4YB8B

Ca. korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 in complex with phosphate and adp
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
229
structure length
229
Chain Sequence
SSRDLLLKAKENGRKSLLEHEAKYFISSYGIPVTNIRLAKSEEEAVNFSREIGFPVVLKIVSPQVVHKSDVGGVKVNLRSEEEVRKAYREIIENVKRNVPNAEIEGILVQEFAPPGVELIIGLLRDPQFGPTVMFGLGGVFVELFRDVSFRVAPLSEQDAESMIKEVKAYKLLTGFRGMEPVDIEAIKDALIRAGRIGVENEEIAEMDLNPVIAYPKGIKVVDARIILR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Korarchaeum cryptofilum (strain opf8)
molecule tags Ligase
molecule keywords alpha subunit of Acyl-CoA synthetase (NDP forming)
total genus 70
structure length 229
sequence length 229
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13549 ATP-grasp_5 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4yb8B01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4yb8B02
2J9GA 4O7WA 4EG0A 1A9XA 2W6ZA 3V4ZA 1EUDB 4MV1A 5KX5F 3JZFA 3GLKA 2R7MA 4MV4A 2NUAB 1EZ1A 4IWXA 4TV8F 2YRXA 3VA7A 3KALA 4XYLB 5D8DA 3HBLA 4IHJF 4YJ3F 4I50F 4O81A 2R84A 4C5CA 3WNZA 3BG5A 1I7NA 2CNQA 3ORQA 2GQRA 2X0SA 5JVLA 3WO1A 3Q2OA 4YBZB 4WD3A 3TQTA 4HNTA 3KAKA 3VPCA 2IP4A 1C3OA 1CQIB 4YAKB 3TW6A 2FPPB 3AX6A 4NYEA 5K2MA 1KUTA 4MA5A 2VR1A 5CB4F 2I80A 2V5AA 4O7VA 1JLLB 1CE8A 1IOVA 2PVPA 2VQDA 2P0AA 3UFXB 1KJJA 1DIKA 4DLKA 2YL2A 4FFRA 4C5AA 2R7NA 3K5IA 1VBGA 2XCLA 3N8DA 4FFPA 5LOVF 2WYOA 3G8DA 5BPFA 3OUUA 4ZQIA 4O4HF 1IOWA 3Q1KA 3SE7A 5LYJF 5J2UF 3MWDA 3V4SA 3JZIA 2GPSA 2FB9A 2GPWA 4FFNA 1GGOA 2YRWA 1BNCA 1M6VA 5JQGF 5C1PA 1UC9A 2DWCA 4I4TF 4O2BF 3MJFA 4M9UA 3R9RA 1OBDA 4MV9A 1GSHA 1B6SA 2ZDQA 1OBGA 3VOTA 1EHIA 1M0TA 4FFOA 1VBHA 3NUAA 5HBRB 4O84A 3JRXA 2V58A 5LXTF 4YB8B 4O7LA 4O7ZA 5DMXA 1E4EA 3N6RA 3LP8A 5BMVF 3ETJA 2Z04A 2ZDGA 5C8YF 3VPBA 1KC7A 3K5HA 3VPDA 3RUPA 5CAEB 3TIGA 4MAMA 2R6FA 3QFFA 4ZI7F 4QSHA 1KJ8A 3JRWA 2W6OA 1B6RA 2YW2A 4EGQA 5JVDF 3E5NA 3WO0A 2YZGA 1KJIA 1DV2A 1BXRA 2YYAA 4MV7A 1W96A 3VMMA 1VKZA 2DIKA 5I47A 2HGSA 2YS7A 2W70A 2NU6B 4FU0A 4ME6A 3TINA 4DIMA 4FE2A 3ETHA 3KAJA 2YZNA 3KREA 1JDEA 1GLVA 2I8CA 3U9TA 5C1OA 3R5XA 1PX2A 3AW8A 4TUYF 3LWBA 2CNVA 2CZGA 4O4LF 2YZLA 4MV3A 3R5HA 2OLSA 4XYMB 2R85A 3TIIA 4FFMA 3R5FA 4YJ2F 2DLNA 1DV1A 2XD4A 4HNVA 3HB9A 3ORRA 5H80A 5IYZF 2QK4A 1GSOA 4O4IF 2CQYA 5CA0F 1SCUB 4HNUA 5HV6A 3HO8A 4O7TA 3I12A 2C00A 4O2AF 2GLTA 5FNVF 4HR7A 4XZ3B 3RFCA 1E4EB 1KJQA 4ZHQF 1WR2A 1A48A 3K3PA 1I7LA 2R7KA 2R86A 4O83A 4EGJA 1EYZA 5J2TF 1PK8A 5GONF 2PN1A 3G8CA 2YZMA 1M0WA 3R23A 1CS0A 5KKNB 2FPIB 4FGRA 2NU7B 1Z2OX 4IZOA 2SCUB 3GIDA 3DF7A 5LA6F 3OUZA 4MV6A 4XX0B 1UC8A 2DZDA 5BPHA 3RV4A 4YAJB 2QF7A 4O7RA 4TV9F 4O7NA 4ZOLF 2W6PA 4E4TA 4HQ6A 4L1KA 2PBZA 1AUVA 4C5BA 2R82A 3U54A 3U55A 2FPGB 2V59A 2R7LA 4FFLA 2GQSA 1Z2NX 4Y8VB 4RZQA 3RV3A 2YS6A 5JQWA 1C30A 4IWYA 2ZDHA 4O82A 1EUCB 2FP4B 4IIJF 5EZYF 1KBLA 4O86A 2W71A 4O7YA 2Z02A 4MA0A 5JH7F 4O7SA 1KJ9A 1Z2PX 1T36A 3U9SA 2NU9B 1AUXA 3MWEA 1KEEA 2W6MA 2I87A 1JKJB 5CA1F 2R87A 2W6QA 1CQJB 1GSAA 5LP6F 2HJWA 2W6NA 4O4JF 1JDBB 1W93A 4MV8A 2NU8B 2VPQA 1ULZA 4WBNF 2CNUA 2YWVA 4I55F
chains in the Genus database with same CATH superfamily
2J9GA 3CQZA 4O7WA 1IBMH 4EG0A 3HKZE 1DAAA 4JV0A 4LSAA 5IP9G 5IWAH 4A3EG 1S0OA 1E4GT 2OH2A 1ZAUA 1P8LA 4QWBA 4ED6A 2JA7G 4J9RA 2COIA 1A9XA 1CKOA 5K3WA 5KFDA 3NGDA 4JI6H 3QQMA 4YR0A 4UCSA 5HNEA 3EPGA 2W6ZA 4WHXA 3W1GA 4ECUA 3V4ZA 2V4RA 4QWAA 5L1LA 4JI7H 1EUDB 2HIXA 4MV1A 1I1LA 4Q4DA 4F4XA 4UCVA 1N33H 5KX5F 4J0MA 3TY5A 4CE5A 3GIPA 3PVXA 1VAJA 1XNQH 4C2MA 4AQYH 2Y0SA 1TWGA 2ALZA 1Y1WG 5KG4A 4PWQA 4LFAH 3JZFA 3GLKA 4GKJH 2R7MA 3HT5A 4MV4A 4YP3A 2NUAB 1EZ1A 3JZ6A 3G6VA 4IWXA 4DR6H 4J9LA 4TV8F 1N36H 2FLNA 4J9NA 4LFBH 2C2EA 5KFAA 1FVIA 4DL2A 2WB1A 3T54A 2YRXA 4AYBE 4A3IG 4KHPH 3VA7A 3KALA 3T1YH 4Q0YA 3RBEA 2ATLA 2Y4RA 4RAYA 4XYLB 1TWCA 5D8DA 4DRFA 1BGWA 2VOBA 3HBLA 4JI2H 4BXXG 5L1KA 4LF4H 2UVUA 4UUGA 