4YBZB

Ca. korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 in complex with adp and with phosphorylated phosphohistidine segment (site i orientation)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
229
structure length
229
Chain Sequence
SSRDLLLKAKENGRKSLLEHEAKYFISSYGIPVTNIRLAKSEEEAVNFSREIGFPVVLKIVSPQVVHKSDVGGVKVNLRSEEEVRKAYREIIENVKRNVPNAEIEGILVQEFAPPGVELIIGLLRDPQFGPTVMFGLGGVFVELFRDVSFRVAPLSEQDAESMIKEVKAYKLLTGFRGMEPVDIEAIKDALIRAGRIGVENEEIAEMDLNPVIAYPKGIKVVDARIILR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Korarchaeum cryptofilum (strain opf8)
molecule tags Ligase
molecule keywords alpha subunit of Acyl-CoA synthetase (NDP forming)
total genus 64
structure length 229
sequence length 229
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13549 ATP-grasp_5 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4ybzB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4ybzB02
1Z2PX 4C5AA 2W6ZA 2OLSA 4MV3A 3WO0A 3GIDA 5LP6F 3QFFA 3U9SA 5C8YF 2CNVA 4TV8F 1JDEA 2CNUA 5HBRB 2HJWA 5LA6F 3G8DA 1KJJA 1BNCA 4I4TF 1KEEA 1BXRA 2FPIB 2YZLA 2Z02A 1A9XA 5KKNB 2W71A 2NU8B 1I7NA 2FPPB 4ZHQF 3BG5A 1VKZA 2R7NA 2WYOA 4YAKB 5IYZF 1OBDA 4IIJF 1M6VA 4YAJB 1PX2A 3K5HA 2YRXA 4O83A 1CS0A 5LXTF 3VOTA 3R5HA 3UFXB 5CB4F 1CQIB 1SCUB 4QSHA 2QF7A 2SCUB 2Z04A 3VPBA 1DV2A 4O2AF 3RFCA 1A48A 2YS7A 3NUAA 4TUYF 3U54A 5EZYF 4ZQIA 4Y8VB 4MA0A 4MV1A 4O4JF 4HNUA 2GPWA 2X0SA 5BPFA 1JKJB 1W96A 4I55F 5C1OA 2IP4A 2PVPA 3DF7A 1I7LA 2PBZA 3HO8A 4FFRA 1M0TA 1EUDB 1DV1A 4EGQA 2R87A 4L1KA 1KC7A 3V4SA 2GQSA 2R7LA 2W6PA 3K5IA 2NU9B 1IOVA 4I50F 1VBHA 1B6RA 2VPQA 5KX5F 3Q2OA 3OUUA 1C30A 4O7YA 2YRWA 1JDBB 5LYJF 4O82A 5JQGF 4O7RA 2R6FA 4ZOLF 2J9GA 3U55A 2YW2A 2R7MA 3JZIA 4TV9F 2GPSA 4O7VA 5J2TF 5JQWA 4ME6A 4MA5A 4O7ZA 2W6MA 1Z2OX 4O7NA 5CA0F 3K3PA 3ETJA 2DZDA 3G8CA 3AW8A 2DIKA 1B6SA 4O7WA 3VPCA 5BPHA 1W93A 4FFPA 5BMVF 5CA1F 2C00A 4M9UA 1EHIA 3VMMA 5FNVF 1Z2NX 5H80A 3WNZA 1JLLB 1KBLA 4XYLB 5I47A 3RV4A 3RUPA 3TIIA 3JZFA 4NYEA 2W6OA 4O7LA 2YZGA 3Q1KA 1KJ8A 2GLTA 5JVDF 4IWYA 2FP4B 2ZDHA 3HBLA 5JH7F 3RV3A 4O4HF 2ZDGA 2W70A 2GQRA 3TINA 2FB9A 4ZI7F 2R82A 3JRXA 2I8CA 5LOVF 3R23A 1VBGA 4E4TA 2W6NA 2YZMA 1KJQA 1GSAA 5GONF 3GLKA 4MV7A 3TW6A 1UC9A 1OBGA 2NUAB 3I12A 2XCLA 3SE7A 1EYZA 1EZ1A 4EG0A 3MWEA 2R86A 5K2MA 2P0AA 5C1PA 2CQYA 4FGRA 3LP8A 2DWCA 3WO1A 2V58A 1GSHA 3KREA 4YB8B 1IOWA 1WR2A 1DIKA 2XD4A 4MV9A 1GLVA 1AUVA 2PN1A 4XX0B 3HB9A 3R5FA 4O81A 4O7TA 4FU0A 1PK8A 4O2BF 5CAEB 3ETHA 4IHJF 2DLNA 3TIGA 4MV8A 2YL2A 3MWDA 2YYAA 3KAJA 2V59A 1GGOA 4C5BA 4IWXA 1GSOA 2YZNA 1UC8A 4IZOA 4HQ6A 3KALA 2NU7B 4FFLA 1M0WA 4MAMA 3N6RA 5J2UF 4RZQA 4FFOA 1E4EB 4HNTA 1CQJB 4YBZB 1KJ9A 4MV6A 4FE2A 4O7SA 5HV6A 4MV4A 2HGSA 4O4IF 1KUTA 2R85A 4DLKA 5DMXA 3R5XA 3V4ZA 4WBNF 2CNQA 2I80A 3ORRA 4FFNA 2R84A 2ZDQA 4YJ3F 4C5CA 4EGJA 3R9RA 2V5AA 4O4LF 1CE8A 2YWVA 2NU6B 1EUCB 2CZGA 4O84A 2YS6A 3U9TA 3TQTA 4HR7A 1AUXA 2I87A 2W6QA 2VR1A 4XZ3B 3AX6A 4WD3A 3N8DA 1C3OA 1KJIA 3LWBA 2R7KA 4O86A 3VA7A 1E4EA 4FFMA 1ULZA 2QK4A 4YJ2F 3ORQA 3VPDA 3KAKA 2VQDA 3E5NA 3MJFA 5D8DA 5JVLA 2FPGB 3JRWA 4DIMA 4HNVA 4XYMB 3OUZA 1T36A
chains in the Genus database with same CATH superfamily
3JSNA 1Z2PX 4UFZA 2W7OA 2AGQA 4C5AA 1L2ZA 2W6ZA 3BA8A 2OLSA 3GTOA 4MV3A 3WO0A 5KT2A 2W9BA 2UXCH 3GIDA 5LP6F 4QW9A 3T1HH 3NGDA 3C0FB 3QFFA 4UCVA 4IRKA 3N41B 5KFPA 5KFXA 3T9EA 3U9SA 3BJYA 4DV4H 5C8YF 2UXBH 3QWUA 2CNVA 5KG7A 4E6NA 4BY7G 1TA8A 4TV8F 3CVZA 1JDEA 1KTAA 5KFAA 1I1KA 2CNUA 5C44G 3HOXG 3J80W 4X65H 1RYRA 4JV5H 5HBRB 1SFOA 4RUCA 4JI7H 2HJWA 5LA6F 3G8DA 1KJJA 4JV1A 3J7AK 4TM5A 1I3QA 2ZM6H 1BNCA 4I4TF 1KEEA 1S97A 2Y4RA 3L2PA 2V4QA 1S0MA 5BWUA 2ZGIA 1I50A 3OTOH 4O3RA 2A1HA 1BXRA 5I5TA 2COGA 2HHFA 2ZJTA 3FKIA 4F4WA 4ED0A 2HVSA 4DL5A 1ET0A 5I5UA 4YR0A 4PBCA 3T5HA 2FPIB 2YZLA 2Z02A 5IP9G 4WHXA 2JA5G 4CMFA 1A9XA 1XNQH 1N32H 4LSXA 4CKEA 5KKNB 2W71A 