4YBPA

Crystal structure of the r111k:y134f:t54v:r132q:p39q:r59y mutant of human cellular retinoic acid binding proteinii with retinal after 24 hour incubation at 1.83 angstrom resolution - thermodynamic product - 1st cycle
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
137
structure length
137
Chain Sequence
PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKQAVEIKQEGDTFYIKVSTTVYTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTKELTNDGELILTMTADDVVCTQVFVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular retinoic acid-binding protein 2
publication title A Photoisomerizing Rhodopsin Mimic Observed at Atomic Resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 36
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2015-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 4ybpA00
3KQ0A 5L8IA 1QFVA 4ORUA 2L67A 4ALBA 2CZTA 3HWDA 2X45A 2NNDA 4ZH6A 3CWKA 2QO4A 2G78A 2ACPX 4I3CA 1O1VA 2FWVA 3WJBA 2F73A 4NLJA 1TW4A 3O2YA 3FR2A 2JU3A 3O22A 2HNXA 4YBUA 3C77X 3WVMA 1KZXA 1PEEA 3EM0A 4IMOA 1FDQA 4UU2A 1JZUA 1CJ5A 4TKHA 3RZYA 4LKTA 1EALA 4BVMA 1KQXA 1SXYA 5DG4A 1FEMA 2QM9A 3RSWA 3UEVA 1GX8A 1DZPA 1EIOA 2ASNX 2GTFX 1YIVA 3PP6A 4AZPA 3FR5A 3HWEA 3S26A 2FLJA 4YCEA 4ZFXA 2EU7X 2P8GA 4NYQA 1IKJA 4K19A 4ZHGA 4RUUA 4ZCBA 2JU7A 5D8JA 2MO5A 1T8VA 2AT5X 4EDEA 5EDCA 1LF7A 1B56A 4GH7A 1GGLA 2AT6X 4CK4A 1FENA 1QFTA 4DQ4A 3VG6A 3DSZA 3MBTA 3EBKA 5HZ5A 4DQ3A 3CQNA 1UZ2X 3L4RA 3K3LA 5KHPA 1BSYA 3OJYC 1B8EA 3NQ9A 4ALOA 1GKAB 3NX2A 2PY1A 5LJGA 5LJDA 1N0SA 3UEUA 1DZJA 3P6HA 3FELA 4IB6A 1QY0A 2WSJA 4GE1A 4YDBA 5HCCC 2RD7C 3WBGA 2NP1A 4XMGA 4Y0SA 1JV4A 4YH0A 4ZH9A 5IO7A 1ERXA 1XKIA 1EQDA 1I4UA 3D95A 3FMZA 1PM1X 2HMBA 1PMPA 2N93A 4I3BA 3FENA 3FA7A 1IFCA 4D6BA 1IKEA 2WWPA 2A0AA 1A2DA 3BRNA 4GRJA 1KOIA 3IA8A 3PH6A 4YDAA 2HZQA 4HFOA 3APXA 1EUOA 3FEPA 3NX1A 3PEDA 4AZMA 4AZQA 5FAZA 4PSQA 5K06A 1HBPA 1AELA 2W2AA 2OFMX 1X8QA 1OBQA 2JU8A 1IFBA 5LJEA 3TGCA 1L6MA 3BX8A 3NQ3A 3STMX 2QOSC 4AZRA 2HLVA 2OVEA 5C0NA 1ICNA 1T68X 2CBRA 4MVKA 1MDCA 2CM9A 5D45A 5H9NA 4AZOA 2WR6A 5LKEA 3HK1A 1BEBA 1P6PA 2AT3X 3G7XA 2W2FA 2Q2PA 1G74A 3O19A 1A57A 4NYRA 1OPBA 3UEXA 5FENA 4ORXA 5HWZA 4EFGA 1MUPA 1SXUA 4RUNA 1U0XA 1E06A 1IIUA 4I9RA 3TGAA 1ERBA 2JOZA 4TQ2A 4XMEA 4YFQA 1BSOA 2WQ9A 4IB7A 2WEWA 1KZWA 4N7DA 3KFHA 3ZUOA 5L8OA 4QYPA 5LJCA 1HMTA 3JS1A 3EMMA 1KQWA 1HN2A 2L5PA 4XMDA 3FIQA 4MVIA 3HWFA 5HA0A 3HWGA 5HTDA 4MVLA 4ARHA 3FW4A 4A1YA 5LKFA 2AKQA 4AYHA 1KGLA 3FA8A 4XMCA 3GAQA 4LZVA 4OS0A 5D47A 4ES7A 2FR3A 1EPBA 1A3YA 2OVAA 4NNSA 5EEEA 3APWA 4EXZA 2G79A 1GXAA 5EEDA 3VG7A 3CQRA 2K62A 3BDRA 4HPAA 3P6GA 3P6EA 4ZHCA 1EW3A 2AH7X 2XKLA 1ICMA 5HZQA 1JJJA 3T1DA 4A8ZA 2RCTA 2QO6A 2FR2A 1G7NA 4GETA 3B2KA 1OBUA 1LICA 2A2UA 2E4JA 4HPCA 4YFRA 3STNA 2ACOA 5HA1A 2K23A 4YMYA 1BLRA 5HZ8A 4GNWA 1LNMA 3TZSA 1QABE 1CBRA 3B2LA 3I0AA 1OEEA 1CBSA 5BVSA 1HBQA 4TKBA 1LIDA 1SXWA 2XSTA 4N7CA 5F6BA 3MVFA 1BWYA 3CBCA 1X89A 4QZTA 1MX7A 2LBAA 3FEKA 5F6ZA 1G5WA 3WJEA 1DC9A 1SA8A 5KICA 1GT5A 4XMFA 5HZ9A 1FE3A 3AKMA 4TNNA 1FELA 1BBPA 1ZNHA 5HCDC 1CRBA 3FW5A 3NP1A 1HMRA 2AL0X 4QGWA 3AKNA 1QQSA 1NP4A 2IFBA 2QO5A 5CE4A 1XCAA 3APUA 1U18A 3QKGA 3IFBA 1GX9A 5B29A 4ORWA 4WFVA 2WQAE 3FA6A 1G85A 3B2HA 4NNTA 4R0BA 1O1UA 4QGVA 5L8NA 3KFGA 3C76X 4Y0QA 3CMPA 2FT9A 1DF3A 1E5PA 1RLBE 2R56A 4GKCA 4IAWA 4LKPA 4ZHFA 4Y0RA 3BU9A 3PPTA 1YWBA 1VYFA 4ORRA 4Y0PA 3ELXA 2NNEA 1GKAA 3BLGA 1ALBA 3JSQA 5KIDA 4TKJA 2KTDA 1KT3A 1EIIA 1BRPA 2OVDA 4YKOA 3KFIA 2AT8X 2JN3A 1LIBA 1D3SA 1X8NA 4EEJA 3VG4A 1SY1A 4GNYA 3D96A 5D48A 4A60A 1X8OA 4OMXA 1LKEA 4NLIA 1ADLA 1VYGA 1YUPA 1LPJA 1QY2A 1JYDA 2OZQA 5F58A 2NNQA 2RQ0A 1B0OA 1S44A 2HYSA 3NR3A 4QYNA 4ZJ0A 4OS8A 2OFRX 1YWCA 5BVQA 3P6FA 2DM5A 1DZKA 5HAEA 1YP6A 1MX8A 3ELZA 5FFHA 1GT3A 4LZUA 1Z24A 3B2IA 5H9LA 4AZNA 5H9KA 2ANSA 3NPOA 1YWDA 3BSZE 3P6CA 1QWDA 2GC9A 5EPQA 5H8TA 3FR4A 2A13A 3CR6A 3KZAA 4TJZA 3B2JA 2Q9SA 4IMNA 4BOEA 1KXOA 1LIFA 2LB6A 2CM4A 1ZNKA 1YWAA 4M7MA 1CBIA 2W2BA 3P6DA 1KT4A 1X8PA 2MM3A 3EYCA 5DPQA 4YBPA 1GT1A 5LJHA 2GJ5A 1NGLA 1CBQA 5HBSA 3WJGA 4ORSA 1X71A 3F9DA 2WUTA 1YP7A 2KT4B 5HTEA 4ODDA 2R74A 4QZUA 1HMSA 2FS6A 3U9PC 3U0DA 4YGZA 1ZNEA 1DZMA 2RA6A 1GM6A 1TOWA 4WFUA 1JBHA 1QG5A 1DFVA 1JJXA 2LKKA 2L68A 1O8VA 2L9CA 1TOUA 2LFOA 4YKMA 4A1HA 1MVGA 3F8AA 1RBPA 2POAA 1HQPA 1PBOA 5BVTA 2WEXA 1E00A 3APVA 4O9SA 1H91A 1SY3A 3D97A 5H9AA 2RCQA 1I05A 3KFFA 4ZR2A 4NP1A 1E02A 2Q4NA 3C78X 2FTBA 3UEWA 1SXXA 2CBSA 4ZGUA 5F1EA 2BLGA 4AW8A 1UREA 4ZHHA 4TLJA 1OBPA 3EBWA 4IBAA 3PH5A 2HZRA 1LIEA 4QAEA 4I3DA 1ZNDA 5D4AA 5B27A 2CZUA 4ORYA 1OEJA 1S2PA 3DTQA 4UU3A 2A3FX 4YCHA 2X46A 1BM5A 1AVGI 2FS7A 5EZ2A 1GT4A 1BRQA 4OMWA 1LFOA 3SAOA 4YFPA 3PECA 2AMMX 3WJDA 4YGHA 1OPAA 5LJKA 1S7DA 1IW2A 1ZNGA 5AQ6A 1ACDA 2ALLX 3FLLA 1T0VA 4IB9A 4BQUA 4I9SA 5HZ6A 3STKA 1ZRYA 4XMHA 1NP1A 5IO6A 1KT5A 1BSQA 2R73A 1X8UA 3WJCA 4HPDA 2AT0X 1EPAA 3U03A 3CBSA 5JR8A 1D2UA 1VPRA 2FRSA 1DV9A 4KIIA 3ZUIA 1U17A 2MJIA 3TGBA 3FA9A 1SY0A 4M6SA 1BJ7A 1KT6A 1B4MA 1TXLA 1ML7A 5EDBA 2G7BA 4QGXA 1I04A 4IAXA 4YGGA 3TF6A 3ZQ3A 3BY0A 3WXQA 1AB0A 2LBVA 3BS2A 1R0UA 2O62A 4OS3A 1SY2A 3WJFA 3VG3A 1JYJA 5IO5A 1TVQA 4D6AA 1I06A 3BX7A 4HPBA 2Q39A 2YG2A 5LJBA 1ZNLA 1FTPA 1OEKA 3BU1A 5HCEC 1EXSA 1QY1A 3I17A 4IB8A 3VG2A 2Q2MA 3NADA 1A18A 2A2GA 3Q6LA 4WBKA 5F7GA 4ZHDA 1AQBA 1KT7A 3VG5A
chains in the Genus database with same CATH superfamily
