4YBZB

Ca. korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 in complex with adp and with phosphorylated phosphohistidine segment (site i orientation)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
229
structure length
229
Chain Sequence
SSRDLLLKAKENGRKSLLEHEAKYFISSYGIPVTNIRLAKSEEEAVNFSREIGFPVVLKIVSPQVVHKSDVGGVKVNLRSEEEVRKAYREIIENVKRNVPNAEIEGILVQEFAPPGVELIIGLLRDPQFGPTVMFGLGGVFVELFRDVSFRVAPLSEQDAESMIKEVKAYKLLTGFRGMEPVDIEAIKDALIRAGRIGVENEEIAEMDLNPVIAYPKGIKVVDARIILR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha subunit of Acyl-CoA synthetase (NDP forming)
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Korarchaeum cryptofilum (strain opf8)
molecule tags Ligase
total genus 64
structure length 229
sequence length 229
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13549 ATP-grasp_5 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4ybzB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4ybzB02
2YS7A 2W6NA 5J2UF 1A48A 1KC7A 2GQSA 4C5CA 2YWVA 2R84A 4O82A 4Y8VB 1W93A 2YZGA 2FPIB 3AW8A 2VPQA 1A9XA 1JLLB 3RV4A 3VPCA 5EZYF 4YB8B 5LA6F 2IP4A 2QK4A 4ZI7F 5J2TF 2R7KA 4O7WA 4IWXA 2YZNA 2CNQA 1KEEA 1Z2OX 4FGRA 4XYMB 4MV4A 2I80A 2DLNA 3U9SA 2FPPB 2W6QA 3HBLA 1I7NA 5CB4F 2CNVA 1OBDA 2DZDA 3JRXA 3KAJA 3E5NA 5HV6A 2XCLA 4WD3A 3DF7A 3ETHA 3OUZA 2W70A 3TINA 2DIKA 4IZOA 3GLKA 3Q1KA 2FB9A 1JDBB 1KUTA 1M6VA 2ZDQA 3R9RA 1ULZA 3HO8A 4FFPA 1UC9A 4IIJF 3R5FA 3Q2OA 3R5HA 4L1KA 4O7RA 4TV8F 2R87A 1Z2PX 3VMMA 4MAMA 4O81A 2GPWA 2NU6B 1KJ8A 4YAKB 4I55F 4YBZB 3QFFA 1C3OA 4FU0A 2YZLA 2ZDGA 1CQJB 3RUPA 2V5AA 2W71A 1B6RA 1OBGA 2QF7A 1KJ9A 1DV1A 4DIMA 2R7NA 4I4TF 5IYZF 5D8DA 5C1PA 2NU7B 2R7MA 4HR7A 3R5XA 4MV3A 4MA5A 1I7LA 2CQYA 3U55A 3JZIA 4TUYF 2DWCA 3WO1A 3KAKA 4HQ6A 2YW2A 3RV3A 1BXRA 1JKJB 1CE8A 1PX2A 4HNTA 1CS0A 2W6ZA 1GGOA 5H80A 2R85A 2ZDHA 2J9GA 3UFXB 3KALA 1PK8A 5I47A 3WO0A 3MJFA 5BPFA 1IOVA 2PBZA 1M0WA 4XX0B 3MWEA 3U9TA 3KREA 2YZMA 2P0AA 2R82A 3VOTA 4YJ3F 2W6OA 2V59A 3N8DA 4WBNF 1EZ1A 4M9UA 4MV7A 5CA1F 1GSAA 4YJ2F 4O4HF 2YYAA 3K3PA 3HB9A 4O7VA 2NU9B 2SCUB 4YAJB 4ZOLF 2WYOA 4FE2A 4I50F 1WR2A 4E4TA 3VPDA 3V4SA 4O7YA 2FPGB 4MV8A 5JVLA 1B6SA 2R6FA 3G8CA 2C00A 4C5AA 2Z04A 3ORRA 1VBGA 5FNVF 2YL2A 4O4LF 4MA0A 1E4EB 2W6PA 3LWBA 4QSHA 1KJJA 3G8DA 3MWDA 2GPSA 1KBLA 5LP6F 2V58A 2PN1A 4ZHQF 3GIDA 1KJQA 1EUDB 4RZQA 4TV9F 1CQIB 2VQDA 4ZQIA 5DMXA 1W96A 4EG0A 1GSOA 5JQGF 3I12A 4O84A 1KJIA 3N6RA 5LXTF 4DLKA 3JZFA 5C8YF 2YS6A 3VA7A 4FFOA 1EYZA 1EUCB 3TW6A 3LP8A 4MV6A 5C1OA 4O7TA 1M0TA 3V4ZA 5CAEB 1Z2NX 4EGJA 3SE7A 4O4JF 3VPBA 4IHJF 2PVPA 3ETJA 2I8CA 2VR1A 5KX5F 1AUXA 3K5HA 2X0SA 4HNVA 1EHIA 3TIGA 5LYJF 5K2MA 1T36A 5LOVF 3R23A 1DV2A 3AX6A 3NUAA 5GONF 5JVDF 2YRWA 4IWYA 2XD4A 4MV9A 5HBRB 2OLSA 4FFLA 4FFNA 3WNZA 1AUVA 4FFMA 2HJWA 2Z02A 5BMVF 4MV1A 1E4EA 1JDEA 1VBHA 4O83A 2FP4B 3U54A 1BNCA 2GLTA 5JQWA 4O7NA 1C30A 2CNUA 4O2BF 4NYEA 4O7LA 2GQRA 4O7ZA 3TIIA 1GLVA 4C5BA 4O4IF 4EGQA 4ME6A 1UC8A 3ORQA 5JH7F 3JRWA 4O86A 1IOWA 4FFRA 2R86A 5CA0F 2R7LA 1GSHA 3OUUA 2W6MA 2I87A 3RFCA 4XZ3B 4HNUA 3TQTA 2NU8B 1VKZA 2NUAB 3K5IA 5BPHA 1DIKA 2YRXA 4O2AF 2HGSA 2CZGA 3BG5A 1SCUB 4XYLB 5KKNB 4O7SA
chains in the Genus database with same CATH superfamily
4JV1A 4EFEA 2AGQA 2ZM6H 3T5KA 4PZ8A 5DQHA 5DLGA 2JEJA 2YS7A 3OSNA 3H4DA 3M9NB 2HIXA 2HVSA 5KT3A 1ZETA 1A0GA 2IMWP 2W6NA 5J2UF 1RJRA 3NGDA 1FVIA 1HR0H 1A48A 1KC7A 2WB1A 5FPRA 2GQSA 1X9NA 4C5CA 2HG8A 2YWVA 5KFAA 2R84A 4O82A 5KFFA 3G6VA 2ASLA 4AYBA 4Y8VB 4ECXA 4DV7H 1XMQH 1S0OA 3GTJA 1DAAA 3T7AA 4IR9A 1W93A 4EBDA 4UCTA 2YZGA 2FPIB 3TY9A 5KFXA 3AW8A 2RF4A 5KFQA 2VPQA 3Q8QB 2W7OA 1A9XA 4LF4H 1JLLB 3RV4A 3VPCA 4RAYA 2W9CA 4ECRA 5EZYF 5DGAA 4YB8B 5BWWA 1Y1VG 4RB2C 2W9BA 4JV0A 2NVYA 3M4IA 2J6SA 5EWFA 3TQ1A 5KFLA 5IP9G 5LA6F 4DL2A 2IP4A 4A3CG 2QK4A 1B04A 4ZI7F 5J2TF 2OWOA 5KT5A 3H3VH 3PO3G 3RTXA 2R7KA 4TVIA 4QWAA 4O7WA 4RZRA 