2NU8B 1WCMG 3Q8PB 4Q4CA 1I7NA 2WTFA 3BACA 3GV8B 2FPPB 3SNOA 4ZHQF 3BG5A 4J9KA 1VKZA 1RJRA 4CC6A 1T3NA 2WB1E 2R7NA 2WYOA 4YAKB 5IYZF 4RNMA 2JEJA 3GIQA 1OBDA 4Q8EA 3EYYA 1CKNB 4IIJF 3HT5A 1M6VA 5K3WA 4YQWA 3W5OA 2UUCH 3HOZG 5KFKA 2ASLA 4YAJB 1PX2A 3K5HA 3KTMA 4A2BA 2YRXA 4O83A 1CS0A 1K1SA 4DV5H 2ALZA 5LXTF 3T54A 3R5HA 3VOTA 2FK2A 3UFXB 3HKZA 3VNNA 4AYBA 5CB4F 1CQIB 1SCUB 3JAMW 4DL6A 4QSHA 2AGOA 3PO3G 5IWAH 5FD5A 2YCHA 2OH2A 2QF7A 2SCUB 3WWIA 5L9XA 4DR7H 4F4ZA 2Z04A 4UCTA 5DGBA 4ED6A 2VUMG 2J6SA 3BQ1A 2XGQA 2UUBH 5L1JA 3VPBA 5LMUH 3T99A 2CFMA 5BWXA 1DV2A 3TY5A 4O2AF 3RFCA 1A48A 3LQSA 2FMAA 2PMZA 3AYHB 3Q8QB 2YS7A 5KG2A 2ASJA 3NUAA 4JI8H 4TUYF 3U54A 1SEIA 4EBEA 3GTMA 1O75A 4JI2H 1FVIA 3HOVG 1I6UA 3F8NA 2NVYA 5EZYF 2C2DA 3NC0B 2JEGA 4ZQIA 4GKJH 4EQ5A 3IN5A 4Y8VB 2C22A 2VA3A 2R7ZA 3MR6A 5L1IA 1S0OA 3N43B 1S9FA 4MA0A 2UVVA 4MV1A 1N36H 5BWWA 4YY3H 5IYBG 4O4JF 4HNUA 2GPWA 4A3FG 1TWAA 1A3GA 1GO3E 2XCPA 4ECZA 2X0SA 5BPFA 1JKJB 4DUYH 5IT9W 2KSWA 3FKIG 4JV0A 4DV3H 3LULA 1W96A 4I55F 3H20A 2VOBA 5C1OA 1E4GT 2E2HA 2JA7A 4NZNA 5A2QW 5KG5A 3RB0A 5C5JA 2R8GA 3Q8RB 5CM0A 2IP4A 5DLGA 4EYIB 2PVPA 3DF7A 2FLPA 1BGWA 4EFBA 3QQMA 4QJFA 1I7LA 2PBZA 1IBKH 3HO8A 4FFRA 2JEFA 2JA6A 2R93A 1M0TA 4B3TH 1EUDB 4BWSC 3T1YH 1DV1A 5EWGA 5C3EG 4NXNH 1Y1WA 4EGQA 4KHPH 5CR5A 4U6PA 2R87A 4QWEA 3T9DA 4J9OA 4EEYA 4L1KA 1KC7A 5KFEA 4A3IG 4Q45A 4ECUA 3V4SA 4U7CA 3H3VH 5BYAA 1N34H 1A0GA 1R9TA 4UCRA 3L4KA 5DGHA 4DV1H 4RUAA 3GQCA 3TY8A 2GQSA 3GTKA 2R7LA 2C35B 2X5RA 3S24A 4F4XA 3GTLA 2W6PA 2HDKA 3K5IA 2NU9B 5DGAA 5I5YA 4GLXA 4DL2A 2O03A 3FMAA 4LF6H 5I60A 1IOVA 4I50F 3N44B 3EPGA 4FM9A 1RYSA 4YR3A 1VBHA 1SYXB 3H40A 4ECVA 1B6RA 4EBCA 2VPQA 5KX5F 2FKLA 3Q2OA 4DV0H 2UVWA 3OUUA 2DAAA 3DTGA 5KFUA 5F9NA 1C30A 2R92G 1IYEA 3V6KA 4O7YA 2YRWA 3OHBA 4DAAA 4ECYA 1JDBB 1ZQ7A 4GKKH 4UCSA 5LYJF 3GDEA 4O82A 4O7RA 5JQGF 3RGXA 2R6FA 2VPSA 4ZOLF 2ODTX 3NBYB 4QIWA 5KT7A 2W9AA 5DG7A 1IYDA 4AQYH 3RAXA 1HNXH 1CKNA 2FK1A 2J9GA 3U55A 5KFTA 2HIXA 2BQUA 4IRDA 1ZHSA 1T94A 3QZ8A 2YW2A 4DL4A 2R7MA 3JZIA 4TV9F 4O3SA 2GPSA 4O7VA 4RAYA 3MR5A 5J2TF 4RB0A 5JQWA 2B63A 4NZMA 1CKOA 4ME6A 2FK3A 4MA5A 4O7ZA 2W6MA 1Z2OX 5LMNH 2WDTA 5KFHA 3EPIA 5BR8H 1I1MA 4J0MA 4O7NA 1V9PA 5CA0F 3K3PA 4RB2C 5DG9A 4BXXG 4X66H 3ETJA 4YHHH 4JV2A 1N56A 3JZ6A 3HOWG 4HYKA 4YP3A 3MR2A 4ECSA 4YR2A 5KG0A 2DZDA 5D1OA 3G8CA 3CSWA 3GIKA 3AW8A 4EEQA 4B3MH 5KFIA 3FDSA 4DV7H 1V4YA 1I1LA 4I7HA 3GB8B 2R8JA 3TY9A 3V6JA 2XC9A 2DIKA 4CKBA 3RGZA 3H0GA 4TQSA 5FD6A 1ZAUA 1TAEA 3RTXA 1RJQA 3PZPA 3GIMA 4HN2A 2W9BB 2UVUA 2W57A 3G6YA 1B6SA 4O7WA 3GTQA 2FLNA 3PR4A 4JI3H 3M9OB 3VPCA 3GJXB 1XK5A 1TWHA 4LMYA 5BPHA 3NBZB 3CEBA 1G2WA 2R8HA 3N42B 5I5WA 1W93A 4FFPA 5BMVF 4K0KH 5I5SA 1XMQH 1HNZH 5CA1F 2C00A 3BAAA 4M9UA 2COJA 2WAQA 3G6VA 1FJGH 4RAZA 3GIJA 2J6TA 1N33H 1EHIA 3UZBA 1I94H 3VMMA 1WSCA 4ED7A 4DR5H 4FBTA 1BJTA 3T5KA 1JXLA 5FNVF 1Z2NX 4JYAH 2FLLA 3PW7A 5BYBA 2E2IA 5H80A 4JI6H 4DR2H 5KG4A 3WNZA 1N48A 1JLLB 1KBLA 5KFLA 4XYLB 5I47A 5KFFA 3RV4A 3GV7B 4O3PA 3RUPA 3RAQA 3T5JA 2B63G 4LF5H 4MTEA 3TIIA 3JZFA 4NYEA 4IR1A 5DLFA 3PW4A 4Q0YA 2W6OA 1S03G 3PR5B 2UXDH 5KFVA 4NLGA 2JEIA 2VUMA 4O7LA 2YZGA 3Q1KA 5D1OB 5I5XA 1XDNA 5EWFA 4M0JA 4CE5A 4ED2A 4LF9H 3RJ0A 2Y0SA 1TWCA 1KJ8A 4ED1A 2GLTA 2ASDA 4JI1H 4DQNA 2CKZB 2RDJA 3RB6A 4BBRG 4O3QA 4A2AA 2IMWP 4X64H 2R8KA 5JVDF 1WCMA 2EJ3A 4NZOA 4IWYA 4DV2H 1P8LA 2FP4B 2HHFB 2ZDHA 3HBLA 5JH7F 1AN7A 3RV3A 4O4HF 3RF2A 5FLXW 4F4YA 2ZDGA 4DR3H 2W70A 4RZRA 2W8KA 4FS1A 2JA7G 4BBSG 5KFNA 4LSAA 2GQRA 4CKCA 4QIWE 2ATLA 3TINA 4F50A 2WAQE 2FB9A 4J9LA 1TWGA 4LFCH 4C2MA 2UVRA 2W9CA 4A3LG 2ABJA 2COIA 2CW8A 4ZI7F 4DRFA 1A0IA 2UUAH 2R82A 3BA9A 3GIIA 3JRXA 3PW5A 3RIZA 2HVQA 2I8CA 4R7RA 5LOVF 5KT5A 1IBMH 4Q44A 3R23A 3RB3A 1FKAH 4LF8H 4MTDA 2EJ0A 4X62H 1VBGA 5E25A 4E4TA 5DG8A 2W6NA 2YZMA 3G6XA 4LF7H 1KJQA 1GSAA 4APMA 5GONF 2XGPA 2VQEH 3OHAA 3GLKA 4MV7A 3TW6A 