AYBE 3ETJA 2UU9H 2UUAH 4MV4A 1B33N 4DRFA 3JSLA 3FKIG 2AQ4A 5KFKA 5IT9W 4C5AA 5F9LA 2PMZE 3Q8SB 4RB3C 1MZBA 4F4ZA 4ECTA 1FJGH 3GTLA 5KS8A 3N6RA 2W7PA 1S0NA 5L1IA 2R8GA 4RCNA 2Q7DA 4U7CA 4YAJB 1CS0A 5L1JA 3WWJA 3KALA 1T94A 1TA8A 4MV7A 2R6FA 2VUGA 3OSNA 5DGHA 5CR5A 3T54A 4LH7A 5HBRB 4EGJA 4YBZB 3U0GA 4MTDA 3MFIA 3GIKA 1RYSA 4JI0H 1V4YA 3IN5A 3MWDA 2AU0A 3PFFA 3JSNA 2W71A 4RNMA 3T1YH 1XNQH 4NZMA 1K1SA 3M9OB 1A0IA 4DUYH 5KG4A 1OWTA 2WDTA 5F9NA 2JA5G 2V9WA 5K3WA 5IYDG 2AGOA 4DV1H 2UXBH 3GIPA 2ZM6H 2JEJA 4EBDA 4Q45A 2HIVA 1V51A 4JV5H 2I87A 3CVZA 4DL5A 3W1GA 3CEBA 3MR2A 3WO1A 5D1OB 5KFAA 4IWYA 3UFXB 4J9MA 2ZGIA 3GTJA 1JKJB 2I80A 4WHXA 5KFSA 5LMUH 2UVVA 1I6UA 1Y1WA 1CKMA 4ECWA 2DLNA 5FD5A 1BJTA 4XZ3B 3UZBA 5LL6b 1E4EB 1UC9A 3QZ7A 2FB9A 2FK2A 2GQRA 4JI5H 1GO3E 1SCUB 2C35B 5KG5A 3GTOA 1ULZA 2W6ZA 3HXLA 3K5IA 2YZGA 3GIJA 4NXNH 1AUXA 4HNTA 2C2RA 4EGQA 4O7WA 3RGZA 2ALZA 2YZNA 2XGQA 2JA6A 2BQUA 1VS0A 3I4MG 4O7RA 5DG8A 3KAKA 3CQZA 1S10A 1HNWH 1E4GT 4QJFA 1ZHQA 2O03A 2SCUB 2Y0SA 2DPJA 1T3NA 3NBYB 1I1KA 2R86A 4IHJF 4M9UA 2Y0SE 4ETSA 4A2AA 1TWAA 5A2QW 5KT3A 3Q8QB 4DV2H 4LF6H 5J2UF 1S68A 2PVPA 5I5SA 4DV7H 2DIKA 4IR1A 5C1OA 4Q8FA 5C1PA 2HGWA 2QYZA 3I4NG 4PWQA 2HG8A 5CA0F 2NU8B 2COJA 3HKZA 1S0MA 4QW8A 2EIYA 2NVYA 3U9SA 4DL3A 3VNNA 1IOVA 5BWXA 3HKZE 3TY9A 5D1PA 3QZ8A 4J9OA 5JH7F 4J9NA 3V6JA 1JDBB 3GILA 1N33H 5KFOA 3OSPA 2Z04A 5I5XA 2FK1A 2QF7A 3T99A 3R5XA 3FKIA 3MWEA 2R7NA 3IG0A 3VPCA 5IP7G 2V5AA 1SEIA 1DAAA 2COGA 3R5FA 2Y4RA 5IYBG 4HNVA 4FU0A 2FPPB 5BWVA 4O7SA 4IZOA 4X65H 4C5CA 1JXLA 4EG0A 1SFOA 2JEGA 4B3RH 1RYRA 5L1KA 3RIZA 1Y1WG 4FFRA 1KJIA 4U6PA 3LQSA 4MA0A 4QWBA 4IIJF 5LYJF 4ZI7F 1Z2OX 5EWEA 3UZOA 4CHIA 3GDEA 4JI4H 3TEKA 2FPIB 2W9CA 4F50A 4JI8H 4TV9F 3W1BA 2XD4A 5FD6A 3HOYG 2GLTA 2NU6B 1Z2NX 4ECZA 4FM9A 3VA7A 2FPGB 4ED1A 1CE8A 4O2BF 2DAAA 4DR2H 5KG1A 1S9FA 4DUZH 5BWTA 3TIIA 4O7NA 3LP8A 3MWMA 1AN7A 3JZIA 1S0OA 2R7LA 3RF2A 4O4IF 2ZJTA 4BBRG 4X62H 4L1KA 2VA2A 1Z2PX 3V4ZA 1B6SA 2CNUA 4J0MA 3KHLA 1I94H 3V6HA 1GLVA 3H3VH 3N6XA 2W6OA 1EKFA 3TINA 4GLXA 4TM5A 4PBCA 5LXTF 4DL2A 1N36H 4GKKH 1AUVA 2YS6A 2WB1A 5C8YF 4RZQA 5KFIA 3SE7A 2R84A 1EKPA 3WWIA 2WB1E 4TV8F 2YWVA 5KFVA 1Y14B 3AX6A 1M7JA 5I5WA 3VOTA 3PN1A 4O83A 1EKVA 2PMZA 4LSAA 3Q8PB 1HR0H 2ASJA 4A3GG 1WRVA 4DV0H 4GC6A 3T5LA 5DG7A 3J80W 4RZRA 1B04A 4DR5H 4DL7A 4PZ7A 1CQJB 2ZDHA 3Q8RB 3T9BA 3HOUG 2OH2A 5KG6A 4O7YA 3VMMA 3RFCA 1IBKH 1KJQA 3BA8A 2UUCH 4X64H 1WH2A 3PW5A 5CB4F 3VPBA 1KUTA 1M0WA 3S24A 4E4TA 2W9BA 4ECRA 2NUAB 5KX5F 1GSHA 2R87A 5HV6A 3VPDA 2ODTX 4O86A 4DQNA 3C0FB 4XYMB 5KG0A 2R7KA 5KT7A 3RAQA 2R93G 2C2EA 2R7ZG 4UCSA 3PR5B 3G6VA 3GTKA 1EZ1A 2W6MA 3BQ0A 1I7LA 3T5HA 5KFGA 4K0KH 5BR8H 3T9AA 3R5HA 1I2KA 5JQGF 5K2MA 5KFWA 5KT4A 5DQGA 3HOXG 4ED7A 4A3KG 1J5EH 4LFCH 1KT8A 3DTFA 5KFDA 2DABA 3EYYA 1KJJA 5KG3A 3MR6A 4I7HA 3RB3A 3V4SA 3PW0A 2R8KA 4JI7H 4I4TF 1N34H 2YU9A 1IBMH 3G8DA 1KJ9A 1S97A 2IP4A 1JLLB 4NZOA 3L4JA 4EBEA 4ECUA 3OUUA 4FFMA 4DAAA 5EZYF 3Q2OA 4FFPA 4PZ6A 2HIXA 3TY8A 5DAAA 5I5TA 1KEEA 4RU9A 3GIIA 2VQEH 2C28A 4LF9H 4O3SA 2GQSA 5EWGA 4DR6H 4IRKA 3PO3G 2UVUA 4LF5H 5C4XG 3OHBA 4JI3H 5FPRA 5BYBA 3NGDA 3QQMA 1WR2A 4ED8A 2V59A 3NUAA 4HN2A 4Q4CA 5KFMA 5DMXA 4IR9A 5JQWA 4A93G 1VBGA 2YW2A 4PZ8A 2W9AA 3UQ8A 2W8LA 3K5HA 3H20A 2YS7A 4ECVA 3V6KA 2P0AA 1BNCA 2CNQA 4GKJH 4NZNA 1K1QA 2E2HA 2YZMA 2R8JA 1JDEA 3JRXA 3RV3A 2Z02A 3I12A 3H0GG 3BACA 5KFPA 3KHRA 2PN1A 1KTAA 3U54A 4RUCA 3H4BA 1I1MA 2R8IA 2C22A 4A3BG 4JI6H 1JIHA 