2OL8O 3KQ0A 5L8IA 2X4MA 1QFVA 4ORUA 2L67A 4ALBA 2CZTA 3HWDA 3T2WA 2X45A 3TGCA 2NNDA 1VWQB 1SLFB 4ZH6A 3CWKA 2QO4A 2G78A 3PDFA 2FHLA 1VWMB 2ACPX 4I3CA 5IXGA 1O1VA 2FWVA 2AF5A 2ZAIA 3WJBA 2F73A 4FGIB 1VWOB 4NLJA 1STPA 1TW4A 3O2YA 3WYPA 3FR2A 4CPEA 2JU3A 3O22A 2HNXA 4YBUA 3C77X 3SLTA 3WVMA 1PEEA 3EM0A 1KZXA 2RTOB 4IMOA 1FDQA 4I6SA 4UU2A 5FQ8E 1CJ5A 4TKHA 3RZYA 1HXLA 1N9MA 4LKTA 1KQXA 1SXYA 4QQ1A 4BVMA 5B5FA 5DG4A 1FEMA 2QM9A 3RSWA 4KCAA 3UEVA 4CPHB 1GX8A 1DZPA 1EIOA 2ASNX 2GTFX 1YIVA 3PP6A 4AZPA 2A8GA 3FR5A 3HWEA 3S26A 3WZOA 2FLJA 1SWGA 4YCEA 4ZFXA 2RTMA 2EU7X 2P8GA 4L1NA 2Y3FA 1IKJA 4NYQA 4K19A 1Y9TA 4KT5A 4I60A 1AVEA 4ZHGA 4RUUA 1MM9A 2JU7A 4ZCBA 4Z27A 5D8JA 2MO5A 1T8VA 2AT5X 4ZHDA 3PK2A 4EDEA 4GU8A 1LF7A 5EDCA 1B56A 4U3QA 4GH7A 4C5PA 1GGLA 2AT6X 4HWMA 4CK4A 1FENA 1QFTA 4DQ4A 2OY5O 3VG6A 3DSZA 3MBTA 3EBKA 5HZ5A 1KL3A 1PTSA 3CQNA 4O3ZA 3SZJA 4DQ3A 1UZ2X 5K67A 2UYWA 3L4RA 5AJBA 3K3LA 4ZGFA 5KHPA 2KTSA 4KC7A 1NBXA 1BSYA 3OJYC 3RDSA 1B8EA 3NQ9A 2OL6O 3D9WA 2A5BA 4ALOA 1GKAB 3NX2A 2PY1A 5LJGA 5LJDA 1VWEB 1N0SA 4O3XB 1AVDA 3UEUA 2VFCA 3RDUA 1DZJA 1W4TA 2UZ2A 3P6HA 3S60A 1I9HA 1VWFB 3FELA 3LV4A 4IB6A 1QY0A 2WSJA 4GE1A 4JNJA 4YDBA 2RD7C 3VHIA 2NP1A 3WBGA 5HCCC 4XMGA 4Y0SA 1JV4A 4YH0A 4ZH9A 4BX6B 5AEOA 2GTLN 5IO7A 4EQAC 1SMPI 1ERXA 1XKIA 1EQDA 1I4UA 2KW1A 3D95A 3FMZA 4JGLA 1PM1X 1LUQA 2HMBA 2QMIA 2Z4IA 1PMPA 2F01A 2N93A 4I3BA 3FENA 3FA7A 1IFCA 1RSUB 4KC8A 4D6BA 1VWDB 1IKEA 2WWPA 4Z28A 1KFFA 1A2DA 2A0AA 3VG5A 4Z2PA 3BRNA 3E3CA 4O4OA 3KVNA 3RE5A 1VWCB 3EW1A 2I5ZO 4GRJA 1KOIA 3IA8A 5KIDA 3PH6A 2Y3EA 4FQBB 4YDAA 2HZQA 2IZAA 4HFOA 3APXA 2A5CA 1EUOA 1RXHA 3FEPA 1N43A 3NX1A 3PEDA 4AZMA 1HXZA 3SLJA 4OELA 4AZQA 5FAZA 4CDCA 4PSQA 5K06A 4ML7B 1HBPA 2DJFA 1JIWI 2Y32A 2W2AA 1N9YA 4CDEA 1AELA 2FKJA 1I78A 2BT9A 2OFMX 2BS6A 1X8QA 2KD2A 1OBQA 2JU8A 1IFBA 3EW2A 2X32A 1L6MA 4NW4A 3WYQA 3BX8A 3NQ3A 5LJEA 3F6ZB 3STMX 2QOSC 1JZUA 4AZRA 5L3YA 2VDFA 2HLVA 2OVEA 5C0NA 1ICNA 1T68X 2CBRA 4MVKA 1MDCA 3VHMA 1RXKA 2CM9A 5D45A 5H9NA 4Z2OA 2X56A 2FKGA 3WZPA 4AZOA 2WR6A 4BGFA 5LKEA 1JMXA 3HK1A 4Y59A 1BEBA 1P6PA 2AT3X 3G7XA 2W2FA 2Q2PA 1Y55X 1G74A 1LDQA 3O19A 1A57A 4NYRA 1OPBA 3UEXA 3HOLA 5FENA 4ORXA 3WOVA 1E2TA 5HWZA 2BS5A 3VHHA 1MUPA 5K68A 1SXUA 4EFGA 4RUNA 1U0XA 4U46A 1E06A 1IIUA 4I9RA 3SZIA 1ERBA 2JOZA 3TGAA 4TQ2A 4XMEA 4YFQA 1SWQA 1BSOA 2GH7A 5FQ6E 2WQ9A 4IB7A 3SLOA 2WEWA 3WZNA 1KZWA 1LCZA 3MG5A 2OF9A 2IZJA 4NV8A 4L3RA 4N7DA 3KFHA 3ZUOA 5L8OA 4QYPA 5LJCA 3NBXX 1HMTA 3JS1A 5JD2A 3EMMA 1KQWA 1HN2A 2L5PA 4XMDA 3FIQA 4MVIA 3ZW0A 1SRJA 3RDMA 3HWFA 5HA0A 3HWGA 1SWFA 3PQUA 1SWSA 5HTDA 1HQQA 4MVLA 4ARHA 5B11O 3FW4A 4A1YA 5LKFA 2AKQA 4AYHA 1KGLA 3FA8A 2BSZA 2RTRB 3FDCA 4XMCA 3GAQA 4LZVA 4OS0A 5D47A 4ES7A 4BBOA 2FR3A 1EPBA 4ID2A 1A3YA 2OVAA 2RTEB 4NNSA 3APWA 5EEEA 3P02A 2G79A 4EXZA 1GXAA 5EEDA 3VG7A 3CQRA 2K62A 3BDRA 4HPAA 3P6GA 3P6EA 4ZHCA 1EW3A 2OFBA 2AH7X 2XKLA 1ICMA 5HZQA 3SZHA 1JJJA 1BWYA 3T1DA 4A8ZA 2RCTA 3OBLA 2FGSA 2QO6A 1Y53X 3VE2A 2FR2A 3VU1A 4CSBA 1G7NA 1VWLB 4GETA 4O4SA 3RDOA 3B2KA 1OBUA 4O49A 4O4UA 2OL7A 4EKVA 5IRUA 3V8UA 4BX5A 1LICA 2A2UA 2E4JA 4HPCA 4YFRA 4U8UM 3RY2A 3STNA 2ACOA 2X8FA 5HA1A 2K23A 4YMYA 1BLRA 1MOYA 2C1QA 5AJCA 5HZ8A 5CHKA 4GNWA 1LNMA 3TZSA 1QABE 1CBRA 3B2LA 3VGWA 3I0AA 1OEEA 1CBSA 3RBYA 4CDFA 2X55A 1HBQA 5IRAA 5BVSA 4TKBA 1LIDA 1SXWA 1K3BA 2XSTA 4N7CA 3MVFA 5F6BA 1RSTB 2WPUA 3CBCA 1X89A 4QZTA 1MX7A 2LBAA 3FEKA 5F6ZA 4QRLA 1G5WA 2LA7A 4O3WA 1DC9A 3WJEA 1SA8A 5KICA 1GT5A 4XMFA 4GD9A 5HZ9A 1FE3A 1SWLA 3AKMA 4TNNA 4U8UO 4JO6A 4CPIA 1FELA 1BBPA 4BX7B 1ZNHA 5HCDC 1CRBA 3FW5A 3NP1A 3VE1A 1HMRA 2X8SA 2AL0X 2GTLM 2IZIA 2Z4HA 1QQSA 3AKNA 4KH8A 4QGWA 1NP4A 3WZQA 3X00A 2IFBA 2QO5A 4JHQA 1VWAB 2IZLB 5CE4A 1XCAA 5CYBA 2IZFB 3APUA 1U18A 3QKGA 3RDXA 1PBYA 1GX9A 3IFBA 5B29A 4ORWA 4WFVA 2WQAE 1SWTA 1LELA 2VFBA 2X34A 3FA6A 1G85A 1SRFA 3B2HA 4NNTA 1IJ8A 1O1UA 4R0BA 4QGVA 5L8NA 3KFGA 1N7YA 2RTCB 3AUMO 3C76X 3S5VA 4Y0QA 3CMPA 3QQ2A 4GJVA 1SLDB 1JQPA 2CAMA 2FT9A 4Z2VA 1DF3A 1E5PA 1RLBE 2JW1A 1UYOX 2GTLO 2R56A 4GKCA 4IAWA 4LKPA 4ZHFA 2RTDB 1MK5A 4BJ8A 4Y0RA 3BU9A 1OSPO 3PPTA 1YWBA 1VYFA 4FBVA 1NQNA 4ORRA 4Y0PA 2PI3O 1Y0GA 2AVIA 3RWXA 3ELXA 4COTA 1SWDA 4DNEA 1EALA 1VWKB 2NNEA 5CSEA 2RTNB 3VPJE 1GKAA 2RTKA 3BLGA 2IZBA 1ALBA 3JSQA 4GK9A 4I95A 2KTDA 4TKJA 1KT3A 2QCBA 1N4JA 1BRPA 2G5LA 2OVDA 1EIIA 4YKOA 3KFIA 2AT8X 1SWAA 2IZDB 2JN3A 3FYFA 1LIBA 1D3SA 2HKDA 1X8NA 4MVEA 2RTIB 1SRGA 2G8CO 3LHNA 4CPFA 3VG4A 4EEJA 3EC5A 1SY1A 4GNYA 2OVSA 4BCSA 4BX6A 3D96A 5D48A 1VWJB 4A60A 2FHNX 3T2XA 1X8OA 3HPEA 4OMXA 4OKAA 1LKEA 4NLIA 4CDDA 1ADLA 1VYGA 1YUPA 1LPJA 1QY2A 1JYDA 1VWPB 1VWHB 2OZQA 2NNQA 2RQ0A 1B0OA 5F58A 1S44A 3T6FA 2HYSA 3NR3A 4QYNA 4ZJ0A 4OS8A 2OFRX 1YWCA 5BVQA 1VWNB 3P6FA 1SREA 1Y52X 4MISA 1LDOA 1DZKA 2DM5A 4MIRA 5HAEA 1YP6A 1MX8A 3ELZA 5FFHA 1GT3A 4LZUA 1Z24A 2RTLA 3B2IA 4MEEA 5H9LA 1KL4A 4AZNA 1SWRA 1FJ1E 4BX5B 1SWEA 2JGSA 4IABA 5H9KA 2ANSA 3NPOA 3HOEA 1YWDA 2M4LA 3BSZE 3P6CA 1QWDA 1RAVA 1Y9LA 1RXJA 1DF8A 1WBIA 2GC9A 1JMZA 5EPQA 3FR4A 2A13A 2C1SA 3CR6A 5H8TA 3PQSA 3KZAA 3RY1A 4TJZA 3B2JA 2Q9SA 4IMNA 4BOEA 3RE6A 1KXOA 1LIFA 4O3YA 4NV7A 2LB6A 1SWNA 2CM4A 1ZNKA 1YWAA 3OD9A 1CBIA 3Q34A 4M7MA 4FBRA 1SWBA 2W2BA 4LQZA 3P6DA 1KT4A 1X8PA 2MM3A 3AEHA 3EYCA 5DPQA 1SWKA 1GT1A 4YBPA 4ON1A 1VWBB 2GJ5A 1NGLA 4GJSA 5LJHA 5IRWA 3ZW2A 2MWHA 1CBQA 5HBSA 3WJGA 4O4XA 4ORSA 1SWHA 3NQKA 1X71A 3F9DA 3ZI8A 2WUTA 1YP7A 2KT4B 5HTEA 3ZW1A 4ODDA 2R74A 4QZUA 1HMSA 3LTWA 2FS6A 3U9PC 3U0DA 4YGZA 3SOTA 1VWRB 1ZNEA 1DZMA 2RA6A 1GM6A 1TOWA 4WFUA 5B10O 1QG5A 3RDQA 1JBHA 1DFVA 2OY8A 1JJXA 2LKKA 2RTGB 2L68A 1O8VA 2L9CA 2IZHB 1TOUA 2LFOA 4YKMA 4A1HA 1MVGA 3F8AA 3S5XA 