4GC7A 1UC9A 5FPOA 1OBGA 4JUZA 2R93G 4A3JG 2IA6A 3DAAA 3OSNA 3RR5A 5I5VA 2EIYA 2AQ4A 2NUAB 1JIHA 4ECRA 2YU9A 3I12A 2XCLA 3SGIA 3H4DA 3SE7A 5L1KA 4J9MA 2DABA 3PVXA 1J5EH 2R7ZG 1EKPA 1EYZA 4A3MG 1EZ1A 4DUZH 4EG0A 3MWEA 2R86A 5KFOA 5K2MA 3WWJA 2IBKA 2BR0A 2XCAA 2P0AA 5C1PA 3GIPA 3GV5B 3PN1A 4LH7A 2VQFH 3HOYG 5KFBA 4EYHB 3PFFA 2W7PA 4J9RA 2CQYA 1Y1VA 4FGRA 5IYCG 3LP8A 4K6NA 3K3VA 2DWCA 3WO1A 2V58A 1OWTA 3RBDA 1GSHA 3SI8A 4Q8FA 3KXYT 5KFWA 3PW0A 1MZBA 2W8LA 3KREA 3N6XA 1JX4A 1EKFA 3RB4A 3I4MG 5KFQA 4RNOA 4YB8B 2PMZE 1IOWA 1WR2A 4QWBA 4R8UB 4LFAH 1DIKA 2XD4A 5JUMA 4MV9A 3W1BA 4A3GG 4QW8A 1Y1WG 3KHGA 4UCOA 1GLVA 1AUVA 4RU9A 2CW7A 2PN1A 4XX0B 3HB9A 4PZ7A 3MFHA 5FPRA 3I4NG 3GTJA 3R5FA 4ECXA 5KFYA 4O81A 4O7TA 4FU0A 5DQHA 1HR0H 4IRCA 4LFBH 5DGIA 1CKMA 1PK8A 2Q2TA 4ECWA 5CE8A 4O2BF 5CAEB 3TW7A 3MR3A 3DTFA 3KHHA 3ETHA 1RJPA 2UU9H 4IHJF 4CHIA 4CC5A 1RK6A 2C28A 2DLNA 1S68A 4A3BG 3TIGA 2RF4A 4QWAA 1DGSA 4MV8A 2YL2A 3MWDA 4TVIA 3M9NB 2YYAA 3WWHA 3KAJA 4IWXA 2V59A 1GGOA 4C5BA 4R8UA 5F9LA 1GSOA 3GILA 2YZNA 4J9SA 4FS2A 4RNNA 4ETSA 5KFRA 1DAAA 4A3CG 4ED3A 2AU0A 2WB1A 3T7AA 4IAJA 4J9PA 2VA2A 5BWVA 1GYFA 4RCNA 3UYYA 1UC8A 1VS0A 4IZOA 3PW2A 1Y14B 3M9MB 4HQ6A 3TQ1A 2J6UA 3KALA 4UUGA 5FJ8G 5KFDA 2QYZA 4DR6H 2FJZA 5T14A 3GTGA 5KFSA 3OSPA 4FBUA 4LF4H 4OX9H 2NU7B 4JXUA 1M0WA 4FFLA 4MAMA 3N6RA 5J2UF 2JA6G 4RZQA 2HVRA 4UCUA 4CMDA 3TEKA 3HOUG 3CQZA 2JA8G 1I2LA 4FFOA 5DQGA 1E4EB 3T9CA 4HNTA 3KHLA 2M05A 3J81W 3V6HA 4A3EG 4M7EA 2JA5A 5KFJA 1CQJB 2NVXA 4YBZB 5KT6A 5KT4A 4IR9A 1KJ9A 5KS8A 4RB3C 4MV6A 4PDBA 4FE2A 2Q7DA 5EOYA 5KFGA 5DAAA 4GLWA 4A3KG 4O7SA 1V51A 1XMOH 5KG6A 4DV6H 4JI0H 4QWCA 2V4RA 5HV6A 4MV4A 4O3OA 4EBDA 2HGSA 4O4IF 2HG8A 4J9QA 1KUTA 2F4VH 1VAJA 2R85A 4Q4DA 3HKZE 4DLKA 1K83A 4NXMH 5KG3A 4QWDA 2RGRA 2VUGA 5DMXA 4RB1A 3T5LA 4PZ8A 4DR4H 3R5XA 3V4ZA 1TWFA 4O3NA 1I2KA 4DR1H 1E4FT 2DPIA 4WBNF 2CNQA 2I80A 3ORRA 4FFNA 2R84A 2ZDQA 4LH6A 4YJ3F 4C5CA 3R9RA 2V5AA 3T9FA 4EGJA 4O4LF 2FE3A 4ECQA 2HHHH 4A93G 1CE8A 2R92A 1K1QA 3L4JA 4B3SH 2HIVA 5KFZA 4DL7A 4J9NA 2HGXA 3MFIA 1ZETA 2YWVA 1RK5A 2NU6B 3JSLA 2W9CB 2RDIA 1EUCB 4AYBE 2C2EA 2CZGA 4O84A 2YS6A 2HGWA 3U9TA 3W1GA 2MCTA 5KG1A 1S10A 4PWQA 3PO2G 4TQRA 3MWMA 4ED8A 2E5LH 2XIGA 3TQTA 4HR7A 2RGVA 5L1LA 1AUXA 1UNNC 1ZHQA 5IP7G 4B3RH 2I87A 2W6QA 5BWTA 1EKVA 1P16A 2VR1A 1XNRH 4XZ3B 3T9AA 3AX6A 4WD3A 5EDWA 3N8DA 4ECTA 1WH2A 1C3OA 1KJIA 1M7JA 3LWBA 3IG0A 5C4XG 2AGPA 2R7KA 2QB5A 4O86A 3U0GA 3VA7A 4BY1G 5EWEA 2BQ3A 4JI4H 1HNWH 3BQ0A 1WRVA 1E4EA 5HNEA 4FFMA 5KFMA 3RBEA 1ULZA 2QK4A 1X9NA 2C2RA 4YJ2F 2WE6A 4G3IA 4GC6A 3UZOA 3ORQA 3VPDA 5KT3A 2Q2UA 3KAKA 3LMLA 3Q8SB 2VQDA 5LL6b 3E5NA 3QZ7A 3H4BA 3KYHC 2EJ2A 3M4IA 1KT8A 3MJFA 2OWOA 5D8DA 1B33N 5FLMG 4DL3A 1IBLH 4A3DG 3HXLA 3H0GG 5JVLA 1Y1VG 3BABA 5DISC 2DPJA 5BWRA 3KHRA 3BQ2A 5FR9A 1S0NA 5KFCA 5D1PA 2V9WA 2R8IA 4Q43A 5IYDG 2FPGB 3N40P 3JRWA 4DIMA 4HNVA 5DQIA 3GTPA 4XYMB 2BQRA 3T9BA 2Y0SE 3OUZA 4PZ6A 4EFEA 1T36A 3UQ8A 1B04A 4JI5H
chains in the Genus database with same CATH topology
1Z2PX 4C5AA 2W6ZA 2OLSA 4MV3A 3WO0A 3GIDA 5LP6F 3QFFA 3U9SA 5C8YF 2CNVA 4TV8F 1JDEA 2CNUA 5HBRB 2HJWA 5LA6F 3G8DA 1KJJA 1BNCA 4I4TF 1KEEA 1BXRA 2FPIB 2YZLA 2Z02A 1A9XA 5KKNB 2W71A 2NU8B 1I7NA 2FPPB 4ZHQF 3BG5A 1VKZA 2R7NA 2WYOA 4YAKB 5IYZF 1OBDA 4IIJF 1M6VA 4YAJB 1PX2A 3K5HA 2YRXA 4O83A 1CS0A 5LXTF 3VOTA 3R5HA 3UFXB 5CB4F 1CQIB 1SCUB 4QSHA 2QF7A 2SCUB 2Z04A 3VPBA 1DV2A 4O2AF 3RFCA 1A48A 2YS7A 3NUAA 4TUYF 3U54A 5EZYF 4ZQIA 4Y8VB 4MA0A 4MV1A 4O4JF 4HNUA 2GPWA 2X0SA 5BPFA 1JKJB 1W96A 4I55F 5C1OA 2IP4A 2PVPA 3DF7A 1I7LA 2PBZA 3HO8A 4FFRA 1M0TA 1EUDB 1DV1A 4EGQA 2R87A 4L1KA 1KC7A 3V4SA 2GQSA 2R7LA 2W6PA 3K5IA 2NU9B 1IOVA 4I50F 1VBHA 1B6RA 2VPQA 5KX5F 3Q2OA 3OUUA 1C30A 4O7YA 2YRWA 1JDBB 5LYJF 4O82A 5JQGF 4O7RA 2R6FA 4ZOLF 2J9GA 3U55A 2YW2A 2R7MA 3JZIA 4TV9F 2GPSA 4O7VA 5J2TF 5JQWA 4ME6A 4MA5A 4O7ZA 2W6MA 