4YBZB

Ca. korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 in complex with adp and with phosphorylated phosphohistidine segment (site i orientation)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
229
structure length
229
Chain Sequence
SSRDLLLKAKENGRKSLLEHEAKYFISSYGIPVTNIRLAKSEEEAVNFSREIGFPVVLKIVSPQVVHKSDVGGVKVNLRSEEEVRKAYREIIENVKRNVPNAEIEGILVQEFAPPGVELIIGLLRDPQFGPTVMFGLGGVFVELFRDVSFRVAPLSEQDAESMIKEVKAYKLLTGFRGMEPVDIEAIKDALIRAGRIGVENEEIAEMDLNPVIAYPKGIKVVDARIILR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Korarchaeum cryptofilum (strain opf8)
molecule tags Ligase
molecule keywords alpha subunit of Acyl-CoA synthetase (NDP forming)
total genus 64
structure length 229
sequence length 229
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13549 ATP-grasp_5 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4ybzB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4ybzB02
3RV3A 3ETHA 2R86A 1SCUB 2R7LA 5EZYF 1UC9A 1VBHA 2DIKA 5JVLA 1OBGA 2YS6A 3V4SA 2V59A 1EYZA 5HV6A 1KJIA 4MAMA 4IIJF 4O81A 2X0SA 3R9RA 3E5NA 1W96A 4XYLB 5C1PA 4MV6A 4WD3A 4QSHA 3RV4A 1BXRA 2YZMA 2OLSA 2R6FA 4I4TF 3VPDA 4MA5A 3Q1KA 5BPHA 3TINA 1AUXA 2YW2A 1C30A 1PK8A 3TW6A 4FFPA 4WBNF 2CNUA 2GPWA 2CZGA 4HQ6A 5LXTF 3HO8A 1GSOA 4O2BF 1EUCB 3ETJA 1VBGA 3NUAA 5JVDF 2W6NA 1KJQA 2R7MA 3JRWA 2R7KA 1DV1A 1KUTA 2DLNA 2ZDQA 4IWYA 3N8DA 4Y8VB 3JZIA 2GLTA 2YWVA 2VQDA 1KEEA 2FPPB 4O86A 3G8CA 5HBRB 3V4ZA 5BPFA 5J2UF 2YL2A 3RFCA 4YBZB 2ZDHA 3AX6A 1B6SA 1E4EA 3VPBA 1JLLB 4O4JF 4MV8A 1Z2OX 3G8DA 4FU0A 4YJ2F 2R85A 2CNQA 2XCLA 2NU8B 3U55A 1T36A 5D8DA 4M9UA 4ZOLF 4C5CA 3VPCA 5LOVF 2C00A 3U9TA 3TIGA 5JH7F 2YYAA 4HNVA 1KJ9A 4IHJF 1VKZA 1DIKA 2QK4A 4ME6A 4TV8F 4EGQA 1Z2PX 3KAJA 1A48A 4O7YA 4IWXA 2HJWA 1GLVA 4ZQIA 1E4EB 1WR2A 2R84A 2DWCA 4O7SA 3K5IA 1M6VA 1C3OA 1CE8A 4FFMA 4DIMA 4YJ3F 2YZNA 3K3PA 2FPIB 3UFXB 1KJJA 3MWEA 3WO0A 3AW8A 2I80A 5LYJF 3R5FA 3OUZA 1B6RA 4O7NA 1JDBB 4IZOA 2GQRA 5CB4F 1EZ1A 3RUPA 3TQTA 5IYZF 1AUVA 3DF7A 3LWBA 3JRXA 2VR1A 1KC7A 3KREA 2NU7B 2W6MA 3ORRA 2ZDGA 3KAKA 1IOWA 4FE2A 2Z02A 2FPGB 5K2MA 3U54A 4XYMB 5CA0F 5I47A 2CNVA 2WYOA 5C1OA 3VMMA 2XD4A 4FGRA 1JDEA 2R7NA 2R87A 1EUDB 4O84A 2J9GA 5KKNB 1I7NA 1ULZA 3R5XA 1BNCA 4E4TA 5FNVF 3R23A 2W6PA 4MV4A 2PVPA 5JQWA 3I12A 2P0AA 2GPSA 5KX5F 5JQGF 3MWDA 3QFFA 2R82A 3KALA 2W70A 4YAJB 2YS7A 4YB8B 5BMVF 3Q2OA 4O82A 3OUUA 5GONF 2V58A 2YRWA 4L1KA 1KJ8A 4FFRA 3BG5A 3VA7A 2NU6B 3R5HA 2W6ZA 3TIIA 1W93A 4MA0A 4DLKA 2GQSA 4O7ZA 4EGJA 4RZQA 1M0TA 4O2AF 3SE7A 3VOTA 1A9XA 4MV3A 4MV9A 4O7VA 3ORQA 3JZFA 3WNZA 3MJFA 2W6OA 4I55F 4XX0B 1DV2A 2PBZA 1GSHA 4O7RA 1GGOA 4TV9F 1PX2A 3HBLA 1GSAA 2PN1A 5DMXA 2YZLA 4O7TA 4O4HF 5LP6F 2NUAB 2IP4A 2Z04A 5H80A 4XZ3B 2W6QA 3N6RA 3LP8A 4O83A 5C8YF 2I8CA 4O4IF 4I50F 2YZGA 2I87A 1Z2NX 4FFOA 4C5AA 1JKJB 4HR7A 2YRXA 4C5BA 3WO1A 2QF7A 1UC8A 3K5HA 4NYEA 4ZI7F 5LA6F 2V5AA 1CQJB 2VPQA 1I7LA 3GIDA 4FFLA 5CAEB 5J2TF 2FP4B 4MV7A 4O7WA 2NU9B 1M0WA 5CA1F 3GLKA 4HNTA 4O4LF 2DZDA 2FB9A 4EG0A 4FFNA 3U9SA 1OBDA 2HGSA 1IOVA 4O7LA 4YAKB 3HB9A 2CQYA 1EHIA 4HNUA 2W71A 4TUYF 1CQIB 4ZHQF 2SCUB 4MV1A 1CS0A 1KBLA
chains in the Genus database with same CATH superfamily
3QZ7A 3DAAA 3S24A 1CKOA 5EOYA 4QW8A 4FBTA 4RUAA 3RV3A 3L2PA 2UXBH 4YY3H 4IRCA 2FK3A 3H0GG 3ETHA 1V51A 5C5JA 1TWFA 3RAQA 3J81W 2O03A 2R86A 2AGPA 4LF4H 2CW7A 1EKVA 1SCUB 2OWOA 2BQ3A 3L4JA 2R7LA 2HVQA 3Q8PB 3T1HH 5KFAA 3RB6A 3GIMA 4J9LA 5KFXA 1UC9A 5EZYF 4RUCA 3GV8B 1VBHA 1CKMA 5KFLA 2DIKA 5CR5A 5JVLA 4JI7H 4DR2H 3HKZA 4A3JG 4ED7A 2JEFA 4E6NA 4ECRA 2WAQE 4DR5H 4ED8A 2UU9H 1OBGA 2YS6A 3T9CA 3V4SA 1K83A 4U7CA 5KFIA 2V59A 1EYZA 5HV6A 1V4YA 3AYHB 1JIHA 5KFOA 1RJRA 2VQEH 3BQ0A 2R7ZG 2QB5A 1KJIA 4MAMA 2W9CA 3FMAA 4IIJF 4B3TH 2ZJTA 4O81A 2VQFH 2WTFA 5KS8A 2X0SA 3R9RA 4QWEA 3I4NG 3E5NA 1W96A 4DR3H 4YR3A 2UUCH 5EWFA 3BJYA 4XYLB 1ZETA 3GQCA 5C1PA 4J9QA 1XK5A 