4YB8B

Ca. korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 in complex with phosphate and adp
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
229
structure length
229
Chain Sequence
SSRDLLLKAKENGRKSLLEHEAKYFISSYGIPVTNIRLAKSEEEAVNFSREIGFPVVLKIVSPQVVHKSDVGGVKVNLRSEEEVRKAYREIIENVKRNVPNAEIEGILVQEFAPPGVELIIGLLRDPQFGPTVMFGLGGVFVELFRDVSFRVAPLSEQDAESMIKEVKAYKLLTGFRGMEPVDIEAIKDALIRAGRIGVENEEIAEMDLNPVIAYPKGIKVVDARIILR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha subunit of Acyl-CoA synthetase (NDP forming)
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Korarchaeum cryptofilum (strain opf8)
molecule tags Ligase
total genus 70
structure length 229
sequence length 229
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13549 ATP-grasp_5 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4yb8B01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4yb8B02
3Q1KA 4Y8VB 1KC7A 3VOTA 5FNVF 2ZDHA 5BMVF 1GSHA 5EZYF 2GPSA 5JQWA 3HBLA 3JZFA 4FFOA 1W96A 2NU7B 1VKZA 2VR1A 2FP4B 5J2UF 1KEEA 1AUVA 1T36A 2GQRA 3HB9A 1GSAA 1W93A 3E5NA 3KAJA 4O7LA 4XZ3B 2FPIB 3VMMA 2IP4A 2I87A 3VPCA 2YZGA 4IWYA 2QF7A 3DF7A 3R5FA 2C00A 2PBZA 1A48A 4WD3A 2NUAB 4O4HF 4ME6A 5DMXA 2W6MA 2W70A 3VA7A 4IWXA 3R5XA 4YAKB 3GIDA 1EZ1A 4ZOLF 1IOVA 1GSOA 4L1KA 5GONF 2W6OA 2YW2A 3GLKA 4YBZB 1B6RA 1KJJA 1CQJB 4IZOA 2NU6B 4FGRA 1PK8A 1IOWA 3AW8A 3MWEA 4HNUA 4XYLB 5C8YF 3HO8A 4O4IF 5BPHA 3KREA 2Z04A 1UC9A 1ULZA 2GPWA 4MAMA 4FFNA 5LA6F 2YWVA 2PN1A 2CNUA 2VQDA 3U55A 2YL2A 4C5CA 2Z02A 5LXTF 1CQIB 3VPDA 1GGOA 3SE7A 2CNQA 1Z2OX 3TIIA 4MA0A 2FPGB 2YZLA 2R6FA 3TQTA 5HBRB 2W6NA 5JVLA 4FFMA 5K2MA 4O83A 2R82A 4XYMB 4MV9A 2R87A 2I80A 4TV9F 5D8DA 3OUZA 2W6ZA 5CB4F 4M9UA 5IYZF 5C1OA 4O86A 2FPPB 2SCUB 2R7KA 3R5HA 1C3OA 3V4SA 5CAEB 4HQ6A 3ETHA 4O4JF 1M6VA 4IHJF 3KAKA 1CS0A 5C1PA 1DIKA 2W71A 3WO1A 1PX2A 1B6SA 1GLVA 2V59A 4MV1A 3G8DA 3MJFA 1DV1A 2YYAA 4ZQIA 5LP6F 4TUYF 3U9SA 3LWBA 1I7NA 3R9RA 4EGJA 4I55F 4YJ2F 4I50F 3WO0A 5LOVF 4O7SA 4O7NA 5KX5F 5J2TF 4MV7A 1EYZA 2PVPA 1I7LA 3BG5A 3UFXB 4MV8A 4MA5A 1C30A 2XD4A 4O7VA 4NYEA 1A9XA 2VPQA 1BNCA 3K5IA 2CQYA 3JRWA 3N8DA 1Z2NX 2YZMA 4O7WA 3U9TA 4C5BA 2DLNA 1E4EB 2CNVA 1M0TA 3WNZA 5JH7F 4O7ZA 3N6RA 4O4LF 3K5HA 1JLLB 4HNTA 4O2BF 2I8CA 4E4TA 2R7NA 5JQGF 3VPBA 2QK4A 4FFRA 2X0SA 1DV2A 4DLKA 5LYJF 2DZDA 3TW6A 2GQSA 2WYOA 1WR2A 4QSHA 2XCLA 1Z2PX 1JKJB 3R23A 2V5AA 3QFFA 3U54A 3I12A 4I4TF 4YB8B 5BPFA 2J9GA 5CA0F 3OUUA 1CE8A 2R7LA 2NU9B 2OLSA 5KKNB 4C5AA 3JZIA 1KJQA 1AUXA 3ORQA 3ORRA 4O7YA 1EUDB 1JDEA 4MV4A 2DIKA 3LP8A 4FE2A 4O82A 5HV6A 3ETJA 2R7MA 3Q2OA 4EGQA 5I47A 2P0AA 4YAJB 2NU8B 4MV3A 4EG0A 3RV4A 1EHIA 2GLTA 1KUTA 4FU0A 2DWCA 3RUPA 3NUAA 2HJWA 2YZNA 3G8CA 2ZDQA 1VBGA 2R84A 1KJ8A 3MWDA 1OBDA 4WBNF 4O2AF 4XX0B 1KJIA 4IIJF 3KALA 1UC8A 2W6QA 4RZQA 4ZHQF 1VBHA 4O7RA 2CZGA 4FFPA 4O84A 1EUCB 2YS6A 1M0WA 2YRXA 3RFCA 4O81A 4HR7A 3K3PA 2V58A 5H80A 2YRWA 3AX6A 4MV6A 2R86A 4TV8F 3TINA 4YJ3F 5JVDF 2R85A 4DIMA 1KJ9A 4ZI7F 3JRXA 1KBLA 4HNVA 5CA1F 2ZDGA 1OBGA 2FB9A 4O7TA 1SCUB 3V4ZA 4FFLA 1JDBB 1E4EA 3TIGA 1BXRA 2HGSA 2W6PA 2YS7A 3RV3A
chains in the Genus database with same CATH superfamily
3SGIA 3Q1KA 1TAEA 2DAAA 4Y8VB 3T9AA 4PWQA 1KC7A 1JXLA 1FKAH 4JV0A 3DTFA 3VOTA 4LFCH 1L2ZA 5FNVF 1FVIA 2HHFA 2ZDHA 2HDKA 5I5SA 5BMVF 5IYDG 1GSHA 5HNEA 1SFOA 4HN2A 3V6HA 4UCUA 3F8NA 1V4YA 4RB1A 3KHHA 4LSAA 3MFIA 1XMQH 1TWGA 1RYRA 2JA7A 5I5XA 2HVQA 4CKBA 5EZYF 2GPSA 4QWEA 4Q43A 5JQWA 3G6XA 3QQMA 3BQ1A 1WCMA 3HBLA 2AGPA 3AYHB 1O75A 2JEIA 4RZRA 5KFNA 2XGQA 3GTQA 3JZFA 4FFOA 2JA7G 4PZ7A 1IBMH 2AGQA 4CE5A 2J6TA 4NLGA 4EFEA 1WSCA 1W96A 5KT2A 4X65H 5C44G 1S0OA 2NU7B 3CEBA 3HT5A 1WCMG 3OHAA 4O3PA 4LF4H 3FDSA 1VKZA 4NXMH 4BXXG 2VR1A 4DUZH 4YY3H 4IRKA 4ETSA 3GTMA 2FP4B 5J2UF 3RR5A 2W9CA 4A93G 4DL3A 1KEEA 1AUVA 1T36A 2COGA 3GIQA 2GQRA 5KG0A 4AYBA 4DL5A 3RBDA 2BR0A 1N56A 3GTKA 