3LULA 3KXYT 3RGXA 5IYCG 3M9MB 1HNZH 3PVXA 3OTOH 2A1HA 5LA6F 3RBEA 3PW4A 2V4QA 4O4LF 5KFXA 2FK3A 2J6TA 2DWCA 2VR1A 3TY5A 3E5NA 4CKEA 1ZHSA 1ZETA 5D8DA 2PBZA 3BABA 1UNNC 3U9TA 4FFOA 5DQHA 4M7EA 4ME6A 1I2LA 2ASLA 4Y8VB 4YJ3F 3BQ1A 4BWSC 4ED2A 2WAQA 1M6VA 4HQ6A 4CKCA 1BGWA 2XGPA 2FLNA 4F4YA 2WAQE 2B63A 2KSWA 2HVRA 4A2BA 2YRXA 2XCAA 5BWUA 5CAEB 5KFHA 3DTGA 3H4DA 4RNOA 4DV4H 1Y1VG 1VKZA 2NU9B 4CMDA 2FKLA 5FJ8G 2RDIA 2VPQA 5I60A 2Q2TA 2VUMG 4GLWA 4XYLB 2UXDH 2FE3A 4O3QA 1P8LA 5KFZA 4HR7A 3T9EA 5EOYA 3SGIA 3JAMW 5DG9A 3GLKA 5KT2A 4A3CG 3OUZA 2C2DA 5C44G 1TAEA 3OHAA 5KFEA 4CMFA 4CKBA 3DAAA 3G8CA 3N41B 2I8CA 1RJQA 1WCMG 5I5UA 2IMWP 2R7ZA 3HB9A 1HNXH 2HGSA 2W6PA 4FGRA 5KFLA 4ECQA 4O4HF 1SYXB 2XCLA 5FLXW 4J9QA 4LH6A 4A3LG 2HVQA 4HYKA 1PK8A 3TW6A 4NYEA 3K3VA 2J6SA 4J9KA 2YRWA 4UUGA 5HNEA 2XC9A 4LF7H 5DLGA 3LMLA 1FVIA 2CW7A 1IYDA 1XMQH 2HJWA 2IA6A 4O3OA 5BMVF 5I5VA 2R92G 1A3GA 4KHPH 2RGRA 3PW2A 2R7MA 4UCUA 2X0SA 2W6QA 3J81W 3KREA 2NVXA 2ATLA 1E4FT 5KG2A 4A3JG 4EBCA 4TQSA 4O3RA 4Q44A 1I1LA 2UVWA 3N40P 4BY1G 2HHHH 3GTQA 4DV6H 1X9NA 4DR7H 5LOVF 1T36A 5KFFA 4UCTA 4LFBH 1L2ZA 4X66H 2HVSA 2HDKA 1OBGA 4F4XA 4DR3H 4O7ZA 3L4KA 4ZQIA 2HHFA 2QK4A 3KAJA 3EPGA 4R7RA 4QWEA 5FNVF 4EQ5A 3KHGA 3UYYA 1O75A 3EPIA 5KFYA 4QW9A 4YR0A 1A0GA 3AW8A 1KC7A 4ECYA 4G3IA 1GSOA 3GIQA 3H0GA 1XK5A 2W57A 2ZDGA 2B63G 4PDBA 2J6UA 3RB4A 1UC8A 4JV2A 3RB6A 4J9LA 4TQRA 2R82A 4C5BA 3ETHA 2C00A 3MFHA 4F4WA 4FS2A 1IBLH 4TVIA 2COIA 4C2MA 3GV8B 2R8HA 4RB1A 4R8UA 3RJ0A 4EYHB 3F8NA 1ZQ7A 4YAKB 3GQCA 2ASDA 2GPWA 3N42B 2AGPA 3BA9A 1I3QA 2FJZA 4J9SA 4BXXG 5I5YA 1WSCA 1DGSA 4JI2H 5KFCA 4EYIB 5KFBA 2YCHA 4DR1H 3SNOA 1R9TA 3PO2G 4CE5A 5I47A 1TWGA 2WYOA 3NC0B 3RTXA 1PX2A 2CQYA 1Y1VA 1P16A 3SI8A 1M0TA 3N8DA 3LWBA 4O3PA 4A3EG 1N56A 4LMYA 2DZDA 4M0JA 5DISC 2JA6G 2UXCH 2VUMA 4RUAA 5DGBA 2VQDA 2W9CB 4WBNF 4O7LA 4DL4A 1TWCA 4ED0A 2FMAA 5EWFA 4YHHH 4A3FG 5DGAA 5BPFA 2E2IA 1GYFA 1WCMA 1IYEA 4TUYF 5DGIA 3GIMA 3U55A 4QIWA 5FR9A 5KFTA 3GV5B 3JZFA 2VPSA 3M9NB 4QIWE 5T14A 5KFJA 4Q8EA 3GTMA 2W7OA 1EYZA 3TW7A 4ED3A 2BQRA 4O81A 5JUMA 5IWAH 3GTGA 4BY7G 4MV1A 3BJYA 2R92A 4A3MG 2CZGA 4EFBA 1A48A 3G6YA 3TQTA 2AGQA 1RJRA 2BR0A 4QWAA 2UVRA 1V9PA 4B3MH 4EFEA 2V4RA 5KT6A 1I7NA 3GTPA 3WNZA 3HBLA 3MJFA 1G2WA 3PR4A 3RBDA 3T9DA 2JEFA 4B3SH 5KFRA 4UCRA 3WWHA 4CC6A 1OBDA 2Q2UA 1DV1A 4RNNA 4MA5A 5BYAA 1EUCB 4MV3A 1A9XA 4RAYA 2HHFB 2RDJA 1EUDB 4O84A 3T5JA 2FLLA 4NLGA 4NXMH 4UCOA 3CSWA 5E25A 4QWDA 1ET0A 2VOBA 2F4VH 2X5RA 3T1HH 3GJXB 1KJ8A 3NBZB 4JUZA 2R93A 3HT5A 1N48A 4JV0A 1FKAH 3FMAA 4LFAH 3JRWA 3PZPA 3RV4A 3RAXA 1TWHA 2OLSA 4EEQA 4YB8B 1CKNA 3HOZG 5IYZF 5CM0A 1I50A 2ABJA 2WTFA 1EHIA 3KYHC 1XDNA 2J9GA 4AQYH 1KBLA 3R23A 5BPHA 3J7AK 4MV9A 4CC5A 4MV8A 4R8UB 3W5OA 4YR2A 2VA3A 4HNUA 5BWRA 4JYAH 2V58A 2UUBH 2EJ3A 4APMA 1W93A 2W9BB 4O4JF 4DIMA 4O2AF 1GSAA 3MR3A 5KG7A 2DPIA 2MCTA 5KT5A 3BAAA 3RUPA 3N44B 4UFZA 4FFLA 2FP4B 1C30A 2JA7A 2ZDQA 2W8KA 1K83A 3RB0A 5L1LA 4RAZA 1DV2A 4Q4DA 4O3NA 4LSXA 4LF4H 2WE6A 1CQIB 1C3OA 3AYHB 1N32H 3JZ6A 4DL6A 2YZLA 5KFNA 4YP3A 2XCPA 2JEIA 4DV5H 3T7AA 2CFMA 2QB5A 3GB8B 3Q1KA 4J9PA 2CNVA 4E6NA 4IRCA 4GC7A 5DQIA 3M4IA 2YL2A 5EDWA 3GV7B 4RB2C 5CA1F 3KHHA 1B6RA 3MR5A 3DF7A 4O7TA 4ZHQF 2XIGA 4YQWA 3ORQA 4O7VA 5FPOA 5JVDF 4QWCA 2VQFH 3TQ1A 4EEYA 4IRDA 2JA8G 4IAJA 4XX0B 3HO8A 5D1OA 4A3IG 4A3DG 4BBSG 2BQ3A 4FS1A 4MV6A 5LMNH 5LP6F 4JXUA 5J2TF 1VAJA 5KFUA 1VBHA 3N43B 5C3EG 2EJ0A 4ED6A 1BXRA 2CKZB 4QSHA 4JI1H 4JV1A 2YYAA 2JA5A 3WO0A 4ECSA 4DR4H 2OWOA 2RF4A 5C5JA 4MAMA 1E4EA 2W6NA 4K6NA 3T9FA 4I55F 4Q0YA 4DLKA 4FE2A 1CKOA 4ZOLF 3PW7A 3QWUA 3HOVG 1GGOA 4YJ2F 3HOWG 3T9CA 4J9RA 3L2PA 1DIKA 1ZAUA 5DLFA 4ECXA 4FBUA 4LF8H 1XNRH 3RR5A 3ORRA 3R9RA 4WD3A 2NU7B 1XMOH 4MTEA 2CW8A 4Q43A 5CE8A 5JVLA 1W96A 2GPSA 3BG5A 2M05A 4O82A 4IWXA 4RB0A 2R85A 3TIGA 2IBKA 1JX4A 3K3PA 2RGVA 2E5LH 4UCVA 4I50F 5BWWA 3BQ2A 3T5KA 5FLMG 4FFNA 1RK5A 4FBTA 3H40A 4DV3H 5IP9G 5KFQA 5GONF 2W70A 4OX9H 3GIDA 1S03G 3G6XA
