4YBQD

Rat glut5 with fv in the outward-open form
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
120
structure length
120
Chain Sequence
b'LEVNLVESGGGLVQPGGSRKLSCAASGFTFSSFGMHWVRQAPEKGLEWVAHISSGSRTIDYADTVKGRFTISRDNPKNTLFLQMTSLRSEDTAIYYCARGNGYYDALDYWGQGTSVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Solute carrier family 2, facilitated glucose transporter mem
molecule tags Transport protein/immune system
source organism Rattus norvegicus
publication title Structure and mechanism of the mammalian fructose transporter GLUT5
pubmed doi rcsb
total genus 27
structure length 120
sequence length 120
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ybqD00
4I0KA 4L9LB 4ENEC 3DXAA 4K3JH 4P5TB 2R2EB 3RU8H 3ULUL 4IS6A 1ACYL 5FHBL 3I6LD 1ZT4B 1Y18B 3L5HA 1XF5B 3OJDB 3GI8H 4NKOA 2GY7B 3DUHA 4B50A 1P7QB 4QTIL 2ZUUA 5ID1B 4PRIE 4F33B 4P23D 3WUWB 1J0HA 4TUJB 4L5FH 4XMKL 4PJEF 4XCFH 1ZHBA 2A74A 3TCLA 3FO1B 4IMKA 2EEAA 4LP5A 1P5VA 3QAZC 4C56A 2ED9A 4MAYD 4DUVA 4MNQE 3QULA 5JW5A 1ZT1B 4NCDA 4ZG1A 1J5OH 4ZXBD 1A1NA 3NA4A 5FA3A 5FYJH 1X5LA 4DKFL 4I4WB 1OSZA 3JWNC 5BS0D 4RGNC 1UVQA 3EDDA 5F9DC 1DVFC 4LEXL 1A4KA 2VH5L 3QCTL 4ACPA 4N0YH 3WFHB 4ALAL 4AYFA 5DMKB 1GGIL 1BEYH 1QLEH 3WD5H 5D2LF 4X6DE 1J88A 2HKHH 2HKFH 4ZUVB 4NQSA 2HLAA 5HY9B 4HKJA 4JVUA 2CIIA 1JHLL 4NPYA 3A6BH 3U4BL 4KKAD 2YWZA 5HHXL 3V0VB 5FYJE 1H3GA 4ZYKA 5CJXC 2XQYK 4OSUH 4KAQL 4BSWB 2D0HA 3I3EA 3V8OA 4OF5A 4IMKC 4LGPB 4DQOH 4HUXA 4OF6A 5IESH 1JFQL 3U7WH 4YO0A 3HR5B 4ODVH 2LVEA 2OTPA 2V7NB 1NBYB 2MNUA 3QFJE 5BS0A 1RZ7L 1T7XA 5C0CA 5B8CB 4XBPA 2A6JB 2DBJA 4U1MA 3VXRA 1JYNA 1VA9A 3AXLB 1VACA 1NMAH 3PWPD 1ZLUH 4C56D 3TT3L 4YLQT 1LK2A 3FO2A 1CXIA 2EH7H 3QUMB 3PP4H 3MQIA 3OKEB 4RFNB 3UJIH 3G5XB 1KIRB 1T4KA 1H3WM 4JPVL 2NXZB 5FGSA 3MRJB 2FDBP 3Q3GA 3UO1L 1I8IA 1NJ9A 4JFFB 1FAKT 3I3BA 2NY0D 5D71L 4E41D 4F7PA 1NBVH 2CMRL 2AK4D 1IBGH 2KPNA 1DP0A 4NHCH 1U2CA 1MELA 4FQ2L 4J7RA 4X6DA 1F11B 3IDMA 1IL1A 5KSUB 2BY3A 3WJJA 3WNLA 5INDA 1S7WA 4XP9L 5FDWB 6FABL 3HMXL 1N5AA 2HWZH 1KGCD 4FZEH 4WJ5B 4PJGB 1LO0H 2H6PB 3AS0A 2Q8AL 1ZGLP 5F9OL 4MB4A 4ODVL 1JGEA 2H3NB 2R1XA 2RCSH 2DB8A 3SPVA 5I16A 3ZTJH 2Z9TA 1MJUH 3SO3C 4DZ8A 3F65A 2I5YL 5KSBF 1I7RB 5F7LB 3RUGF 5GXBB 3SY0B 1Y6NR 4KGJA 5J3HD 1ODAA 3UX9B 1U8OB 4UU9B 1FN4B 3KPNB 4APQA 4WO4D 2P5EE 3T0AA 4JGMA 4UIKL 2HP4A 2VABA 1FL5A 3ARYA 3OR6B 2DQCH 1ZGLB 4PJHB 1KJ3L 1GGIH 4NM4H 4M7KL 3DARA 3OHXA 4S0SD 5ESAA 4A6YL 5JQ6H 4BK5A 1IGFH 4FFVD 4JPKH 2BNQE 4G8IB 1P53A 2CDFB 4QRPA 5CZKA 1CGXA 3K8MA 2XN9E 4FG6C 2ORBH 4RMVA 3OKDA 1AGFA 3MJ9H 3ILQC 1DFBH 4GO6B 4CUCA 1N7MH 3JV4A 4P2QB 3MLZH 4PJXE 2FWOA 4PJBA 1J1XH 2D0FA 3DIFA 3C9NB 1V3KA 4PY7B 2VZTA 3VFGH 3QAZB 1FNAA 1KUMA 2NY3B 3BT2L 5D7JB 5E08L 1X9QA 1GC1H 5IB1B 2AJ3B 2Y36H 4XNZB 1TDQA 2DKMA 1A7QH 1JP5A 2ZSVB 3LKRB 3O8XD 1BQSA 1I4FA 2VDRL 3OR7A 1NANH 5B3JF 1AHWC 1HOCA 3SDAC 4JJ5A 4ONGL 1ZSDA 3GNML 4LL9A 2XQBL 3RJQB 3S6CA 1FFNA 4I0PA 3SE4A 1U3HC 2DYPB 1ZVSB 1XR9A 5IT2H 3HZKB 1T5WA 4HFWB 3ZSSA 1HDMA 1FVCA 3GSXA 3DO3A 3V5KA 4F33A 5CD3A 5I1HL 4X83A 3GSOB 4NQEB 3CMOH 3EJZC 3TA3C 1QFWI 1DBAH 3FQTB 4LSPH 4C56B 2W60B 5LQBL 2B39A 2EDLA 3B6SA 3UYOD 1UQSB 3VXTB 3CVIH 5TF1L 1EGJL 2YC1B 3U48A 4OKVA 2ARJA 2IAMA 5E2TL 1KTDA 1H8OA 3P4MA 1JMXA 3IDXH 5D93C 5C0BA 4JFFD 1X5AA 4MSWA 3RIAK 3PF2A 2HFEB 4KK8C 5B39A 1A6AB 1FNEA 5E2JA 4I1NB 1ZLSL 2R2HA 1R3JB 3IJYA 3MV9B 1JHKL 4K3EH 1XGTB 4PP1D 4U31A 4QKXB 4U4BA 1NGYA 2EH8H 3ULVD 1H0DA 3IDYC 1OP9A 5D1XB 3PHQB 3ARGA 1HILB 3G5ZB 4ZOEA 5FM8A 4FTVD 3MRQA 2D03H 5SWZA 1ZANH 2WMPA 3O3DB 4FQLL 5IUSA 2WP3O 1G7MA 1LK3L 1KG0A 3TYGH 3LQZA 5F97E 1DUYA 1YEFH 3TO4A 1NGPH 5CIPA 4ZTPL 4O5LL 4M7LT 5DT1L 1R0AH 5FM4A 3MCKA 4XCNB 1P6AB 5F1NA 3MX0A 1UXWA 2GCYB 3K46A 4X7CC 2DLTA 2XKNB 1PX4A 3A67H 3RWFA 4PJCE 2GT9B 3MCLL 1ZLWH 3V6OE 1K8IA 1Q0YH 2YPLA 3FN3A 4DVRL 5A2JH 4NQUA 3AROA 4C58B 5IMLA 3BMVA 3OJVC 5EORL 3BQUC 4GG6A 3ARGC 2XTJD 1BD2A 1CD8A 5C6WH 2VDNH 1VHPA 2IH1B 4HUUB 1H3XA 1MUJA 1S3KH 1IKFH 2PYEB 2DJUA 2XOTA 2V5MA 5FYJD 1AI1H 5SX5H 5CFHA 3QWQB 2DWEB 5CUSL 1PX3A 2J8OA 5I76A 1BZ9A 4LCCA 3ZE1E 2VAAA 4N5ED 2HJKA 4U6HA 1MFEH 3K3QA 1FZOA 4MCYB 5D96B 5E99H 3OZ9H 4QXGL 3RTQD 1YEFL 4TVPE 4LARH 3VE0A 4LRIA 1R0AL 8CGTA 3UZEA 5IOPB 2YZ8A 1L0XA 4YPJA 2CDEA 4Z78A 2V7HA 4PJAF 4R7DA 1X44A 2AP2A 4WY7L 1UKSA 1RAMA 1RD6A 1WCBB 2WWKT 3HUJA 4Z7WA 1Q9KB 4LKXA 2HG5A 3MLVH 3TJEH 4RGOH 3LSOB 3SDCC 3I02B 4MXVF 2EIBA 5E00A 2BNRD 2Q6WA 4MHHI 1HYRC 3IVKA 5HPMB 4AIZA 1MHCA 1S5HA 1H5BB 1N3NA 1K5NA 2EH8L 1B2WL 2C4FT 1TFHA 4M3KB 3MGTB 4JZOB 4Y19D 2F58L 3G6AA 5MHSE 3LZFH 2IPKB 3VXRE 1N26A 1XIWC 2Z91A 3M17A 2P8MB 4F3FA 5D2LE 4X6DF 1MLCB 2YUWA 5I9QB 2H1PH 1LP9F 1FZMB 1M71B 3JV6A 5BZWA 2NY6B 3TZVC 5F21B 4NDMA 4PS4L 1A6WL 2BERA 4PY8I 4G8EB 4XPGH 3WYRA 4MCZB 4LLQB 2H8PB 2NQCA 3HAEG 4UILH 4IIQC 1FCGA 3WS6C 5DVLA 5ICZB 1EEZA 1LQSR 2HH0H 2Z8SA 3NGBC 5FYKD 3STZB 4KDWA 1SJHA 4ZOBA 1AGBB 1T7VA 3D9AH 4NZUL 1MQKL 2VDRH 4Q9QH 4X7TA 1YY8A 3K1KC 4IOSD 4RFEA 3LKOA 3ARWA 3TFKC 3X12A 2BVEA 5FYJU 3ZTJG 4KTYA 3I75B 4UT6H 3ZT7A 4M7ZB 1RY7B 3CFCL 3OPZH 5MERA 4G6FB 1KC5H 