2JA5A 3HB9A 3IG0A 1GSAA 3PW0A 4A3FG 1W93A 2DABA 3E5NA 3BQ0A 1IBKH 2XCAA 2QB5A 3GIKA 3KAJA 1ET0A 1N32H 3T9BA 4A3IG 1I3QA 3N43B 1ZAUA 4O7LA 4XZ3B 3RTXA 5D1OA 4F4YA 4GKJH 3HOUG 2JA5G 2FPIB 4QIWA 3VMMA 2E5LH 2IP4A 3CVZA 4RUCA 5DGAA 2I87A 3VPCA 2XIGA 2YZGA 2J6UA 1XNRH 4IWYA 3H4DA 2QF7A 5I60A 3DF7A 5KG3A 3TY8A 3LMLA 3R5FA 4DL2A 4LF9H 2ASJA 4J9NA 4BWSC 2C00A 2PBZA 3T99A 3GDEA 1A48A 2JEJA 2WAQE 5LL6b 3T1YH 5KFEA 4WD3A 2NUAB 1A0GA 4GLWA 4J9SA 3RB4A 3UZOA 3PFFA 3CSWA 4ME6A 4O4HF 3MFHA 5DMXA 2UUAH 2W6MA 4UUGA 1WH2A 2W70A 3VA7A 4IWXA 4QWAA 3R5XA 5L1LA 3KXYT 4YAKB 1K1QA 3GIDA 2A1HA 4QWDA 2WTFA 2R92A 1EZ1A 1VS0A 4GKKH 2C2DA 4PZ6A 5K3WA 4ZOLF 5BWTA 5T14A 1IOVA 2Q7DA 2FLLA 5LMUH 1GSOA 4L1KA 4RB2C 5GONF 2W6OA 2YW2A 3GLKA 3JSLA 4YBZB 5DQHA 4IRCA 3JAMW 2V4QA 3EPGA 1B6RA 4ECVA 1A0IA 4ED0A 2R92G 1KJJA 1CQJB 4A3CG 4IZOA 3KHLA 2NU6B 4IRDA 4Q45A 5IP9G 4FGRA 4GC6A 4ED6A 1PK8A 4WHXA 4RU9A 4DR5H 5KFYA 2VPSA 5FPOA 2ATLA 2IA6A 1IOWA 3H0GG 3AW8A 3KYHC 3MWEA 4CC5A 1EKVA 4HNUA 2FMAA 4XYLB 1S0NA 5C8YF 3HO8A 4O4IF 4QWCA 3GILA 4DL6A 4G3IA 4Q0YA 4DR6H 3RGZA 3S24A 5BPHA 3KREA 2KSWA 4R8UB 3BABA 2Z04A 5FJ8G 4FS2A 5KT5A 4YHHH 3T5JA 1UC9A 2R8IA 3WWJA 2WB1E 2V4RA 1EKPA 1ULZA 2GPWA 4NZOA 4MAMA 4FFNA 4UCOA 5LA6F 2YWVA 3VNNA 1V9PA 4DV6H 2FJZA 2PN1A 4AYBE 3V6KA 1XK5A 4LF8H 2UXDH 2CNUA 5KFSA 4J9RA 4HYKA 2VQDA 1MZBA 4NZMA 4NZNA 3U55A 2YL2A 4C5CA 2Z02A 5LXTF 1CQIB 1J5EH 1TWHA 4QJFA 3Q8QB 2C28A 2R8GA 3VPDA 1GGOA 3EPIA 4MTEA 4LF6H 5KG7A 4ECYA 4QIWE 4CMFA 1TWAA 3SE7A 2CW7A 2UUBH 2CNQA 1Z2OX 3MR2A 3TIIA 2HHFB 2FK3A 2UVUA 3TW7A 3IN5A 4MA0A 5IP7G 3HOZG 2OWOA 5FR9A 2FPGB 3RGXA 5IYCG 2YZLA 2R6FA 2RGVA 5KFRA 4YR3A 1RYSA 3TQTA 5HBRB 2W6NA 2W57A 2EJ3A 5E25A 4ECUA 4JI1H 4OX9H 2R93A 2VQEH 5C3EG 3HXLA 4YR2A 5JVLA 2VA3A 5DGIA 4FFMA 5K2MA 3W1GA 5BWWA 2FK2A 1CKOA 3NGDA 3GB8B 3JSNA 4O83A 2R82A 4DAAA 3QZ8A 2RDIA 4XYMB 1T3NA 2F4VH 4X64H 4MV9A 2R87A 2I80A 2O03A 2W9BA 2C2EA 2R8HA 4TV9F 5D8DA 5I5VA 2COIA 1N48A 4FBUA 4M0JA 3GIPA 2C2RA 3OUZA 2W6ZA 5CB4F 2W9CB 3PW5A 1KT8A 4ED8A 2AGOA 2UXCH 4TQRA 3NBYB 4M9UA 5IYZF 5C1OA 4O86A 2FPPB 3M9NB 3G6VA 4DR3H 4E6NA 4Q8EA 2SCUB 2UXBH 3FKIG 5IYBG 4TM5A 3W5OA 3LQSA 4BY7G 3KHRA 2R7KA 3R5HA 5CR5A 5D1OB 1C3OA 4FS1A 3V4SA 5KG5A 2W8LA 5CAEB 2NVXA 2JA6A 4HQ6A 1BGWA 3ETHA 4O4JF 2WDTA 4RNNA 1M6VA 4UCTA 4IHJF 4LMYA 3KAKA 1ZHSA 5KFVA 4J0MA 4JI0H 1CS0A 3MR5A 4DV2H 2JA6G 4ED2A 5C1PA 4DR4H 1DIKA 5JUMA 2W71A 4M7EA 1JX4A 2RF4A 3WO1A 1E4FT 5KFOA 4CHIA 1PX2A 1B6SA 1GLVA 4DRFA 3HKZA 4RAYA 2V59A 3RF2A 5KFWA 1ZETA 4MV1A 4GLXA 3H20A 4JUZA 4A2BA 5KG4A 3G8DA 5EDWA 5I5WA 2HHHH 3RB3A 2EIYA 4U7CA 4ECWA 3MJFA 4CMDA 1DV1A 3GTGA 5KFUA 2YYAA 2RGRA 4QW8A 3C0FB 3T5HA 3T9CA 1I1LA 3N42B 3J7AK 2R8KA 5BYBA 1I50A 1Y1VA 4JI6H 1I6UA 4ZQIA 3FMAA 5KG6A 3GV8B 2VQFH 5LP6F 3PR4A 5DQGA 3T7AA 4TUYF 3UZBA 4QWBA 3K3VA 1Y1VG 2YCHA 3U9SA 1S0MA 4K0KH 4DV4H 1FJGH 1SEIA 3GIIA 2UVRA 4NXNH 4Q4DA 4J9LA 5BR8H 3LWBA 4RAZA 5FLMG 4TQSA 1I7NA 3DTGA 3R9RA 4I55F 1P16A 4EGJA 3BQ2A 4YJ2F 2R8JA 4I50F 1GO3E 3PVXA 3WO0A 1K1SA 5LOVF 3N6XA 4O7SA 4O7NA 3RB6A 2DPJA 5BWVA 3PR5B 5KX5F 4C2MA 5J2TF 3WWIA 5KFPA 3PW4A 4A3DG 4EEQA 4MV7A 1EYZA 5DG7A 1N36H 4A3EG 2PVPA 4A3GG 5FLXW 1I7LA 3BG5A 3UFXB 3H0GA 5I5TA 2PMZA 1RJRA 4ECXA 2VUMA 2W8KA 2ZGIA 3PW7A 2HGWA 4A3LG 2J6SA 4MV8A 5DLGA 4MA5A 4GC7A 4RUAA 3L2PA 5KFJA 1N33H 1WRVA 4BY1G 1C30A 4EYHB 1S9FA 2VUMG 2XD4A 4O7VA 5KT3A 4NYEA 2W7OA 2HVRA 3NBZB 1A9XA 1UNNC 2VPQA 1BNCA 3K5IA 4PZ8A 2FK1A 5KFKA 2CQYA 3M4IA 3JRWA 3T5LA 4LH6A 3N8DA 1Z2NX 2YZMA 2CW8A 1I1KA 4O7WA 2QYZA 2VA2A 2ZJTA 4LSXA 4A2AA 3T1HH 4JV2A 4A3MG 5FD5A 3U9TA 2WE6A 4F4XA 2UU9H 2BQRA 3BA8A 5D1PA 2DLNA 4C5BA 1E4EB 4RNOA 4JV1A 4EBEA 3BJYA 3U0GA 2CNVA 1TA8A 3QWUA 4DR7H 5C5JA 4IR9A 3HKZE 5EOYA 1M0TA 1HNZH 4EBCA 4PBCA 5KFGA 3WNZA 3WWHA 5JH7F 4O7ZA 3N6RA 4O4LF 2XCPA 5L1IA 3K5HA 5BWXA 5I5UA 5KT4A 1JLLB 1HNXH 4B3MH 4FBTA 4LFAH 4HNTA 2AQ4A 4O2BF 