chains in the Genus database with same CATH topology
5KKNB 5H80A 1IOWA 3QFFA 3ETJA 4MV4A 4C5AA 3N6RA 4YAJB 1CS0A 2R6FA 3KALA 4MV7A 4EGJA 5HBRB 4YBZB 3MWDA 2W71A 2I87A 3WO1A 4IWYA 3UFXB 1JKJB 2I80A 2DLNA 4XZ3B 1E4EB 1UC9A 2FB9A 2GQRA 1SCUB 1ULZA 2W6ZA 3K5IA 2YZGA 1AUXA 4HNTA 4EGQA 4O7WA 2YZNA 4O7RA 3KAKA 2SCUB 4M9UA 2R86A 4IHJF 5J2UF 2PVPA 2DIKA 5C1OA 5C1PA 5CA0F 2NU8B 3U9SA 1IOVA 5JH7F 1JDBB 2Z04A 2QF7A 3R5XA 3MWEA 2R7NA 3VPCA 2V5AA 3R5FA 4HNVA 4FU0A 2FPPB 4O7SA 4IZOA 4C5CA 4EG0A 4FFRA 1KJIA 4MA0A 4IIJF 5LYJF 4ZI7F 1Z2OX 2FPIB 4TV9F 2XD4A 2GLTA 2NU6B 1Z2NX 3VA7A 2FPGB 1CE8A 4O2BF 3TIIA 4O7NA 3LP8A 3JZIA 2R7LA 4O4IF 4L1KA 1Z2PX 3V4ZA 1B6SA 2CNUA 1GLVA 2W6OA 3TINA 5LXTF 1AUVA 2YS6A 5C8YF 4RZQA 3SE7A 2R84A 4TV8F 2YWVA 3AX6A 3VOTA 4O83A 1CQJB 2ZDHA 4O7YA 3VMMA 3RFCA 1KJQA 5CB4F 3VPBA 1KUTA 1M0WA 4E4TA 2NUAB 5KX5F 1GSHA 2R87A 5HV6A 3VPDA 4O86A 4XYMB 2R7KA 1EZ1A 2W6MA 1I7LA 3R5HA 5JQGF 5K2MA 1KJJA 3V4SA 4I4TF 3G8DA 1KJ9A 2IP4A 1JLLB 3OUUA 4FFMA 5EZYF 3Q2OA 4FFPA 1KEEA 2GQSA 1WR2A 2V59A 3NUAA 5DMXA 5JQWA 1VBGA 2YW2A 3K5HA 2YS7A 2P0AA 1BNCA 2CNQA 2YZMA 1JDEA 3JRXA 3RV3A 2Z02A 3I12A 2PN1A 3U54A 5LA6F 4O4LF 2DWCA 2VR1A 3E5NA 5D8DA 2PBZA 3U9TA 4FFOA 4ME6A 4Y8VB 4YJ3F 1M6VA 4HQ6A 2YRXA 5CAEB 1VKZA 2NU9B 2VPQA 4XYLB 4HR7A 3GLKA 3OUZA 3G8CA 2I8CA 3HB9A 2HGSA 2W6PA 4FGRA 4O4HF 2XCLA 1PK8A 3TW6A 4NYEA 2YRWA 2HJWA 5BMVF 2R7MA 2X0SA 2W6QA 3KREA 5LOVF 1T36A 1OBGA 4O7ZA 4ZQIA 2QK4A 3KAJA 5FNVF 3AW8A 1KC7A 1GSOA 2ZDGA 1UC8A 2R82A 4C5BA 3ETHA 2C00A 4YAKB 2GPWA 5I47A 2WYOA 2CQYA 1PX2A 1M0TA 3N8DA 3LWBA 2DZDA 2VQDA 4WBNF 4O7LA 5BPFA 4TUYF 3U55A 3JZFA 1EYZA 4O81A 4MV1A 2CZGA 1A48A 3TQTA 1I7NA 3WNZA 3HBLA 3MJFA 1OBDA 1DV1A 4MA5A 1EUCB 4MV3A 1A9XA 1EUDB 4O84A 1KJ8A 3JRWA 3RV4A 2OLSA 4YB8B 5IYZF 1EHIA 2J9GA 1KBLA 3R23A 5BPHA 4MV9A 4MV8A 4HNUA 2V58A 1W93A 4O4JF 4DIMA 4O2AF 1GSAA 3RUPA 4FFLA 2FP4B 1C30A 2ZDQA 1DV2A 1CQIB 1C3OA 2YZLA 3Q1KA 2CNVA 2YL2A 5CA1F 1B6RA 3DF7A 4O7TA 4ZHQF 3ORQA 4O7VA 5JVDF 4XX0B 3HO8A 4MV6A 5LP6F 5J2TF 1VBHA 1BXRA 4QSHA 2YYAA 3WO0A 4MAMA 1E4EA 2W6NA 4I55F 4DLKA 4FE2A 4ZOLF 1GGOA 4YJ2F 1DIKA 3ORRA 3R9RA 4WD3A 2NU7B 5JVLA 1W96A 2GPSA 3BG5A 4O82A 4IWXA 2R85A 3TIGA 3K3PA 4I50F 4FFNA 5GONF 2W70A 3GIDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KKN B;  5H80 A;  1IOW A;  3QFF A;  3ETJ A;  4MV4 A;  4C5A A;  3N6R A;  4YAJ B;  1CS0 A;  2R6F A;  3KAL A;  4MV7 A;  4EGJ A;  5HBR B;  4YBZ B;  3MWD A;  2W71 A;  2I87 A;  3WO1 A;  4IWY A;  3UFX B;  1JKJ B;  2I80 A;  2DLN A;  4XZ3 B;  1E4E B;  1UC9 A;  2FB9 A;  2GQR A;  1SCU B;  1ULZ A;  2W6Z A;  3K5I A;  2YZG A;  1AUX A;  4HNT A;  4EGQ A;  4O7W A;  2YZN A;  4O7R A;  3KAK A;  2SCU B;  4M9U A;  2R86 A;  4IHJ F;  5J2U F;  2PVP A;  2DIK A;  5C1O A;  5C1P A;  5CA0 F;  2NU8 B;  3U9S A;  1IOV A;  5JH7 F;  1JDB B;  2Z04 A;  2QF7 A;  3R5X A;  3MWE A;  2R7N A;  3VPC A;  2V5A A;  3R5F A;  4HNV A;  4FU0 A;  2FPP B;  4O7S A;  4IZO A;  4C5C A;  4EG0 A;  4FFR A;  