4CMFA 2Q2UA 4IHJF 5C3EG 3M9NB 2FLPA 5DGHA 2ZM6H 4M7EA 4YJ3F 4LF9H 4RB1A 4RNNA 4CHIA 4M0JA 4I50F 1SEIA 2JEFA 4O81A 3T7AA 4O3NA 5KFEA 4CKCA 2R84A 2W57A 2R8IA 5DGIA 4C5CA 1CKMA 2YU9A 4EFEA 3WNZA 4Q8EA 3OHBA 3BG5A 2JEIA 1I7NA 2CNQA 4RB3C 2CW8A 4ED3A 2HGWA 2R93G 2ABJA 3ORQA 5BWUA 4QIWA 3RF2A 2GQRA 2X0SA 5I5YA 5JVLA 2UUCH 3WO1A 2AU0A 2HVQA 3Q2OA 5I5SA 2J6SA 4PZ7A 3PW2A 5CM0A 5BWWA 4ED7A 4YBZB 3GIJA 5C4XG 4WD3A 4DR1H 3RR5A 4NZMA 5I5XA 3Q8QB 3TQTA 2V4QA 4NZOA 1S9FA 5KG7A 3EPIA 4HNTA 5KFZA 2W9CA 3KAKA 3VPCA 2IP4A 5LMNH 4CKBA 1Y1VG 2JEJA 1MZBA 1C3OA 2UUAH 1A0GA 1UNNC 2HHFB 1CQIB 3JAMW 4ED1A 4YAKB 3GJXB 3J81W 4ECSA 3TW6A 2FPPB 4X62H 4PZ6A 1G2WA 3AX6A 4NYEA 1TWFA 3M9OB 2F4VH 5K2MA 2R7ZG 1S10A 1KUTA 4MA5A 2Q7DA 2ZJTA 1VS0A 4ED8A 1RJQA 2VR1A 5CB4F 2I80A 2V5AA 3GTMA 3NBZB 3HOWG 4TQSA 4O7VA 2XC9A 1JLLB 2FKLA 3QZ8A 3GILA 3RB0A 2C22A 4JYAH 2IMWP 3UZOA 1CE8A 3HOZG 1IOVA 2PVPA 4BWSC 4Q44A 1RK6A 2VQDA 3WWJA 2P0AA 2UVWA 1TA8A 4LF6H 3GTGA 2HIVA 4QJFA 3WWHA 1CKNB 4J9PA 2RDIA 3CEBA 4LMYA 5BWXA 1KJJA 3UFXB 4GKKH 4AYBA 1DIKA 2BQUA 5I60A 4DLKA 4F4YA 4IRDA 2YL2A 3DAAA 5KFTA 1TWAA 3EYYA 2JA5G 2UVVA 4JI3H 5D1OB 4FFRA 4C5AA 5IT9W 2R7NA 4ECTA 1RYRA 3K5IA 2FLLA 1VBGA 4O3QA 1AN7A 4DV5H 1IBKH 4JV1A 2XCLA 4IR9A 2VQFH 4JXUA 3T9BA 3SNOA 4R8UA 3PW7A 3N8DA 4FFPA 5LOVF 2WYOA 2WTFA 3G8DA 4IAJA 5IP7G 4RZRA 4ECVA 3LMLA 5BPFA 3OUUA 4ZQIA 3AYHB 2HHHH 4A3MG 2C2DA 4O4HF 1IOWA 3Q1KA 3BQ2A 4APMA 3SE7A 4LSXA 4EEYA 3GQCA 1ZETA 5LYJF 5J2UF 2PMZE 3MWDA 3V4SA 1RK5A 3F8NA 1X9NA 3JZIA 2GPSA 4DV3H 4UCRA 4LH6A 2VQEH 2FB9A 4LH7A 4DL7A 4A3JG 4UCOA 3S24A 2GPWA 4FFNA 2XGQA 3PO3G 1Y1WA 1GGOA 2YRWA 5DG8A 2CKZB 4DR4H 5DISC 4GC7A 4ECXA 1BNCA 4DUYH 1M6VA 4O3PA 1L2ZA 2AQ4A 3BA9A 4QW9A 2MCTA 1HR0H 2RGVA 4PZ8A 5JQGF 3N43B 5C1PA 4F4WA 3MFHA 1IYEA 4FS2A 3PR4A 1UC9A 4A3BG 2DWCA 4I4TF 3N6XA 4YR2A 1XNRH 4O2BF 3MJFA 1S68A 4M9UA 3R9RA 1OBDA 4ETSA 3RJ0A 4EBDA 3GTQA 4MV9A 1RJPA 4DL6A 4R7RA 1GSHA 5DG9A 3BABA 1B6SA 2ZDQA 1A0IA 1OBGA 3VOTA 1EHIA 3KHGA 1M0TA 3UQ8A 3FDSA 1XK5A 4U7CA 2KSWA 2XCAA 4U6PA 4PBCA 4ED2A 2WE6A 5FPOA 1V51A 4FFOA 1VBHA 3GV8B 3NUAA 5HBRB 1O75A 1ZQ7A 4ECRA 4CC6A 2ODTX 1S97A 4O84A 5IYBG 3HOUG 3MWMA 3JRXA 4I7HA 3GV7B 4BY7G 2V58A 4X64H 1N56A 5LXTF 4PDBA 2HG8A 4YB8B 4O7LA 2J6UA 4DL5A 2V9WA 5KFRA 2AGPA 3CVZA 4ECYA 4O7ZA 5DMXA 2XGPA 1E4EA 1I94H 2WAQE 3H4DA 3T9EA 5FPRA 3N6RA 3LP8A 4EEQA 3ETJA 5BMVF 2DPIA 3GIKA 5L1IA 2Z04A 3RGXA 1HNWH 1I50A 5FR9A 1T94A 1FJGH 2ZDGA 1R9TA 5C8YF 2JA8G 3HOYG 3T9AA 4QWEA 3VPBA 2PMZA 2EJ0A 3BQ1A 4DV4H 3W1BA 2W7OA 4DV6H 2W9CB 4DR5H 2R8GA 1KC7A 5C44G 1I2KA 2UXDH 3TEKA 3K5HA 2W9BB 2M05A 3RIZA 2JA6A 3VPDA 3RUPA 4LF7H 3OHAA 4O3RA 3HOXG 1EKVA 4LF5H 1J5EH 5CAEB 3TIGA 4MAMA 2FK3A 1I1MA 2R6FA 4EQ5A 2E5LH 3QFFA 4RB2C 1B33N 3RB3A 4HN2A 3UZBA 4ZI7F 4QSHA 1S03G 1KJ8A 3JRWA 4DV0H 3T5JA 2W6OA 4A2BA 1B6RA 2YW2A 5KFVA 4EGQA 3L2PA 1BJTA 3V6JA 4FS1A 5JVDF 4DL3A 3SI8A 3E5NA 2W7PA 4B3TH 3J7AK 3BACA 2FE3A 4QWDA 5L1JA 3WO0A 2YZGA 1KJIA 1DV2A 2DABA 2JA5A 1BXRA 5A2QW 2RDJA 3U0GA 3H20A 3OTOH 4CMDA 2YYAA 2R92G 3UYYA 4MV7A 4TVIA 3Q8PB 3HOVG 1W96A 3VMMA 5KT6A 2UUBH 1VKZA 2DIKA 4EYHB 2VUMG 5I47A 3KHHA 3OSNA 3NC0B 2HGSA 4A3DG 3H40A 2YS7A 1WSCA 5F9NA 5LL6b 5T14A 2W70A 4JI5H 3I4NG 4FBTA 1I1KA 1XMQH 2NU6B 4FU0A 2A1HA 1DGSA 3CSWA 5BYBA 4ME6A 2UXCH 3TINA 1JX4A 4EBEA 3OSPA 4DIMA 5KG0A 4JV2A 4FE2A 1RJRA 4B3SH 5L9XA 4DR2H 5EDWA 1SFOA 3TY8A 1P16A 4TM5A 2EJ2A 2C35B 3GIMA 5FLMG 3ETHA 4A3GG 3KAJA 4FM9A 2YZNA 3KREA 4YR3A 3T5HA 4BBRG 5KG2A 1JDEA 3C0FB 3RGZA 4B3MH 1GLVA 2I8CA 5BWVA 3IG0A 5C5JA 3U9TA 3GTJA 3TY9A 5C1OA 1XDNA 4J9QA 4F4ZA 3R5XA 1V4YA 3N44B 5FD5A 4YY3H 1N32H 1PX2A 5KG5A 3LQSA 1Y1VA 3AW8A 5KFSA 3N40P 5KFKA 4TUYF 3LWBA 4EBCA 4IRCA 4RAZA 5KT2A 2BR0A 3LULA 2CNVA 2CZGA 4UCUA 4QIWE 4ECQA 2JA6G 4O4LF 1HNXH 2EIYA 4UCTA 2BQ3A 2RF4A 4X65H 2J6TA 2YZLA 4MV3A 3R5HA 2OLSA 5IYDG 5BR8H 4QWCA 3G6XA 3GTPA 4XYMB 