4YBZB

Ca. korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 in complex with adp and with phosphorylated phosphohistidine segment (site i orientation)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
229
structure length
229
Chain Sequence
b'SSRDLLLKAKENGRKSLLEHEAKYFISSYGIPVTNIRLAKSEEEAVNFSREIGFPVVLKIVSPQVVHKSDVGGVKVNLRSEEEVRKAYREIIENVKRNVPNAEIEGILVQEFAPPGVELIIGLLRDPQFGPTVMFGLGGVFVELFRDVSFRVAPLSEQDAESMIKEVKAYKLLTGFRGMEPVDIEAIKDALIRAGRIGVENEEIAEMDLNPVIAYPKGIKVVDARIILR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha subunit of Acyl-CoA synthetase (NDP forming)
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Korarchaeum cryptofilum (strain opf8)
molecule tags Ligase
total genus 64
structure length 229
sequence length 229
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13549 ATP-grasp_5 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4ybzB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4ybzB02
1VKZA 2FPPB 4EG0A 1PX2A 2W6ZA 2SCUB 1E4EB 1B6RA 2DIKA 3NUAA 4ZQIA 4EGJA 4TUYF 2C00A 1M0WA 2YL2A 2R85A 3RFCA 2PVPA 4IZOA 3WO0A 1GGOA 4FU0A 5GONF 1KBLA 4O86A 3K5IA 4WD3A 3ETHA 4O2BF 2GQRA 3JZIA 3KALA 4DIMA 5LA6F 1B6SA 1KJJA 3TW6A 3VMMA 1OBDA 3ETJA 5LOVF 5CA1F 2W70A 4YJ3F 4IWXA 4RZQA 2HJWA 2YZMA 5BMVF 2CNQA 1I7LA 5K2MA 3V4ZA 5BPHA 5KKNB 3TIIA 4O4JF 5J2TF 4FFPA 2R6FA 2I80A 4WBNF 4C5CA 4YAJB 1OBGA 4FE2A 3U55A 1EYZA 2R87A 2GQSA 1VBGA 2YZLA 2YYAA 1C30A 4MV1A 4HNTA 2V58A 3HB9A 2OLSA 4MV8A 4I4TF 3V4SA 1KEEA 3Q1KA 3RV3A 4O84A 3E5NA 4O7NA 2R7NA 4FFLA 1AUXA 3R23A 1UC9A 1JKJB 4FFRA 1EUCB 5BPFA 1JLLB 2QK4A 4IHJF 2YRXA 2W6PA 1I7NA 4O7RA 1EUDB 2YS7A 2W6OA 2DLNA 2ZDHA 1ULZA 1A9XA 5CAEB 2I87A 4XYMB 4FFNA 2FP4B 1AUVA 1JDEA 3WO1A 2YRWA 1BNCA 1DV1A 1IOVA 3VPDA 4O81A 3MJFA 5C8YF 4I55F 2FPGB 5KX5F 1KJ9A 1VBHA 2YS6A 5CA0F 2NU6B 2PN1A 3U54A 4MA0A 5JVLA 2X0SA 4MV4A 4YAKB 3OUUA 3UFXB 1CE8A 2XCLA 4TV9F 4NYEA 4O82A 5CB4F 4I50F 3WNZA 4TV8F 3R5XA 1E4EA 3G8DA 1KUTA 3I12A 2P0AA 3QFFA 5DMXA 1T36A 3JZFA 4O4LF 4E4TA 3N6RA 2VQDA 3ORRA 3BG5A 5EZYF 1KJ8A 2DZDA 2I8CA 4QSHA 5JVDF 4HNVA 2FB9A 1GSAA 3U9TA 4FGRA 2R84A 1KJQA 2WYOA 4C5AA 4MV3A 3N8DA 3TINA 2CQYA 4O7VA 1EHIA 2GLTA 1Z2OX 4DLKA 4ZI7F 2ZDGA 2CZGA 2GPSA 4L1KA 2YZNA 4IWYA 1IOWA 4O4HF 2NU7B 2VPQA 2V5AA 3G8CA 1M6VA 4M9UA 3VA7A 5LYJF 1CQIB 2W6MA 1CQJB 3JRWA 1UC8A 1BXRA 3SE7A 1A48A 3HBLA 3VOTA 5IYZF 4MAMA 4HNUA 4YJ2F 4ZHQF 2NU8B 2GPWA 1KC7A 4C5BA 1Z2NX 2YZGA 1DIKA 5HV6A 2W71A 4HQ6A 1C3OA 4XX0B 4FFOA 3K3PA 2ZDQA 2YWVA 3RV4A 5FNVF 3MWDA 3MWEA 4YBZB 3TQTA 2DWCA 4XZ3B 4MV7A 1DV2A 2R86A 4O7TA 2VR1A 2IP4A 4MA5A 3KAKA 1SCUB 4YB8B 3AW8A 3LWBA 3GIDA 2R7KA 2R7LA 4MV9A 2CNUA 2R82A 2CNVA 2YW2A 4XYLB 3K5HA 5HBRB 3KAJA 4O2AF 2Z04A 5LXTF 3VPBA 3DF7A 1GSHA 2FPIB 2W6QA 4ME6A 5JQWA 1GLVA 2J9GA 4O7WA 1M0TA 4HR7A 2NUAB 5J2UF 3LP8A 1GSOA 3AX6A 3R9RA 4O83A 2HGSA 2XD4A 4O4IF 4O7ZA 4EGQA 1EZ1A 5C1PA 4O7LA 3HO8A 3KREA 4Y8VB 3JRXA 1W96A 2NU9B 2Z02A 5LP6F 1Z2PX 5C1OA 4O7SA 1CS0A 5I47A 1PK8A 3OUZA 3R5FA 4IIJF 3R5HA 4O7YA 1KJIA 3TIGA 3U9SA 5JQGF 5H80A 3Q2OA 4FFMA 2V59A 1WR2A 4MV6A 3VPCA 5JH7F 3ORQA 2W6NA 3RUPA 1W93A 2PBZA 3GLKA 2QF7A 2R7MA 1JDBB 4ZOLF 5D8DA
chains in the Genus database with same CATH superfamily
1TWHA 1E4GT 1VKZA 4QWBA 2FPPB 3T9AA 4EG0A 4RB0A 2R8HA 4ECTA 4DL6A 5DGIA 4CE5A 3PW0A 5BWWA 5EWEA 2FK2A 4NZOA 4DRFA 3EYYA 4QIWA 2COIA 5DGBA 2IA6A 2JA5G 4LF8H 2UVUA 4A3BG 4A93G 3GTLA 5I5UA 2KSWA 5D1OB 1PX2A 3Q8SB 3BQ0A 2E2HA 2VUMA 3PW5A 4A3KG 2HGXA 4ED1A 2YCHA 2W6ZA 3N6XA 1CKMA 4BBRG 5F9LA 2SCUB 4J9KA 1E4EB 2FE3A 1B6RA 4ECZA 1Y1WA 2DIKA 1TWAA 4YP3A 4B3RH 3NUAA 3G6XA 1EKVA 2Q7DA 4ZQIA 3MWMA 4JI6H 3OSPA 4EGJA 2ZM6H 4TUYF 1M0WA 2C00A 2YL2A 4JI7H 2R85A 3RFCA 2PVPA 3UYYA 5FLXW 4IZOA 2XGQA 4DV6H 1OWTA 2R93G 3WO0A 4LFBH 1GGOA 4FU0A 4JI4H 5GONF 1KBLA 4O86A 4I7HA 3BACA 3K5IA 2R7ZG 4WD3A 3BABA 4RZRA 4PBCA 5KG0A 2DPIA 3ETHA 4O2BF 