4GDAA 1RBPA 1SWPA 2POAA 3RKGA 1HQPA 4OEMA 1PBOA 3T6LA 2I5VO 4U8UN 5BVTA 2C4IA 2IZCB 2WEXA 1E00A 3APVA 3ZWEA 4O9SA 1H91A 1MEPA 1SY3A 2RN4A 3D97A 2F09A 2RCQA 3D4RA 4GGZA 5H9AA 2RTPB 1I05A 2QOMA 3KFFA 4ZR2A 2ZAGA 4NP1A 1E02A 4YVBA 1W5RA 2Q4NA 3C78X 2FTBA 1K24A 1SXXA 2CBSA 2OY1O 3UEWA 3N91A 4IRWA 2IZKA 5F1EA 5B5GA 4ZGUA 2BLGA 2DJGA 2RTFB 4AW8A 1UYNX 1UREA 5B2AO 4ZHHA 4TLJA 1OBPA 3EBWA 4IBAA 3PH5A 4U9CA 2HZRA 1LIEA 4QAEA 4I3DA 1ZNDA 5D4AA 2RTHB 4CPHA 5B27A 2CZUA 2MHDA 4ORYA 1OEJA 1S2PA 3DTQA 4UU3A 2A3FX 4YCHA 1SLGB 2X46A 1BM5A 1AVGI 2FS7A 2BC3A 5EZ2A 1GT4A 1BRQA 4OMWA 1LFOA 2OY7A 3SAOA 4YFPA 3PECA 2AMMX 3WJDA 1NDJA 4YGHA 1OPAA 3ZZVA 2X8TA 5LJKA 2RTAA 1S7DA 1IW2A 1GX3A 1JJUA 1ZNGA 5AQ6A 1ACDA 1SRHA 2ALLX 3FLLA 1T0VA 2IZGB 4IB9A 4BQUA 4INNA 4I9SA 5HZ6A 3UAQA 3STKA 2OFAA 1ZRYA 4XMHA 1STSB 5BYPA 1NP1A 3MM0A 4GGRA 5IO6A 2IZEB 4WHIA 4Y5DA 4GZVA 2OYBO 4B55A 1KT5A 1BSQA 4FBOA 1KL5A 3HTYA 2R73A 1X8UA 4GGTA 3WJCA 4HPDA 2AT0X 1EPAA 3U03A 3JQOA 3CBSA 5JR8A 1D2UA 3ZW0B 1VPRA 1SWCA 2FRSA 1HY2A 1DV9A 4Z6JA 4KIIA 1VWIB 3ZUIA 2YMSA 1U17A 2MJIA 3TGBA 3FA9A 1SY0A 4BX7A 4DCBA 4M6SA 4CV7A 1BJ7A 5B3MO 1KT6A 1B4MA 2JMBA 1TXLA 1ML7A 3CKFA 4GDZA 5EDBA 2G7BA 3GE2A 4QGXA 1SWOA 1I04A 4IAXA 4YGGA 3TF6A 3ZQ3A 2RTQB 3BY0A 4QNIA 1LCWA 3H3IA 4GUZA 3WXQA 1AB0A 1SRIA 1WUBA 5F2BA 2LBVA 3BS2A 1NC9A 1R0UA 2O62A 4OS3A 1SY2A 3WJFA 3VG3A 1JYJA 3CKGA 5IO5A 4PJ2A 1TVQA 1EI5A 3FIDA 4D6AA 1SWJA 1I06A 3BX7A 4HPBA 2Q39A 2YG2A 5LJBA 1VWGB 5FQ7E 3ZW1B 1ZNLA 1FTPA 1NQMA 1SWUA 2ZSCA 1OEKA 3BU1A 3MX7A 1W6FA 5HCEC 1STRB 2MF6A 1EXSA 1QY1A 1VYOA 2RTJA 3I17A 4IB8A 3VG2A 2BHVA 2Q2MA 3P24A 2RTBB 1A18A 1LCVA 2A2GA 3NADA 3OE3A 3Q6LA 4WBKA 1AQBA 5F7GA 2OF8A 1KT7A 1SLEB
chains in the Genus database with same CATH topology
3KQ0A 5L8IA 1QFVA 4ORUA 2L67A 4ALBA 2CZTA 3HWDA 2X45A 2NNDA 4ZH6A 3CWKA 2QO4A 2G78A 2ACPX 4I3CA 1O1VA 2FWVA 2ZAIA 3WJBA 2F73A 4FGIB 4NLJA 1TW4A 3O2YA 3FR2A 2JU3A 3O22A 2HNXA 4YBUA 3C77X 3WVMA 1KZXA 1PEEA 3EM0A 4IMOA 1FDQA 4I6SA 4UU2A 5FQ8E 1CJ5A 4TKHA 3RZYA 4LKTA 1EALA 4BVMA 1KQXA 1SXYA 4QQ1A 5DG4A 1FEMA 2QM9A 3RSWA 4KCAA 3UEVA 1GX8A 1DZPA 1EIOA 2ASNX 2GTFX 1YIVA 3PP6A 4AZPA 3FR5A 3HWEA 3S26A 2FLJA 4YCEA 4ZFXA 2EU7X 2P8GA 4L1NA 4NYQA 1IKJA 4K19A 1Y9TA 4KT5A 4ZHGA 4RUUA 4ZCBA 2JU7A 5D8JA 2MO5A 1T8VA 2AT5X 4EDEA 4GU8A 1LF7A 5EDCA 1B56A 4U3QA 4GH7A 1GGLA 2AT6X 4HWMA 4CK4A 1FENA 1QFTA 4DQ4A 3VG6A 3DSZA 3MBTA 3EBKA 5HZ5A 4DQ3A 3CQNA 4O3ZA 1UZ2X 3L4RA 5AJBA 3K3LA 4ZGFA 5KHPA 2KTSA 4KC7A 1BSYA 3OJYC 1B8EA 3NQ9A 4ALOA 1GKAB 3NX2A 2PY1A 5LJGA 5LJDA 1N0SA 4O3XB 3UEUA 1DZJA 3P6HA 3S60A 3FELA 3LV4A 4IB6A 1QY0A 2WSJA 4GE1A 4YDBA 5HCCC 2RD7C 3WBGA 2NP1A 4XMGA 4Y0SA 1JV4A 4YH0A 4ZH9A 5AEOA 5IO7A 2GTLN 4EQAC 1SMPI 2KW1A 1ERXA 1XKIA 1EQDA 1I4UA 3D95A 3FMZA 4JGLA 1PM1X 2HMBA 2QMIA 2Z4IA 1PMPA 2N93A 4I3BA 3FENA 3FA7A 1IFCA 4KC8A 4D6BA 1IKEA 2WWPA 2A0AA 1A2DA 3BRNA 3E3CA 4O4OA 4GRJA 1KOIA 3IA8A 3PH6A 4FQBB 4YDAA 2HZQA 4HFOA 3APXA 1EUOA 3FEPA 3NX1A 3PEDA 4AZMA 4AZQA 5FAZA 4PSQA 5K06A 4ML7B 1HBPA 1AELA 1JIWI 2W2AA 2BT9A 2OFMX 2BS6A 1X8QA 2KD2A 1OBQA 2JU8A 1IFBA 5LJEA 3TGCA 1L6MA 4NW4A 3BX8A 3NQ3A 3F6ZB 3STMX 2QOSC 1JZUA 4AZRA 2HLVA 2OVEA 5C0NA 1ICNA 1T68X 2CBRA 4MVKA 1MDCA 2CM9A 5D45A 5H9NA 4AZOA 2WR6A 5LKEA 3HK1A 1BEBA 1P6PA 2AT3X 3G7XA 2W2FA 2Q2PA 1G74A 3O19A 1A57A 4NYRA 1OPBA 3UEXA 3HOLA 5FENA 4ORXA 3WOVA 5HWZA 2BS5A 4EFGA 1MUPA 1SXUA 4RUNA 1U0XA 1E06A 1IIUA 4I9RA 3TGAA 1ERBA 2JOZA 4TQ2A 4XMEA 4YFQA 1BSOA 5FQ6E 2WQ9A 4IB7A 2WEWA 1KZWA 4L3RA 4N7DA 3KFHA 3ZUOA 5L8OA 4QYPA 5LJCA 3NBXX 1HMTA 3JS1A 3EMMA 1KQWA 1HN2A 2L5PA 4XMDA 3FIQA 4MVIA 3ZW0A 3HWFA 5HA0A 3HWGA 3PQUA 5HTDA 4MVLA 4ARHA 3FW4A 4A1YA 5LKFA 2AKQA 4AYHA 1KGLA 3FA8A 4XMCA 3GAQA 4LZVA 4OS0A 5D47A 4ES7A 2FR3A 1EPBA 4ID2A 1A3YA 2OVAA 4NNSA 5EEEA 3APWA 4EXZA 3P02A 2G79A 1GXAA 5EEDA 3VG7A 3CQRA 2K62A 3BDRA 4HPAA 3P6GA 3P6EA 4ZHCA 1EW3A 2AH7X 2XKLA 1ICMA 5HZQA 1JJJA 3T1DA 4A8ZA 2RCTA 3OBLA 2QO6A 3VE2A 3VU1A 2FR2A 4CSBA 1G7NA 4GETA 4O4SA 3B2KA 1OBUA 4O49A 4O4UA 3V8UA 1LICA 2A2UA 2E4JA 4HPCA 4YFRA 4U8UM 3STNA 2ACOA 2X8FA 5HA1A 2K23A 4YMYA 1BLRA 5HZ8A 5AJCA 4GNWA 1LNMA 3TZSA 1QABE 1CBRA 3B2LA 3I0AA 1OEEA 1CBSA 3RBYA 5BVSA 1HBQA 4TKBA 1LIDA 1SXWA 2XSTA 4N7CA 5F6BA 3MVFA 1BWYA 3CBCA 1X89A 4QZTA 1MX7A 2LBAA 3FEKA 5F6ZA 4QRLA 1G5WA 2LA7A 4O3WA 1DC9A 3WJEA 1SA8A 5KICA 1GT5A 4XMFA 5HZ9A 1FE3A 3AKMA 4TNNA 4U8UO 1FELA 1BBPA 1ZNHA 5HCDC 1CRBA 3FW5A 3NP1A 3VE1A 1HMRA 2X8SA 2AL0X 2GTLM 2Z4HA 3AKNA 1QQSA 4KH8A 4QGWA 1NP4A 2IFBA 2QO5A 5CE4A 1XCAA 5CYBA 3APUA 1U18A 3QKGA 3IFBA 1GX9A 5B29A 4ORWA 4WFVA 2WQAE 3FA6A 1G85A 3B2HA 4NNTA 4R0BA 1O1UA 4QGVA 5L8NA 3KFGA 3S5VA 3C76X 4Y0QA 3CMPA 2FT9A 1DF3A 1E5PA 1RLBE 2JW1A 2GTLO 2R56A 4GKCA 4IAWA 4LKPA 4ZHFA 4Y0RA 3BU9A 3PPTA 1YWBA 1VYFA 4FBVA 4ORRA 4Y0PA 4COTA 3RWXA 3ELXA 2NNEA 3VPJE 1GKAA 3BLGA 1ALBA 3JSQA 4GK9A 4I95A 2KTDA 4TKJA 1KT3A 5KIDA 1EIIA 1BRPA 2OVDA 4YKOA 3KFIA 2JN3A 2AT8X 3FYFA 1LIBA 1D3SA 1X8NA 4MVEA 3LHNA 4EEJA 3VG4A 1SY1A 4GNYA 2OVSA 3D96A 5D48A 4A60A 1X8OA 4OMXA 1LKEA 4NLIA 1ADLA 1VYGA 1YUPA 1LPJA 1QY2A 1JYDA 2OZQA 5F58A 2NNQA 2RQ0A 1B0OA 1S44A 2HYSA 3NR3A 4QYNA 4ZJ0A 4OS8A 2OFRX 1YWCA 5BVQA 3P6FA 4MISA 2DM5A 1DZKA 4MIRA 5HAEA 1YP6A 1MX8A 3ELZA 5FFHA 1GT3A 4LZUA 1Z24A 3B2IA 5H9LA 4AZNA 4IABA 5H9KA 2ANSA 3NPOA 3HOEA 1YWDA 2M4LA 3BSZE 3P6CA 1QWDA 1Y9LA 2GC9A 5EPQA 5H8TA 3FR4A 2A13A 3CR6A 3PQSA 3KZAA 4TJZA 3B2JA 2Q9SA 4IMNA 4BOEA 1KXOA 1LIFA 4O3YA 2LB6A 2CM4A 1ZNKA 1YWAA 3OD9A 1CBIA 4M7MA 4FBRA 2W2BA 4LQZA 3P6DA 1KT4A 1X8PA 2MM3A 