2I8CA 2Q2TA 4F4ZA 2CFMA 4UCSA 3GTLA 4E4TA 3TY5A 2FKLA 2R7NA 3RAQA 4JI5H 5JQGF 3OHBA 3VPBA 3DAAA 2QK4A 3N41B 4YP3A 4FFRA 3V6JA 3MR3A 2COJA 5CE8A 1G2WA 3RB0A 2Q2UA 4EEYA 4B3RH 2X0SA 1DV2A 3GJXB 1IYEA 4DLKA 4DL7A 5LYJF 4JI8H 2DZDA 3TW6A 1CKNA 2GQSA 1M7JA 5F9LA 3PO2G 2VUGA 4J9KA 4O3SA 2WYOA 4A3JG 1WR2A 4X62H 4QSHA 2NVYA 3I4MG 2XCLA 3T9FA 3FKIA 2ABJA 1Z2PX 1JKJB 4EBDA 4F50A 3R23A 5EWFA 5KFAA 3UQ8A 5IWAH 1S68A 2V5AA 3QFFA 4ECRA 4IR1A 4EQ5A 3U54A 3BA9A 2MCTA 3I12A 4I4TF 2FLPA 3BACA 3KTMA 1N34H 4YB8B 2PMZE 5BPFA 4CC6A 2J9GA 5CA0F 5KG2A 3T9DA 3GIJA 3OUUA 2BQUA 5IT9W 4ED1A 5KFBA 3GV7B 3HOXG 1CE8A 2R7LA 3H40A 1I2LA 2NU9B 2FLNA 2OLSA 3HOWG 1P8LA 5KKNB 3RJ0A 4C5AA 2JEGA 2UUCH 3JZIA 1KJQA 2JEFA 4APMA 3GTJA 5KT7A 2M05A 1OWTA 2HIVA 3T5KA 2DPIA 4ECSA 2BQ3A 1A3GA 1AUXA 5KG1A 5KFIA 4DQNA 3ORQA 3ORRA 2C35B 4JXUA 4O7YA 5L9XA 4DL4A 4BBSG 4PDBA 4KHPH 1EUDB 1TWFA 5EWEA 2XC9A 1DAAA 4DUYH 4JI2H 1EKFA 1JDEA 4MV4A 5A2QW 2B63A 3N40P 4DV7H 3LULA 4A3BG 2ZM6H 5DGBA 5EWGA 2DIKA 3TEKA 4JI7H 5KS8A 3GQCA 4CKCA 3LP8A 3J80W 4JV5H 4FE2A 2RDJA 1GYFA 5DLFA 2V9WA 2B63G 1XDNA 4O3QA 2WB1A 4O82A 5HV6A 3ETJA 2FE3A 1BJTA 4YQWA 3T54A 2R7MA 3Q2OA 4EGQA 5I47A 1RK5A 1KTAA 2ODTX 2P0AA 4YAJB 5BWUA 5DAAA 2HVSA 1TWCA 2CKZB 1HR0H 4JI4H 3CQZA 2JA8G 2NU8B 3HOVG 4MV3A 5KT6A 4EG0A 4J9OA 2ASDA 3RIZA 3RV4A 1E4GT 1EHIA 3UYYA 2GLTA 4EYIB 5KFDA 4FM9A 2HGXA 1KUTA 5DG9A 4RB3C 2E2IA 4FU0A 4A3KG 2DWCA 4YR0A 2X5RA 3HOYG 3RUPA 4LH7A 3Q8SB 4F4WA 3SI8A 1XNQH 4LFBH 3GTPA 1ZQ7A 1VAJA 2IBKA 3NUAA 1CKMA 1SYXB 4IAJA 2Y0SA 4MTDA 2UVVA 2W9AA 3SNOA 2HJWA 2YZNA 3G8CA 3TY9A 2ZDQA 5DISC 1Y14B 1VBGA 4DV3H 3RAXA 2R84A 2EJ2A 1KJ8A 3MWDA 3KHGA 1OBDA 4WBNF 4CKEA 3GV5B 3M9OB 5FPRA 2R7ZA 1R9TA 3JZ6A 3MR6A 1B33N 4O2AF 4JYAH 4XX0B 4ECTA 1KJIA 1I2KA 4O3OA 4IIJF 3KALA 4UCVA 3QZ7A 1UC8A 2W6QA 4RZQA 2AU0A 2R7ZG 4ECZA 1IYDA 2ASLA 3G6YA 4ZHQF 5KFZA 5I5YA 1I1MA 1VBHA 3OSPA 2YU9A 4O7RA 5C4XG 4TVIA 2CZGA 2ALZA 4BBRG 4UCRA 1S03G 4FFPA 5CM0A 3BAAA 4O84A 3EYYA 4LF5H 5KFCA 3M9MB 5DG8A 4ED3A 3Q8RB 3H4BA 1EUCB 2YS6A 1M0WA 5L1KA 2YRXA 3RFCA 4U6PA 3GTOA 4K6NA 1X9NA 3PW2A 5KFMA 1K83A 4O81A 3J81W 4O3RA 2E2HA 4HR7A 5DQIA 3T9EA 1B04A 3W1BA 3K3PA 2VOBA 2V58A 4RB0A 5KFHA 5H80A 2YRWA 1CKNB 3NC0B 3AX6A 4O3NA 4MV6A 5KFLA 2W9BB 2R86A 4EFBA 1RJQA 4I7HA 1Y1WA 4TV8F 3Q8PB 3PO3G 4AQYH 1RK6A 3TINA 3OTOH 4YJ3F 1ZHQA 3GIMA 5JVDF 1AN7A 4R7RA 4Q44A 3N44B 4J9MA 4Q4CA 2R85A 4RCNA 1JIHA 1DGSA 4DR2H 2IMWP 1Y1WG 4RNMA 4DIMA 2R93G 4DV0H 1S97A 1KJ9A 3PN1A 3MWMA 2UVWA 4ZI7F 1T94A 3L4KA 1S10A 2XGPA 5KFXA 4ED7A 4LF7H 3JRXA 1KBLA 2C22A 4HNVA 5CA1F 3H3VH 4DR1H 4DV1H 5KFFA 3OSNA 2ZDGA 1OBGA 1V51A 3L4JA 4J9PA 2EJ0A 3TQ1A 5F9NA 4QW9A 4R8UA 2FB9A 5DGHA 4O7TA 5LMNH 1XMOH 1SCUB 2HG8A 3V4ZA 2Y0SE 4ECQA 4DV5H 5BWRA 2Y4RA 1I94H 3PZPA 2WAQA 4B3SH 4JI3H 5KFQA 4FFLA 1HNWH 4B3TH 1JDBB 3RBEA 1E4EA 5BYAA 3TIGA 4J9QA 2OH2A 3I4NG 1BXRA 2HGSA 2W6PA 2HIXA 2YS7A 1RJPA 5KFTA 4X66H 3RV3A 2W7PA 5L1JA 4UFZA 5FD6A 1IBLH 4Q8FA
chains in the Genus database with same CATH topology
3Q1KA 4Y8VB 1KC7A 3VOTA 5FNVF 2ZDHA 5BMVF 1GSHA 5EZYF 2GPSA 5JQWA 3HBLA 3JZFA 4FFOA 1W96A 2NU7B 1VKZA 2VR1A 2FP4B 5J2UF 1KEEA 1AUVA 1T36A 2GQRA 3HB9A 1GSAA 1W93A 3E5NA 3KAJA 4O7LA 4XZ3B 2FPIB 3VMMA 2IP4A 2I87A 3VPCA 2YZGA 4IWYA 2QF7A 3DF7A 3R5FA 2C00A 2PBZA 1A48A 4WD3A 2NUAB 4O4HF 4ME6A 5DMXA 2W6MA 2W70A 3VA7A 4IWXA 3R5XA 4YAKB 3GIDA 1EZ1A 4ZOLF 1IOVA 1GSOA 4L1KA 5GONF 2W6OA 2YW2A 3GLKA 4YBZB 1B6RA 1KJJA 1CQJB 4IZOA 2NU6B 4FGRA 1PK8A 1IOWA 3AW8A 3MWEA 4HNUA 4XYLB 5C8YF 3HO8A 4O4IF 5BPHA 3KREA 2Z04A 1UC9A 1ULZA 2GPWA 4MAMA 4FFNA 5LA6F 2YWVA 2PN1A 2CNUA 2VQDA 3U55A 2YL2A 4C5CA 2Z02A 5LXTF 1CQIB 3VPDA 1GGOA 3SE7A 2CNQA 1Z2OX 3TIIA 4MA0A 2FPGB 2YZLA 2R6FA 3TQTA 5HBRB 2W6NA 5JVLA 4FFMA 5K2MA 4O83A 2R82A 4XYMB 4MV9A 2R87A 2I80A 4TV9F 5D8DA 3OUZA 2W6ZA 5CB4F 4M9UA 5IYZF 5C1OA 4O86A 2FPPB 2SCUB 2R7KA 3R5HA 1C3OA 3V4SA 5CAEB 