2QYZA 4MV6A 4DV4H 4AQYH 1I6UA 3GB8B 2WB1A 4WD3A 4QSHA 4YR2A 3GILA 5I5TA 3MWMA 5KFCA 2NVXA 4LSAA 4JI6H 2B63G 3RV4A 2VA2A 2OH2A 1OWTA 4GKJH 1BXRA 4A3GG 2YZMA 3RB0A 1TWHA 5DG8A 1KT8A 3MR5A 3G6VA 1B33N 3NBZB 2OLSA 2ODTX 4I4TF 5I5UA 2R6FA 4X62H 4RNNA 3G6XA 4EBEA 2C35B 2W57A 3VPDA 3N6XA 4MA5A 3WWJA 1K1SA 3GIKA 3Q1KA 5BPHA 5DGBA 2PMZE 5C4XG 3LQSA 1ZQ7A 4U6PA 3TINA 1AUXA 3OSNA 1I1KA 4DV3H 2YW2A 4EFBA 2RF4A 4NZMA 1C30A 1PK8A 4ED3A 1WH2A 3TW6A 4PWQA 1M7JA 5LL6b 4B3SH 4IR9A 4KHPH 4FFPA 4WBNF 3OSPA 2WB1E 2CNUA 2GPWA 1X9NA 3UQ8A 4DAAA 5KFNA 2CZGA 3M9NB 1XMQH 3TW7A 1XNRH 2EIYA 4HQ6A 4UCSA 3HO8A 5LXTF 5I5WA 1GSOA 3PW7A 4O2BF 4CKEA 1EUCB 2V4QA 2UUAH 1I94H 3ETJA 1VBGA 1HNWH 2IA6A 5FR9A 5DQHA 2V9WA 2VPSA 3NUAA 5C44G 5JVDF 2W6NA 3H20A 2AGOA 1KJQA 4O3PA 2R7MA 5DG7A 2IMWP 3HOUG 2FLPA 3NC0B 3JRWA 2R7KA 5L1JA 2ASJA 5BR8H 3V6HA 2R7ZA 5CE8A 3PR5B 1DV1A 1KUTA 4K6NA 2DLNA 3WWIA 3CSWA 3MFHA 5LMUH 1RYRA 4Q8FA 1IYDA 1S03G 2ZDQA 4J9MA 2FE3A 5IWAH 5EWEA 4IWYA 3HOYG 3N8DA 4CC5A 4A3LG 4Y8VB 5BYBA 3JZIA 3TY9A 2GLTA 2YWVA 2VQDA 1KEEA 2FPPB 2FK1A 4GC6A 4O86A 4LFCH 3G8CA 4EYHB 5KG2A 5HBRB 4DV1H 5HNEA 1S0MA 2UVWA 3V4ZA 5BPFA 3H0GA 2V4RA 5J2UF 4DR6H 1RYSA 2YL2A 4ED1A 3RFCA 2X5RA 4PDBA 3OHBA 5I60A 5DISC 4QIWA 4YBZB 1GO3E 5JUMA 3M9MB 2FK2A 2ZDHA 4ECWA 3AX6A 1B6SA 4X66H 4NXMH 5KFQA 3GV7B 4JI8H 5KFYA 2Q7DA 1HNZH 3KHRA 3BAAA 1E4EA 1RK6A 3VPBA 1SYXB 4UCRA 3RB4A 3LULA 1JLLB 4O4JF 4MV8A 4CKCA 4CHIA 3FKIA 2HHFA 4GLWA 3Q8RB 1IBLH 2VA3A 1Z2OX 3G8DA 4JI5H 1E4GT 5KG5A 4YP3A 4FU0A 3PW5A 4YJ2F 3JZ6A 2HVRA 2PMZA 2R85A 5DLGA 2EJ0A 2JA8G 2CNQA 4UCUA 2XCLA 2NU8B 3U55A 1T36A 5D8DA 4Q45A 3BA9A 4M9UA 4ZOLF 2CKZB 4C5CA 2XIGA 4QWDA 3GIPA 1Y1WA 3HXLA 1DAAA 2HG8A 3U0GA 3VPCA 1Y14B 3PFFA 4DV7H 5DGIA 2JA5A 4WHXA 1I50A 5KT4A 3GTJA 4FBUA 5LOVF 5BWWA 2C00A 3RR5A 3U9TA 3W5OA 5DG9A 3TIGA 4A3MG 5JH7F 4A2BA 3KYHC 3H3VH 1I2LA 2C2EA 3BABA 1CKNB 2YYAA 2R93A 4NXNH 3T9DA 4HNVA 1KJ9A 4IAJA 2ASDA 4IHJF 1P8LA 1VKZA 4ME6A 1DIKA 2QK4A 4TV8F 4EGQA 1Z2PX 4GLXA 1E4FT 5KFVA 2DAAA 1N36H 2YU9A 4BXXG 3Q8SB 4APMA 4Q43A 4LH6A 4O3QA 3KAJA 4DV2H 1A48A 3HT5A 4O7YA 1BJTA 3G6YA 4IWXA 4YR0A 1I1MA 2HJWA 4UCTA 1GLVA 1ZHQA 5DAAA 4CMDA 3HOWG 2COGA 2RGVA 3KHLA 2R92G 4LH7A 4ZQIA 2Q2UA 1E4EB 1WR2A 4JV1A 2R84A 3BACA 4ECTA 2DWCA 4O7SA 3K5IA 3T99A 2UVRA 5KFJA 1M6VA 4DQNA 4J9RA 2FMAA 4DL4A 1C3OA 4LSXA 1Y1VA 1CE8A 2DABA 4FFMA 4DIMA 1O75A 2VUMA 3RIZA 1VS0A 4J9SA 4YJ3F 3CQZA 2YZNA 3K3PA 2FPIB 4ECYA 3UFXB 1P16A 3GTQA 1KJJA 3PVXA 3MWEA 3WO0A 4NZOA 1FJGH 3AW8A 5DLFA 3SI8A 4NZNA 2I80A 5LYJF 5KT5A 3EYYA 2C2RA 4A3KG 2CFMA 3R5FA 2UVUA 1ZAUA 3OUZA 4ED2A 1B6RA 5KFSA 4PZ6A 3T9AA 3MR2A 3KTMA 4O7NA 1JDBB 3T9BA 1Y1WG 5KFHA 4IZOA 4YQWA 2DPIA 2UUBH 4G3IA 3HOZG 2GQRA 4IRDA 2COIA 5CB4F 2A1HA 1RK5A 4UFZA 1EZ1A 3RUPA 4F4XA 4Q0YA 3TQTA 5FLXW 4DL7A 2AGQA 2W9BA 1GYFA 5IYZF 2AU0A 2W9AA 4RNMA 1AUVA 3FKIG 3DF7A 3M4IA 3LWBA 4M7EA 5LMNH 3JRXA 4PBCA 1A3GA 2UXDH 2VR1A 1AN7A 5BWUA 1KC7A 3KREA 2R8JA 4JUZA 4JI3H 2NU7B 2W6MA 3ORRA 5KFBA 2ZDGA 4UUGA 5IYDG 4O3RA 3KAKA 5DGAA 3GTGA 5KFDA 1IOWA 3FDSA 4RAYA 3N42B 2JEIA 2C28A 3H4DA 1S0OA 4JI0H 4FE2A 2ABJA 2Z02A 3H40A 2FPGB 5K2MA 2C22A 3BQ1A 1I1LA 3U54A 4ECSA 2W7PA 3PW2A 3GJXB 4XYMB 3HKZE 5CM0A 5F9NA 3T5JA 4LF8H 5CA0F 1DGSA 4ECVA 1J5EH 3F8NA 5I47A 2WE6A 2CNVA 2WYOA 5C1OA 3H4BA 4UCOA 3VMMA 2XD4A 3UZBA 4A3EG 1T94A 4FGRA 4RNOA 3PW4A 2W9CB 1JDEA 3VNNA 4F50A 1T3NA 4MTDA 1WSCA 2FLNA 2R7NA 2R87A 3T9FA 2YCHA 3LMLA 5I5YA 3TY8A 1FVIA 1EUDB 4R8UA 4JI1H 2RDIA 4X64H 3L4KA 4J9KA 4O84A 4QWBA 2J9GA 5DQIA 2IBKA 2R8HA 5KKNB 3RGZA 3HOXG 2ZGIA 3JSNA 5D1OB 4CC6A 2Q2TA 1I7NA 5KG0A 1ULZA 3R5XA 1BNCA 4EBCA 3T5HA 1I2KA 3MR3A 4E4TA 5FNVF 1V9PA 4AYBA 4J0MA 4O3OA 5KFPA 2E5LH 1UNNC 5F9LA 5I5SA 4TVIA 3SNOA 4R7RA 3R23A 2W6PA 2W9BB 4MV4A 4UCVA 4YHHH 2W7OA 5KFGA 2PVPA 4B3MH 2DPJA 1TAEA 3I12A 4CE5A 5JQWA 4ED0A 3DTFA 1TWGA 2P0AA 5D1PA 4DRFA 2HDKA 1SFOA 2GPSA 4EEYA 