3EYCA 5DPQA 4YBPA 1GT1A 5LJHA 4ON1A 2GJ5A 1NGLA 3ZW2A 2MWHA 1CBQA 5HBSA 3WJGA 4O4XA 4ORSA 3NQKA 1X71A 3F9DA 3ZI8A 2WUTA 1YP7A 2KT4B 5HTEA 3ZW1A 4ODDA 2R74A 4QZUA 1HMSA 2FS6A 3U9PC 3U0DA 4YGZA 3SOTA 1ZNEA 1DZMA 2RA6A 1GM6A 1TOWA 4WFUA 1JBHA 1QG5A 1DFVA 1JJXA 2LKKA 2L68A 1O8VA 2L9CA 1TOUA 2LFOA 4YKMA 4A1HA 1MVGA 3F8AA 3S5XA 1RBPA 2POAA 3RKGA 1HQPA 1PBOA 4U8UN 5BVTA 2WEXA 1E00A 3APVA 3ZWEA 4O9SA 1H91A 1SY3A 3D97A 2RN4A 5H9AA 2F09A 2RCQA 3D4RA 1I05A 3KFFA 4ZR2A 2ZAGA 4NP1A 1E02A 2Q4NA 3C78X 2FTBA 3UEWA 1SXXA 2CBSA 3ZZVA 4ZGUA 3N91A 5F1EA 2BLGA 4AW8A 1UREA 4ZHHA 4TLJA 1OBPA 3EBWA 4IBAA 3PH5A 4U9CA 2HZRA 1LIEA 4QAEA 4I3DA 1ZNDA 5D4AA 5B27A 2CZUA 2MHDA 4ORYA 1OEJA 1S2PA 3DTQA 4UU3A 2A3FX 4YCHA 2X46A 1BM5A 1AVGI 2FS7A 5EZ2A 1GT4A 1BRQA 4OMWA 1LFOA 3SAOA 4YFPA 3PECA 2AMMX 3WJDA 4YGHA 1OPAA 5LJKA 2X8TA 1S7DA 1IW2A 1ZNGA 5AQ6A 1ACDA 2ALLX 3FLLA 1T0VA 4IB9A 4BQUA 4INNA 4I9SA 5HZ6A 3UAQA 3STKA 1ZRYA 4XMHA 5BYPA 1NP1A 5IO6A 4WHIA 4GZVA 1KT5A 1BSQA 4FBOA 3HTYA 2R73A 1X8UA 3WJCA 4HPDA 2AT0X 1EPAA 3U03A 3JQOA 3CBSA 5JR8A 1D2UA 3ZW0B 1VPRA 2FRSA 1DV9A 4KIIA 3ZUIA 2YMSA 1U17A 2MJIA 3TGBA 3FA9A 1SY0A 4CV7A 4M6SA 1BJ7A 1KT6A 1B4MA 2JMBA 1TXLA 1ML7A 4GDZA 5EDBA 2G7BA 3GE2A 4QGXA 1I04A 4IAXA 4YGGA 3TF6A 3ZQ3A 3BY0A 4QNIA 3H3IA 3WXQA 1AB0A 2LBVA 3BS2A 1R0UA 2O62A 4OS3A 1SY2A 3WJFA 3VG3A 1JYJA 5IO5A 4PJ2A 1TVQA 1EI5A 4D6AA 1I06A 3BX7A 4HPBA 2Q39A 2YG2A 5LJBA 5FQ7E 3ZW1B 1ZNLA 1FTPA 1OEKA 3BU1A 3MX7A 5HCEC 1EXSA 1QY1A 3I17A 4IB8A 3VG2A 2BHVA 2Q2MA 3P24A 3NADA 1A18A 2A2GA 3OE3A 3Q6LA 4WBKA 5F7GA 4ZHDA 1AQBA 1KT7A 3VG5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KQ0 A;  5L8I A;  1QFV A;  4ORU A;  2L67 A;  4ALB A;  2CZT A;  3HWD A;  2X45 A;  2NND A;  4ZH6 A;  3CWK A;  2QO4 A;  2G78 A;  2ACP X;  4I3C A;  1O1V A;  2FWV A;  3WJB A;  2F73 A;  4NLJ A;  1TW4 A;  3O2Y A;  3FR2 A;  2JU3 A;  3O22 A;  2HNX A;  4YBU A;  3C77 X;  3WVM A;  1KZX A;  1PEE A;  3EM0 A;  4IMO A;  1FDQ A;  4UU2 A;  1JZU A;  1CJ5 A;  4TKH A;  3RZY A;  4LKT A;  1EAL A;  4BVM A;  1KQX A;  1SXY A;  5DG4 A;  1FEM A;  2QM9 A;  3RSW A;  3UEV A;  1GX8 A;  1DZP A;  1EIO A;  2ASN X;  2GTF X;  1YIV A;  3PP6 A;  4AZP A;  3FR5 A;  3HWE A;  3S26 A;  2FLJ A;  4YCE A;  4ZFX A;  2EU7 X;  2P8G A;  4NYQ A;  1IKJ A;  4K19 A;  4ZHG A;  4RUU A;  4ZCB A;  2JU7 A;  5D8J A;  2MO5 A;  1T8V A;  2AT5 X;  4EDE A;  5EDC A;  1LF7 A;  1B56 A;  4GH7 A;  1GGL A;  2AT6 X;  4CK4 A;  1FEN A;  1QFT A;  4DQ4 A;  3VG6 A;  3DSZ A;  3MBT A;  3EBK A;  5HZ5 A;  4DQ3 A;  3CQN A;  1UZ2 X;  3L4R A;  3K3L A;  5KHP A;  1BSY A;  3OJY C;  1B8E A;  3NQ9 A;  4ALO A;  1GKA B;  3NX2 A;  2PY1 A;  5LJG A;  5LJD A;  1N0S A;  3UEU A;  1DZJ A;  3P6H A;  3FEL A;  4IB6 A;  1QY0 A;  2WSJ A;  4GE1 A;  4YDB A;  5HCC C;  2RD7 C;  3WBG A;  2NP1 A;  4XMG A;  4Y0S A;  1JV4 A;  4YH0 A;  4ZH9 A;  5IO7 A;  1ERX A;  1XKI A;  1EQD A;  1I4U A;  3D95 A;  3FMZ A;  1PM1 X;  2HMB A;  1PMP A;  2N93 A;  4I3B A;  3FEN A;  3FA7 A;  1IFC A;  4D6B A;  1IKE A;  2WWP A;  2A0A A;  1A2D A;  3BRN A;  4GRJ A;  1KOI A;  3IA8 A;  3PH6 A;  4YDA A;  2HZQ A;  4HFO A;  3APX A;  1EUO A;  3FEP A;  3NX1 A;  3PED A;  4AZM A;  4AZQ A;  5FAZ A;  4PSQ A;  5K06 A;  1HBP A;  1AEL A;  2W2A A;  2OFM X;  1X8Q A;  1OBQ A;  2JU8 A;  1IFB A;  5LJE A;  3TGC A;  1L6M A;  3BX8 A;  3NQ3 A;  3STM X;  2QOS C;  4AZR A;  2HLV A;  2OVE A;  5C0N A;  1ICN A;  1T68 X;  2CBR A;  4MVK A;  1MDC A;  2CM9 A;  5D45 A;  5H9N A;  4AZO A;  2WR6 A;  5LKE A;  3HK1 A;  1BEB A;  1P6P A;  2AT3 X;  3G7X A;  2W2F A;  2Q2P A;  1G74 A;  3O19 A;  1A57 A;  4NYR A;  1OPB A;  3UEX A;  5FEN A;  4ORX A;  5HWZ A;  4EFG A;  1MUP A;  1SXU A;  4RUN A;  1U0X A;  1E06 A;  1IIU A;  4I9R A;  3TGA A;  1ERB A;  2JOZ A;  4TQ2 A;  4XME A;  4YFQ A;  1BSO A;  2WQ9 A;  4IB7 A;  2WEW A;  1KZW A;  4N7D A;  3KFH A;  3ZUO A;  5L8O A;  4QYP A;  5LJC A;  1HMT A;  3JS1 A;  3EMM A;  1KQW A;  1HN2 A;  2L5P A;  4XMD A;  3FIQ A;  4MVI A;  3HWF A;  5HA0 A;  3HWG A;  5HTD A;  4MVL A;  4ARH A;  3FW4 A;  4A1Y A;  5LKF A;  2AKQ A;  4AYH A;  1KGL A;  3FA8 A;  4XMC A;  3GAQ A;  4LZV A;  4OS0 A;  5D47 A;  4ES7 A;  2FR3 A;  1EPB A;  1A3Y A;  2OVA A;  4NNS A;  5EEE A;  3APW A;  4EXZ A;  2G79 A;  1GXA A;  5EED A;  3VG7 A;  3CQR A;  2K62 A;  3BDR A;  4HPA A;  3P6G A;  3P6E A;  4ZHC A;  1EW3 A;  2AH7 X;  2XKL A;  1ICM A;  5HZQ A;  1JJJ A;  3T1D A;  4A8Z A;  2RCT A;  2QO6 A;  2FR2 A;  1G7N A;  4GET A;  3B2K A;  1OBU A;  1LIC A;  2A2U A;  2E4J A;  4HPC A;  4YFR A;  3STN A;  2ACO A;  5HA1 A;  2K23 A;  4YMY A;  1BLR A;  5HZ8 A;  4GNW A;  1LNM A;  3TZS A;  1QAB E;  1CBR A;  3B2L A;  3I0A A;  1OEE A;  1CBS A;  5BVS A;  1HBQ A;  4TKB A;  1LID A;  1SXW A;  2XST A;  4N7C A;  5F6B A;  3MVF A;  1BWY A;  3CBC A;  1X89 A;  4QZT A;  1MX7 A;  2LBA A;  3FEK A;  5F6Z A;  1G5W A;  3WJE A;  1DC9 A;  1SA8 A;  5KIC A;  1GT5 A;  4XMF A;  5HZ9 A;  1FE3 A;  3AKM A;  4TNN A;  1FEL A;  1BBP A;  1ZNH A;  5HCD C;  1CRB A;  3FW5 A;  3NP1 A;  1HMR A;  2AL0 X;  4QGW A;  3AKN A;  1QQS A;  1NP4 A;  2IFB A;  2QO5 A;  5CE4 A;  1XCA A;  3APU A;  1U18 A;  3QKG A;  3IFB A;  1GX9 A;  5B29 A;  4ORW A;  4WFV A;  2WQA E;  3FA6 A;  1G85 A;  3B2H A;  4NNT A;  4R0B A;  1O1U A;  4QGV A;  5L8N A;  3KFG A;  3C76 X;  4Y0Q A;  3CMP A;  2FT9 A;  1DF3 A;  1E5P A;  1RLB E;  2R56 A;  4GKC A;  4IAW A;  4LKP A;  4ZHF A;  4Y0R A;  3BU9 A;  3PPT A;  1YWB A;  1VYF A;  4ORR A;  4Y0P A;  3ELX A;  2NNE A;  1GKA A;  3BLG A;  1ALB A;  3JSQ A;  5KID