2GQRA 5I60A 3JZIA 4JI5H 2JA6G 5EWFA 1VS0A 3KALA 4ECRA 1XDNA 4BY1G 4DIMA 3M9NB 5LA6F 2EJ0A 4PZ8A 2XCAA 1HR0H 1B6SA 1KJJA 4YHHH 2BQRA 1SFOA 3TW6A 4HN2A 3VMMA 1OBDA 2OWOA 3ETJA 5LOVF 5KT6A 3G6VA 2ASDA 2R7ZA 1A3GA 1JIHA 3AYHB 3DTGA 2W70A 5CA1F 3EPIA 1S03G 4YJ3F 4AYBE 5KG4A 5D1PA 5CE8A 4IWXA 2FJZA 4APMA 3T5HA 4IR1A 5KFWA 4GC7A 4RZQA 2W9CB 2HJWA 2YZMA 1T94A 4MTEA 5KFQA 5KT4A 3JZ6A 1UNNC 3HOYG 4PZ7A 3HXLA 5IYDG 5KFKA 5BMVF 2CNQA 1I7LA 3NBZB 3RB3A 2J6TA 4O3SA 5K2MA 3V4ZA 5BPHA 2AQ4A 5KKNB 4A2AA 2ASLA 4GLXA 5IYCG 4NLGA 3TIIA 5I5XA 4O4JF 4O3OA 5J2TF 4X66H 2V4RA 2ATLA 2F4VH 2WAQE 4FFPA 2O03A 2R6FA 2I80A 4WBNF 1I1LA 2A1HA 1I3QA 5DQGA 4FS2A 3MFIA 4ED3A 2JEFA 1RK5A 4C5CA 3FKIG 4A2BA 5KT5A 2EJ2A 4J9OA 5KT7A 3UZBA 4FBTA 4GLWA 4YAJB 4NXNH 1OBGA 2HHFB 1RK6A 4ED6A 4A3EG 1ZHQA 4FE2A 3U55A 3T99A 5KT2A 1EYZA 5C5JA 2R87A 2FLNA 4LH7A 4Q4DA 3PZPA 2GQSA 1VBGA 2YZLA 2YYAA 5FPOA 1S0OA 3SNOA 4ECSA 1C30A 4F4XA 2R92A 1ET0A 4MV1A 4HNTA 3KYHC 4IR9A 4DR5H 1RYSA 2MCTA 3GTGA 3PR4A 3K3VA 3KHLA 2RGRA 3N42B 3DAAA 4DR1H 1M7JA 1N33H 2V58A 2NVXA 3HB9A 2OLSA 4JI2H 4MV8A 3F8NA 4I4TF 5KFJA 3V4SA 1N32H 1KEEA 1WCMA 3Q1KA 4UFZA 3RV3A 3TY9A 4ECWA 4O84A 4LSAA 3E5NA 4O7NA 4QWDA 2RDIA 5BWRA 2WAQA 2XGPA 2Y0SE 4CHIA 2R7NA 1I50A 4FFLA 1UC9A 3R23A 1AUXA 2EIYA 1EKPA 1JKJB 1IBLH 3N43B 4FFRA 1EUCB 4PZ6A 4Q44A 2AGOA 5BPFA 1IYDA 1CKNA 1JLLB 3RF2A 2R8IA 3RR5A 3GILA 1I1KA 2QK4A 5KFIA 4IRCA 5L1IA 4A3GG 2IBKA 4IHJF 4J9NA 2YRXA 3CEBA 3NBYB 2W6PA 4UCSA 1I7NA 1I1MA 4O7RA 4QW8A 1EUDB 5HNEA 4ED2A 2YS7A 3V6KA 2E5LH 2WE6A 3RB0A 2W6OA 3M4IA 3TY8A 2DLNA 3Q8PB 3W5OA 3GIPA 5KFNA 4J9QA 4O3PA 2OH2A 4RNOA 2ZDHA 4RAZA 3RGXA 3CQZA 1HNWH 1ULZA 1A9XA 1DGSA 4EFBA 5CAEB 1FKAH 1DAAA 4YR0A 1IYEA 5I5TA 1V51A 2I87A 2FLLA 2J6SA 4X62H 4GKKH 5KS8A 3N40P 4XYMB 4FFNA 3IN5A 5KFGA 1AUVA 2FP4B 2UVWA 4YQWA 4K0KH 2X5RA 2VQFH 4UCTA 2EJ3A 4J9MA 2Y0SA 2VA2A 4IRDA 4DV7H 1JDEA 5CR5A 3WO1A 2YRWA 1IBKH 1S0NA 1BNCA 2PMZE 2WTFA 1Y1WG 1DV1A 4CC5A 4WHXA 3T9DA 4LF5H 2DAAA 4UUGA 4Q4CA 3TY5A 3FDSA 5DLGA 1IOVA 2CW8A 3VPDA 2C2DA 1RJRA 3MR2A 5KFFA 4RB1A 3DTFA 1XMOH 1FVIA 5L9XA 4JUZA 4RUCA 4O81A 3MJFA 4UCOA 5C8YF 4QWAA 4TM5A 3HOXG 1JX4A 4I55F 2VPSA 3C0FB 2FPGB 4JI3H 5KX5F 2WB1E 1KJ9A 4ECXA 2IMWP 3WWJA 5DGAA 1VBHA 2YS6A 3GTOA 5FR9A 3H0GA 3PFFA 4LFAH 3L2PA 5KFVA 5CA0F 2C2RA 2NU6B 4DUYH 2PN1A 1I2LA 3U54A 4MA0A 2FK1A 1XNRH 4C2MA 4B3MH 3BA9A 5JVLA 2JA8G 2X0SA 5L1JA 4MV4A 5K3WA 4J9SA 3UQ8A 4ECYA 4YAKB 3OUUA 3UFXB 3GIIA 3GQCA 2VOBA 3J7AK 1CE8A 2XCLA 2COGA 1Y1VA 4DR7H 3HKZE 4CKEA 4TV9F 1MZBA 4QW9A 5DAAA 2PMZA 1GO3E 5D1OA 4NYEA 5BYAA 3KXYT 4O82A 1P8LA 5KFCA 5KT3A 3GIJA 3BJYA 4FS1A 4ED8A 3HOVG 5CB4F 2RDJA 4I50F 3WNZA 4TV8F 1HNXH 4R8UB 4JI8H 3GTKA 3R5XA 5JUMA 1E4EA 4LF7H 3LQSA 3G8DA 1KUTA 3I12A 3OTOH 2P0AA 5DLFA 2QB5A 4MTDA 3QFFA 2WB1A 4J0MA 3T54A 5DMXA 5IWAH 5EWGA 1T36A 3JZFA 1S68A 3T9CA 2ZGIA 4O4LF 5KFHA 5IT9W 4E4TA 4A3IG 3PW2A 2JEIA 1CKOA 3OHBA 4DL3A 3N6RA 4X65H 2UVRA 1KT8A 1XK5A 1BGWA 4JV5H 3BQ2A 3J80W 4DV3H 3SI8A 5LL6b 2XCPA 4Q8FA 4EEQA 2VQDA 3ORRA 4O3NA 3GTQA 5I5YA 3PO3G 3BG5A 5EZYF 2HDKA 3HKZA 2W9BB 4LF4H 2HVQA 5E25A 1WSCA 2R92G 1KJ8A 4J9RA 5KFUA 4JV2A 2DZDA 2I8CA 4QSHA 3RBDA 5JVDF 3T9EA 4DV2H 4LF9H 4HNVA 2HIVA 4QJFA 3HOZG 4JV1A 2FB9A 3T5LA 3I4MG 4X64H 1ZQ7A 1E4FT 5KG7A 1GSAA 3U9TA 4CMFA 4JXUA 4AYBA 1WCMG 2W9CA 1JXLA 4F4WA 3T1YH 5KFLA 4B3TH 4FGRA 2QYZA 3Q8QB 4FBUA 5C3EG 2R84A 5DG9A 4UCRA 3MR6A 4EYHB 3PVXA 5KFRA 5FLMG 3PO2G 5BYBA 4A3DG 2UU9H 3TW7A 2Q2TA 1KJQA 2WYOA 1BJTA 4LSXA 2COJA 2W57A 5KFOA 1B04A 4C5AA 2JEGA 4AQYH 5T14A 4MV3A 3N8DA 3TINA 2W7OA 3KHRA 2CQYA 2C2EA 3GV5B 4O7VA 1V4YA 1EHIA 3CSWA 3H40A 2GLTA 1Z2OX 3HOWG 4M0JA 4DLKA 4ZI7F 2ZDGA 3MR3A 4RCNA 5IP9G 5KFXA 1SEIA 1Y14B 2CZGA 4BXXG 2GPSA 3HT5A 4FM9A 3J81W 3LULA 4L1KA 2YU9A 2HVRA 2YZNA 4IWYA 1IOWA 2FMAA 4O4HF 2NU7B 2VPQA 2V5AA 3RTXA 3QWUA 2ABJA 3G8CA 1M6VA 4BBSG 5BWUA 3T1HH 1WRVA 4M9UA 5F9NA 