1KJI A;  4MA0 A;  4IIJ F;  5LYJ F;  4ZI7 F;  1Z2O X;  2FPI B;  4TV9 F;  2XD4 A;  2GLT A;  2NU6 B;  1Z2N X;  3VA7 A;  2FPG B;  1CE8 A;  4O2B F;  3TII A;  4O7N A;  3LP8 A;  3JZI A;  2R7L A;  4O4I F;  4L1K A;  1Z2P X;  3V4Z A;  1B6S A;  2CNU A;  1GLV A;  2W6O A;  3TIN A;  5LXT F;  1AUV A;  2YS6 A;  5C8Y F;  4RZQ A;  3SE7 A;  2R84 A;  4TV8 F;  2YWV A;  3AX6 A;  3VOT A;  4O83 A;  1CQJ B;  2ZDH A;  4O7Y A;  3VMM A;  3RFC A;  1KJQ A;  5CB4 F;  3VPB A;  1KUT A;  1M0W A;  4E4T A;  2NUA B;  5KX5 F;  1GSH A;  2R87 A;  5HV6 A;  3VPD A;  4O86 A;  4XYM B;  2R7K A;  1EZ1 A;  2W6M A;  1I7L A;  3R5H A;  5JQG F;  5K2M A;  1KJJ A;  3V4S A;  4I4T F;  3G8D A;  1KJ9 A;  2IP4 A;  1JLL B;  3OUU A;  4FFM A;  5EZY F;  3Q2O A;  4FFP A;  1KEE A;  2GQS A;  1WR2 A;  2V59 A;  3NUA A;  5DMX A;  5JQW A;  1VBG A;  2YW2 A;  3K5H A;  2YS7 A;  2P0A A;  1BNC A;  2CNQ A;  2YZM A;  1JDE A;  3JRX A;  3RV3 A;  2Z02 A;  3I12 A;  2PN1 A;  3U54 A;  5LA6 F;  4O4L F;  2DWC A;  2VR1 A;  3E5N A;  5D8D A;  2PBZ A;  3U9T A;  4FFO A;  4ME6 A;  4Y8V B;  4YJ3 F;  1M6V A;  4HQ6 A;  2YRX A;  5CAE B;  1VKZ A;  2NU9 B;  2VPQ A;  4XYL B;  4HR7 A;  3GLK A;  3OUZ A;  3G8C A;  2I8C A;  3HB9 A;  2HGS A;  2W6P A;  4FGR A;  4O4H F;  2XCL A;  1PK8 A;  3TW6 A;  4NYE A;  2YRW A;  2HJW A;  5BMV F;  2R7M A;  2X0S A;  2W6Q A;  3KRE A;  5LOV F;  1T36 A;  1OBG A;  4O7Z A;  4ZQI A;  2QK4 A;  3KAJ A;  5FNV F;  3AW8 A;  1KC7 A;  1GSO A;  2ZDG A;  1UC8 A;  2R82 A;  4C5B A;  3ETH A;  2C00 A;  4YAK B;  2GPW A;  5I47 A;  2WYO A;  2CQY A;  1PX2 A;  1M0T A;  3N8D A;  3LWB A;  2DZD A;  2VQD A;  4WBN F;  4O7L A;  5BPF A;  4TUY F;  3U55 A;  3JZF A;  1EYZ A;  4O81 A;  4MV1 A;  2CZG A;  1A48 A;  3TQT A;  1I7N A;  3WNZ A;  3HBL A;  3MJF A;  1OBD A;  1DV1 A;  4MA5 A;  1EUC B;  4MV3 A;  1A9X A;  1EUD B;  4O84 A;  1KJ8 A;  3JRW A;  3RV4 A;  2OLS A;  4YB8 B;  5IYZ F;  1EHI A;  2J9G A;  1KBL A;  3R23 A;  5BPH A;  4MV9 A;  4MV8 A;  4HNU A;  2V58 A;  1W93 A;  4O4J F;  4DIM A;  4O2A F;  1GSA A;  3RUP A;  4FFL A;  2FP4 B;  1C30 A;  2ZDQ A;  1DV2 A;  1CQI B;  1C3O A;  2YZL A;  3Q1K A;  2CNV A;  2YL2 A;  5CA1 F;  1B6R A;  3DF7 A;  4O7T A;  4ZHQ F;  3ORQ A;  4O7V A;  5JVD F;  4XX0 B;  3HO8 A;  4MV6 A;  5LP6 F;  5J2T F;  1VBH A;  1BXR A;  4QSH A;  2YYA A;  3WO0 A;  4MAM A;  1E4E A;  2W6N A;  4I55 F;  4DLK A;  4FE2 A;  4ZOL F;  1GGO A;  4YJ2 F;  1DIK A;  3ORR A;  3R9R A;  4WD3 A;  2NU7 B;  5JVL A;  1W96 A;  2GPS A;  3BG5 A;  4O82 A;  4IWX A;  2R85 A;  3TIG A;  3K3P A;  4I50 F;  4FFN A;  5GON F;  2W70 A;  3GID A; 
#chains in the Genus database with same CATH topology
 2EJ2 A;  5KKN B;  5L9X A;  1RJP A;  5H80 A;  4B3T H;  3FDS A;  1IOW A;  3KTM A;  4YY3 H;  1CKN B;  4YR3 A;  2FLP A;  4AYB A;  2JA7 G;  3QFF A;  1TWF A;  2HGX A;  1RK6 A;  4AYB E;  3ETJ A;  2UU9 H;  2UUA H;  4MV4 A;  1B33 N;  4DRF A;  3JSL A;  3FKI G;  2AQ4 A;  5KFK A;  5IT9 W;  4C5A A;  5F9L A;  2PMZ E;  3Q8S B;  4RB3 C;  1MZB A;  4F4Z A;  4ECT A;  1FJG H;  3GTL A;  5KS8 A;  3N6R A;  2W7P A;  1S0N A;  5L1I A;  2R8G A;  4RCN A;  2Q7D A;  4U7C A;  4YAJ B;  1CS0 A;  5L1J A;  3WWJ A;  3KAL A;  1T94 A;  1TA8 A;  4MV7 A;  2R6F A;  2VUG A;  3OSN A;  5DGH A;  5CR5 A;  3T54 A;  4LH7 A;  5HBR B;  4EGJ A;  4YBZ B;  3U0G A;  4MTD A;  3MFI A;  3GIK A;  1RYS A;  4JI0 H;  1V4Y A;  3IN5 A;  3MWD A;  2AU0 A;  3PFF A;  3JSN A;  2W71 A;  4RNM A;  3T1Y H;  1XNQ H;  4NZM A;  1K1S A;  3M9O B;  1A0I