4HQ6A 3ETHA 4O4JF 1M6VA 4IHJF 3KAKA 1CS0A 5C1PA 1DIKA 2W71A 3WO1A 1PX2A 1B6SA 1GLVA 2V59A 4MV1A 3G8DA 3MJFA 1DV1A 2YYAA 4ZQIA 5LP6F 4TUYF 3U9SA 3LWBA 1I7NA 3R9RA 4EGJA 4I55F 4YJ2F 4I50F 3WO0A 5LOVF 4O7SA 4O7NA 5KX5F 5J2TF 4MV7A 1EYZA 2PVPA 1I7LA 3BG5A 3UFXB 4MV8A 4MA5A 1C30A 2XD4A 4O7VA 4NYEA 1A9XA 2VPQA 1BNCA 3K5IA 2CQYA 3JRWA 3N8DA 1Z2NX 2YZMA 4O7WA 3U9TA 4C5BA 2DLNA 1E4EB 2CNVA 1M0TA 3WNZA 5JH7F 4O7ZA 3N6RA 4O4LF 3K5HA 1JLLB 4HNTA 4O2BF 2I8CA 4E4TA 2R7NA 5JQGF 3VPBA 2QK4A 4FFRA 2X0SA 1DV2A 4DLKA 5LYJF 2DZDA 3TW6A 2GQSA 2WYOA 1WR2A 4QSHA 2XCLA 1Z2PX 1JKJB 3R23A 2V5AA 3QFFA 3U54A 3I12A 4I4TF 4YB8B 5BPFA 2J9GA 5CA0F 3OUUA 1CE8A 2R7LA 2NU9B 2OLSA 5KKNB 4C5AA 3JZIA 1KJQA 1AUXA 3ORQA 3ORRA 4O7YA 1EUDB 1JDEA 4MV4A 2DIKA 3LP8A 4FE2A 4O82A 5HV6A 3ETJA 2R7MA 3Q2OA 4EGQA 5I47A 2P0AA 4YAJB 2NU8B 4MV3A 4EG0A 3RV4A 1EHIA 2GLTA 1KUTA 4FU0A 2DWCA 3RUPA 3NUAA 2HJWA 2YZNA 3G8CA 2ZDQA 1VBGA 2R84A 1KJ8A 3MWDA 1OBDA 4WBNF 4O2AF 4XX0B 1KJIA 4IIJF 3KALA 1UC8A 2W6QA 4RZQA 4ZHQF 1VBHA 4O7RA 2CZGA 4FFPA 4O84A 1EUCB 2YS6A 1M0WA 2YRXA 3RFCA 4O81A 4HR7A 3K3PA 2V58A 5H80A 2YRWA 3AX6A 4MV6A 2R86A 4TV8F 3TINA 4YJ3F 5JVDF 2R85A 4DIMA 1KJ9A 4ZI7F 3JRXA 1KBLA 4HNVA 5CA1F 2ZDGA 1OBGA 2FB9A 4O7TA 1SCUB 3V4ZA 4FFLA 1JDBB 1E4EA 3TIGA 1BXRA 2HGSA 2W6PA 2YS7A 3RV3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q1K A;  4Y8V B;  1KC7 A;  3VOT A;  5FNV F;  2ZDH A;  5BMV F;  1GSH A;  5EZY F;  2GPS A;  5JQW A;  3HBL A;  3JZF A;  4FFO A;  1W96 A;  2NU7 B;  1VKZ A;  2VR1 A;  2FP4 B;  5J2U F;  1KEE A;  1AUV A;  1T36 A;  2GQR A;  3HB9 A;  1GSA A;  1W93 A;  3E5N A;  3KAJ A;  4O7L A;  4XZ3 B;  2FPI B;  3VMM A;  2IP4 A;  2I87 A;  3VPC A;  2YZG A;  4IWY A;  2QF7 A;  3DF7 A;  3R5F A;  2C00 A;  2PBZ A;  1A48 A;  4WD3 A;  2NUA B;  4O4H F;  4ME6 A;  5DMX A;  2W6M A;  2W70 A;  3VA7 A;  4IWX A;  3R5X A;  4YAK B;  3GID A;  1EZ1 A;  4ZOL F;  1IOV A;  1GSO A;  4L1K A;  5GON F;  2W6O A;  2YW2 A;  3GLK A;  4YBZ B;  1B6R A;  1KJJ A;  1CQJ B;  4IZO A;  2NU6 B;  4FGR A;  1PK8 A;  1IOW A;  3AW8 A;  3MWE A;  4HNU A;  4XYL B;  5C8Y F;  3HO8 A;  4O4I F;  5BPH A;  3KRE A;  2Z04 A;  1UC9 A;  1ULZ A;  2GPW A;  4MAM A;  4FFN A;  5LA6 F;  2YWV A;  2PN1 A;  2CNU A;  2VQD A;  3U55 A;  2YL2 A;  4C5C A;  2Z02 A;  5LXT F;  1CQI B;  3VPD A;  1GGO A;  3SE7 A;  2CNQ A;  1Z2O X;  3TII A;  4MA0 A;  2FPG B;  2YZL A;  2R6F A;  3TQT A;  5HBR B;  2W6N A;  5JVL A;  4FFM A;  5K2M A;  4O83 A;  2R82 A;  4XYM B;  4MV9 A;  2R87 A;  2I80 A;  4TV9 F;  5D8D A;  3OUZ A;  2W6Z A;  5CB4 F;  4M9U A;  5IYZ F;  5C1O A;  4O86 A;  2FPP B;  2SCU B;  2R7K A;  3R5H A;  1C3O A;  3V4S A;  5CAE B;  4HQ6 A;  3ETH A;  4O4J F;  1M6V A;  4IHJ F;  3KAK A;  1CS0 A;  5C1P A;  1DIK A;  2W71 A;  3WO1 A;  1PX2 A;  1B6S A;  1GLV A;  2V59 A;  4MV1 A;  3G8D A;  3MJF A;  1DV1 A;  2YYA A;  4ZQI A;  5LP6 F;  4TUY F;  3U9S A;  3LWB A;  1I7N A;  3R9R A;  4EGJ A;  4I55 F;  4YJ2 F;  4I50 F;  3WO0 A;  5LOV F;  4O7S A;  4O7N A;  5KX5 F;  5J2T F;  4MV7 A;  1EYZ A;  2PVP A;  1I7L A;  3BG5 A;  3UFX B;  4MV8 A;  4MA5 A;  1C30 A;  2XD4 A;  4O7V A;  4NYE A;  1A9X A;  2VPQ A;  1BNC A;  3K5I A;  2CQY A;  3JRW A;  3N8D A;  1Z2N X;  2YZM A;  4O7W A;  3U9T A;  4C5B A;  2DLN A;  1E4E B;  2CNV A;  1M0T A;  3WNZ A;  5JH7 F;  4O7Z A;  3N6R A;  4O4L F;  3K5H A;  1JLL B;  4HNT A;  4O2B F;  2I8C A;  4E4T A;  2R7N A;  5JQG F;  3VPB A;  2QK4 A;  4FFR A;  2X0S A;  1DV2 A;  4DLK A;  5LYJ F;  2DZD A;  3TW6 A;  2GQS A;  2WYO A;  1WR2 A;  4QSH A;  2XCL A;  1Z2P X;  1JKJ B;  3R23 A;  2V5A A;  3QFF A;  3U54 A;  3I12 A;  4I4T F;  4YB8 B;  5BPF A;  2J9G A;  5CA0 F;  3OUU A;  1CE8 A;  2R7L A;  2NU9 B;  2OLS A;  5KKN B;  4C5A A;  3JZI A;  1KJQ A;  1AUX A;  3ORQ A;  3ORR A;  4O7Y A;  1EUD B;  1JDE A;  4MV4 A;  2DIK A;  3LP8 A;  4FE2 A;  4O82 A;  5HV6 A;  3ETJ A;  2R7M A;  3Q2O