2BQRA 1CKNA 4IWXA 4JI3H 3T9EA 4APMA 5L1IA 3TY8A 2YZNA 4DV5H 3GTKA 5LL6b 2CNQA 1I50A 5DGHA 1KEEA 2XIGA 4YR3A 2UXCH 2QYZA 4DV4H 2ABJA 5T14A 1S9FA 1TWAA 4LF5H 5LMUH 4J9PA 3RJ0A 1Z2OX 4A2BA 4FS2A 4FGRA 2V4QA 4A3BG 4XYMB 4A3DG 4MV4A 2DABA 4ECVA 2JA7G 4QJFA 2I80A 2JA6G 2W9CB 1I3QA 5KFIA 2YCHA 3GIPA 5IYBG 4A3FG 4FBUA 4ECWA 2DLNA 1V51A 1Y1WG 5BWRA 3M9MB 5KG5A 3U9SA 1BGWA 2FPPB 2W9BB 2RGVA 2W6QA 3HBLA 5D1OB 2Q2UA 1I7NA 4YHHH 4J9MA 3PO2G 2J6TA 4LMYA 4JI6H 5CB4F 3N42B 5EWGA 3QZ8A 2BR0A 2CNVA 3KXYT 2R7ZG 4JYAH 1OBDA 2DZDA 4FM9A 2WE6A 1G2WA 3TEKA 2FLLA 4EEYA 3VNNA 2C2RA 2B63G 3HOZG 4R8UA 2HHHH 3JRXA 3F8NA 4JUZA 1R9TA 3KAJA 4TQSA 5F9NA 3K3VA 3E5NA 3H20A 3T5HA 5KG1A 4DUZH 4DL4A 4F4XA 3KHGA 3V6KA 2JA8G 3DTFA 5HV6A 2XCLA 1I1KA 4WD3A 3DF7A 3ETHA 1WSCA 4IRCA 2FKLA 3OUZA 5KFKA 3V6HA 1S03G 5KG7A 2BQ3A 2EJ2A 2W70A 3T54A 3TINA 4F50A 1OWTA 2C2DA 2XCPA 4QWDA 4Q4CA 5C4XG 2DIKA 4Q8FA 4IZOA 3Q8PB 4JI8H 3GLKA 3Q1KA 2CW8A 3G6XA 2FB9A 1JDBB 1KUTA 1ZHSA 3FKIA 4R7RA 1M6VA 2ZDQA 2RDIA 4DV2H 3R9RA 1ULZA 4CKBA 2V9WA 3HO8A 4FFPA 1UC9A 4IIJF 3PW2A 3R5FA 3NC0B 3W1BA 3FKIG 3Q2OA 2E5LH 3GIMA 3R5HA 3PR5B 4L1KA 2AQ4A 1N33H 4O7RA 1SEIA 2VQFH 3OSPA 5BWVA 1XDNA 4TV8F 2R87A 1FJGH 3SGIA 1EKFA 1Z2PX 2EIYA 4ED8A 4DL3A 2A1HA 3PR4A 1S10A 1KTAA 3VMMA 1WCMA 3C0FB 4ED0A 1ZHQA 1XNQH 2CFMA 4MAMA 4A3KG 3GV8B 4O81A 5JUMA 5EDWA 2GPWA 3N6XA 1EKVA 2NU6B 4BY1G 2XC9A 3SNOA 1SFOA 3W5OA 5I5WA 4DV6H 1KJ8A 2OH2A 4ED3A 2F4VH 5DG7A 5EWEA 3DTGA 2WB1E 1P16A 3TY5A 4YAKB 4ECQA 3J80W 3GTLA 4UCVA 2Y0SA 4RUCA 3L4KA 4I55F 1E4GT 1MZBA 4U7CA 1ET0A 4YR2A 3OHBA 3T1YH 4YBZB 3QFFA 2HGWA 1C3OA 4ETSA 4EEQA 4DUYH 2W8LA 4FU0A 2YZLA 2Y4RA 2ZDGA 5L1LA 1CQJB 2UUBH 3GIIA 2NVXA 2VUGA 3RUPA 2VA2A 2V5AA 3FMAA 1RYRA 3BA8A 3RGXA 1HNWH 2W71A 1B6RA 4CKEA 2UUAH 3RIZA 4DV0H 2C22A 1S0NA 2R92G 1OBGA 2QF7A 5I60A 4HN2A 1KJ9A 3CEBA 1DV1A 4DIMA 2UU9H 2R7NA 3KHRA 3JSNA 4I4TF 4UCRA 5IYZF 2MCTA 5FJ8G 4FS1A 1I2LA 4LFBH 4B3RH 5D8DA 5C1PA 2NU7B 2R7MA 3HKZA 5KT7A 4DQNA 3MR5A 1EKPA 4HR7A 3U0GA 3R5XA 2WAQE 3RBDA 1RYSA 3BQ2A 4GLWA 3H4BA 4MV3A 1S0MA 4Q45A 3RB4A 4MA5A 2X5RA 1TAEA 4DR5H 3BAAA 5DAAA 1I7LA 1GYFA 5D1PA 2HDKA 2CQYA 3RAXA 5BYBA 3U55A 3UZOA 4FBTA 4BBSG 3JZIA 4TUYF 3S24A 1M7JA 3L4JA 2DWCA 2UVRA 4F4WA 2ASDA 3WO1A 3KAKA 4HQ6A 2YW2A 4RAZA 5D1OA 4DR1H 3RV3A 5KFVA 5FLMG 1BXRA 1RK5A 3IG0A 4EYIB 4O3SA 5IYDG 2ODTX 4BBRG 4I7HA 3T1HH 4QIWA 1JKJB 1CE8A 1PX2A 4HNTA 5KFMA 1O75A 2AU0A 3M9OB 1JIHA 3LMLA 2C35B 3GIJA 4J9NA 1CS0A 2W6ZA 1GGOA 4PZ7A 4CC5A 1I1MA 3KYHC 5H80A 2R85A 3PVXA 3IN5A 1HNXH 5E25A 3HOYG 2COGA 2J9GA 2ZDHA 3UFXB 3KALA 3RB0A 1HNZH 1PK8A 3I4NG 2UXBH 2Q2TA 4GC6A 5I47A 1GO3E 3WO0A 3I4MG 2QB5A 4JXUA 3UZBA 5KFYA 2BQUA 4JI0H 3RR5A 3MJFA 1VAJA 4J9LA 1RJPA 5KT2A 4K0KH 1VS0A 2PMZE 3T9CA 1KT8A 1IOVA 2PBZA 5BPFA 3KTMA 5I5SA 1M0WA 5F9LA 4XX0B 1N36H 3MWEA 1J5EH 3W1GA 4PWQA 4O3PA 4QWEA 3U9TA 3KREA 2YZMA 2JEIA 2P0AA 2R82A 3VOTA 4YJ3F 3HXLA 2W6OA 5C3EG 3RB3A 1L2ZA 2V59A 5IT9W 3N8DA 5BWUA 5KFDA 3G6YA 4WBNF 3NBYB 3JSLA 2FJZA 4JI2H 3BQ1A 1EZ1A 4M9UA 4MV7A 3JZ6A 4UCOA 2W8KA 4CMFA 3HOXG 5CA1F 3PW4A 3GTGA 1GSAA 4YJ2F 3PW5A 4O4HF 4A3GG 3QWUA 3N40P 3GV7B 4X65H 2YYAA 2VUMA 3AYHB 3L2PA 1I94H 2E2IA 2J6UA 3SI8A 3LQSA 3K3PA 3HB9A 5CE8A 4O7VA 5DG8A 1IBLH 4IAJA 4HYKA 2NU9B 5FR9A 2VUMG 2SCUB 4UCSA 4A93G 4YAJB 4ED2A 4YR0A 4ZOLF 4DR7H 2WYOA 1TWGA 4RCNA 4FE2A 4I50F 5I5XA 3LULA 2Y0SE 4DL6A 1JXLA 2HHFB 2JA5A 4WHXA 5CM0A 1WR2A 4E4TA 4X62H 2IA6A 4ECUA 3VPDA 3QQMA 4DR3H 4LSXA 1AN7A 1DGSA 4NZMA 1I2KA 4O7YA 3V4SA 4YY3H 2FPGB 4MV8A 5KFHA 3PW0A 5JVLA 2C28A 1B6SA 2R8IA 2R6FA 3JAMW 3G8CA 2Q7DA 3CQZA 4RNNA 2R8HA 4ED6A 4Q8EA 2DAAA 4JI7H 3WWHA 4DR4H 4LFAH 2C00A 4C5AA 4DV3H 1RK6A 2EJ3A 5DQIA 5KT4A 4A3MG 1SYXB 2Z04A 1WCMG 5A2QW 3ORRA 3RGZA 1VBGA 5KG2A 2XCAA 3GB8B 3GIQA 4OX9H 1K1QA 4UCUA 1Y14B 4F4ZA 4ECYA 1TA8A 3MFIA 4Q4DA 5DLFA 4J9RA 4BY7G 4BXXG 4EFBA 4AYBE 5K3WA 2KSWA 5FNVF 1ZQ7A 2VOBA 4J9OA 