2UXDH 2UUBH 2WDTA 2ALZA 4K6NA 4HYKA 3VA7A 5LYJF 1IBMH 4Q43A 4DV1H 1CQIB 2W6MA 4TQSA 1CQJB 2W9AA 4DL2A 4J9LA 2CW7A 5I5SA 1AN7A 2B63G 3JRWA 5BWXA 3OSNA 1UC8A 1N48A 4KHPH 2JA7A 1BXRA 2BR0A 3SE7A 4DQNA 5EOYA 4DR3H 1XMQH 1A48A 3HBLA 4GKJH 2ASJA 1ZAUA 3VOTA 3GTPA 4CKBA 3RBEA 3GDEA 5IYZF 2VQEH 4GC6A 4IRKA 3H0GG 3PW7A 4QWCA 4MAMA 4HNUA 2B63A 3LMLA 4RU9A 2XIGA 3H4DA 1R9TA 5IYBG 2AGPA 3H3VH 3PN1A 4YJ2F 4YY3H 1TAEA 3KHHA 1FJGH 5KFPA 5KFSA 4ZHQF 3CVZA 2UUAH 2CKZB 3KTMA 5C4XG 2NU8B 1EKFA 5BWTA 3RGZA 4O3RA 1Y1VG 4R7RA 4O3QA 5LMUH 2GPWA 1KC7A 4C5BA 3L4KA 5EDWA 3G6YA 3RB6A 1Z2NX 2YZGA 1I6UA 5DGHA 5FD6A 1DIKA 4CMDA 5KFTA 1GYFA 5HV6A 5A2QW 2W71A 5I5WA 2HVSA 4RB3C 3QZ8A 4HQ6A 3H20A 4JI0H 4A3CG 4PDBA 5KFYA 4DR4H 1C3OA 4XX0B 5KG1A 1L2ZA 5KFZA 5BR8H 1J5EH 4FFOA 3K3PA 2NVYA 4ECQA 2ZDQA 4BY7G 2YWVA 3RV4A 5FNVF 3TQ1A 2UXCH 3GJXB 2HHHH 3RJ0A 3MWDA 3MWEA 4J9PA 3GIQA 3M9MB 4A3JG 4F4YA 2HGWA 4YBZB 1K1QA 4EBEA 2FKLA 2HG8A 3GTJA 1S9FA 4A3MG 3JSLA 3TQTA 2DWCA 2DPJA 4XZ3B 4OX9H 4RAYA 2JA5A 4A3LG 4MV7A 4U7CA 1DV2A 1TA8A 2R86A 4O7TA 4A3FG 2VR1A 5IP7G 4LF6H 2IP4A 4MA5A 3T9BA 3MFHA 4RB2C 3BQ1A 2J6UA 3KAKA 1SCUB 3BA8A 1A0IA 4YB8B 3T9FA 4ED0A 4DL5A 2CFMA 3AW8A 3MR5A 4DV5H 2Q2UA 1O75A 3WWHA 5KFEA 4DL4A 3S24A 3LWBA 2BQ3A 2E2IA 3QZ7A 5FJ8G 3GIDA 3T7AA 2R7KA 5KFMA 4YR2A 5FD5A 3IG0A 2R7LA 4IAJA 1I2KA 2CNUA 4MV9A 2R93A 1V9PA 2R82A 1RJPA 4DR2H 3KHGA 3RAXA 2CNVA 2YW2A 4UCUA 4XYLB 4LMYA 1S97A 1I94H 3GIKA 4G3IA 3K5HA 2BQUA 2R8JA 5L1KA 5HBRB 3KAJA 4O2AF 2Z04A 5LXTF 1ZHSA 2JA6A 3VPBA 1B33N 4M7EA 3DF7A 4LFCH 4R8UA 2FLPA 1GSHA 5DQHA 4TQRA 4QWEA 2FPIB 4EFEA 4YR3A 2W6QA 4F50A 2RF4A 3PR5B 5FPRA 2UXBH 4NZNA 3RAQA 4ME6A 5JQWA 1GLVA 4RUAA 2J9GA 4O7WA 5DG8A 1SYXB 1M0TA 2DABA 4HR7A 2NUAB 5J2UF 2C35B 1N56A 1HNZH 4DR6H 2RGVA 4RNMA 2UUCH 3TEKA 1A0GA 3LP8A 4LH6A 2R8KA 2C22A 3JAMW 2W7PA 1GSOA 3FMAA 3GIMA 3AX6A 1S10A 3BAAA 5DISC 3R9RA 2ODTX 4NXMH 4O83A 4F4ZA 4ED7A 1TWFA 2ZJTA 1XNQH 2HGSA 2XD4A 1G2WA 2W9BA 2HIXA 1CKNB 3UZOA 4EQ5A 4O4IF 4O7ZA 2W8KA 5DG7A 4EGQA 3RB4A 1EZ1A 5KG3A 5C1PA 3PW4A 4DAAA 2W8LA 4CKCA 4O7LA 3HO8A 2JEJA 2HHFA 3KREA 4Y8VB 3JRXA 4PWQA 1W96A 4EBCA 3GB8B 3NC0B 4E6NA 3FKIA 4DUZH 3N41B 3T5KA 1ZETA 4B3SH 5KFDA 2UVVA 1P16A 2Z02A 2NU9B 5LP6F 4EBDA 1Z2PX 5KG6A 1TWCA 4Q0YA 1KTAA 5C1OA 2AU0A 4Q8EA 3HOUG 4O7SA 5CM0A 2R8GA 1TWGA 3RIZA 3GV7B 1CS0A 5I47A 4DL7A 1PK8A 3OUZA 3R5FA 3W1GA 2M05A 5KG5A 2JA7G 3NGDA 1N36H 4JV0A 3JSNA 3V6JA 4IIJF 4EEYA 3SGIA 3R5HA 1VAJA 1WH2A 4O7YA 1KJIA 4BWSC 5C44G 3TIGA 3U9SA 4U6PA 5JQGF 3H4BA 4ECVA 3I4NG 4QIWE 4UCVA 5KG2A 5H80A 2AGQA 3VNNA 3Q2OA 3GTMA 3QQMA 4FFMA 2V59A 3WWIA 2VUGA 1WR2A 1K1SA 2Y4RA 4NZMA 2VA3A 2FK3A 5DQIA 2V4QA 3OHAA 4MV6A 3N44B 5L1LA 3VPCA 1X9NA 4ECUA 1K83A 5JH7F 1T3NA 3Q8RB 3ORQA 2W6NA 3RUPA 2XC9A 4ETSA 5KFAA 4DV0H 3U0GA 3EPGA 2V9WA 5LMNH 4Q45A 4DV4H 1W93A 5BWVA 5I5VA 2PBZA 3GLKA 4EYIB 4JI1H 4JYAH 3T5JA 4RNNA 1RJQA 3GV8B 2QF7A 3W1BA 2C28A 2R7MA 1JDBB 3L4JA 3V6HA 1N34H 4ZOLF 5KFBA 4CC6A 2VUMG 1RYRA 5D8DA 4TVIA 3M9OB 1S0MA
chains in the Genus database with same CATH topology
1VKZA 2FPPB 4EG0A 1PX2A 2W6ZA 2SCUB 1E4EB 1B6RA 2DIKA 3NUAA 4ZQIA 4EGJA 4TUYF 2C00A 1M0WA 2YL2A 2R85A 3RFCA 2PVPA 4IZOA 3WO0A 1GGOA 4FU0A 5GONF 1KBLA 4O86A 3K5IA 4WD3A 3ETHA 4O2BF 2GQRA 3JZIA 3KALA 4DIMA 5LA6F 1B6SA 1KJJA 3TW6A 3VMMA 1OBDA 3ETJA 5LOVF 5CA1F 2W70A 4YJ3F 4IWXA 4RZQA 2HJWA 2YZMA 5BMVF 2CNQA 1I7LA 5K2MA 3V4ZA 5BPHA 5KKNB 3TIIA 4O4JF 5J2TF 4FFPA 2R6FA 2I80A 4WBNF 4C5CA 4YAJB 1OBGA 4FE2A 3U55A 1EYZA 2R87A 2GQSA 1VBGA 2YZLA 2YYAA 1C30A 4MV1A 4HNTA 2V58A 3HB9A 2OLSA 4MV8A 4I4TF 3V4SA 1KEEA 3Q1KA 3RV3A 4O84A 3E5NA 4O7NA 2R7NA 4FFLA 1AUXA 3R23A 1UC9A 1JKJB 4FFRA 1EUCB 5BPFA 1JLLB 2QK4A 4IHJF 2YRXA 2W6PA 1I7NA 4O7RA 1EUDB 2YS7A 2W6OA 2DLNA 2ZDHA 1ULZA 1A9XA 5CAEB 2I87A 4XYMB 4FFNA 2FP4B 1AUVA 1JDEA 3WO1A 2YRWA 1BNCA 1DV1A 1IOVA 3VPDA 4O81A 3MJFA 5C8YF 4I55F 2FPGB 5KX5F 1KJ9A 