4YBHA

Crystal structure of the human rage ectodomain (vc1c2 fragment) in complex with human s100a6
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
302
structure length
302
Chain Sequence
AMAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Advanced glycosylation end product-specific receptor
publication title The Structure of the RAGE:S100A6 Complex Reveals a Unique Mode of Homodimerization for S100 Proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 54
structure length 302
sequence length 302
ec nomenclature
pdb deposition date 2015-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08205 C2-set_2 CD80-like C2-set immunoglobulin domain
A PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ybhA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ybhA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ybhA03
1BQHB 1UWGL 1JGDA 1K6QH 3OQ3B 1HQRB 2AP2A 5DJDB 3RVVD 3QEUB 5HYEA 3VFPB 4NNXA 1TVDA 4G8GB 4ODXB 4OCSL 3DIFA 4WUKH 4EOWL 3HLAB 4XAWL 5F9JA 1ZWIB 3DYOA 4NKDB 1HSAB 2AJUL 2AQ2A 5KOMC 4LAQH 1RPQA 3CVHH 5C6TH 4G7YL 3L1OL 1JWUA 2Q86B 2BRQA 1JPTH 5ITFB 4OGAC 1YEGH 3LPWA 4KK6C 1ADQA 4BK5A 3U7WL 25C8L 3O3DB 1T4KA 2ESVD 4G43B 2EKSB 3O45B 5FCUH 4BFEA 4HWBH 4L8BA 3ZE2F 3QUZB 4DZ8A 3GSQA 1OGAA 5HGAA 1IM3A 1OSZA 5IF0B 3SBWC 1A5FH 4CU7A 2RIKA 1UB5A 4WEMB 4P0DA 1VENA 2GJ6B 3U7AA 3VDCA 1O7VA 4X5WA 3UTTA 3MFFA 2VISB 1S7UB 4MCYA 3ILPB 3OV6A 3ZKNC 2BNUB 4X6CA 3VXSD 4XBPA 4IOIA 3PV6B 2NY5C 4AENB 1O5DT 4NM4H 1PJ9A 1XF3B 5MEPB 4OCYL 3ZZ1A 3LS5L 1U3HB 4JGJA 2F5BH 3MLTA 1IEAB 2VZ1A 4IMKC 5HHMB 1E6JL 5EBMB 4HK3N 3TO4A 1RJLA 4BSWB 3W11D 3QUML 1PYWA 3DGGA 3FFDB 2G5RA 5F93C 4N1EA 4APQA 2HFFA 4Y4HA 5CLWA 4M48H 4G6KL 1FBIL 5E99H 4LGSB 4DUXA 2R2HA 1Q0XH 1CR9L 1YDPB 3CXHK 4LLUA 4I9WD 4XH2B 5KANI 4XMKL 1U91B 1AE6L 4DVRL 1Z5LB 4OFPA 4CMHC 4PJ9B 2KZ1B 5SWSB 3VRIA 3P4NB 2YMXH 4JRWA 3BGMB 1T66C 3UJIH 1L7TH 3GSOA 2VDLH 4Y19A 5J12B 1XF2B 4PJCA 1QBLH 1RZJL 1NMBH 1CGTA 3GRWL 5LCVL 1KEMH 3BE1L 3M8OH 4WU5B 5KW9H 3LPFA 5ESAB 2DIAA 1TJHH 1RZFL 5BRZE 1GGBL 3AREB 2A38A 3EO1A 3RNKB 1XGPB 4CU6A 3TT3H 3MV7E 4NCC2 1F11B 5JHDD 1FFOB 3IB4A 2OTWB 4NO0A 4OD1H 4F2MB 2E8YA 4QXUL 3SKMB 3RZCA 1MIEL 4KMTH 1W8NA 4ZUUA 4YHZH 4R2GC 3LKQA 2LU4A 3TBTA 3Q5OA 4FRWA 1JMXA 2QQQA 1H8SA 2VDMH 3BGFC 2CMRH 1YYML 5IVXA 1LHZA 1AO7E 4Z7WE 5MEND 5IM7A 3IF1B 5DMGC 1WBYA 1S7SA 2CO6B 1BVKA 1G9NL 3O6KH 4LCWD 5IBLD 2X4RB 3NBNA 1WWWX 4U1GB 3TPUA 3ILQC 3BEVA 5E8EB 4QRTB 3VA6A 4TRPH 1RIUH 1A9EA 1NCTA 2GK0B 4UILH 1KN4L 5I2IB 4WFEE 2VLJE 4WW2B 4P46B 1RVFL 4X6BA 3JWOH 4M4PA 5FUOL 3I3EA 2FR4B 4YHYB 3FT2B 2I25N 3I2CL 2M2DA 1JYWA 2UY6A 3RTQB 1KIQA 4OIBA 1BEYH 4HPOH 1S9YA 3CK0H 4PRPE 3IDYB 5J7CC 1CCZA 1NC4B 3NAAL 4OGZA 1G1CA 2P42B 1KCUH 1CFNA 2IPUK 3MBXH 4KTEH 4PTUA 5BV7C 3DBXB 3T0EB 5D72L 4FFVD 1KTDB 5A2KH 1P7KB 4LVEA 4JFFE 1IL1B 4NO2A 3RPKA 1G9MC 3MV9A 5H8DA 5JW4M 3UP1A 1A64A 4QTHA 4NIKB 3EGSB 3GMRA 1YN7A 5ACZB 3SE4A 3HMWL 3QNZB 3JWDC 2CRIA 3OZ9L 3MZGB 4Z0XA 1CG9A 4WV1C 4JQVA 3SKOA 4PREB 3EUUA 4CW1B 1WF5A 4PLJC 1NFDE 4X6FB 2BOBB 4MQ7B 3VXMA 2DYPD 2YBRB 4KHTH 4GKZA 2OR8A 3V5KB 1EPFA 2H32A 2JKXA 3LN5B 3F7PC 4MXVE 4RSVA 5C0AE 5A2FA 1F4XL 4XNXH 5D1QD 5L2JB 1JI2A 1EEZB 1MHHA 1G9MH 3C60C 3HAEG 4ODVH 4OB5H 3OTTA 4TSCL 4ZSOB 5HDQL 3NFNA 5I8EA 5HY9A 2C1PA 1H3VA 1AKJD 2CRZA 2DQGL 1NUFA 1A4JB 4R4BB 3JVGA 2O5ZH 1ZT4B 2ZCHL 3H7BA 1GZQA 3BUYA 3B5TA 3TZVC 4ODWB 4P2OC 3DWTA 2A2QT 5JXEC 4OT1H 2GK2A 1FSKC 3V9FA 1VGKB 1LEIA 1FORL 3WEXA 2B5IC 2K9UA 1KFAH 2ATPA 2QQKL 3G9VA 3G6JE 1B6DA 2VXQH 3SGEI 2X4OA 2X4NB 2PCPB 2DMKA 2JELH 4KKAD 4D0BB 1NBVL 2V2TA 4PJ5B 4Y2DA 4WFGE 2BNRA 1I85A 2ZPKH 1HHJA 2Y07L 1JN6B 2AI0L 3WNKA 3ZTNL 3QEHA 2FWOB 4JR9L 4RMVA 1YNTB 4RNRB 2XQYK 3PWNA 2OM5A 1KPRA 1DBAH 3MR9B 3LDBB 4OUUA 4MJ5A 5I1LA 4WDIB 5I15L 2HWZH 4L3EB 3ZDXE 1NDMA 2V9RA 2JF1A 5DMKB 4JRYB 4D3CH 4C57C 1MIML 1OTTD 4LIQL 2B1AH 5GS0L 2IPTH 5E9DE 1FPTH 3KR3H 3QIUD 1UEYA 1D5XB 4EN3B 4PJIB 4JCLA 2IAMB 3VXRB 4HLZG 2OI9B 5JR1L 1NMCB 3BKCL 5GGUA 1I1YB 3EJZC 3GSUA 5SWZD 1YYLH 4DAGL 2NXYB 3SKNB 1ZLVH 2SEBA 1T1YB 1AFVH 1S78D 3MNWB 1XIWC 2WBJD 2YEZB 4K8RD 4MSWA 1QNZL 1Z0MA 5FXCH 3SN6N 3VWJA 3U6RA 4Z7NE 1CD1B 2J8UE 5L2KE 1N5AA 5IFAL 3VG0H 5LJYH 2DJUA 4PRBB 1SJXA 4HWEL 3S88H 3CFBB 2OL3L 3GSRA 1QO3A 3P0VH 1ZSDA 4KFZC 4ELMF 2PKDA 4QRRB 5D6DA 5B3JE 5IMOA 4KTDH 5DEFA 5EOCL 4U7MA 4YHLL 1YMME 4DK3A 5AZ2L 4WFHE 2BRRH 4BH8A 3LKPA 3NACH 3O3AB 2CR6A 1MFCH 4JZJA 3G5XA 1FNHA 2PW2A 4PY7B 4QHMB 1H8NA 2QKIB 4JDVB 4X9IA 1P1ZA 2KZWA 2R0ZL 2HLFC 5J11C 3DUUA 1AHWA 4HW6A 1KPUB 3UBXB 3RL1A 2AJSL 1FNGB 3V6FA 4XWGL 3Q3GA 3GSNL 1GOHA 2LAGB 1MCHA 1JF6A 4CBPA 3CSBA 1X5ZA 5HDOA 1CT8B 5DD3L 2VWEC 4NN7C 4YXKL 4F7MA 1HZHH 5JHLL 3MLUH 4WCYL 5T3ZD 5EU6E 3P4OA 4J6RL 2XRAL 2J4WL 5F44A 4Z0BH 2ATKA 4TUJB 2IALA 1T03H 2XICA 3VE0B 4ZNEA 1A7NH 4PJ7E 4O4YL 1OAZL 3FKUS 4OLVL 1FE8H 1P4BH 3VJ6B 4ELKA 3S34H 4Y1AE 4LKCB 3LQZB 5HYJD 4AT6B 4L4VE 4KRMB 5IBUB 4F7PA 1AD9B 1FDLL 4F57H 1DL7H 4OZHF 1TVBA 1XR8B 5I0ZA 1R5VB 3TFKD 1OHQA 2XKSA 1H5BA 4JPVL 4C56A 5LXGH 2DM3A 1IEBB 2WINB 3ARXA 3MLXH 4M03A 1EEYA 3MRCA 2EDBA 3DARA 