2CW7A 2R85A 2ASJA 3TIIA 4FFMA 2XIGA 5KFUA 4A3LG 3DTGA 5I5UA 3PN1A 3QWUA 4O3SA 3I4MG 5KG3A 3R5FA 3FMAA 3KYHC 2HVRA 4YJ2F 4A93G 3W5OA 1RYSA 3G6YA 2DLNA 2FK2A 5DGBA 4DV1H 5KFBA 4YHHH 2VA3A 1B04A 1DV1A 1V9PA 2XD4A 3TW7A 4IRKA 4HNVA 4DQNA 3HB9A 3ORRA 5H80A 2QYZA 5IYZF 3H4BA 2W9AA 2QK4A 1GSOA 4O4IF 2CQYA 3BQ0A 4JI1H 2E2IA 5CA0F 1SCUB 4HNUA 5HV6A 3KXYT 3GDEA 3RAXA 1A3GA 2JA7A 1EKPA 3HO8A 4O7TA 5KT7A 3MR5A 3I12A 2C00A 4NZNA 1WCMA 5KFWA 1K1SA 3RBDA 5IYCG 4GC6A 2FJZA 3Q8RB 3N41B 3V6HA 4O2AF 2GLTA 2FK1A 5FNVF 2VPSA 5DQHA 5KFHA 4LF8H 4JV5H 5KT5A 1IYDA 4HR7A 4XZ3B 2R8HA 1XMOH 5KT3A 1T3NA 2RGRA 3RFCA 1E4EB 1JXLA 3SGIA 4X66H 4RNMA 5KS8A 4DV2H 1KJQA 4ZHQF 1WR2A 4GLXA 3T9FA 4R8UB 4Q43A 3IN5A 2R8JA 1HNZH 4EFBA 4TQRA 1A48A 3JSLA 3K3PA 1I7LA 2R7KA 4YQWA 2R86A 4LFCH 5D1OA 4O83A 4MTEA 4EGJA 1EYZA 2COGA 2VA2A 5KG1A 4NXNH 2R7ZA 5J2TF 1PK8A 5GONF 2AGOA 2PN1A 2WDTA 3G8CA 2YZMA 1M0WA 3R23A 3VNNA 3QZ7A 5KFIA 4JUZA 4DR3H 5DLFA 3GTKA 2NVXA 3L4JA 5FD6A 3M4IA 4Q4CA 2ASLA 1CS0A 5KKNB 2FPIB 4FGRA 1I3QA 3MR2A 4J9KA 2NU7B 1Z2OX 4J9OA 4B3RH 4IZOA 2SCUB 3MR6A 3FKIG 1ET0A 3GIDA 2E2HA 4JI4H 3DF7A 1E4FT 3NBYB 5LA6F 2WB1E 5LMUH 2UXBH 5KFPA 5KFOA 2HDKA 3H0GG 2X5RA 2HVSA 2OWOA 3OUZA 1K83A 4MV6A 4XX0B 5KT4A 4K0KH 1UC8A 3PO2G 1I6UA 3GIQA 4Q45A 3GV5B 4RU9A 2DZDA 3PR5B 2R93A 5BPHA 4RUCA 2R8KA 3DTFA 3RV4A 2VUMA 3JSNA 4YAJB 1EKFA 4RUAA 2QF7A 2C2RA 4O7RA 2HHFA 1N34H 5BYAA 4OX9H 3V6KA 4TV9F 4O7NA 4ZOLF 4ED0A 2W6PA 3BJYA 4O3OA 4E4TA 5I5TA 4JI0H 4HQ6A 4L1KA 3L4KA 2PBZA 4CKEA 1AUVA 2B63G 5EWGA 4C5BA 1GYFA 2R82A 2EJ3A 5JUMA 2DAAA 3U54A 3U55A 1SYXB 1Y14B 3MR3A 4Q8FA 3GTLA 2FPGB 2V59A 2R7LA 4FFLA 1ZHQA 3T5LA 5KFJA 5FLXW 3PW4A 5F9LA 3J80W 2GQSA 2W8LA 2BQRA 2UVRA 1S0MA 4JI8H 3GTOA 2COJA 2ZGIA 3H0GA 5CR5A 2HGXA 4F50A 3RAQA 1Z2NX 2DPJA 4Y8VB 5KFYA 4DUZH 5KFCA 5BWRA 1TAEA 3GIIA 3PZPA 3T1HH 4A3FG 4RZQA 3BA8A 4HYKA 3PW0A 5D1PA 2R92A 3RV3A 5DAAA 3WWIA 2YS6A 5JQWA 3Q8SB 1C30A 1TWHA 1FKAH 2CFMA 2ZDHA 4IWYA 4O82A 4RCNA 2ASDA 3H3VH 2XCPA 2W8KA 1OWTA 1ZHSA 5EWFA 3GB8B 4J9MA 1EUCB 2FP4B 4IIJF 5EZYF 2FMAA 2C28A 1N48A 4G3IA 2O03A 5KFQA 4ECWA 4E6NA 2WAQA 4A2AA 2B63A 1KBLA 4O86A 4RNOA 3PW5A 3RB6A 4GLWA 2Q2TA 1M7JA 2W71A 5E25A 4O7YA 3RTXA 2Z02A 4DL4A 4MA0A 5JH7F 4RB0A 4J9SA 4O7SA 4UFZA 3T9CA 1KJ9A 1Z2PX 1T36A 4DAAA 1IBLH 3U9SA 3T9DA 4FBUA 4NLGA 2QB5A 3N42B 5KFFA 2JEGA 2NU9B 3KTMA 1K1QA 1AUXA 3MWEA 2VUGA 1GO3E 3RB4A 2W9BA 1JIHA 1KEEA 5FJ8G 2YCHA 1WCMG 5I5VA 2W6MA 4DV7H 2Y0SE 4A3KG 5KFNA 2I87A 1JKJB 5DQIA 1KT8A 5CA1F 2R87A 2W6QA 1CQJB 2NVYA 1GSAA 3TQ1A 3HXLA 3K3VA 3PFFA 5I5WA 1S0NA 2IBKA 5LP6F 2HJWA 1KTAA 2W6NA 2IA6A 5EOYA 4O4JF 3MFIA 3M9MB 1JDBB 4QW8A 3KHRA 4IR1A 1CKNA 4EYIB 1W93A 3BAAA 1I2LA 3KHLA 4A3CG 4MV8A 1WRVA 2UU9H 4DR7H 5KG6A 2NU8B 3HKZA 5KFLA 5KFGA 4MTDA 5DGAA 5DLGA 5EWEA 4ECZA 4NXMH 3T5KA 2VPQA 1ULZA 4BBSG 5KFMA 3FKIA 5DQGA 3T99A 5CE8A 1WH2A 2AGQA 5DG7A 4WBNF 4K6NA 5KFXA 2CNUA 4BY1G 2YWVA 5BWTA 4CC5A 4I55F
chains in the Genus database with same CATH topology
2J9GA 4O7WA 4EG0A 1A9XA 2W6ZA 3V4ZA 1EUDB 4MV1A 5KX5F 3JZFA 3GLKA 2R7MA 4MV4A 2NUAB 1EZ1A 4IWXA 4TV8F 2YRXA 3VA7A 3KALA 4XYLB 5D8DA 3HBLA 4IHJF 4YJ3F 4I50F 4O81A 2R84A 4C5CA 3WNZA 3BG5A 1I7NA 2CNQA 3ORQA 2GQRA 2X0SA 5JVLA 3WO1A 3Q2OA 4YBZB 4WD3A 3TQTA 4HNTA 3KAKA 3VPCA 2IP4A 1C3OA 1CQIB 4YAKB 3TW6A 2FPPB 3AX6A 4NYEA 5K2MA 1KUTA 4MA5A 2VR1A 5CB4F 2I80A 2V5AA 4O7VA 1JLLB 1CE8A 1IOVA 2PVPA 2VQDA 2P0AA 3UFXB 1KJJA 1DIKA 4DLKA 2YL2A 4FFRA 4C5AA 2R7NA 3K5IA 1VBGA 2XCLA 3N8DA 4FFPA 5LOVF 2WYOA 3G8DA 5BPFA 3OUUA 4ZQIA 4O4HF 1IOWA 3Q1KA 3SE7A 5LYJF 5J2UF 3MWDA 3V4SA 3JZIA 2GPSA 2FB9A 2GPWA 4FFNA 1GGOA 2YRWA 1BNCA 1M6VA 5JQGF 5C1PA 1UC9A 2DWCA 4I4TF 4O2BF 3MJFA 4M9UA 3R9RA 1OBDA 4MV9A 1GSHA 1B6SA 2ZDQA 1OBGA 3VOTA 1EHIA 1M0TA 4FFOA 1VBHA 3NUAA 5HBRB 4O84A 3JRXA 2V58A 5LXTF 4YB8B 4O7LA 4O7ZA 5DMXA 1E4EA 3N6RA 3LP8A 5BMVF 3ETJA 2Z04A 2ZDGA 5C8YF 