1VBHA 2YS6A 5CA0F 2NU6B 2PN1A 3U54A 4MA0A 5JVLA 2X0SA 4MV4A 4YAKB 3OUUA 3UFXB 1CE8A 2XCLA 4TV9F 4NYEA 4O82A 5CB4F 4I50F 3WNZA 4TV8F 3R5XA 1E4EA 3G8DA 1KUTA 3I12A 2P0AA 3QFFA 5DMXA 1T36A 3JZFA 4O4LF 4E4TA 3N6RA 2VQDA 3ORRA 3BG5A 5EZYF 1KJ8A 2DZDA 2I8CA 4QSHA 5JVDF 4HNVA 2FB9A 1GSAA 3U9TA 4FGRA 2R84A 1KJQA 2WYOA 4C5AA 4MV3A 3N8DA 3TINA 2CQYA 4O7VA 1EHIA 2GLTA 1Z2OX 4DLKA 4ZI7F 2ZDGA 2CZGA 2GPSA 4L1KA 2YZNA 4IWYA 1IOWA 4O4HF 2NU7B 2VPQA 2V5AA 3G8CA 1M6VA 4M9UA 3VA7A 5LYJF 1CQIB 2W6MA 1CQJB 3JRWA 1UC8A 1BXRA 3SE7A 1A48A 3HBLA 3VOTA 5IYZF 4MAMA 4HNUA 4YJ2F 4ZHQF 2NU8B 2GPWA 1KC7A 4C5BA 1Z2NX 2YZGA 1DIKA 5HV6A 2W71A 4HQ6A 1C3OA 4XX0B 4FFOA 3K3PA 2ZDQA 2YWVA 3RV4A 5FNVF 3MWDA 3MWEA 4YBZB 3TQTA 2DWCA 4XZ3B 4MV7A 1DV2A 2R86A 4O7TA 2VR1A 2IP4A 4MA5A 3KAKA 1SCUB 4YB8B 3AW8A 3LWBA 3GIDA 2R7KA 2R7LA 4MV9A 2CNUA 2R82A 2CNVA 2YW2A 4XYLB 3K5HA 5HBRB 3KAJA 4O2AF 2Z04A 5LXTF 3VPBA 3DF7A 1GSHA 2FPIB 2W6QA 4ME6A 5JQWA 1GLVA 2J9GA 4O7WA 1M0TA 4HR7A 2NUAB 5J2UF 3LP8A 1GSOA 3AX6A 3R9RA 4O83A 2HGSA 2XD4A 4O4IF 4O7ZA 4EGQA 1EZ1A 5C1PA 4O7LA 3HO8A 3KREA 4Y8VB 3JRXA 1W96A 2NU9B 2Z02A 5LP6F 1Z2PX 5C1OA 4O7SA 1CS0A 5I47A 1PK8A 3OUZA 3R5FA 4IIJF 3R5HA 4O7YA 1KJIA 3TIGA 3U9SA 5JQGF 5H80A 3Q2OA 4FFMA 2V59A 1WR2A 4MV6A 3VPCA 5JH7F 3ORQA 2W6NA 3RUPA 1W93A 2PBZA 3GLKA 2QF7A 2R7MA 1JDBB 4ZOLF 5D8DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VKZ A;  2FPP B;  4EG0 A;  1PX2 A;  2W6Z A;  2SCU B;  1E4E B;  1B6R A;  2DIK A;  3NUA A;  4ZQI A;  4EGJ A;  4TUY F;  2C00 A;  1M0W A;  2YL2 A;  2R85 A;  3RFC A;  2PVP A;  4IZO A;  3WO0 A;  1GGO A;  4FU0 A;  5GON F;  1KBL A;  4O86 A;  3K5I A;  4WD3 A;  3ETH A;  4O2B F;  2GQR A;  3JZI A;  3KAL A;  4DIM A;  5LA6 F;  1B6S A;  1KJJ A;  3TW6 A;  3VMM A;  1OBD A;  3ETJ A;  5LOV F;  5CA1 F;  2W70 A;  4YJ3 F;  4IWX A;  4RZQ A;  2HJW A;  2YZM A;  5BMV F;  2CNQ A;  1I7L A;  5K2M A;  3V4Z A;  5BPH A;  5KKN B;  3TII A;  4O4J F;  5J2T F;  4FFP A;  2R6F A;  2I80 A;  4WBN F;  4C5C A;  4YAJ B;  1OBG A;  4FE2 A;  3U55 A;  1EYZ A;  2R87 A;  2GQS A;  1VBG A;  2YZL A;  2YYA A;  1C30 A;  4MV1 A;  4HNT A;  2V58 A;  3HB9 A;  2OLS A;  4MV8 A;  4I4T F;  3V4S A;  1KEE A;  3Q1K A;  3RV3 A;  4O84 A;  3E5N A;  4O7N A;  2R7N A;  4FFL A;  1AUX A;  3R23 A;  1UC9 A;  1JKJ B;  4FFR A;  1EUC B;  5BPF A;  1JLL B;  2QK4 A;  4IHJ F;  2YRX A;  2W6P A;  1I7N A;  4O7R A;  1EUD B;  2YS7 A;  2W6O A;  2DLN A;  2ZDH A;  1ULZ A;  1A9X A;  5CAE B;  2I87 A;  4XYM B;  4FFN A;  2FP4 B;  1AUV A;  1JDE A;  3WO1 A;  2YRW A;  1BNC A;  1DV1 A;  1IOV A;  3VPD A;  4O81 A;  3MJF A;  5C8Y F;  4I55 F;  2FPG B;  5KX5 F;  1KJ9 A;  1VBH A;  2YS6 A;  5CA0 F;  2NU6 B;  2PN1 A;  3U54 A;  4MA0 A;  5JVL A;  2X0S A;  4MV4 A;  4YAK B;  3OUU A;  3UFX B;  1CE8 A;  2XCL A;  4TV9 F;  4NYE A;  4O82 A;  5CB4 F;  4I50 F;  3WNZ A;  4TV8 F;  3R5X A;  1E4E A;  3G8D A;  1KUT A;  3I12 A;  2P0A A;  3QFF A;  5DMX A;  1T36 A;  3JZF A;  4O4L F;  4E4T A;  3N6R A;  2VQD A;  3ORR A;  3BG5 A;  5EZY F;  1KJ8 A;  2DZD A;  2I8C A;  4QSH A;  5JVD F;  4HNV A;  2FB9 A;  1GSA A;  3U9T A;  4FGR A;  2R84 A;  1KJQ A;  2WYO A;  4C5A A;  4MV3 A;  3N8D A;  3TIN A;  2CQY A;  4O7V A;  1EHI A;  2GLT A;  1Z2O X;  4DLK A;  4ZI7 F;  2ZDG A;  2CZG A;  2GPS A;  4L1K A;  2YZN A;  4IWY A;  1IOW A;  4O4H F;  2NU7 B;  2VPQ A;  2V5A A;  3G8C A;  1M6V A;  4M9U A;  3VA7 A;  5LYJ F;  1CQI B;  2W6M A;  1CQJ B;  3JRW A;  1UC8 A;  1BXR A;  3SE7 A;  1A48 A;  3HBL A;  3VOT A;  5IYZ F;  4MAM A;  4HNU A;  4YJ2 F;  4ZHQ F;  2NU8 B;  2GPW A;  1KC7 A;  4C5B A;  1Z2N X;  2YZG A;  1DIK A;  5HV6 A;  2W71 A;  4HQ6 A;  1C3O A;  4XX0 B;  4FFO A;  3K3P A;  2ZDQ A;  2YWV A;  3RV4 A;  5FNV F;  3MWD A;  3MWE A;  4YBZ B;  3TQT A;  2DWC A;  4XZ3 B;  4MV7 A;  1DV2 A;  2R86 A;  4O7T A;  2VR1 A;  2IP4 A;  4MA5 A;  3KAK A;  1SCU B;  4YB8 B;  3AW8 A;  3LWB A;  3GID