4PZ6A 5CR5A 5DISC 2W57A 3H0GA 5FPOA 3J81W 4EBCA 4B3TH 5KFRA 4O3RA 2YL2A 4O4LF 4Q44A 4MA0A 2JEGA 2UVWA 1E4EB 2W6PA 4LH6A 5KFUA 5DG9A 4QW9A 4C2MA 3GV5B 4A3JG 3BABA 4A2AA 3LWBA 1TWCA 5KFGA 4QSHA 4PDBA 4JI1H 3CSWA 1KJJA 4BWSC 3PN1A 2R8JA 3G8DA 3T9FA 2COIA 5LMNH 4QWCA 3RF2A 5C5JA 4RU9A 3MWDA 2GPSA 1KBLA 4QIWE 4A3EG 4DR6H 2JEFA 2O03A 3HOVG 3HOUG 1V4YA 1P8LA 5LP6F 2V58A 2PN1A 4ZHQF 3N44B 5KFTA 4JV2A 3GIDA 1KJQA 1N32H 1A0IA 3T9AA 2UVUA 5DGBA 3H40A 5IP7G 2ASJA 1EUDB 4B3SH 4RZQA 4TV9F 4DRFA 1T94A 4J9QA 1CQIB 2VQDA 4GKJH 1BJTA 2M05A 4ZQIA 4NLGA 1K1SA 5DMXA 4DL5A 4M0JA 5BR8H 1W96A 2R8GA 4CHIA 4LF7H 4MTDA 4EG0A 2HVRA 1GSOA 5JQGF 3I12A 4O84A 1KJIA 3N6RA 5KG4A 1N34H 5LXTF 4DLKA 4PBCA 3OHAA 3JZFA 4JI5H 3BACA 5C8YF 4RNMA 2YS6A 3N41B 5KFCA 3VA7A 2FLPA 3GIKA 4FFOA 1IYEA 2FMAA 1EYZA 1EUCB 5I5UA 4RB3C 5KFZA 2XGPA 5I5VA 3TW6A 5IYCG 4AQYH 3LP8A 4MV6A 4QWBA 2HIVA 4ED1A 4LFCH 4O3NA 5KFWA 1Y1VA 4RB0A 3RB6A 4JV5H 5C1OA 1CKOA 4CC6A 4K6NA 4YP3A 4O7TA 3WWJA 3EYYA 4DR2H 1M0TA 3V6JA 5KFEA 3MFHA 1N56A 2EJ0A 5DGIA 4GKKH 1N48A 3V4ZA 2UVVA 2AGPA 5CAEB 1Z2NX 4EGJA 5KFSA 3SE7A 4GLXA 2C2EA 5FLXW 4O4JF 3VPBA 5HNEA 4IHJF 3MWMA 3QZ7A 4IRDA 5KT6A 2PVPA 3KHLA 5KG0A 5L1JA 5FD6A 4RB1A 5L1KA 4JI4H 5KFJA 3ETJA 2I8CA 2VR1A 2WAQA 2ALZA 3T9DA 5KX5F 2FE3A 5EOYA 2HHFA 4U6PA 2W9AA 4LF8H 5L9XA 4ECZA 2JA7A 2JA6A 3T99A 1XK5A 4O3OA 1AUXA 2UUCH 2E2HA 4ECSA 1Y1WA 3K5HA 2X0SA 4M7EA 3DAAA 3CVZA 5C44G 4HNVA 1EHIA 1T3NA 4LSAA 3TIGA 5LYJF 3UYYA 3RBEA 4X66H 5I5YA 3OTOH 5KG6A 5K2MA 3HOWG 3Q8SB 3GTMA 1K83A 1T36A 5LOVF 1V9PA 3R23A 5I5TA 2R7ZA 1DV2A 3AX6A 3UQ8A 1RJQA 4B3MH 2B63A 4RUAA 4UFZA 3NUAA 5GONF 5JVDF 2YRWA 4IWYA 4O3QA 5KFPA 4RNOA 2COJA 4CMDA 2XD4A 4MV9A 1ZAUA 1B33N 4Q0YA 4TQRA 5FD5A 3T5LA 2VA3A 5HBRB 2UXDH 4TM5A 2OLSA 4LF6H 3BQ0A 3PFFA 1CKNB 4FFNA 4FFLA 3WNZA 2CKZB 4YQWA 2XGQA 1FKAH 1AUVA 2RGRA 4FFMA 2HVQA 2HJWA 3FDSA 3EPIA 3T5JA 2Z02A 4NZOA 4EQ5A 5BMVF 4DV1H 4A3LG 4Q43A 4MV1A 1E4EA 5KFOA 4EBEA 4GC7A 4F4YA 2HGXA 1JDEA 4LF9H 1VBHA 2IBKA 4O83A 2FP4B 4NZNA 1BNCA 4UUGA 3U54A 4IRKA 2YU9A 2GLTA 1UNNC 3GDEA 5JQWA 2PMZA 1CKMA 3GJXB 1TWHA 2WDTA 1S68A 4O7NA 1C30A 2CNUA 5KFBA 4O2BF 4QW8A 1WH2A 4LH7A 5DQGA 4ED7A 4NYEA 3NBZB 4O7LA 3MR2A 3PW7A 2GQRA 1JX4A 1I6UA 4O7ZA 3N43B 3TIIA 5KFNA 2DPJA 1GLVA 2RDJA 3HKZE 5BWXA 3RAQA 2W7PA 1A3GA 4C5BA 3HT5A 2JA5G 4O4IF 4J9SA 5BWTA 3GTOA 1XNRH 4EGQA 3BA9A 1UC8A 4ME6A 2FK3A 4R8UB 2FK2A 2AGOA 3ORQA 5JH7F 4J9KA 3JRWA 3BJYA 3KHHA 4DL7A 4O86A 4CE5A 1IOWA 4J0MA 4FFRA 2R86A 3Q8RB 5CA0F 2ZGIA 2R7LA 3T9BA 1GSHA 4E6NA 2VPSA 3OUUA 2W6MA 2I87A 3RFCA 3H0GG 2VQEH 2R93A 4XZ3B 2DPIA 4HNUA 3TQTA 1XMOH 4NXMH 4ECTA 3TW7A 4MTEA 4X64H 3MR3A 2NU8B 3MR6A 1VKZA 2ZJTA 3GTPA 1IBKH 2NUAB 3K5IA 5BPHA 1I1LA 2WTFA 2ATLA 2V4RA 3J7AK 4KHPH 4A3IG 1E4FT 3WWIA 5KS8A 2R93G 1DIKA 2YRXA 1IYDA 2FK1A 5BYAA 4O2AF 4EYHB 5IWAH 4IR1A 2HGSA 2CZGA 2FLNA 3BG5A 4G3IA 3GTQA 3GILA 4NXNH 2R92A 1TWFA 2CW7A 1SCUB 1IBMH 4XYLB 4DAAA 3GQCA 1S97A 2R8KA 3EPGA 5KKNB 4O7SA 5KG3A 3PZPA 4CKCA 1WRVA
chains in the Genus database with same CATH topology
2YS7A 2W6NA 5J2UF 1A48A 1KC7A 2GQSA 4C5CA 2YWVA 2R84A 4O82A 4Y8VB 1W93A 2YZGA 2FPIB 3AW8A 2VPQA 1A9XA 1JLLB 3RV4A 3VPCA 5EZYF 4YB8B 5LA6F 2IP4A 2QK4A 4ZI7F 5J2TF 2R7KA 4O7WA 4IWXA 2YZNA 2CNQA 1KEEA 1Z2OX 4FGRA 4XYMB 4MV4A 2I80A 2DLNA 3U9SA 2FPPB 2W6QA 3HBLA 1I7NA 5CB4F 2CNVA 1OBDA 2DZDA 3JRXA 3KAJA 3E5NA 5HV6A 2XCLA 4WD3A 3DF7A 3ETHA 3OUZA 2W70A 3TINA 2DIKA 4IZOA 3GLKA 3Q1KA 2FB9A 1JDBB 1KUTA 1M6VA 2ZDQA 3R9RA 1ULZA 3HO8A 4FFPA 1UC9A 4IIJF 3R5FA 3Q2OA 3R5HA 4L1KA 4O7RA 4TV8F 2R87A 1Z2PX 3VMMA 4MAMA 4O81A 2GPWA 2NU6B 1KJ8A 4YAKB 4I55F 4YBZB 3QFFA 1C3OA 4FU0A 2YZLA 2ZDGA 1CQJB 3RUPA 2V5AA 2W71A 1B6RA 1OBGA 2QF7A 1KJ9A 1DV1A 4DIMA 2R7NA 4I4TF 5IYZF 5D8DA 5C1PA 2NU7B 2R7MA 4HR7A 3R5XA 4MV3A 4MA5A 1I7LA 2CQYA 3U55A 3JZIA 4TUYF 2DWCA 3WO1A 3KAKA 4HQ6A 2YW2A 3RV3A 1BXRA 1JKJB 1CE8A 1PX2A 