2H26B 1OW0A 4TSAH 1VEOA 2O5XL 3PWJA 3WDIA 2X9WA 1V7MH 1OM3L 3ARFA 1BGXH 1R5VB 2VDMH 3QUYB 4X4ME 4LPCA 2UVEA 4BFEA 4S2SA 4X8XA 2ORBL 2DIBA 2VB5A 1T89C 3GEWB 3N1FC 4KTDL 2I60L 4HJ0D 2FD6H 1WBZA 5MENA 4FTVA 3HZMA 3QIUA 4P2RD 5IQ7L 4ZFZB 4NQVA 1GHFH 7FABL 3CVHB 4LFHG 4IM8A 3QO1B 3WXWL 4KRPB 1W72A 5D7JC 2BVOA 1R3KB 1FFQA 5E8NA 1YC7A 4R2GD 3UYRH 2E9BA 1KXVC 4I3SH 1KJ3H 3TESA 2DL9A 2NY1D 4J3SA 4MQ7A 4JFDB 3I6KA 1QACA 3O6FA 4XBGA 5DJ2B 2F5AH 3GBMH 1K6QL 32C2A 3RL1B 5GS0C 3H42H 4ONFL 2A77L 1OQOA 1BOGA 1DTUA 4M4PA 4PRHB 1MRFL 1ZV5A 4PGBB 3L3OB 3R1GL 1WAAE 1G7MB 4H20L 2DQDL 1UACH 2I25N 1DQQA 2G75A 4IDJL 1CU4H 1U3HB 4JQXA 3LDBC 4DN3H 4H5SB 2C3XA 5DJ0B 2QADB 2QSCH 2K7QA 3KYNA 3VRIA 4XRCB 3REVA 4KUCF 5HD8C 1CBVH 2E5EA 3U4EB 4L29B 3DMMA 3FAXA 3HMXA 5AYUL 3QR2A 2M26A 2X4RA 3DROB 1HXYB 5EU6A 5DJDA 1JYVA 1S7TA 5F89A 4XNZC 5DHVA 1SJEB 2ZUWA 3O6FC 1IC4L 4FQ1L 1VFOA 3PGCA 2LTQB 2VDPL 2PYFA 2QR0A 2A83A 3GO1L 1I9JH 4MYWB 3BN9C 4XWOC 2EH7L 5FKAA 2ID5A 1T80A 5DC9B 3DURA 5DUBA 4PTUA 1XGRB 1AGEA 2IANA 1MCLA 2VE6A 1T0MA 5K9KB 1OF2B 3V4UL 5GJTL 4OLWL 3IETB 4MVBD 1RZFL 3D2UA 3FB6A 2XZQH 1BMGA 3LKNA 2VTFA 3VE0B 3IS1X 2FR4A 2F54E 4XVJL 5I0ZA 4PJ8C 4QRPD 2APBA 5IOPA 5KTEL 1SBBA 4HS8H 1OSPH 4IRSC 2GSGA 3GMNA 5DRZA 1A3RH 5BCAA 3WIFA 1FH5L 4XXCA 5IQ9B 3GRWL 5C7XL 5E2TH 4FXKA 2AKRA 5D9SB 3IFPB 2F19H 1OTUC 5DURB 1T1ZB 4PJDA 4PRID 1BZ7B 2DQHL 2PO6C 3EOAB 3G9AB 2Q6WB 5JLZB 4WW2C 5C09A 1AR1C 2GK0B 5T1MA 1MEXL 2BHZA 1OGAB 3BEVA 2AEIT 3JUYA 3K81A 4OCXL 5EOCL 1Q9WA 2E27L 3HZVA 1CTNA 3QXAB 4FS0A 3BVNB 2BSTA 4JRYB 3PHOA 1IT9L 1EDQA 1MLBA 3DGCR 3G6AB 2JB5L 5D1ZD 5DJ8A 3DO7A 3K80A 5IEKA 1OTTD 1WFTA 1MCIA 3O41B 4JFOA 4MDIA 2J4WL 1TPXB 2NTFB 1II4E 3MODH 4L8BB 1AFVL 2G2RA 3SBWA 1UM5H 2OSLB 2XQBH 1NCAL 4HK3N 3BIBX 1AFVH 2V5YA 3OAYK 5I1JH 1NLBH 2NXZC 1UZ8B 2AK4A 1EUUA 5KS9E 3NABH 4LSTL 2IFFL 4DZBA 1U8JB 3VW3H 4RAHA 2BSED 3VGHA 4KK9D 4HGMA 4GXVH 4JFEE 4NYLA 3TA3A 4XBEL 1LO4L 2ITCA 1HSAA 3R0NA 2QHLA 3C5ZC 4W6YB 3MV11 3VFSA 1G6RB 1AQDB 3MRCA 1NBZA 5J06A 4HWBH 2AJUL 5H37G 5JDSB 3BGMA 1FGVL 3DX9A 2DQGL 5DHYB 4GAGL 4NZTH 43C9B 2QSQA 3GRWH 3KHOA 4LCWB 5C7XH 2X4QB 3QI9C 4NT6B 3TEUA 1R6VA 3UPRB 2DTML 4GW4B 3MLUL 3VXRD 3LKSB 3FT2A 4M62H 1OOAA 1U8NB 5DD6B 3OJMB 4M7KH 4A6YH 4NM4L 3PWJB 2O5YL 2D9CA 1UYWH 2PKDA 3C5JB 2NY5C 5DSCB 3FCTA 4QXWA 4MS8C 2J5LB 4BJLA 3PXJA 1S9VB 1CL7H 4PJ9C 2IFGA 4OZGE 1FQ9C 1PSKH 1PG7H 3KPRD 3MOBL 2LV4A 4GG6F 4Z76A 1U8LA 5J12B 4NUJB 1WFUA 2J6EA 1E6JH 3OF6A 1TJHL 4QRUB 1DSFL 1R3KA 3BZ4A 1JPFB 3DHMA 4XC1H 4U0RB 4EJ1C 4PRNA 5E5UB 2HT2D 4Y16D 4MQ7B 2CLRB 4H25A 1T03H 3MRPA 4I18C 4PJXB 4M1GH 3V8CA 5D8JH 4OTXL 3QRGL 5KOMC 3ZL4L 2X41A 3RGVC 1PY4A 5D8JL 1RIVL 3O8XB 3T65B 1RSFA 4R4FL 3OXSA 1QRNA 3SO3B 5DI8A 3GJEA 5GJSH 5GSRA 4OTXH 3ZL4H 1G84A 3WKML 2NZ9C 1A7PH 5JIKA 4TRPL 1SY6A 4JKPH 4DN3L 5IB5A 1N0XH 5C2BL 4IDJH 4NN6B 5DQ9A 4GRWH 4HK3J 4GFTB 4P23A 3KYMB 3L3IB 4MJIA 2ZCHH 1CE1H 2E9JA 1FRGL 3REVB 5I6XB 4YGVA 5F70A 1N5YL 3P0VL 5C0IB 3L3HA 4S1QH 3WHXB 2KZ1B 3RI5F 3AVEA 3GMQB 1PQZA 2OYPA 4HXAH 1G7IB 5IBTH 3PQYE 2VZSA 1YEEL 1HWHB 5H2BA 2EKSB 4HLJA 4AEIH 5C0JB 2D7TL 7CGTA 4YDLB 2JJTA 3CXHJ 4WHTA 5GRUH 4P2YA 1TQCB 4M1CC 3M8OH 3U30C 1MFBL 4JQVC 2CUHA 4EN3D 2YR3A 2G60L 1EHLH 3MRKA 2XWTA 1LE9A 4Y88A 1U8PB 3DURB 5DUBB 4PTUB 4X9FA 2EC9U 2FB4H 2DTMH 4HX1A 3OKLA 4PJCB 3TBYB 3MRFB 2CPCA 3LEVH 1MI5B 4NJAH 3LQAC 3TBSB 1HHIB 2VDML 5GGUA 4YHIA 2AK4E 3C09C 3BUTA 1UJ3A 3KPSA 1I7UA 3GBLA 4Y1AA 3FT4A 4LMQI 4EEEA 4ZUTB 2CK0L 3QDHA 1OAKH 2WINA 4JFZL 3QPXL 4LEOB 1IEHA 2RGSA 5CGMA 2YXMA 1RUAH 2Z92A 5IJKC 3BZDA 1LO3H 2DQUH 3VJ6B 1MHHA 1T7ZA 4HUNB 5C08E 1AXTL 1F2QA 1I8KB 1T6WA 2PETA 3SDXE 4L9LA 5LGKA 3KAAA 4KKBC 3D5OF 5K9QI 1HNFA 5JOEA 2J1KA 1Y18A 2R1YA 4PJFA 4CMMB 3KWWA 1QR1B 3O81A 4CVXA 1HHGA 4K9EC 3WDJA 4WUUE 3F7QA 4D0CA 2BSTB 5I1DA 4RWYL 3N50A 3QQ3A 3MRRB 2DQEH 4XVSH 4PJEB 3GSUA 1KPUA 4X4YB 5GIRB 2EO1A 1ZHLA 2GSIB 5C0AE 4OCXH 1AXSB 4QF1A 4NP4L 3D39A 5SWZE 4ELKA 3KS0J 1PZUB 4V1DA 3QG6B 1PDKA 5CP3H 3ZTNH 2AXFA 2BMKA 2J6EH 1MCHA 3BJLA 4YZFE 4U1IB 4LHUB 1JGVH 1YDPA 3WO4B 3OKMB 1JN6B 1TVHB 1GIGL 3U82B 1DLHB 1S9YB 4POYA 3QEUA 1CT8B 5I1CL 2GAZB 2GFBA 4LSQL 2PXYC 4JQIH 4P5KA 4ZUVA 6CGTA 1ZEAL 5FO8B 4HKXB 1U8IB 3W39B 2UY6A 1G9ML 4O2FA 5CP7B 2QV2A 5LJYH 5E6IC 4M3JA 3AS1A 3KPMA 4QHLB 5GS1A 3ZKQD 1HKFA 3UEZA 4FQQA 1OGAE 3TBTA 4N8PA 4XPHL 1YN7A 4IRZL 2Y5TA 3QZWA 1Z5LA 4AQ1B 2ZOKB 3W9EB 3Q5YA 1IAKA 1TITA 4U1GB 3CH1A 1I9JL 4NQDD 5GISH 2A6DA 4CW1B 5DD6A 3BP5A 3ARVA 2GTZA 4P59L 4L8CA 1S7XA 1HINH 1J0KA 2C26A 1P9MA 2LVCA 3X14B 4U1JB 4LHUD 2VLKA 4OAWB 4P4KA 3MMEA 1NLDL 1S9VA 3K2UL 4S1DC 2DBLH 3K0WA 5J1SC 3G5XA 2WM0A 1MIML 3ZO0A 1DBJH 4UMGA 1RFDH 1UGNA 1P7QD 4U1HB 2FATH 1NUGA 1T04B 2YD8A 1RZGA 2OJZL 2EDTA 2ZSWA 2QSCL 3AMLA 3QDJA 2VXSL 3DRQB 4MXQD 5C0EB 2XRAL 3P9LB 4TYUA 1N64H 1PYWA 3BPLB 5I8OL 1JGDA 5E6YA 3T0EE 1V7NL 3JWDL 3L3KB 4H8WL 2XRAH 4I9WD 5I71C 4GJTB 4M7LL 3Q6GH 4JY5L 2LAAA 4FQXD 4XNMB 3GMRA 4YK4C 4LAQH 5JOFB 4ZTPH 3RY4A 5D7IF 4GRMA 1RZJC 3K8KA 5I2IB 3PL6B 1U8QB 1YECL 4I3SL 2DWDB 1DE4B 4PTTB 3VXQB 4Y4KA 4D0DA 2W0LA 2JCCA 3IFLL 