A;  4TKJ A;  2KTD A;  1KT3 A;  1EII A;  1BRP A;  2OVD A;  4YKO A;  3KFI A;  2AT8 X;  2JN3 A;  1LIB A;  1D3S A;  1X8N A;  4EEJ A;  3VG4 A;  1SY1 A;  4GNY A;  3D96 A;  5D48 A;  4A60 A;  1X8O A;  4OMX A;  1LKE A;  4NLI A;  1ADL A;  1VYG A;  1YUP A;  1LPJ A;  1QY2 A;  1JYD A;  2OZQ A;  5F58 A;  2NNQ A;  2RQ0 A;  1B0O A;  1S44 A;  2HYS A;  3NR3 A;  4QYN A;  4ZJ0 A;  4OS8 A;  2OFR X;  1YWC A;  5BVQ A;  3P6F A;  2DM5 A;  1DZK A;  5HAE A;  1YP6 A;  1MX8 A;  3ELZ A;  5FFH A;  1GT3 A;  4LZU A;  1Z24 A;  3B2I A;  5H9L A;  4AZN A;  5H9K A;  2ANS A;  3NPO A;  1YWD A;  3BSZ E;  3P6C A;  1QWD A;  2GC9 A;  5EPQ A;  5H8T A;  3FR4 A;  2A13 A;  3CR6 A;  3KZA A;  4TJZ A;  3B2J A;  2Q9S A;  4IMN A;  4BOE A;  1KXO A;  1LIF A;  2LB6 A;  2CM4 A;  1ZNK A;  1YWA A;  4M7M A;  1CBI A;  2W2B A;  3P6D A;  1KT4 A;  1X8P A;  2MM3 A;  3EYC A;  5DPQ A;  4YBP A;  1GT1 A;  5LJH A;  2GJ5 A;  1NGL A;  1CBQ A;  5HBS A;  3WJG A;  4ORS A;  1X71 A;  3F9D A;  2WUT A;  1YP7 A;  2KT4 B;  5HTE A;  4ODD A;  2R74 A;  4QZU A;  1HMS A;  2FS6 A;  3U9P C;  3U0D A;  4YGZ A;  1ZNE A;  1DZM A;  2RA6 A;  1GM6 A;  1TOW A;  4WFU A;  1JBH A;  1QG5 A;  1DFV A;  1JJX A;  2LKK A;  2L68 A;  1O8V A;  2L9C A;  1TOU A;  2LFO A;  4YKM A;  4A1H A;  1MVG A;  3F8A A;  1RBP A;  2POA A;  1HQP A;  1PBO A;  5BVT A;  2WEX A;  1E00 A;  3APV A;  4O9S A;  1H91 A;  1SY3 A;  3D97 A;  5H9A A;  2RCQ A;  1I05 A;  3KFF A;  4ZR2 A;  4NP1 A;  1E02 A;  2Q4N A;  3C78 X;  2FTB A;  3UEW A;  1SXX A;  2CBS A;  4ZGU A;  5F1E A;  2BLG A;  4AW8 A;  1URE A;  4ZHH A;  4TLJ A;  1OBP A;  3EBW A;  4IBA A;  3PH5 A;  2HZR A;  1LIE A;  4QAE A;  4I3D A;  1ZND A;  5D4A A;  5B27 A;  2CZU A;  4ORY A;  1OEJ A;  1S2P A;  3DTQ A;  4UU3 A;  2A3F X;  4YCH A;  2X46 A;  1BM5 A;  1AVG I;  2FS7 A;  5EZ2 A;  1GT4 A;  1BRQ A;  4OMW A;  1LFO A;  3SAO A;  4YFP A;  3PEC A;  2AMM X;  3WJD A;  4YGH A;  1OPA A;  5LJK A;  1S7D A;  1IW2 A;  1ZNG A;  5AQ6 A;  1ACD A;  2ALL X;  3FLL A;  1T0V A;  4IB9 A;  4BQU A;  4I9S A;  5HZ6 A;  3STK A;  1ZRY A;  4XMH A;  1NP1 A;  5IO6 A;  1KT5 A;  1BSQ A;  2R73 A;  1X8U A;  3WJC A;  4HPD A;  2AT0 X;  1EPA A;  3U03 A;  3CBS A;  5JR8 A;  1D2U A;  1VPR A;  2FRS A;  1DV9 A;  4KII A;  3ZUI A;  1U17 A;  2MJI A;  3TGB A;  3FA9 A;  1SY0 A;  4M6S A;  1BJ7 A;  1KT6 A;  1B4M A;  1TXL A;  1ML7 A;  5EDB A;  2G7B A;  4QGX A;  1I04 A;  4IAX A;  4YGG A;  3TF6 A;  3ZQ3 A;  3BY0 A;  3WXQ A;  1AB0 A;  2LBV A;  3BS2 A;  1R0U A;  2O62 A;  4OS3 A;  1SY2 A;  3WJF A;  3VG3 A;  1JYJ A;  5IO5 A;  1TVQ A;  4D6A A;  1I06 A;  3BX7 A;  4HPB A;  2Q39 A;  2YG2 A;  5LJB A;  1ZNL A;  1FTP A;  1OEK A;  3BU1 A;  5HCE C;  1EXS A;  1QY1 A;  3I17 A;  4IB8 A;  3VG2 A;  2Q2M A;  3NAD A;  1A18 A;  2A2G A;  3Q6L A;  4WBK A;  5F7G A;  4ZHD A;  1AQB A;  1KT7 A;  3VG5 A; 
#chains in the Genus database with same CATH topology
 2OL8 O;  3KQ0 A;  5L8I A;  2X4M A;  1QFV A;  4ORU A;  2L67 A;  4ALB A;  2CZT A;  3HWD A;  3T2W A;  2X45 A;  3TGC A;  2NND A;  1VWQ B;  1SLF B;  4ZH6 A;  3CWK A;  2QO4 A;  2G78 A;  3PDF A;  2FHL A;  1VWM B;  2ACP X;  4I3C A;  5IXG A;  1O1V A;  2FWV A;  2AF5 A;  2ZAI A;  3WJB A;  2F73 A;  4FGI B;  1VWO B;  4NLJ A;  1STP A;  1TW4 A;  3O2Y A;  3WYP A;  3FR2 A;  4CPE A;  2JU3 A;  3O22 A;  2HNX A;  4YBU A;  3C77 X;  3SLT A;  3WVM A;  1PEE A;  3EM0 A;  1KZX A;  2RTO B;  4IMO A;  1FDQ A;  4I6S A;  4UU2 A;  5FQ8 E;  1CJ5 A;  4TKH A;  3RZY A;  1HXL A;  1N9M A;  4LKT A;  1KQX A;  1SXY A;  4QQ1 A;  4BVM A;  5B5F A;  5DG4 A;  1FEM A;  2QM9 A;  3RSW A;  4KCA A;  3UEV A;  4CPH B;  1GX8 A;  1DZP A;  1EIO A;  2ASN X;  2GTF X;  1YIV A;  3PP6 A;  4AZP A;  2A8G A;  3FR5 A;  3HWE A;  3S26 A;  3WZO A;  2FLJ A;  1SWG A;  4YCE A;  4ZFX A;  2RTM A;  2EU7 X;  2P8G A;  4L1N A;  2Y3F A;  1IKJ A;  4NYQ A;  4K19 A;  1Y9T A;  4KT5 A;  4I60 A;  1AVE A;  4ZHG A;  4RUU A;  1MM9 A;  2JU7 A;  4ZCB A;  4Z27 A;  5D8J A;  2MO5 A;  1T8V A;  2AT5 X;  4ZHD A;  3PK2 A;  4EDE A;  4GU8 A;  1LF7 A;  5EDC A;  1B56 A;  4U3Q A;  4GH7 A;  4C5P A;  1GGL A;  2AT6 X;  4HWM A;  4CK4 A;  1FEN A;  1QFT A;  4DQ4 A;  2OY5 O;  3VG6 A;  3DSZ A;  3MBT A;  3EBK A;  5HZ5 A;  1KL3 A;  1PTS A;  3CQN A;  4O3Z A;  3SZJ A;  4DQ3 A;  1UZ2 X;  5K67 A;  2UYW A;  3L4R A;  5AJB A;  3K3L A;  4ZGF A;  5KHP A;  2KTS A;  4KC7 A;  1NBX A;  1BSY A;  3OJY C;  3RDS A;  1B8E A;  3NQ9 A;  2OL6 O;  3D9W A;  2A5B A;  4ALO A;  1GKA B;  3NX2 A;  2PY1 A;  5LJG A;  5LJD A;  1VWE B;  1N0S A;  4O3X B;  1AVD A;  3UEU A;  2VFC A;  3RDU A;  1DZJ A;  1W4T A;  2UZ2 A;  3P6H A;  3S60 A;  1I9H A;  1VWF B;  3FEL A;  3LV4 A;  4IB6 A;  1QY0 A;  2WSJ A;  4GE1 A;  4JNJ A;  4YDB A;  2RD7 C;  3VHI A;  2NP1 A;  3WBG A;  5HCC C;  4XMG A;  4Y0S A;  1JV4 A;  4YH0 A;  4ZH9 A;  4BX6 B;  5AEO A;  2GTL N;  5IO7 A;  4EQA C;  1SMP I;  1ERX A;  1XKI A;  1EQD A;  1I4U A;  2KW1 A;  3D95 A;  3FMZ A;  4JGL A;  1PM1 X;  1LUQ A;  2HMB A;  2QMI A;  2Z4I A;  1PMP A;  2F01 A;  2N93 A;  4I3B A;  3FEN A;  3FA7 A;  1IFC A;  1RSU B;  4KC8 A;  4D6B A;  1VWD B;  1IKE A;  2WWP A;  4Z28 A;  1KFF A;  1A2D A;  2A0A A;  3VG5 A;  4Z2P A;  3BRN A;  3E3C A;  4O4O A;  3KVN A;  3RE5 A;  1VWC B;  3EW1 A;  2I5Z O;  4GRJ A;  1KOI A;  3IA8 A;  5KID A;  3PH6 A;  2Y3E A;  4FQB B;  4YDA A;  2HZQ A;  2IZA A;  4HFO A;  3APX A;  2A5C A;  1EUO A;  1RXH A;  3FEP A;  1N43 A;  3NX1 A;  3PED A;  4AZM A;  1HXZ A;  3SLJ A;  4OEL A;  4AZQ A;  5FAZ A;  4CDC A;  4PSQ A;  5K06 A;  4ML7 B;  1HBP A;  2DJF A;  1JIW I;  2Y32 