1Z2OX 4O7NA 5CA0F 3K3PA 3ETJA 2DZDA 3G8CA 3AW8A 2DIKA 1B6SA 4O7WA 3VPCA 5BPHA 1W93A 4FFPA 5BMVF 5CA1F 2C00A 4M9UA 1EHIA 3VMMA 5FNVF 1Z2NX 5H80A 3WNZA 1JLLB 1KBLA 4XYLB 5I47A 3RV4A 3RUPA 3TIIA 3JZFA 4NYEA 2W6OA 4O7LA 2YZGA 3Q1KA 1KJ8A 2GLTA 5JVDF 4IWYA 2FP4B 2ZDHA 3HBLA 5JH7F 3RV3A 4O4HF 2ZDGA 2W70A 2GQRA 3TINA 2FB9A 4ZI7F 2R82A 3JRXA 2I8CA 5LOVF 3R23A 1VBGA 4E4TA 2W6NA 2YZMA 1KJQA 1GSAA 5GONF 3GLKA 4MV7A 3TW6A 1UC9A 1OBGA 2NUAB 3I12A 2XCLA 3SE7A 1EYZA 1EZ1A 4EG0A 3MWEA 2R86A 5K2MA 2P0AA 5C1PA 2CQYA 4FGRA 3LP8A 2DWCA 3WO1A 2V58A 1GSHA 3KREA 4YB8B 1IOWA 1WR2A 1DIKA 2XD4A 4MV9A 1GLVA 1AUVA 2PN1A 4XX0B 3HB9A 3R5FA 4O81A 4O7TA 4FU0A 1PK8A 4O2BF 5CAEB 3ETHA 4IHJF 2DLNA 3TIGA 4MV8A 2YL2A 3MWDA 2YYAA 3KAJA 2V59A 1GGOA 4C5BA 4IWXA 1GSOA 2YZNA 1UC8A 4IZOA 4HQ6A 3KALA 2NU7B 4FFLA 1M0WA 4MAMA 3N6RA 5J2UF 4RZQA 4FFOA 1E4EB 4HNTA 1CQJB 4YBZB 1KJ9A 4MV6A 4FE2A 4O7SA 5HV6A 4MV4A 2HGSA 4O4IF 1KUTA 2R85A 4DLKA 5DMXA 3R5XA 3V4ZA 4WBNF 2CNQA 2I80A 3ORRA 4FFNA 2R84A 2ZDQA 4YJ3F 4C5CA 4EGJA 3R9RA 2V5AA 4O4LF 1CE8A 2YWVA 2NU6B 1EUCB 2CZGA 4O84A 2YS6A 3U9TA 3TQTA 4HR7A 1AUXA 2I87A 2W6QA 2VR1A 4XZ3B 3AX6A 4WD3A 3N8DA 1C3OA 1KJIA 3LWBA 2R7KA 4O86A 3VA7A 1E4EA 4FFMA 1ULZA 2QK4A 4YJ2F 3ORQA 3VPDA 3KAKA 2VQDA 3E5NA 3MJFA 5D8DA 5JVLA 2FPGB 3JRWA 4DIMA 4HNVA 4XYMB 3OUZA 1T36A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z2P X;  4C5A A;  2W6Z A;  2OLS A;  4MV3 A;  3WO0 A;  3GID A;  5LP6 F;  3QFF A;  3U9S A;  5C8Y F;  2CNV A;  4TV8 F;  1JDE A;  2CNU A;  5HBR B;  2HJW A;  5LA6 F;  3G8D A;  1KJJ A;  1BNC A;  4I4T F;  1KEE A;  1BXR A;  2FPI B;  2YZL A;  2Z02 A;  1A9X A;  5KKN B;  2W71 A;  2NU8 B;  1I7N A;  2FPP B;  4ZHQ F;  3BG5 A;  1VKZ A;  2R7N A;  2WYO A;  4YAK B;  5IYZ F;  1OBD A;  4IIJ F;  1M6V A;  4YAJ B;  1PX2 A;  3K5H A;  2YRX A;  4O83 A;  1CS0 A;  5LXT F;  3VOT A;  3R5H A;  3UFX B;  5CB4 F;  1CQI B;  1SCU B;  4QSH A;  2QF7 A;  2SCU B;  2Z04 A;  3VPB A;  1DV2 A;  4O2A F;  3RFC A;  1A48 A;  2YS7 A;  3NUA A;  4TUY F;  3U54 A;  5EZY F;  4ZQI A;  4Y8V B;  4MA0 A;  4MV1 A;  4O4J F;  4HNU A;  2GPW A;  2X0S A;  5BPF A;  1JKJ B;  1W96 A;  4I55 F;  5C1O A;  2IP4 A;  2PVP A;  3DF7 A;  1I7L A;  2PBZ A;  3HO8 A;  4FFR A;  1M0T A;  1EUD B;  1DV1 A;  4EGQ A;  2R87 A;  4L1K A;  1KC7 A;  3V4S A;  2GQS A;  2R7L A;  2W6P A;  3K5I A;  2NU9 B;  1IOV A;  4I50 F;  1VBH A;  1B6R A;  2VPQ A;  5KX5 F;  3Q2O A;  3OUU A;  1C30 A;  4O7Y A;  2YRW A;  1JDB B;  5LYJ F;  4O82 A;  5JQG F;  4O7R A;  2R6F A;  4ZOL F;  2J9G A;  3U55 A;  2YW2 A;  2R7M A;  3JZI A;  4TV9 F;  2GPS A;  4O7V A;  5J2T F;  5JQW A;  4ME6 A;  4MA5 A;  4O7Z A;  2W6M A;  1Z2O X;  4O7N A;  5CA0 F;  3K3P A;  3ETJ A;  2DZD A;  3G8C A;  3AW8 A;  2DIK A;  1B6S A;  4O7W A;  3VPC A;  5BPH A;  1W93 A;  4FFP A;  5BMV F;  5CA1 F;  2C00 A;  4M9U A;  1EHI A;  3VMM A;  5FNV F;  1Z2N X;  5H80 A;  3WNZ A;  1JLL B;  1KBL A;  4XYL B;  5I47 A;  3RV4 A;  3RUP A;  3TII A;  3JZF A;  4NYE A;  2W6O A;  4O7L A;  2YZG A;  3Q1K A;  1KJ8 A;  2GLT A;  5JVD F;  4IWY A;  2FP4 B;  2ZDH A;  3HBL A;  5JH7 F;  3RV3 A;  4O4H F;  2ZDG A;  2W70 A;  2GQR A;  3TIN A;  2FB9 A;  4ZI7 F;  2R82 A;  3JRX A;  2I8C A;  5LOV F;  3R23 A;  1VBG A;  4E4T A;  2W6N A;  2YZM A;  1KJQ A;  1GSA A;  5GON F;  3GLK A;  4MV7 A;  3TW6 A;  1UC9 A;  1OBG A;  2NUA B;  3I12 A;  2XCL A;  3SE7 A;  1EYZ A;  1EZ1 A;  4EG0 A;  3MWE A;  2R86 A;  5K2M A;  2P0A A;  5C1P A;  2CQY A;  4FGR A;  3LP8 A;  2DWC A;  3WO1 A;  2V58 A;  1GSH A;  3KRE A;  4YB8 B;  1IOW A;  1WR2 A;  1DIK A;  2XD4 A;  4MV9 A;  1GLV A;  1AUV A;  2PN1 A;  4XX0 B;  3HB9 A;  3R5F A;  4O81 A;  4O7T A;  4FU0 A;  1PK8 A;  4O2B F;  5CAE B;  3ETH A;  4IHJ F;  2DLN A;  3TIG A;  4MV8 A;  2YL2 A;  3MWD A;  2YYA A;  3KAJ A;  2V59 A;  1GGO A;  4C5B A;  4IWX A;  1GSO A;  2YZN A;  1UC8 A;  4IZO A;  4HQ6 A;  3KAL A;  2NU7 B;  4FFL