3HC0A 1HOCA 3OF6A 4PRIA 3WJJC 1WEJH 3WL9B 4LSRH 4HUVB 3EOTH 3I50H 4MNQD 3RHWK 1NEZB 1YA5A 5IIEA 1CLOL 3B2VL 4B50A 3E3QC 4OLUH 2VXUL 1AR1D 4L4TD 4LHQB 4AEHL 2X4QA 1KCSL 3RJQB 3CVIL 1XF5A 3BQUC 5FHAL 3FCTB 4HIIA 4UQ2B 5K9KB 5I74C 3TM6A 4P5TD 1OD9A 4XP6H 3QULB 3WS6A 2PO6C 1W72H 3SJVA 3UDWA 4D9RD 5I1JH 3QI9B 4ZD3H 4ZNCD 5EBLB 3AMLA 5E4IA 1UG9A 1BF8A 4HUWA 3AAZB 3GDBA 4UIMA 4TSAL 4RGNB 3GI8L 5KOVC 1BQHA 3DI2B 4LBEB 1BOGB 2MTPA 1MSPA 5CS7A 12E8H 4GAYB 1HQRA 5DJDA 2PTVA 3QEUA 1FNSL 5BRZD 3VFPA 3MBED 1G6RB 1ZLUH 4OD2B 4G8GA 4YBLC 4FZ8L 4ODXA 1OP5K 1JV5B 2MJWA 1L6ZA 1MFEL 1HILB 4BJLA 3J7HA 3KPSD 35C8L 5I9QC 3HLAA 3HE6B 3H9HB 1ZWIA 4NKDA 3T04D 1HSAA 4Z7VB 5M95B 1WGOA 4K07A 3UBXG 4ZAKB 1OGAE 2Q86A 3BISA 1J8HB 5ITFA 2Z92B 1X9QA 1AO7D 4L9LC 4BZ2L 1OD7A 3O3DA 4G43A 5KVDL 2EKSA 3O45A 1NLBL 4NN5C 2YRLA 3UTTE 3QUZA 3WNMA 2A1WH 2XA8H 1WBXB 1M4KA 4X6CE 3QUXB 5JXAL 4KRPB 2PR4H 5IF0A 3D87B 4F7CB 3BKJL 3ARFC 5DD0H 5IOPB 4PPTA 4WFED 1B0RB 2GJ6A 2VLJD 5CEYA 2VDKL 1TVHB 2YD6A 1PZUB 1MY7A 1S7UA 1VPOL 2VISA 3ILPA 4OIIH 1BBDH 2DM2A 2BNUA 5DHVH 3PV6A 5I75B 4AENA 5EBWB 1LK3L 2OQJB 1XF3A 5MEPA 1U3HA 3OBAA 1IEAA 1X44A 2WANA 3H8NA 3CSYB 3SGJC 2CSPA 1YNLL 4PLKC 5EBMA 4TUKH 1JHLH 1KTKE 4BSWA 5TJWK 4RX4A 3VMNA 3FFDA 1KB5L 4QTIL 1I3GL 4LRIA 2OMBA 5IBUG 4XHJC 4HK3J 4HXAL 4ODSL 3WO4B 3AM8A 2PXYC 5HBBA 5TDOB 4R97B 1YDPA 3KJ6H 4XH2A 3WUWB 1YMHB 4IRJB 1U91A 3BWAB 4Y19E 3DUHA 4K7PX 1Z5LA 4GT7A 4URTB 3HR6A 1LGVA 4PJ9A 1I1CA 3LQAL 5SWSA 3TIEB 2X09A 3P4NA 4JFHD 5I18H 4HS8H 3BGMA 3B3IB 1I7ZB 5IFJB 1NEZG 1XF2A 4NHUB 1T04B 4OF7A 2A0LC 3RX8A 5C92A 1JNNH 2EDYA 1U36A 1MFAL 3JV6B 4PJXB 4YFLI 2ZUYA 3CGTA 3PWPE 4B7LA 1EO7A 1MAKA 3Q0HA 4WU5A 4GMSH 5IHLB 5ESAA 3CNKA 2CPCA 4LPUA 3WLWD 5C0CB 3AREA 3TVMC 3RNKA 1XGPA 1L7IL 3KPPB 1Y0LB 2DTMH 3T3PE 1H3PL 1F11A 1OW0A 3IFPB 3BESR 1FFOA 2L7UA 2OTWA 4NQCD 4F2MA 2BFVH 3SKMA 3KYKH 1KIPB 2QHRH 3WKML 2M1KA 4POZC 2N7BA 4HC1L 1A14L 3C08H 1X7QB 3IF1A 4DN3L 2VLRD 1UCBL 2BY2A 4AMKL 2X4RA 4H8WL 4QXGL 5E8EA 4QRTA 5GRVK 4P9MH 3MLRH 4GXUM 5I2IA 4WW2A 4Z7OF 4P46A 4M7JL 2FR4A 3FT2A 3I75B 2GFBB 3MRFB 2VQUA 3B8YA 4H0IA 3RTQA 3WCYA 5F7FA 1SJHB 5FUCC 3GZKA 4KK8D 4MA7H 4DKFL 3MV9E 3RUGB 1CZ8H 3C6LC 5BOZG 4QHUB 2Z31B 2UWEB 3V0WL 1N5YL 3HPJB 3DBXA 3N1PC 3T0EA 3FO9A 1KTDA 1P7KA 1JRHH 4Y7MA 1HINL 1C1EH 1IL1A 2BSRB 5IB1B 4H25B 4GRLC 3IGAB 3ARGD 4JHZA 4DUVA 4YC2B 4KPHH 4NKIL 5CZXC 2XTJE 3EGSA 2LU3A 5JW5B 1H3WM 3DRTB 3EW3B 5ACZA 1UADC 4LSQH 1Q9OB 2DL9A 3VXME 5DD5L 3QNZA 4M1CD 1H15B 5IMMB 5I1EL 3MV01 4O51B 4PREA 1EZVY 2D0HA 3WDIA 2VE6B 4CW1A 4X6FA 2YA0A 4J1UB 2BOBA 3CFKB 4MQ7A 1UM6L 4MAUH 4XAWH 1R6VA 4OTXL 2YBRA 2F54B 4S1QH 5B3NA 3TNMB 1AH1A 3V5KA 3ZHLA 1HIML 4NO5B 2VLME 3CSPA 3LN5A 4Z9KB 5ABDE 5L2JA 1YMMD 3C5ZB 3SDXF 3ARRA 5L8LB 3UYRL 1EEZA 1KENL 2NY1C 4LSTL 1UWXK 4B41A 3R06B 3FRPG 1D3CA 1JYVA 5GPRA 4ZSOA 3AVEA 3DO7B 5I30L 1MI5B 5I76B 3PP4L 4LGRB 1A6UH 1A4JA 4R4BA 3RVUC 1MJ7H 1ZT4A 2P44B 1ZA6B 1L0YA 5D7JB 4OM0L 4ODWA 2HMIC 2XYCA 2ZKHL 2FHFA 4F15C 4OGXH 1VGKA 3STBA 4YXHH 5CGYD 1S7XB 4MYWB 1UCTA 2BNRE 4HUKB 3UTPD 1MQ8A 1ITCA 1UEMA 2X4NA 2PCPA 3SDYL 2Y5TB 4KJQC 1J1XL 4G9DB 4M1GH 1HHGB 5F6IB 5DURB 3S97C 4D0BA 2CIIB 4LARH 4PJ5A 1CGSL 1IFHL 1QHOA 3DECA 2J7LA 3CZFB 1MY5A 2HP4A 2ZUSA 3EYQC 2NXZC 1JN6A 1BM3H 4N0CC 1D6VL 2FWOA 4RNRA 1YNTA 3RWFA 3P11L 3MR9A 4R9HA 3QP3A 5D9SB 3RX7A 4JQIH 1EV2E 4WDIA 2NY2C 3RAJL 4L3EA 3QXVA 2FIRT 15C8L 5DMKA 2V5RA 4JRYA 3A67H 3ZL4H 4X6DB 1IC5L 3FQWB 3RY6C 5DZNA 2F8OA 1JL8A 2EIEA 2WM0A 4X7FC 3EOBB 3ARDD 4M7ZC 4ONFH 1NCCH 2EXWC 3DUSB 4K7PH 5LWYL 1D5XA 4EN3A 4PJIA 4LMQE 2IAMA 3VXRA 2EZ0C 3HMXH 4KDTC 5F21B 1CICD 1GIGL 4GBXD 1I1YA 2IC2A 2EDEA 1C12B 3BP6B 3OJ2C 4RAVB 4RISL 1OTUD 3GSXB 3SKNA 1MJUH 1T1YA 3MNWA 3QHFH 4JJ5A 3MV11 2YEZA 3V5DB 2H2SD 2D7OA 5D7IB 5AAMA 2I9LB 1CD1A 4UZGA 1R0AH 5T33H 1DBMH 1NKRA 1RIHL 3X3GL 3P0YL 4N8CL 1NQBA 1ND0B 4PRBA 3B9KC 3CFBA 3BDBA 4XWOC 1CDCA 1BECA 4OD3L 1K8DB 4QRRA 4IOFD 5IP4A 3QUYC 1AGDB 3QEGH 2VKXA 3QDJB 1U8JB 3P73B 1BD2D 5E4EB 4XMLL 3O3AA 1LO3L 4G6AD 3N85H 4Z5RB 1T6VN 2CGRH 1EGJL 4IRSB 5E5UB 5LBSL 2JCCF 3QIWB 4JO3L 4PY7A 4QHMA 5ACLA 3C8DA 2QKIA 4JDVA 5HGGS 1JNLL 4K3DL 1TPXB 1FZMB 2VDOH 1RUMH 4S2SB 1KPUA 3MMEB 4HH9B 3UBXA 2DQUL 1FNGA 4K9EC 3BOVA 3OKYA 4CGTA 5EUOF 2WZPD 4RMQA 5CWSB 1YPZF 2AGJH 2P8MB 5E8DH 5TQ0H 4KAQH 4NQUA 4FG6D 1WZMA 1CT8A 3QB7C 3LIZL 1GGTA 1QBMH 2J88H 3U4BL 2C3XA 5F9DC 4JANB 3KPRB 4WHYH 1LP9A 4NPYB 5GGQH 5I17B 3M17B 3O4OC 3HA0A 5F7YC 1MCCA 4TUJA 4L3CB 3WFDH 1IM9B 3UPRB 5DLML 3VE0A 2OTPA 3MLYH 4NZRH 3VRLF 5DVOA 5KAQF 4KJYB 4EXKA 3OJDB 3FMGL 4I3SL 3FB7B 3UTTD 2OTUB 3OZ9H 4GLRI 5F9WB 1KLGB 1T83C 2VN7A 4C56E 2AAVA 4AQ1B 4LKCA 3LQZA 4NJ9L 4XCCL 3INUL 4AT6A 5ECJE 3K80A 5CLTA 1AD9A 3FT4B 2D0GA 5BCAA 3VGFA 4YWGH 1T3FB 1XR8A 4PRIE 1R5VA 3I3BA 4ZXBC 2BNQD 2V2WB 3PHSA 3MRHB 1IEBA 3NIDE 2X40A 1V7NH 2WINA 2W9EL 4N5ED 4Y4HD 1YC7A 2Y6SD 2QQLL 5FHBH 5CBEB 5JZ7D 3WL9A 1FAIH 4HUVA 1MJ8L 4MS8C 3DX9B 5B39G 1TQBC 3MNZB 1NEZA 5AYUH 2FEDC 3QDAA 4P5MB 3O2DA 1VFUA 5CP3H 4XNMB 4WI7A 3GBMH 4OLYL 1G7QB 4Z76B 1TITA 4ZTOH 1FORH 3G9AB 3SJVE 2QQKH 4WI8A 3B8SA 4X7EC 