A;  4EGQ A;  5I47 A;  2P0A A;  4YAJ B;  2NU8 B;  4MV3 A;  4EG0 A;  3RV4 A;  1EHI A;  2GLT A;  1KUT A;  4FU0 A;  2DWC A;  3RUP A;  3NUA A;  2HJW A;  2YZN A;  3G8C A;  2ZDQ A;  1VBG A;  2R84 A;  1KJ8 A;  3MWD A;  1OBD A;  4WBN F;  4O2A F;  4XX0 B;  1KJI A;  4IIJ F;  3KAL A;  1UC8 A;  2W6Q A;  4RZQ A;  4ZHQ F;  1VBH A;  4O7R A;  2CZG A;  4FFP A;  4O84 A;  1EUC B;  2YS6 A;  1M0W A;  2YRX A;  3RFC A;  4O81 A;  4HR7 A;  3K3P A;  2V58 A;  5H80 A;  2YRW A;  3AX6 A;  4MV6 A;  2R86 A;  4TV8 F;  3TIN A;  4YJ3 F;  5JVD F;  2R85 A;  4DIM A;  1KJ9 A;  4ZI7 F;  3JRX A;  1KBL A;  4HNV A;  5CA1 F;  2ZDG A;  1OBG A;  2FB9 A;  4O7T A;  1SCU B;  3V4Z A;  4FFL A;  1JDB B;  1E4E A;  3TIG A;  1BXR A;  2HGS A;  2W6P A;  2YS7 A;  3RV3 A; 
#chains in the Genus database with same CATH topology
 3SGI A;  3Q1K A;  1TAE A;  2DAA A;  4Y8V B;  3T9A A;  4PWQ A;  1KC7 A;  1JXL A;  1FKA H;  4JV0 A;  3DTF A;  3VOT A;  4LFC H;  1L2Z A;  5FNV F;  1FVI A;  2HHF A;  2ZDH A;  2HDK A;  5I5S A;  5BMV F;  5IYD G;  1GSH A;  5HNE A;  1SFO A;  4HN2 A;  3V6H A;  4UCU A;  3F8N A;  1V4Y A;  4RB1 A;  3KHH A;  4LSA A;  3MFI A;  1XMQ H;  1TWG A;  1RYR A;  2JA7 A;  5I5X A;  2HVQ A;  4CKB A;  5EZY F;  2GPS A;  4QWE A;  4Q43 A;  5JQW A;  3G6X A;  3QQM A;  3BQ1 A;  1WCM A;  3HBL A;  2AGP A;  3AYH B;  1O75 A;  2JEI A;  4RZR A;  5KFN A;  2XGQ A;  3GTQ A;  3JZF A;  4FFO A;  2JA7 G;  4PZ7 A;  1IBM H;  2AGQ A;  4CE5 A;  2J6T A;  4NLG A;  4EFE A;  1WSC A;  1W96 A;  5KT2 A;  4X65 H;  5C44 G;  1S0O A;  2NU7 B;  3CEB A;  3HT5 A;  1WCM G;  3OHA A;  4O3P A;  4LF4 H;  3FDS A;  1VKZ A;  4NXM H;  4BXX G;  2VR1 A;  4DUZ H;  4YY3 H;  4IRK A;  4ETS A;  3GTM A;  2FP4 B;  5J2U F;  3RR5 A;  2W9C A;  4A93 G;  4DL3 A;  1KEE A;  1AUV A;  1T36 A;  2COG A;  3GIQ A;  2GQR A;  5KG0 A;  4AYB A;  4DL5 A;  3RBD A;  2BR0 A;  1N56 A;  3GTK A;  2JA5 A;  3HB9 A;  3IG0 A;  1GSA A;  3PW0 A;  4A3F G;  1W93 A;  2DAB A;  3E5N A;  3BQ0 A;  1IBK H;  2XCA A;  2QB5 A;  3GIK A;  3KAJ A;  1ET0 A;  1N32 H;  3T9B A;  4A3I G;  1I3Q A;  3N43 B;  1ZAU A;  4O7L A;  4XZ3 B;  3RTX A;  5D1O A;  4F4Y A;  4GKJ H;  3HOU G;  2JA5 G;  2FPI B;  4QIW A;  3VMM A;  2E5L H;  2IP4 A;  3CVZ A;  4RUC A;  5DGA A;  2I87 A;  3VPC A;  2XIG A;  2YZG A;  2J6U A;  1XNR H;  4IWY A;  3H4D A;  2QF7 A;  5I60 A;  3DF7 A;  5KG3 A;  3TY8 A;  3LML A;  3R5F A;  4DL2 A;  4LF9 H;  2ASJ A;  4J9N A;  4BWS C;  2C00 A;  2PBZ A;  3T99 A;  3GDE A;  1A48 A;  2JEJ A;  2WAQ E;  5LL6 b;  3T1Y H;  5KFE A;  4WD3 A;  2NUA B;  1A0G A;  4GLW A;  4J9S A;  3RB4 A;  3UZO A;  3PFF A;  3CSW A;  4ME6 A;  4O4H F;  3MFH A;  5DMX A;  2UUA H;  2W6M A;  4UUG A;  1WH2 A;  2W70 A;  3VA7 A;  4IWX A;  4QWA A;  3R5X A;  5L1L A;  3KXY T;  4YAK B;  1K1Q A;  3GID A;  2A1H A;  4QWD A;  2WTF A;  2R92 A;  1EZ1 A;  1VS0 A;  4GKK H;  2C2D A;  4PZ6 A;  5K3W A;  4ZOL F;  5BWT A;  5T14 A;  1IOV A;  2Q7D A;  2FLL A;  5LMU H;  1GSO A;  4L1K A;  4RB2 C;  5GON F;  2W6O A;  2YW2 A;  3GLK A;  3JSL A;  4YBZ B;  5DQH A;  4IRC A;  3JAM W;  2V4Q A;  3EPG A;  1B6R A;  4ECV A;  1A0I A;  4ED0 A;  2R92 G;  1KJJ A;  1CQJ B;  4A3C G;  4IZO A;  3KHL A;  2NU6 B;  4IRD A;  4Q45 A;  5IP9 G;  4FGR A;  4GC6 A;  4ED6 A;  1PK8 A;  4WHX A;  4RU9 A;  4DR5 H;  5KFY A;  2VPS A;  5FPO A;  2ATL A;  2IA6 A;  1IOW A;  3H0G G;  3AW8 A;  3KYH C;  3MWE A;  4CC5 A;  1EKV A;  4HNU A;  2FMA A;  4XYL B;  1S0N A;  5C8Y F;  3HO8 A;  4O4I F;  4QWC A;  3GIL A;  4DL6 A;  4G3I A;  4Q0Y A;  4DR6 H;  3RGZ A;  3S24 A;  5BPH A;  3KRE A;  2KSW A;  4R8U B;  3BAB A;  2Z04 A;  5FJ8 G;  4FS2 A;  5KT5 A;  4YHH H;  3T5J A;  1UC9 A;  2R8I A;  3WWJ A;  2WB1 E;  2V4R A;  1EKP A;  1ULZ A;  2GPW A;  4NZO A;  4MAM A;  4FFN A;  4UCO A;  5LA6 F;  2YWV A;  3VNN A;  1V9P A;  4DV6 H;  2FJZ A;  2PN1 A;  4AYB E;  3V6K A;  1XK5 A;  4LF8 H;  2UXD H;  2CNU A;  5KFS A;  4J9R