A;  2W2A A;  1N9Y A;  4CDE A;  1AEL A;  2FKJ A;  1I78 A;  2BT9 A;  2OFM X;  2BS6 A;  1X8Q A;  2KD2 A;  1OBQ A;  2JU8 A;  1IFB A;  3EW2 A;  2X32 A;  1L6M A;  4NW4 A;  3WYQ A;  3BX8 A;  3NQ3 A;  5LJE A;  3F6Z B;  3STM X;  2QOS C;  1JZU A;  4AZR A;  5L3Y A;  2VDF A;  2HLV A;  2OVE A;  5C0N A;  1ICN A;  1T68 X;  2CBR A;  4MVK A;  1MDC A;  3VHM A;  1RXK A;  2CM9 A;  5D45 A;  5H9N A;  4Z2O A;  2X56 A;  2FKG A;  3WZP A;  4AZO A;  2WR6 A;  4BGF A;  5LKE A;  1JMX A;  3HK1 A;  4Y59 A;  1BEB A;  1P6P A;  2AT3 X;  3G7X A;  2W2F A;  2Q2P A;  1Y55 X;  1G74 A;  1LDQ A;  3O19 A;  1A57 A;  4NYR A;  1OPB A;  3UEX A;  3HOL A;  5FEN A;  4ORX A;  3WOV A;  1E2T A;  5HWZ A;  2BS5 A;  3VHH A;  1MUP A;  5K68 A;  1SXU A;  4EFG A;  4RUN A;  1U0X A;  4U46 A;  1E06 A;  1IIU A;  4I9R A;  3SZI A;  1ERB A;  2JOZ A;  3TGA A;  4TQ2 A;  4XME A;  4YFQ A;  1SWQ A;  1BSO A;  2GH7 A;  5FQ6 E;  2WQ9 A;  4IB7 A;  3SLO A;  2WEW A;  3WZN A;  1KZW A;  1LCZ A;  3MG5 A;  2OF9 A;  2IZJ A;  4NV8 A;  4L3R A;  4N7D A;  3KFH A;  3ZUO A;  5L8O A;  4QYP A;  5LJC A;  3NBX X;  1HMT A;  3JS1 A;  5JD2 A;  3EMM A;  1KQW A;  1HN2 A;  2L5P A;  4XMD A;  3FIQ A;  4MVI A;  3ZW0 A;  1SRJ A;  3RDM A;  3HWF A;  5HA0 A;  3HWG A;  1SWF A;  3PQU A;  1SWS A;  5HTD A;  1HQQ A;  4MVL A;  4ARH A;  5B11 O;  3FW4 A;  4A1Y A;  5LKF A;  2AKQ A;  4AYH A;  1KGL A;  3FA8 A;  2BSZ A;  2RTR B;  3FDC A;  4XMC A;  3GAQ A;  4LZV A;  4OS0 A;  5D47 A;  4ES7 A;  4BBO A;  2FR3 A;  1EPB A;  4ID2 A;  1A3Y A;  2OVA A;  2RTE B;  4NNS A;  3APW A;  5EEE A;  3P02 A;  2G79 A;  4EXZ A;  1GXA A;  5EED A;  3VG7 A;  3CQR A;  2K62 A;  3BDR A;  4HPA A;  3P6G A;  3P6E A;  4ZHC A;  1EW3 A;  2OFB A;  2AH7 X;  2XKL A;  1ICM A;  5HZQ A;  3SZH A;  1JJJ A;  1BWY A;  3T1D A;  4A8Z A;  2RCT A;  3OBL A;  2FGS A;  2QO6 A;  1Y53 X;  3VE2 A;  2FR2 A;  3VU1 A;  4CSB A;  1G7N A;  1VWL B;  4GET A;  4O4S A;  3RDO A;  3B2K A;  1OBU A;  4O49 A;  4O4U A;  2OL7 A;  4EKV A;  5IRU A;  3V8U A;  4BX5 A;  1LIC A;  2A2U A;  2E4J A;  4HPC A;  4YFR A;  4U8U M;  3RY2 A;  3STN A;  2ACO A;  2X8F A;  5HA1 A;  2K23 A;  4YMY A;  1BLR A;  1MOY A;  2C1Q A;  5AJC A;  5HZ8 A;  5CHK A;  4GNW A;  1LNM A;  3TZS A;  1QAB E;  1CBR A;  3B2L A;  3VGW A;  3I0A A;  1OEE A;  1CBS A;  3RBY A;  4CDF A;  2X55 A;  1HBQ A;  5IRA A;  5BVS A;  4TKB A;  1LID A;  1SXW A;  1K3B A;  2XST A;  4N7C A;  3MVF A;  5F6B A;  1RST B;  2WPU A;  3CBC A;  1X89 A;  4QZT A;  1MX7 A;  2LBA A;  3FEK A;  5F6Z A;  4QRL A;  1G5W A;  2LA7 A;  4O3W A;  1DC9 A;  3WJE A;  1SA8 A;  5KIC A;  1GT5 A;  4XMF A;  4GD9 A;  5HZ9 A;  1FE3 A;  1SWL A;  3AKM A;  4TNN A;  4U8U O;  4JO6 A;  4CPI A;  1FEL A;  1BBP A;  4BX7 B;  1ZNH A;  5HCD C;  1CRB A;  3FW5 A;  3NP1 A;  3VE1 A;  1HMR A;  2X8S A;  2AL0 X;  2GTL M;  2IZI A;  2Z4H A;  1QQS A;  3AKN A;  4KH8 A;  4QGW A;  1NP4 A;  3WZQ A;  3X00 A;  2IFB A;  2QO5 A;  4JHQ A;  1VWA B;  2IZL B;  5CE4 A;  1XCA A;  5CYB A;  2IZF B;  3APU A;  1U18 A;  3QKG A;  3RDX A;  1PBY A;  1GX9 A;  3IFB A;  5B29 A;  4ORW A;  4WFV A;  2WQA E;  1SWT A;  1LEL A;  2VFB A;  2X34 A;  3FA6 A;  1G85 A;  1SRF A;  3B2H A;  4NNT A;  1IJ8 A;  1O1U A;  4R0B A;  4QGV A;  5L8N A;  3KFG A;  1N7Y A;  2RTC B;  3AUM O;  3C76 X;  3S5V A;  4Y0Q A;  3CMP A;  3QQ2 A;  4GJV A;  1SLD B;  1JQP A;  2CAM A;  2FT9 A;  4Z2V A;  1DF3 A;  1E5P A;  1RLB E;  2JW1 A;  1UYO X;  2GTL O;  2R56 A;  4GKC A;  4IAW A;  4LKP A;  4ZHF A;  2RTD B;  1MK5 A;  4BJ8 A;  4Y0R A;  3BU9 A;  1OSP O;  3PPT A;  1YWB A;  1VYF A;  4FBV A;  1NQN A;  4ORR A;  4Y0P A;  2PI3 O;  1Y0G A;  2AVI A;  3RWX A;  3ELX A;  4COT A;  1SWD A;  4DNE A;  1EAL A;  1VWK B;  2NNE A;  5CSE A;  2RTN B;  3VPJ E;  1GKA A;  2RTK A;  3BLG A;  2IZB A;  1ALB A;  3JSQ A;  4GK9 A;  4I95 A;  2KTD A;  4TKJ A;  1KT3 A;  2QCB A;  1N4J A;  1BRP A;  2G5L A;  2OVD A;  1EII A;  4YKO A;  3KFI A;  2AT8 X;  1SWA A;  2IZD B;  2JN3 A;  3FYF A;  1LIB A;  1D3S A;  2HKD A;  1X8N A;  4MVE A;  2RTI B;  1SRG A;  2G8C O;  3LHN A;  4CPF A;  3VG4 A;  4EEJ A;  3EC5 A;  1SY1 A;  4GNY A;  2OVS A;  4BCS A;  4BX6 A;  3D96 A;  5D48 A;  1VWJ B;  4A60 A;  2FHN X;  3T2X A;  1X8O A;  3HPE A;  4OMX A;  4OKA A;  1LKE A;  4NLI A;  4CDD A;  1ADL A;  1VYG A;  1YUP A;  1LPJ A;  1QY2 A;  1JYD A;  1VWP B;  1VWH B;  2OZQ A;  2NNQ A;  2RQ0 A;  1B0O A;  5F58 A;  1S44 A;  3T6F A;  2HYS A;  3NR3 A;  4QYN A;  4ZJ0 A;  4OS8 A;  2OFR X;  1YWC A;  5BVQ A;  1VWN B;  3P6F A;  1SRE A;  1Y52 X;  4MIS A;  1LDO A;  1DZK A;  2DM5 A;  4MIR A;  5HAE A;  1YP6 A;  1MX8 A;  3ELZ A;  5FFH A;  1GT3 A;  4LZU A;  1Z24 A;  2RTL A;  3B2I A;  4MEE A;  5H9L A;  1KL4 A;  4AZN A;  1SWR A;  1FJ1 E;  4BX5 B;  1SWE A;  2JGS A;  4IAB A;  5H9K A;  2ANS A;  3NPO A;  3HOE A;  1YWD A;  2M4L A;  3BSZ E;  3P6C A;  1QWD A;  1RAV A;  1Y9L A;  1RXJ A;  1DF8 A;  1WBI A;  2GC9 A;  1JMZ A;  5EPQ A;  3FR4 A;  2A13 A;  2C1S A;  3CR6 A;  5H8T A;  3PQS A;  3KZA A;  3RY1 A;  4TJZ A;  3B2J A;  2Q9S A;  4IMN A;  4BOE A;  3RE6 A;  1KXO A;  1LIF A;  4O3Y A;  4NV7 A;  2LB6 A;  1SWN A;  2CM4 A;  1ZNK A;  1YWA A;  3OD9 A;  1CBI A;  3Q34 A;  4M7M A;  4FBR A;  1SWB A;  2W2B A;  4LQZ A;  3P6D A;  1KT4 A;  1X8P A;  2MM3 A;  3AEH A;  3EYC A;  5DPQ A;  1SWK A;  1GT1 A;  4YBP A;  4ON1 A;  1VWB B;  2GJ5 A;  1NGL A;  4GJS A;  5LJH A;  5IRW A;  3ZW2 A;  2MWH A;  1CBQ A;  5HBS A;  3WJG A;  4O4X A;  4ORS A;  1SWH A;  3NQK A;  1X71 A;  3F9D A;  3ZI8 A;  2WUT A;  1YP7 A;  2KT4 B;  5HTE A;  3ZW1 A;  4ODD A;  2R74 