1G7JB 2PYEE 3IJHA 1A0QH 1OCWH 2RIKA 5D2NB 2BX5A 4Z7QE 5IW6B 3PWPE 2MSPA 1R5IB 2R56H 3BO8A 2XPGA 5GRZA 3OR6A 4YK4B 3WUWG 1IGYA 3RL2B 1ZGLA 3CLFL 4E42A 4Y4HD 3IYLW 5F1OB 4HUVB 2H32B 1WWAX 1IE5A 4EN3B 3BPLC 4PD4J 3MROB 2DQTL 3VFUB 1KACB 3VWJA 4QWWD 3N9GL 3DLQR 2VSCA 3ME0A 1VERA 3NFNB 4XPHH 1HI6A 5FGCB 4DGYH 4AG4H 4U0RC 1A9EB 4K8RD 3D3VA 2JIXA 4L3EB 1MHEB 3CIQA 4ZS7H 4YXHL 1FNGB 3BX7C 4ZAKA 5C09E 1ETZB 2IQ9H 5F88B 3PGFH 4GKZA 5DDHB 3HTLX 1SEQL 2W07A 4X6CA 1MRDL 1IAOB 3O0RL 4YHZL 3EFDH 1CQYA 3P9WB 3RVWC 5IHBA 1OTUD 1N4XH 4JJ5B 2R2BB 4U49A 3AGVA 3HE7C 4C83B 4PV8B 5D5MF 4OQTH 4A6YA 3AREB 4AENA 3HI6H 3IKKA 2OR7A 3GI9L 3VGBA 4PJFF 5DJAB 4R3SA 3A6OA 5DQJA 2FLBT 2CLZB 3ECBB 2EIEA 3ARSA 3NFPA 3KJ4B 5I17A 3QQ3B 5KS9B 1AO7A 2VLJB 3L3DB 1Q9LA 4JDVA 1CDBA 3SEPA 3B6SB 4HWEH 3VGDA 4U1NB 1YEIH 3KPRB 3NAAL 1TIUA 1UQSA 5L88H 2R23A 2R0KL 3FO9B 5K59F 2VWEC 3LS4H 5B38B 5IWLC 2EDFA 1G7PA 4RFOH 2AGJH 4FQHA 4MNQB 3MRMB 2IAMB 2HAZA 5IKCA 3FQRA 3PWNB 3IAGC 4KUZL 5EPMA 3WFCH 1JN6A 1TVHA 4OFPA 5CAYB 3UJTH 1A6AA 4LSVH 1RJYB 1ZA6B 1CT8A 3U9UA 4HFUL 1P1ZB 1UH3A 4G9FE 4Q6IA 5JHDB 2V17L 1O0VA 1OAYL 1LE5A 4BQ6A 1XF4A 3MRQB 3DBXA 1JV5A 3H8NA 1BD2E 2P1YA 4LLVB 4K8RC 1YNTA 1VACB 3O4LE 2HTLC 4G8FA 5DMIL 2OI9B 1OLZA 1NGZB 4Q58C 2AVGA 2OK0L 2B7DT 5CWSA 1NKRA 4OIIH 2BJMH 3QQ4A 1RULL 2F54B 3MACL 2ZOKA 3W9EA 3IAPA 5DD0L 5L2KE 1UXWB 4NUGH 4M4RA 5JW3L 4OM1L 4F80A 1J87A 1YPZF 3RWFB 3S96B 4POZD 1T21A 4U1JA 4TTGA 2GUOA 3B2UC 3V5HB 3P0VH 4HF5L 1P2CA 1TQCC 5E0QA 4H26B 1BVZA 3O6LL 1E27B 3LDBB 3VXSB 1I3RA 3CC5A 2XA8L 4RBPH 4U3XA 3RNQA 2R0WL 3SJVD 3WFEH 5J1AB 4KXZH 4IBLT 2B4CC 3FL7A 2UWEF 3KNBA 3S3PA 5BXFA 1OGAD 1B0GA 2DM3A 4RRPA 4DZ8B 1UH2A 1DQML 2ERJB 1T83C 3N0PB 1JGDB 4S0TD 1ZANL 5CBEB 3D0VA 1JNNH 3WMSA 1CFQB 4XNMA 5KN5B 1RUPL 4CRPA 1P4BH 3RKDD 1EERB 1FL5B 5FGBA 1AQKL 1RJLB 5I2IA 1TCRA 4PJHA 1P4IH 2AJZB 2CDGB 2JK5B 2AEPL 3W0WD 1FLRH 1AE6L 2A9ML 3K74B 5IW6A 3QPQD 3GMMA 2X42A 2YD9A 5DO2C 3PIQB 4OLEA 1AGFB 5DEGA 4WWKA 5ALBH 1C12B 2FJGB 1MCPL 4P2QA 5I1KL 1PKQE 4Z7UA 3MNVA 1V3JA 4LSSL 3JVGC 1F4WL 3MJGX 1QBML 4LLDA 1EFXB 2L7UA 4H1LH 2ZNXA 1YQVH 5JHLL 3B2VL 3NFNA 3QO0A 1EH9A 1I4FB 4D94A 4R4BA 2VXUH 1YMMB 3N06B 1AGDB 5HI4C 1JWUB 1NCBL 2VLRA 2F53A 3D3VB 4Y16A 3BKMH 3ZE2F 5GRUL 2J3SA 1Q94B 5ICZA 4PJBE 2FGZA 4IIQB 2XTJB 4OT1H 2P7TB 2XV6B 1MVUA 1OL0A 1G7QB 3STZA 4L4VD 1T6VN 3RNKA 3TPUA 2D9QB 1BVKB 3V5KB 1K2DB 5TGBB 1YYMH 3TZVB 1NLBL 4PRAB 4NQEA 1NFIB 5DUML 1JWMA 5DD5H 1MCNA 1IQDA 1L7TH 1EO8H 1G7HA 4XVUD 5DK2B 4HLZG 4C83A 3CX5J 4HWZB 3OSKA 4PGJA 3QIWB 3RDTC 4LRNL 2AJVH 2H9GB 3BKYH 3QDGB 1GL4B 3H9HA 5JXEC 1WVZA 1QBAA 4JPKL 4QXTB 1TVDA 4PJDF 3EYQD 4PRBA 1KBGH 5AUMA 3MNWA 2MQ3A 1OAXL 2J8UF 1V3MA 1R3JA 4G80A 3KPRE 5DJYB 3OV6A 1IGMH 4NNYA 2EDBA 1J12A 5C8JA 2CRYA 1AE6H 3DGGB 2VXQL 4XC1L 2X4OB 2C1PA 4ZUUB 3O9WA 1BVLB 1SVZA 4MB3A 1UB6B 4FQXC 1FFRA 3MV9D 2AEPH 4WTXA 3NOIA 1BJ1H 1P4IL 3QCUL 3RKPA 2GTWA 4OUUB 3A0OA 3LEXA 4M9OA 1QKZL 1IC7L 2EDEA 5L8JB 1KG0B 4J3VA 2CGRH 2C3VB 2P48B 3JWOC 1N0XL 4Q6IB 4G6FD 3P30L 1U93B 5ICXB 5GRWA 1EHXA 3VH8B 4YIQA 5EC2A 5HGAA 4KJQC 2AJXH 4JKMA 1Y6MR 3GJFK 1QSFD 1FZKA 1DLFH 2IMNA 5JZ7C 3LHPL 2XG4A 1OW0C 3QH3B 3ES6A 3L3OA 2VUOA 3ISWA 4YDIL 3VFRA 5CCKL 4LCIH 4WHCA 3JTSB 3ARFC 4JREB 3CFEA 4GRWE 3S88L 1T89A 3HS0B 3O6KH 2HYMA 4CMHB 4CNIB 2HJLB 1KXQE 4JPVH 5C09D 4F15C 3MRGB 1QFOA 3EBAA 3FFCB 3L6FA 3EDFA 3UPAA 3CH8A 1RZKC 4X5WA 4ETYA 1HXMA 4TPRH 2DLFH 3RHWF 5GRVK 4L1HA 4EI5A 1OAUL 2VIRA 4MXQC 2MCG1 2FZ3B 4X7EC 4RQQA 1I3RB 1I8LC 3PWUB 3I6LE 3I2CL 4WHYH 5BRZE 5A40E 3BPCB 4D9QD 5DZOA 4WI5A 5J1AA 5KANI 1CFNA 3DUUB 2V9QA 5IM7A 4HSQA 1IEBB 2E7CA 2IANB 3VD4A 1U95B 1TNNA 4Y5XC 5EZOL 5IW1B 3F6LA 4NN6C 2NYYC 4JGUA 3ARXA 2BC4A 4LKXB 4YNYA 4WU5B 1D5MA 4L3CA 2VJXA 1KLGB 4X6CE 3OMZA 2ZOLA 4Y5VA 3SKMB 2DL2A 3I02A 1SBSL 4QOKE 8FABB 5ADPH 1TJIH 4YH6A 2HKHL 1CFQA 4DWHA 1KGCE 5KN5A 4NN7C 3VXSE 3V6BR 1GCFA 2IMMA 1CR9H 3TNNA 5F3HA 1B6DA 3UAJC 1OY3B 2ESVA 4PJFE 3QI9D 5DLML 4M02A 2AJZA 2UZXB 3I6GA 1TJIL 3CDGA 2NY1C 2VL4A 1AIFA 3QQNA 5DZLA 5FUCE 3O3AB 5JXAH 3VXPB 4YGAB 4PJGF 1AKJA 1BJ1J 1R3LB 3BYTA 2CR3A 4CKVX 4Z77B 1FZMA 5BZWB 1HQRB 4HS8L 1OP5H 1OM3H 1C7SA 2ZKHL 5K33A 3H3KA 1F3RB 5DUMH 2H8PA 5TPWH 3LY6A 5DJ8B 5E94A 4PGDA 4Q74A 5HJ3B 12E8L 1DL7L 3ARTA 4LRIC 3RWJA 1AD0B 2NTFA 3RWIA 3CFKB 3HHRB 1UM4L 4GRLC 4K23L 3ARBA 1NCDL 5CZXC 5FHBH 3SGEI 3VXNB 4CN4A 5DR5L 5SWSA 4PJ5A 4PRPE 5ISZE 4YAQA 3HE7A 4K3JL 3T4YA 3K4AA 3EYUH 1GZQA 1CLZL 5DQDH 1I1RA 1CFTA 2OTWA 3WSQL 3G9VA 5KAQF 1YZZA 3D69B 1H3UA 2NX5D 3O6KL 1EAPB 1Q94A 3FONB 3VGGA 3QA3A 4ERSH 3LKOB 3ZKMD 3FFDA 3BKCH 3FOMB 3OKKB 3RA7H 2P7TA 1LDPH 4J12A 2MHAA 4TTDC 3IGAB 3DV4B 1LP9A 3UDWC 1A1MA 4YHKL 2Y07L 5IROC 5L2JB 1UFUA 2EDJA 1E6OL 2LFGA 2FNBA 3S3SA 3QIUD 5JW3H 3LKQB 2XZQL 3R8QA 3BW9A 4YBLB 1W0WA 2BXYA 2WQ8A 3DX9B 1IGIL 2HRPL 5DK2A 5IF0B 1RULH 1LO2L 3WKNA 1IM9A 2AAVA 4X5XB 5I1GL 4L9DA 4RMUA 2V2XA 5HHOB 4PJ9B 1CU4L 4M9PA 3QDGA 4RX4D 1XF1A 4R96B 4ODHL 4H88H 4YHLL 1FNSL 2DJ4A 3CU1A 1DUZA 4HK0A 5FF6A 4GLRI 3BKJL 5D1ZC 5GZNC 3VD9A 1W72B 3OAUH 3LAFA 4M6ML 1VEPA 3UTSE 2LQRA 4FQIL 5E8OA 