A;  4HYK A;  2VQD A;  1MZB A;  4NZM A;  4NZN A;  3U55 A;  2YL2 A;  4C5C A;  2Z02 A;  5LXT F;  1CQI B;  1J5E H;  1TWH A;  4QJF A;  3Q8Q B;  2C28 A;  2R8G A;  3VPD A;  1GGO A;  3EPI A;  4MTE A;  4LF6 H;  5KG7 A;  4ECY A;  4QIW E;  4CMF A;  1TWA A;  3SE7 A;  2CW7 A;  2UUB H;  2CNQ A;  1Z2O X;  3MR2 A;  3TII A;  2HHF B;  2FK3 A;  2UVU A;  3TW7 A;  3IN5 A;  4MA0 A;  5IP7 G;  3HOZ G;  2OWO A;  5FR9 A;  2FPG B;  3RGX A;  5IYC G;  2YZL A;  2R6F A;  2RGV A;  5KFR A;  4YR3 A;  1RYS A;  3TQT A;  5HBR B;  2W6N A;  2W57 A;  2EJ3 A;  5E25 A;  4ECU A;  4JI1 H;  4OX9 H;  2R93 A;  2VQE H;  5C3E G;  3HXL A;  4YR2 A;  5JVL A;  2VA3 A;  5DGI A;  4FFM A;  5K2M A;  3W1G A;  5BWW A;  2FK2 A;  1CKO A;  3NGD A;  3GB8 B;  3JSN A;  4O83 A;  2R82 A;  4DAA A;  3QZ8 A;  2RDI A;  4XYM B;  1T3N A;  2F4V H;  4X64 H;  4MV9 A;  2R87 A;  2I80 A;  2O03 A;  2W9B A;  2C2E A;  2R8H A;  4TV9 F;  5D8D A;  5I5V A;  2COI A;  1N48 A;  4FBU A;  4M0J A;  3GIP A;  2C2R A;  3OUZ A;  2W6Z A;  5CB4 F;  2W9C B;  3PW5 A;  1KT8 A;  4ED8 A;  2AGO A;  2UXC H;  4TQR A;  3NBY B;  4M9U A;  5IYZ F;  5C1O A;  4O86 A;  2FPP B;  3M9N B;  3G6V A;  4DR3 H;  4E6N A;  4Q8E A;  2SCU B;  2UXB H;  3FKI G;  5IYB G;  4TM5 A;  3W5O A;  3LQS A;  4BY7 G;  3KHR A;  2R7K A;  3R5H A;  5CR5 A;  5D1O B;  1C3O A;  4FS1 A;  3V4S A;  5KG5 A;  2W8L A;  5CAE B;  2NVX A;  2JA6 A;  4HQ6 A;  1BGW A;  3ETH A;  4O4J F;  2WDT A;  4RNN A;  1M6V A;  4UCT A;  4IHJ F;  4LMY A;  3KAK A;  1ZHS A;  5KFV A;  4J0M A;  4JI0 H;  1CS0 A;  3MR5 A;  4DV2 H;  2JA6 G;  4ED2 A;  5C1P A;  4DR4 H;  1DIK A;  5JUM A;  2W71 A;  4M7E A;  1JX4 A;  2RF4 A;  3WO1 A;  1E4F T;  5KFO A;  4CHI A;  1PX2 A;  1B6S A;  1GLV A;  4DRF A;  3HKZ A;  4RAY A;  2V59 A;  3RF2 A;  5KFW A;  1ZET A;  4MV1 A;  4GLX A;  3H20 A;  4JUZ A;  4A2B A;  5KG4 A;  3G8D A;  5EDW A;  5I5W A;  2HHH H;  3RB3 A;  2EIY A;  4U7C A;  4ECW A;  3MJF A;  4CMD A;  1DV1 A;  3GTG A;  5KFU A;  2YYA A;  2RGR A;  4QW8 A;  3C0F B;  3T5H A;  3T9C A;  1I1L A;  3N42 B;  3J7A K;  2R8K A;  5BYB A;  1I50 A;  1Y1V A;  4JI6 H;  1I6U A;  4ZQI A;  3FMA A;  5KG6 A;  3GV8 B;  2VQF H;  5LP6 F;  3PR4 A;  5DQG A;  3T7A A;  4TUY F;  3UZB A;  4QWB A;  3K3V A;  1Y1V G;  2YCH A;  3U9S A;  1S0M A;  4K0K H;  4DV4 H;  1FJG H;  1SEI A;  3GII A;  2UVR A;  4NXN H;  4Q4D A;  4J9L A;  5BR8 H;  3LWB A;  4RAZ A;  5FLM G;  4TQS A;  1I7N A;  3DTG A;  3R9R A;  4I55 F;  1P16 A;  4EGJ A;  3BQ2 A;  4YJ2 F;  2R8J A;  4I50 F;  1GO3 E;  3PVX A;  3WO0 A;  1K1S A;  5LOV F;  3N6X A;  4O7S A;  4O7N A;  3RB6 A;  2DPJ A;  5BWV A;  3PR5 B;  5KX5 F;  4C2M A;  5J2T F;  3WWI A;  5KFP A;  3PW4 A;  4A3D G;  4EEQ A;  4MV7 A;  1EYZ A;  5DG7 A;  1N36 H;  4A3E G;  2PVP A;  4A3G G;  5FLX W;  1I7L A;  3BG5 A;  3UFX B;  3H0G A;  5I5T A;  2PMZ A;  1RJR A;  4ECX A;  2VUM A;  2W8K A;  2ZGI A;  3PW7 A;  2HGW A;  4A3L G;  2J6S A;  4MV8 A;  5DLG A;  4MA5 A;  4GC7 A;  4RUA A;  3L2P A;  5KFJ A;  1N33 H;  1WRV A;  4BY1 G;  1C30 A;  4EYH B;  1S9F A;  2VUM G;  2XD4 A;  4O7V A;  5KT3 A;  4NYE A;  2W7O A;  2HVR A;  3NBZ B;  1A9X A;  1UNN C;  2VPQ A;  1BNC A;  3K5I A;  4PZ8 A;  2FK1 A;  5KFK A;  2CQY A;  3M4I A;  3JRW A;  3T5L A;  4LH6 A;  3N8D A;  1Z2N X;  2YZM A;  2CW8 A;  1I1K A;  4O7W A;  2QYZ A;  2VA2 A;  2ZJT A;  4LSX A;  4A2A A;  3T1H H;  4JV2 A;  4A3M G;  5FD5 A;  3U9T A;  2WE6 A;  4F4X A;  2UU9 H;  2BQR A;  3BA8 A;  5D1P A;  2DLN A;  4C5B A;  1E4E B;  4RNO A;  4JV1 A;  4EBE A;  3BJY A;  3U0G A;  2CNV A;  1TA8 A;  3QWU A;  4DR7 H;  5C5J A;  4IR9 A;  3HKZ E;  5EOY A;  1M0T A;  1HNZ H;  4EBC A;  4PBC A;  5KFG A;  3WNZ A;  3WWH A;  5JH7 F;  4O7Z A;  3N6R A;  4O4L F;  2XCP A;  5L1I A;  3K5H A;  5BWX A;  5I5U A;  5KT4 A;  1JLL B;  1HNX H;  4B3M H;  4FBT A;  4LFA H;  4HNT A;  2AQ4 A;  4O2B F;  2I8C A;  2Q2T A;  4F4Z A;  2CFM A;  4UCS A;  3GTL A;  4E4T