4RB1A 5DQGA 5IYCG 5A2QW 5E25A 5KX5F 1S68A 1WRVA 4TQSA 3V6KA 5JQGF 2JA6A 1L2ZA 4QW9A 4ECZA 3MWDA 3KHHA 4RZRA 3QFFA 2R82A 3KALA 2NVYA 4F4ZA 4F4WA 2VUGA 2W70A 3UYYA 3GTKA 4YAJB 2RGRA 2XGPA 2XGQA 2YS7A 4YB8B 2HHFB 3Q2OA 5BMVF 1S9FA 4O82A 4BBRG 3QQMA 4X65H 3OUUA 5GONF 5BWXA 4CMFA 4A2AA 1B04A 2V58A 5KT7A 5BWRA 2YRWA 4L1KA 4DL3A 2JA6G 1KJ8A 1FKAH 4FFRA 3Q8QB 4J9OA 2B63A 3T5KA 3GIQA 4MTEA 3RB3A 4I7HA 3PO3G 4LFBH 4RB2C 3BG5A 4RU9A 2NU6B 5K3WA 3VA7A 4EFEA 3R5HA 4EEQA 3CEBA 2W6ZA 5FPRA 2KSWA 2MCTA 3TIIA 4RB0A 4ETSA 4O3SA 4Q8EA 2E2IA 5KFUA 3DTGA 2XCAA 3T54A 1N32H 1W93A 4MA0A 4DLKA 2GQSA 4O7ZA 3OTOH 3PN1A 3OHAA 4EGJA 2EJ3A 4RZQA 4DL2A 1M0TA 3PZPA 4O2AF 3SE7A 3VOTA 1A9XA 4MV3A 3NGDA 5KG3A 1R9TA 4LF7H 4Q4DA 5KFMA 4MV9A 4O7VA 3ORQA 3N44B 4DV0H 3HOVG 2R8IA 3SGIA 4F4YA 2HIVA 5C3EG 4J9PA 3W1GA 4JV2A 4BBSG 2BR0A 3JZFA 5KT3A 4DV6H 3V6JA 3WNZA 1EKPA 3MJFA 5BWTA 3N40P 3PO2G 4HN2A 2W6OA 4TQRA 5KFZA 3BA8A 5I5VA 4BY7G 4M0JA 5KFWA 1A0IA 2W8LA 5L1LA 4DR4H 4I55F 4XX0B 1DV2A 2PBZA 1S10A 1GSHA 4O7RA 1GGOA 4AYBE 4TV9F 1PX2A 5FD5A 3GTPA 1N33H 3HBLA 5KFRA 4A3CG 4BY1G 1GSAA 3K3VA 3NBYB 3W1BA 5IT9W 4FS2A 2PN1A 2E2HA 4PZ8A 5I5XA 1A0GA 1N56A 2JEGA 5DMXA 1TWCA 2YZLA 3GIJA 4ED6A 4O7TA 4O4HF 5LP6F 3IG0A 5L9XA 2AQ4A 2NUAB 2IP4A 1N34H 3BQ2A 4LF9H 3IN5A 1IBMH 2Z04A 5H80A 1HR0H 2Y0SE 4A3IG 2UVVA 4JXUA 4GKKH 4NLGA 4EYIB 4FM9A 1TWAA 3EPGA 4XZ3B 5KFKA 2W6QA 4A3FG 3N6RA 4O3NA 2XC9A 3GV5B 3GTLA 3RAXA 4LFAH 3GTMA 5KT2A 3RJ0A 1TA8A 3LP8A 5KFFA 2CW8A 5L1IA 4O83A 4DUZH 2FJZA 2FKLA 3J7AK 2EJ2A 3GDEA 3C0FB 4CKBA 2R92A 2J6SA 4JI4H 1JX4A 2W8KA 5C8YF 1WCMG 2I8CA 3T7AA 4IRKA 5KFEA 1KTAA 1I3QA 3MR6A 1XDNA 3I4MG 4GC7A 1RJQA 3T9EA 4O4IF 4JI2H 1XMOH 4JYAH 2UXCH 3TQ1A 4I50F 1S97A 4DL6A 3PW0A 3QZ8A 3GIIA 2YZGA 2I87A 1IYEA 1EKFA 1BGWA 1JXLA 2C2DA 4ECXA 1Z2NX 4FFOA 4LF5H 3GTOA 4C5AA 1K1QA 2XCPA 2HGWA 4OX9H 2JA7G 1JKJB 2M05A 4HR7A 4RAZA 2HVSA 2BQUA 2YRXA 3RTXA 4C5BA 1SEIA 3WO1A 5KT6A 4HYKA 5IP9G 2VUMG 1Y1VG 2J6TA 2QF7A 4EBDA 1UC8A 3K5HA 4NYEA 4ZI7F 4DUYH 3KHGA 5LA6F 4LMYA 2V5AA 1HNXH 3EPIA 4QIWE 4RB3C 1CQJB 2VPQA 3JSLA 4ECUA 4ECQA 3RBEA 1VAJA 5L1KA 1S0NA 5IP7G 4A3DG 3CVZA 1I7LA 3KXYT 2ASLA 5FJ8G 5EWGA 5BYAA 5IYBG 3GIDA 2ZM6H 2ATLA 3M9OB 1ET0A 2Y4RA 4FFLA 4R8UB 2WAQA 4IR1A 2J6UA 2COJA 4FS1A 5KG6A 5KG7A 2R8KA 5DGHA 2ALZA 5CAEB 4DL5A 3T1YH 5J2TF 2Y0SA 2VOBA 2FP4B 4DR1H 2BQRA 4JV5H 4A93G 4MV7A 5KG1A 4O7WA 2R93G 4LF6H 1ZHSA 3T5LA 4DV5H 2NU9B 2RDJA 4QJFA 3UZOA 5BWVA 1M0WA 2WDTA 4A3BG 5T14A 5CA1F 1G2WA 5FD6A 2FLLA 3GLKA 4C2MA 4HNTA 4BWSC 2JEJA 2HGXA 2JA5G 2R8GA 1XNQH 4O4LF 2HHHH 5KG4A 4PZ7A 5KFTA 1WCMA 2DZDA 2FB9A 4EG0A 4JV0A 4FFNA 1RJPA 3U9SA 2F4VH 1OBDA 4Q4CA 4DR7H 2HGSA 3TEKA 3N43B 3QWUA 4K0KH 3RBDA 1IOVA 4QWCA 1IBKH 3PR4A 3RF2A 4O7LA 4YAKB 3JAMW 3HB9A 3WWHA 2CQYA 3MFIA 4J9NA 4B3RH 1EHIA 4HNUA 1MZBA 2W71A 4QWAA 2JA7A 4TM5A 4RCNA 1N48A 4TUYF 3TY5A 3N41B 2HIXA 1CQIB 4EQ5A 3J80W 4ZHQF 2SCUB 1CKNA 4MV1A 5FPOA 5FLMG 1CS0A 3RGXA 5EDWA 5D1OA 4Q44A 1KBLA
chains in the Genus database with same CATH topology
3RV3A 3ETHA 2R86A 1SCUB 2R7LA 5EZYF 1UC9A 1VBHA 2DIKA 5JVLA 1OBGA 2YS6A 3V4SA 2V59A 1EYZA 5HV6A 1KJIA 4MAMA 4IIJF 4O81A 2X0SA 3R9RA 3E5NA 1W96A 4XYLB 5C1PA 4MV6A 4WD3A 4QSHA 3RV4A 1BXRA 2YZMA 2OLSA 2R6FA 4I4TF 3VPDA 4MA5A 3Q1KA 5BPHA 3TINA 1AUXA 2YW2A 1C30A 1PK8A 3TW6A 4FFPA 4WBNF 2CNUA 2GPWA 2CZGA 4HQ6A 5LXTF 3HO8A 1GSOA 4O2BF 1EUCB 3ETJA 1VBGA 3NUAA 5JVDF 2W6NA 1KJQA 2R7MA 3JRWA 2R7KA 1DV1A 1KUTA 2DLNA 2ZDQA 4IWYA 3N8DA 4Y8VB 3JZIA 2GLTA 2YWVA 2VQDA 1KEEA 2FPPB 4O86A 3G8CA 5HBRB 3V4ZA 5BPFA 5J2UF 2YL2A 3RFCA 4YBZB 2ZDHA 3AX6A 1B6SA 1E4EA 3VPBA 1JLLB 4O4JF 4MV8A 1Z2OX 3G8DA 4FU0A 4YJ2F 2R85A 2CNQA 2XCLA 2NU8B 3U55A 1T36A 5D8DA 4M9UA 4ZOLF 4C5CA 3VPCA 5LOVF 2C00A 3U9TA 3TIGA 5JH7F 2YYAA 4HNVA 1KJ9A 4IHJF 1VKZA 1DIKA 2QK4A 4ME6A 4TV8F 4EGQA 1Z2PX 3KAJA 1A48A 4O7YA 4IWXA 2HJWA 1GLVA 4ZQIA 1E4EB 1WR2A 