1I1CA 3MO1B 1FP5A 3PJSB 5C8JB 1CXLA 4JFDA 4FQCL 15C8L 2RR3A 2ADGA 2WBJA 4FZ8L 5DJ2A 3RHWK 1UB6A 4OCWL 4U3HA 2Z0BA 3WXWH 4N0FA 5T3XD 1T5XB 3CDYA 4Q9BA 1C1EH 1ES0B 1IFHL 3G6DL 4BQ9A 3T2NH 4JVWA 4OLYH 4XMPL 5T1KB 4M7LH 4LRNH 4D3CL 4LQFL 3NAAH 4Z95H 1XIWB 2JELL 5IV2A 2HFGH 4H20H 3C5SA 4XPFH 5F96L 3ETBF 5HGAB 1B0RB 4K7FB 4BK4A 3MREA 1JMZA 1F4YH 4NBXB 4L29A 5KSBB 2X4RB 4P46D 1MCJA 2IPUG 3E6FB 4PGCA 5D1QD 4JLRA 5EFIA 4F15B 1IMHC 1MIMH 1CS6A 4WFHE 5SWQB 1F00I 4PBVC 1CXEA 4CVZA 5IVXB 1AXIB 1NGXA 4ORGA 3L3HB 2BNRA 3WJJC 3H0TB 3FFCA 1NEZB 3L6FB 4G6ML 3MCLH 5D6CB 3VXMA 3B2UD 2CLVB 3G5YB 3T0BA 1JGUH 3ALPA 3QBTB 4OBRA 2Y25A 5I8KL 3S36L 2DJSA 2KDGA 1FZJA 3VMOA 4JO3L 5CJOH 3J8F7 3RX7A 5E4IA 2EC9T 1ZT1A 4UT9H 4HFUH 1OGTA 1TZGL 2AI0L 1WEJH 1CFVL 1MJ7L 1M6OB 1LK3H 1IEBA 3QISA 4Q6IC 5FIEA 2GSGB 4LSVL 3QFDB 2QADC 3HNSH 3WIIH 5IB2B 5D7SH 1DCLA 3MYZA 4S1RH 2XA3A 2JJSC 3VFVA 4S1DD 4Y5VB 1MQKH 1UJ3B 4WW1A 1I7UB 4P46C 4XTRC 4Z5RB 4ZUTA 1RPQA 3EOAA 5JLZA 1LO5B 2YRZA 4FFYH 3B9DA 2FJFB 4QGTA 1BQLH 2O93L 5DO2D 3DSFH 4OFDA 3BEVB 4LDEB 4OQTA 1YMHB 1C5BL 1RUQL 4CVWA 5MP6H 1JNNL 3EIFA 3HMWL 3VXPA 2FSEA 1H8SA 3LKPA 5GGTA 5C92A 1KTKE 2FEDD 4NRYA 3MYJB 5F1IB 4JN1H 2X6MA 3C8DA 4JFFE 2VQUA 4GW1B 4KJWD 2NYYD 4NKIH 3QNXB 1N4XL 2OP4L 4QXGH 3DECA 3QDMB 1N6QL 4PPTA 5DFVC 4PV9B 3QG7L 1D5ZA 3ZYIA 5GIRA 1NCTA 4XCYA 4NN5C 3WBDA 4JFHE 3D39B 2AJYH 4RSVA 3TA3B 3MBXL 2HLAB 1F6FB 2JJUA 3DX6B 1G0YR 4O4YH 3JTTA 3ZKXC 5L7XL 2IALA 3C2SA 3LPGA 5F7NC 1F3DJ 4RGOL 3ZYZA 4OD2B 4X6EA 3RBGA 3EZ8A 5EBLA 2DS4A 3ZDYE 1I1YA 4NJ9H 3FFDB 3FOMA 4JFZH 4WVRA 4LIQE 1Q38A 1LP9B 2DQTH 5E08H 3AY4C 4BZ1L 4DKEH 1RZIB 4CL7A 4JFPB 5HDLA 4MDJB 1HSBB 1I9EA 5FDWA 1R5WA 3AU1B 3KPQB 4QHUB 1FJ1A 4ORZC 2MPAH 1WF5A 4KHTL 4BZ1H 5CSZB 3T2NL 2A2QT 3GZKA 5FK9A 3SPVB 5I16B 2X2YA 4JHWH 2CKBL 1ZLVK 3UTOA 3MJ8B 4PLOB 5CGTA 4OZGA 5HI5C 3QUYC 2EDKA 3JVGA 4JFYB 1J0JA 4M43H 3HB3C 3FTGB 2MKWA 4W81A 4KWUA 4O4YL 4WV1A 1V3LA 4HUWA 1MREH 1F4YL 5TQ0L 2NLJA 4M6MH 5FCUL 2NZ9D 3MXVH 4NGHH 2R1WA 3BKJH 1QBLH 3PABB 4U1KB 4PJXA 3BZEB 2NY3C 3DVFA 1F11A 3IDMB 3AY4A 3ZLQC 2HRLA 3QWOB 3O8XA 4LQ1A 2BNQA 4LLAA 4XNYL 5CHNB 4X7FC 5EU3A 4N8VA 1CDJA 1Z0NA 3MXWH 4Q6YA 2NXYB 1I85C 1LO2H 2HT2C 3QDJB 3ZTNL 1F8TL 1KENL 2WWMC 3HAEH 4IOIA 4EDXB 3UBXG 4QO1A 5BVPL 2P47B 2YPVL 4X4MA 3DIFB 4NHUB 4QHNA 1RK0B 4HULB 1J05B 3RPIA 2ICEA 3S7GA 3L3KA 4U1SA 4XB7A 1CZ8L 4P2OA 4NSKB 4J3TA 5BV7C 2B1HL 3WHXA 3RDTA 3VRLF 1NMCC 5CGYD 5D1QA 1KEGH 5EOQL 4HEPG 5KVFH 4PGCB 4Z0BH 4PJIE 4LSRL 2NY5L 3FFCE 3VXOB 3MGOA 1FIEA 3WS3A 3T0WA 4DAGH 4ETQB 1RUAL 1DQDL 4DGYL 2JJVA 4LNVA 1U8PA 3E6HA 4ODUB 3RL2A 1I9IL 1XGPA 1UYWL 3OKLB 5IEHA 1JPGB 4HAFA 5LQBH 1MI5A 5E03A 3TBSA 1INQA 4HDIB 1QTYT 4J6RH 4MD5A 4MJ4A 3CMOL 4Z7QF 3N1QC 4I3GA 1RHFA 5F9WC 5CEZH 3MRNB 1T2JA 4UBDD 1VGKB 1N7ML 3DUSA 4KVNH 4IRJB 2DMBA 4WDIA 5D2LA 5KZCB 3LRGA 1BFVH 1GIGH 1W0YT 5ALCL 1KELH 1MNUH 1ZHNA 2VDOH 2F53E 2ARJB 3BSZL 3MLRL 3T8XB 1H9VA 1HOCB 1JGVL 1I8KA 2DKSA 2NMSA 5DFWH 3SN6N 4D9LH 3NCEB 4I0PB 4OI8A 2WW8A 1MJ8H 5EDXA 2E9IA 3ZT5A 2QADD 4G8GB 3A6CH 3P2TA 3B3IB 3NABL 3PHQA 4LSTH 3GSXB 1PKOA 1QRNE 1X5IA 1T1XB 5DJ6B 4GAYA 4S1QL 4KJQD 5CD3B 4YQXL 1MQ8A 3JWDH 3O4OB 4H8WH 3MRRA 3QNZB 1XGUA 4PJEA 3QIWD 1T20A 4Z7UF 4X4YA 2UV3A 1J1XL 2BOBA 4KQ3H 5E2UL 1AXSA 1KYOJ 2J4WH 2FHBA 3VFMA 4XZUA 1DBMH 3D39E 5C0CD 2I9TA 2YA0A 1UEMA 3G08B 3KS0H 4IOFD 5ADOL 1U41A 3LQMA 1SJXA 2E27H 2GCYA 1IQWL 3LD8B 3SDCD 5IROA 2HFEA 4MNHA 1DLHA 3STBA 3VFNB 1HEZA 1JTPA 5KW9H 2BFVH 3MLXH 2JLLA 1JUFB 4AEEA 4XCEB 4HS3B 4EXPX 4XAWH 5EO9A 4P2RB 3QNYB 3RI5K 1T3FA 5SWSD 4FQIH 3ARBD 3G5ZA 3CU7A 1URLA 4MNQA 3H6JA 4OUOA 5EBWA 3LEVL 1D9KD 1HYSC 5SWZB 4QRSA 1C5DB 2XZZA 5C3TA 2PYEA 4RIRA 4FQQB 1EO5A 1PG7L 5FOBB 4YHLH 1NMBL 5J6HB 1ZA6A 3VXUB 1CL7L 5I76B 3QZWB 1NAKH 2Z8RA 5FB8B 2Z31B 3DYPA 1TZIA 5JORA 3DX8A 2Q8AH 3GM0A 2A6DB 2D7TH 2OR9H 1MFCH 3OKOA 2F8XC 1S7XB 1ZVYA 4QRRB 1DBKH 3SE8L 4P3WA 4DVBB 1EAJA 5KSAD 2YPLB 3N1MC 3W0WB 4ODXA 1LDPL 4JRWA 1BQHB 3C60D 2VDPH 4P0DA 3GSNH 3VDAA 5JPNA 2X5PA 4UTAH 5D2NC 4F7EB 4PLJD 3LSOA 1FVEB 2E7MA 2V2WB 1MUJB 5C2BH 4WGWB 1H8NA 4GG8A 4G7VL 4WV1B 3E3QC 1XR8A 4BFIB 1MCWM 1A7PL 2NR6D 3ARBC 4BKLA 5F7WC 1BZ9B 4Y2DD 2ESVE 1W0VB 3T4AA 3KPLB 3RX8A 4L4TE 3GMPA 2E6QA 1RQ5A 3ARPA 2YD5A 5IVXE 4QXUL 5SX4I 3MJ6A 3ILPB 3BDXA 3EYVA 2GYSA 1RIUH 4NO0B 3SJVB 2GK2A 1EEUA 5GZOC 4OGZA 1E4XI 3WIHH 2OZ4H 1UC6A 3FQXA 3MRHA 4OCYH 3MLPA 1U8QA 3PL6A 1ZWIA 3BD5A 1J05A 3RPIB 3LRHA 2W9LA 3HKFA 4IJ3C 2VXQH 3D0VB 5D2NA 2P5EB 3B8SA 4MJ2A 4Z7OE 3S3JA 2ICWJ 1Y0LB 3J7HA 2NR6C 5BRZA 4R0LB 3H9SA 4PRDA 5L8LB 3OG4B 2EIZB 2FJHA 2AXGB 1ACYH 2A6KB 3OQ3B 1KCUL 1P84J 1I1AD 1CD1A 4D9LL 3ZKSD 4LPVA 5KVMC 3RIAF 4KJWC 3T0ED 1U91A 1FH5H 2H45A 3MOQA 4MWFB 3I75A 4UV7H 3LRSB 4OZFG 2FJGA 4D9RD 4V1DE 2CJUH 5D5MA 4KTEL 2EO9A 2BHUA 4WI4A 2H26A 4JRXB 3D85D 2Q8BH 3M8OL 5IG7B 2L7JA 4L3EA 3ARRA 1VFMA 5IHZB 2HT3D 5IBLC 3U0PB 3BWUC 1T83A 1EFXA 1FAIL 3HPLA 3H2WA 4YXLH 3BD4A 5JHDE 3H7BB 2ICWI 4GMTL 3HE6D 3TIEB 3RY6A 2AQ2A 3RU8L 3W0WE 4K3DH 4UDUB 5EH1A 1B4RA 5AWNL 1NCCL 2QKIA 2FX7H 4RFEB 4OB5L 3SHSA 4I2XA 4NQDE 3MV8D 