A;  2R7K A;  2R7L A;  4MV9 A;  2CNU A;  2R82 A;  2CNV A;  2YW2 A;  4XYL B;  3K5H A;  5HBR B;  3KAJ A;  4O2A F;  2Z04 A;  5LXT F;  3VPB A;  3DF7 A;  1GSH A;  2FPI B;  2W6Q A;  4ME6 A;  5JQW A;  1GLV A;  2J9G A;  4O7W A;  1M0T A;  4HR7 A;  2NUA B;  5J2U F;  3LP8 A;  1GSO A;  3AX6 A;  3R9R A;  4O83 A;  2HGS A;  2XD4 A;  4O4I F;  4O7Z A;  4EGQ A;  1EZ1 A;  5C1P A;  4O7L A;  3HO8 A;  3KRE A;  4Y8V B;  3JRX A;  1W96 A;  2NU9 B;  2Z02 A;  5LP6 F;  1Z2P X;  5C1O A;  4O7S A;  1CS0 A;  5I47 A;  1PK8 A;  3OUZ A;  3R5F A;  4IIJ F;  3R5H A;  4O7Y A;  1KJI A;  3TIG A;  3U9S A;  5JQG F;  5H80 A;  3Q2O A;  4FFM A;  2V59 A;  1WR2 A;  4MV6 A;  3VPC A;  5JH7 F;  3ORQ A;  2W6N A;  3RUP A;  1W93 A;  2PBZ A;  3GLK A;  2QF7 A;  2R7M A;  1JDB B;  4ZOL F;  5D8D A; 
#chains in the Genus database with same CATH topology
 1TWH A;  1E4G T;  1VKZ A;  4QWB A;  2FPP B;  3T9A A;  4EG0 A;  4RB0 A;  2R8H A;  4ECT A;  4DL6 A;  5DGI A;  4CE5 A;  3PW0 A;  5BWW A;  5EWE A;  2FK2 A;  4NZO A;  4DRF A;  3EYY A;  4QIW A;  2COI A;  5DGB A;  2IA6 A;  2JA5 G;  4LF8 H;  2UVU A;  4A3B G;  4A93 G;  3GTL A;  5I5U A;  2KSW A;  5D1O B;  1PX2 A;  3Q8S B;  3BQ0 A;  2E2H A;  2VUM A;  3PW5 A;  4A3K G;  2HGX A;  4ED1 A;  2YCH A;  2W6Z A;  3N6X A;  1CKM A;  4BBR G;  5F9L A;  2SCU B;  4J9K A;  1E4E B;  2FE3 A;  1B6R A;  4ECZ A;  1Y1W A;  2DIK A;  1TWA A;  4YP3 A;  4B3R H;  3NUA A;  3G6X A;  1EKV A;  2Q7D A;  4ZQI A;  3MWM A;  4JI6 H;  3OSP A;  4EGJ A;  2ZM6 H;  4TUY F;  1M0W A;  2C00 A;  2YL2 A;  4JI7 H;  2R85 A;  3RFC A;  2PVP A;  3UYY A;  5FLX W;  4IZO A;  2XGQ A;  4DV6 H;  1OWT A;  2R93 G;  3WO0 A;  4LFB H;  1GGO A;  4FU0 A;  4JI4 H;  5GON F;  1KBL A;  4O86 A;  4I7H A;  3BAC A;  3K5I A;  2R7Z G;  4WD3 A;  3BAB A;  4RZR A;  4PBC A;  5KG0 A;  2DPI A;  3ETH A;  4O2B F;  2GQR A;  5I60 A;  3JZI A;  4JI5 H;  2JA6 G;  5EWF A;  1VS0 A;  3KAL A;  4ECR A;  1XDN A;  4BY1 G;  4DIM A;  3M9N B;  5LA6 F;  2EJ0 A;  4PZ8 A;  2XCA A;  1HR0 H;  1B6S A;  1KJJ A;  4YHH H;  2BQR A;  1SFO A;  3TW6 A;  4HN2 A;  3VMM A;  1OBD A;  2OWO A;  3ETJ A;  5LOV F;  5KT6 A;  3G6V A;  2ASD A;  2R7Z A;  1A3G A;  1JIH A;  3AYH B;  3DTG A;  2W70 A;  5CA1 F;  3EPI A;  1S03 G;  4YJ3 F;  4AYB E;  5KG4 A;  5D1P A;  5CE8 A;  4IWX A;  2FJZ A;  4APM A;  3T5H A;  4IR1 A;  5KFW A;  4GC7 A;  4RZQ A;  2W9C B;  2HJW A;  2YZM A;  1T94 A;  4MTE A;  5KFQ A;  5KT4 A;  3JZ6 A;  1UNN C;  3HOY G;  4PZ7 A;  3HXL A;  5IYD G;  5KFK A;  5BMV F;  2CNQ A;  1I7L A;  3NBZ B;  3RB3 A;  2J6T A;  4O3S A;  5K2M A;  3V4Z A;  5BPH A;  2AQ4 A;  5KKN B;  4A2A A;  2ASL A;  4GLX A;  5IYC G;  4NLG A;  3TII A;  5I5X A;  4O4J F;  4O3O A;  5J2T F;  4X66 H;  2V4R A;  2ATL A;  2F4V H;  2WAQ E;  4FFP A;  2O03 A;  2R6F A;  2I80 A;  4WBN F;  1I1L A;  2A1H A;  1I3Q A;  5DQG A;  4FS2 A;  3MFI A;  4ED3 A;  2JEF A;  1RK5 A;  4C5C A;  3FKI G;  4A2B A;  5KT5 A;  2EJ2 A;  4J9O A;  5KT7 A;  3UZB A;  4FBT A;  4GLW A;  4YAJ B;  4NXN H;  1OBG A;  2HHF B;  1RK6 A;  4ED6 A;  4A3E G;  1ZHQ A;  4FE2 A;  3U55 A;  3T99 A;  5KT2 A;  1EYZ A;  5C5J A;  2R87 A;  2FLN A;  4LH7 A;  4Q4D A;  3PZP A;  2GQS A;  1VBG A;  2YZL A;  2YYA A;  5FPO A;  1S0O A;  3SNO A;  4ECS A;  1C30 A;  4F4X A;  2R92 A;  1ET0 A;  4MV1 A;  4HNT A;  3KYH C;  4IR9 A;  4DR5 H;  1RYS A;  2MCT A;  3GTG A;  3PR4 A;  3K3V A;  3KHL A;  2RGR A;  3N42 B;  3DAA A;  4DR1 H;  1M7J A;  1N33 H;  2V58 A;  2NVX A;  3HB9 A;  2OLS A;  4JI2 H;  4MV8 A;  3F8N A;  4I4T F;  5KFJ A;  3V4S A;  1N32 H;  1KEE A;  1WCM A;  3Q1K A;  4UFZ A;  3RV3 A;  3TY9 A;  4ECW A;  4O84 A;  4LSA A;  3E5N A;  4O7N A;  4QWD A;  2RDI A;  5BWR A;  2WAQ A;  2XGP A;  2Y0S E;  4CHI A;  2R7N A;  1I50 A;  4FFL A;  1UC9 A;  3R23 A;  1AUX A;  2EIY A;  1EKP A;  1JKJ B;  1IBL H;  3N43 B;  4FFR A;  1EUC B;  4PZ6 A;  4Q44 A;  2AGO A;  5BPF A;  1IYD A;  1CKN A;  1JLL B;  