1K3ZA 4JO1H 5E70A 3TO2B 4OZIB 1JFQH 1NMAL 4UQ2A 5K9KA 3SO5A 1KBGH 1HK6A 4UT7L 4C4KT 3VD5A 5EA0L 3QULA 5KSAB 4DKDC 1QSFB 2F53D 5HVHB 3IJSB 2H9GB 4NQXB 3QI9A 3ARBD 4GW4B 3I9GL 4QNPF 4WI6A 3T2NL 5EBLA 2DLEA 2EIDA 5DQDH 2AI0H 4F9PA 1W0VB 4YHPB 3SQOL 3P9LB 1N2RB 5B4MD 4G8GE 3SGDI 4KUZH 3PWPD 1DQDL 1BOGA 1VERA 1FIEA 4LBEA 1CXKA 2V9QA 4GAYA 4NDMB 4OZFH 3A6OA 1N64H 2HH0L 4O00A 3VD9A 1LDSA 1G6RA 4H88L 2YR3A 4OD2A 4OZGB 3PGFH 1JV5A 2DQEH 1HILA 5BQ7B 1HH6B 2ZUTA 4MLSA 1HKLH 3EDDA 3EBAA 3HE6A 3H9HA 5D96C 1T1ZB 4TPRH 1MUJB 4Z7VA 5I66B 4ZAKA 3KLHD 4ZODA 1J8HA 5DJ2B 3THMH 2Z92A 3V4PL 5CHNB 4M5YH 2GJ6E 4K2UL 1WBXA 1S8DB 5SX5H 2DAVA 3QUXA 3C5JB 4NJAH 5A16B 4F7CA 3BSZH 2RHEA 5IOPA 3LEYH 1MELA 3EJYC 2VXTH 5LQBL 5TPWL 1B0RA 1BQLL 1TVHA 2GSGB 2HTKD 4XVUD 2BERA 4UV7L 5HHME 1WWAX 1SMAA 1VEPA 5EBWA 4ODHL 4GLRH 2IGFH 2OQJA 2IMNA 5F9AC 1ADQH 3CSYA 4TVPE 2B4CH 3TO4C 2R9HC 2DLFL 3O9WC 3CXHJ 4PGJA 1N7ML 1MWAB 4Y8AA 5E2VL 2UVFA 5SWSE 3CMGA 2BVEA 3LEXB 3MOAH 4DTGH 2AQ3A 2FSEB 4LVNC 2XTJD 5TDOA 3NGBC 3VFWB 3FRPA 3I85A 3WUWA 1TIUA 3ROOB 1YMHA 2EYTB 4IRJA 3BWAA 3OWEA 4KKNA 2R2CA 1ACYH 4FFYH 3TIEA 5ANMB 2APXA 5CEZL 3QXAB 3UX9B 3B3IA 3U0WL 3E0GA 1I7ZA 4GKSB 1K3IA 5IFJA 5GS2H 2OXGA 4KROB 4NHUA 1T04A 4Z7QF 1EERB 1JTPA 3QDGB 2VLMD 5IKCB 1BGXH 1CL7I 2LV4A 4XVJL 2YUZA 4PJXA 3JV6A 4MQXC 1BJ8A 1J0KA 4L9DA 1IGCL 4S1SL 2LQRA 5DVLA 3VFNB 5C0CA 2FECL 4LQFH 5FM4A 3KPPA 5GGRB 1Y0LA 1XF1A 1FLTX 3IFPA 5JA8B 5SX4I 1NAKH 2IQ9L 4JDZB 1HCVA 5IVZB 1QSED 1KIPA 2BVOB 2D03L 5KSBB 4PRHB 1U58B 1IGFL 3ULVL 1TENA 3BPOB 2P5EE 2BY1A 4WEBH 1F4YL 1X7QA 5JIPA 4GG6B 1J0JA 3WHE0 1TZGL 4YBQC 3IJHB 1VDGA 3CLFL 2B1HH 2F19H 3B2VH 5KN5B 5F72S 4XNUH 1A7QL 3I75A 1OY3B 2J6EA 1RUPL 2GFBA 4U49A 3MRFA 3T0EE 4I3GA 4NQEB 5E6IB 1FRGH 4WY7H 5A2JH 1SJHA 5FO9B 2YPVL 3WNNA 1YQVL 2Q8AL 3RUGA 1MLCB 1YEEH 4QHUA 5CAYB 2Z31A 1KPVB 2UWEA 5AAWA 3HPJA 4MJ6B 4NN6B 4X7CC 4KY1L 5INDB 4NQSB 1S5IH 4PJFF 2A9MH 2BSRA 5IB1A 4H25A 4NKOB 3IGAA 3N1MC 2XN9B 4LSSH 3HZVB 7FABH 3F58L 2IBZY 1KYOK 1B2WH 3CFCH 4LSUL 5JW5A 3DRTA 1WT5C 5BXFB 3SE4C 1Q9OA 4UTAL 1WUNT 2DJSA 1H15A 4DVBB 5IMMA 5FIEA 5C0RL 1XT5A 4O51A 2JB5H 5TE4H 2VE6A 35C8H 4B7IA 1IKNA 5ADOH 4J1UA 3CFKA 1CIDA 4LMQI 2J1KA 2VXSL 3IFNH 4I5BB 1C16B 2F54A 3MA9H 3T65B 3TNMA 4F80A 4NOFA 4NO5A 5FV2A 4HJ0C 3C5ZA 4JG0L 3R06A 2AK1L 3EDJA 4JKKA 2YC1B 3DO7A 5C07B 1A7RL 2MWCA 3X13B 1MI5A 2OXHA 4MAYB 5I76A 1CIUA 3JVGC 3U48A 5DUPH 1QYGH 2B20A 1ZA6A 3ZKSD 1WZLA 4YHKL 1YNKH 5D7JA 4N0YH 1XGYH 1AGEB 2DS4A 1CL7H 5IT2L 2HFGL 1ROWA 2QADC 2W07A 3HUJB 4TYUA 4WRLA 4PJ5E 3L5HA 1JUFB 1MCLA 4AYFA 1I3VA 1S7XA 5F1OB 5JW4Q 2H32H 1LDPL 4PJ8B 2Z8VC 2Y5TA 4G9DA 4U31A 1HHGA 2CIIA 4Y2DC 5FYJL 1KXTB 5DRWB 1I9RH 3CZFA 4OLWH 5SX4H 2YD7A 3GEWB 4L3EE 1KNOB 5DD6B 1WWCA 1KB5H 4IJ3C 1A4KB 1DQMH 1U8OB 4G9FB 4Z7UB 2X10A 4X9FA 3W11C 5D9SA 3TT1H 1F90L 3VGAC 1IGML 2JB6B 4PJIE 3VXRE 4WTZG 1KIUA 2AXJA 4X6DA 3FQWA 4MXWH 3EZ8A 2BSTB 5GGTL 1YEKL 3EOBA 3KS0H 4XPBH 2D7TH 3A6BL 3DUSA 2Q6WB 4U1IB 3OJVC 3SKJL 4RQQB 3QPQD 1F6FB 1OQOA 3BP6A 1C12A 4RAVA 3VWKC 4EDWL 3GSXA 3MSPA 2X2YA 5T3XE 4Z7WF 3CZJA 2DLTA 3V5DA 3FRUB 2O93L 4XC3H 5E2UL 1UZ8B 1CDUA 4JJHA 5D7IA 3VU2A 2YZ1A 1T0NB 2I9LA 4QRRE 3VWJC 3GHBL 4AIXA 4OLXH 4YUEL 4ZUVB 4JFDB 1ND0A 2E7CA 3BO8B 4Q9QL 4Q9BA 3X11B 2VQTA 1XGQB 5E0QA 1K8DA 3VMOA 1ZMYA 1CVSC 4O5LH 3W82A 3O4LB 1AGDA 3MQIA 4JPWL 3S8WA 1QBAA 2V5TA 5GQBA 5JPMB 3QDJA 1CU4L 1U8JA 1DN0B 2VDPH 3P73A 4MCZB 4Z5RA 1C5CL 3PWVB 4G6JL 3RVTD 1SBBA 4IRSA 5I8CB 3QIWA 4H8WH 4DW2L 1I75A 4E5XB 5I1DB 1OSPH 1WK0A 1FZMA 1BX2B 1AHWC 4HIJB 3PJSB 4ZQKB 1DE4B 4TULH 4S2SA 4OM1H 3MMEA 4HH9A 5FM5M 5C0FB 1XH3B 1DR9A 2EH8L 2GCYA 3K0WA 1DDHB 5CWSA 1GC1H 1LP9E 4P3DB 2P8MA 2MQ3A 4YFLF 4AG4H 4CU8A 2CD0A 2F74B 3G5ZA 4OCLC 4FA8A 3KHQA 1MRDH 3DVGB 1RZKC 1EO5A 1K85A 1FIGL 3RKPA 4JANA 3KPRA 3SE3A 1EEQA 2EIZB 5AZEH 4JM4H 3V0WH 4NPYA 4R2GB 4LNRB 3M17A 2MCPL 5I17A 1CYGA 3PUCA 1NFDF 5F1SA 1HDMB 1FYHB 4P9HL 5H37G 3PP3H 4CN1A 4L3CA 1WV7T 5A3ID 5EB9A 3QNXB 1IM9A 1RUKL 4GAGH 3UPRA 5HHXH 1X4YA 1RIVL 3MODL 2PYEB 4KJYA 3OR7B 1MQKL 1Z2KA 1AY1H 3OJDA 1JPSH 4MZ3A 2NY3D 3FB7A 2OTUA 1G7LB 2I5YH 4X4ME 3ZSTA 4E0RB 3GO1L 1NFIB 1KLGA 5DTFB 1S3KL 2VDNL 4KH2A 4AY0A 5F9OL 5EZJB 3VRJB 5FUZH 4BSJA 4YE4H 2R1YB 4M3KB 3FT4A 2W9DL 4NKQB 1KN2H 3MXWL 4FQ1L 1CFVL 1DBBH 4JFZH 1T3FA 4DKEL 3MRHA 3UYRH 5DRZB 2APVA 2DM7A 3G6JF 5BV7B 4ZTPH 1TCRB 3WFZA 3T3ME 4TVPD 4GAJH 5CBEA 1OM3L 1WVZA 3MNVB 1H3TA 2DBLH 3DX9A 4LVHB 1DLFL 1URLA 3MNZA 3BZ4B 4L8CB 4P5MA 2AK4B 4XNMA 4Z76A 1E4XI 1G7QA 1SEQH 5SWSD 4JFXB 3K8LA 1PLGL 1T1WB 4LNVA 2BVUA 1RZIA 1ZGLM 4D9LL 1PAMA 3ZDXF 3TO2A 1E4KC 4OZIA 4NUJB 3HZYB 2VC2H 3PL6D 4BZ1H 5KSAA 5EZIL 3WS6C 4RGNE 1QSFA 3AB0C 4HCRA 3BDYL 3IJSA 2H9GA 4WGVB 5E5RB 3SDDB 4NQXA 1GPOH 4GW4A 1T0PB 4RRPG 4XI5D 4FXLA 4PY8I 1W0VA 1CLYH 1NCUA 4YHPA 3IXTB 1T7YA 3P9LA 1N2RA 1EBAA 4XCYB 4DQOH 1R3HB 1KCLA 1KJVB 1Z9SA 1PSKH 2BMKB 1SVZA 3L5JA 4NDMA 5DUML 5DJ0B 1S7RB 3L5XL 3N50A 4LPXA 4Z7VE 1Q1JL 4R7NB 4Z7NF 3QHZH 1CBVH 2UZIL 4OZGA 3TZVB 2J8UF 2VUYA 1J8HE 1L6XA 2EH7L 3QEQE 4QWWC 5BQ7A 1HH6A 1CLZL 2V17L 4M93B 1SVCP 3MFGB 2OR9H 2UUDK 