4HNTA 1CS0A 2W6ZA 1GGOA 5H80A 2R85A 2ZDHA 2J9GA 3UFXB 3KALA 1PK8A 5I47A 3WO0A 3MJFA 5BPFA 1IOVA 2PBZA 1M0WA 4XX0B 3MWEA 3U9TA 3KREA 2YZMA 2P0AA 2R82A 3VOTA 4YJ3F 2W6OA 2V59A 3N8DA 4WBNF 1EZ1A 4M9UA 4MV7A 5CA1F 1GSAA 4YJ2F 4O4HF 2YYAA 3K3PA 3HB9A 4O7VA 2NU9B 2SCUB 4YAJB 4ZOLF 2WYOA 4FE2A 4I50F 1WR2A 4E4TA 3VPDA 3V4SA 4O7YA 2FPGB 4MV8A 5JVLA 1B6SA 2R6FA 3G8CA 2C00A 4C5AA 2Z04A 3ORRA 1VBGA 5FNVF 2YL2A 4O4LF 4MA0A 1E4EB 2W6PA 3LWBA 4QSHA 1KJJA 3G8DA 3MWDA 2GPSA 1KBLA 5LP6F 2V58A 2PN1A 4ZHQF 3GIDA 1KJQA 1EUDB 4RZQA 4TV9F 1CQIB 2VQDA 4ZQIA 5DMXA 1W96A 4EG0A 1GSOA 5JQGF 3I12A 4O84A 1KJIA 3N6RA 5LXTF 4DLKA 3JZFA 5C8YF 2YS6A 3VA7A 4FFOA 1EYZA 1EUCB 3TW6A 3LP8A 4MV6A 5C1OA 4O7TA 1M0TA 3V4ZA 5CAEB 1Z2NX 4EGJA 3SE7A 4O4JF 3VPBA 4IHJF 2PVPA 3ETJA 2I8CA 2VR1A 5KX5F 1AUXA 3K5HA 2X0SA 4HNVA 1EHIA 3TIGA 5LYJF 5K2MA 1T36A 5LOVF 3R23A 1DV2A 3AX6A 3NUAA 5GONF 5JVDF 2YRWA 4IWYA 2XD4A 4MV9A 5HBRB 2OLSA 4FFLA 4FFNA 3WNZA 1AUVA 4FFMA 2HJWA 2Z02A 5BMVF 4MV1A 1E4EA 1JDEA 1VBHA 4O83A 2FP4B 3U54A 1BNCA 2GLTA 5JQWA 4O7NA 1C30A 2CNUA 4O2BF 4NYEA 4O7LA 2GQRA 4O7ZA 3TIIA 1GLVA 4C5BA 4O4IF 4EGQA 4ME6A 1UC8A 3ORQA 5JH7F 3JRWA 4O86A 1IOWA 4FFRA 2R86A 5CA0F 2R7LA 1GSHA 3OUUA 2W6MA 2I87A 3RFCA 4XZ3B 4HNUA 3TQTA 2NU8B 1VKZA 2NUAB 3K5IA 5BPHA 1DIKA 2YRXA 4O2AF 2HGSA 2CZGA 3BG5A 1SCUB 4XYLB 5KKNB 4O7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YS7 A;  2W6N A;  5J2U F;  1A48 A;  1KC7 A;  2GQS A;  4C5C A;  2YWV A;  2R84 A;  4O82 A;  4Y8V B;  1W93 A;  2YZG A;  2FPI B;  3AW8 A;  2VPQ A;  1A9X A;  1JLL B;  3RV4 A;  3VPC A;  5EZY F;  4YB8 B;  5LA6 F;  2IP4 A;  2QK4 A;  4ZI7 F;  5J2T F;  2R7K A;  4O7W A;  4IWX A;  2YZN A;  2CNQ A;  1KEE A;  1Z2O X;  4FGR A;  4XYM B;  4MV4 A;  2I80 A;  2DLN A;  3U9S A;  2FPP B;  2W6Q A;  3HBL A;  1I7N A;  5CB4 F;  2CNV A;  1OBD A;  2DZD A;  3JRX A;  3KAJ A;  3E5N A;  5HV6 A;  2XCL A;  4WD3 A;  3DF7 A;  3ETH A;  3OUZ A;  2W70 A;  3TIN A;  2DIK A;  4IZO A;  3GLK A;  3Q1K A;  2FB9 A;  1JDB B;  1KUT A;  1M6V A;  2ZDQ A;  3R9R A;  1ULZ A;  3HO8 A;  4FFP A;  1UC9 A;  4IIJ F;  3R5F A;  3Q2O A;  3R5H A;  4L1K A;  4O7R A;  4TV8 F;  2R87 A;  1Z2P X;  3VMM A;  4MAM A;  4O81 A;  2GPW A;  2NU6 B;  1KJ8 A;  4YAK B;  4I55 F;  4YBZ B;  3QFF A;  1C3O A;  4FU0 A;  2YZL A;  2ZDG A;  1CQJ B;  3RUP A;  2V5A A;  2W71 A;  1B6R A;  1OBG A;  2QF7 A;  1KJ9 A;  1DV1 A;  4DIM A;  2R7N A;  4I4T F;  5IYZ F;  5D8D A;  5C1P A;  2NU7 B;  2R7M A;  4HR7 A;  3R5X A;  4MV3 A;  4MA5 A;  1I7L A;  2CQY A;  3U55 A;  3JZI A;  4TUY F;  2DWC A;  3WO1 A;  3KAK A;  4HQ6 A;  2YW2 A;  3RV3 A;  1BXR A;  1JKJ B;  1CE8 A;  1PX2 A;  4HNT A;  1CS0 A;  2W6Z A;  1GGO A;  5H80 A;  2R85 A;  2ZDH A;  2J9G A;  3UFX B;  3KAL A;  1PK8 A;  5I47 A;  3WO0 A;  3MJF A;  5BPF A;  1IOV A;  2PBZ A;  1M0W A;  4XX0 B;  3MWE A;  3U9T A;  3KRE A;  2YZM A;  2P0A A;  2R82 A;  3VOT A;  4YJ3 F;  2W6O A;  2V59 A;  3N8D A;  4WBN F;  1EZ1 A;  4M9U A;  4MV7 A;  5CA1 F;  1GSA A;  4YJ2 F;  4O4H F;  2YYA A;  3K3P A;  3HB9 A;  4O7V A;  2NU9 B;  2SCU B;  4YAJ B;  4ZOL F;  2WYO A;  4FE2 A;  4I50 F;  1WR2 A;  4E4T A;  3VPD A;  3V4S A;  4O7Y A;  2FPG B;  4MV8 A;  5JVL A;  1B6S A;  2R6F A;  3G8C A;  2C00 A;  4C5A A;  2Z04 A;  3ORR A;  1VBG A;  5FNV F;  2YL2 A;  4O4L F;  4MA0 A;  1E4E B;  2W6P A;  3LWB A;  4QSH A;  1KJJ A;  3G8D A;  3MWD A;  2GPS A;  1KBL A;  5LP6 F;  2V58 A;  2PN1 A;  4ZHQ F;  3GID A;  1KJQ A;  1EUD B;  4RZQ A;  4TV9 F;  1CQI B;  2VQD A;  4ZQI A;  5DMX A;  1W96 A;  4EG0 A;  1GSO A;  5JQG F;  3I12 A;  4O84 A;  1KJI A;  3N6R A;  5LXT F;  4DLK A;  3JZF A;  5C8Y F;  2YS6 A;  3VA7 A;  4FFO A;  1EYZ A;  1EUC B;  3TW6 A;  3LP8 A;  4MV6 A;  5C1O A;  4O7T A;  1M0T A;  3V4Z A;  5CAE B;  1Z2N X;  4EGJ A;  3SE7 A;  4O4J F;  3VPB A;  4IHJ F;  2PVP A;  3ETJ A;  2I8C A;  2VR1 A;  5KX5 F;  1AUX A;  3K5H A;  2X0S A;  4HNV A;  1EHI A;  3TIG A;  5LYJ F;  5K2M A;  1T36 A;  5LOV F;  3R23 A;  1DV2 A;  3AX6 A;  3NUA A;  5GON F;  5JVD F;  2YRW A;  4IWY A;  2XD4 A;  4MV9 A;  5HBR B;  2OLS A;  4FFL A;  4FFN A;  3WNZ A;  1AUV A;  4FFM A;  2HJW A;  2Z02 A;  5BMV F;  4MV1 A;  1E4E A;  1JDE A;  1VBH A;  4O83 A;  2FP4 B;  3U54 A;  1BNC A;  2GLT A;  5JQW A;  4O7N A;  1C30 A;  2CNU A;  4O2B F;  4NYE A;  4O7L A;  2GQR A;  4O7Z A;  3TII A;  1GLV A;  4C5B A;  4O4I F;  4EGQ A;  4ME6 A;  1UC8 A;  3ORQ A;  5JH7 F;  3JRW A;  4O86 A;  1IOW A;  4FFR A;  2R86 A;  5CA0 F;  2R7L A;  1GSH A;  3OUU A;  2W6M A;  2I87 A;  3RFC A;  4XZ3 B;  4HNU A;  3TQT A;  2NU8 B;  1VKZ A;  2NUA B;  3K5I A;  5BPH A;  1DIK A;  2YRX A;  4O2A F;  2HGS A;  2CZG A;  3BG5 A;  1SCU B;  4XYL B;  5KKN B;  4O7S A; 
#chains in the Genus database with same CATH topology
 4JV1 A;  4EFE A;  2AGQ A;  2ZM6 H;  3T5K A;  4PZ8 A;  5DQH A;  5DLG A;  2JEJ A;  2YS7 A;  3OSN A;  3H4D A;  3M9N B;  2HIX A;  2HVS A;  5KT3 A;  1ZET A;  1A0G A;  2IMW P;  2W6N A;  5J2U F;  1RJR A;  3NGD A;  1FVI A;  1HR0 H;  1A48 A;  1KC7 A;  2WB1 A;  5FPR A;  2GQS A;  1X9N A;  4C5C A;  2HG8 A;  2YWV A;  5KFA A;  2R84 A;  4O82 A;  5KFF A;  3G6V A;  2ASL A;  4AYB A;  4Y8V B;  4ECX A;  4DV7 H;  1XMQ H;  1S0O A;  3GTJ A;  1DAA A;  3T7A A;  4IR9 A;  1W93 A;  4EBD A;  4UCT A;  2YZG A;  2FPI B;  3TY9 A;  5KFX A;  3AW8 A;  2RF4 A;  5KFQ A;  2VPQ A;  3Q8Q B;  2W7O A;  1A9X A;  4LF4 H;  1JLL B;  3RV4 A;  3VPC A;  4RAY A;  2W9C A;  4ECR A;  5EZY F;  5DGA A;  4YB8 B;  5BWW A;  1Y1V G;  4RB2 C;  2W9B A;  4JV0 A;  2NVY A;  3M4I A;  2J6S A;  5EWF A;  3TQ1 A;  5KFL A;  5IP9 G;  5LA6 F;  4DL2 A;  2IP4 A;  4A3C G;  2QK4 A;  1B04 A;  4ZI7 F;  5J2T F;  2OWO A;  5KT5 A;  3H3V H;  3PO3 G;  3RTX A;  2R7K A;  4TVI A;  4QWA A;  4O7W A;  4RZR A;  2BQR A;  1CKN A;  4IWX A;  4JI3 H;  3T9E A;  4APM A;  5L1I A;  3TY8 A;  2YZN A;  4DV5 H;  3GTK A;  5LL6 b;  2CNQ A;  1I50 A;  5DGH A;  1KEE A;  2XIG A;  4YR3 A;  2UXC H;  2QYZ A;  4DV4 H;  2ABJ A;  5T14 A;  1S9F A;  1TWA A;  4LF5 H;  5LMU H;  4J9P A;  3RJ0 A;  1Z2O X;  4A2B A;  4FS2 A;  4FGR A;  2V4Q A;  4A3B G;  4XYM B;  4A3D G;  4MV4 A;  2DAB A;  4ECV A;  2JA7 G;  4QJF A;  2I80 A;  2JA6 G;  2W9C B;  1I3Q A;  5KFI A;  2YCH A;  3GIP A;  5IYB G;  4A3F G;  4FBU A;  4ECW A;  2DLN A;  1V51 A;  1Y1W G;  5BWR A;  3M9M B;  5KG5 A;  3U9S A;  1BGW A;  2FPP B;  2W9B B;  2RGV A;  2W6Q A;  3HBL A;  5D1O B;  2Q2U A;  1I7N A;  4YHH H;  4J9M A;  3PO2 G;  2J6T A;  4LMY A;  4JI6 H;  5CB4 F;  3N42 B;  5EWG A;  3QZ8 A;  2BR0 A;  2CNV A;  3KXY T;  2R7Z G;  4JYA H;  1OBD A;  2DZD A;  4FM9 A;  2WE6 A;  1G2W A;  3TEK A;  2FLL A;  4EEY A;  3VNN A;  2C2R A;  2B63 G;  3HOZ G;  4R8U A;  2HHH H;  3JRX A;  3F8N A;  4JUZ A;  1R9T A;  3KAJ A;  4TQS A;  5F9N A;  3K3V A;  3E5N A;  3H20 A;  3T5H A;  5KG1 A;  4DUZ H;  4DL4 A;  4F4X A;  3KHG A;  3V6K A;  2JA8 G;  3DTF A;  5HV6 A;  2XCL A;  1I1K A;  4WD3 A;  3DF7 A;  3ETH A;  1WSC A;  4IRC A;  2FKL A;  3OUZ A;  5KFK A;  3V6H A;  1S03 G;  5KG7 A;  2BQ3 A;  2EJ2 A;  2W70 A;  3T54 A;  3TIN A;  4F50 A;  1OWT A;  2C2D A;  2XCP A;  4QWD A;  4Q4C A;  5C4X G;  2DIK A;  4Q8F A;  4IZO A;  3Q8P B;  4JI8 H;  3GLK A;  3Q1K A;  2CW8 A;  3G6X A;  2FB9 A;  1JDB B;  1KUT A;  1ZHS A;  3FKI A;  4R7R A;  1M6V A;  2ZDQ A;  2RDI A;  4DV2 H;  3R9R A;  1ULZ A;  4CKB A;  2V9W A;  3HO8 A;  4FFP A;  1UC9 A;  4IIJ F;  3PW2 A;  3R5F A;  3NC0 B;  3W1B A;  3FKI G;  3Q2O A;  2E5L H;  3GIM A;  3R5H A;  3PR5 B;  4L1K A;  2AQ4 A;  1N33 H;  4O7R A;  1SEI A;  2VQF H;  3OSP A;  5BWV A;  1XDN A;  4TV8 F;  2R87 A;  1FJG H;  3SGI A;  1EKF A;  1Z2P X;  2EIY A;  4ED8 A;  4DL3 A;  2A1H A;  3PR4 A;  1S10 A;  1KTA A;  3VMM A;  1WCM A;  3C0F B;  4ED0 A;  1ZHQ A;  1XNQ H;  2CFM A;  4MAM A;  4A3K G;  3GV8 B;  4O81 A;  5JUM A;  5EDW A;  2GPW A;  3N6X A;  1EKV