A;  4DUY H;  5KG4 A;  1OWT A;  2WDT A;  5F9N A;  2JA5 G;  2V9W A;  5K3W A;  5IYD G;  2AGO A;  4DV1 H;  2UXB H;  3GIP A;  2ZM6 H;  2JEJ A;  4EBD A;  4Q45 A;  2HIV A;  1V51 A;  4JV5 H;  2I87 A;  3CVZ A;  4DL5 A;  3W1G A;  3CEB A;  3MR2 A;  3WO1 A;  5D1O B;  5KFA A;  4IWY A;  3UFX B;  4J9M A;  2ZGI A;  3GTJ A;  1JKJ B;  2I80 A;  4WHX A;  5KFS A;  5LMU H;  2UVV A;  1I6U A;  1Y1W A;  1CKM A;  4ECW A;  2DLN A;  5FD5 A;  1BJT A;  4XZ3 B;  3UZB A;  5LL6 b;  1E4E B;  1UC9 A;  3QZ7 A;  2FB9 A;  2FK2 A;  2GQR A;  4JI5 H;  1GO3 E;  1SCU B;  2C35 B;  5KG5 A;  3GTO A;  1ULZ A;  2W6Z A;  3HXL A;  3K5I A;  2YZG A;  3GIJ A;  4NXN H;  1AUX A;  4HNT A;  2C2R A;  4EGQ A;  4O7W A;  3RGZ A;  2ALZ A;  2YZN A;  2XGQ A;  2JA6 A;  2BQU A;  1VS0 A;  3I4M G;  4O7R A;  5DG8 A;  3KAK A;  3CQZ A;  1S10 A;  1HNW H;  1E4G T;  4QJF A;  1ZHQ A;  2O03 A;  2SCU B;  2Y0S A;  2DPJ A;  1T3N A;  3NBY B;  1I1K A;  2R86 A;  4IHJ F;  4M9U A;  2Y0S E;  4ETS A;  4A2A A;  1TWA A;  5A2Q W;  5KT3 A;  3Q8Q B;  4DV2 H;  4LF6 H;  5J2U F;  1S68 A;  2PVP A;  5I5S A;  4DV7 H;  2DIK A;  4IR1 A;  5C1O A;  4Q8F A;  5C1P A;  2HGW A;  2QYZ A;  3I4N G;  4PWQ A;  2HG8 A;  5CA0 F;  2NU8 B;  2COJ A;  3HKZ A;  1S0M A;  4QW8 A;  2EIY A;  2NVY A;  3U9S A;  4DL3 A;  3VNN A;  1IOV A;  5BWX A;  3HKZ E;  3TY9 A;  5D1P A;  3QZ8 A;  4J9O A;  5JH7 F;  4J9N A;  3V6J A;  1JDB B;  3GIL A;  1N33 H;  5KFO A;  3OSP A;  2Z04 A;  5I5X A;  2FK1 A;  2QF7 A;  3T99 A;  3R5X A;  3FKI A;  3MWE A;  2R7N A;  3IG0 A;  3VPC A;  5IP7 G;  2V5A A;  1SEI A;  1DAA A;  2COG A;  3R5F A;  2Y4R A;  5IYB G;  4HNV A;  4FU0 A;  2FPP B;  5BWV A;  4O7S A;  4IZO A;  4X65 H;  4C5C A;  1JXL A;  4EG0 A;  1SFO A;  2JEG A;  4B3R H;  1RYR A;  5L1K A;  3RIZ A;  1Y1W G;  4FFR A;  1KJI A;  4U6P A;  3LQS A;  4MA0 A;  4QWB A;  4IIJ F;  5LYJ F;  4ZI7 F;  1Z2O X;  5EWE A;  3UZO A;  4CHI A;  3GDE A;  4JI4 H;  3TEK A;  2FPI B;  2W9C A;  4F50 A;  4JI8 H;  4TV9 F;  3W1B A;  2XD4 A;  5FD6 A;  3HOY G;  2GLT A;  2NU6 B;  1Z2N X;  4ECZ A;  4FM9 A;  3VA7 A;  2FPG B;  4ED1 A;  1CE8 A;  4O2B F;  2DAA A;  4DR2 H;  5KG1 A;  1S9F A;  4DUZ H;  5BWT A;  3TII A;  4O7N A;  3LP8 A;  3MWM A;  1AN7 A;  3JZI A;  1S0O A;  2R7L A;  3RF2 A;  4O4I F;  2ZJT A;  4BBR G;  4X62 H;  4L1K A;  2VA2 A;  1Z2P X;  3V4Z A;  1B6S A;  2CNU A;  4J0M A;  3KHL A;  1I94 H;  3V6H A;  1GLV A;  3H3V H;  3N6X A;  2W6O A;  1EKF A;  3TIN A;  4GLX A;  4TM5 A;  4PBC A;  5LXT F;  4DL2 A;  1N36 H;  4GKK H;  1AUV A;  2YS6 A;  2WB1 A;  5C8Y F;  4RZQ A;  5KFI A;  3SE7 A;  2R84 A;  1EKP A;  3WWI A;  2WB1 E;  4TV8 F;  2YWV A;  5KFV A;  1Y14 B;  3AX6 A;  1M7J A;  5I5W A;  3VOT A;  3PN1 A;  4O83 A;  1EKV A;  2PMZ A;  4LSA A;  3Q8P B;  1HR0 H;  2ASJ A;  4A3G G;  1WRV A;  4DV0 H;  4GC6 A;  3T5L A;  5DG7 A;  3J80 W;  4RZR A;  1B04 A;  4DR5 H;  4DL7 A;  4PZ7 A;  1CQJ B;  2ZDH A;  3Q8R B;  3T9B A;  3HOU G;  2OH2 A;  5KG6 A;  4O7Y A;  3VMM A;  3RFC A;  1IBK H;  1KJQ A;  3BA8 A;  2UUC H;  4X64 H;  1WH2 A;  3PW5 A;  5CB4 F;  3VPB A;  1KUT A;  1M0W A;  3S24 A;  4E4T A;  2W9B A;  4ECR A;  2NUA B;  5KX5 F;  1GSH A;  2R87 A;  5HV6 A;  3VPD A;  2ODT X;  4O86 A;  4DQN A;  3C0F B;  4XYM B;  5KG0 A;  2R7K A;  5KT7 A;  3RAQ A;  2R93 G;  2C2E A;  2R7Z G;  4UCS A;  3PR5 B;  3G6V A;  3GTK A;  1EZ1 A;  2W6M A;  3BQ0 A;  1I7L A;  3T5H A;  5KFG A;  4K0K H;  5BR8 H;  3T9A A;  3R5H A;  1I2K A;  5JQG F;  5K2M A;  5KFW A;  5KT4 A;  5DQG A;  