3RF2 A;  2R8I A;  3RR5 A;  3GIL A;  1I1K A;  2QK4 A;  5KFI A;  4IRC A;  5L1I A;  4A3G G;  2IBK A;  4IHJ F;  4J9N A;  2YRX A;  3CEB A;  3NBY B;  2W6P A;  4UCS A;  1I7N A;  1I1M A;  4O7R A;  4QW8 A;  1EUD B;  5HNE A;  4ED2 A;  2YS7 A;  3V6K A;  2E5L H;  2WE6 A;  3RB0 A;  2W6O A;  3M4I A;  3TY8 A;  2DLN A;  3Q8P B;  3W5O A;  3GIP A;  5KFN A;  4J9Q A;  4O3P A;  2OH2 A;  4RNO A;  2ZDH A;  4RAZ A;  3RGX A;  3CQZ A;  1HNW H;  1ULZ A;  1A9X A;  1DGS A;  4EFB A;  5CAE B;  1FKA H;  1DAA A;  4YR0 A;  1IYE A;  5I5T A;  1V51 A;  2I87 A;  2FLL A;  2J6S A;  4X62 H;  4GKK H;  5KS8 A;  3N40 P;  4XYM B;  4FFN A;  3IN5 A;  5KFG A;  1AUV A;  2FP4 B;  2UVW A;  4YQW A;  4K0K H;  2X5R A;  2VQF H;  4UCT A;  2EJ3 A;  4J9M A;  2Y0S A;  2VA2 A;  4IRD A;  4DV7 H;  1JDE A;  5CR5 A;  3WO1 A;  2YRW A;  1IBK H;  1S0N A;  1BNC A;  2PMZ E;  2WTF A;  1Y1W G;  1DV1 A;  4CC5 A;  4WHX A;  3T9D A;  4LF5 H;  2DAA A;  4UUG A;  4Q4C A;  3TY5 A;  3FDS A;  5DLG A;  1IOV A;  2CW8 A;  3VPD A;  2C2D A;  1RJR A;  3MR2 A;  5KFF A;  4RB1 A;  3DTF A;  1XMO H;  1FVI A;  5L9X A;  4JUZ A;  4RUC A;  4O81 A;  3MJF A;  4UCO A;  5C8Y F;  4QWA A;  4TM5 A;  3HOX G;  1JX4 A;  4I55 F;  2VPS A;  3C0F B;  2FPG B;  4JI3 H;  5KX5 F;  2WB1 E;  1KJ9 A;  4ECX A;  2IMW P;  3WWJ A;  5DGA A;  1VBH A;  2YS6 A;  3GTO A;  5FR9 A;  3H0G A;  3PFF A;  4LFA H;  3L2P A;  5KFV A;  5CA0 F;  2C2R A;  2NU6 B;  4DUY H;  2PN1 A;  1I2L A;  3U54 A;  4MA0 A;  2FK1 A;  1XNR H;  4C2M A;  4B3M H;  3BA9 A;  5JVL A;  2JA8 G;  2X0S A;  5L1J A;  4MV4 A;  5K3W A;  4J9S A;  3UQ8 A;  4ECY A;  4YAK B;  3OUU A;  3UFX B;  3GII A;  3GQC A;  2VOB A;  3J7A K;  1CE8 A;  2XCL A;  2COG A;  1Y1V A;  4DR7 H;  3HKZ E;  4CKE A;  4TV9 F;  1MZB A;  4QW9 A;  5DAA A;  2PMZ A;  1GO3 E;  5D1O A;  4NYE A;  5BYA A;  3KXY T;  4O82 A;  1P8L A;  5KFC A;  5KT3 A;  3GIJ A;  3BJY A;  4FS1 A;  4ED8 A;  3HOV G;  5CB4 F;  2RDJ A;  4I50 F;  3WNZ A;  4TV8 F;  1HNX H;  4R8U B;  4JI8 H;  3GTK A;  3R5X A;  5JUM A;  1E4E A;  4LF7 H;  3LQS A;  3G8D A;  1KUT A;  3I12 A;  3OTO H;  2P0A A;  5DLF A;  2QB5 A;  4MTD A;  3QFF A;  2WB1 A;  4J0M A;  3T54 A;  5DMX A;  5IWA H;  5EWG A;  1T36 A;  3JZF A;  1S68 A;  3T9C A;  2ZGI A;  4O4L F;  5KFH A;  5IT9 W;  4E4T A;  4A3I G;  3PW2 A;  2JEI A;  1CKO A;  3OHB A;  4DL3 A;  3N6R A;  4X65 H;  2UVR A;  1KT8 A;  1XK5 A;  1BGW A;  4JV5 H;  3BQ2 A;  3J80 W;  4DV3 H;  3SI8 A;  5LL6 b;  2XCP A;  4Q8F A;  4EEQ A;  2VQD A;  3ORR A;  4O3N A;  3GTQ A;  5I5Y A;  3PO3 G;  3BG5 A;  5EZY F;  2HDK A;  3HKZ A;  2W9B B;  4LF4 H;  2HVQ A;  5E25 A;  1WSC A;  2R92 G;  1KJ8 A;  4J9R A;  5KFU A;  4JV2 A;  2DZD A;  2I8C A;  4QSH A;  3RBD A;  5JVD F;  3T9E A;  4DV2 H;  4LF9 H;  4HNV A;  2HIV A;  4QJF A;  3HOZ G;  4JV1 A;  2FB9 A;  3T5L A;  3I4M G;  4X64 H;  1ZQ7 A;  1E4F T;  5KG7 A;  1GSA A;  3U9T A;  4CMF A;  4JXU A;  4AYB A;  1WCM G;  2W9C A;  1JXL A;  4F4W A;  3T1Y H;  5KFL A;  4B3T H;  4FGR A;  2QYZ A;  3Q8Q B;  4FBU A;  5C3E G;  2R84 A;  5DG9 A;  4UCR A;  3MR6 A;  4EYH B;  3PVX A;  5KFR A;  5FLM G;  3PO2 G;  5BYB A;  4A3D G;  2UU9 H;  3TW7 A;  2Q2T A;  1KJQ A;  2WYO A;  1BJT A;  4LSX A;  2COJ A;  2W57 A;  5KFO A;  1B04 A;  4C5A A;  2JEG A;  4AQY H;  5T14 A;  4MV3 A;  3N8D A;  3TIN A;  2W7O A;  3KHR A;  2CQY A;  2C2E A;  3GV5 B;  4O7V A;  1V4Y A;  1EHI A;  3CSW A;  3H40 A;  2GLT A;  1Z2O X;  3HOW G;  4M0J A;  4DLK A;  4ZI7 F;  2ZDG A;  3MR3 A;  4RCN A;  5IP9 G;  5KFX A;  1SEI A;  1Y14 B;  2CZG A;  4BXX G;  2GPS A;  3HT5 A;  4FM9 A;  3J81 W;  3LUL A;  4L1K A;  2YU9 A;  2HVR A;  2YZN A;  4IWY A;  1IOW A;  2FMA A;  4O4H F;  2NU7 B;  2VPQ A;  2V5A A;  3RTX A;  3QWU A;  2ABJ A;  3G8C A;  1M6V A;  4BBS G;  5BWU A;  3T1H H;  1WRV A;  4M9U A;  5F9N A;  2UXD H;  2UUB H;  2WDT A;  2ALZ A;  4K6N A;  4HYK A;  3VA7 A;  5LYJ F;  1IBM H;  4Q43 A;  4DV1 H;  1CQI B;  