3VPBA 1KC7A 3K5HA 3VPDA 3RUPA 5CAEB 3TIGA 4MAMA 2R6FA 3QFFA 4ZI7F 4QSHA 1KJ8A 3JRWA 2W6OA 1B6RA 2YW2A 4EGQA 5JVDF 3E5NA 3WO0A 2YZGA 1KJIA 1DV2A 1BXRA 2YYAA 4MV7A 1W96A 3VMMA 1VKZA 2DIKA 5I47A 2HGSA 2YS7A 2W70A 2NU6B 4FU0A 4ME6A 3TINA 4DIMA 4FE2A 3ETHA 3KAJA 2YZNA 3KREA 1JDEA 1GLVA 2I8CA 3U9TA 5C1OA 3R5XA 1PX2A 3AW8A 4TUYF 3LWBA 2CNVA 2CZGA 4O4LF 2YZLA 4MV3A 3R5HA 2OLSA 4XYMB 2R85A 3TIIA 4FFMA 3R5FA 4YJ2F 2DLNA 1DV1A 2XD4A 4HNVA 3HB9A 3ORRA 5H80A 5IYZF 2QK4A 1GSOA 4O4IF 2CQYA 5CA0F 1SCUB 4HNUA 5HV6A 3HO8A 4O7TA 3I12A 2C00A 4O2AF 2GLTA 5FNVF 4HR7A 4XZ3B 3RFCA 1E4EB 1KJQA 4ZHQF 1WR2A 1A48A 3K3PA 1I7LA 2R7KA 2R86A 4O83A 4EGJA 1EYZA 5J2TF 1PK8A 5GONF 2PN1A 3G8CA 2YZMA 1M0WA 3R23A 1CS0A 5KKNB 2FPIB 4FGRA 2NU7B 1Z2OX 4IZOA 2SCUB 3GIDA 3DF7A 5LA6F 3OUZA 4MV6A 4XX0B 1UC8A 2DZDA 5BPHA 3RV4A 4YAJB 2QF7A 4O7RA 4TV9F 4O7NA 4ZOLF 2W6PA 4E4TA 4HQ6A 4L1KA 2PBZA 1AUVA 4C5BA 2R82A 3U54A 3U55A 2FPGB 2V59A 2R7LA 4FFLA 2GQSA 1Z2NX 4Y8VB 4RZQA 3RV3A 2YS6A 5JQWA 1C30A 4IWYA 2ZDHA 4O82A 1EUCB 2FP4B 4IIJF 5EZYF 1KBLA 4O86A 2W71A 4O7YA 2Z02A 4MA0A 5JH7F 4O7SA 1KJ9A 1Z2PX 1T36A 3U9SA 2NU9B 1AUXA 3MWEA 1KEEA 2W6MA 2I87A 1JKJB 5CA1F 2R87A 2W6QA 1CQJB 1GSAA 5LP6F 2HJWA 2W6NA 4O4JF 1JDBB 1W93A 4MV8A 2NU8B 2VPQA 1ULZA 4WBNF 2CNUA 2YWVA 4I55F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J9G A;  4O7W A;  4EG0 A;  1A9X A;  2W6Z A;  3V4Z A;  1EUD B;  4MV1 A;  5KX5 F;  3JZF A;  3GLK A;  2R7M A;  4MV4 A;  2NUA B;  1EZ1 A;  4IWX A;  4TV8 F;  2YRX A;  3VA7 A;  3KAL A;  4XYL B;  5D8D A;  3HBL A;  4IHJ F;  4YJ3 F;  4I50 F;  4O81 A;  2R84 A;  4C5C A;  3WNZ A;  3BG5 A;  1I7N A;  2CNQ A;  3ORQ A;  2GQR A;  2X0S A;  5JVL A;  3WO1 A;  3Q2O A;  4YBZ B;  4WD3 A;  3TQT A;  4HNT A;  3KAK A;  3VPC A;  2IP4 A;  1C3O A;  1CQI B;  4YAK B;  3TW6 A;  2FPP B;  3AX6 A;  4NYE A;  5K2M A;  1KUT A;  4MA5 A;  2VR1 A;  5CB4 F;  2I80 A;  2V5A A;  4O7V A;  1JLL B;  1CE8 A;  1IOV A;  2PVP A;  2VQD A;  2P0A A;  3UFX B;  1KJJ A;  1DIK A;  4DLK A;  2YL2 A;  4FFR A;  4C5A A;  2R7N A;  3K5I A;  1VBG A;  2XCL A;  3N8D A;  4FFP A;  5LOV F;  2WYO A;  3G8D A;  5BPF A;  3OUU A;  4ZQI A;  4O4H F;  1IOW A;  3Q1K A;  3SE7 A;  5LYJ F;  5J2U F;  3MWD A;  3V4S A;  3JZI A;  2GPS A;  2FB9 A;  2GPW A;  4FFN A;  1GGO A;  2YRW A;  1BNC A;  1M6V A;  5JQG F;  5C1P A;  1UC9 A;  2DWC A;  4I4T F;  4O2B F;  3MJF A;  4M9U A;  3R9R A;  1OBD A;  4MV9 A;  1GSH A;  1B6S A;  2ZDQ A;  1OBG A;  3VOT A;  1EHI A;  1M0T A;  4FFO A;  1VBH A;  3NUA A;  5HBR B;  4O84 A;  3JRX A;  2V58 A;  5LXT F;  4YB8 B;  4O7L A;  4O7Z A;  5DMX A;  1E4E A;  3N6R A;  3LP8 A;  5BMV F;  3ETJ A;  2Z04 A;  2ZDG A;  5C8Y F;  3VPB A;  1KC7 A;  3K5H A;  3VPD A;  3RUP A;  5CAE B;  3TIG A;  4MAM A;  2R6F A;  3QFF A;  4ZI7 F;  4QSH A;  1KJ8 A;  3JRW A;  2W6O A;  1B6R A;  2YW2 A;  4EGQ A;  5JVD F;  3E5N A;  3WO0 A;  2YZG A;  1KJI A;  1DV2 A;  1BXR A;  2YYA A;  4MV7 A;  1W96 A;  3VMM A;  1VKZ A;  2DIK A;  5I47 A;  2HGS A;  2YS7 A;  2W70 A;  2NU6 B;  4FU0 A;  4ME6 A;  3TIN A;  4DIM A;  4FE2 A;  3ETH A;  3KAJ A;  2YZN A;  3KRE A;  1JDE A;  1GLV A;  2I8C A;  3U9T A;  5C1O A;  3R5X A;  1PX2 A;  3AW8 A;  4TUY F;  3LWB A;  2CNV A;  2CZG A;  4O4L F;  2YZL A;  4MV3 A;  3R5H A;  2OLS A;  4XYM B;  2R85 A;  3TII A;  4FFM A;  3R5F A;  4YJ2 F;  2DLN A;  1DV1 A;  2XD4 A;  4HNV A;  3HB9 A;  3ORR A;  5H80 A;  5IYZ F;  2QK4 A;  1GSO A;  4O4I F;  2CQY A;  5CA0 F;  1SCU B;  4HNU A;  5HV6 A;  3HO8 A;  4O7T A;  3I12 A;  2C00 A;  4O2A F;  2GLT A;  5FNV F;  4HR7 A;  4XZ3 B;  3RFC A;  1E4E B;  1KJQ A;  4ZHQ F;  1WR2 A;  1A48 A;  3K3P A;  1I7L A;  2R7K A;  2R86 A;  4O83 A;  4EGJ A;  1EYZ A;  5J2T F;  1PK8 A;  5GON F;  2PN1 A;  3G8C A;  2YZM A;  1M0W A;  3R23 A;  1CS0 A;  5KKN B;  2FPI B;  4FGR A;  2NU7 B;  1Z2O X;  4IZO A;  2SCU B;  3GID A;  3DF7 A;  5LA6 F;  3OUZ A;  4MV6 