A;  4QZU A;  1HMS A;  3LTW A;  2FS6 A;  3U9P C;  3U0D A;  4YGZ A;  3SOT A;  1VWR B;  1ZNE A;  1DZM A;  2RA6 A;  1GM6 A;  1TOW A;  4WFU A;  5B10 O;  1QG5 A;  3RDQ A;  1JBH A;  1DFV A;  2OY8 A;  1JJX A;  2LKK A;  2RTG B;  2L68 A;  1O8V A;  2L9C A;  2IZH B;  1TOU A;  2LFO A;  4YKM A;  4A1H A;  1MVG A;  3F8A A;  3S5X A;  4GDA A;  1RBP A;  1SWP A;  2POA A;  3RKG A;  1HQP A;  4OEM A;  1PBO A;  3T6L A;  2I5V O;  4U8U N;  5BVT A;  2C4I A;  2IZC B;  2WEX A;  1E00 A;  3APV A;  3ZWE A;  4O9S A;  1H91 A;  1MEP A;  1SY3 A;  2RN4 A;  3D97 A;  2F09 A;  2RCQ A;  3D4R A;  4GGZ A;  5H9A A;  2RTP B;  1I05 A;  2QOM A;  3KFF A;  4ZR2 A;  2ZAG A;  4NP1 A;  1E02 A;  4YVB A;  1W5R A;  2Q4N A;  3C78 X;  2FTB A;  1K24 A;  1SXX A;  2CBS A;  2OY1 O;  3UEW A;  3N91 A;  4IRW A;  2IZK A;  5F1E A;  5B5G A;  4ZGU A;  2BLG A;  2DJG A;  2RTF B;  4AW8 A;  1UYN X;  1URE A;  5B2A O;  4ZHH A;  4TLJ A;  1OBP A;  3EBW A;  4IBA A;  3PH5 A;  4U9C A;  2HZR A;  1LIE A;  4QAE A;  4I3D A;  1ZND A;  5D4A A;  2RTH B;  4CPH A;  5B27 A;  2CZU A;  2MHD A;  4ORY A;  1OEJ A;  1S2P A;  3DTQ A;  4UU3 A;  2A3F X;  4YCH A;  1SLG B;  2X46 A;  1BM5 A;  1AVG I;  2FS7 A;  2BC3 A;  5EZ2 A;  1GT4 A;  1BRQ A;  4OMW A;  1LFO A;  2OY7 A;  3SAO A;  4YFP A;  3PEC A;  2AMM X;  3WJD A;  1NDJ A;  4YGH A;  1OPA A;  3ZZV A;  2X8T A;  5LJK A;  2RTA A;  1S7D A;  1IW2 A;  1GX3 A;  1JJU A;  1ZNG A;  5AQ6 A;  1ACD A;  1SRH A;  2ALL X;  3FLL A;  1T0V A;  2IZG B;  4IB9 A;  4BQU A;  4INN A;  4I9S A;  5HZ6 A;  3UAQ A;  3STK A;  2OFA A;  1ZRY A;  4XMH A;  1STS B;  5BYP A;  1NP1 A;  3MM0 A;  4GGR A;  5IO6 A;  2IZE B;  4WHI A;  4Y5D A;  4GZV A;  2OYB O;  4B55 A;  1KT5 A;  1BSQ A;  4FBO A;  1KL5 A;  3HTY A;  2R73 A;  1X8U A;  4GGT A;  3WJC A;  4HPD A;  2AT0 X;  1EPA A;  3U03 A;  3JQO A;  3CBS A;  5JR8 A;  1D2U A;  3ZW0 B;  1VPR A;  1SWC A;  2FRS A;  1HY2 A;  1DV9 A;  4Z6J A;  4KII A;  1VWI B;  3ZUI A;  2YMS A;  1U17 A;  2MJI A;  3TGB A;  3FA9 A;  1SY0 A;  4BX7 A;  4DCB A;  4M6S A;  4CV7 A;  1BJ7 A;  5B3M O;  1KT6 A;  1B4M A;  2JMB A;  1TXL A;  1ML7 A;  3CKF A;  4GDZ A;  5EDB A;  2G7B A;  3GE2 A;  4QGX A;  1SWO A;  1I04 A;  4IAX A;  4YGG A;  3TF6 A;  3ZQ3 A;  2RTQ B;  3BY0 A;  4QNI A;  1LCW A;  3H3I A;  4GUZ A;  3WXQ A;  1AB0 A;  1SRI A;  1WUB A;  5F2B A;  2LBV A;  3BS2 A;  1NC9 A;  1R0U A;  2O62 A;  4OS3 A;  1SY2 A;  3WJF A;  3VG3 A;  1JYJ A;  3CKG A;  5IO5 A;  4PJ2 A;  1TVQ A;  1EI5 A;  3FID A;  4D6A A;  1SWJ A;  1I06 A;  3BX7 A;  4HPB A;  2Q39 A;  2YG2 A;  5LJB A;  1VWG B;  5FQ7 E;  3ZW1 B;  1ZNL A;  1FTP A;  1NQM A;  1SWU A;  2ZSC A;  1OEK A;  3BU1 A;  3MX7 A;  1W6F A;  5HCE C;  1STR B;  2MF6 A;  1EXS A;  1QY1 A;  1VYO A;  2RTJ A;  3I17 A;  4IB8 A;  3VG2 A;  2BHV A;  2Q2M A;  3P24 A;  2RTB B;  1A18 A;  1LCV A;  2A2G A;  3NAD A;  3OE3 A;  3Q6L A;  4WBK A;  1AQB A;  5F7G A;  2OF8 A;  1KT7 A;  1SLE B; 
#chains in the Genus database with same CATH homology
 3KQ0 A;  5L8I A;  1QFV A;  4ORU A;  2L67 A;  4ALB A;  2CZT A;  3HWD A;  2X45 A;  2NND A;  4ZH6 A;  3CWK A;  2QO4 A;  2G78 A;  2ACP X;  4I3C A;  1O1V A;  2FWV A;  2ZAI A;  3WJB A;  2F73 A;  4FGI B;  4NLJ A;  1TW4 A;  3O2Y A;  3FR2 A;  2JU3 A;  3O22 A;  2HNX A;  4YBU A;  3C77 X;  3WVM A;  1KZX A;  1PEE A;  3EM0 A;  4IMO A;  1FDQ A;  4I6S A;  4UU2 A;  5FQ8 E;  1CJ5 A;  4TKH A;  3RZY A;  4LKT A;  1EAL A;  4BVM A;  1KQX A;  1SXY A;  4QQ1 A;  5DG4 A;  1FEM A;  2QM9 A;  3RSW A;  4KCA A;  3UEV A;  1GX8 A;  1DZP A;  1EIO A;  2ASN X;  2GTF X;  1YIV A;  3PP6 A;  4AZP A;  3FR5 A;  3HWE A;  3S26 A;  2FLJ A;  4YCE A;  4ZFX A;  2EU7 X;  2P8G A;  4L1N A;  4NYQ A;  1IKJ A;  4K19 A;  1Y9T A;  4KT5 A;  4ZHG A;  4RUU A;  4ZCB A;  2JU7 A;  5D8J A;  2MO5 A;  1T8V A;  2AT5 X;  4EDE A;  4GU8 A;  1LF7 A;  5EDC A;  1B56 A;  4U3Q A;  4GH7 A;  1GGL A;  2AT6 X;  4HWM A;  4CK4 A;  1FEN A;  1QFT A;  4DQ4 A;  3VG6 A;  3DSZ A;  3MBT A;  3EBK A;  5HZ5 A;  4DQ3 A;  3CQN A;  4O3Z A;  1UZ2 X;  3L4R A;  5AJB A;  3K3L A;  4ZGF A;  5KHP A;  2KTS A;  4KC7 A;  1BSY A;  3OJY C;  1B8E A;  3NQ9 A;  4ALO A;  1GKA B;  3NX2 A;  2PY1 A;  5LJG A;  5LJD A;  1N0S A;  4O3X B;  3UEU A;  1DZJ A;  3P6H A;  3S60 A;  3FEL A;  3LV4 A;  4IB6 A;  1QY0 A;  2WSJ A;  4GE1 A;  4YDB A;  5HCC C;  2RD7 C;  3WBG A;  2NP1 A;  4XMG A;  4Y0S A;  1JV4 A;  4YH0 A;  4ZH9 A;  5AEO A;  5IO7 A;  2GTL N;  4EQA C;  1SMP I;  2KW1 A;  1ERX A;  1XKI A;  1EQD A;  1I4U A;  3D95 A;  3FMZ A;  4JGL A;  1PM1 X;  2HMB A;  2QMI A;  2Z4I A;  1PMP A;  2N93 A;  4I3B A;  3FEN A;  3FA7 A;  1IFC A;  4KC8 A;  4D6B A;  1IKE A;  2WWP A;  2A0A A;  1A2D A;  3BRN A;  3E3C A;  4O4O A;  4GRJ A;  1KOI A;  3IA8 A;  3PH6 A;  4FQB B;  4YDA A;  2HZQ A;  4HFO A;  3APX A;  1EUO A;  3FEP A;  3NX1 A;  3PED A;  4AZM A;  4AZQ A;  5FAZ A;  4PSQ A;  5K06 A;  4ML7 B;  1HBP A;  1AEL A;  1JIW I;  2W2A A;  2BT9 A;  2OFM X;  2BS6 A;  1X8Q A;  2KD2 A;  1OBQ A;  2JU8 A;  1IFB A;  5LJE A;  3TGC A;  1L6M A;  4NW4 A;  3BX8 A;  3NQ3 A;  3F6Z B;  3STM X;  2QOS C;  1JZU A;  4AZR A;  2HLV A;  2OVE A;  5C0N A;  1ICN A;  1T68 X;  2CBR A;  4MVK A;  1MDC A;  2CM9 A;  5D45 A;  5H9N A;  4AZO A;  2WR6 A;  5LKE A;  3HK1 A;  1BEB A;  1P6P A;  2AT3 X;  3G7X A;  2W2F A;  2Q2P A;  1G74 A;  3O19 A;  1A57 A;  4NYR A;  1OPB A;  3UEX A;  3HOL A;  5FEN A;  4ORX A;  3WOV A;  5HWZ A;  2BS5 A;  4EFG A;  1MUP A;  1SXU A;  4RUN A;  1U0X A;  1E06 A;  1IIU A;  4I9R A;  3TGA A;  1ERB A;  2JOZ A;  4TQ2 A;  4XME A;  4YFQ A;  1BSO A;  5FQ6 