A;  1M0W A;  4MAM A;  3N6R A;  5J2U F;  4RZQ A;  4FFO A;  1E4E B;  4HNT A;  1CQJ B;  4YBZ B;  1KJ9 A;  4MV6 A;  4FE2 A;  4O7S A;  5HV6 A;  4MV4 A;  2HGS A;  4O4I F;  1KUT A;  2R85 A;  4DLK A;  5DMX A;  3R5X A;  3V4Z A;  4WBN F;  2CNQ A;  2I80 A;  3ORR A;  4FFN A;  2R84 A;  2ZDQ A;  4YJ3 F;  4C5C A;  4EGJ A;  3R9R A;  2V5A A;  4O4L F;  1CE8 A;  2YWV A;  2NU6 B;  1EUC B;  2CZG A;  4O84 A;  2YS6 A;  3U9T A;  3TQT A;  4HR7 A;  1AUX A;  2I87 A;  2W6Q A;  2VR1 A;  4XZ3 B;  3AX6 A;  4WD3 A;  3N8D A;  1C3O A;  1KJI A;  3LWB A;  2R7K A;  4O86 A;  3VA7 A;  1E4E A;  4FFM A;  1ULZ A;  2QK4 A;  4YJ2 F;  3ORQ A;  3VPD A;  3KAK A;  2VQD A;  3E5N A;  3MJF A;  5D8D A;  5JVL A;  2FPG B;  3JRW A;  4DIM A;  4HNV A;  4XYM B;  3OUZ A;  1T36 A; 
#chains in the Genus database with same CATH topology
 3JSN A;  1Z2P X;  4UFZ A;  2W7O A;  2AGQ A;  4C5A A;  1L2Z A;  2W6Z A;  3BA8 A;  2OLS A;  3GTO A;  4MV3 A;  3WO0 A;  5KT2 A;  2W9B A;  2UXC H;  3GID A;  5LP6 F;  4QW9 A;  3T1H H;  3NGD A;  3C0F B;  3QFF A;  4UCV A;  4IRK A;  3N41 B;  5KFP A;  5KFX A;  3T9E A;  3U9S A;  3BJY A;  4DV4 H;  5C8Y F;  2UXB H;  3QWU A;  2CNV A;  5KG7 A;  4E6N A;  4BY7 G;  1TA8 A;  4TV8 F;  3CVZ A;  1JDE A;  1KTA A;  5KFA A;  1I1K A;  2CNU A;  5C44 G;  3HOX G;  3J80 W;  4X65 H;  1RYR A;  4JV5 H;  5HBR B;  1SFO A;  4RUC A;  4JI7 H;  2HJW A;  5LA6 F;  3G8D A;  1KJJ A;  4JV1 A;  3J7A K;  4TM5 A;  1I3Q A;  2ZM6 H;  1BNC A;  4I4T F;  1KEE A;  1S97 A;  2Y4R A;  3L2P A;  2V4Q A;  1S0M A;  5BWU A;  2ZGI A;  1I50 A;  3OTO H;  4O3R A;  2A1H A;  1BXR A;  5I5T A;  2COG A;  2HHF A;  2ZJT A;  3FKI A;  4F4W A;  4ED0 A;  2HVS A;  4DL5 A;  1ET0 A;  5I5U A;  4YR0 A;  4PBC A;  3T5H A;  2FPI B;  2YZL A;  2Z02 A;  5IP9 G;  4WHX A;  2JA5 G;  4CMF A;  1A9X A;  1XNQ H;  1N32 H;  4LSX A;  4CKE A;  5KKN B;  2W71 A;  2NU8 B;  1WCM G;  3Q8P B;  4Q4C A;  1I7N A;  2WTF A;  3BAC A;  3GV8 B;  2FPP B;  3SNO A;  4ZHQ F;  3BG5 A;  4J9K A;  1VKZ A;  1RJR A;  4CC6 A;  1T3N A;  2WB1 E;  2R7N A;  2WYO A;  4YAK B;  5IYZ F;  4RNM A;  2JEJ A;  3GIQ A;  1OBD A;  4Q8E A;  3EYY A;  1CKN B;  4IIJ F;  3HT5 A;  1M6V A;  5K3W A;  4YQW A;  3W5O A;  2UUC H;  3HOZ G;  5KFK A;  2ASL A;  4YAJ B;  1PX2 A;  3K5H A;  3KTM A;  4A2B A;  2YRX A;  4O83 A;  1CS0 A;  1K1S A;  4DV5 H;  2ALZ A;  5LXT F;  3T54 A;  3R5H A;  3VOT A;  2FK2 A;  3UFX B;  3HKZ A;  3VNN A;  4AYB A;  5CB4 F;  1CQI B;  1SCU B;  3JAM W;  4DL6 A;  4QSH A;  2AGO A;  3PO3 G;  5IWA H;  5FD5 A;  2YCH A;  2OH2 A;  2QF7 A;  2SCU B;  3WWI A;  5L9X A;  4DR7 H;  4F4Z A;  2Z04 A;  4UCT A;  5DGB A;  4ED6 A;  2VUM G;  2J6S A;  3BQ1 A;  2XGQ A;  2UUB H;  5L1J A;  3VPB A;  5LMU H;  3T99 A;  2CFM A;  5BWX A;  1DV2 A;  3TY5 A;  4O2A F;  3RFC A;  1A48 A;  3LQS A;  2FMA A;  2PMZ A;  3AYH B;  3Q8Q B;  2YS7 A;  5KG2 A;  2ASJ A;  3NUA A;  4JI8 H;  4TUY F;  3U54 A;  1SEI A;  4EBE A;  3GTM A;  1O75 A;  4JI2 H;  1FVI A;  3HOV G;  1I6U A;  3F8N A;  2NVY A;  5EZY F;  2C2D A;  3NC0 B;  2JEG A;  4ZQI A;  4GKJ H;  4EQ5 A;  3IN5 A;  4Y8V B;  2C22 A;  2VA3 A;  2R7Z A;  3MR6 A;  5L1I A;  1S0O A;  3N43 B;  1S9F A;  4MA0 A;  2UVV A;  4MV1 A;  1N36 H;  5BWW A;  4YY3 H;  5IYB G;  4O4J F;  4HNU A;  2GPW A;  4A3F G;  1TWA A;  1A3G A;  1GO3 E;  2XCP A;  4ECZ A;  2X0S A;  5BPF A;  1JKJ B;  4DUY H;  5IT9 W;  2KSW A;  3FKI G;  4JV0 A;  4DV3 H;  3LUL A;  1W96 A;  4I55 F;  3H20 A;  2VOB A;  5C1O A;  1E4G T;  2E2H A;  2JA7 A;  4NZN A;  5A2Q W;  5KG5 A;  3RB0 A;  5C5J A;  2R8G A;  3Q8R B;  5CM0 A;  2IP4 A;  5DLG A;  4EYI B;  2PVP A;  3DF7 A;  2FLP A;  1BGW A;  4EFB A;  3QQM A;  4QJF A;  1I7L A;  2PBZ A;  1IBK H;  3HO8 A;  4FFR A;  2JEF A;  2JA6 A;  2R93 A;  1M0T A;  4B3T H;  1EUD B;  4BWS C;  3T1Y H;  1DV1 A;  5EWG A;  5C3E G;  4NXN H;  1Y1W A;  4EGQ A;  4KHP H;  5CR5 A;  4U6P A;  2R87 A;  4QWE A;  3T9D A;  4J9O