4U6YA 5KVFL 2FHFA 1QO3B 3F12A 1SYSB 2X4UA 3IXTA 3QDMD 1CXHA 3AREA 4JKPL 4AENB 4OV5A 5MERB 5JMOC 1DDHB 3ZSTA 3BD3A 2CO7B 4QEGA 32C2B 1WIUA 4P9HH 5DJ6A 3U2SA 3KLDA 1M7XA 1U42A 1CBVL 1MHPH 2Q76A 1JWMB 2EEBA 3PUCA 4OZIE 5JR1L 2AJXL 4BH8B 2A73A 3IDIA 3KPSE 3O3BB 3RZWA 1YC8A 1NCWH 1YNKH 5KAQG 1GGUA 4JE4B 1NKOA 4N1CA 4FQJL 1IGTA 3W82A 4ODTH 1X7QB 2R23B 4ZS6C 4XZUB 2ADJB 4LPTA 4NQVB 2F19L 4LHUG 2HJFA 4YHML 3QCUH 3V5DA 4DUWA 1ULVA 4JFEB 3RGVD 3N85H 4HBCH 4UOW0 3S5LA 3MNWB 2QSVA 3KXFA 2NX5B 3QIBA 1AQKH 4ZNEE 4G9DB 3BPOC 3VD5A 5CIPH 1RUPH 4J3WA 5DJYA 1KEML 1AGCA 4NNYB 3UTPE 5IFJB 5JHDA 2MTPA 1JNLH 3KPPB 3MZTA 2PO6D 4GW5A 5EU4A 3MV7B 5HHVH 2K3TA 2EXYD 3AREC 4MB5A 5D93B 1PJ9A 4KQ4H 3GMLA 3DJ9A 1J0ZA 2Z35B 5K9OA 3NMEA 3U7YL 3ULUD 2OM5A 4N5EC 5DVOA 1FSKC 1BREA 4L3EE 5C08B 3BXNA 4F2MA 3NCYS 1NMBH 4TOYH 2FD6L 1A4JA 1U3HA 5GRJL 4NIKB 1EBAA 5BZDA 4JRYE 3G5VA 4HEME 3H7LA 2F54A 5AG8A 4PJIF 1S9WA 2DMCA 4M03A 3U79A 3IF1A 1OQXA 5JPMA 4LVOC 4NQCE 5ACZB 4G43B 1YUHA 1JPSH 2NY7H 3FJTA 2G5BA 2E3VA 4RA3A 5E95B 1S7RA 3GMNB 1FC1A 3QHZL 4YR6A 5DJDB 2R4RH 3T0XA 4XWOD 1P2CB 2UWEA 5FXCH 2FLRT 3TN0C 4PG9B 4AEFA 5T3ZL 1FDLH 1TVBA 3UTSA 2FBJL 1MFAH 2W0FA 4ZD3H 1L9MA 5FYLH 4M93B 1JZ2A 5E1AB 1XR8B 2JE8A 4JCMA 3RZCA 5I8EB 4UZGA 4BKLB 5BXFB 2JB6A 4TVPH 5L6YH 1OGAA 4GRWF 1Z2KA 3WUWA 3PNWB 3F7RA 3BZFB 3MODL 4PJ8D 4HC1A 2VIRB 3KPLA 2K9UA 3DI3B 1NSNL 3L5WA 1CCZA 3GI9H 1FFPB 3QPQC 4RDQG 4FOMA 5LWYL 3C6SA 4LGSB 1MCDA 3SDDB 25C8L 3Q0HA 1WISA 4N8CH 3WIFB 1CLYL 3IT8D 4RNRA 3F7PC 3DOSA 1I7ZA 3LZFL 4D2NA 2SEBB 2DKUA 4QHMB 5ALCH 4NRXA 3P9MB 1WT5C 3AM8A 3V7AE 2OL3A 1JPTL 2LABA 1V05A 4HKJB 4ZS7L 2X7LB 2E7BA 4X4XA 3FOLA 3NH7H 2FJHB 3V0VA 1AQDA 3MNVB 4UINH 5BQ7A 3AMKA 3RWDA 4NFDA 4UNVA 4MJ5A 3V4PH 4ZYKB 4PJ9D 1RIHL 1R3IL 3WO3B 4R26H 5GGSY 4BSWA 2Z93A 3RVUD 1TQBB 3V4UH 4GBXB 4F8QA 3PE9A 1XH3B 4NQTA 1KV3A 4HMDA 1TZHB 5CLTA 4M93C 1VKXA 3WFBL 4X8JB 4EUPG 5IVNA 1YMMA 2R0WH 3FB7B 3O11A 2XNAB 1WIOA 4XWGL 3B9KC 4N0UE 5ICYA 1JRHH 2B4CL 4Z18A 2IBGA 1NFKA 4OGXL 1JGUL 2YPLE 1MFEL 1ZAGA 4O9HL 1J8HA 4LVNB 3BRGC 4YHOH 3HPLB 1I7TB 3BESR 3GBNL 2A9NH 3DX7A 4U6XA 5HVGB 1A7RH 1MCEA 5EO1B 1EEQA 1HSAB 2OR8A 4ISVA 2YS4A 1K2DA 5FYLL 2G5RA 3U7AA 3VFSB 1G6RA 4QRTB 3TIEA 4Z76B 3QUZD 5JDSA 2YPVH 4G6JH 5DD0H 1T7YA 4FXLA 4YUEL 3U46A 1ZOXA 5AZ2L 2HN7A 2P5WD 3W5MA 3OKKA 2X4UB 4LVNC 3ARDD 3FT2B 2VC2L 2PXYB 4KI5D 1A6TB 1BWMA 1IL1B 5KSUA 3LMJH 3RVXD 3V9FA 4BH8A 3QEGL 4HGKC 1B2WH 5TDNB 4LLMB 1KPVA 3FN9A 3GSRA 1IM9B 5CMAB 5HHOA 4UI2A 5IFAH 3KLHC 4GBXC 1I1AB 3P73A 2XXCB 3V7AG 4XXDB 2X4OA 3NCJL 2NTSP 3VH8G 3EW3B 4KI5F 3QJHA 4ZUUA 1CDCA 1CDYA 1XZ0B 3V5DB 3TPKA 4YGVB 1K4CB 3QIBB 1X3DA 3D3VD 2FX9L 5GS1C 5LKNA 2PTVA 5FUOH 1B0WA 3D0LA 3QFJA 5BS0E 2WBJB 3OHXB 4V2CB 3LVEA 5C0JA 1KF9B 2FIKA 1KCSL 3GMLB 1P5UA 1R3HA 4HXBL 2O5XH 1QRNB 1FZKB 3MGAA 3QH3A 1QSEA 5E9DA 3VWKD 4Z7OF 4FG6D 1EGJH 3QUKA 3ZZ1A 3CNKA 2OJZH 5IB5B 4UT6L 4ODTL 2F8OA 1J8HE 1XIWA 5I1GH 2FATL 3D3VE 3FQWB 3IDJB 1RFDL 2YD2A 4JM4L 1RVFL 1YPZB 5D7KD 4ZMAT 2DBLL 3MREB 5IVOA 4JQIL 4LPXA 4P5TD 5TE7H 5D7LE 2A38A 3WL9B 1PW3A 1S7RB 2Y07H 1MH5A 4NC2B 4OCMC 2WUCL 3OJ2C 1G9NL 1M1SA 3LCYA 5DVMA 3UO1H 1OAQH 2EKSA 5DQDL 4NBYB 4WHTB 1MCRA 1ZHBB 2EE3A 3FO1A 4XWGH 4GAFB 2Q87A 2W0FB 2GY5A 2W9DH 3PL6C 3QULB 1B6UA 4ORGB 1J1OL 4QRRD 5JO5A 3P40A 1NMAL 2CLVA 3G5YA 1FL6B 3HCVA 4J4PA 1KT2B 3VCLA 1KTRL 1U95A 1OLLA 2NCMA 3UPCA 1FYTE 5I71B 1BAFL 1FAIH 5EZLB 1IAII 5C6PB 2Z31D 2ZCKL 1CG9B 2E8ZA 4G6AC 4WU5A 4F9PC 4KKAC 1ZEAH 5E2WL 4NWTH 4PRPA 3T77B 3FT4B 3HRZA 5KVEL 4Q2ZB 4AM0A 1V8HA 2AS5M 4NQSB 4UV7L 2FGWL 1N2RB 4G7YL 5JXAL 4PYGA 3QXWA 1EJOH 3O4LB 5E8PB 5IB2A 5KSAB 1BBJB 5T3XH 3PWVA 5EN2A 1FG2B 2Q3ZA 4BH7B 3A6BL 3O3AA 1YEHL 4N8CL 1AKJB 3W81A 1CR9L 2R2HB 3IJYB 1FYTD 5LWYH 4MD0A 3E2HB 5HYJD 5TF0A 2W0KA 3PGDB 3ZYOA 2RAMA 2H2SD 4LARL 5EIIA 3OGCB 4NZDA 4XBPB 3W11D 4Y4FD 5HBBA 3HPJB 1KN4H 5HJ3A 2IQAB 5DJXB 1YEDB 4GRWB 2N4IA 1XFPA 5CZXD 4Y4FB 3ARBB 1GGBH 1DUYB 4MVBC 5SWSB 5CIPB 3DETC 3UROR 4JZJA 3TBVA 4JM2B 4TSCH 1IKFL 4NNPH 1TCMA 4XP5L 5DWUH 5C9KA 4BUHA 2DQUL 3F58H 1LGVA 3S34H 1X5KA 3UMTA 1I8IB 1NJ9B 1EAPA 2KUTA 3QIUC 4MJ6B 1HCVA 3IS0X 1IBGL 2GFBB 2B2XL 3CJJA 1JZ8A 5F7FA 1A1MB 1NC4A 5I1IH 4PG2A 1CD0A 3GHEL 4H0IA 2ZG1A 2NY7L 1JIBA 5I19L 2EEDA 3D39D 4N68A 5C0CE 4D9RE 5IMMB 1HHKA 4FMKA 4U1HA 4OGYH 1P69B 5GS1B 1N8ZB 3CFBA 3S88H 4UTAL 2BRRL 1JGEB 4P9ML 1I1YB 4LASL 5CCKH 3DHJA 3U7YH 1OTSD 2D31B 1YN6B 1GGCL 4R4FH 3S37X 1CGTA 1FG9C 5J7CC 1IAIM 5CBAA 3SKJL 4KDTA 4LNRB 3KXFE 4GBXD 4MXWL 1IEAA 4ZSOA 1AY1L 1RUMH 1P4LA 3P30H 4JHAH 4PR5A 5DF0A 5TDNA 3L1OH 5I74B 3TGXA 2CGRL 4JFQA 3QWRA 3GMRB 3JSSA 4QOKD 3FB5B 3LH2H 1IC7H 3M07A 3CPLA 3MO1A 3MMEB 5BRZD 2OJEB 1KEMH 4DQOL 1FRGH 5ESAB 1B9ZA 2EDHA 4J3XA 2IADA 3QHFH 4Y4KB 2W91A 4L8SC 4P99A 3HI1A 2ZCLL 4G8IA 5TFSL 3ZMRA 1T5XA 2CDFA 2PW2A 1IGML 3CCHA 9CGTA 5ANMA 2VYRE 4WUUD 3ALWA 4AIZB 1MHCB 2VWEE 3DRQA 3EOTL 2W65A 1PZ5B 2FWOB 3P9LA 2RJMA 4PJBB 1T2QH 3BEWB 1F13A 5HYSA 5B3JE 5F7EH 3VG0L 1KN2L 3T2OA 4PY7A 1LILA 4U1LA 3IU4L 3VWJB 5K93A 1NEZG 4ZUSA 3M17B 4ZPTA 3WV0A 2ZSVA 5DMJB 1M71A 4U6VH 1JWSA 1AH1A 