A;  4XX0 B;  1UC8 A;  2DZD A;  5BPH A;  3RV4 A;  4YAJ B;  2QF7 A;  4O7R A;  4TV9 F;  4O7N A;  4ZOL F;  2W6P A;  4E4T A;  4HQ6 A;  4L1K A;  2PBZ A;  1AUV A;  4C5B A;  2R82 A;  3U54 A;  3U55 A;  2FPG B;  2V59 A;  2R7L A;  4FFL A;  2GQS A;  1Z2N X;  4Y8V B;  4RZQ A;  3RV3 A;  2YS6 A;  5JQW A;  1C30 A;  4IWY A;  2ZDH A;  4O82 A;  1EUC B;  2FP4 B;  4IIJ F;  5EZY F;  1KBL A;  4O86 A;  2W71 A;  4O7Y A;  2Z02 A;  4MA0 A;  5JH7 F;  4O7S A;  1KJ9 A;  1Z2P X;  1T36 A;  3U9S A;  2NU9 B;  1AUX A;  3MWE A;  1KEE A;  2W6M A;  2I87 A;  1JKJ B;  5CA1 F;  2R87 A;  2W6Q A;  1CQJ B;  1GSA A;  5LP6 F;  2HJW A;  2W6N A;  4O4J F;  1JDB B;  1W93 A;  4MV8 A;  2NU8 B;  2VPQ A;  1ULZ A;  4WBN F;  2CNU A;  2YWV A;  4I55 F; 
#chains in the Genus database with same CATH topology
 2J9G A;  3CQZ A;  4O7W A;  1IBM H;  4EG0 A;  3HKZ E;  1DAA A;  4JV0 A;  4LSA A;  5IP9 G;  5IWA H;  4A3E G;  1S0O A;  1E4G T;  2OH2 A;  1ZAU A;  1P8L A;  4QWB A;  4ED6 A;  2JA7 G;  4J9R A;  2COI A;  1A9X A;  1CKO A;  5K3W A;  5KFD A;  3NGD A;  4JI6 H;  3QQM A;  4YR0 A;  4UCS A;  5HNE A;  3EPG A;  2W6Z A;  4WHX A;  3W1G A;  4ECU A;  3V4Z A;  2V4R A;  4QWA A;  5L1L A;  4JI7 H;  1EUD B;  2HIX A;  4MV1 A;  1I1L A;  4Q4D A;  4F4X A;  4UCV A;  1N33 H;  5KX5 F;  4J0M A;  3TY5 A;  4CE5 A;  3GIP A;  3PVX A;  1VAJ A;  1XNQ H;  4C2M A;  4AQY H;  2Y0S A;  1TWG A;  2ALZ A;  1Y1W G;  5KG4 A;  4PWQ A;  4LFA H;  3JZF A;  3GLK A;  4GKJ H;  2R7M A;  3HT5 A;  4MV4 A;  4YP3 A;  2NUA B;  1EZ1 A;  3JZ6 A;  3G6V A;  4IWX A;  4DR6 H;  4J9L A;  4TV8 F;  1N36 H;  2FLN A;  4J9N A;  4LFB H;  2C2E A;  5KFA A;  1FVI A;  4DL2 A;  2WB1 A;  3T54 A;  2YRX A;  4AYB E;  4A3I G;  4KHP H;  3VA7 A;  3KAL A;  3T1Y H;  4Q0Y A;  3RBE A;  2ATL A;  2Y4R A;  4RAY A;  4XYL B;  1TWC A;  5D8D A;  4DRF A;  1BGW A;  2VOB A;  3HBL A;  4JI2 H;  4BXX G;  5L1K A;  4LF4 H;  2UVU A;  4UUG A;  4CMF A;  2Q2U A;  4IHJ F;  5C3E G;  3M9N B;  2FLP A;  5DGH A;  2ZM6 H;  4M7E A;  4YJ3 F;  4LF9 H;  4RB1 A;  4RNN A;  4CHI A;  4M0J A;  4I50 F;  1SEI A;  2JEF A;  4O81 A;  3T7A A;  4O3N A;  5KFE A;  4CKC A;  2R84 A;  2W57 A;  2R8I A;  5DGI A;  4C5C A;  1CKM A;  2YU9 A;  4EFE A;  3WNZ A;  4Q8E A;  3OHB A;  3BG5 A;  2JEI A;  1I7N A;  2CNQ A;  4RB3 C;  2CW8 A;  4ED3 A;  2HGW A;  2R93 G;  2ABJ A;  3ORQ A;  5BWU A;  4QIW A;  3RF2 A;  2GQR A;  2X0S A;  5I5Y A;  5JVL A;  2UUC H;  3WO1 A;  2AU0 A;  2HVQ A;  3Q2O A;  5I5S A;  2J6S A;  4PZ7 A;  3PW2 A;  5CM0 A;  5BWW A;  4ED7 A;  4YBZ B;  3GIJ A;  5C4X G;  4WD3 A;  4DR1 H;  3RR5 A;  4NZM A;  5I5X A;  3Q8Q B;  3TQT A;  2V4Q A;  4NZO A;  1S9F A;  5KG7 A;  3EPI A;  4HNT A;  5KFZ A;  2W9C A;  3KAK A;  3VPC A;  2IP4 A;  5LMN H;  4CKB A;  1Y1V G;  2JEJ A;  1MZB A;  1C3O A;  2UUA H;  1A0G A;  1UNN C;  2HHF B;  1CQI B;  3JAM W;  4ED1 A;  4YAK B;  3GJX B;  3J81 W;  4ECS A;  3TW6 A;  2FPP B;  4X62 H;  4PZ6 A;  1G2W A;  3AX6 A;  4NYE A;  1TWF A;  3M9O B;  2F4V H;  5K2M A;  2R7Z G;  1S10 A;  1KUT A;  4MA5 A;  2Q7D A;  2ZJT A;  1VS0 A;  4ED8 A;  1RJQ A;  2VR1 A;  5CB4 F;  2I80 A;  2V5A A;  3GTM A;  3NBZ B;  3HOW G;  4TQS A;  4O7V A;  2XC9 A;  1JLL B;  2FKL A;  3QZ8 A;  3GIL A;  3RB0 A;  2C22 A;  4JYA H;  2IMW P;  3UZO A;  1CE8 A;  3HOZ G;  1IOV A;  2PVP A;  4BWS C;  4Q44 A;  1RK6 A;  2VQD A;  3WWJ A;  2P0A A;  2UVW A;  1TA8 A;  4LF6 H;  3GTG A;  2HIV A;  4QJF A;  3WWH A;  1CKN B;  4J9P A;  2RDI A;  3CEB A;  4LMY A;  5BWX A;  1KJJ A;  3UFX B;  4GKK H;  4AYB A;  1DIK A;  2BQU A;  5I60 A;  4DLK A;  4F4Y A;  4IRD A;  2YL2 A;  3DAA A;  5KFT A;  1TWA A;  3EYY A;  2JA5 G;  2UVV A;  4JI3 H;  5D1O B;  4FFR A;  4C5A A;  5IT9 W;  2R7N A;  4ECT A;  1RYR A;  3K5I A;  2FLL A;  1VBG A;  4O3Q A;  1AN7 A;  4DV5 H;  1IBK H;  4JV1 A;  2XCL A;  4IR9 A;  2VQF H;  4JXU A;  3T9B A;  3SNO A;  4R8U A;  3PW7 A;  3N8D A;  4FFP A;  5LOV F;  