A;  4EEY A;  4L1K A;  1KC7 A;  5KFE A;  4A3I G;  4Q45 A;  4ECU A;  3V4S A;  4U7C A;  3H3V H;  5BYA A;  1N34 H;  1A0G A;  1R9T A;  4UCR A;  3L4K A;  5DGH A;  4DV1 H;  4RUA A;  3GQC A;  3TY8 A;  2GQS A;  3GTK A;  2R7L A;  2C35 B;  2X5R A;  3S24 A;  4F4X A;  3GTL A;  2W6P A;  2HDK A;  3K5I A;  2NU9 B;  5DGA A;  5I5Y A;  4GLX A;  4DL2 A;  2O03 A;  3FMA A;  4LF6 H;  5I60 A;  1IOV A;  4I50 F;  3N44 B;  3EPG A;  4FM9 A;  1RYS A;  4YR3 A;  1VBH A;  1SYX B;  3H40 A;  4ECV A;  1B6R A;  4EBC A;  2VPQ A;  5KX5 F;  2FKL A;  3Q2O A;  4DV0 H;  2UVW A;  3OUU A;  2DAA A;  3DTG A;  5KFU A;  5F9N A;  1C30 A;  2R92 G;  1IYE A;  3V6K A;  4O7Y A;  2YRW A;  3OHB A;  4DAA A;  4ECY A;  1JDB B;  1ZQ7 A;  4GKK H;  4UCS A;  5LYJ F;  3GDE A;  4O82 A;  4O7R A;  5JQG F;  3RGX A;  2R6F A;  2VPS A;  4ZOL F;  2ODT X;  3NBY B;  4QIW A;  5KT7 A;  2W9A A;  5DG7 A;  1IYD A;  4AQY H;  3RAX A;  1HNX H;  1CKN A;  2FK1 A;  2J9G A;  3U55 A;  5KFT A;  2HIX A;  2BQU A;  4IRD A;  1ZHS A;  1T94 A;  3QZ8 A;  2YW2 A;  4DL4 A;  2R7M A;  3JZI A;  4TV9 F;  4O3S A;  2GPS A;  4O7V A;  4RAY A;  3MR5 A;  5J2T F;  4RB0 A;  5JQW A;  2B63 A;  4NZM A;  1CKO A;  4ME6 A;  2FK3 A;  4MA5 A;  4O7Z A;  2W6M A;  1Z2O X;  5LMN H;  2WDT A;  5KFH A;  3EPI A;  5BR8 H;  1I1M A;  4J0M A;  4O7N A;  1V9P A;  5CA0 F;  3K3P A;  4RB2 C;  5DG9 A;  4BXX G;  4X66 H;  3ETJ A;  4YHH H;  4JV2 A;  1N56 A;  3JZ6 A;  3HOW G;  4HYK A;  4YP3 A;  3MR2 A;  4ECS A;  4YR2 A;  5KG0 A;  2DZD A;  5D1O A;  3G8C A;  3CSW A;  3GIK A;  3AW8 A;  4EEQ A;  4B3M H;  5KFI A;  3FDS A;  4DV7 H;  1V4Y A;  1I1L A;  4I7H A;  3GB8 B;  2R8J A;  3TY9 A;  3V6J A;  2XC9 A;  2DIK A;  4CKB A;  3RGZ A;  3H0G A;  4TQS A;  5FD6 A;  1ZAU A;  1TAE A;  3RTX A;  1RJQ A;  3PZP A;  3GIM A;  4HN2 A;  2W9B B;  2UVU A;  2W57 A;  3G6Y A;  1B6S A;  4O7W A;  3GTQ A;  2FLN A;  3PR4 A;  4JI3 H;  3M9O B;  3VPC A;  3GJX B;  1XK5 A;  1TWH A;  4LMY A;  5BPH A;  3NBZ B;  3CEB A;  1G2W A;  2R8H A;  3N42 B;  5I5W A;  1W93 A;  4FFP A;  5BMV F;  4K0K H;  5I5S A;  1XMQ H;  1HNZ H;  5CA1 F;  2C00 A;  3BAA A;  4M9U A;  2COJ A;  2WAQ A;  3G6V A;  1FJG H;  4RAZ A;  3GIJ A;  2J6T A;  1N33 H;  1EHI A;  3UZB A;  1I94 H;  3VMM A;  1WSC A;  4ED7 A;  4DR5 H;  4FBT A;  1BJT A;  3T5K A;  1JXL A;  5FNV F;  1Z2N X;  4JYA H;  2FLL A;  3PW7 A;  5BYB A;  2E2I A;  5H80 A;  4JI6 H;  4DR2 H;  5KG4 A;  3WNZ A;  1N48 A;  1JLL B;  1KBL A;  5KFL A;  4XYL B;  5I47 A;  5KFF A;  3RV4 A;  3GV7 B;  4O3P A;  3RUP A;  3RAQ A;  3T5J A;  2B63 G;  4LF5 H;  4MTE A;  3TII A;  3JZF A;  4NYE A;  4IR1 A;  5DLF A;  3PW4 A;  4Q0Y A;  2W6O A;  1S03 G;  3PR5 B;  2UXD H;  5KFV A;  4NLG A;  2JEI A;  2VUM A;  4O7L A;  2YZG A;  3Q1K A;  5D1O B;  5I5X A;  1XDN A;  5EWF A;  4M0J A;  4CE5 A;  4ED2 A;  4LF9 H;  3RJ0 A;  2Y0S A;  1TWC A;  1KJ8 A;  4ED1 A;  2GLT A;  2ASD A;  4JI1 H;  4DQN A;  2CKZ B;  2RDJ A;  3RB6 A;  4BBR G;  4O3Q A;  4A2A A;  2IMW P;  4X64 H;  2R8K A;  5JVD F;  1WCM A;  2EJ3 A;  4NZO A;  4IWY A;  4DV2 H;  1P8L A;  2FP4 B;  2HHF B;  2ZDH A;  3HBL A;  5JH7 F;  1AN7 A;  3RV3 A;  4O4H F;  3RF2 A;  5FLX W;  4F4Y A;  2ZDG A;  4DR3 H;  2W70 A;  4RZR A;  2W8K A;  4FS1 A;  2JA7 G;  4BBS G;  5KFN A;  4LSA A;  2GQR A;  4CKC A;  4QIW E;  2ATL A;  3TIN A;  4F50 A;  2WAQ E;  2FB9 A;  4J9L A;  1TWG A;  4LFC H;  4C2M A;  2UVR A;  2W9C A;  4A3L G;  2ABJ A;  2COI A;  2CW8 A;  4ZI7 F;  4DRF A;  1A0I A;  2UUA H;  2R82 A;  3BA9 A;  3GII A;  3JRX A;  3PW5 A;  3RIZ A;  2HVQ A;  2I8C A;  4R7R A;  5LOV F;  5KT5 A;  1IBM H;  4Q44 A;  3R23 A;  3RB3 A;  1FKA H;  4LF8 H;  4MTD A;  2EJ0 A;  4X62 H;  1VBG A;  5E25 A;  4E4T A;  5DG8 A;  2W6N A;  2YZM A;  3G6X A;  4LF7 H;  1KJQ A;  1GSA A;  4APM A;  5GON F;  2XGP A;  2VQE H;  3OHA A;  3GLK A;  4MV7 A;  3TW6 A;  4GC7 A;  1UC9 A;  5FPO A;  1OBG A;  4JUZ A;  2R93 G;  4A3J G;  2IA6 A;  