4MNHB 2CLZB 4WI3A 1T1ZA 4FQJH 1MUJA 5I66A 1A7OH 3TP4A 5EC1B 5DJ2A 3QAZC 2F58L 2BHYA 5J4MA 5KVFL 2P5ED 5CHNA 3W5NA 2P47B 2HKHH 1HXMB 3U0TB 1LE5B 2R4RL 4LAJH 4P46D 3OKOB 3NA9L 3QUZC 3MRKB 2BSED 3GIZH 5FYLL 4F37K 1X5LA 1S8DA 3C5JA 1LMKA 3RTQD 5A16A 5DO2D 1D9KB 3F7VB 5FGBA 2GSGA 1M6OB 3CPLB 1NCAL 1DJSA 5DDHB 1AGFB 5F7EH 2VDQL 3GKWL 4X5XB 4F58L 3RRQA 1G0YR 1MFNA 2DN7A 5IQ7H 4XMLH 1LO3H 5I8OH 4LCIH 3R0MA 5FGCB 2NY6B 3BIKB 3MRPB 3NIGE 1EHXA 4UV4L 2Z91B 4XPHL 5JDSB 1MWAA 1QFWL 4XPFL 4DGVL 2EC9T 4LRIC 2CK0L 3TH3T 3IDXL 1XIWB 3LEXA 3AM8C 3WFCL 2FSEA 5GJTL 2FX9L 4EI5D 4YAQB 3VFWA 1NGPL 4PJ7F 3ROOA 3PDOB 2EYTA 1G7MB 4AIZB 4PJ9C 1X5IA 3V95A 3JBG7 1NCBH 3HZKB 5ANMA 1INQB 2D0FA 2VITB 2A83B 4N0RA 4PJXE 3MLVL 3QXAA 1E4XH 2R69L 3F8UB 4GKSA 1XFPA 3QDGA 5C0CE 1ZHNB 5IKCA 3CMOH 3OMZA 1AQKL 5FDYA 2A6JB 1GL4B 4LSDA 5IBTH 1RUAH 1CLCA 2CUIA 2BY3A 4TVPH 4RA0C 5JOPD 3WIIL 3AREC 3VFNA 1B0WA 1MFBH 5GGRA 1CDJA 1KCRH 1QRNA 4J3OC 3MLZH 4P2QB 1TXKA 4WHTB 4FNLH 4JDZA 2Z9TA 5IVZA 3PWUB 1FCCA 2BVOA 2WQRA 1VSCA 1M1SA 1R3IL 4HKJB 5KSBA 4PRHA 1U58A 3I6GB 5DT1L 5FO8B 1ZANH 3BT2H 4NN7B 2A77L 3GJFK 2W9EH 2FCBA 1IAII 1IC7L 4GG6A 3RWJB 3RWIB 2IF7A 4PRNB 4ZFGH 3IJHA 4Z77A 2BOCB 3GJEB 3HE7D 3R0NA 4UMGA 4WW2C 2FDBP 4YFEA 5KN5A 4ONGL 2VSDA 3RUGE 2DRUA 3SY0B 1JF1B 4GO6B 4LASL 2R0WL 3FB6A 2UWEE 1E27B 3HR5B 5C0BD 4NQEA 2AJVH 5E6IA 5FF6B 3H9ZA 5TQ2H 4N5UA 5FO9A 2IAMD 3QWOB 4ZO8A 1RZ7H 1MLCA 1ZOXA 4HUMB 5FM5O 3QA3B 3VI4E 5ILTL 1P5UA 1KPVA 3T0EC 2NXYD 4HIXH 4MJ6A 5GRYA 2HJFB 5INDA 1WFOA 4NQSA 4L8DB 4JPKL 4NKOA 2VAAB 2XN9A 3SQOH 3HZVA 1CGUA 4HLZH 1DANU 1PY4A 3DOSA 5T3XD 4C4KO 4FFZL 3T1WA 4QOKB 2AJYL 5BXFA 2F54E 3EAKA 3SOBH 3ZSSA 5I1IH 3ULUE 4E9LA 4DVBA 2FNBA 5IGXL 5DVKA 1F4HA 2H26B 3O41B 4X6CF 5KVGH 5JQ6L 3RX5A 1BREA 3VXQB 3QRGH 2WWKT 3T65A 4I5BA 1C16A 1R3LB 4M6ML 3HI6H 4XAKD 5DK3A 2IMMA 2NX5D 4GSDL 1MI5E 4WHDA 2PO6B 2Q1EA 5D70H 3RI5K 4Y4KD 1DTUA 2YC1A 2VLKB 3QWRA 5C07A 1MCOH 4MB3A 4CL7A 1ZVHA 3X13A 3D48R 2PTUA 4MAYA 1AXTL 4OSUL 5L7XH 1EUTA 3OKLB 3FFCD 3SE8H 5LQBH 1AGEA 1P84J 1BQLH 5IQ9B 2VLLB 2W60B 3MUZ1 4M5ZH 4U33A 5TE6L 3HUJA 2DQDL 1JUFA 4NC1E 3RIFK 2WUBL 2FX8H 3K2UL 2XV6B 1YY9D 4JFOB 4ODHH 3EFDL 3VFGH 4CVZB 4PJ8A 2XZAL 4PJCF 1GGCH 3S36L 2VXVL 3KS0J 4G8FB 1NANI 4OQTL 3AGVA 4FP8H 3ALXA 5DRWA 4IDJL 5SV4A 1CK0L 4JO2H 3FAXA 1OCWL 1KNOA 3D18B 4FQXD 1Z9OA 3LS4L 4NZJA 5DD6A 4PGDB 4NCDA 1A4KA 1U8OA 4G9FA 4Z7UA 4KZEH 4X6DE 3O6LL 2Q8BL 5CJBA 5DMJB 3LDBC 4P59H 5C0NC 3IYLW 4JLRB 1RURH 1IAIH 4JDTL 3QISA 2JB6A 1A3LH 3QCUH 3ARFB 3OAUL 2OSLB 4N8VB 2BSTA 1E6OL 4WO4B 5TFSL 5JOEA 5E7FA 1BQUA 4I0CC 3T3PF 1TNNA 5T5FL 3LQMA 4MDIB 4OFYA 5IVXF 1QFUL 2Q6WA 4U1IA 4EN3C 5BJTB 3PE9A 5D7IE 3UTQB 1UACL 1KJMB 4RQQA 5CJ5A 1UA6H 4XVJH 4IMKA 1WZ1L 1RY7B 3MV8B 1VFAB 1YC8A 2ED8A 4ZPTB 4LVOB 3FRUA 4LSPH 1EJ6A 4YHML 1UZ8A 4P3CL 1T0NA 3LCYA 3VW3H 4GQ9L 2GITB 4H26B 4XPAH 4ZUVA 1N4XL 4JFDA 4QY8B 1JHKH 3FQNB 3MJ9L 4J3SA 3QDJE 2AJXL 2R0LL 3BO8A 2PXYB 3QG7H 3X11A 1XGQA 4HF5H 5CP7B 1MLBB 1W2KT 3O4LA 2LTQC 1LD9B 3RDTB 2BJMH 3QI9D 3RJDA 5BVPH 3RIAF 2FJHB 5JPMA 4JFEB 2HVJB 1DN0A 1JNHB 3L5WB 3NPZB 4MCZA 1J12A 3HG1D 3PWVA 1ZGLB 5I8CA 4JY5H 1TZGH 1RZJC 1WISA 2D9CA 5FYKL 3BKYH 4E5XA 5K9JL 1FJ1B 5IWLA 5I1DA 3IDJB 3OPZH 2XNAB 1SQ2N 5CD5D 4BQBA 1BX2A 1B6UA 4HIJA 1FO0B 3PJSA 1DE4A 4ZQKA 1OOAA 4HK0B 5C0FA 3FONB 4EBQL 1XH3A 3HC4L 2ARJQ 4G6MH 5T3XH 3F5WB 4KHXL 4EIZC 2Y23A 3KPRE 1DDHA 1S7VB 4P3DA 5FA4B 3S35L 1F58L 4KK5C 5LAXB 2F74A 4MZ2A 3DVGA 2F8VA 3QFJB 3SDCC 5GIRA 3H9SD 3T2OA 3DXAB 4X98B 1FQ9C 2EIZA 2X4TB 3QEQD 3SPVB 4ZO7A 3NMEA 4LNRA 2E9IA 2Z8WC 1HDMA 4OI9A 4LQ1A 4U2ZA 2R2EB 3UJTL 4R8WH 2CUHA 1G9NC 1U3JA 3QNXA 2VMFA 5D1XB 3OGOE 1J18A 3QWQB 1FL3A 2PYEA 4XP5L 2HKFL 3OR7A 3ARGC 1MF2L 2NY4D 3QNYB 5F88B 3W2DH 1G7LA 4Y16D 2UYLB 2DQJH 1NFIA 5DTFA 4E0RA 3HZMB 4S0SD 2P49B 4DK6A 5GGVH 5FK9B 5EZJA 5CGTA 3VRJA 4X0KB 1QSZA 3KJ4C 4HSQA 4UT6L 1XCQB 1GZPB 4NHCL 2R1YA 3QDMB 4G6FD 4IS6B 4ODTH 1U8QB 4HGMA 3EYSH 2WP3O 1CF8H 1N26A 3VD7A 1VACB 1KEGL 2JJUA 4GQPH 4YJZL 1VGEL 3LH2H 3C6LB 5DRZA 2FH6A 5GISH 4HMEA 1TCRA 2NMSA 2DF3A 4JHBA 4J7RA 3TN0D 3WFBH 3MNVA 3JXAA 1TETH 8FABB 4ZDHB 4Z8FH 1X4XA 4OZIE 3MRIB 2X4SB 3BZ4A 4L8CA 1FVEB 3EO0B 2AK4A 5KTEL 5L8JB 3LRSB 4JFXA 1Q9LB 2XKNB 1QSFE 4HFWB 4Q58C 2PTTB 1T1WA 1NC2D 2DWDB 5IROA 5IB2B 5L6YH 2XTLA 3WE6B 3S9DB 4PB0H 4NUJA 1OLZA 3HZYA 3VCLB 5JTWA 2DTSA 3GMQA 3BZEB 2R23B 1FL5B 3QZWB 4U3HA 3SDDA 1YJDL 2B2XH 2KBGA 1CFTB 4DEPB 4O9HL 2ICWB 4LOUD 2NY1B 2GIYA 3DHMA 4RGNC 3WNLA 3IXTA 4LPYA 3IXAB 2BX5A 4OZGE 5DFVD 5HHOB 3O2DH 4XCYA 1NAMH 1R3HA 2F8XC 1KJVA 2FJGB 4KKLC 5ID1B 2BMKA 5B21A 1DBJH 1S7RA 3H3BC 3JV5A 1H3XA 4BUGA 3U36B 4R7NA 2QL1A 3TZVA 1NCWL 1BZQK 1VESA 3F7QA 5D93C 1B4RA 1FGVH 1UKTA 2ORBH 5JXEA 3QPXL 1MHCB 4F15B 4C83B 5FEBA 1FFPB 3GUTB 2Y06H 4MNHA 2CLZA 4FTVB 3H7LA 2ED9A 4ZAKC 3VMPA 4YZFE 2DJ4A 5EC1A 4P3WA 2NY7H 1HXMA 3NTCL 3U0TA 1LE5A 3TJEL 3OKOA 4B0MM 3MRKA 4MDJB 1WSST 4MHHG 1OTUC 1VHPA 5T5NG 3QUXC 1D5ZB 4GUPB 2Z93B 1G6RH 3MLWH 1D9KA 3F7VA 1P7QB 2IWGA 3PNWB 1M6OA 2NY2B 1IGIH 1K6QL 2APTA 3CPLA 1JBJA 5DDHA 1AGFA 5DR5H 4FOMA 1VFOA 4X5XA 4NO3B 