2WYO A;  2WTF A;  3G8D A;  4IAJ A;  5IP7 G;  4RZR A;  4ECV A;  3LML A;  5BPF A;  3OUU A;  4ZQI A;  3AYH B;  2HHH H;  4A3M G;  2C2D A;  4O4H F;  1IOW A;  3Q1K A;  3BQ2 A;  4APM A;  3SE7 A;  4LSX A;  4EEY A;  3GQC A;  1ZET A;  5LYJ F;  5J2U F;  2PMZ E;  3MWD A;  3V4S A;  1RK5 A;  3F8N A;  1X9N A;  3JZI A;  2GPS A;  4DV3 H;  4UCR A;  4LH6 A;  2VQE H;  2FB9 A;  4LH7 A;  4DL7 A;  4A3J G;  4UCO A;  3S24 A;  2GPW A;  4FFN A;  2XGQ A;  3PO3 G;  1Y1W A;  1GGO A;  2YRW A;  5DG8 A;  2CKZ B;  4DR4 H;  5DIS C;  4GC7 A;  4ECX A;  1BNC A;  4DUY H;  1M6V A;  4O3P A;  1L2Z A;  2AQ4 A;  3BA9 A;  4QW9 A;  2MCT A;  1HR0 H;  2RGV A;  4PZ8 A;  5JQG F;  3N43 B;  5C1P A;  4F4W A;  3MFH A;  1IYE A;  4FS2 A;  3PR4 A;  1UC9 A;  4A3B G;  2DWC A;  4I4T F;  3N6X A;  4YR2 A;  1XNR H;  4O2B F;  3MJF A;  1S68 A;  4M9U A;  3R9R A;  1OBD A;  4ETS A;  3RJ0 A;  4EBD A;  3GTQ A;  4MV9 A;  1RJP A;  4DL6 A;  4R7R A;  1GSH A;  5DG9 A;  3BAB A;  1B6S A;  2ZDQ A;  1A0I A;  1OBG A;  3VOT A;  1EHI A;  3KHG A;  1M0T A;  3UQ8 A;  3FDS A;  1XK5 A;  4U7C A;  2KSW A;  2XCA A;  4U6P A;  4PBC A;  4ED2 A;  2WE6 A;  5FPO A;  1V51 A;  4FFO A;  1VBH A;  3GV8 B;  3NUA A;  5HBR B;  1O75 A;  1ZQ7 A;  4ECR A;  4CC6 A;  2ODT X;  1S97 A;  4O84 A;  5IYB G;  3HOU G;  3MWM A;  3JRX A;  4I7H A;  3GV7 B;  4BY7 G;  2V58 A;  4X64 H;  1N56 A;  5LXT F;  4PDB A;  2HG8 A;  4YB8 B;  4O7L A;  2J6U A;  4DL5 A;  2V9W A;  5KFR A;  2AGP A;  3CVZ A;  4ECY A;  4O7Z A;  5DMX A;  2XGP A;  1E4E A;  1I94 H;  2WAQ E;  3H4D A;  3T9E A;  5FPR A;  3N6R A;  3LP8 A;  4EEQ A;  3ETJ A;  5BMV F;  2DPI A;  3GIK A;  5L1I A;  2Z04 A;  3RGX A;  1HNW H;  1I50 A;  5FR9 A;  1T94 A;  1FJG H;  2ZDG A;  1R9T A;  5C8Y F;  2JA8 G;  3HOY G;  3T9A A;  4QWE A;  3VPB A;  2PMZ A;  2EJ0 A;  3BQ1 A;  4DV4 H;  3W1B A;  2W7O A;  4DV6 H;  2W9C B;  4DR5 H;  2R8G A;  1KC7 A;  5C44 G;  1I2K A;  2UXD H;  3TEK A;  3K5H A;  2W9B B;  2M05 A;  3RIZ A;  2JA6 A;  3VPD A;  3RUP A;  4LF7 H;  3OHA A;  4O3R A;  3HOX G;  1EKV A;  4LF5 H;  1J5E H;  5CAE B;  3TIG A;  4MAM A;  2FK3 A;  1I1M A;  2R6F A;  4EQ5 A;  2E5L H;  3QFF A;  4RB2 C;  1B33 N;  3RB3 A;  4HN2 A;  3UZB A;  4ZI7 F;  4QSH A;  1S03 G;  1KJ8 A;  3JRW A;  4DV0 H;  3T5J A;  2W6O A;  4A2B A;  1B6R A;  2YW2 A;  5KFV A;  4EGQ A;  3L2P A;  1BJT A;  3V6J A;  4FS1 A;  5JVD F;  4DL3 A;  3SI8 A;  3E5N A;  2W7P A;  4B3T H;  3J7A K;  3BAC A;  2FE3 A;  4QWD A;  5L1J A;  3WO0 A;  2YZG A;  1KJI A;  1DV2 A;  2DAB A;  2JA5 A;  1BXR A;  5A2Q W;  2RDJ A;  3U0G A;  3H20 A;  3OTO H;  4CMD A;  2YYA A;  2R92 G;  3UYY A;  4MV7 A;  4TVI A;  3Q8P B;  3HOV G;  1W96 A;  3VMM A;  5KT6 A;  2UUB H;  1VKZ A;  2DIK A;  4EYH B;  2VUM G;  5I47 A;  3KHH A;  3OSN A;  3NC0 B;  2HGS A;  4A3D G;  3H40 A;  2YS7 A;  1WSC A;  5F9N A;  5LL6 b;  5T14 A;  2W70 A;  4JI5 H;  3I4N G;  4FBT A;  1I1K A;  1XMQ H;  2NU6 B;  4FU0 A;  2A1H A;  1DGS A;  3CSW A;  5BYB A;  4ME6 A;  2UXC H;  3TIN A;  1JX4 A;  4EBE A;  3OSP A;  4DIM A;  5KG0 A;  4JV2 A;  4FE2 A;  1RJR A;  4B3S H;  5L9X A;  4DR2 H;  5EDW A;  1SFO A;  3TY8 A;  1P16 A;  4TM5 A;  2EJ2 A;  2C35 B;  3GIM A;  5FLM G;  3ETH A;  4A3G G;  3KAJ A;  4FM9 A;  2YZN A;  3KRE A;  4YR3 A;  3T5H A;  4BBR G;  5KG2 A;  1JDE A;  3C0F B;  3RGZ A;  4B3M H;  1GLV A;  2I8C A;  5BWV A;  3IG0 A;  5C5J A;  3U9T A;  3GTJ A;  3TY9 A;  5C1O A;  1XDN A;  4J9Q A;  4F4Z A;  3R5X A;  1V4Y A;  3N44 B;  5FD5 A;  4YY3 H;  1N32 H;  1PX2 A;  5KG5 A;  3LQS A;  1Y1V A;  3AW8 A;  5KFS A;  3N40 P;  5KFK A;  4TUY F;  3LWB A;  4EBC A;  4IRC A;  4RAZ A;  5KT2 A;  2BR0 A;  3LUL A;  2CNV A;  2CZG A;  4UCU A;  4QIW E;  4ECQ A;  2JA6 G;  4O4L F;  1HNX H;  2EIY A;  4UCT A;  2BQ3 A;  2RF4 A;  4X65 H;  2J6T A;  2YZL A;  4MV3 A;  3R5H A;  2OLS A;  5IYD G;  5BR8 H;  4QWC A;  3G6X A;  3GTP A;  4XYM B;  2CW7 A;  2R85 A;  2ASJ A;  3TII