3DAA A;  3OSN A;  3RR5 A;  5I5V A;  2EIY A;  2AQ4 A;  2NUA B;  1JIH A;  4ECR A;  2YU9 A;  3I12 A;  2XCL A;  3SGI A;  3H4D A;  3SE7 A;  5L1K A;  4J9M A;  2DAB A;  3PVX A;  1J5E H;  2R7Z G;  1EKP A;  1EYZ A;  4A3M G;  1EZ1 A;  4DUZ H;  4EG0 A;  3MWE A;  2R86 A;  5KFO A;  5K2M A;  3WWJ A;  2IBK A;  2BR0 A;  2XCA A;  2P0A A;  5C1P A;  3GIP A;  3GV5 B;  3PN1 A;  4LH7 A;  2VQF H;  3HOY G;  5KFB A;  4EYH B;  3PFF A;  2W7P A;  4J9R A;  2CQY A;  1Y1V A;  4FGR A;  5IYC G;  3LP8 A;  4K6N A;  3K3V A;  2DWC A;  3WO1 A;  2V58 A;  1OWT A;  3RBD A;  1GSH A;  3SI8 A;  4Q8F A;  3KXY T;  5KFW A;  3PW0 A;  1MZB A;  2W8L A;  3KRE A;  3N6X A;  1JX4 A;  1EKF A;  3RB4 A;  3I4M G;  5KFQ A;  4RNO A;  4YB8 B;  2PMZ E;  1IOW A;  1WR2 A;  4QWB A;  4R8U B;  4LFA H;  1DIK A;  2XD4 A;  5JUM A;  4MV9 A;  3W1B A;  4A3G G;  4QW8 A;  1Y1W G;  3KHG A;  4UCO A;  1GLV A;  1AUV A;  4RU9 A;  2CW7 A;  2PN1 A;  4XX0 B;  3HB9 A;  4PZ7 A;  3MFH A;  5FPR A;  3I4N G;  3GTJ A;  3R5F A;  4ECX A;  5KFY A;  4O81 A;  4O7T A;  4FU0 A;  5DQH A;  1HR0 H;  4IRC A;  4LFB H;  5DGI A;  1CKM A;  1PK8 A;  2Q2T A;  4ECW A;  5CE8 A;  4O2B F;  5CAE B;  3TW7 A;  3MR3 A;  3DTF A;  3KHH A;  3ETH A;  1RJP A;  2UU9 H;  4IHJ F;  4CHI A;  4CC5 A;  1RK6 A;  2C28 A;  2DLN A;  1S68 A;  4A3B G;  3TIG A;  2RF4 A;  4QWA A;  1DGS A;  4MV8 A;  2YL2 A;  3MWD A;  4TVI A;  3M9N B;  2YYA A;  3WWH A;  3KAJ A;  4IWX A;  2V59 A;  1GGO A;  4C5B A;  4R8U A;  5F9L A;  1GSO A;  3GIL A;  2YZN A;  4J9S A;  4FS2 A;  4RNN A;  4ETS A;  5KFR A;  1DAA A;  4A3C G;  4ED3 A;  2AU0 A;  2WB1 A;  3T7A A;  4IAJ A;  4J9P A;  2VA2 A;  5BWV A;  1GYF A;  4RCN A;  3UYY A;  1UC8 A;  1VS0 A;  4IZO A;  3PW2 A;  1Y14 B;  3M9M B;  4HQ6 A;  3TQ1 A;  2J6U A;  3KAL A;  4UUG A;  5FJ8 G;  5KFD A;  2QYZ A;  4DR6 H;  2FJZ A;  5T14 A;  3GTG A;  5KFS A;  3OSP A;  4FBU A;  4LF4 H;  4OX9 H;  2NU7 B;  4JXU A;  1M0W A;  4FFL A;  4MAM A;  3N6R A;  5J2U F;  2JA6 G;  4RZQ A;  2HVR A;  4UCU A;  4CMD A;  3TEK A;  3HOU G;  3CQZ A;  2JA8 G;  1I2L A;  4FFO A;  5DQG A;  1E4E B;  3T9C A;  4HNT A;  3KHL A;  2M05 A;  3J81 W;  3V6H A;  4A3E G;  4M7E A;  2JA5 A;  5KFJ A;  1CQJ B;  2NVX A;  4YBZ B;  5KT6 A;  5KT4 A;  4IR9 A;  1KJ9 A;  5KS8 A;  4RB3 C;  4MV6 A;  4PDB A;  4FE2 A;  2Q7D A;  5EOY A;  5KFG A;  5DAA A;  4GLW A;  4A3K G;  4O7S A;  1V51 A;  1XMO H;  5KG6 A;  4DV6 H;  4JI0 H;  4QWC A;  2V4R A;  5HV6 A;  4MV4 A;  4O3O A;  4EBD A;  2HGS A;  4O4I F;  2HG8 A;  4J9Q A;  1KUT A;  2F4V H;  1VAJ A;  2R85 A;  4Q4D A;  3HKZ E;  4DLK A;  1K83 A;  4NXM H;  5KG3 A;  4QWD A;  2RGR A;  2VUG A;  5DMX A;  4RB1 A;  3T5L A;  4PZ8 A;  4DR4 H;  3R5X A;  3V4Z A;  1TWF A;  4O3N A;  1I2K A;  4DR1 H;  1E4F T;  2DPI A;  4WBN F;  2CNQ A;  2I80 A;  3ORR A;  4FFN A;  2R84 A;  2ZDQ A;  4LH6 A;  4YJ3 F;  4C5C A;  3R9R A;  2V5A A;  3T9F A;  4EGJ A;  4O4L F;  2FE3 A;  4ECQ A;  2HHH H;  4A93 G;  1CE8 A;  2R92 A;  1K1Q A;  3L4J A;  4B3S H;  2HIV A;  5KFZ A;  4DL7 A;  4J9N A;  2HGX A;  3MFI A;  1ZET A;  2YWV A;  1RK5 A;  2NU6 B;  3JSL A;  2W9C B;  2RDI A;  1EUC B;  4AYB E;  2C2E A;  2CZG A;  4O84 A;  2YS6 A;  2HGW A;  3U9T A;  3W1G A;  2MCT A;  5KG1 A;  1S10 A;  4PWQ A;  3PO2 G;  4TQR A;  3MWM A;  4ED8 A;  2E5L H;  2XIG A;  3TQT A;  4HR7 A;  2RGV A;  5L1L A;  1AUX A;  1UNN C;  1ZHQ A;  5IP7 G;  4B3R H;  2I87 A;  2W6Q A;  5BWT A;  1EKV A;  1P16 A;  2VR1 A;  1XNR H;  4XZ3 B;  3T9A A;  3AX6 A;  4WD3 A;  5EDW A;  3N8D A;  4ECT A;  1WH2 A;  1C3O A;  1KJI A;  1M7J A;  3LWB A;  3IG0 A;  5C4X G;  2AGP A;  2R7K A;  2QB5 A;  4O86 A;  3U0G A;  3VA7 A;  4BY1 G;  5EWE A;  2BQ3 A;  4JI4 H;  1HNW H;  3BQ0 A;  1WRV A;  1E4E A;  5HNE A;  4FFM A;  5KFM A;  3RBE A;  1ULZ A;  2QK4 A;  1X9N A;  2C2R A;  4YJ2 F;  2WE6 A;  4G3I A;  4GC6 A;  3UZO A;  3ORQ A;  3VPD A;  5KT3 A;  2Q2U A;  3KAK A;  3LML A;  3Q8S B;  2VQD A;  5LL6 b;  3E5N A;  3QZ7 A;  3H4B A;  3KYH C;  2EJ2 A;  3M4I A;  1KT8 A;  3MJF A;  2OWO A;  5D8D A;  1B33 N;  5FLM G;  4DL3 A;  1IBL H;  4A3D G;  3HXL A;  3H0G G;  5JVL A;  1Y1V G;  3BAB A;  5DIS C;  2DPJ A;  5BWR A;  3KHR A;  3BQ2 A;  5FR9 A;  1S0N A;  5KFC A;  5D1P A;  2V9W A;  2R8I A;  4Q43 A;  5IYD G;  2FPG B;  3N40 P;  3JRW A;  4DIM A;  4HNV A;  5DQI A;  3GTP A;  4XYM B;  2BQR A;  3T9B A;  2Y0S E;  3OUZ A;  4PZ6 A;  4EFE A;  1T36 A;  3UQ8 A;  1B04 A;  4JI5 H; 