3HOX G;  4ED7 A;  4A3K G;  1J5E H;  4LFC H;  1KT8 A;  3DTF A;  5KFD A;  2DAB A;  3EYY A;  1KJJ A;  5KG3 A;  3MR6 A;  4I7H A;  3RB3 A;  3V4S A;  3PW0 A;  2R8K A;  4JI7 H;  4I4T F;  1N34 H;  2YU9 A;  1IBM H;  3G8D A;  1KJ9 A;  1S97 A;  2IP4 A;  1JLL B;  4NZO A;  3L4J A;  4EBE A;  4ECU A;  3OUU A;  4FFM A;  4DAA A;  5EZY F;  3Q2O A;  4FFP A;  4PZ6 A;  2HIX A;  3TY8 A;  5DAA A;  5I5T A;  1KEE A;  4RU9 A;  3GII A;  2VQE H;  2C28 A;  4LF9 H;  4O3S A;  2GQS A;  5EWG A;  4DR6 H;  4IRK A;  3PO3 G;  2UVU A;  4LF5 H;  5C4X G;  3OHB A;  4JI3 H;  5FPR A;  5BYB A;  3NGD A;  3QQM A;  1WR2 A;  4ED8 A;  2V59 A;  3NUA A;  4HN2 A;  4Q4C A;  5KFM A;  5DMX A;  4IR9 A;  5JQW A;  4A93 G;  1VBG A;  2YW2 A;  4PZ8 A;  2W9A A;  3UQ8 A;  2W8L A;  3K5H A;  3H20 A;  2YS7 A;  4ECV A;  3V6K A;  2P0A A;  1BNC A;  2CNQ A;  4GKJ H;  4NZN A;  1K1Q A;  2E2H A;  2YZM A;  2R8J A;  1JDE A;  3JRX A;  3RV3 A;  2Z02 A;  3I12 A;  3H0G G;  3BAC A;  5KFP A;  3KHR A;  2PN1 A;  1KTA A;  3U54 A;  4RUC A;  3H4B A;  1I1M A;  2R8I A;  2C22 A;  4A3B G;  4JI6 H;  1JIH A;  3LUL A;  3KXY T;  3RGX A;  5IYC G;  3M9M B;  1HNZ H;  3PVX A;  3OTO H;  2A1H A;  5LA6 F;  3RBE A;  3PW4 A;  2V4Q A;  4O4L F;  5KFX A;  2FK3 A;  2J6T A;  2DWC A;  2VR1 A;  3TY5 A;  3E5N A;  4CKE A;  1ZHS A;  1ZET A;  5D8D A;  2PBZ A;  3BAB A;  1UNN C;  3U9T A;  4FFO A;  5DQH A;  4M7E A;  4ME6 A;  1I2L A;  2ASL A;  4Y8V B;  4YJ3 F;  3BQ1 A;  4BWS C;  4ED2 A;  2WAQ A;  1M6V A;  4HQ6 A;  4CKC A;  1BGW A;  2XGP A;  2FLN A;  4F4Y A;  2WAQ E;  2B63 A;  2KSW A;  2HVR A;  4A2B A;  2YRX A;  2XCA A;  5BWU A;  5CAE B;  5KFH A;  3DTG A;  3H4D A;  4RNO A;  4DV4 H;  1Y1V G;  1VKZ A;  2NU9 B;  4CMD A;  2FKL A;  5FJ8 G;  2RDI A;  2VPQ A;  5I60 A;  2Q2T A;  2VUM G;  4GLW A;  4XYL B;  2UXD H;  2FE3 A;  4O3Q A;  1P8L A;  5KFZ A;  4HR7 A;  3T9E A;  5EOY A;  3SGI A;  3JAM W;  5DG9 A;  3GLK A;  5KT2 A;  4A3C G;  3OUZ A;  2C2D A;  5C44 G;  1TAE A;  3OHA A;  5KFE A;  4CMF A;  4CKB A;  3DAA A;  3G8C A;  3N41 B;  2I8C A;  1RJQ A;  1WCM G;  5I5U A;  2IMW P;  2R7Z A;  3HB9 A;  1HNX H;  2HGS A;  2W6P A;  4FGR A;  5KFL A;  4ECQ A;  4O4H F;  1SYX B;  2XCL A;  5FLX W;  4J9Q A;  4LH6 A;  4A3L G;  2HVQ A;  4HYK A;  1PK8 A;  3TW6 A;  4NYE A;  3K3V A;  2J6S A;  4J9K A;  2YRW A;  4UUG A;  5HNE A;  2XC9 A;  4LF7 H;  5DLG A;  3LML A;  1FVI A;  2CW7 A;  1IYD A;  1XMQ H;  2HJW A;  2IA6 A;  4O3O A;  5BMV F;  5I5V A;  2R92 G;  1A3G A;  4KHP H;  2RGR A;  3PW2 A;  2R7M A;  4UCU A;  2X0S A;  2W6Q A;  3J81 W;  3KRE A;  2NVX A;  2ATL A;  1E4F T;  5KG2 A;  4A3J G;  4EBC A;  4TQS A;  4O3R A;  4Q44 A;  1I1L A;  2UVW A;  3N40 P;  4BY1 G;  2HHH H;  3GTQ A;  4DV6 H;  1X9N A;  4DR7 H;  5LOV F;  1T36 A;  5KFF A;  4UCT A;  4LFB H;  1L2Z A;  4X66 H;  2HVS A;  2HDK A;  1OBG A;  4F4X A;  4DR3 H;  4O7Z A;  3L4K A;  4ZQI A;  2HHF A;  2QK4 A;  3KAJ A;  3EPG A;  4R7R A;  4QWE A;  5FNV F;  4EQ5 A;  3KHG A;  3UYY A;  1O75 A;  3EPI A;  5KFY A;  4QW9 A;  4YR0 A;  1A0G A;  3AW8 A;  1KC7 A;  4ECY A;  4G3I A;  1GSO A;  3GIQ A;  3H0G A;  1XK5 A;  2W57 A;  2ZDG A;  2B63 G;  4PDB A;  2J6U A;  3RB4 A;  1UC8 A;  4JV2 A;  3RB6 A;  4J9L A;  4TQR A;  2R82 A;  4C5B A;  3ETH A;  2C00 A;  3MFH A;  4F4W A;  4FS2 A;  1IBL H;  4TVI A;  2COI A;  4C2M A;  3GV8 B;  2R8H A;  4RB1 A;  4R8U A;  3RJ0 A;  4EYH B;  3F8N A;  1ZQ7 A;  4YAK B;  3GQC A;  2ASD A;  2GPW A;  3N42 B;  2AGP A;  3BA9 A;  1I3Q A;  2FJZ A;  4J9S A;  