A;  4FFM A;  2XIG A;  5KFU A;  4A3L G;  3DTG A;  5I5U A;  3PN1 A;  3QWU A;  4O3S A;  3I4M G;  5KG3 A;  3R5F A;  3FMA A;  3KYH C;  2HVR A;  4YJ2 F;  4A93 G;  3W5O A;  1RYS A;  3G6Y A;  2DLN A;  2FK2 A;  5DGB A;  4DV1 H;  5KFB A;  4YHH H;  2VA3 A;  1B04 A;  1DV1 A;  1V9P A;  2XD4 A;  3TW7 A;  4IRK A;  4HNV A;  4DQN A;  3HB9 A;  3ORR A;  5H80 A;  2QYZ A;  5IYZ F;  3H4B A;  2W9A A;  2QK4 A;  1GSO A;  4O4I F;  2CQY A;  3BQ0 A;  4JI1 H;  2E2I A;  5CA0 F;  1SCU B;  4HNU A;  5HV6 A;  3KXY T;  3GDE A;  3RAX A;  1A3G A;  2JA7 A;  1EKP A;  3HO8 A;  4O7T A;  5KT7 A;  3MR5 A;  3I12 A;  2C00 A;  4NZN A;  1WCM A;  5KFW A;  1K1S A;  3RBD A;  5IYC G;  4GC6 A;  2FJZ A;  3Q8R B;  3N41 B;  3V6H A;  4O2A F;  2GLT A;  2FK1 A;  5FNV F;  2VPS A;  5DQH A;  5KFH A;  4LF8 H;  4JV5 H;  5KT5 A;  1IYD A;  4HR7 A;  4XZ3 B;  2R8H A;  1XMO H;  5KT3 A;  1T3N A;  2RGR A;  3RFC A;  1E4E B;  1JXL A;  3SGI A;  4X66 H;  4RNM A;  5KS8 A;  4DV2 H;  1KJQ A;  4ZHQ F;  1WR2 A;  4GLX A;  3T9F A;  4R8U B;  4Q43 A;  3IN5 A;  2R8J A;  1HNZ H;  4EFB A;  4TQR A;  1A48 A;  3JSL A;  3K3P A;  1I7L A;  2R7K A;  4YQW A;  2R86 A;  4LFC H;  5D1O A;  4O83 A;  4MTE A;  4EGJ A;  1EYZ A;  2COG A;  2VA2 A;  5KG1 A;  4NXN H;  2R7Z A;  5J2T F;  1PK8 A;  5GON F;  2AGO A;  2PN1 A;  2WDT A;  3G8C A;  2YZM A;  1M0W A;  3R23 A;  3VNN A;  3QZ7 A;  5KFI A;  4JUZ A;  4DR3 H;  5DLF A;  3GTK A;  2NVX A;  3L4J A;  5FD6 A;  3M4I A;  4Q4C A;  2ASL A;  1CS0 A;  5KKN B;  2FPI B;  4FGR A;  1I3Q A;  3MR2 A;  4J9K A;  2NU7 B;  1Z2O X;  4J9O A;  4B3R H;  4IZO A;  2SCU B;  3MR6 A;  3FKI G;  1ET0 A;  3GID A;  2E2H A;  4JI4 H;  3DF7 A;  1E4F T;  3NBY B;  5LA6 F;  2WB1 E;  5LMU H;  2UXB H;  5KFP A;  5KFO A;  2HDK A;  3H0G G;  2X5R A;  2HVS A;  2OWO A;  3OUZ A;  1K83 A;  4MV6 A;  4XX0 B;  5KT4 A;  4K0K H;  1UC8 A;  3PO2 G;  1I6U A;  3GIQ A;  4Q45 A;  3GV5 B;  4RU9 A;  2DZD A;  3PR5 B;  2R93 A;  5BPH A;  4RUC A;  2R8K A;  3DTF A;  3RV4 A;  2VUM A;  3JSN A;  4YAJ B;  1EKF A;  4RUA A;  2QF7 A;  2C2R A;  4O7R A;  2HHF A;  1N34 H;  5BYA A;  4OX9 H;  3V6K A;  4TV9 F;  4O7N A;  4ZOL F;  4ED0 A;  2W6P A;  3BJY A;  4O3O A;  4E4T A;  5I5T A;  4JI0 H;  4HQ6 A;  4L1K A;  3L4K A;  2PBZ A;  4CKE A;  1AUV A;  2B63 G;  5EWG A;  4C5B A;  1GYF A;  2R82 A;  2EJ3 A;  5JUM A;  2DAA A;  3U54 A;  3U55 A;  1SYX B;  1Y14 B;  3MR3 A;  4Q8F A;  3GTL A;  2FPG B;  2V59 A;  2R7L A;  4FFL A;  1ZHQ A;  3T5L A;  5KFJ A;  5FLX W;  3PW4 A;  5F9L A;  3J80 W;  2GQS A;  2W8L A;  2BQR A;  2UVR A;  1S0M A;  4JI8 H;  3GTO A;  2COJ A;  2ZGI A;  3H0G A;  5CR5 A;  2HGX A;  4F50 A;  3RAQ A;  1Z2N X;  2DPJ A;  4Y8V B;  5KFY A;  4DUZ H;  5KFC A;  5BWR A;  1TAE A;  3GII A;  3PZP A;  3T1H H;  4A3F G;  4RZQ A;  3BA8 A;  4HYK A;  3PW0 A;  5D1P A;  2R92 A;  3RV3 A;  5DAA A;  3WWI A;  2YS6 A;  5JQW A;  3Q8S B;  1C30 A;  1TWH A;  1FKA H;  2CFM A;  2ZDH A;  4IWY A;  4O82 A;  4RCN A;  2ASD A;  3H3V H;  2XCP A;  2W8K A;  1OWT A;  1ZHS A;  5EWF A;  3GB8 B;  4J9M A;  1EUC B;  2FP4 B;  4IIJ F;  5EZY F;  2FMA A;  2C28 A;  1N48 A;  4G3I A;  2O03 A;  5KFQ A;  4ECW A;  4E6N A;  2WAQ A;  4A2A A;  2B63 A;  1KBL A;  4O86 A;  4RNO A;  3PW5 A;  3RB6 A;  4GLW A;  2Q2T A;  1M7J A;  2W71 A;  5E25 A;  4O7Y A;  3RTX A;  2Z02 A;  4DL4 A;  4MA0 A;  5JH7 F;  4RB0 A;  4J9S A;  4O7S A;  4UFZ A;  3T9C A;  1KJ9 A;  1Z2P X;  1T36 A;  4DAA A;  1IBL H;  3U9S A;  3T9D A;  4FBU A;  4NLG A;  2QB5 A;  3N42 B;  5KFF A;  2JEG A;  2NU9 B;  3KTM A;  1K1Q A;  1AUX A;  3MWE A;  2VUG A;  1GO3 E;  3RB4 A;  2W9B A;  1JIH A;  1KEE A;  5FJ8 G;  2YCH A;  1WCM G;  5I5V A;  2W6M A;  4DV7 H;  2Y0S E;  4A3K G;  5KFN A;  2I87 A;  1JKJ B;  5DQI A;  1KT8 A;  5CA1 F;  2R87 A;  2W6Q A;  1CQJ B;  2NVY A;  1GSA A;  3TQ1 A;  3HXL A;  3K3V A;  3PFF A;  5I5W A;  1S0N A;  2IBK A;  5LP6 F;  2HJW A;  1KTA A;  2W6N A;  2IA6 A;  5EOY A;  4O4J F;  3MFI A;  3M9M B;  1JDB B;  4QW8 A;  3KHR A;  4IR1 A;  1CKN A;  4EYI B;  1W93 A;  3BAA A;  1I2L A;  3KHL A;  4A3C G;  4MV8 A;  1WRV A;  2UU9 H;  4DR7 H;  5KG6 A;  2NU8 B;  3HKZ A;  5KFL A;  5KFG A;  4MTD A;  5DGA A;  5DLG A;  5EWE A;  4ECZ A;  4NXM H;  3T5K A;  2VPQ A;  1ULZ A;  4BBS G;  5KFM A;  3FKI A;  5DQG A;  3T99 A;  5CE8 A;  1WH2 A;  2AGQ A;  5DG7 A;  4WBN F;  4K6N A;  5KFX A;  2CNU A;  4BY1 G;  2YWV A;  5BWT A;  4CC5 A;  4I55 F; 