A;  2NU6 B;  4BY1 G;  2XC9 A;  3SNO A;  1SFO A;  3W5O A;  5I5W A;  4DV6 H;  1KJ8 A;  2OH2 A;  4ED3 A;  2F4V H;  5DG7 A;  5EWE A;  3DTG A;  2WB1 E;  1P16 A;  3TY5 A;  4YAK B;  4ECQ A;  3J80 W;  3GTL A;  4UCV A;  2Y0S A;  4RUC A;  3L4K A;  4I55 F;  1E4G T;  1MZB A;  4U7C A;  1ET0 A;  4YR2 A;  3OHB A;  3T1Y H;  4YBZ B;  3QFF A;  2HGW A;  1C3O A;  4ETS A;  4EEQ A;  4DUY H;  2W8L A;  4FU0 A;  2YZL A;  2Y4R A;  2ZDG A;  5L1L A;  1CQJ B;  2UUB H;  3GII A;  2NVX A;  2VUG A;  3RUP A;  2VA2 A;  2V5A A;  3FMA A;  1RYR A;  3BA8 A;  3RGX A;  1HNW H;  2W71 A;  1B6R A;  4CKE A;  2UUA H;  3RIZ A;  4DV0 H;  2C22 A;  1S0N A;  2R92 G;  1OBG A;  2QF7 A;  5I60 A;  4HN2 A;  1KJ9 A;  3CEB A;  1DV1 A;  4DIM A;  2UU9 H;  2R7N A;  3KHR A;  3JSN A;  4I4T F;  4UCR A;  5IYZ F;  2MCT A;  5FJ8 G;  4FS1 A;  1I2L A;  4LFB H;  4B3R H;  5D8D A;  5C1P A;  2NU7 B;  2R7M A;  3HKZ A;  5KT7 A;  4DQN A;  3MR5 A;  1EKP A;  4HR7 A;  3U0G A;  3R5X A;  2WAQ E;  3RBD A;  1RYS A;  3BQ2 A;  4GLW A;  3H4B A;  4MV3 A;  1S0M A;  4Q45 A;  3RB4 A;  4MA5 A;  2X5R A;  1TAE A;  4DR5 H;  3BAA A;  5DAA A;  1I7L A;  1GYF A;  5D1P A;  2HDK A;  2CQY A;  3RAX A;  5BYB A;  3U55 A;  3UZO A;  4FBT A;  4BBS G;  3JZI A;  4TUY F;  3S24 A;  1M7J A;  3L4J A;  2DWC A;  2UVR A;  4F4W A;  2ASD A;  3WO1 A;  3KAK A;  4HQ6 A;  2YW2 A;  4RAZ A;  5D1O A;  4DR1 H;  3RV3 A;  5KFV A;  5FLM G;  1BXR A;  1RK5 A;  3IG0 A;  4EYI B;  4O3S A;  5IYD G;  2ODT X;  4BBR G;  4I7H A;  3T1H H;  4QIW A;  1JKJ B;  1CE8 A;  1PX2 A;  4HNT A;  5KFM A;  1O75 A;  2AU0 A;  3M9O B;  1JIH A;  3LML A;  2C35 B;  3GIJ A;  4J9N A;  1CS0 A;  2W6Z A;  1GGO A;  4PZ7 A;  4CC5 A;  1I1M A;  3KYH C;  5H80 A;  2R85 A;  3PVX A;  3IN5 A;  1HNX H;  5E25 A;  3HOY G;  2COG A;  2J9G A;  2ZDH A;  3UFX B;  3KAL A;  3RB0 A;  1HNZ H;  1PK8 A;  3I4N G;  2UXB H;  2Q2T A;  4GC6 A;  5I47 A;  1GO3 E;  3WO0 A;  3I4M G;  2QB5 A;  4JXU A;  3UZB A;  5KFY A;  2BQU A;  4JI0 H;  3RR5 A;  3MJF A;  1VAJ A;  4J9L A;  1RJP A;  5KT2 A;  4K0K H;  1VS0 A;  2PMZ E;  3T9C A;  1KT8 A;  1IOV A;  2PBZ A;  5BPF A;  3KTM A;  5I5S A;  1M0W A;  5F9L A;  4XX0 B;  1N36 H;  3MWE A;  1J5E H;  3W1G A;  4PWQ A;  4O3P A;  4QWE A;  3U9T A;  3KRE A;  2YZM A;  2JEI A;  2P0A A;  2R82 A;  3VOT A;  4YJ3 F;  3HXL A;  2W6O A;  5C3E G;  3RB3 A;  1L2Z A;  2V59 A;  5IT9 W;  3N8D A;  5BWU A;  5KFD A;  3G6Y A;  4WBN F;  3NBY B;  3JSL A;  2FJZ A;  4JI2 H;  3BQ1 A;  1EZ1 A;  4M9U A;  4MV7 A;  3JZ6 A;  4UCO A;  2W8K A;  4CMF A;  3HOX G;  5CA1 F;  3PW4 A;  3GTG A;  1GSA A;  4YJ2 F;  3PW5 A;  4O4H F;  4A3G G;  3QWU A;  3N40 P;  3GV7 B;  4X65 H;  2YYA A;  2VUM A;  3AYH B;  3L2P A;  1I94 H;  2E2I A;  2J6U A;  3SI8 A;  3LQS A;  3K3P A;  3HB9 A;  5CE8 A;  4O7V A;  5DG8 A;  1IBL H;  4IAJ A;  4HYK A;  2NU9 B;  5FR9 A;  2VUM G;  2SCU B;  4UCS A;  4A93 G;  4YAJ B;  4ED2 A;  4YR0 A;  4ZOL F;  4DR7 H;  2WYO A;  1TWG A;  4RCN A;  4FE2 A;  4I50 F;  5I5X A;  3LUL A;  2Y0S E;  4DL6 A;  1JXL A;  2HHF B;  2JA5 A;  4WHX A;  5CM0 A;  1WR2 A;  4E4T A;  4X62 H;  2IA6 A;  4ECU A;  3VPD A;  3QQM A;  4DR3 H;  4LSX A;  1AN7 A;  1DGS A;  4NZM A;  1I2K A;  4O7Y A;  3V4S A;  4YY3 H;  2FPG B;  4MV8 A;  5KFH A;  3PW0 A;  5JVL A;  2C28 A;  1B6S A;  2R8I A;  2R6F A;  3JAM W;  3G8C A;  2Q7D A;  3CQZ A;  4RNN A;  2R8H A;  4ED6 A;  4Q8E A;  2DAA A;  4JI7 H;  3WWH A;  4DR4 H;  4LFA H;  2C00 A;  4C5A A;  4DV3 H;  1RK6 A;  2EJ3 A;  5DQI A;  5KT4 A;  4A3M G;  1SYX B;  2Z04 A;  1WCM G;  5A2Q W;  3ORR A;  3RGZ A;  1VBG A;  5KG2 A;  2XCA A;  3GB8 B;  3GIQ A;  4OX9 H;  1K1Q A;  4UCU A;  1Y14 B;  4F4Z A;  4ECY A;  1TA8 A;  3MFI A;  4Q4D A;  5DLF A;  4J9R A;  4BY7 G;  4BXX G;  4EFB A;  4AYB E;  5K3W A;  2KSW A;  5FNV F;  1ZQ7 A;  2VOB A;  4J9O A;  4PZ6 A;  5CR5 A;  5DIS C;  2W57 A;  3H0G A;  5FPO A;  3J81 W;  4EBC A;  4B3T H;  5KFR A;  4O3R A;  