2R84A 2DWCA 4O7SA 3K5IA 1M6VA 1C3OA 1CE8A 4FFMA 4DIMA 4YJ3F 2YZNA 3K3PA 2FPIB 3UFXB 1KJJA 3MWEA 3WO0A 3AW8A 2I80A 5LYJF 3R5FA 3OUZA 1B6RA 4O7NA 1JDBB 4IZOA 2GQRA 5CB4F 1EZ1A 3RUPA 3TQTA 5IYZF 1AUVA 3DF7A 3LWBA 3JRXA 2VR1A 1KC7A 3KREA 2NU7B 2W6MA 3ORRA 2ZDGA 3KAKA 1IOWA 4FE2A 2Z02A 2FPGB 5K2MA 3U54A 4XYMB 5CA0F 5I47A 2CNVA 2WYOA 5C1OA 3VMMA 2XD4A 4FGRA 1JDEA 2R7NA 2R87A 1EUDB 4O84A 2J9GA 5KKNB 1I7NA 1ULZA 3R5XA 1BNCA 4E4TA 5FNVF 3R23A 2W6PA 4MV4A 2PVPA 5JQWA 3I12A 2P0AA 2GPSA 5KX5F 5JQGF 3MWDA 3QFFA 2R82A 3KALA 2W70A 4YAJB 2YS7A 4YB8B 5BMVF 3Q2OA 4O82A 3OUUA 5GONF 2V58A 2YRWA 4L1KA 1KJ8A 4FFRA 3BG5A 3VA7A 2NU6B 3R5HA 2W6ZA 3TIIA 1W93A 4MA0A 4DLKA 2GQSA 4O7ZA 4EGJA 4RZQA 1M0TA 4O2AF 3SE7A 3VOTA 1A9XA 4MV3A 4MV9A 4O7VA 3ORQA 3JZFA 3WNZA 3MJFA 2W6OA 4I55F 4XX0B 1DV2A 2PBZA 1GSHA 4O7RA 1GGOA 4TV9F 1PX2A 3HBLA 1GSAA 2PN1A 5DMXA 2YZLA 4O7TA 4O4HF 5LP6F 2NUAB 2IP4A 2Z04A 5H80A 4XZ3B 2W6QA 3N6RA 3LP8A 4O83A 5C8YF 2I8CA 4O4IF 4I50F 2YZGA 2I87A 1Z2NX 4FFOA 4C5AA 1JKJB 4HR7A 2YRXA 4C5BA 3WO1A 2QF7A 1UC8A 3K5HA 4NYEA 4ZI7F 5LA6F 2V5AA 1CQJB 2VPQA 1I7LA 3GIDA 4FFLA 5CAEB 5J2TF 2FP4B 4MV7A 4O7WA 2NU9B 1M0WA 5CA1F 3GLKA 4HNTA 4O4LF 2DZDA 2FB9A 4EG0A 4FFNA 3U9SA 1OBDA 2HGSA 1IOVA 4O7LA 4YAKB 3HB9A 2CQYA 1EHIA 4HNUA 2W71A 4TUYF 1CQIB 4ZHQF 2SCUB 4MV1A 1CS0A 1KBLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RV3 A;  3ETH A;  2R86 A;  1SCU B;  2R7L A;  5EZY F;  1UC9 A;  1VBH A;  2DIK A;  5JVL A;  1OBG A;  2YS6 A;  3V4S A;  2V59 A;  1EYZ A;  5HV6 A;  1KJI A;  4MAM A;  4IIJ F;  4O81 A;  2X0S A;  3R9R A;  3E5N A;  1W96 A;  4XYL B;  5C1P A;  4MV6 A;  4WD3 A;  4QSH A;  3RV4 A;  1BXR A;  2YZM A;  2OLS A;  2R6F A;  4I4T F;  3VPD A;  4MA5 A;  3Q1K A;  5BPH A;  3TIN A;  1AUX A;  2YW2 A;  1C30 A;  1PK8 A;  3TW6 A;  4FFP A;  4WBN F;  2CNU A;  2GPW A;  2CZG A;  4HQ6 A;  5LXT F;  3HO8 A;  1GSO A;  4O2B F;  1EUC B;  3ETJ A;  1VBG A;  3NUA A;  5JVD F;  2W6N A;  1KJQ A;  2R7M A;  3JRW A;  2R7K A;  1DV1 A;  1KUT A;  2DLN A;  2ZDQ A;  4IWY A;  3N8D A;  4Y8V B;  3JZI A;  2GLT A;  2YWV A;  2VQD A;  1KEE A;  2FPP B;  4O86 A;  3G8C A;  5HBR B;  3V4Z A;  5BPF A;  5J2U F;  2YL2 A;  3RFC A;  4YBZ B;  2ZDH A;  3AX6 A;  1B6S A;  1E4E A;  3VPB A;  1JLL B;  4O4J F;  4MV8 A;  1Z2O X;  3G8D A;  4FU0 A;  4YJ2 F;  2R85 A;  2CNQ A;  2XCL A;  2NU8 B;  3U55 A;  1T36 A;  5D8D A;  4M9U A;  4ZOL F;  4C5C A;  3VPC A;  5LOV F;  2C00 A;  3U9T A;  3TIG A;  5JH7 F;  2YYA A;  4HNV A;  1KJ9 A;  4IHJ F;  1VKZ A;  1DIK A;  2QK4 A;  4ME6 A;  4TV8 F;  4EGQ A;  1Z2P X;  3KAJ A;  1A48 A;  4O7Y A;  4IWX A;  2HJW A;  1GLV A;  4ZQI A;  1E4E B;  1WR2 A;  2R84 A;  2DWC A;  4O7S A;  3K5I A;  1M6V A;  1C3O A;  1CE8 A;  4FFM A;  4DIM A;  4YJ3 F;  2YZN A;  3K3P A;  2FPI B;  3UFX B;  1KJJ A;  3MWE A;  3WO0 A;  3AW8 A;  2I80 A;  5LYJ F;  3R5F A;  3OUZ A;  1B6R A;  4O7N A;  1JDB B;  4IZO A;  2GQR A;  5CB4 F;  1EZ1 A;  3RUP A;  3TQT A;  5IYZ F;  1AUV A;  3DF7 A;  3LWB A;  3JRX A;  2VR1 A;  1KC7 A;  3KRE A;  2NU7 B;  2W6M A;  3ORR A;  2ZDG A;  3KAK A;  1IOW A;  4FE2 A;  2Z02 A;  2FPG B;  5K2M A;  3U54 A;  4XYM B;  5CA0 F;  5I47 A;  2CNV A;  2WYO A;  5C1O A;  3VMM A;  2XD4 A;  4FGR A;  1JDE A;  2R7N A;  2R87 A;  1EUD B;  4O84 A;  2J9G A;  5KKN B;  1I7N A;  1ULZ A;  3R5X A;  1BNC A;  4E4T A;  5FNV F;  3R23 A;  2W6P A;  4MV4 A;  2PVP A;  5JQW A;  3I12 A;  2P0A A;  2GPS A;  5KX5 F;  5JQG F;  3MWD A;  3QFF A;  2R82 A;  3KAL A;  2W70 A;  4YAJ B;  2YS7 A;  4YB8 B;  5BMV F;  3Q2O A;  4O82 A;  3OUU A;  5GON F;  2V58 A;  2YRW A;  4L1K A;  1KJ8 A;  4FFR A;  3BG5 A;  3VA7 A;  2NU6 B;  3R5H A;  2W6Z A;  3TII A;  1W93 A;  4MA0 A;  4DLK A;  2GQS A;  4O7Z A;  4EGJ A;  4RZQ A;  1M0T A;  4O2A F;  3SE7 A;  3VOT A;  1A9X A;  4MV3 A;  4MV9 A;  4O7V A;  3ORQ A;  3JZF A;  3WNZ A;  3MJF A;  2W6O A;  4I55 F;  4XX0 B;  1DV2 A;  2PBZ A;  1GSH A;  4O7R A;  1GGO A;  4TV9 F;  1PX2 A;  3HBL A;  1GSA A;  2PN1 A;  5DMX A;  2YZL A;  4O7T A;  4O4H F;  5LP6 F;  2NUA B;  2IP4 A;  2Z04 A;  5H80 A;  4XZ3 B;  2W6Q A;  3N6R A;  3LP8 A;  4O83 A;  5C8Y F;  2I8C A;  4O4I F;  4I50 F;  2YZG A;  2I87 A;  1Z2N X;  4FFO A;  4C5A A;  1JKJ B;  4HR7 A;  2YRX A;  4C5B A;  3WO1 A;  2QF7 A;  1UC8 A;  3K5H A;  4NYE A;  4ZI7 F;  5LA6 F;  2V5A A;  1CQJ B;  2VPQ A;  1I7L A;  3GID A;  4FFL A;  5CAE B;  5J2T F;  2FP4 B;  4MV7 A;  4O7W A;  2NU9 B;  1M0W A;  5CA1 F;  3GLK A;  4HNT A;  4O4L F;  2DZD A;  2FB9 A;  4EG0 A;  4FFN A;  3U9S A;  1OBD A;  2HGS A;  1IOV A;  4O7L A;  4YAK B;  3HB9 A;  2CQY A;  1EHI A;  4HNU A;  2W71 A;  4TUY F;  1CQI B;  4ZHQ F;  2SCU B;  4MV1 A;  1CS0 A;  1KBL A; 
#chains in the Genus database with same CATH topology
 3QZ7 A;  3DAA A;  3S24 A;  1CKO A;  5EOY A;  4QW8 A;  4FBT A;  4RUA A;  3RV3 A;  3L2P A;  2UXB H;  4YY3 H;  4IRC A;  2FK3 A;  3H0G G;  3ETH A;  1V51 A;  5C5J A;  1TWF A;  3RAQ A;  3J81 W;  2O03 A;  2R86 A;  2AGP A;  4LF4 H;  2CW7 A;  1EKV A;  1SCU B;  2OWO A;  2BQ3 A;  3L4J A;  2R7L A;  2HVQ A;  3Q8P B;  3T1H H;  5KFA A;  3RB6 A;  3GIM A;  4J9L A;  5KFX A;  1UC9 A;  5EZY F;  4RUC A;  3GV8 B;  1VBH A;  1CKM A;  5KFL A;  2DIK A;  5CR5 A;  5JVL A;  4JI7 H;  4DR2 H;  3HKZ A;  4A3J G;  4ED7 A;  2JEF A;  4E6N A;  4ECR A;  2WAQ E;  4DR5 H;  4ED8 A;  2UU9 H;  1OBG A;  2YS6 A;  3T9C A;  3V4S A;  1K83 A;  4U7C A;  5KFI A;  2V59 A;  1EYZ A;  5HV6 A;  1V4Y A;  3AYH B;  1JIH A;  5KFO A;  1RJR A;  2VQE H;  3BQ0 A;  2R7Z G;  2QB5 A;  1KJI A;  4MAM A;  2W9C A;  3FMA A;  4IIJ F;  4B3T H;  2ZJT A;  4O81 A;  2VQF H;  2WTF A;  5KS8 A;  2X0S A;  3R9R A;  4QWE A;  3I4N G;  3E5N A;  1W96 A;  4DR3 H;  4YR3 A;  2UUC H;  5EWF A;  3BJY A;  4XYL B;  1ZET A;  3GQC A;  5C1P A;  4J9Q A;  1XK5 A;  2QYZ A;  4MV6 A;  4DV4 H;  4AQY H;  1I6U A;  3GB8 B;  2WB1 A;  4WD3 A;  4QSH A;  4YR2 A;  3GIL A;  5I5T A;  3MWM A;  5KFC A;  2NVX A;  4LSA A;  4JI6 H;  2B63 G;  3RV4 A;  2VA2 A;  2OH2 A;  1OWT A;  4GKJ H;  1BXR A;  4A3G G;  2YZM A;  3RB0 A;  1TWH A;  5DG8 A;  1KT8 A;  3MR5 A;  3G6V A;  1B33 N;  3NBZ B;  2OLS A;  2ODT X;  4I4T F;  5I5U A;  2R6F A;  4X62 H;  4RNN A;  3G6X A;  4EBE A;  2C35 B;  2W57 A;  3VPD A;  3N6X A;  4MA5 A;  3WWJ A;  1K1S A;  3GIK A;  3Q1K A;  5BPH A;  5DGB A;  2PMZ E;  5C4X G;  3LQS A;  1ZQ7 A;  4U6P A;  3TIN A;  1AUX A;  3OSN A;  1I1K A;  4DV3 H;  2YW2 A;  4EFB A;  2RF4 A;  4NZM A;  1C30 A;  1PK8 A;  4ED3 A;  1WH2 A;  3TW6 A;  4PWQ A;  1M7J A;  5LL6 b;  4B3S H;  4IR9 A;  4KHP H;  4FFP A;  4WBN F;  3OSP A;  2WB1 E;  2CNU A;  2GPW A;  1X9N A;  3UQ8 A;  4DAA A;  5KFN A;  2CZG A;  3M9N B;  1XMQ H;  3TW7 A;  1XNR H;  2EIY A;  4HQ6 A;  4UCS A;  3HO8 A;  5LXT F;  5I5W A;  1GSO A;  3PW7 A;  4O2B F;  4CKE A;  1EUC B;  2V4Q A;  2UUA H;  1I94 H;  3ETJ A;  1VBG A;  1HNW H;  2IA6 A;  5FR9 A;  5DQH A;  2V9W A;  2VPS A;  3NUA A;  5C44 G;  5JVD F;  2W6N A;  3H20 A;  2AGO A;  1KJQ A;  4O3P A;  2R7M A;  5DG7 A;  2IMW P;  3HOU G;  2FLP A;  3NC0 B;  3JRW A;  2R7K A;  5L1J A;  2ASJ A;  5BR8 H;  3V6H A;  2R7Z A;  5CE8 A;  3PR5 B;  1DV1 A;  1KUT A;  4K6N A;  2DLN A;  3WWI A;  3CSW A;  3MFH A;  5LMU H;  1RYR A;  4Q8F A;  1IYD A;  1S03 G;  2ZDQ A;  4J9M A;  2FE3 A;  5IWA H;  5EWE A;  4IWY A;  3HOY G;  3N8D A;  4CC5 A;  4A3L G;  4Y8V B;  5BYB A;  3JZI A;  3TY9 A;  2GLT A;  2YWV A;  2VQD A;  1KEE A;  2FPP B;  2FK1 A;  4GC6 A;  4O86 A;  4LFC H;  3G8C A;  4EYH B;  5KG2 A;  5HBR B;  4DV1 H;  5HNE A;  1S0M A;  2UVW A;  3V4Z A;  5BPF A;  3H0G A;  2V4R A;  5J2U F;  4DR6 H;  1RYS A;  2YL2 A;  4ED1 A;  3RFC A;  2X5R A;  4PDB A;  3OHB A;  5I60 A;  5DIS C;  4QIW A;  4YBZ B;  1GO3 E;  5JUM A;  3M9M B;  2FK2 A;  2ZDH A;  4ECW A;  3AX6 A;  1B6S A;  4X66 H;  4NXM H;  5KFQ A;  3GV7 B;  4JI8 H;  5KFY A;  2Q7D