3GB7B 4IOIB 2DQGH 4MA1C 4MLIA 4EDXA 2Q7YB 5A2IH 3EGSA 3AUVA 3STLA 2IBZY 2X4NB 4S1SH 2DWDA 2ZPKL 4PTTA 5DEZA 3VXQA 5BVJA 1S7SB 3GNMH 4QHKI 1GZPA 1CF8L 5T1KD 2BVPA 3HAEA 4HZLA 4ONGH 5C0ND 4U1SB 3CZFA 1E4JA 4ZTOL 4MJID 5FECA 5JIIA 1WZ1L 3WL9A 2AEWA 2DYPA 1ZVSA 4IEFB 5D1QB 5J6GA 3A6CL 4WV1C 2MFNA 1OTTC 3QT2A 5CEYB 4GS7B 4G6KL 3G04A 4NNPL 4XP5H 3VMPA 4BSJA 2CJUL 4M7JL 2Y9RT 2Q8BL 3B2VH 4PB0H 4YHYB 5JW4M 3VRLE 3BGAA 3MLYL 3HCVB 3ZE0E 2QQQA 4RMSA 4PRHD 1U36A 4RMQA 5DC4B 5BV7H 3QFDA 4OKVB 1NAMA 4DOHB 3EO0A 4GKSA 3TC9A 2CLZA 1GPOH 3ECBA 3P4MB 5FGBC 5FHAH 4KMQA 4UTBH 1MFBH 1E4WH 4X9HA 1INQB 4HDIA 3SBWC 5JDJA 5I1KH 4JR9H 2UUDK 4KKBD 4KXZI 3L7FB 4FP8L 5BO1L 1KJVB 1OP5K 4JDTL 1EV2E 1KLUA 4WW1B 1KN2H 2YEZB 1D9KA 4QTHB 1M7DA 3E2HC 2Z31C 1F3DH 1YQ2A 3PWLA 4N1HB 5ID0B 5JA8B 4S2SB 3HRZB 3E0GA 3DV6A 3MRNA 3EZJB 3MV7D 1U3YA 3MNZB 3QUZB 2FJFA 4ALAH 4FTVB 3P11L 1IAOA 4EUPA 4ZFZA 4JFDE 1GAFL 2A9MH 3PWVB 2NZIA 2WIIB 5GS0H 4OIBA 5EZOH 2HA1A 1YJDL 2WBKA 1M4KA 4HIXL 5CJ8A 2NY5H 3QHFL 2OZ4L 2EICA 1P4BL 2W38A 4U7MA 2CKNA 3RGVB 3SOBH 1MJUL 4PJCF 2KZWA 3GK8H 3W2DH 2VLJD 4G8GA 3VI4E 1CDGA 1OB1A 2ZG3A 2EE9A 4DW2H 4YDKH 4OLWH 2WANA 4KROD 3MUJA 5GS0D 4PRHA 3INUH 4UNTA 5GS2H 2BNUB 4XP1H 1UM6L 1FE8L 2X4SB 4FABL 2CK2A 5DEFA 5GGSA 2GT9A 4PYHA 3LN9A 2EYSB 2ZUVA 5CWSB 5GGTH 3WFEL 4N9GA 3TA3D 5LXGL 5TDPB 2I9TB 1NCUA 1KCVH 3MV8B 4C56E 4XRCA 1DZBA 4JANA 4R97B 2HVJB 3ULUE 4OD2A 4OD1H 4NRZB 4X6EB 1Q72H 3HUJF 4Z7WF 3BP6B 1PSKL 2WV3A 3B5TA 5KTEH 3RAJH 3L3JA 5DD1L 3LV3A 2Y5EA 1E28A 2VO5A 4OM1H 3UC0H 4IOFC 1T3FB 2HJKB 4NFBA 3WO4C 2C9AA 4UB0H 1NC2D 2X1WL 3L1OL 3QI9B 5IMMA 1OTSC 4MDJA 1HSBA 3U1SH 3C2AH 4CN1A 5IJVB 1CK0H 2A83B 4UAOB 4HPOL 1R5WB 4OD3L 4I13B 1CVRA 1S7QB 3ROOA 4I18A 1BJ8A 3AS2A 3BDYH 4KK8D 3DVNA 4HIHA 1CQKA 3VXUA 4TQEH 2FYYA 5IGXH 1XGRA 2CDEB 2XY2A 4Z78B 5J8OA 5KG9B 3GJFH 1YN6A 3L7EB 4P9MH 1RMFH 5D7LA 1F45A 2EDNA 3H42L 1FNHA 1R24A 3DNKA 2CKBB 1I1FA 4NO5B 3MRBB 3FTGA 4K7PH 3O9WC 1D6EA 1SY6L 5E00B 4U2YA 4I48A 3BE1H 3P4NB 4UQ3B 4P23C 5IIEA 4NNXB 2FX9H 3NTCH 5FCSH 4NN5B 4H26A 1KBGL 4JZOA 5ADOH 1A7BA 3VXSA 3EKCA 5E8EB 1IQWH 2IPKA 3BUYB 4LIQL 4NZRL 5TE4L 2PW2B 4QOKA 4M00A 4X98B 4GG8B 4Q9RL 1LD9B 1T0NB 2FGWH 5DEGB 2JJTC 3MBXH 5EG6C 1DBML 4PJ8B 5KSVB 2WBWB 4XB8A 3TFKD 1V7ML 4XHJD 3HE6C 5DGRA 4B5EA 1J5OL 3BEWA 3T3ME 4YQXH 3T4AB 3BVNA 5GHWL 4PJAB 1HQ4B 4XAKD 35C8L 3IFNL 4AT6A 4IRJC 5T5NG 4LLDB 3KG5A 5CBEA 4XCFL 1HCFX 2BNQD 4X4ZA 1OARH 2FX8H 3REWB 5EOCH 5DVNA 1A6VL 1WZMA 4WFHD 3UYRL 2H2SC 1WJ3A 3FQXB 2G9HB 3BKML 2GJZA 4PJIB 1U2HA 1AO7E 4P46B 1X4YA 2X4NA 2PN5A 4LAJH 4LCCC 3UTTB 3ULUH 1IC5L 3NACL 4YHZH 2B1AH 3WIHA 4X7TB 4KU1A 4OGAD 4G9FD 3KHQA 3NFSH 4QGYA 3WS3B 5HYJE 1L6ZA 1U8JA 1NGQL 4CGTA 1ZTXH 1FGNH 5TQ2L 1S7VA 5C2UB 1S7UB 5HSFA 4WW2F 5C0RL 1TJGL 4WWKB 5J6GB 2E7LA 4FFVC 1QYGL 5IP4A 5KVEH 2CIKB 4JG1H 5BRZB 4G42B 5TGBA 4LK4A 3ZKND 2AXGA 3CAFA 3KLAB 5ELIA 4KY1L 3BGMB 1CD1B 3EFFB 4J6RL 1FHGA 3V52L 3QEQD 43C9A 4GT7A 4F9LC 1RK1B 1F4XH 1DBBL 4X7DC 4HG4K 3QFJD 4PD4K 2DQJH 4XC3L 5T1LD 4HKZA 1KB5H 3EO0B 3N9GH 4KROB 3CVHA 4R9HA 4UT9L 1A22B 5F3BB 2W9DL 2FH6A 4DN4H 5AUMB 4D0BA 3IDGA 4FFWD 2BVOB 1WAAF 4P2OC 1VGEH 2C7UB 4G80B 2HH0L 4Q0XL 2GITB 4M1CD 1KCRL 1G7LA 1ZTXL 5TQ2H 2Q86B 4ZFOL 2ADFH 3MNZA 1LEKA 1MOEA 2Y7QB 3IJSA 3S35L 2B1HH 4GAYB 5C9JA 3O9WB 5ISZA 4OZ4B 3TZVA 1CD9B 4KRPC 1KJ2B 3EO1B 3QNZA 4OUUA 4O02H 3BZ4B 1VPOL 3TN0D 3QRFM 2APWA 1VADA 4PJ7F 1HH6A 5IFAL 3IXTB 5DVKA 3CDFA 3B4NA 3D1MC 3OWEA 1MWAA 5E2VL 4G5ZH 1L6XA 5FCUH 3O3BA 3GJEB 5GSRB 4N1EA 4X6FA 1MFDH 3NIFF 5A2LH 5HTSA 2ARJQ 2GJ6D 4NQEE 1IGTB 4LQFH 5EU6B 1X7QA 2DQFA 2HFFA 2HTKD 4J1UA 2NY4B 3C6LB 4W4OC 3QUML 4V2BA 3DGGA 4RBPK 3F7VB 3ARUA 4K94H 1C1EL 5DMGC 5EUKB 4OZIF 4P5TC 5C0AD 1PLGL 4Z7VE 3MRGA 4R8WL 3GMQA 4HW6A 1ORQB 3RVVD 1QSVA 1ZXQA 1AGEB 2D7MA 1INDH 5GRVL 1OF2A 3KPPA 4KK5D 5FYKL 3L3GA 5DMYA 4Y5VC 1X6LA 5DHVH 3WXVH 5EOTA 4BELD 2ZJSL 5TJWK 4NKDB 4O5LH 4AY0A 1H3VA 4KGLA 1KXTB 2FR4B 4WI8A 2BXZA 2YUXA 4ZUWA 4DKEL 4Y19A 4HG4J 4TTDD 2FYYB 4HV8B 4KFZC 1QG3A 4HX1B 4P2QE 3CFEB 3TBYA 4KVCH 4JDZA 2X4PA 4TUOB 3S4SG 1S9XB 3VXMD 4FXKB 1S9WB 1JTTA 4J3OC 3WNMA 5FKPA 1I1FB 4NO5A 2HJLA 1MY7A 4CDGC 1XF5A 4H1LG 5C09B 3SCMA 3B9KD 3SGKA 2AJYL 1KCKA 4Y5XB 1QR4A 4TNVK 3UTZB 1NFDB 3C5ZB 3RWHA 3QDAA 4EQ2A 4WU7B 4JJHA 1JF1B 5KS9F 5E8EA 3SDXB 3T0DA 5HVHB 2BSRA 4QOKB 4MDIB 5JW5B 2P43B 3BDBA 1LD9A 2JJWA 4CMMA 3RZCB 25C8H 2E8YA 5T3XE 1LEIA 4PJ8A 5KSVA 2OSLA 1DVFD 4JN1L 4FQLH 1Z9LA 3PP3H 1UKTA 3FB8A 5MP6L 1DL7H 1ND0B 5D96C 43CAB 4MA7L 3NIGF 4AT6B 3NPSB 5HYQB 4HGWB 2V2TB 3IFNH 2EYRA 1TPXC 3EUUA 1KPUB 5GHWH 1T1YA 5IR1A 3NH7L 2R29L 4CMHC 1TTFA 4J8RA 3PP3K 4K3EL 4KROC 2AV7B 4OZFB 2I27N 1ADQL 2D4DA 5FUZH 3SDDA 4PJ5B 2ESVB 2YPLD 3V4VL 2XYCA 4RNRB 3C8HA 2DD8L 4QYOA 3WN5B 2VRAA 4ZODA 4UDTA 2UYLA 1KB5L 3BP7B 3X11A 1QSFB 4LCWA 1J8HD 4WTZA 5KJRH 5KVGH 4HUXB 3QHZH 3SDAA 4OZIA 5E8DL 3VGAB 1CTOA 3LKSA 4YO0B 4JDTH 4RX4A 3B9VA 3HR5A 2MWCA 4M8VA 4JM2D 4ESKA 2R9HD 2ZG2A 3SKOB 3LPFA 3IXAB 4JRXA 1IM9D 1X5HA 5I1HH 3ULUF 4K7PX 2P24B 3T08A 5CJQH 2ZJSH 5DSCA 5SWZD 3WXVL 2NY2B 3MJ9L 3GRWA 3RWIB 