2YL2 A;  4O4L F;  4Q44 A;  4MA0 A;  2JEG A;  2UVW A;  1E4E B;  2W6P A;  4LH6 A;  5KFU A;  5DG9 A;  4QW9 A;  4C2M A;  3GV5 B;  4A3J G;  3BAB A;  4A2A A;  3LWB A;  1TWC A;  5KFG A;  4QSH A;  4PDB A;  4JI1 H;  3CSW A;  1KJJ A;  4BWS C;  3PN1 A;  2R8J A;  3G8D A;  3T9F A;  2COI A;  5LMN H;  4QWC A;  3RF2 A;  5C5J A;  4RU9 A;  3MWD A;  2GPS A;  1KBL A;  4QIW E;  4A3E G;  4DR6 H;  2JEF A;  2O03 A;  3HOV G;  3HOU G;  1V4Y A;  1P8L A;  5LP6 F;  2V58 A;  2PN1 A;  4ZHQ F;  3N44 B;  5KFT A;  4JV2 A;  3GID A;  1KJQ A;  1N32 H;  1A0I A;  3T9A A;  2UVU A;  5DGB A;  3H40 A;  5IP7 G;  2ASJ A;  1EUD B;  4B3S H;  4RZQ A;  4TV9 F;  4DRF A;  1T94 A;  4J9Q A;  1CQI B;  2VQD A;  4GKJ H;  1BJT A;  2M05 A;  4ZQI A;  4NLG A;  1K1S A;  5DMX A;  4DL5 A;  4M0J A;  5BR8 H;  1W96 A;  2R8G A;  4CHI A;  4LF7 H;  4MTD A;  4EG0 A;  2HVR A;  1GSO A;  5JQG F;  3I12 A;  4O84 A;  1KJI A;  3N6R A;  5KG4 A;  1N34 H;  5LXT F;  4DLK A;  4PBC A;  3OHA A;  3JZF A;  4JI5 H;  3BAC A;  5C8Y F;  4RNM A;  2YS6 A;  3N41 B;  5KFC A;  3VA7 A;  2FLP A;  3GIK A;  4FFO A;  1IYE A;  2FMA A;  1EYZ A;  1EUC B;  5I5U A;  4RB3 C;  5KFZ A;  2XGP A;  5I5V A;  3TW6 A;  5IYC G;  4AQY H;  3LP8 A;  4MV6 A;  4QWB A;  2HIV A;  4ED1 A;  4LFC H;  4O3N A;  5KFW A;  1Y1V A;  4RB0 A;  3RB6 A;  4JV5 H;  5C1O A;  1CKO A;  4CC6 A;  4K6N A;  4YP3 A;  4O7T A;  3WWJ A;  3EYY A;  4DR2 H;  1M0T A;  3V6J A;  5KFE A;  3MFH A;  1N56 A;  2EJ0 A;  5DGI A;  4GKK H;  1N48 A;  3V4Z A;  2UVV A;  2AGP A;  5CAE B;  1Z2N X;  4EGJ A;  5KFS A;  3SE7 A;  4GLX A;  2C2E A;  5FLX W;  4O4J F;  3VPB A;  5HNE A;  4IHJ F;  3MWM A;  3QZ7 A;  4IRD A;  5KT6 A;  2PVP A;  3KHL A;  5KG0 A;  5L1J A;  5FD6 A;  4RB1 A;  5L1K A;  4JI4 H;  5KFJ A;  3ETJ A;  2I8C A;  2VR1 A;  2WAQ A;  2ALZ A;  3T9D A;  5KX5 F;  2FE3 A;  5EOY A;  2HHF A;  4U6P A;  2W9A A;  4LF8 H;  5L9X A;  4ECZ A;  2JA7 A;  2JA6 A;  3T99 A;  1XK5 A;  4O3O A;  1AUX A;  2UUC H;  2E2H A;  4ECS A;  1Y1W A;  3K5H A;  2X0S A;  4M7E A;  3DAA A;  3CVZ A;  5C44 G;  4HNV A;  1EHI A;  1T3N A;  4LSA A;  3TIG A;  5LYJ F;  3UYY A;  3RBE A;  4X66 H;  5I5Y A;  3OTO H;  5KG6 A;  5K2M A;  3HOW G;  3Q8S B;  3GTM A;  1K83 A;  1T36 A;  5LOV F;  1V9P A;  3R23 A;  5I5T A;  2R7Z A;  1DV2 A;  3AX6 A;  3UQ8 A;  1RJQ A;  4B3M H;  2B63 A;  4RUA A;  4UFZ A;  3NUA A;  5GON F;  5JVD F;  2YRW A;  4IWY A;  4O3Q A;  5KFP A;  4RNO A;  2COJ A;  4CMD A;  2XD4 A;  4MV9 A;  1ZAU A;  1B33 N;  4Q0Y A;  4TQR A;  5FD5 A;  3T5L A;  2VA3 A;  5HBR B;  2UXD H;  4TM5 A;  2OLS A;  4LF6 H;  3BQ0 A;  3PFF A;  1CKN B;  4FFN A;  4FFL A;  3WNZ A;  2CKZ B;  4YQW A;  2XGQ A;  1FKA H;  1AUV A;  2RGR A;  4FFM A;  2HVQ A;  2HJW A;  3FDS A;  3EPI A;  3T5J A;  2Z02 A;  4NZO A;  4EQ5 A;  5BMV F;  4DV1 H;  4A3L G;  4Q43 A;  4MV1 A;  1E4E A;  5KFO A;  4EBE A;  4GC7 A;  4F4Y A;  2HGX A;  1JDE A;  4LF9 H;  1VBH A;  2IBK A;  4O83 A;  2FP4 B;  4NZN A;  1BNC A;  4UUG A;  3U54 A;  4IRK A;  2YU9 A;  2GLT A;  1UNN C;  3GDE A;  5JQW A;  2PMZ A;  1CKM A;  3GJX B;  1TWH A;  2WDT A;  1S68 A;  4O7N A;  1C30 A;  2CNU A;  5KFB A;  4O2B F;  4QW8 A;  1WH2 A;  4LH7 A;  5DQG A;  4ED7 A;  4NYE A;  3NBZ B;  4O7L A;  3MR2 A;  3PW7 A;  2GQR A;  1JX4 A;  1I6U A;  4O7Z A;  3N43 B;  3TII A;  5KFN A;  2DPJ A;  1GLV A;  2RDJ A;  3HKZ E;  5BWX A;  3RAQ A;  2W7P A;  1A3G A;  4C5B A;  3HT5 A;  2JA5 G;  4O4I F;  4J9S A;  5BWT A;  3GTO A;  1XNR H;  4EGQ A;  3BA9 A;  1UC8 A;  4ME6 A;  2FK3 A;  4R8U B;  2FK2 A;  2AGO A;  3ORQ A;  5JH7 F;  4J9K A;  3JRW A;  3BJY A;  3KHH A;  4DL7 A;  4O86 A;  4CE5 A;  1IOW A;  4J0M A;  4FFR A;  2R86 A;  3Q8R B;  5CA0 F;  2ZGI A;  2R7L A;  3T9B A;  1GSH A;  4E6N A;  2VPS A;  3OUU A;  2W6M A;  2I87 A;  3RFC A;  3H0G G;  2VQE H;  2R93 A;  4XZ3 B;  2DPI A;  4HNU A;  3TQT A;  1XMO H;  4NXM H;  4ECT A;  3TW7 A;  4MTE A;  4X64 H;  3MR3 A;  2NU8 B;  3MR6 A;  1VKZ A;  2ZJT A;  3GTP A;  1IBK H;  2NUA B;  3K5I A;  5BPH A;  1I1L A;  2WTF A;  2ATL A;  2V4R A;  3J7A K;  4KHP H;  4A3I G;  1E4F T;  3WWI A;  5KS8 A;  2R93 G;  1DIK A;  2YRX A;  1IYD A;  2FK1 A;  5BYA A;  4O2A F;  4EYH B;  5IWA H;  4IR1 A;  2HGS A;  2CZG A;  2FLN A;  3BG5 A;  4G3I A;  3GTQ A;  3GIL A;  4NXN H;  2R92 A;  1TWF A;  2CW7 A;  1SCU B;  1IBM H;  4XYL B;  4DAA A;  3GQC A;  1S97 A;  2R8K A;  3EPG A;  5KKN B;  4O7S A;  5KG3 A;  3PZP A;  4CKC A;  1WRV A; 