2W6M A;  4TQS A;  1CQJ B;  2W9A A;  4DL2 A;  4J9L A;  2CW7 A;  5I5S A;  1AN7 A;  2B63 G;  3JRW A;  5BWX A;  3OSN A;  1UC8 A;  1N48 A;  4KHP H;  2JA7 A;  1BXR A;  2BR0 A;  3SE7 A;  4DQN A;  5EOY A;  4DR3 H;  1XMQ H;  1A48 A;  3HBL A;  4GKJ H;  2ASJ A;  1ZAU A;  3VOT A;  3GTP A;  4CKB A;  3RBE A;  3GDE A;  5IYZ F;  2VQE H;  4GC6 A;  4IRK A;  3H0G G;  3PW7 A;  4QWC A;  4MAM A;  4HNU A;  2B63 A;  3LML A;  4RU9 A;  2XIG A;  3H4D A;  1R9T A;  5IYB G;  2AGP A;  3H3V H;  3PN1 A;  4YJ2 F;  4YY3 H;  1TAE A;  3KHH A;  1FJG H;  5KFP A;  5KFS A;  4ZHQ F;  3CVZ A;  2UUA H;  2CKZ B;  3KTM A;  5C4X G;  2NU8 B;  1EKF A;  5BWT A;  3RGZ A;  4O3R A;  1Y1V G;  4R7R A;  4O3Q A;  5LMU H;  2GPW A;  1KC7 A;  4C5B A;  3L4K A;  5EDW A;  3G6Y A;  3RB6 A;  1Z2N X;  2YZG A;  1I6U A;  5DGH A;  5FD6 A;  1DIK A;  4CMD A;  5KFT A;  1GYF A;  5HV6 A;  5A2Q W;  2W71 A;  5I5W A;  2HVS A;  4RB3 C;  3QZ8 A;  4HQ6 A;  3H20 A;  4JI0 H;  4A3C G;  4PDB A;  5KFY A;  4DR4 H;  1C3O A;  4XX0 B;  5KG1 A;  1L2Z A;  5KFZ A;  5BR8 H;  1J5E H;  4FFO A;  3K3P A;  2NVY A;  4ECQ A;  2ZDQ A;  4BY7 G;  2YWV A;  3RV4 A;  5FNV F;  3TQ1 A;  2UXC H;  3GJX B;  2HHH H;  3RJ0 A;  3MWD A;  3MWE A;  4J9P A;  3GIQ A;  3M9M B;  4A3J G;  4F4Y A;  2HGW A;  4YBZ B;  1K1Q A;  4EBE A;  2FKL A;  2HG8 A;  3GTJ A;  1S9F A;  4A3M G;  3JSL A;  3TQT A;  2DWC A;  2DPJ A;  4XZ3 B;  4OX9 H;  4RAY A;  2JA5 A;  4A3L G;  4MV7 A;  4U7C A;  1DV2 A;  1TA8 A;  2R86 A;  4O7T A;  4A3F G;  2VR1 A;  5IP7 G;  4LF6 H;  2IP4 A;  4MA5 A;  3T9B A;  3MFH A;  4RB2 C;  3BQ1 A;  2J6U A;  3KAK A;  1SCU B;  3BA8 A;  1A0I A;  4YB8 B;  3T9F A;  4ED0 A;  4DL5 A;  2CFM A;  3AW8 A;  3MR5 A;  4DV5 H;  2Q2U A;  1O75 A;  3WWH A;  5KFE A;  4DL4 A;  3S24 A;  3LWB A;  2BQ3 A;  2E2I A;  3QZ7 A;  5FJ8 G;  3GID A;  3T7A A;  2R7K A;  5KFM A;  4YR2 A;  5FD5 A;  3IG0 A;  2R7L A;  4IAJ A;  1I2K A;  2CNU A;  4MV9 A;  2R93 A;  1V9P A;  2R82 A;  1RJP A;  4DR2 H;  3KHG A;  3RAX A;  2CNV A;  2YW2 A;  4UCU A;  4XYL B;  4LMY A;  1S97 A;  1I94 H;  3GIK A;  4G3I A;  3K5H A;  2BQU A;  2R8J A;  5L1K A;  5HBR B;  3KAJ A;  4O2A F;  2Z04 A;  5LXT F;  1ZHS A;  2JA6 A;  3VPB A;  1B33 N;  4M7E A;  3DF7 A;  4LFC H;  4R8U A;  2FLP A;  1GSH A;  5DQH A;  4TQR A;  4QWE A;  2FPI B;  4EFE A;  4YR3 A;  2W6Q A;  4F50 A;  2RF4 A;  3PR5 B;  5FPR A;  2UXB H;  4NZN A;  3RAQ A;  4ME6 A;  5JQW A;  1GLV A;  4RUA A;  2J9G A;  4O7W A;  5DG8 A;  1SYX B;  1M0T A;  2DAB A;  4HR7 A;  2NUA B;  5J2U F;  2C35 B;  1N56 A;  1HNZ H;  4DR6 H;  2RGV A;  4RNM A;  2UUC H;  3TEK A;  1A0G A;  3LP8 A;  4LH6 A;  2R8K A;  2C22 A;  3JAM W;  2W7P A;  1GSO A;  3FMA A;  3GIM A;  3AX6 A;  1S10 A;  3BAA A;  5DIS C;  3R9R A;  2ODT X;  4NXM H;  4O83 A;  4F4Z A;  4ED7 A;  1TWF A;  2ZJT A;  1XNQ H;  2HGS A;  2XD4 A;  1G2W A;  2W9B A;  2HIX A;  1CKN B;  3UZO A;  4EQ5 A;  4O4I F;  4O7Z A;  2W8K A;  5DG7 A;  4EGQ A;  3RB4 A;  1EZ1 A;  5KG3 A;  5C1P A;  3PW4 A;  4DAA A;  2W8L A;  4CKC A;  4O7L A;  3HO8 A;  2JEJ A;  2HHF A;  3KRE A;  4Y8V B;  3JRX A;  4PWQ A;  1W96 A;  4EBC A;  3GB8 B;  3NC0 B;  4E6N A;  3FKI A;  4DUZ H;  3N41 B;  3T5K A;  1ZET A;  4B3S H;  5KFD A;  2UVV A;  1P16 A;  2Z02 A;  2NU9 B;  5LP6 F;  4EBD A;  1Z2P X;  5KG6 A;  1TWC A;  4Q0Y A;  1KTA A;  5C1O A;  2AU0 A;  4Q8E A;  3HOU G;  4O7S A;  5CM0 A;  2R8G A;  1TWG A;  3RIZ A;  3GV7 B;  1CS0 A;  5I47 A;  4DL7 A;  1PK8 A;  3OUZ A;  3R5F A;  3W1G A;  2M05 A;  5KG5 A;  2JA7 G;  3NGD A;  1N36 H;  4JV0 A;  3JSN A;  3V6J A;  4IIJ F;  4EEY A;  3SGI A;  3R5H A;  1VAJ A;  1WH2 A;  4O7Y A;  1KJI A;  4BWS C;  5C44 G;  3TIG A;  3U9S A;  4U6P A;  5JQG F;  3H4B A;  4ECV A;  3I4N G;  4QIW E;  4UCV A;  5KG2 A;  5H80 A;  2AGQ A;  3VNN A;  3Q2O A;  3GTM A;  3QQM A;  4FFM A;  2V59 A;  3WWI A;  2VUG A;  1WR2 A;  1K1S A;  2Y4R A;  4NZM A;  2VA3 A;  2FK3 A;  5DQI A;  2V4Q A;  3OHA A;  4MV6 A;  3N44 B;  5L1L A;  3VPC A;  1X9N A;  4ECU A;  1K83 A;  5JH7 F;  1T3N A;  3Q8R B;  3ORQ A;  2W6N A;  3RUP A;  2XC9 A;  4ETS A;  5KFA A;  4DV0 H;  3U0G A;  3EPG A;  2V9W A;  5LMN H;  4Q45 A;  4DV4 H;  1W93 A;  5BWV A;  5I5V A;  2PBZ A;  3GLK A;  4EYI B;  4JI1 H;  4JYA H;  3T5J A;  4RNN A;  1RJQ A;  3GV8 B;  2QF7 A;  3W1B A;  2C28 A;  2R7M A;  1JDB B;  3L4J A;  3V6H A;  1N34 H;  4ZOL F;  5KFB A;  4CC6 A;  2VUM G;  1RYR A;  5D8D A;  4TVI A;  3M9O B;  1S0M A; 