4BXX G;  5I5Y A;  1WSC A;  1DGS A;  4JI2 H;  5KFC A;  4EYI B;  5KFB A;  2YCH A;  4DR1 H;  3SNO A;  1R9T A;  3PO2 G;  4CE5 A;  5I47 A;  1TWG A;  2WYO A;  3NC0 B;  3RTX A;  1PX2 A;  2CQY A;  1Y1V A;  1P16 A;  3SI8 A;  1M0T A;  3N8D A;  3LWB A;  4O3P A;  4A3E G;  1N56 A;  4LMY A;  2DZD A;  4M0J A;  5DIS C;  2JA6 G;  2UXC H;  2VUM A;  4RUA A;  5DGB A;  2VQD A;  2W9C B;  4WBN F;  4O7L A;  4DL4 A;  1TWC A;  4ED0 A;  2FMA A;  5EWF A;  4YHH H;  4A3F G;  5DGA A;  5BPF A;  2E2I A;  1GYF A;  1WCM A;  1IYE A;  4TUY F;  5DGI A;  3GIM A;  3U55 A;  4QIW A;  5FR9 A;  5KFT A;  3GV5 B;  3JZF A;  2VPS A;  3M9N B;  4QIW E;  5T14 A;  5KFJ A;  4Q8E A;  3GTM A;  2W7O A;  1EYZ A;  3TW7 A;  4ED3 A;  2BQR A;  4O81 A;  5JUM A;  5IWA H;  3GTG A;  4BY7 G;  4MV1 A;  3BJY A;  2R92 A;  4A3M G;  2CZG A;  4EFB A;  1A48 A;  3G6Y A;  3TQT A;  2AGQ A;  1RJR A;  2BR0 A;  4QWA A;  2UVR A;  1V9P A;  4B3M H;  4EFE A;  2V4R A;  5KT6 A;  1I7N A;  3GTP A;  3WNZ A;  3HBL A;  3MJF A;  1G2W A;  3PR4 A;  3RBD A;  3T9D A;  2JEF A;  4B3S H;  5KFR A;  4UCR A;  3WWH A;  4CC6 A;  1OBD A;  2Q2U A;  1DV1 A;  4RNN A;  4MA5 A;  5BYA A;  1EUC B;  4MV3 A;  1A9X A;  4RAY A;  2HHF B;  2RDJ A;  1EUD B;  4O84 A;  3T5J A;  2FLL A;  4NLG A;  4NXM H;  4UCO A;  3CSW A;  5E25 A;  4QWD A;  1ET0 A;  2VOB A;  2F4V H;  2X5R A;  3T1H H;  3GJX B;  1KJ8 A;  3NBZ B;  4JUZ A;  2R93 A;  3HT5 A;  1N48 A;  4JV0 A;  1FKA H;  3FMA A;  4LFA H;  3JRW A;  3PZP A;  3RV4 A;  3RAX A;  1TWH A;  2OLS A;  4EEQ A;  4YB8 B;  1CKN A;  3HOZ G;  5IYZ F;  5CM0 A;  1I50 A;  2ABJ A;  2WTF A;  1EHI A;  3KYH C;  1XDN A;  2J9G A;  4AQY H;  1KBL A;  3R23 A;  5BPH A;  3J7A K;  4MV9 A;  4CC5 A;  4MV8 A;  4R8U B;  3W5O A;  4YR2 A;  2VA3 A;  4HNU A;  5BWR A;  4JYA H;  2V58 A;  2UUB H;  2EJ3 A;  4APM A;  1W93 A;  2W9B B;  4O4J F;  4DIM A;  4O2A F;  1GSA A;  3MR3 A;  5KG7 A;  2DPI A;  2MCT A;  5KT5 A;  3BAA A;  3RUP A;  3N44 B;  4UFZ A;  4FFL A;  2FP4 B;  1C30 A;  2JA7 A;  2ZDQ A;  2W8K A;  1K83 A;  3RB0 A;  5L1L A;  4RAZ A;  1DV2 A;  4Q4D A;  4O3N A;  4LSX A;  4LF4 H;  2WE6 A;  1CQI B;  1C3O A;  3AYH B;  1N32 H;  3JZ6 A;  4DL6 A;  2YZL A;  5KFN A;  4YP3 A;  2XCP A;  2JEI A;  4DV5 H;  3T7A A;  2CFM A;  2QB5 A;  3GB8 B;  3Q1K A;  4J9P A;  2CNV A;  4E6N A;  4IRC A;  4GC7 A;  5DQI A;  3M4I A;  2YL2 A;  5EDW A;  3GV7 B;  4RB2 C;  5CA1 F;  3KHH A;  1B6R A;  3MR5 A;  3DF7 A;  4O7T A;  4ZHQ F;  2XIG A;  4YQW A;  3ORQ A;  4O7V A;  5FPO A;  5JVD F;  4QWC A;  2VQF H;  3TQ1 A;  4EEY A;  4IRD A;  2JA8 G;  4IAJ A;  4XX0 B;  3HO8 A;  5D1O A;  4A3I G;  4A3D G;  4BBS G;  2BQ3 A;  4FS1 A;  4MV6 A;  5LMN H;  5LP6 F;  4JXU A;  5J2T F;  1VAJ A;  5KFU A;  1VBH A;  3N43 B;  5C3E G;  2EJ0 A;  4ED6 A;  1BXR A;  2CKZ B;  4QSH A;  4JI1 H;  4JV1 A;  2YYA A;  2JA5 A;  3WO0 A;  4ECS A;  4DR4 H;  2OWO A;  2RF4 A;  5C5J A;  4MAM A;  1E4E A;  2W6N A;  4K6N A;  3T9F A;  4I55 F;  4Q0Y A;  4DLK A;  4FE2 A;  1CKO A;  4ZOL F;  3PW7 A;  3QWU A;  3HOV G;  1GGO A;  4YJ2 F;  3HOW G;  3T9C A;  4J9R A;  3L2P A;  1DIK A;  1ZAU A;  5DLF A;  4ECX A;  4FBU A;  4LF8 H;  1XNR H;  3RR5 A;  3ORR A;  3R9R A;  4WD3 A;  2NU7 B;  1XMO H;  4MTE A;  2CW8 A;  4Q43 A;  5CE8 A;  5JVL A;  1W96 A;  2GPS A;  3BG5 A;  2M05 A;  4O82 A;  4IWX A;  4RB0 A;  2R85 A;  3TIG A;  2IBK A;  1JX4 A;  3K3P A;  2RGV A;  2E5L H;  4UCV A;  4I50 F;  5BWW A;  3BQ2 A;  3T5K A;  5FLM G;  4FFN A;  1RK5 A;  4FBT A;  3H40 A;  4DV3 H;  5IP9 G;  5KFQ A;  5GON F;  2W70 A;  4OX9 H;  3GID A;  1S03 G;  3G6X A; 