3TH2T 5I75C 5GS0C 2X42A 2HFEB 4DGIH 3CFDB 4IOFC 4M7ZB 2WWMC 3ARZA 4WUKL 5JLZB 2OK0L 4F7TB 4LEXH 2HT4D 3BIKA 3MRPA 3B4NA 1MEXH 3CVHL 2Z91A 4LAQL 5C6TL 5JDSA 1JPTL 4N1CA 1YEGL 5CZVH 2J2ZA 4X9GA 1EHLH 3CC5B 3ALPA 4O02H 2AVGA 1XIWA 5FCUL 5ANME 4HWBL 4R97C 4YAQA 5I1CH 1X5XA 1L0XA 4U1SB 3PDOA 1FL6B 1G7MA 2WLZA 2X89D 1WAAA 1J86A 5TDNB 3QDGE 1A5FL 3R8QA 5IFHH 1MCBA 3HZKA 4PY8J 1INQA 4LP4A 2VITA 1I9JH 2A83A 1OGTB 3E6HB 1X5FA 3QUYB 3U4EB 4WU7B 1UKQA 1ZHNA 4M43H 4NM4L 3L3GB 3TESA 4AEIH 4I0PD 1RAMA 4MXQD 2A6JA 2F5BL 3E2HB 1QRNE 5I16B 3U9UB 4K23H 4ZFOB 3MACH 4NGHH 3ARYA 4NC0B 5KSBE 3CDGB 4PRHE 5FKAB 3D2UB 4M48L 2DD8H 5E99L 4LFHG 4P2QA 4WHTA 1Q0XL 1TNMA 5DGRA 4GG6E 3PWUA 1QFWI 3UC0L 4HKJA 3O3EB 1KLFA 3RA7H 3W9DB 3I6GA 5C09B 5FO8A 5EU3B 1I1AD 2YMXL 3NCFB 4K3EH 3UJIL 2VDLL 3RWJA 3RWIA 5J1SC 4Q74A 4WTWA 1JZ8A 4PRNA 4YIQB 2Z8RA 5KVEH 5EWIH 3MRGB 1QBLL 1ORQB 2BOCA 3GJEA 4NQEE 1KEML 2Y6SC 1YEJH 3M8OL 4M7LH 5KW9L 4HH8A 3SY0A 1JF1A 3CFIC 2EDKA 1TJHL 3VXOB 3F6IA 1E27A 3HR5A 3MROB 3RVWD 5FF6A 3VD4A 3TT3L 3I84A 3QWOA 3BPCB 4OD1L 1AJ7H 1NLDH 2XN9E 2AV1B 3QA3A 4KMTL 4XP9H 2HT3D 4YHZL 1CN4A 5JW4R 2HJFA 4L8DA 2VDML 3OKNB 2Q7YB 3OX8B 2CMRL 5BO1H 5F7LB 3AS3A 2HTLD 4K7FB 2VAAA 4KI5E 2IAND 2FHCA 2AJ3B 4OGYH 3A0OA 3WJLC 5CKAA 3GIVB 3O6KL 4QOKA 2J6EH 2V5SA 2W59A 4TRPL 1FN4B 1RIUL 4JN1H 4UILL 5B4MC 4XP1H 3JWOL 43C9B 2H26A 3O41A 5EOTB 4K3JH 5KS9B 4PR5B 2V17H 1LO0H 3QDJD 4JM2B 3VXQA 2N4IA 1QOKA 3FT3B 2EEAA 2WW8A 3ZYJA 1R3LA 1BEYL 1FC2D 3MZTA 3CK0L 4HPOL 5C07E 4BSVB 2QSTA 3C5ZC 5I8KH 5FOJA 1KCUL 2PO6A 3MBXL 4KTEL 1JTOA 5INCB 2EDFA 4U05A 1SBSH 2EDRA 2C5DC 1WIUA 4PRAB 4H1LB 2VLKA 3GBNH 3HUJE 5CJXC 2VB5A 4TVSa 3RWCB 1BIHA 4YPGB 3FO0H 3OKLA 5D7JC 4KZDH 5IQ9A 2VLLA 2W60A 3Q6FB 2JIXD 2ED7A 3KPRD 2R15A 4OIAA 5DC0A 3ULUH 4JFOA 4CVZA 4G9FE 5F6IC 4G8FA 1LK2B 5D96B 4KHTL 3BPNB 2HA1A 4XNXL 3D18A 4NRYB 4D0CB 1VFMA 2W0FB 4PGDA 2YSSB 1G9ML 5BOPA 3GM8A 4ODVL 5J3HC 4OB5L 5D1ZC 3PQYB 3VDAA 1TFHA 3JTTB 4JLRA 2ZWLT 3O3UN 2O5ZL 1I7RB 3IETB 3ARFA 3OKMB 1BQSA 2OSLA 1IMHC 4N8VA 3L5IA 5DHYB 1CD0A 4WO4A 1II4E 3IS0X 3F65A 4OT1L 2CDGB 3I6LE 5EORH 3GSVB 4MDIA 4ODUB 2R69H 1KFAL 5BJTA 1VADB 3K81A 4OCMC 5DJCB 5E5MB 2ADGB 3TA3D 3S37X 1AP2B 2VXQL 3ZE0E 3UTQA 1KJMA 5HDBF 3CDCA 2GW5A 5D6CB 1AQKH 2JELL 4G5ZH 4JFDE 5JW3L 3MV8A 3O0RH 1VFAA 3SE9H 1OAYH 4ZPTA 3DROB 3E1F1 3CVHB 3EDEA 1Z6JT 4P23D 4WW2F 3WIIH 2ZPKL 3O4LE 3UTOA 4R6UA 5C08B 2GITA 2JLLA 4H26A 5D7KE 4QY8A 1DBAL 3FQNA 1CXEA 1Y18A 1FYTB 2PXYA 1A22B 3NGBB 2HWZL 4OFIA 5KSAD 5CP7A 1G7PB 1QSFD 1MLBA 5C71A 1UZ6E 4D3CL 3LQAC 1LD9A 3RDTA 3PXJA 3C8KB 4KVCL 4I0KA 3ETBF 1JPGB 2FJHA 2N1KA 4JFEA 2HVJA 2B1AL 1JNHA 5E4EC 3L5WA 1LO4H 5ISZD 1FPTL 3KR3L 5C2UB 4MWFB 2YXFA 4IRSC 1HE7A 5J57B 4NUGH 1ZGLA 3QIWC 3VI3E 1FJ1A 5JMRA 1KGCE 4KMQA 3IDJA 3B2UD 2XNAA 5C0IB 4JRXD 3BI9X 1FO0A 1YYLL 4HK0A 3QQ9C 4ORGB 3FONA 2OLDA 1WICA 1F4WH 4J4PD 3TBWB 3F5WA 3QSKB 1MCPH 1RK0B 3UROR 1S7VA 4PJDB 1NBQA 4WUUB 3WLBB 5F1NB 5FA4A 1ZAGA 4GW1B 3KVQA 5LAXA 1NCNA 5GGSB 3VG0L 4XX1G 3OGCB 1JCKA 1T2QH 3QFJA 3S88L 1CFQB 1QQDB 1X6NA 2EDTA 4MVBC 3SE3C 3DXAA 4N0UB 4PIRF 4X98A 4Q9RH 2X4TA 3SPVA 1O0VA 4KTDL 2PYEE 5FYKD 2R2EA 2YUVA 5E2WH 3QQ3B 2BRRL 3DMMB 1QG3A 3V52L 3NACL 5D1XA 1MFCL 4E41B 3UJJH 4HJJH 2XACC 3UTSB 3P77B 3QNYA 5F88A 4S1DD 2UYLA 4TNWK 2C7UB 1AC6A 3HZMA 2GJZA 5FK9A 4Y4FD 4X0KA 4FHBD 2P48B 1TTUA 4U3CA 1XCQA 1GZPA 5FFLA 3QDMA 1HH9B 2O26U 4EEEA 4IS6A 5I71C 1U8QA 4CN6A 4YHIB 4ENED 4M00A 4XNZC 3C6LA 1K4DB 1U8KB 1HZHL 3MLUL 1I8IB 4JGMA 1RZGB 4KJPD 3SCMB 2X1XR 2AXFB 4OF3A 5HYFA 3JUYA 4Z0BL 3Q48A 2MNUA 3O8XB 4P4KB 8FABA 1T03L 1UH3A 4MJ2A 3MRIA 1EFXB 2X4SA 5IHUH 2VNCA 1FVEA 3EO0A 3LRSA 1Q9LA 2XKNA 4HFWA 2PTTA 1FE8L 2DWDA 1G84A 5IB2A 1P4BL 3WE6A 3HTLX 3S34L 3VCLA 4PJIF 3BP5A 3BZEA 2R23A 2BK8A 4J3XA 1FL5A 5HVHC 3QZWA 3NCMA 1RFDH 3NCYS 3OXSB 1DL7L 5DXWA 5TF1L 4F57L 3MREB 3RGVD 3JV0A 1CFTA 4KI1A 5JQHC 5D5MB 5LXGL 4OCWH 2ICWA 1PEWA 2CKBB 4PGBB 5DI8B 3IS1X 3O6LH 3MLXL 1QBBA 3IXAA 5HHOA 4YO0B 1QRND 3NZHH 2IEPA 1WEJL 2FJGA 5ID1A 4LSRL 4B5EA 3EOTL 2C3HA 3CLEH 3I50L 1S5HB 4F3FB 3U36A 2C4FU 5TFSH 2QADB 1MHCA 4OLUL 3MRBB 4C83A 1FFPA 3GUTA 4HCRH 2GT9B 3CXDH 4FTVA 1U6AH 1MCFA 4OKVB 3OJMB 3VDBA 4R4ND 4LPVA 5EU4A 3BD5A 3H3PH 4XP6L 1W72L 2R8SL 3VXSB 5I1JL 4ZD3L 3S37H 3QPQC 4MDJA 2AS5M 4OJFH 4RFOH 4CRPA 1AR2A 1D5ZA 4IJ3B 4GUPA 4WWKD 5FGSA 1LE9B 5E6ID 5K93A 2Z93A 1XEDA 4CJ0A 5BMFH 3IAPA 1P7QA 3PNWA 3BYYA 4N8PA 4GXUN 3DSFH 3VGAB 12E8L 5ID0B 1G9EA 5FGCE 3D85D 4K3HA 2XXCB 4NO3A 3BP4B 2HFEA 3RY6A 1MCWW 3CFDA 4D9QD 5BS0D 4O2CB 3U1SH 4PRDB 1ZS8B 3RGHA 2K7QA 3NN8B 5JLZA 4U0RB 5D2NB 3V6BR 4F7TA 3GMOB 3K4AA 4KDTA 2XZZA 3T2PA 3PXHA 3VWKB 4KK9D 2NY0D 4M7KL 3NABH 4Y88A 1MRFH 3GM0A 1A6WH 5ICYB 3FQTB 2E3VA 2A1WL 1I8LA 1KIRB 3NA4A 5CUSH 4U1SA 1FL6A 1S7TB 2NR6C 5IEHB 2CR3A 5DD0L 5TDNA 1VFBB 2H2PC 1KOAA 1TZIB 2Q7NA 1SYVB 4U3XA 2BCKB 1OGTA 4JGUA 2MOVA 3E6HA 5GZNC 3QUYA 1KCKA 1M7IB 4OIIL 5JHDB 1BBDL 3U4EA 4WU7A 2BVPA 1IBGH 4M3JA 4Q0XH 3EDFA 4P5KB 3WD5H 3L3GA 1WCBB 1A6VH 1MWAH 3S96B 1YN6B 3BX7C 4RBPH 5EZLB 5HYQB 1MRCH 4TUKL 3ZYOA 5I16A 1JHLL 4P2QE 1T2JA 3U9UA 5MENB 