A;  1HNZ H;  3KHR A;  3BAA A;  1E4E A;  1RK6 A;  3VPB A;  1SYX B;  4UCR A;  3RB4 A;  3LUL A;  1JLL B;  4O4J F;  4MV8 A;  4CKC A;  4CHI A;  3FKI A;  2HHF A;  4GLW A;  3Q8R B;  1IBL H;  2VA3 A;  1Z2O X;  3G8D A;  4JI5 H;  1E4G T;  5KG5 A;  4YP3 A;  4FU0 A;  3PW5 A;  4YJ2 F;  3JZ6 A;  2HVR A;  2PMZ A;  2R85 A;  5DLG A;  2EJ0 A;  2JA8 G;  2CNQ A;  4UCU A;  2XCL A;  2NU8 B;  3U55 A;  1T36 A;  5D8D A;  4Q45 A;  3BA9 A;  4M9U A;  4ZOL F;  2CKZ B;  4C5C A;  2XIG A;  4QWD A;  3GIP A;  1Y1W A;  3HXL A;  1DAA A;  2HG8 A;  3U0G A;  3VPC A;  1Y14 B;  3PFF A;  4DV7 H;  5DGI A;  2JA5 A;  4WHX A;  1I50 A;  5KT4 A;  3GTJ A;  4FBU A;  5LOV F;  5BWW A;  2C00 A;  3RR5 A;  3U9T A;  3W5O A;  5DG9 A;  3TIG A;  4A3M G;  5JH7 F;  4A2B A;  3KYH C;  3H3V H;  1I2L A;  2C2E A;  3BAB A;  1CKN B;  2YYA A;  2R93 A;  4NXN H;  3T9D A;  4HNV A;  1KJ9 A;  4IAJ A;  2ASD A;  4IHJ F;  1P8L A;  1VKZ A;  4ME6 A;  1DIK A;  2QK4 A;  4TV8 F;  4EGQ A;  1Z2P X;  4GLX A;  1E4F T;  5KFV A;  2DAA A;  1N36 H;  2YU9 A;  4BXX G;  3Q8S B;  4APM A;  4Q43 A;  4LH6 A;  4O3Q A;  3KAJ A;  4DV2 H;  1A48 A;  3HT5 A;  4O7Y A;  1BJT A;  3G6Y A;  4IWX A;  4YR0 A;  1I1M A;  2HJW A;  4UCT A;  1GLV A;  1ZHQ A;  5DAA A;  4CMD A;  3HOW G;  2COG A;  2RGV A;  3KHL A;  2R92 G;  4LH7 A;  4ZQI A;  2Q2U A;  1E4E B;  1WR2 A;  4JV1 A;  2R84 A;  3BAC A;  4ECT A;  2DWC A;  4O7S A;  3K5I A;  3T99 A;  2UVR A;  5KFJ A;  1M6V A;  4DQN A;  4J9R A;  2FMA A;  4DL4 A;  1C3O A;  4LSX A;  1Y1V A;  1CE8 A;  2DAB A;  4FFM A;  4DIM A;  1O75 A;  2VUM A;  3RIZ A;  1VS0 A;  4J9S A;  4YJ3 F;  3CQZ A;  2YZN A;  3K3P A;  2FPI B;  4ECY A;  3UFX B;  1P16 A;  3GTQ A;  1KJJ A;  3PVX A;  3MWE A;  3WO0 A;  4NZO A;  1FJG H;  3AW8 A;  5DLF A;  3SI8 A;  4NZN A;  2I80 A;  5LYJ F;  5KT5 A;  3EYY A;  2C2R A;  4A3K G;  2CFM A;  3R5F A;  2UVU A;  1ZAU A;  3OUZ A;  4ED2 A;  1B6R A;  5KFS A;  4PZ6 A;  3T9A A;  3MR2 A;  3KTM A;  4O7N A;  1JDB B;  3T9B A;  1Y1W G;  5KFH A;  4IZO A;  4YQW A;  2DPI A;  2UUB H;  4G3I A;  3HOZ G;  2GQR A;  4IRD A;  2COI A;  5CB4 F;  2A1H A;  1RK5 A;  4UFZ A;  1EZ1 A;  3RUP A;  4F4X A;  4Q0Y A;  3TQT A;  5FLX W;  4DL7 A;  2AGQ A;  2W9B A;  1GYF A;  5IYZ F;  2AU0 A;  2W9A A;  4RNM A;  1AUV A;  3FKI G;  3DF7 A;  3M4I A;  3LWB A;  4M7E A;  5LMN H;  3JRX A;  4PBC A;  1A3G A;  2UXD H;  2VR1 A;  1AN7 A;  5BWU A;  1KC7 A;  3KRE A;  2R8J A;  4JUZ A;  4JI3 H;  2NU7 B;  2W6M A;  3ORR A;  5KFB A;  2ZDG A;  4UUG A;  5IYD G;  4O3R A;  3KAK A;  5DGA A;  3GTG A;  5KFD A;  1IOW A;  3FDS A;  4RAY A;  3N42 B;  2JEI A;  2C28 A;  3H4D A;  1S0O A;  4JI0 H;  4FE2 A;  2ABJ A;  2Z02 A;  3H40 A;  2FPG B;  5K2M A;  2C22 A;  3BQ1 A;  1I1L A;  3U54 A;  4ECS A;  2W7P A;  3PW2 A;  3GJX B;  4XYM B;  3HKZ E;  5CM0 A;  5F9N A;  3T5J A;  4LF8 H;  5CA0 F;  1DGS A;  4ECV A;  1J5E H;  3F8N A;  5I47 A;  2WE6 A;  2CNV A;  2WYO A;  5C1O A;  3H4B A;  4UCO A;  3VMM A;  2XD4 A;  3UZB A;  4A3E G;  1T94 A;  4FGR A;  4RNO A;  3PW4 A;  2W9C B;  1JDE A;  3VNN A;  4F50 A;  1T3N A;  4MTD A;  1WSC A;  2FLN A;  2R7N A;  2R87 A;  3T9F A;  2YCH A;  3LML A;  5I5Y A;  3TY8 A;  1FVI A;  1EUD B;  4R8U A;  4JI1 H;  2RDI A;  4X64 H;  3L4K A;  4J9K A;  4O84 A;  4QWB A;  2J9G A;  5DQI A;  2IBK A;  2R8H A;  5KKN B;  3RGZ A;  3HOX G;  2ZGI A;  3JSN A;  5D1O B;  4CC6 A;  2Q2T A;  1I7N A;  5KG0 A;  1ULZ A;  3R5X A;  1BNC A;  4EBC A;  3T5H A;  1I2K A;  3MR3 A;  4E4T A;  5FNV F;  1V9P A;  4AYB A;  4J0M A;  4O3O A;  5KFP A;  2E5L H;  1UNN C;  5F9L A;  5I5S A;  4TVI A;  3SNO A;  4R7R A;  3R23 A;  2W6P A;  2W9B B;  4MV4 A;  4UCV A;  4YHH H;  2W7O A;  5KFG A;  2PVP A;  4B3M H;  2DPJ A;  1TAE A;  3I12 A;  4CE5 A;  5JQW A;  4ED0 A;  3DTF A;  1TWG A;  2P0A A;  5D1P A;  4DRF A;  2HDK A;  1SFO A;  2GPS A;  4EEY A;  4RB1 A;  5DQG A;  5IYC G;  5A2Q W;  5E25 A;  5KX5 F;  1S68 A;  1WRV A;  