5AAMA 1H15A 2WBJC 4JHZA 2V2XB 4PJ9A 5IHLB 3ARGD 1JZ3A 1IGCH 3WDHA 3QUMA 4G6MH 5HI5D 3IFLH 1NAML 3BRDA 1MRCL 1NANI 4IMLA 2IWGA 4MHHG 2I9LA 1CFTB 2FBJH 3TIDB 3IDGB 2NXYC 2VISA 4AEIL 3X14A 4JREC 4XPTL 1PVHA 2IAMD 2B20A 2D7NA 4I2XB 1I7TA 3PJSA 3DV4A 1A47A 1VENA 1KULA 1CXFA 2R69H 2ADGB 3BT2H 1V7NH 2APXA 2Y7QA 3EDKA 3IJSB 4DUXA 2VZOA 4PRHE 1CICC 2CXKA 2ZCHL 1DR9A 4WJ5A 2VLME 2H6PA 4D3CH 1ZHKB 3AC0A 3WLBA 1U8MB 5AD0B 4HQQL 2HFGL 3PQYA 3SE4C 4E9LA 3H9SE 2R4SL 3WKMH 1MAJA 1T66C 1IFHH 1UEYA 4R97C 5GRJH 1LVEA 4XP9H 2EXYC 3ARED 6FABH 1FO0B 3CX5K 4P23B 3KYMA 3L3IA 1T2QL 3KXFB 3TVMD 1Q1JH 2DICA 3G6JA 5DJCB 1BLNB 2DLHA 3IU3A 1U8HB 4GAJH 2BHYA 1AGCB 3GJFA 3MV7E 1SY6H 4ODBD 4RGMB 2DDQH 4NOFA 4Y4HB 3T3MF 3FRUB 2H2PC 3ELAT 2FX7L 5CLWA 1VB9A 4Y4HC 4YDVA 3U0TA 3ULVF 4GRLD 1BP3B 3QUXB 4LLUB 3B9KB 1KJ2L 4L4TA 4XMLL 2BNRB 2FEDC 4GMTH 2DOCA 4F2MB 4W4NA 5IK3B 3SE8H 2LE9A 1IGYB 3G5VB 3RFZC 3VWKC 2NY6D 4UOJA 1RUML 4E42B 3TWCL 1QD0A 4KJYB 1HHIA 5GGUB 2IG2L 2FO1A 2O5YH 4KY1H 1B0RA 1A6PA 1YMME 1NAKL 4N0CC 4Y1AB 1A02N 1PGRB 1Z9SA 3O45A 3BH8A 2YK1L 4GKOA 4LEOA 4EI5D 2DLEA 1FV1A 5J57B 1HHHB 3H9SD 2AJVL 5IJKA 1DANT 1A21A 3RA7L 3ZE1F 4OGYL 1M05B 3FQWA 4F57L 1NGQH 4L4JA 4LF3A 5B3NA 5H37H 3U4BH 2QQNL 5I19H 2JIXB 5FKPB 1ZSDB 3TT1L 1KCUH 4Y7MA 4M5ZL 1H5BC 1UXSA 4G6KH 4JN2A 3EYSH 4ODSL 4EXKA 3KWWB 3QIBD 5D6CA 3VXMB 1LEGB 2HVKA 3KXFD 4GXUN 3TVMB 5KW9L 1T5WB 4HFWA 4LLYA 4ZPVB 1IARB 3K4ZA 4NC1E 2VH5H 5DJZB 4RWHA 4LEXH 1OARL 2FX8L 2YXFA 3GSOA 5TPWL 1CIUA 3NGBB 2XFXB 1CF8H 1JF1A 1NUDA 5I73C 3SGJC 5DRWA 1UA6L 2BSRB 2MCPH 5LVEA 5EC1A 1UJ3C 4WIQA 4RMTA 2XWBA 2B8OT 2ZKHH 4QT5B 1WICA 3AB0C 4OLVL 4ZOCA 2YN5A 4M8QA 2YWYA 4Y2DA 5LAXA 5DQJB 2PXYD 1KTDB 1YDPB 2NY6C 4AH2A 3GDBA 43CAA 3QDJE 3QXVA 2VDLL 3QDMA 4YE4H 1GOGA 2E7LC 5DRNA 5L8KB 3P9MA 1S9YA 4J8RB 1MCOL 5HI3C 1FL3A 1ZT7A 4HCRL 1CLOH 1UCBH 3FO9A 3H3BC 3TT1H 2AXHA 5KSAA 2CRIA 1AP2B 3I9GL 2DQHH 5LBSL 5IKCB 5EUOF 1SBSH 5BQ7B 4BH7A 1MNUL 4BQ8A 3TBTB 3NIFE 2HTKC 1YN7B 4MQSB 2VKWA 1BIIB 4F58H 1RI8A 2AJSL 2HTLD 1C5CH 1D6VL 5J1TC 5JA9A 4PP2B 1UWXK 1UA6H 1G9MC 1OT1A 1UWGL 1JZ5A 1LE5B 4WHYG 3HLAA 3SKOA 5GZOD 4XCNA 1J9CT 5F1NB 1KB9J 4JHAL 4L5FL 1RZFH 4Z7VF 5ICYB 3KPQA 4QHUA 1FPTL 2J7LA 5DJXA 4NHCL 3GI8L 4XCYB 2V6HA 2Y4SA 5I15H 2KH2B 3PV7A 2N7BA 4MNQD 2P8PB 4R90L 4DK3A 1MJJA 3GO1H 2EDQA 3JBG7 1JGLH 2VDQH 4OLUH 4OZGB 1BD2B 1CGUA 2QHRL 4F57H 4NQXA 4G6AD 5KBNC 4HUUA 1YNLL 2VUYA 2VISB 3U46B 4JZNA 1NMCB 1UB5A 1XCTB 2VDQL 4GKNA 1MIEH 2OTUA 5D7IE 4YHPA 4XH2B 3KPTA 4G9FB 1UG9A 4RMWA 4N90E 3BOVA 2GUOB 1SM3H 1HHJB 2VN4A 3FT3A 5DA0B 3TT3H 2ARWA 3IAQA 3ROLB 5CINL 5EA0L 4ZXBA 5EIVA 3QWOA 4MCYA 4QRRE 5CHNA 1MFCL 1G9EA 5GPRA 3RNQB 1T03L 4EVNA 1S5IL 1U8MA 2WUBL 1UWGH 5HDOA 3QDME 1NBQA 5GGQH 5CMAA 4YDKL 4DW2L 3ZHDA 4NM8L 4TULL 3WFZA 5CD5C 2FEEI 1U8KA 2NX5E 4KKCC 3O2VL 4WWKD 1CFSA 1HN1A 4GH7B 4U7SA 5F7DB 4BQBA 4QNPF 4XX1G 3IJHB 4OLXL 1DEEB 3IRZA 4NSKA 4PR5B 1MAKA 5MEOA 5DJCA 4GAJL 4HUWB 2V17H 2FL5A 3IVKB 2R8SL 3CSBA 4GRLA 1K5NB 4M6OL 4R6UA 3FRUA 3C60A 3B5HA 1MRCH 5DRXA 1YEHH 2VAJA 5SWSE 3U0TB 2BNQB 4F8TA 1R3HB 4YE4L 4P3DB 2AV1A 4P9HC 4ZO6A 5FHAL 4ETQA 2Z91B 3O6MH 4KZEL 4LASH 2BOCB 3MOAL 1EK3A 1MI5D 5BV7L 1MFNA 4KHTH 3BGFB 4P3CL 2PTTA 3ULVL 1WWWX 1L7TL 4ZFOA 2FBOJ 1JPGA 1X6NA 4HWEL 4Z7UB 1PKQB 5HYSB 2UUDH 1YPZA 3HRPA 4U33A 2ICEB 1LO4H 4ZAKB 2NNAA 4TSAL 4JGJA 2APTA 3O3EB 3KJ6L 3F8UB 4YEEA 2PYED 1A14L 2VL5A 3QCVH 4GKZB 4MQTB 5DDHA 5C0NC 2R9HC 1SQ2N 3GB7A 4WDIB 5D2LB 4PP1C 3S34L 1J8KA 3EGSB 4E5XA 3SCMD 3FMGH 1KIQB 5IBUB 3MA9L 4Y16B 4UBDC 1YY8B 2VMFA 1FIGH 3MLRH 4S10A 2YUZA 3RPKA 5LCVH 4I9WE 3SDCA 4O9HH 1LEGA 5EOQH 5K59E 4ODUA 1Z6JT 2Y06H 3SDYH 4K2UH 2YHGA 5D2NE 5CEXB 1PBYA 3TCLB 1XGUB 5HYFA 4C55A 5DA4A 2BOBB 3FQUA 3QIWA 5FA3B 5C71A 3DUSB 3X3GL 1GGTA 1WBZB 2I07B 1CGWA 4HS6B 2NW3B 1NGWA 3CK0L 3BPNC 4QXTA 4UUJB 3V4PL 3PV6A 4YFLI 4D9QE 5EPMB 5TFSH 2ADIA 3QUXC 5A2KH 1KCSH 4MNHB 1U58A 1M7DB 3PWLB 2NXZD 2IC2A 4LCWD 5EWIH 4OM0L 3BN3B 1UADC 3DV6B 4TUKL 1P1ZA 3ZE0F 1NDMA 3NIDF 1XCQB 5EZJB 3BGFC 5EIIB 1N6UA 2IBBA 3F5WA 4KVCL 4FNLH 3GGWB 1AO7D 4RIRB 1YPZE 5E4EB 4KJPC 3E8UH 5GRXG 1ZA3B 4J4PC 4XP4L 3QQ4B 5JUEL 3TJHD 3HNVH 3MUY1 5DJ0A 3VD3A 5FUCC 5BS0B 4APQC 3ULVE 1I1AC 4LCYB 4LKCB 3OKOB 1A3QA 5E99L 5DUPL 4YJZL 1F90H 2OI9C 4CADB 3VFRB 4MJ6A 5I1LA 3TZVD 4Z8FH 3QZWG 1REIA 3DROA 2EYSA 4MLSA 5TQ0H 2B2XH 3V5HA 5CEZD 1NC4B 1QA9B 5T3ZH 1E27A 2WK2A 5FYKU 2ZUQB 1T4KB 4M5YH 3DETD 5HYEA 1P6FA 3LB6D 4F7EA 1HH9A 1FVEA 2EDDA 3QEHB 2R4RL 2X89A 4M61A 5T33H 5GGRA 2OK0H 3NCYP 5CJBA 4Z7NE 4PRIB 2Q20A 1BM3H 3JWOH 4KPHH 2K1MA 3ZDZF 3L9RB 3MLTA 4LCWE 3UJJL 4HHAA 4OBSA 4PREB 5DD3H 3S9DB 4ZXBB 1IRAY 1KN4L 2MPAL 4MD4A 3U36A 5MEPB 4F7TB 4GG6E 2OZ4A 1TETH 5BMFL 5HGDA 2YPKB 4Z95L 2BNRE 1S7QA 3D18A 4HIHB 4NO0A 5F44A 4FRWA 4AQOA 1NGPL 3BISA 1MWAL 3MBEA 1WTGT 3MRHB 3VGAC 5HPOA 1UKQA 3L7EA 1ZWIB 4IRZH 2YSSA 5F7DA 1BIHA 4HPYL 4PJEE 4UIMA 4XHQA 1RIHH 4YNYB 1I8MB 5IQ7H 1KLGA 1YY9D 3L5XL 4O51A 4WUUB 5T3XL 1D6EB 2FIRT 4YEFA 3GMMB 4YX2L 1TQBC 4APQB 1BFOA 1UWEH 4YBQC 1F4AA 2VABB 5FUZL 4N0UB 2BVYA 5L9DL 1PZ5A 4G5ZL 1W0VA 2ED7A 