4ZFOA 3RQ3A 4XVTH 3T3MF 43CAB 2I9TB 1OTSC 2A74B 2CUMA 3P9WB 1FG2B 1U8PB 3CDGA 5FKAA 3D2UA 4EVNB 3KXFD 2VWEE 5IV2B 4QRQB 3KJ6L 4LHUD 4IIQC 5A43C 4KMLB 3O3EA 3W9DA 3EYVB 3GK8H 5C09A 3BPOC 3FO2B 5EU3A 5L88H 5I18L 5DWUH 3QCTH 4HS8L 4OGAD 1TLKA 1ZT7B 2AJZB 3FB8B 4MA3B 3FOMB 4YIQA 3MRGA 1ORQA 5IEKB 1B9ZA 5EIIB 1JNNL 5LGHH 4KUCF 2LFGA 3JZ7A 3KPQB 2MPAH 5HDLA 1QP1A 4GMSL 4OCXH 4Q6IB 4QGTA 2O5YH 1FV1B 3VXOA 3MROA 3LZFH 1SY6A 3ZKND 2DTML 4FFWD 3MPCA 2R2BA 1XR9B 3BPCA 2BFVL 4Z7VF 5KANG 2AV1A 3JWNC 2EXYC 3KYKL 4Z7QE 3I6LD 4Q9CA 2Q7YA 2ZUVA 3OKNA 3OX8A 4QOKE 5HJ3B 4K7FA 4JKLA 2DYPB 2R29H 3D25B 4XB7A 2AJ3A 5GRUH 3TGXA 4JFDD 4XVSH 2D4FA 2KH2B 3GIVA 3E3QE 3R1GH 4PGCB 5D1QB 1T89A 1I7UB 2C26A 4NP4H 5GHWL 3CIQA 1FN4A 3MUGB 4FABH 4O58H 4P9ML 3BW9B 3MLRL 4XHQA 2B39A 5DJ8B 2Y25A 2YPLB 43C9A 5KS9A 5EOTA 1AKJB 4PR5A 3HKFA 1HNGA 4JM2A 3FT3A 4FQPA 4PD4K 2HRPH 4ZPVA 5F7UA 3DV4B 5BVJB 4MA7L 4TQEH 4BSVA 2VJXA 1BBJB 1CZ8L 2LVCA 3AB0B 4U7KA 3RU8H 5INCA 1EJOH 3AXLB 4PRAA 4H1LA 1JRHL 1C1EL 5KG9B 1OARH 4MAYC 3AROA 5EIQA 5ALBH 1KGCD 5CSBA 1GOGA 4KPHL 3RWCA 4YPGA 2J8OA 1DQLH 2ZG3A 3EOYG 3OAZH 2DQTH 3Q6FA 1ZLWH 1IAOB 5C7XH 4LSQL 4PS4H 4F33B 2VAJA 5C0EB 4R2GD 1T2XA 5DMIH 4OCNC 2YD9A 3GHEH 4PJ8C 2W91A 4KRNA 4LLMB 4PJFE 4UIKH 2H41A 4MAUL 2OK0H 1ACZA 1LK2A 5DMGD 4S1QL 4IOSD 4PJXF 1A6ZB 4HG4J 3KG5A 3VFMB 4DN4H 1X5JA 2DDQH 4NYLB 5CMAB 4NRYA 4D0CA 3ILQD 1DQJB 2W0FA 3QAZB 3QIUB 2YSSA 2YUXA 3QG6B 3PQYA 3ZT7A 5H37H 1MCRA 3ARWA 3JTTA 5AWNH 1RD6A 3OKDB 2YRPA 1A6UL 1MJ7L 3SDAC 2WBJB 3IETA 3MOQA 2MHAB 3OKMA 5DHYA 2NQCA 2E7LA 5DJAB 2CIKB 3M45A 2CDGA 4GKOA 4OGXL 3GSVA 3MV8E 4FQIH 4ODUA 3BKMH 3U2SB 4YXHL 1JZ7A 1VADA 5E5MA 5DJCA 2ADGA 1AP2A 2AEQH 5MERB 2O5XH 3T77B 5D6CA 3F12B 3FQRB 4P2RD 4M1GL 3J8F7 2EDDA 1R24B 4LARL 5KJRH 4FQ2H 4PFEA 2FBJH 5F96H 3DROA 3C6SB 4LLQB 3O9WA 4YDKH 1BM3L 5C08A 1Y6MR 1X3DA 2I24N 1FYTA 5EU5B 4JFEE 4JQIL 3CJJA 3HAEB 4PLJD 3RUGF 1G7PA 2P8LB 4PYGA 3UC0H 2GEEA 3ORJA 3A67L 4Q97A 3ZL4L 3C8KA 2UWEF 1BLNB 4KGJA 1JPGA 2NY5H 4JG1H 1F3JB 4NQTA 1KB9J 4MJIB 4U6YB 1CTNA 4ONFL 1NCCL 2KL6A 5EDXA 3C60D 4MWFA 4K7PL 5DHVB 4PBXA 3VI4F 3VXUD 1WBZB 4WI2A 3ZYIA 3HMXL 1A0QH 5IWLC 3OAYK 5C0IA 4N0FB 2D7MA 1MJUL 4ORGA 3QFJE 5GZOC 3QHFL 3TBWA 2R56H 3NFSH 1RK0A 3DXAE 4PJDA 4P2OD 1LVEA 1U3YA 5JXED 4WUUA 4Y5XC 2XA3A 1OT1A 5ERWB 5F1NA 3WLBA 1CS6A 3RI5F 1R0AL 4GW1A 1DBML 5T33L 3QR2A 2W38A 5GGSA 2YK1H 3OGCA 3ULUF 1CFQA 2QJDA 1QQDA 3BGAA 4IDLA 4N0UA 3NCBB 4YDVB 2QQNH 3QEGL 3U30B 3D3VD 3ULVC 5J1AB 5HYJB 3QQ3A 3DMMA 1MHEB 4K71C 3RIFF 4HBCL 3TYGH 3N85L 3X3FH 1JPST 4E41A 4LLYB 3QIBC 2CGRL 1DVFD 2ZNXA 3UTSA 3K1DA 2BDNH 3P77A 3QDME 4MB4A 4LCUB 2VDOL 2P5WD 1RUML 4AL8H 2QR0B 2C7UA 5FUCE 1MOEA 3T08A 1L4IA 1N59B 4YFDB 1N3NB 1V3MA 2AGJL 4LRNH 4MNQB 1HH9A 5E8DL 5D7LD 5TQ0L 4KAQL 1CE6B 4YHIA 1QBML 3MCLH 2J88L 4NWUH 3QXUA 4BK4A 1K4DA 1U8KA 1YQ2A 4L4TB 3X14B 1QFOA 3EJZD 3AU1B 5GGQL 5EBGA 1I8IA 4AIOA 4U6VH 3SCMA 1RZGA 4P5TB 1XIWD 2AXFA 3O8XA 4P4KA 2XZQH 3WFDL 4UBDC 4LKXB 4LVHC 1MREL 4Y4KC 1RZ8B 1EFXA 4KGLA 3L3DB 5DK2B 4OAWB 1P5VA 4NZRL 3IFLH 3MLYL 3VFTB 4BELD 4X6DF 4M62H 4PJBB 1WT5A 2G75B 5IROC 4JKMA 1C5BH 3WFEL 4HQQH 4K94C 2APWA 5HI4C 3V8CA 3V79C 1IKFH 5HSFA 5HXMA 5BRZB 1KC5H 5BV7H 4G3YH 3SDDC 3OXSA 4I4WB 5HHOE 4YWGL 5I6XB 3STLB 3MREA 3IT8D 4FQQB 3KPSB 5D5MA 5HVFB 2KKQA 4M6OL 1A3QA 2CKBA 4PGBA 1V7NL 5D7IF 5DI8A 2HLFD 4TN9A 1EO8H 4V1DD 4YO0A 5T1LD 2Z35B 5FHBL 4A6YL 2AKRB 2NLJB 3Q2CA 1AO7B 1FAIL 1NGYB 1VB9A 2RBLA 3SKUD 4FTVE 1S5HA 4WGWB 3JWDH 5AYUL 5ENWB 4F3FA 1A1NB 3GBML 4K94H 4M93C 4ZTOL 2HT2C 3MRBA 3KPMB 3RVXC 2GT9A 2ADIB 4JO1L 1IT9H 1XGTB 1JFQL 4OKVA 3UEZA 1KBGL 3W39B 3QHTC 5JW3H 5GS1C 1OP3H 3VXSA 3MA7B 2G2RB 3TWCH 4ZOEA 4N90E 1MH5B 1DCLA 5DQDL 4ACPA 4AH2B 4LF3B 2J12B 1LE9A 4XNYH 1JP5A 1D9KC 1UVQB 4KUZL 4DWHA 1QRKA 5DRNB 4M61B 3DSNA 2GTWB 5ID0A 3L3IB 5J8OA 1N64L 4AM0B 5HYIA 4KVCH 5TDPB 3BP4A 3PGFL 4JFYB 2DQEL 5DGQA 3IDIB 4TUOB 4O2CA 2XWJB 1IAMA 1HKLL 2GY7B 1ZS8A 4PRDA 3NN8A 3DHJA 4XCFH 5HI5D 5D2NA 2NY6C 3D69B 4TPRL 3GMOA 4DGYH 1C8PA 3WHXB 3P40A 4L8SC 1JNJA 5ALCL 1FVDB 3DX7B 3THML 3VWKA 4UNVA 2NZ9C 3G6AB 4POYA 4M5YL 3QUMB 1GOFA 4HPYH 3FQTA 5ICYA 5IB4B 1KXVC 5CD5C 3QCVH 1KIRA 2FB4H 2DLIA 1S7TA 4NJAL 1PDKA 4PUBH 3BSZL 3BQUD 5IEHA 3LEYL 1VFBA 2VXTL 1TZIA 4P48A 1SYVA 2BCKA 2EDLA 2OZ4A 5BZWA 1M7IA 2LTQB 3WIHA 5JHDA 3EZJB 3WDHA 4NQCB 2FH8A 4CVWA 3EYUH 4P5KA 1WCBA 2IGFL 3V52H 4UOW0 3S96A 1YN6A 3U83A 1ADQL 1ZT1B 4TTDC 5EZLA 5HYQA 3WBDA 2EE6A 3QH3B 1E4WH 2B4CL 3KYOB 3IKCB 5MENA 2CLVB 4BKLB 1C08B 5F70A 4EXPX 1YEFH 4X7TB 43CAA 1JI1A 5F3HB 5K9OB 2I9TA 2A74A 2VLRB 1FG2A 2DQIH 5C09E 4EVNA 4DTGL 3MOAL 5IV2A 4OZIF 5E8OB 2NY4C 4QRQA 3MGOB 2QEJA 3RWDB 3BIBX 1WTGT 1HYRC 4PB9H 2FGWH 1U3ZA 1MCQA 3QQNA 3EYVA 1ACYL 1D5IH 4FFYL 3SDCB 4TOYH 3FO2A 3ZMRA 4I2XB 4CN4A 3QUKB 1P2CB 4MA3A 1ZT7A 1DQQB 2AJZA 3FB8A 2Y4SA 4GW5B 3FOMA 4P9HC 3IRPX 4W6WB 4PBWD 2ZSWB 5IEKA 1BGXL 2HLAB 4JN2B 4LLAA 5EIIA 5I0DA 4MMZC 4C54A 5SWQB 3ARFD 3KPQA 2BSSB 3OG6B 5B22A 1N0XH 1WITA 2ZZUT 1J88A 4XMPH 4OZGF 3ARGB 1PGRB 4Q6IA 4NT6B 1FV1A 4LQFL 4FZEH 1XGUB 1OAUH 4I77H 3BH9B 3VXPB 3ZE1E 