4TQS A;  3V6K A;  5JQG F;  2JA6 A;  1L2Z A;  4QW9 A;  4ECZ A;  3MWD A;  3KHH A;  4RZR A;  3QFF A;  2R82 A;  3KAL A;  2NVY A;  4F4Z A;  4F4W A;  2VUG A;  2W70 A;  3UYY A;  3GTK A;  4YAJ B;  2RGR A;  2XGP A;  2XGQ A;  2YS7 A;  4YB8 B;  2HHF B;  3Q2O A;  5BMV F;  1S9F A;  4O82 A;  4BBR G;  3QQM A;  4X65 H;  3OUU A;  5GON F;  5BWX A;  4CMF A;  4A2A A;  1B04 A;  2V58 A;  5KT7 A;  5BWR A;  2YRW A;  4L1K A;  4DL3 A;  2JA6 G;  1KJ8 A;  1FKA H;  4FFR A;  3Q8Q B;  4J9O A;  2B63 A;  3T5K A;  3GIQ A;  4MTE A;  3RB3 A;  4I7H A;  3PO3 G;  4LFB H;  4RB2 C;  3BG5 A;  4RU9 A;  2NU6 B;  5K3W A;  3VA7 A;  4EFE A;  3R5H A;  4EEQ A;  3CEB A;  2W6Z A;  5FPR A;  2KSW A;  2MCT A;  3TII A;  4RB0 A;  4ETS A;  4O3S A;  4Q8E A;  2E2I A;  5KFU A;  3DTG A;  2XCA A;  3T54 A;  1N32 H;  1W93 A;  4MA0 A;  4DLK A;  2GQS A;  4O7Z A;  3OTO H;  3PN1 A;  3OHA A;  4EGJ A;  2EJ3 A;  4RZQ A;  4DL2 A;  1M0T A;  3PZP A;  4O2A F;  3SE7 A;  3VOT A;  1A9X A;  4MV3 A;  3NGD A;  5KG3 A;  1R9T A;  4LF7 H;  4Q4D A;  5KFM A;  4MV9 A;  4O7V A;  3ORQ A;  3N44 B;  4DV0 H;  3HOV G;  2R8I A;  3SGI A;  4F4Y A;  2HIV A;  5C3E G;  4J9P A;  3W1G A;  4JV2 A;  4BBS G;  2BR0 A;  3JZF A;  5KT3 A;  4DV6 H;  3V6J A;  3WNZ A;  1EKP A;  3MJF A;  5BWT A;  3N40 P;  3PO2 G;  4HN2 A;  2W6O A;  4TQR A;  5KFZ A;  3BA8 A;  5I5V A;  4BY7 G;  4M0J A;  5KFW A;  1A0I A;  2W8L A;  5L1L A;  4DR4 H;  4I55 F;  4XX0 B;  1DV2 A;  2PBZ A;  1S10 A;  1GSH A;  4O7R A;  1GGO A;  4AYB E;  4TV9 F;  1PX2 A;  5FD5 A;  3GTP A;  1N33 H;  3HBL A;  5KFR A;  4A3C G;  4BY1 G;  1GSA A;  3K3V A;  3NBY B;  3W1B A;  5IT9 W;  4FS2 A;  2PN1 A;  2E2H A;  4PZ8 A;  5I5X A;  1A0G A;  1N56 A;  2JEG A;  5DMX A;  1TWC A;  2YZL A;  3GIJ A;  4ED6 A;  4O7T A;  4O4H F;  5LP6 F;  3IG0 A;  5L9X A;  2AQ4 A;  2NUA B;  2IP4 A;  1N34 H;  3BQ2 A;  4LF9 H;  3IN5 A;  1IBM H;  2Z04 A;  5H80 A;  1HR0 H;  2Y0S E;  4A3I G;  2UVV A;  4JXU A;  4GKK H;  4NLG A;  4EYI B;  4FM9 A;  1TWA A;  3EPG A;  4XZ3 B;  5KFK A;  2W6Q A;  4A3F G;  3N6R A;  4O3N A;  2XC9 A;  3GV5 B;  3GTL A;  3RAX A;  4LFA H;  3GTM A;  5KT2 A;  3RJ0 A;  1TA8 A;  3LP8 A;  5KFF A;  2CW8 A;  5L1I A;  4O83 A;  4DUZ H;  2FJZ A;  2FKL A;  3J7A K;  2EJ2 A;  3GDE A;  3C0F B;  4CKB A;  2R92 A;  2J6S A;  4JI4 H;  1JX4 A;  2W8K A;  5C8Y F;  1WCM G;  2I8C A;  3T7A A;  4IRK A;  5KFE A;  1KTA A;  1I3Q A;  3MR6 A;  1XDN A;  3I4M G;  4GC7 A;  1RJQ A;  3T9E A;  4O4I F;  4JI2 H;  1XMO H;  4JYA H;  2UXC H;  3TQ1 A;  4I50 F;  1S97 A;  4DL6 A;  3PW0 A;  3QZ8 A;  3GII A;  2YZG A;  2I87 A;  1IYE A;  1EKF A;  1BGW A;  1JXL A;  2C2D A;  4ECX A;  1Z2N X;  4FFO A;  4LF5 H;  3GTO A;  4C5A A;  1K1Q A;  2XCP A;  2HGW A;  4OX9 H;  2JA7 G;  1JKJ B;  2M05 A;  4HR7 A;  4RAZ A;  2HVS A;  2BQU A;  2YRX A;  3RTX A;  4C5B A;  1SEI A;  3WO1 A;  5KT6 A;  4HYK A;  5IP9 G;  2VUM G;  1Y1V G;  2J6T A;  2QF7 A;  4EBD A;  1UC8 A;  3K5H A;  4NYE A;  4ZI7 F;  4DUY H;  3KHG A;  5LA6 F;  4LMY A;  2V5A A;  1HNX H;  3EPI A;  4QIW E;  4RB3 C;  1CQJ B;  2VPQ A;  3JSL A;  4ECU A;  4ECQ A;  3RBE A;  1VAJ A;  5L1K A;  1S0N A;  5IP7 G;  4A3D G;  3CVZ A;  1I7L A;  3KXY T;  2ASL A;  5FJ8 G;  5EWG A;  5BYA A;  5IYB G;  3GID A;  2ZM6 H;  2ATL A;  3M9O B;  1ET0 A;  2Y4R A;  4FFL A;  4R8U B;  2WAQ A;  4IR1 A;  2J6U A;  2COJ A;  4FS1 A;  5KG6 A;  5KG7 A;  2R8K A;  5DGH A;  2ALZ A;  5CAE B;  4DL5 A;  3T1Y H;  5J2T F;  2Y0S A;  2VOB A;  2FP4 B;  4DR1 H;  2BQR A;  4JV5 H;  4A93 G;  4MV7 A;  5KG1 A;  4O7W A;  2R93 G;  4LF6 H;  1ZHS A;  3T5L A;  4DV5 H;  2NU9 B;  2RDJ A;  4QJF A;  3UZO A;  5BWV A;  1M0W A;  2WDT A;  4A3B G;  5T14 A;  5CA1 F;  1G2W A;  5FD6 A;  2FLL A;  3GLK A;  4C2M A;  4HNT A;  4BWS C;  2JEJ A;  2HGX A;  2JA5 G;  2R8G A;  1XNQ H;  4O4L F;  2HHH H;  5KG4 A;  4PZ7 A;  5KFT A;  1WCM A;  2DZD A;  2FB9 A;  4EG0 A;  4JV0 A;  4FFN A;  1RJP A;  3U9S A;  2F4V H;  1OBD A;  4Q4C A;  4DR7 H;  2HGS A;  3TEK A;  3N43 B;  3QWU A;  4K0K H;  3RBD A;  1IOV A;  4QWC A;  1IBK H;  3PR4 A;  3RF2 A;  4O7L A;  4YAK B;  3JAM W;  3HB9 A;  3WWH A;  2CQY A;  3MFI A;  4J9N A;  4B3R H;  1EHI A;  4HNU A;  1MZB A;  2W71 A;  4QWA A;  2JA7 A;  4TM5 A;  4RCN A;  1N48 A;  4TUY F;  3TY5 A;  3N41 B;  2HIX A;  1CQI B;  4EQ5 A;  3J80 W;  4ZHQ F;  2SCU B;  1CKN A;  4MV1 A;  5FPO A;  5FLM G;  1CS0 A;  3RGX A;  5EDW A;  5D1O A;  4Q44 A;  1KBL A; 