1HWGB 5M94B 4N5UA 3QXAA 2QJDA 5E5RB 5AZEH 3MBED 2XTJC 2ZCKH 2GJ6A 4P3DA 2YZ1A 1Q0XL 4XNQA 5I30H 1CLYH 1KTLB 3OAZH 2PCPA 2VQTA 2KQNA 4L1DA 1S9KC 4P48A 4R4BB 4JQVA 3STLB 3QDJD 4OZHA 3FFCD 2VLRB 3SKUD 5ENWB 4G3YL 2AK4B 1I3VA 2F53B 1F6LL 5IHZA 5IB1A 1SEQH 3TN0A 1ERNA 3MFFB 1TJGH 4ZQKB 5EO0A 3H9ZA 5FECB 3CFKA 2C4XA 2AEQL 1FGNL 3VXNA 3EYFA 1OWRM 3T4YB 4P4KD 5CEYA 2VLKD 4P46A 4OCRL 1CGYA 5D70L 2EIZA 5TE7L 1BBDL 1IQDB 4RISL 3HNTL 3FMGL 4BSVB 1FFNB 3BQUD 5A1AA 1RZKH 1MPAH 3I3DA 3P77B 2X05A 3VGEA 2FCBA 2DM4A 3QQ9D 12E8H 3HZKA 3SGDI 4OQ1A 2BDNH 2APFA 2CIKA 2BRQA 1HIMH 2F58H 3SDXF 1CVSC 4NFCA 4HKBB 4NO2A 4Y16C 2YEZA 3T1WA 5GQBA 2XACC 3O6ML 1IZKA 4KZEH 2X44D 4YX2H 5FUOL 4XHJC 4JFDD 3VI3F 2RQ8A 4ZO7A 4X7SH 3AAZA 5B21A 1BVLA 4KI5C 5JQ6L 3T0EC 1PLGH 5TH2A 3S5LB 1OP3K 1UT9A 2DLIA 3ALXA 3NTCL 4H0GA 1FNEB 1U58B 3NCJH 2GHWB 4N90D 1NGYB 2OBGA 4HJJH 2UVFA 3ZDXE 5DGQA 2P46B 1N0LA 3F12B 2NPLX 4OLXH 4H25B 1QFPA 3LOWA 4HXAL 3P3YA 5EIQA 4V1DD 4M1DL 1AR2A 5KSBE 5C9JB 4YIQB 5EC2B 1F42A 1N5YH 4QNPE 4HMCA 5F7KC 5DI8B 2X4SA 4K3HA 4WEUD 2V9TA 1F58L 4GMSL 2J2ZA 3KR3H 3ZYJA 1JYXA 1Z0MA 4N9GB 2HWZL 5TDPA 5FEBA 4F37K 2HJFB 3G6DH 3VG9C 1KYOK 4YXKL 5EORH 4N0CD 5IHUH 2D7OA 5JPMB 3P0YH 1JBJA 2NX5A 5I75B 5ACZA 1VSCA 3BP6A 2XKNA 3ZKXB 2G5BB 3TP4A 1MIEL 5SX5K 2ADFL 1X5JA 4EZMA 3CVHL 4KK6C 3E6FA 2J5LC 4M6NL 3VDBA 3OTTA 3GKWL 3MV7A 3RQ3A 4JLRB 5EFIB 5GISL 3MJ7B 1JGLL 5AWNH 4X6CF 3UTSB 3KPSD 5EU5B 2QHRH 4R90H 1CFNB 5ITFB 3RIFK 2DWEA 1ORQA 4Y5YB 1WV7T 2DQJL 2QL1A 5IM7B 4P2RE 1WQVT 3SKNB 1N59B 4HPOH 2VAAB 2N1KA 1IGIH 4UB0L 1E0OB 5KOVC 2CKBA 3O4OC 4J3UA 2EIDA 5CKAA 2ZOLB 3Q5TA 1QFWH 1YEJH 4G43A 3KYOA 4Y19B 2QQKL 3CLEL 3SOBL 4I3RH 4H0HB 4NNXA 4Y8AA 4U3CA 4YR6B 1BWWA 2MMXA 4HIXH 3BRFA 4I0PC 2X4PB 4TUOA 1MHHB 4ERSL 3CDGB 4UIMB 5HD8D 2WBJD 4L8DA 1QQDB 1I8MA 3VFVB 1TVBB 4DCQB 3P11H 4NRXB 1W8OA 2AJUH 2FHCA 3BUYA 4O58L 1I3UA 1CLZH 2J6EL 1MCOH 1LO5A 1LWRA 5MEQA 4HC1L 1NCDH 1HQRA 2FH8A 4XVTL 2JB6B 4I77H 3HZYA 4XNUL 3RWEB 1G6RL 5ILTL 3VRJB 3MGTA 4K7PY 3RWDB 1FFPA 5E94B 3LKPB 2GSIA 2IF7A 4XNQB 4R4NC 1KLFA 4QF1B 4PB0L 3U6RB 3M1BA 4GW1A 1RU9L 4MQXD 4WW2B 3CSGA 3NIDE 4JKLA 1E4XL 3FB8B 4HZAA 1I9RH 4HH9A 2E9WA 1I7ZB 3ARDB 2W59A 2SEBA 4OFKA 4PUBH 3S37L 4HGWA 2RHEA 1WUNT 1D5ZB 4NZJA 1T1YB 3RP1A 1G6RH 3MLSH 2GAZA 1S7UA 5IVZA 2AV7A 4M5ZH 3VFWB 1Q9OB 1GOHA 2QQNH 3CSYB 3MA7A 1MF2L 3QWRD 1GPOL 5C0GA 4KTEH 3R06A 3CXHK 1HZHL 1QSFA 1YEGL 1BQUA 1JYWA 4GBXA 2ZUXA 4C59B 2DAVA 2KQMA 5BJTB 3NN8B 1XH3A 4N8VG 3CLEH 3MZGB 1A6ZA 3MRLA 4M7JH 1QBMH 3R0MA 1XGQA 4X99B 1A6TA 5TDOA 4F37F 3BWAA 3I2CH 1FFOA 2GEEA 2OR9L 1JNJA 2X40A 3C08L 2DQCL 4RZCA 4HKBA 4NO2B 1DQTA 2C7UA 3B9AA 5CSZA 1J8HB 5D5ME 1AKJD 3RWCA 1H15B 5LGHH 4PLNC 4TPRL 5FO7A 3EJJX 4EI6A 2QQLL 5MENB 4K8RH 4LPYA 3VFPA 1KJMA 1XF3A 1JJUA 4IMLB 4XX1E 2ESVD 2HMID 3N85L 4HBCL 4AEHH 4BZ2H 3H9YA 3OX8B 4OCSL 2DYPD 4UQ2B 1T04A 4FXGA 1RUKH 2ZSWB 2UZYB 3HG1E 5GGQL 1VADB 4M6AA 1U6AL 5T1KA 1S5IH 3NZ8A 4PJAE 1JNHA 3I6KB 4OZHE 4KHXL 5BOPA 4TRPH 2M1KA 3GSWB 4ONHA 4OKDA 3RL1A 2PXYA 5HHMB 1AD9A 5DK0A 4Y19E 3ET9F 1X5XA 1RZJH 5IHUL 4KHXH 4MXVE 4LOUD 1CGSH 1KPVB 1L4IA 2GJ6E 2UZIH 4NQED 4LVHC 1X5ZA 4GRMB 2BRRH 2OQJB 1E6JL 1TJHH 2DQFB 4OCSH 3UBXA 3BJ91 1RK0A 4XPAH 3QJHB 1DE4A 4D0DB 3MR9B 3NCBB 3GSNL 1ZLVH 5IVXA 1OP3H 4EIZC 2A6IA 3G6JB 2RB8A 5DZNA 2F53D 1BLNA 3U4EA 2XPGB 1LP9E 4PGEA 1HXYA 3GJFB 1CGVA 3GUTB 4CU6A 3V2AR 1FZJB 1LMKA 4ZNEA 2DF3A 3QUXA 3TBWB 3GSVB 4P5MA 2N7AA 3D2UD 1OPGH 4KDTC 2OS7A 3CUPB 1KELL 4M62L 4MAUH 5JO5B 1YEGH 4HV8A 3WS6A 4KTDH 1WZLA 1E4KA 4KV5E 1QHOA 3T04D 4YDJB 1S9XA 5ECJE 3X13B 1G9NC 5IMOB 1CG9A 3L95A 1DQJB 3OXRA 1MHEA 1A1OA 1T7WA 5E24E 3CXDH 4OI7A 4PRPB 3LKNB 4EIGB 4L8SA 3O2DH 2X70A 4LP4A 2IFFH 1WIPA 1HHHA 5HI4D 1MH5B 3QEQE 4LHJB 5HYIA 3UTZA 3O4LA 5E8PA 1I9RL 4LF3B 5ANME 1NC4D 3IFPA 2CH8A 2DM7A 3S37H 4P4RB 4P5TA 1XF2B 2ZPKH 2VZUA 3WE6A 4WEBH 4Z0BL 5ITBH 3OJDA 4NKOB 3FO0L 3TVMA 3V6OC 1RU9H 2D3VA 3B3IA 1KEGL 5E2WH 5JHLH 3OAZK 1XIWD 3U9PL 3PGDA 3WEXB 3HZYB 3RWEA 4HT1H 2WZPD 4PJ7A 3NCFB 4JO1H 3Q2CA 2XFXA 1QSED 4QXUH 5E9DD 3DRTB 3P4OA 3ZDYF 2P5WB 5ILTH 1BX2A 1SHMA 1YEDA 3PQYD 4XPGL 1QNZL 1WFOA 5HHMD 4K3GA 1UZ6E 4PG2C 4Y4FA 4PLJC 4Q2ZA 4AM0B 1F8TH 1KENH 4B7IA 3TBVB 4M8QB 1G7PB 3DX6A 3G08A 1S78C 4FQHB 2ILLA 3DVIA 2IALB 1UVQB 4HH9B 5F9WB 1M7IB 2AERT 1EO7A 2YA1A 1EJOL 4FFWC 2VQ1B 2UYLB 3HI5H 3EFDL 1G9NH 4L4VA 1ACZA 5HYJA 3Q6FB 5H94B 2VR9A 1W2KT 1MRDH 3NPSC 4MD0B 3V0WH 3U30B 4S11A 4XVJH 5CEZL 1FL3B 1OT2A 5EO9B 4P2RA 5MEND 3TV3H 1Q9OA 4XAKE 1HYSD 1PEZA 2IG2H 4WFFD 4DTGL 4JFPA 4S1RL 3RVTD 3FHQA 1XF4B 5I74C 1NBZB 3WNPA 3HNSL 4LLVA 4QRSB 5EU7E 3ZE2E 4PB9L 1F6AB 1A6UL 2PW1B 1GXEA 4PJBF 4G8FB 1CL7I 1WEJL 5TE6H 5I6XC 3QEQB 3R8BB 5FK9B 5J9PA 5F1KC 2Z31A 4JRXD 1RHHB 4GUPB 1VFAB 1AC0A 1XGQB 4WGVB 3MJ8A 4JM2A 4X99A 4XTRD 5JORB 1K9TA 4HMEA 4ZSOB 1L0QA 1P4LB 4J4PD 4DGIL 3DVGB 1FBIL 4KRLB 4R2GC 4JFXA 5AYUH 5FV2A 1IJ9A 5IW3A 1MJJB 3SO5A 2P5WE 3UJJH 3I50L 4EI6B 3PABA 1LHZA 3RKDC 5J4MA 4HJ0C 1KPRB 2CQVA 4TNVF 3SDDD 4NQXB 2DQIH 5EU3B 3QUMH 3RUGA 2VXTH 3C87A 3OX8A 4UQ2A 4QRUA 4K71C 1XCTA 4GKNB 4WTWA 1YMMD