A;  3TY5 A;  2FKL A;  2R7N A;  3RAQ A;  4JI5 H;  5JQG F;  3OHB A;  3VPB A;  3DAA A;  2QK4 A;  3N41 B;  4YP3 A;  4FFR A;  3V6J A;  3MR3 A;  2COJ A;  5CE8 A;  1G2W A;  3RB0 A;  2Q2U A;  4EEY A;  4B3R H;  2X0S A;  1DV2 A;  3GJX B;  1IYE A;  4DLK A;  4DL7 A;  5LYJ F;  4JI8 H;  2DZD A;  3TW6 A;  1CKN A;  2GQS A;  1M7J A;  5F9L A;  3PO2 G;  2VUG A;  4J9K A;  4O3S A;  2WYO A;  4A3J G;  1WR2 A;  4X62 H;  4QSH A;  2NVY A;  3I4M G;  2XCL A;  3T9F A;  3FKI A;  2ABJ A;  1Z2P X;  1JKJ B;  4EBD A;  4F50 A;  3R23 A;  5EWF A;  5KFA A;  3UQ8 A;  5IWA H;  1S68 A;  2V5A A;  3QFF A;  4ECR A;  4IR1 A;  4EQ5 A;  3U54 A;  3BA9 A;  2MCT A;  3I12 A;  4I4T F;  2FLP A;  3BAC A;  3KTM A;  1N34 H;  4YB8 B;  2PMZ E;  5BPF A;  4CC6 A;  2J9G A;  5CA0 F;  5KG2 A;  3T9D A;  3GIJ A;  3OUU A;  2BQU A;  5IT9 W;  4ED1 A;  5KFB A;  3GV7 B;  3HOX G;  1CE8 A;  2R7L A;  3H40 A;  1I2L A;  2NU9 B;  2FLN A;  2OLS A;  3HOW G;  1P8L A;  5KKN B;  3RJ0 A;  4C5A A;  2JEG A;  2UUC H;  3JZI A;  1KJQ A;  2JEF A;  4APM A;  3GTJ A;  5KT7 A;  2M05 A;  1OWT A;  2HIV A;  3T5K A;  2DPI A;  4ECS A;  2BQ3 A;  1A3G A;  1AUX A;  5KG1 A;  5KFI A;  4DQN A;  3ORQ A;  3ORR A;  2C35 B;  4JXU A;  4O7Y A;  5L9X A;  4DL4 A;  4BBS G;  4PDB A;  4KHP H;  1EUD B;  1TWF A;  5EWE A;  2XC9 A;  1DAA A;  4DUY H;  4JI2 H;  1EKF A;  1JDE A;  4MV4 A;  5A2Q W;  2B63 A;  3N40 P;  4DV7 H;  3LUL A;  4A3B G;  2ZM6 H;  5DGB A;  5EWG A;  2DIK A;  3TEK A;  4JI7 H;  5KS8 A;  3GQC A;  4CKC A;  3LP8 A;  3J80 W;  4JV5 H;  4FE2 A;  2RDJ A;  1GYF A;  5DLF A;  2V9W A;  2B63 G;  1XDN A;  4O3Q A;  2WB1 A;  4O82 A;  5HV6 A;  3ETJ A;  2FE3 A;  1BJT A;  4YQW A;  3T54 A;  2R7M A;  3Q2O A;  4EGQ A;  5I47 A;  1RK5 A;  1KTA A;  2ODT X;  2P0A A;  4YAJ B;  5BWU A;  5DAA A;  2HVS A;  1TWC A;  2CKZ B;  1HR0 H;  4JI4 H;  3CQZ A;  2JA8 G;  2NU8 B;  3HOV G;  4MV3 A;  5KT6 A;  4EG0 A;  4J9O A;  2ASD A;  3RIZ A;  3RV4 A;  1E4G T;  1EHI A;  3UYY A;  2GLT A;  4EYI B;  5KFD A;  4FM9 A;  2HGX A;  1KUT A;  5DG9 A;  4RB3 C;  2E2I A;  4FU0 A;  4A3K G;  2DWC A;  4YR0 A;  2X5R A;  3HOY G;  3RUP A;  4LH7 A;  3Q8S B;  4F4W A;  3SI8 A;  1XNQ H;  4LFB H;  3GTP A;  1ZQ7 A;  1VAJ A;  2IBK A;  3NUA A;  1CKM A;  1SYX B;  4IAJ A;  2Y0S A;  4MTD A;  2UVV A;  2W9A A;  3SNO A;  2HJW A;  2YZN A;  3G8C A;  3TY9 A;  2ZDQ A;  5DIS C;  1Y14 B;  1VBG A;  4DV3 H;  3RAX A;  2R84 A;  2EJ2 A;  1KJ8 A;  3MWD A;  3KHG A;  1OBD A;  4WBN F;  4CKE A;  3GV5 B;  3M9O B;  5FPR A;  2R7Z A;  1R9T A;  3JZ6 A;  3MR6 A;  1B33 N;  4O2A F;  4JYA H;  4XX0 B;  4ECT A;  1KJI A;  1I2K A;  4O3O A;  4IIJ F;  3KAL A;  4UCV A;  3QZ7 A;  1UC8 A;  2W6Q A;  4RZQ A;  2AU0 A;  2R7Z G;  4ECZ A;  1IYD A;  2ASL A;  3G6Y A;  4ZHQ F;  5KFZ A;  5I5Y A;  1I1M A;  1VBH A;  3OSP A;  2YU9 A;  4O7R A;  5C4X G;  4TVI A;  2CZG A;  2ALZ A;  4BBR G;  4UCR A;  1S03 G;  4FFP A;  5CM0 A;  3BAA A;  4O84 A;  3EYY A;  4LF5 H;  5KFC A;  3M9M B;  5DG8 A;  4ED3 A;  3Q8R B;  3H4B A;  1EUC B;  2YS6 A;  1M0W A;  5L1K A;  2YRX A;  3RFC A;  4U6P A;  3GTO A;  4K6N A;  1X9N A;  3PW2 A;  5KFM A;  1K83 A;  4O81 A;  3J81 W;  4O3R A;  2E2H A;  4HR7 A;  5DQI A;  3T9E A;  1B04 A;  3W1B A;  3K3P A;  2VOB A;  2V58 A;  4RB0 A;  5KFH A;  5H80 A;  2YRW A;  1CKN B;  3NC0 B;  3AX6 A;  4O3N A;  4MV6 A;  5KFL A;  2W9B B;  2R86 A;  4EFB A;  1RJQ A;  4I7H A;  1Y1W A;  4TV8 F;  3Q8P B;  3PO3 G;  4AQY H;  1RK6 A;  3TIN A;  3OTO H;  4YJ3 F;  1ZHQ A;  3GIM A;  5JVD F;  1AN7 A;  4R7R A;  4Q44 A;  3N44 B;  4J9M A;  4Q4C A;  2R85 A;  4RCN A;  1JIH A;  1DGS A;  4DR2 H;  2IMW P;  1Y1W G;  4RNM A;  4DIM A;  2R93 G;  4DV0 H;  1S97 A;  1KJ9 A;  3PN1 A;  3MWM A;  2UVW A;  4ZI7 F;  1T94 A;  3L4K A;  1S10 A;  2XGP A;  5KFX A;  4ED7 A;  4LF7 H;  3JRX A;  1KBL A;  2C22 A;  4HNV A;  5CA1 F;  3H3V H;  4DR1 H;  4DV1 H;  5KFF A;  3OSN A;  2ZDG A;  1OBG A;  1V51 A;  3L4J A;  4J9P A;  2EJ0 A;  3TQ1 A;  5F9N A;  4QW9 A;  4R8U A;  2FB9 A;  5DGH A;  4O7T A;  5LMN H;  1XMO H;  1SCU B;  2HG8 A;  3V4Z A;  2Y0S E;  4ECQ A;  4DV5 H;  5BWR A;  2Y4R A;  1I94 H;  3PZP A;  2WAQ A;  4B3S H;  4JI3 H;  5KFQ A;  4FFL A;  1HNW H;  4B3T H;  1JDB B;  3RBE A;  1E4E A;  5BYA A;  3TIG A;  4J9Q A;  2OH2 A;  3I4N G;  1BXR A;  2HGS A;  2W6P A;  2HIX A;  2YS7 A;  1RJP A;  5KFT A;  4X66 H;  3RV3 A;  2W7P A;  5L1J A;  4UFZ A;  5FD6 A;  1IBL H;  4Q8F A; 