1XR9A 3KJ4B 9CGTA 3CCHB 1NAKL 3HPLB 5TF1H 3G5YB 3L3OB 4PLKD 3QBTB 2E7HA 4YDIH 5IHBA 1A7BA 1YY8B 5HJ3A 5C9KA 4WEBL 2DYPA 1WFUA 3D25A 4YZFF 5KS9E 5D1QA 4PGCA 4LOUC 1I7UA 1FNFA 1QFHA 1T6WA 3MUGA 1UXSB 3PV7A 3BW9A 3GGWB 3BDXA 1SJEB 3GKZA 4G8EB 5DJ8A 2B1HL 2YPLA 2F19L 3S7GA 1J0ZA 5HHQB 1AKJA 1B0GB 4XNUL 5HGDA 4XX1E 4NZUH 2X9XA 2VN4A 1FHGA 3N9GH 4OUOA 1E4KA 1FRGL 4WY7L 3DV4A 5BVJA 1BBJA 5ELIA 1YEEL 4LLDB 2A0LD 2R8SH 2C1OB 3AXLA 4W81A 1S5IL 2A9ML 5KG9A 2DB8A 2VERN 1T0MB 3ULSB 4LSSL 7FABL 3TVMD 1Q8MA 2A6DB 2D4DA 1QLFB 4KJWD 1B2WL 4GXVH 5FAAA 3CFCL 1IAOA 1IARB 1INDH 4JFPB 4F33A 5C0EA 4YR6B 4UT9H 3MV7D 1YECH 2JE8A 4G42B 4AEEA 4POZD 3CX2A 5TE4L 2JB5L 5D93B 5DRXB 5C6PB 1FFQA 4LLMA 5ADOL 4WWID 1OAXH 2VTFA 4L29B 5KZCD 5HHVH 4F7EB 3RWGB 3IFNL 3MA9L 3PQYE 1BAFH 1AI1H 1A6ZA 3VFMA 4GFTB 3KDMB 3ARDB 4NYLA 5CMAA 1DQJA 4MHHI 1PX3A 3QIUA 4M7KH 3QG6A 2HT4C 4ERSH 3AY4C 1CICB 4NRZB 4R90H 4JFQB 2HJKB 3OKDA 5DUPL 1QYGL 4QHKI 2WBJA 3HNTH 2MHAA 1YNKL 2EE3A 4N0YL 1XGYL 5T1KD 4WO4C 1CL7L 5DJAA 2CIKA 5KSBF 2XFXB 3JUZA 1BWMA 4U6HB 1JRHI 3C6LD 3Q1SH 2XZCH 3U2SA 4HWNA 1K4CB 1I8MB 1EFQA 4PRPD 4S1RH 3D0LB 3EOAB 4GG6F 4UINH 5MERA 4LCCC 3T77A 2P46B 2EDJA 5C08E 3F12A 3FQRA 4GRLD 5E94B 4MA8H 1R24A 1FYTE 1I9RL 4LVOC 3L6FB 3C6SA 5CZXD 4OLWL 1T7XA 4LLQA 5C6WH 1LO2H 1BD2B 1FCGA 4I0PC 4JFFD 5FA3B 1FNLA 3H0TB 1DQML 2QSCH 1WZKA 5EU5A 1EUUA 5CJOH 3L3HB 3ARTA 3HAEA 3TT1L 3VFVB 1PEZA 2P8LA 3RDTC 2HN7B 2OL3B 4PJCE 5KSUB 5GRXG 1BLNA 2VYRE 3TV3H 4CJ1A 2FIKB 1F3JA 5B38B 4MXWL 4G7VH 1V3KA 4MJIA 4U6YA 4Y5VB 3H42H 1OAQH 1CGXA 4XPBL 2D7TL 4ETYA 3SEPA 1I9IH 1WBZA 4UOW1 4PJDE 4K55A 2X9WA 3KLDA 1YEHH 1HHKB 4WUUE 3P30H 5C0AD 4N0FA 3LSOB 3RVUD 5IB5B 4BZYA 2E27H 4KI5F 1UXWB 1V5JA 1ZHBB 5LKNA 4UUJB 4N0UE 4XC3L 2HMID 5C3LD 5ERWA 3NH7L 4OLXL 3K7UA 1HI6B 4JVWA 3GJFB 5IVXE 3GSNB 5DD1H 3UTTB 4HS3B 5CILH 3C2SA 1DUZB 5D2LB 4KJQD 2G9HB 2E7BA 4YDVA 4O5LL 2NPLX 4E41E 4QRSB 1TDQA 3UTSE 1OT2A 1ES0B 5J1AA 3EYQD 5HYJA 2NXZD 2XQBH 1KF9B 1MHEA 3RKDC 2VDPL 4MX7B 5D1XC 4N0CD 1FO0H 2ZG1A 2NW3B 4JCMA 1X5YA 2BNQB 4LLYA 3UCRA 3B6SB 1N6VA 1RJCA 4WFGD 2HTLC 4YQXH 5GHWH 2YKLH 4N90D 1OSPL 2GK0A 4LCUA 2DMBA 3HUJF 4HIHB 1YUHB 4TULL 2QR0A 4OM1L 4PJAB 1GGUA 3ARQA 3MLPA 4FMFA 1N59A 2LABA 1N3NA 3B9VA 1GC1L 4MNQA 3HB3C 2EXWD 4HDIB 3TJHC 3TH4T 4AG4L 1CE6A 4TSBH 3BIAX 1MRDL 1NC4A 3U46B 2EZ0D 4NM8H 4L4TA 3X14A 5AZEL 4JM4L 3AU1A 2BVTA 2DLHA 5E9DD 4Z7UF 4P5TA 1OB1B 5GSRB 2F53B 4LKXA 2N7AA 3ARBB 1RZ8A 4GAGL 3L3DA 5DK2A 4OAWA 3VFTA 5HHXL 2HAZA 3OKEB 3B9KD 1BFOB 4PJBA 4XWOD 5FKPB 1AY1L 2G75A 1JPSL 5F97E 2ZUWA 1TCMA 2I5YL 1WFTA 3RNQB 1J0HA 5L2KD 3C8HA 3PWPB 1B4JH 1IQWH 3W0WB 3WYRA 5D5ME 5HI3C 5FUZL 4YE4L 5BRZA 4I4WA 1KN2L 1DBBL 3LMJH 4JFZL 3FHAA 4NRXB 3STLA 1ONQB 2G60L 1NPUA 5EU7E 4DEPC 4FQQA 1E28B 3KPSA 1FH5H 3HNSH 5IM7B 5JUEH 1QVOB 4WFHD 3MUY1 3ZE0F 4ZTPL 2OP4H 5IB3B 5E8PB 2Z35A 3M1BB 1G6VK 2ADJB 4GAJL 3VGHA 5BW7C 1J1PH 3DTXB 3B83A 2AKRA 2NLJA 1AO7A 5B38G 2DBLL 1NGYA 5ENWA 1JZ3A 1A1NA 4HKXB 3ROLB 1SEQL 4JZOB 2A6KB 4I13B 3VXSE 1CFSB 3KPMA 4WI5A 2ADIA 1GAFH 1XGTA 2VC2L 1UZ6F 1YEDB 3W39A 1RULH 1UB6B 4BZ1L 5MP6H 4JHWH 4KXZI 3VGEA 4HS6B 2JJTA 3TA3C 3MA7A 1GPOL 2G2RA 3S3JA 5EU6D 3LN4B 1MH5A 4QT5B 1CLYL 4AH2A 4LF3A 3NFPB 3VI3F 1R5WB 1N6QH 4P23C 5IJKA 5D1ZB 5J9PB 5GRZA 4DQOL 5DRNA 3V6OA 3G5VB 2GTWA 3CDYA 1PSKL 4LU5H 3U79A 1JVKA 3L3IA 1A47A 4AM0A 5TDPA 4P4RB 5H35B 4LPWA 1CBVL 3QHZL 1EVTC 4ZXBD 4JAMB 4JFYA 5B39B 3ULVF 4Y1AD 4UDUB 3EIFA 2OYPA 3IDIA 4TUOA 4CUCA 2XWJA 2OR9L 4L4VD 3OXRB 4OBRA 1UJ3C 5ICZB 4FQJL 3D69A 5TE7H 1BFVH 1OWRM 1WC7B 1A7OL 2WMPA 3FOLB 3WHXA 1FVDA 3DX7A 4MS8D 3G6AA 5IK3B 2HKHL 3BRGC 1NCDH 2FEDD 1R5IB 3QUMA 2X4UB 4Q2ZB 5IB4A 1RMFH 3GIZL 1GXEA 1I8LC 4JREB 1KB5B 4XTRC 4LLVB 5E56A 4IRZH 1JTTA 4ZUSB 5JHDE 3MTRA 5GGVY 1ERNA 4RCAA 4L5FH 1OVZA 2FBOJ 3GI9H 2RQ8A 5CIPB 5GSVB 1KTRL 4BH7B 4W68A 5J06A 5JOFB 5F7EL 5D71H 4NQCA 5MENE 1ZLSH 5DZLA 2X4OB 2N56A 4X4XB 1DFBH 5GRJH 1QSEB 5IQ7L 4HBCH 3E2HC 5DJXB 5I8OL 1ZT1A 4LCIL 3QH3A 3KYOA 3IKCA 3G6DH 4WIQA 5AG8A 1UQSB 2CLVA 3GRWA 4BKLA 2F9BT 1C08A 4JHAH 4X7TA 3FN0H 3PWNB 5F3HA 3IU3B 5K9OA 2DM4A 2VLRA 3C2AH 4KRLB 2GUOB 5E8OA 1ZEAH 1GRWA 5F7KC 3MGOA 3NVQA 4HUXB 3RWDA 3K4ZA 2D9QB 5L8KB 2QSQA 1PX4A 2C9AA 3KPTA 1ZLVK 3BVNB 3SDCA 2RCSH 3BYTA 1NCBL 4I2XA 1ZA3B 3QUKA 1P2CA 3DETC 4Z78B 4ZNEE 1DQQA 1E4XL 4GW5A 4ENEC 5IESH 4ZOAA 1A1OB 3VXNB 2XG5A 3D9AH 2RB8A 1I9EA 4M7LT 2ZSWA 1OGAD 2YD4A 3E6FB 3UAJC 1MREH 2HLAA 3CMOL 3ZKMC 3BAEH 3G04B 5SWQA 3FZUC 4KJPC 1RUAL 5IBTL 4TVPL 4K9EH 4D8PB 2BSSA 1WWBX 4NNPH 2BC4B 4KXZH 3ARGA 4NT6A 5E1HB 4GRWF 4XC1H 3VJ6A 4ISVB 1XGUA 3WFEH 1MFBL 2IG2L 2BXYA 3BH9A 3VXPA 3OHXB 1KCRL 4OF0A 3GSRB 2W65B 4WEUD 3MLZL 1U95B 4PJGB 4UOJA 5ETUB 3CCHA 3HPLA 1MFDH 4FNLL 2DI7A 5JIIA 5CEXB 1W8OA 3G5YA 5I71B 5GS2D 3L3OA 4M6NH 4PP1D 3TO4D 2R9HD 4XNZB 4M6OH 1YY8A 3O9WD 3O2VH 1ZANL 3BT2L 3OR6B 3U82B 3D0VB 2XKUA 4DUWA 4APQD 2COQA 5IMLB 1T7WA 5C08D 3RGVC 2YPLE 3KHOA 1FYTD 1ZV5A 4A6YH 4ZS6C 1T89C 4ZFGL 3DV6B 1UXSA 3GGWA 1SJEA 4G8EA 4RDQF 2EDOA 5FV1L 4U1NB 2VL5B 5HHQA 1NGQH 4JM2C 2EDXA 1JYXA 4R26H 2D31B 2JK5B 2AJVL 3FCTA 4Z6AT 