#chains in the Genus database with same CATH homology
 3RV3 A;  3ETH A;  2R86 A;  1SCU B;  2R7L A;  5EZY F;  1UC9 A;  1VBH A;  2DIK A;  5JVL A;  1OBG A;  2YS6 A;  3V4S A;  2V59 A;  1EYZ A;  5HV6 A;  1KJI A;  4MAM A;  4IIJ F;  4O81 A;  2X0S A;  3R9R A;  3E5N A;  1W96 A;  4XYL B;  5C1P A;  4MV6 A;  4WD3 A;  4QSH A;  3RV4 A;  1BXR A;  2YZM A;  2OLS A;  2R6F A;  4I4T F;  3VPD A;  4MA5 A;  3Q1K A;  5BPH A;  3TIN A;  1AUX A;  2YW2 A;  1C30 A;  1PK8 A;  3TW6 A;  4FFP A;  4WBN F;  2CNU A;  2GPW A;  2CZG A;  4HQ6 A;  5LXT F;  3HO8 A;  1GSO A;  4O2B F;  1EUC B;  3ETJ A;  1VBG A;  3NUA A;  5JVD F;  2W6N A;  1KJQ A;  2R7M A;  3JRW A;  2R7K A;  1DV1 A;  1KUT A;  2DLN A;  2ZDQ A;  4IWY A;  3N8D A;  4Y8V B;  3JZI A;  2GLT A;  2YWV A;  2VQD A;  1KEE A;  2FPP B;  4O86 A;  3G8C A;  5HBR B;  3V4Z A;  5BPF A;  5J2U F;  2YL2 A;  3RFC A;  4YBZ B;  2ZDH A;  3AX6 A;  1B6S A;  1E4E A;  3VPB A;  1JLL B;  4O4J F;  4MV8 A;  1Z2O X;  3G8D A;  4FU0 A;  4YJ2 F;  2R85 A;  2CNQ A;  2XCL A;  2NU8 B;  3U55 A;  1T36 A;  5D8D A;  4M9U A;  4ZOL F;  4C5C A;  3VPC A;  5LOV F;  2C00 A;  3U9T A;  3TIG A;  5JH7 F;  2YYA A;  4HNV A;  1KJ9 A;  4IHJ F;  1VKZ A;  1DIK A;  2QK4 A;  4ME6 A;  4TV8 F;  4EGQ A;  1Z2P X;  3KAJ A;  1A48 A;  4O7Y A;  4IWX A;  2HJW A;  1GLV A;  4ZQI A;  1E4E B;  1WR2 A;  2R84 A;  2DWC A;  4O7S A;  3K5I A;  1M6V A;  1C3O A;  1CE8 A;  4FFM A;  4DIM A;  4YJ3 F;  2YZN A;  3K3P A;  2FPI B;  3UFX B;  1KJJ A;  3MWE A;  3WO0 A;  3AW8 A;  2I80 A;  5LYJ F;  3R5F A;  3OUZ A;  1B6R A;  4O7N A;  1JDB B;  4IZO A;  2GQR A;  5CB4 F;  1EZ1 A;  3RUP A;  3TQT A;  5IYZ F;  1AUV A;  3DF7 A;  3LWB A;  3JRX A;  2VR1 A;  1KC7 A;  3KRE A;  2NU7 B;  2W6M A;  3ORR A;  2ZDG A;  3KAK A;  1IOW A;  4FE2 A;  2Z02 A;  2FPG B;  5K2M A;  3U54 A;  4XYM B;  5CA0 F;  5I47 A;  2CNV A;  2WYO A;  5C1O A;  3VMM A;  2XD4 A;  4FGR A;  1JDE A;  2R7N A;  2R87 A;  1EUD B;  4O84 A;  2J9G A;  5KKN B;  1I7N A;  1ULZ A;  3R5X A;  1BNC A;  4E4T A;  5FNV F;  3R23 A;  2W6P A;  4MV4 A;  2PVP A;  5JQW A;  3I12 A;  2P0A A;  2GPS A;  5KX5 F;  5JQG F;  3MWD A;  3QFF A;  2R82 A;  3KAL A;  2W70 A;  4YAJ B;  2YS7 A;  4YB8 B;  5BMV F;  3Q2O A;  4O82 A;  3OUU A;  5GON F;  2V58 A;  2YRW A;  4L1K A;  1KJ8 A;  4FFR A;  3BG5 A;  3VA7 A;  2NU6 B;  3R5H A;  2W6Z A;  3TII A;  1W93 A;  4MA0 A;  4DLK A;  2GQS A;  4O7Z A;  4EGJ A;  4RZQ A;  1M0T A;  4O2A F;  3SE7 A;  3VOT A;  1A9X A;  4MV3 A;  4MV9 A;  4O7V A;  3ORQ A;  3JZF A;  3WNZ A;  3MJF A;  2W6O A;  4I55 F;  4XX0 B;  1DV2 A;  2PBZ A;  1GSH A;  4O7R A;  1GGO A;  4TV9 F;  1PX2 A;  3HBL A;  1GSA A;  2PN1 A;  5DMX A;  2YZL A;  4O7T A;  4O4H F;  5LP6 F;  2NUA B;  2IP4 A;  2Z04 A;  5H80 A;  4XZ3 B;  2W6Q A;  3N6R A;  3LP8 A;  4O83 A;  5C8Y F;  2I8C A;  4O4I F;  4I50 F;  2YZG A;  2I87 A;  1Z2N X;  4FFO A;  4C5A A;  1JKJ B;  4HR7 A;  2YRX A;  4C5B A;  3WO1 A;  2QF7 A;  1UC8 A;  3K5H A;  4NYE A;  4ZI7 F;  5LA6 F;  2V5A A;  1CQJ B;  2VPQ A;  1I7L A;  3GID A;  4FFL A;  5CAE B;  5J2T F;  2FP4 B;  4MV7 A;  4O7W A;  2NU9 B;  1M0W A;  5CA1 F;  3GLK A;  4HNT A;  4O4L F;  2DZD A;  2FB9 A;  4EG0 A;  4FFN A;  3U9S A;  1OBD A;  2HGS A;  1IOV A;  4O7L A;  4YAK B;  3HB9 A;  2CQY A;  1EHI A;  4HNU A;  2W71 A;  4TUY F;  1CQI B;  4ZHQ F;  2SCU B;  4MV1 A;  1CS0 A;  1KBL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...