E;  2WQ9 A;  4IB7 A;  2WEW A;  1KZW A;  4L3R A;  4N7D A;  3KFH A;  3ZUO A;  5L8O A;  4QYP A;  5LJC A;  3NBX X;  1HMT A;  3JS1 A;  3EMM A;  1KQW A;  1HN2 A;  2L5P A;  4XMD A;  3FIQ A;  4MVI A;  3ZW0 A;  3HWF A;  5HA0 A;  3HWG A;  3PQU A;  5HTD A;  4MVL A;  4ARH A;  3FW4 A;  4A1Y A;  5LKF A;  2AKQ A;  4AYH A;  1KGL A;  3FA8 A;  4XMC A;  3GAQ A;  4LZV A;  4OS0 A;  5D47 A;  4ES7 A;  2FR3 A;  1EPB A;  4ID2 A;  1A3Y A;  2OVA A;  4NNS A;  5EEE A;  3APW A;  4EXZ A;  3P02 A;  2G79 A;  1GXA A;  5EED A;  3VG7 A;  3CQR A;  2K62 A;  3BDR A;  4HPA A;  3P6G A;  3P6E A;  4ZHC A;  1EW3 A;  2AH7 X;  2XKL A;  1ICM A;  5HZQ A;  1JJJ A;  3T1D A;  4A8Z A;  2RCT A;  3OBL A;  2QO6 A;  3VE2 A;  3VU1 A;  2FR2 A;  4CSB A;  1G7N A;  4GET A;  4O4S A;  3B2K A;  1OBU A;  4O49 A;  4O4U A;  3V8U A;  1LIC A;  2A2U A;  2E4J A;  4HPC A;  4YFR A;  4U8U M;  3STN A;  2ACO A;  2X8F A;  5HA1 A;  2K23 A;  4YMY A;  1BLR A;  5HZ8 A;  5AJC A;  4GNW A;  1LNM A;  3TZS A;  1QAB E;  1CBR A;  3B2L A;  3I0A A;  1OEE A;  1CBS A;  3RBY A;  5BVS A;  1HBQ A;  4TKB A;  1LID A;  1SXW A;  2XST A;  4N7C A;  5F6B A;  3MVF A;  1BWY A;  3CBC A;  1X89 A;  4QZT A;  1MX7 A;  2LBA A;  3FEK A;  5F6Z A;  4QRL A;  1G5W A;  2LA7 A;  4O3W A;  1DC9 A;  3WJE A;  1SA8 A;  5KIC A;  1GT5 A;  4XMF A;  5HZ9 A;  1FE3 A;  3AKM A;  4TNN A;  4U8U O;  1FEL A;  1BBP A;  1ZNH A;  5HCD C;  1CRB A;  3FW5 A;  3NP1 A;  3VE1 A;  1HMR A;  2X8S A;  2AL0 X;  2GTL M;  2Z4H A;  3AKN A;  1QQS A;  4KH8 A;  4QGW A;  1NP4 A;  2IFB A;  2QO5 A;  5CE4 A;  1XCA A;  5CYB A;  3APU A;  1U18 A;  3QKG A;  3IFB A;  1GX9 A;  5B29 A;  4ORW A;  4WFV A;  2WQA E;  3FA6 A;  1G85 A;  3B2H A;  4NNT A;  4R0B A;  1O1U A;  4QGV A;  5L8N A;  3KFG A;  3S5V A;  3C76 X;  4Y0Q A;  3CMP A;  2FT9 A;  1DF3 A;  1E5P A;  1RLB E;  2JW1 A;  2GTL O;  2R56 A;  4GKC A;  4IAW A;  4LKP A;  4ZHF A;  4Y0R A;  3BU9 A;  3PPT A;  1YWB A;  1VYF A;  4FBV A;  4ORR A;  4Y0P A;  4COT A;  3RWX A;  3ELX A;  2NNE A;  3VPJ E;  1GKA A;  3BLG A;  1ALB A;  3JSQ A;  4GK9 A;  4I95 A;  2KTD A;  4TKJ A;  1KT3 A;  5KID A;  1EII A;  1BRP A;  2OVD A;  4YKO A;  3KFI A;  2JN3 A;  2AT8 X;  3FYF A;  1LIB A;  1D3S A;  1X8N A;  4MVE A;  3LHN A;  4EEJ A;  3VG4 A;  1SY1 A;  4GNY A;  2OVS A;  3D96 A;  5D48 A;  4A60 A;  1X8O A;  4OMX A;  1LKE A;  4NLI A;  1ADL A;  1VYG A;  1YUP A;  1LPJ A;  1QY2 A;  1JYD A;  2OZQ A;  5F58 A;  2NNQ A;  2RQ0 A;  1B0O A;  1S44 A;  2HYS A;  3NR3 A;  4QYN A;  4ZJ0 A;  4OS8 A;  2OFR X;  1YWC A;  5BVQ A;  3P6F A;  4MIS A;  2DM5 A;  1DZK A;  4MIR A;  5HAE A;  1YP6 A;  1MX8 A;  3ELZ A;  5FFH A;  1GT3 A;  4LZU A;  1Z24 A;  3B2I A;  5H9L A;  4AZN A;  4IAB A;  5H9K A;  2ANS A;  3NPO A;  3HOE A;  1YWD A;  2M4L A;  3BSZ E;  3P6C A;  1QWD A;  1Y9L A;  2GC9 A;  5EPQ A;  5H8T A;  3FR4 A;  2A13 A;  3CR6 A;  3PQS A;  3KZA A;  4TJZ A;  3B2J A;  2Q9S A;  4IMN A;  4BOE A;  1KXO A;  1LIF A;  4O3Y A;  2LB6 A;  2CM4 A;  1ZNK A;  1YWA A;  3OD9 A;  1CBI A;  4M7M A;  4FBR A;  2W2B A;  4LQZ A;  3P6D A;  1KT4 A;  1X8P A;  2MM3 A;  3EYC A;  5DPQ A;  4YBP A;  1GT1 A;  5LJH A;  4ON1 A;  2GJ5 A;  1NGL A;  3ZW2 A;  2MWH A;  1CBQ A;  5HBS A;  3WJG A;  4O4X A;  4ORS A;  3NQK A;  1X71 A;  3F9D A;  3ZI8 A;  2WUT A;  1YP7 A;  2KT4 B;  5HTE A;  3ZW1 A;  4ODD A;  2R74 A;  4QZU A;  1HMS A;  2FS6 A;  3U9P C;  3U0D A;  4YGZ A;  3SOT A;  1ZNE A;  1DZM A;  2RA6 A;  1GM6 A;  1TOW A;  4WFU A;  1JBH A;  1QG5 A;  1DFV A;  1JJX A;  2LKK A;  2L68 A;  1O8V A;  2L9C A;  1TOU A;  2LFO A;  4YKM A;  4A1H A;  1MVG A;  3F8A A;  3S5X A;  1RBP A;  2POA A;  3RKG A;  1HQP A;  1PBO A;  4U8U N;  5BVT A;  2WEX A;  1E00 A;  3APV A;  3ZWE A;  4O9S A;  1H91 A;  1SY3 A;  3D97 A;  2RN4 A;  5H9A A;  2F09 A;  2RCQ A;  3D4R A;  1I05 A;  3KFF A;  4ZR2 A;  2ZAG A;  4NP1 A;  1E02 A;  2Q4N A;  3C78 X;  2FTB A;  3UEW A;  1SXX A;  2CBS A;  3ZZV A;  4ZGU A;  3N91 A;  5F1E A;  2BLG A;  4AW8 A;  1URE A;  4ZHH A;  4TLJ A;  1OBP A;  3EBW A;  4IBA A;  3PH5 A;  4U9C A;  2HZR A;  1LIE A;  4QAE A;  4I3D A;  1ZND A;  5D4A A;  5B27 A;  2CZU A;  2MHD A;  4ORY A;  1OEJ A;  1S2P A;  3DTQ A;  4UU3 A;  2A3F X;  4YCH A;  2X46 A;  1BM5 A;  1AVG I;  2FS7 A;  5EZ2 A;  1GT4 A;  1BRQ A;  4OMW A;  1LFO A;  3SAO A;  4YFP A;  3PEC A;  2AMM X;  3WJD A;  4YGH A;  1OPA A;  5LJK A;  2X8T A;  1S7D A;  1IW2 A;  1ZNG A;  5AQ6 A;  1ACD A;  2ALL X;  3FLL A;  1T0V A;  4IB9 A;  4BQU A;  4INN A;  4I9S A;  5HZ6 A;  3UAQ A;  3STK A;  1ZRY A;  4XMH A;  5BYP A;  1NP1 A;  5IO6 A;  4WHI A;  4GZV A;  1KT5 A;  1BSQ A;  4FBO A;  3HTY A;  2R73 A;  1X8U A;  3WJC A;  4HPD A;  2AT0 X;  1EPA A;  3U03 A;  3JQO A;  3CBS A;  5JR8 A;  1D2U A;  3ZW0 B;  1VPR A;  2FRS A;  1DV9 A;  4KII A;  3ZUI A;  2YMS A;  1U17 A;  2MJI A;  3TGB A;  3FA9 A;  1SY0 A;  4CV7 A;  4M6S A;  1BJ7 A;  1KT6 A;  1B4M A;  2JMB A;  1TXL A;  1ML7 A;  4GDZ A;  5EDB A;  2G7B A;  3GE2 A;  4QGX A;  1I04 A;  4IAX A;  4YGG A;  3TF6 A;  3ZQ3 A;  3BY0 A;  4QNI A;  3H3I A;  3WXQ A;  1AB0 A;  2LBV A;  3BS2 A;  1R0U A;  2O62 A;  4OS3 A;  1SY2 A;  3WJF A;  3VG3 A;  1JYJ A;  5IO5 A;  4PJ2 A;  1TVQ A;  1EI5 A;  4D6A A;  1I06 A;  3BX7 A;  4HPB A;  2Q39 A;  2YG2 A;  5LJB A;  5FQ7 E;  3ZW1 B;  1ZNL A;  1FTP A;  1OEK A;  3BU1 A;  3MX7 A;  5HCE C;  1EXS A;  1QY1 A;  3I17 A;  4IB8 A;  3VG2 A;  2BHV A;  2Q2M A;  3P24 A;  3NAD A;  1A18 A;  2A2G A;  3OE3 A;  3Q6L A;  4WBK A;  5F7G A;  4ZHD A;  1AQB A;  1KT7 A;  3VG5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...