#chains in the Genus database with same CATH homology
 2J9G A;  4O7W A;  4EG0 A;  1A9X A;  2W6Z A;  3V4Z A;  1EUD B;  4MV1 A;  5KX5 F;  3JZF A;  3GLK A;  2R7M A;  4MV4 A;  2NUA B;  1EZ1 A;  4IWX A;  4TV8 F;  2YRX A;  3VA7 A;  3KAL A;  4XYL B;  5D8D A;  3HBL A;  4IHJ F;  4YJ3 F;  4I50 F;  4O81 A;  2R84 A;  4C5C A;  3WNZ A;  3BG5 A;  1I7N A;  2CNQ A;  3ORQ A;  2GQR A;  2X0S A;  5JVL A;  3WO1 A;  3Q2O A;  4YBZ B;  4WD3 A;  3TQT A;  4HNT A;  3KAK A;  3VPC A;  2IP4 A;  1C3O A;  1CQI B;  4YAK B;  3TW6 A;  2FPP B;  3AX6 A;  4NYE A;  5K2M A;  1KUT A;  4MA5 A;  2VR1 A;  5CB4 F;  2I80 A;  2V5A A;  4O7V A;  1JLL B;  1CE8 A;  1IOV A;  2PVP A;  2VQD A;  2P0A A;  3UFX B;  1KJJ A;  1DIK A;  4DLK A;  2YL2 A;  4FFR A;  4C5A A;  2R7N A;  3K5I A;  1VBG A;  2XCL A;  3N8D A;  4FFP A;  5LOV F;  2WYO A;  3G8D A;  5BPF A;  3OUU A;  4ZQI A;  4O4H F;  1IOW A;  3Q1K A;  3SE7 A;  5LYJ F;  5J2U F;  3MWD A;  3V4S A;  3JZI A;  2GPS A;  2FB9 A;  2GPW A;  4FFN A;  1GGO A;  2YRW A;  1BNC A;  1M6V A;  5JQG F;  5C1P A;  1UC9 A;  2DWC A;  4I4T F;  4O2B F;  3MJF A;  4M9U A;  3R9R A;  1OBD A;  4MV9 A;  1GSH A;  1B6S A;  2ZDQ A;  1OBG A;  3VOT A;  1EHI A;  1M0T A;  4FFO A;  1VBH A;  3NUA A;  5HBR B;  4O84 A;  3JRX A;  2V58 A;  5LXT F;  4YB8 B;  4O7L A;  4O7Z A;  5DMX A;  1E4E A;  3N6R A;  3LP8 A;  5BMV F;  3ETJ A;  2Z04 A;  2ZDG A;  5C8Y F;  3VPB A;  1KC7 A;  3K5H A;  3VPD A;  3RUP A;  5CAE B;  3TIG A;  4MAM A;  2R6F A;  3QFF A;  4ZI7 F;  4QSH A;  1KJ8 A;  3JRW A;  2W6O A;  1B6R A;  2YW2 A;  4EGQ A;  5JVD F;  3E5N A;  3WO0 A;  2YZG A;  1KJI A;  1DV2 A;  1BXR A;  2YYA A;  4MV7 A;  1W96 A;  3VMM A;  1VKZ A;  2DIK A;  5I47 A;  2HGS A;  2YS7 A;  2W70 A;  2NU6 B;  4FU0 A;  4ME6 A;  3TIN A;  4DIM A;  4FE2 A;  3ETH A;  3KAJ A;  2YZN A;  3KRE A;  1JDE A;  1GLV A;  2I8C A;  3U9T A;  5C1O A;  3R5X A;  1PX2 A;  3AW8 A;  4TUY F;  3LWB A;  2CNV A;  2CZG A;  4O4L F;  2YZL A;  4MV3 A;  3R5H A;  2OLS A;  4XYM B;  2R85 A;  3TII A;  4FFM A;  3R5F A;  4YJ2 F;  2DLN A;  1DV1 A;  2XD4 A;  4HNV A;  3HB9 A;  3ORR A;  5H80 A;  5IYZ F;  2QK4 A;  1GSO A;  4O4I F;  2CQY A;  5CA0 F;  1SCU B;  4HNU A;  5HV6 A;  3HO8 A;  4O7T A;  3I12 A;  2C00 A;  4O2A F;  2GLT A;  5FNV F;  4HR7 A;  4XZ3 B;  3RFC A;  1E4E B;  1KJQ A;  4ZHQ F;  1WR2 A;  1A48 A;  3K3P A;  1I7L A;  2R7K A;  2R86 A;  4O83 A;  4EGJ A;  1EYZ A;  5J2T F;  1PK8 A;  5GON F;  2PN1 A;  3G8C A;  2YZM A;  1M0W A;  3R23 A;  1CS0 A;  5KKN B;  2FPI B;  4FGR A;  2NU7 B;  1Z2O X;  4IZO A;  2SCU B;  3GID A;  3DF7 A;  5LA6 F;  3OUZ A;  4MV6 A;  4XX0 B;  1UC8 A;  2DZD A;  5BPH A;  3RV4 A;  4YAJ B;  2QF7 A;  4O7R A;  4TV9 F;  4O7N A;  4ZOL F;  2W6P A;  4E4T A;  4HQ6 A;  4L1K A;  2PBZ A;  1AUV A;  4C5B A;  2R82 A;  3U54 A;  3U55 A;  2FPG B;  2V59 A;  2R7L A;  4FFL A;  2GQS A;  1Z2N X;  4Y8V B;  4RZQ A;  3RV3 A;  2YS6 A;  5JQW A;  1C30 A;  4IWY A;  2ZDH A;  4O82 A;  1EUC B;  2FP4 B;  4IIJ F;  5EZY F;  1KBL A;  4O86 A;  2W71 A;  4O7Y A;  2Z02 A;  4MA0 A;  5JH7 F;  4O7S A;  1KJ9 A;  1Z2P X;  1T36 A;  3U9S A;  2NU9 B;  1AUX A;  3MWE A;  1KEE A;  2W6M A;  2I87 A;  1JKJ B;  5CA1 F;  2R87 A;  2W6Q A;  1CQJ B;  1GSA A;  5LP6 F;  2HJW A;  2W6N A;  4O4J F;  1JDB B;  1W93 A;  4MV8 A;  2NU8 B;  2VPQ A;  1ULZ A;  4WBN F;  2CNU A;  2YWV A;  4I55 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...