#chains in the Genus database with same CATH homology
 2YS7 A;  2W6N A;  5J2U F;  1A48 A;  1KC7 A;  2GQS A;  4C5C A;  2YWV A;  2R84 A;  4O82 A;  4Y8V B;  1W93 A;  2YZG A;  2FPI B;  3AW8 A;  2VPQ A;  1A9X A;  1JLL B;  3RV4 A;  3VPC A;  5EZY F;  4YB8 B;  5LA6 F;  2IP4 A;  2QK4 A;  4ZI7 F;  5J2T F;  2R7K A;  4O7W A;  4IWX A;  2YZN A;  2CNQ A;  1KEE A;  1Z2O X;  4FGR A;  4XYM B;  4MV4 A;  2I80 A;  2DLN A;  3U9S A;  2FPP B;  2W6Q A;  3HBL A;  1I7N A;  5CB4 F;  2CNV A;  1OBD A;  2DZD A;  3JRX A;  3KAJ A;  3E5N A;  5HV6 A;  2XCL A;  4WD3 A;  3DF7 A;  3ETH A;  3OUZ A;  2W70 A;  3TIN A;  2DIK A;  4IZO A;  3GLK A;  3Q1K A;  2FB9 A;  1JDB B;  1KUT A;  1M6V A;  2ZDQ A;  3R9R A;  1ULZ A;  3HO8 A;  4FFP A;  1UC9 A;  4IIJ F;  3R5F A;  3Q2O A;  3R5H A;  4L1K A;  4O7R A;  4TV8 F;  2R87 A;  1Z2P X;  3VMM A;  4MAM A;  4O81 A;  2GPW A;  2NU6 B;  1KJ8 A;  4YAK B;  4I55 F;  4YBZ B;  3QFF A;  1C3O A;  4FU0 A;  2YZL A;  2ZDG A;  1CQJ B;  3RUP A;  2V5A A;  2W71 A;  1B6R A;  1OBG A;  2QF7 A;  1KJ9 A;  1DV1 A;  4DIM A;  2R7N A;  4I4T F;  5IYZ F;  5D8D A;  5C1P A;  2NU7 B;  2R7M A;  4HR7 A;  3R5X A;  4MV3 A;  4MA5 A;  1I7L A;  2CQY A;  3U55 A;  3JZI A;  4TUY F;  2DWC A;  3WO1 A;  3KAK A;  4HQ6 A;  2YW2 A;  3RV3 A;  1BXR A;  1JKJ B;  1CE8 A;  1PX2 A;  4HNT A;  1CS0 A;  2W6Z A;  1GGO A;  5H80 A;  2R85 A;  2ZDH A;  2J9G A;  3UFX B;  3KAL A;  1PK8 A;  5I47 A;  3WO0 A;  3MJF A;  5BPF A;  1IOV A;  2PBZ A;  1M0W A;  4XX0 B;  3MWE A;  3U9T A;  3KRE A;  2YZM A;  2P0A A;  2R82 A;  3VOT A;  4YJ3 F;  2W6O A;  2V59 A;  3N8D A;  4WBN F;  1EZ1 A;  4M9U A;  4MV7 A;  5CA1 F;  1GSA A;  4YJ2 F;  4O4H F;  2YYA A;  3K3P A;  3HB9 A;  4O7V A;  2NU9 B;  2SCU B;  4YAJ B;  4ZOL F;  2WYO A;  4FE2 A;  4I50 F;  1WR2 A;  4E4T A;  3VPD A;  3V4S A;  4O7Y A;  2FPG B;  4MV8 A;  5JVL A;  1B6S A;  2R6F A;  3G8C A;  2C00 A;  4C5A A;  2Z04 A;  3ORR A;  1VBG A;  5FNV F;  2YL2 A;  4O4L F;  4MA0 A;  1E4E B;  2W6P A;  3LWB A;  4QSH A;  1KJJ A;  3G8D A;  3MWD A;  2GPS A;  1KBL A;  5LP6 F;  2V58 A;  2PN1 A;  4ZHQ F;  3GID A;  1KJQ A;  1EUD B;  4RZQ A;  4TV9 F;  1CQI B;  2VQD A;  4ZQI A;  5DMX A;  1W96 A;  4EG0 A;  1GSO A;  5JQG F;  3I12 A;  4O84 A;  1KJI A;  3N6R A;  5LXT F;  4DLK A;  3JZF A;  5C8Y F;  2YS6 A;  3VA7 A;  4FFO A;  1EYZ A;  1EUC B;  3TW6 A;  3LP8 A;  4MV6 A;  5C1O A;  4O7T A;  1M0T A;  3V4Z A;  5CAE B;  1Z2N X;  4EGJ A;  3SE7 A;  4O4J F;  3VPB A;  4IHJ F;  2PVP A;  3ETJ A;  2I8C A;  2VR1 A;  5KX5 F;  1AUX A;  3K5H A;  2X0S A;  4HNV A;  1EHI A;  3TIG A;  5LYJ F;  5K2M A;  1T36 A;  5LOV F;  3R23 A;  1DV2 A;  3AX6 A;  3NUA A;  5GON F;  5JVD F;  2YRW A;  4IWY A;  2XD4 A;  4MV9 A;  5HBR B;  2OLS A;  4FFL A;  4FFN A;  3WNZ A;  1AUV A;  4FFM A;  2HJW A;  2Z02 A;  5BMV F;  4MV1 A;  1E4E A;  1JDE A;  1VBH A;  4O83 A;  2FP4 B;  3U54 A;  1BNC A;  2GLT A;  5JQW A;  4O7N A;  1C30 A;  2CNU A;  4O2B F;  4NYE A;  4O7L A;  2GQR A;  4O7Z A;  3TII A;  1GLV A;  4C5B A;  4O4I F;  4EGQ A;  4ME6 A;  1UC8 A;  3ORQ A;  5JH7 F;  3JRW A;  4O86 A;  1IOW A;  4FFR A;  2R86 A;  5CA0 F;  2R7L A;  1GSH A;  3OUU A;  2W6M A;  2I87 A;  3RFC A;  4XZ3 B;  4HNU A;  3TQT A;  2NU8 B;  1VKZ A;  2NUA B;  3K5I A;  5BPH A;  1DIK A;  2YRX A;  4O2A F;  2HGS A;  2CZG A;  3BG5 A;  1SCU B;  4XYL B;  5KKN B;  4O7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...