#chains in the Genus database with same CATH homology
 3Q1K A;  4Y8V B;  1KC7 A;  3VOT A;  5FNV F;  2ZDH A;  5BMV F;  1GSH A;  5EZY F;  2GPS A;  5JQW A;  3HBL A;  3JZF A;  4FFO A;  1W96 A;  2NU7 B;  1VKZ A;  2VR1 A;  2FP4 B;  5J2U F;  1KEE A;  1AUV A;  1T36 A;  2GQR A;  3HB9 A;  1GSA A;  1W93 A;  3E5N A;  3KAJ A;  4O7L A;  4XZ3 B;  2FPI B;  3VMM A;  2IP4 A;  2I87 A;  3VPC A;  2YZG A;  4IWY A;  2QF7 A;  3DF7 A;  3R5F A;  2C00 A;  2PBZ A;  1A48 A;  4WD3 A;  2NUA B;  4O4H F;  4ME6 A;  5DMX A;  2W6M A;  2W70 A;  3VA7 A;  4IWX A;  3R5X A;  4YAK B;  3GID A;  1EZ1 A;  4ZOL F;  1IOV A;  1GSO A;  4L1K A;  5GON F;  2W6O A;  2YW2 A;  3GLK A;  4YBZ B;  1B6R A;  1KJJ A;  1CQJ B;  4IZO A;  2NU6 B;  4FGR A;  1PK8 A;  1IOW A;  3AW8 A;  3MWE A;  4HNU A;  4XYL B;  5C8Y F;  3HO8 A;  4O4I F;  5BPH A;  3KRE A;  2Z04 A;  1UC9 A;  1ULZ A;  2GPW A;  4MAM A;  4FFN A;  5LA6 F;  2YWV A;  2PN1 A;  2CNU A;  2VQD A;  3U55 A;  2YL2 A;  4C5C A;  2Z02 A;  5LXT F;  1CQI B;  3VPD A;  1GGO A;  3SE7 A;  2CNQ A;  1Z2O X;  3TII A;  4MA0 A;  2FPG B;  2YZL A;  2R6F A;  3TQT A;  5HBR B;  2W6N A;  5JVL A;  4FFM A;  5K2M A;  4O83 A;  2R82 A;  4XYM B;  4MV9 A;  2R87 A;  2I80 A;  4TV9 F;  5D8D A;  3OUZ A;  2W6Z A;  5CB4 F;  4M9U A;  5IYZ F;  5C1O A;  4O86 A;  2FPP B;  2SCU B;  2R7K A;  3R5H A;  1C3O A;  3V4S A;  5CAE B;  4HQ6 A;  3ETH A;  4O4J F;  1M6V A;  4IHJ F;  3KAK A;  1CS0 A;  5C1P A;  1DIK A;  2W71 A;  3WO1 A;  1PX2 A;  1B6S A;  1GLV A;  2V59 A;  4MV1 A;  3G8D A;  3MJF A;  1DV1 A;  2YYA A;  4ZQI A;  5LP6 F;  4TUY F;  3U9S A;  3LWB A;  1I7N A;  3R9R A;  4EGJ A;  4I55 F;  4YJ2 F;  4I50 F;  3WO0 A;  5LOV F;  4O7S A;  4O7N A;  5KX5 F;  5J2T F;  4MV7 A;  1EYZ A;  2PVP A;  1I7L A;  3BG5 A;  3UFX B;  4MV8 A;  4MA5 A;  1C30 A;  2XD4 A;  4O7V A;  4NYE A;  1A9X A;  2VPQ A;  1BNC A;  3K5I A;  2CQY A;  3JRW A;  3N8D A;  1Z2N X;  2YZM A;  4O7W A;  3U9T A;  4C5B A;  2DLN A;  1E4E B;  2CNV A;  1M0T A;  3WNZ A;  5JH7 F;  4O7Z A;  3N6R A;  4O4L F;  3K5H A;  1JLL B;  4HNT A;  4O2B F;  2I8C A;  4E4T A;  2R7N A;  5JQG F;  3VPB A;  2QK4 A;  4FFR A;  2X0S A;  1DV2 A;  4DLK A;  5LYJ F;  2DZD A;  3TW6 A;  2GQS A;  2WYO A;  1WR2 A;  4QSH A;  2XCL A;  1Z2P X;  1JKJ B;  3R23 A;  2V5A A;  3QFF A;  3U54 A;  3I12 A;  4I4T F;  4YB8 B;  5BPF A;  2J9G A;  5CA0 F;  3OUU A;  1CE8 A;  2R7L A;  2NU9 B;  2OLS A;  5KKN B;  4C5A A;  3JZI A;  1KJQ A;  1AUX A;  3ORQ A;  3ORR A;  4O7Y A;  1EUD B;  1JDE A;  4MV4 A;  2DIK A;  3LP8 A;  4FE2 A;  4O82 A;  5HV6 A;  3ETJ A;  2R7M A;  3Q2O A;  4EGQ A;  5I47 A;  2P0A A;  4YAJ B;  2NU8 B;  4MV3 A;  4EG0 A;  3RV4 A;  1EHI A;  2GLT A;  1KUT A;  4FU0 A;  2DWC A;  3RUP A;  3NUA A;  2HJW A;  2YZN A;  3G8C A;  2ZDQ A;  1VBG A;  2R84 A;  1KJ8 A;  3MWD A;  1OBD A;  4WBN F;  4O2A F;  4XX0 B;  1KJI A;  4IIJ F;  3KAL A;  1UC8 A;  2W6Q A;  4RZQ A;  4ZHQ F;  1VBH A;  4O7R A;  2CZG A;  4FFP A;  4O84 A;  1EUC B;  2YS6 A;  1M0W A;  2YRX A;  3RFC A;  4O81 A;  4HR7 A;  3K3P A;  2V58 A;  5H80 A;  2YRW A;  3AX6 A;  4MV6 A;  2R86 A;  4TV8 F;  3TIN A;  4YJ3 F;  5JVD F;  2R85 A;  4DIM A;  1KJ9 A;  4ZI7 F;  3JRX A;  1KBL A;  4HNV A;  5CA1 F;  2ZDG A;  1OBG A;  2FB9 A;  4O7T A;  1SCU B;  3V4Z A;  4FFL A;  1JDB B;  1E4E A;  3TIG A;  1BXR A;  2HGS A;  2W6P A;  2YS7 A;  3RV3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...