#chains in the Genus database with same CATH homology
 5KKN B;  5H80 A;  1IOW A;  3QFF A;  3ETJ A;  4MV4 A;  4C5A A;  3N6R A;  4YAJ B;  1CS0 A;  2R6F A;  3KAL A;  4MV7 A;  4EGJ A;  5HBR B;  4YBZ B;  3MWD A;  2W71 A;  2I87 A;  3WO1 A;  4IWY A;  3UFX B;  1JKJ B;  2I80 A;  2DLN A;  4XZ3 B;  1E4E B;  1UC9 A;  2FB9 A;  2GQR A;  1SCU B;  1ULZ A;  2W6Z A;  3K5I A;  2YZG A;  1AUX A;  4HNT A;  4EGQ A;  4O7W A;  2YZN A;  4O7R A;  3KAK A;  2SCU B;  4M9U A;  2R86 A;  4IHJ F;  5J2U F;  2PVP A;  2DIK A;  5C1O A;  5C1P A;  5CA0 F;  2NU8 B;  3U9S A;  1IOV A;  5JH7 F;  1JDB B;  2Z04 A;  2QF7 A;  3R5X A;  3MWE A;  2R7N A;  3VPC A;  2V5A A;  3R5F A;  4HNV A;  4FU0 A;  2FPP B;  4O7S A;  4IZO A;  4C5C A;  4EG0 A;  4FFR A;  1KJI A;  4MA0 A;  4IIJ F;  5LYJ F;  4ZI7 F;  1Z2O X;  2FPI B;  4TV9 F;  2XD4 A;  2GLT A;  2NU6 B;  1Z2N X;  3VA7 A;  2FPG B;  1CE8 A;  4O2B F;  3TII A;  4O7N A;  3LP8 A;  3JZI A;  2R7L A;  4O4I F;  4L1K A;  1Z2P X;  3V4Z A;  1B6S A;  2CNU A;  1GLV A;  2W6O A;  3TIN A;  5LXT F;  1AUV A;  2YS6 A;  5C8Y F;  4RZQ A;  3SE7 A;  2R84 A;  4TV8 F;  2YWV A;  3AX6 A;  3VOT A;  4O83 A;  1CQJ B;  2ZDH A;  4O7Y A;  3VMM A;  3RFC A;  1KJQ A;  5CB4 F;  3VPB A;  1KUT A;  1M0W A;  4E4T A;  2NUA B;  5KX5 F;  1GSH A;  2R87 A;  5HV6 A;  3VPD A;  4O86 A;  4XYM B;  2R7K A;  1EZ1 A;  2W6M A;  1I7L A;  3R5H A;  5JQG F;  5K2M A;  1KJJ A;  3V4S A;  4I4T F;  3G8D A;  1KJ9 A;  2IP4 A;  1JLL B;  3OUU A;  4FFM A;  5EZY F;  3Q2O A;  4FFP A;  1KEE A;  2GQS A;  1WR2 A;  2V59 A;  3NUA A;  5DMX A;  5JQW A;  1VBG A;  2YW2 A;  3K5H A;  2YS7 A;  2P0A A;  1BNC A;  2CNQ A;  2YZM A;  1JDE A;  3JRX A;  3RV3 A;  2Z02 A;  3I12 A;  2PN1 A;  3U54 A;  5LA6 F;  4O4L F;  2DWC A;  2VR1 A;  3E5N A;  5D8D A;  2PBZ A;  3U9T A;  4FFO A;  4ME6 A;  4Y8V B;  4YJ3 F;  1M6V A;  4HQ6 A;  2YRX A;  5CAE B;  1VKZ A;  2NU9 B;  2VPQ A;  4XYL B;  4HR7 A;  3GLK A;  3OUZ A;  3G8C A;  2I8C A;  3HB9 A;  2HGS A;  2W6P A;  4FGR A;  4O4H F;  2XCL A;  1PK8 A;  3TW6 A;  4NYE A;  2YRW A;  2HJW A;  5BMV F;  2R7M A;  2X0S A;  2W6Q A;  3KRE A;  5LOV F;  1T36 A;  1OBG A;  4O7Z A;  4ZQI A;  2QK4 A;  3KAJ A;  5FNV F;  3AW8 A;  1KC7 A;  1GSO A;  2ZDG A;  1UC8 A;  2R82 A;  4C5B A;  3ETH A;  2C00 A;  4YAK B;  2GPW A;  5I47 A;  2WYO A;  2CQY A;  1PX2 A;  1M0T A;  3N8D A;  3LWB A;  2DZD A;  2VQD A;  4WBN F;  4O7L A;  5BPF A;  4TUY F;  3U55 A;  3JZF A;  1EYZ A;  4O81 A;  4MV1 A;  2CZG A;  1A48 A;  3TQT A;  1I7N A;  3WNZ A;  3HBL A;  3MJF A;  1OBD A;  1DV1 A;  4MA5 A;  1EUC B;  4MV3 A;  1A9X A;  1EUD B;  4O84 A;  1KJ8 A;  3JRW A;  3RV4 A;  2OLS A;  4YB8 B;  5IYZ F;  1EHI A;  2J9G A;  1KBL A;  3R23 A;  5BPH A;  4MV9 A;  4MV8 A;  4HNU A;  2V58 A;  1W93 A;  4O4J F;  4DIM A;  4O2A F;  1GSA A;  3RUP A;  4FFL A;  2FP4 B;  1C30 A;  2ZDQ A;  1DV2 A;  1CQI B;  1C3O A;  2YZL A;  3Q1K A;  2CNV A;  2YL2 A;  5CA1 F;  1B6R A;  3DF7 A;  4O7T A;  4ZHQ F;  3ORQ A;  4O7V A;  5JVD F;  4XX0 B;  3HO8 A;  4MV6 A;  5LP6 F;  5J2T F;  1VBH A;  1BXR A;  4QSH A;  2YYA A;  3WO0 A;  4MAM A;  1E4E A;  2W6N A;  4I55 F;  4DLK A;  4FE2 A;  4ZOL F;  1GGO A;  4YJ2 F;  1DIK A;  3ORR A;  3R9R A;  4WD3 A;  2NU7 B;  5JVL A;  1W96 A;  2GPS A;  3BG5 A;  4O82 A;  4IWX A;  2R85 A;  3TIG A;  3K3P A;  4I50 F;  4FFN A;  5GON F;  2W70 A;  3GID A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...