#chains in the Genus database with same CATH homology
 1Z2P X;  4C5A A;  2W6Z A;  2OLS A;  4MV3 A;  3WO0 A;  3GID A;  5LP6 F;  3QFF A;  3U9S A;  5C8Y F;  2CNV A;  4TV8 F;  1JDE A;  2CNU A;  5HBR B;  2HJW A;  5LA6 F;  3G8D A;  1KJJ A;  1BNC A;  4I4T F;  1KEE A;  1BXR A;  2FPI B;  2YZL A;  2Z02 A;  1A9X A;  5KKN B;  2W71 A;  2NU8 B;  1I7N A;  2FPP B;  4ZHQ F;  3BG5 A;  1VKZ A;  2R7N A;  2WYO A;  4YAK B;  5IYZ F;  1OBD A;  4IIJ F;  1M6V A;  4YAJ B;  1PX2 A;  3K5H A;  2YRX A;  4O83 A;  1CS0 A;  5LXT F;  3VOT A;  3R5H A;  3UFX B;  5CB4 F;  1CQI B;  1SCU B;  4QSH A;  2QF7 A;  2SCU B;  2Z04 A;  3VPB A;  1DV2 A;  4O2A F;  3RFC A;  1A48 A;  2YS7 A;  3NUA A;  4TUY F;  3U54 A;  5EZY F;  4ZQI A;  4Y8V B;  4MA0 A;  4MV1 A;  4O4J F;  4HNU A;  2GPW A;  2X0S A;  5BPF A;  1JKJ B;  1W96 A;  4I55 F;  5C1O A;  2IP4 A;  2PVP A;  3DF7 A;  1I7L A;  2PBZ A;  3HO8 A;  4FFR A;  1M0T A;  1EUD B;  1DV1 A;  4EGQ A;  2R87 A;  4L1K A;  1KC7 A;  3V4S A;  2GQS A;  2R7L A;  2W6P A;  3K5I A;  2NU9 B;  1IOV A;  4I50 F;  1VBH A;  1B6R A;  2VPQ A;  5KX5 F;  3Q2O A;  3OUU A;  1C30 A;  4O7Y A;  2YRW A;  1JDB B;  5LYJ F;  4O82 A;  5JQG F;  4O7R A;  2R6F A;  4ZOL F;  2J9G A;  3U55 A;  2YW2 A;  2R7M A;  3JZI A;  4TV9 F;  2GPS A;  4O7V A;  5J2T F;  5JQW A;  4ME6 A;  4MA5 A;  4O7Z A;  2W6M A;  1Z2O X;  4O7N A;  5CA0 F;  3K3P A;  3ETJ A;  2DZD A;  3G8C A;  3AW8 A;  2DIK A;  1B6S A;  4O7W A;  3VPC A;  5BPH A;  1W93 A;  4FFP A;  5BMV F;  5CA1 F;  2C00 A;  4M9U A;  1EHI A;  3VMM A;  5FNV F;  1Z2N X;  5H80 A;  3WNZ A;  1JLL B;  1KBL A;  4XYL B;  5I47 A;  3RV4 A;  3RUP A;  3TII A;  3JZF A;  4NYE A;  2W6O A;  4O7L A;  2YZG A;  3Q1K A;  1KJ8 A;  2GLT A;  5JVD F;  4IWY A;  2FP4 B;  2ZDH A;  3HBL A;  5JH7 F;  3RV3 A;  4O4H F;  2ZDG A;  2W70 A;  2GQR A;  3TIN A;  2FB9 A;  4ZI7 F;  2R82 A;  3JRX A;  2I8C A;  5LOV F;  3R23 A;  1VBG A;  4E4T A;  2W6N A;  2YZM A;  1KJQ A;  1GSA A;  5GON F;  3GLK A;  4MV7 A;  3TW6 A;  1UC9 A;  1OBG A;  2NUA B;  3I12 A;  2XCL A;  3SE7 A;  1EYZ A;  1EZ1 A;  4EG0 A;  3MWE A;  2R86 A;  5K2M A;  2P0A A;  5C1P A;  2CQY A;  4FGR A;  3LP8 A;  2DWC A;  3WO1 A;  2V58 A;  1GSH A;  3KRE A;  4YB8 B;  1IOW A;  1WR2 A;  1DIK A;  2XD4 A;  4MV9 A;  1GLV A;  1AUV A;  2PN1 A;  4XX0 B;  3HB9 A;  3R5F A;  4O81 A;  4O7T A;  4FU0 A;  1PK8 A;  4O2B F;  5CAE B;  3ETH A;  4IHJ F;  2DLN A;  3TIG A;  4MV8 A;  2YL2 A;  3MWD A;  2YYA A;  3KAJ A;  2V59 A;  1GGO A;  4C5B A;  4IWX A;  1GSO A;  2YZN A;  1UC8 A;  4IZO A;  4HQ6 A;  3KAL A;  2NU7 B;  4FFL A;  1M0W A;  4MAM A;  3N6R A;  5J2U F;  4RZQ A;  4FFO A;  1E4E B;  4HNT A;  1CQJ B;  4YBZ B;  1KJ9 A;  4MV6 A;  4FE2 A;  4O7S A;  5HV6 A;  4MV4 A;  2HGS A;  4O4I F;  1KUT A;  2R85 A;  4DLK A;  5DMX A;  3R5X A;  3V4Z A;  4WBN F;  2CNQ A;  2I80 A;  3ORR A;  4FFN A;  2R84 A;  2ZDQ A;  4YJ3 F;  4C5C A;  4EGJ A;  3R9R A;  2V5A A;  4O4L F;  1CE8 A;  2YWV A;  2NU6 B;  1EUC B;  2CZG A;  4O84 A;  2YS6 A;  3U9T A;  3TQT A;  4HR7 A;  1AUX A;  2I87 A;  2W6Q A;  2VR1 A;  4XZ3 B;  3AX6 A;  4WD3 A;  3N8D A;  1C3O A;  1KJI A;  3LWB A;  2R7K A;  4O86 A;  3VA7 A;  1E4E A;  4FFM A;  1ULZ A;  2QK4 A;  4YJ2 F;  3ORQ A;  3VPD A;  3KAK A;  2VQD A;  3E5N A;  3MJF A;  5D8D A;  5JVL A;  2FPG B;  3JRW A;  4DIM A;  4HNV A;  4XYM B;  3OUZ A;  1T36 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...