#chains in the Genus database with same CATH homology
 1VKZ A;  2FPP B;  4EG0 A;  1PX2 A;  2W6Z A;  2SCU B;  1E4E B;  1B6R A;  2DIK A;  3NUA A;  4ZQI A;  4EGJ A;  4TUY F;  2C00 A;  1M0W A;  2YL2 A;  2R85 A;  3RFC A;  2PVP A;  4IZO A;  3WO0 A;  1GGO A;  4FU0 A;  5GON F;  1KBL A;  4O86 A;  3K5I A;  4WD3 A;  3ETH A;  4O2B F;  2GQR A;  3JZI A;  3KAL A;  4DIM A;  5LA6 F;  1B6S A;  1KJJ A;  3TW6 A;  3VMM A;  1OBD A;  3ETJ A;  5LOV F;  5CA1 F;  2W70 A;  4YJ3 F;  4IWX A;  4RZQ A;  2HJW A;  2YZM A;  5BMV F;  2CNQ A;  1I7L A;  5K2M A;  3V4Z A;  5BPH A;  5KKN B;  3TII A;  4O4J F;  5J2T F;  4FFP A;  2R6F A;  2I80 A;  4WBN F;  4C5C A;  4YAJ B;  1OBG A;  4FE2 A;  3U55 A;  1EYZ A;  2R87 A;  2GQS A;  1VBG A;  2YZL A;  2YYA A;  1C30 A;  4MV1 A;  4HNT A;  2V58 A;  3HB9 A;  2OLS A;  4MV8 A;  4I4T F;  3V4S A;  1KEE A;  3Q1K A;  3RV3 A;  4O84 A;  3E5N A;  4O7N A;  2R7N A;  4FFL A;  1AUX A;  3R23 A;  1UC9 A;  1JKJ B;  4FFR A;  1EUC B;  5BPF A;  1JLL B;  2QK4 A;  4IHJ F;  2YRX A;  2W6P A;  1I7N A;  4O7R A;  1EUD B;  2YS7 A;  2W6O A;  2DLN A;  2ZDH A;  1ULZ A;  1A9X A;  5CAE B;  2I87 A;  4XYM B;  4FFN A;  2FP4 B;  1AUV A;  1JDE A;  3WO1 A;  2YRW A;  1BNC A;  1DV1 A;  1IOV A;  3VPD A;  4O81 A;  3MJF A;  5C8Y F;  4I55 F;  2FPG B;  5KX5 F;  1KJ9 A;  1VBH A;  2YS6 A;  5CA0 F;  2NU6 B;  2PN1 A;  3U54 A;  4MA0 A;  5JVL A;  2X0S A;  4MV4 A;  4YAK B;  3OUU A;  3UFX B;  1CE8 A;  2XCL A;  4TV9 F;  4NYE A;  4O82 A;  5CB4 F;  4I50 F;  3WNZ A;  4TV8 F;  3R5X A;  1E4E A;  3G8D A;  1KUT A;  3I12 A;  2P0A A;  3QFF A;  5DMX A;  1T36 A;  3JZF A;  4O4L F;  4E4T A;  3N6R A;  2VQD A;  3ORR A;  3BG5 A;  5EZY F;  1KJ8 A;  2DZD A;  2I8C A;  4QSH A;  5JVD F;  4HNV A;  2FB9 A;  1GSA A;  3U9T A;  4FGR A;  2R84 A;  1KJQ A;  2WYO A;  4C5A A;  4MV3 A;  3N8D A;  3TIN A;  2CQY A;  4O7V A;  1EHI A;  2GLT A;  1Z2O X;  4DLK A;  4ZI7 F;  2ZDG A;  2CZG A;  2GPS A;  4L1K A;  2YZN A;  4IWY A;  1IOW A;  4O4H F;  2NU7 B;  2VPQ A;  2V5A A;  3G8C A;  1M6V A;  4M9U A;  3VA7 A;  5LYJ F;  1CQI B;  2W6M A;  1CQJ B;  3JRW A;  1UC8 A;  1BXR A;  3SE7 A;  1A48 A;  3HBL A;  3VOT A;  5IYZ F;  4MAM A;  4HNU A;  4YJ2 F;  4ZHQ F;  2NU8 B;  2GPW A;  1KC7 A;  4C5B A;  1Z2N X;  2YZG A;  1DIK A;  5HV6 A;  2W71 A;  4HQ6 A;  1C3O A;  4XX0 B;  4FFO A;  3K3P A;  2ZDQ A;  2YWV A;  3RV4 A;  5FNV F;  3MWD A;  3MWE A;  4YBZ B;  3TQT A;  2DWC A;  4XZ3 B;  4MV7 A;  1DV2 A;  2R86 A;  4O7T A;  2VR1 A;  2IP4 A;  4MA5 A;  3KAK A;  1SCU B;  4YB8 B;  3AW8 A;  3LWB A;  3GID A;  2R7K A;  2R7L A;  4MV9 A;  2CNU A;  2R82 A;  2CNV A;  2YW2 A;  4XYL B;  3K5H A;  5HBR B;  3KAJ A;  4O2A F;  2Z04 A;  5LXT F;  3VPB A;  3DF7 A;  1GSH A;  2FPI B;  2W6Q A;  4ME6 A;  5JQW A;  1GLV A;  2J9G A;  4O7W A;  1M0T A;  4HR7 A;  2NUA B;  5J2U F;  3LP8 A;  1GSO A;  3AX6 A;  3R9R A;  4O83 A;  2HGS A;  2XD4 A;  4O4I F;  4O7Z A;  4EGQ A;  1EZ1 A;  5C1P A;  4O7L A;  3HO8 A;  3KRE A;  4Y8V B;  3JRX A;  1W96 A;  2NU9 B;  2Z02 A;  5LP6 F;  1Z2P X;  5C1O A;  4O7S A;  1CS0 A;  5I47 A;  1PK8 A;  3OUZ A;  3R5F A;  4IIJ F;  3R5H A;  4O7Y A;  1KJI A;  3TIG A;  3U9S A;  5JQG F;  5H80 A;  3Q2O A;  4FFM A;  2V59 A;  1WR2 A;  4MV6 A;  3VPC A;  5JH7 F;  3ORQ A;  2W6N A;  3RUP A;  1W93 A;  2PBZ A;  3GLK A;  2QF7 A;  2R7M A;  1JDB B;  4ZOL F;  5D8D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...