4Y19D 5FCSH 5TQ2L 5I1HH 3LPGA 1KJ2H 3AS1A 1RZ7L 4LLDA 2ERJB 5J13B 1YJDC 2C1OA 4KKBC 1F2XK 4HIXL 4MQXD 5E24E 4R4NC 5HVGB 2QTEA 1MCKA 3AAZA 5IW6B 1T5XB 3D39B 1A6TB 1T0MA 3ULSA 4UTBH 2YWYA 3GSWB 1QKZH 4HGKC 2A6DA 4ZOCA 1QLFA 5EZOH 4NO0D 1WAAF 3RZCD 6FABH 4WWKC 4JFPA 3SOBL 5I1IL 4XXCC 1OAKH 2IFFH 4GS7C 4YR6A 3IDUA 4OCRH 4G42A 5KVGL 2DQCH 5DRXA 1GHFH 1JGUH 3ARPA 4CVUA 4L29A 3QRGL 1ETZB 4F7EA 3L95B 3RWGA 2JJSA 3UYOD 3HI6L 4E41D 3BPNC 3P4LA 4RWYH 3KDMA 3ARDA 4H1LH 3N0PB 1UYWH 4HKZB 5ALCH 4YBQD 2EICA 3DYMA 1OP5H 4HT1L 5D70L 1CICA 1BIIB 2VDRH 4NRZA 1SYSB 1MCOL 4JFQA 3O6MH 2HJKA 3V5HB 2NY0C 4X7SH 3MX0A 5L7XL 1JGLH 1RI8A 3SE8L 2ENSA 2E7LC 1KUMA 2HJLB 4M5ZL 1A3RH 1F45A 2XFXA 3GNMH 4U6HA 5K59E 2X4QB 1K4CA 2FX8L 1I8MA 3D0LA 3EOAA 3VFGL 4MA1B 1X5KA 3MV9D 1GGCL 1BPVA 5E94A 3Q6GH 3BH8B 1J1OH 4FP8L 3P9MB 3L6FA 4JO2L 2V6HA 1ZLUK 1BD2A 5FA3A 1ZTXL 5DUBB 3KWWB 4CVXB 3H0TA 1X6LA 2H8PB 4KZEL 5CZKA 4P59L 5EIVA 3MRNB 2MQ0A 5LGKA 4MJIE 3I3DA 2RJMA 3L3HA 1RURL 1IAIL 4LSVH 5DEGB 3VFVA 3VXMD 1IGYB 1A3LL 2KQMA 4YX2H 1T22B 2HN7A 2OL3A 3QCUL 5KSUA 2CRMA 2FIKA 5B38A 4NBXB 1T5WB 5K33A 4HJ0D 5T3ZE 4Y5VA 1PG7X 2QSVA 4NFBA 4Y0GA 3S4SB 4RGMB 3B9AA 3BUTA 4UNUA 1HHKA 1QEWB 1TTGA 1UA6L 3LSOA 3NIFE 2IJ0C 1ZVSB 5IB5A 1UXWA 1ZHBA 4LSPL 4UUJA 1T1XB 3HFMH 2GAZB 2QADD 4JO4H 1HNFA 3VW3L 4ZS7H 1HI6A 3O6FC 4XPAL 4L1DA 3TIDB 4EQ3A 5HYJE 3GJFA 1JHKL 3GSNA 5CEYB 2VZOA 2NY3B 3LHPH 1H0DB 3P3YA 3QG7L 4HS3A 1DUZA 4HF5L 5D2LA 2APFA 2G9HA 4QEGA 4IIQB 1M05B 3A6CL 5HDBE 4QRSA 4Y2DD 4X9BA 4FFWC 4JY6B 2BJML 5ADPH 1ES0A 5BVPL 2BNRD 2ITCB 3TCLB 3DMMC 3DJ9A 5DK0B 3CUPB 4MX7A 4QHKJ 4OKDA 2DMCA 4U6TA 3RPIB 2NW3A 2BNQA 2XOTA 3B6SA 4JY5L 4NZTL 1S9XB 2Y7QB 3H3KA 3BKYL 4MNQE 3U7YH 2MQCA 3OPZL 4NC2B 5L9DH 1OPGH 2ADFH 4HIHA 1MNUH 1YUHA 3QXDB 4WFFE 4PJAA 3VGBA 3L7FB 4X80H 4G6ML 5T3XL 4I3RH 4L4TE 2MSPA 3U0PB 1EAPB 3STZB 4HDIA 3U46A 4XPTH 2V9TA 4H20H 3HNVH 4D9RE 1P4LB 3VWKD 4YK4B 1Q0YH 2QHLA 3EHBD 3QRFM 1SHMA 4JKPH 3SCMC 3PL6B 4Y89A 4PJBE 5C2BH 1KCVL 3OB0K 1OB1A 5GSRA 3O8XC 2F53A 2I60H 4P4KC 1QACA 2IADB 3VWJD 4R8WL 2J8HA 1IQDB 2FGZA 3ARBA 1GYAA 1CE1H 2ARJB 4DCQB 4Z95H 5K9QG 3WJLA 4W4NA 3NCJH 4M1DH 3OKEA 1BFOA 5FKPA 3W2DL 3JWOC 2DQJL 3RNQA 4WW1B 5IW3A 3PWPA 3W0WA 5GGVL 3KPSE 2DQHH 1FC1A 3RVVC 2GYSA 2BVQB 4ODTL 4NFDA 3EYSL 4ZSOE 1TJIH 1CF8L 4NRXA 1ONQA 3PHOB 4HFUH 1UC6A 1K9TA 1E28A 3PF2A 5D7SH 2ENYA 4OLZH 1BQHG 3LH2L 3IKKA 1QVOA 1RK1B 3O3BB 1TJGH 5GISL 2WUCL 2ICWJ 2ICCA 1GSMA 2X05A 1NSNH 5IB3A 5E8PA 4GJTB 4HIEB 2X7LB 3M1BA 4Y5YC 2ADJA 5EU7C 5CJXA 7CGTA 3DTXA 3WFBL 2P5EB 1TETL 4Z8FL 2AEPH 1FFRA 4QHLB 4HKXA 1UWXH 3QDHA 3ROLA 2PW1B 3S4SG 4JZOA 4RMUA 1QZ1A 2A6KA 2DIJA 5E95B 3L9RB 2H3NB 2FD6H 3VGGA 1CFSA 4XP4H 5L6YL 4PB0L 4OQ1A 2P43B 3DNKA 3BEWB 1YEDA 1VEOA 1UB6A 4YHOH 2PN5A 2CKBH 4HS6A 3KPLB 1V3JA 3BHBB 3FO9B 2B2XL 3V6OE 3T1FB 1HSBB 2MFNA 3B43A 3LN4A 4QT5A 4JRYE 1LILA 4EUPB 3NFPA 3MRJB 4NSKB 1R5WA 1J05B 4JB9H 5D1ZA 4DOHB 1P4IL 3KNBB 3O2DL 5J9PA 1NAML 3G5VA 2EYRB 3ZTJG 2FX7H 5T5NF 5IHZB 3N1FC 1DBJL 2ZUUA 4EDXB 1QR1B 3WXVH 3SDAB 5J89A 1CDYA 4P4RA 5H35A 1KTLB 4JFHE 5DSCB 2WV3A 2YUWA 4LDOB 1BVZA 4EI5B 4JAMA 1CI5A 4C56D 5B39A 1TZHB 2XT1B 1FGVL 2ORBL 4UDUA 2CLRB 4RMWA 2Y06L 4U0RC 1G7JB 5D2NC 4RAUB 4HULB 3OXRA 1KELH 5ICZA 2QLVB 3OF6D 4PRID 2VR5A 1WC7A 3FOLA 4YGVB 1EXUB 5HGBB 3F62A 1PG7H 4ZUTB 5IK3A 2NY7L 2E7MA 1R5IA 4QF1B 2X4UA 4Q2ZA 2YPLD 1J0IA 4KQ3H 3U9PH 5CJQH 2RAMA 1KB5A 2JJVA 3NH7H 4LLVA 1JHTB 4ZUSA 1PW3A 4NQCE 1D6EB 4WTXA 1EMTH 1G6RL 3MLWL 4N9GB 3BFOA 5CIPA 5GSVA 2EYSB 3HC3L 4BH7A 1IGIL 1FNAA 5DR5L 5JOFA 3SJVD 4JZNB 1D5BB 1J5OH 1RHHB 4AJ0A 4DGIL 3DX8B 4X4XA 2DKSA 1QSEA 2VLRE 5DJXA 5E6ZA 4LEXL 4RFEB 1Q72H 2Y36H 1UQSA 1MEXL 5I1AB 1AGBB 5CZVL 3RWFB 1EHLL 3IU3A 4U4BA 1DVFC 5IBLC 4O02L 4G8GD 4I2XE 3HE7B 3RZWA 2GUOA 2FRGP 4QWWD 1AD0B 5I1CL 4Y5XB 2OZ4H 4HUXA 2OX5A 3WIHH 2ZOKB 4OI7A 1IC4H 3BVNA 5IFHL 3O2WH 1FVCB 3BD3A 1IAKB 5C0BB 1ZA3A 1I9JL 2OR7A 4ONOA 4Z78A 5ITBH 4IMLB 3JSSA 1A1OA 2E5EA 3VXNA 4HC1A 3QUZD 2AXHA 4BQ9A 4M43L 5ACMA 2IH1B 3E6FA 5L0QC 4AEIL 3WHE1 4K71B 4FFVC 3G04A 4JJ5B 1JGEB 3QIBB 5J56B 4D8PA 3IFOB 2BC4A 2GJ6D 2L7JA 4K23L 5HPMB 1FGNL 4Q6IC 3MACL 5I73B 3E8UH 4ISVA 4NGHL 2A73B 3T0BA 1RZKH 3IVKB 3OHXA 3TBSB 2DD8L 2W65A 4R4FH 1U95A 4PJGA 4TNVK 5ETUA 4NQDB 2JJWA 1U3HD 4K3GA 5CEXA 1BFSA 3T8XB 4BQ8A 2Q76B 5HHMD 2DKUA 4EUPG 1QFWM 2G60H 5BZDB 3RA7L 2V2WA 4RX4D 1Z3GH 3LRGA 2E6PA 4W6YB 3OR6A 4PJHB 4AZ8A 3D0VA 4K3EL 3ARUA 4KC3B 5IMLA 1NL0H 2EECA 2NX5B 5C86A 5D1QC 1XMWA 1HYSD 3HCVB 5KVEL 5EWIL 3LEVH 2HYMA 3DV6A 3WN5B 4RIRB 5D8JH 4Y4KB 4WI9A 1YEJL 4U1NA 1D5MB 4M7LL 2VL5A 4PJ9D 3H2WA 4NCC1 2VO5A 3V0VB 4QXWA 4MJID 1N6UA 2D31A 4I1NB 2JK5A 3FFCB 3UTPE 2VH5H 2C3WA 4PJEF 5FYJU 1MPAH 3MXVH 3WS3B 1YEIH 1CVRA 1AJ7L 1NLDL 2Y1VA 1GCFA 1LP9B 5EOQH 3BPLB 4XP9L 1P53A 3NPSC 5JMOC 2B0SH 4OI8A 4PGEB 1UM4H 4HMDA 5BO1L 4KKAC 5IW6A 1T5XA 2BHUA 4JQXA 3S3SA 3D39A 1A6TA 3ARED 3WXWH 3SGEH 3ARVA 3GSWA 3CFEB 4IBLT 5B8CB 4OGYL 5TGBB 3IJYB 4FQXB 1LEKB 2J6EL 1S7WB 1SMOA 4ALAH 4JN1L 2F5AH 4XP1L 1EK3A 2R4SH 4K3JL 4GRWB 1LO0L 1U9KA 2FEEL 1ETZA 1OTTC 3L95A 1GVIA 4XBEH 1FAKT 4FQCH