4YC2B

Crystal structure of the stabilized inner domain of clade a/e hiv-1 gp120 from e. coli in complex with the antibody a32.
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
224
structure length
223
Chain Sequence
b'QVQLQESGPGLVKPSQTLSLSCTVSGSSSSGAHYWSWIRQYPGKGLEWIGYIHYSGNTYYNPSLKSRITISQHTSENQFSLKLNSVTVADTAVYYCARGTRLRTLRNAFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords The stabilized inner domain of clade A/E HIV-1 gp120 from E.
publication title Paring Down HIV Env: Design and Crystal Structure of a Stabilized Inner Domain of HIV-1 gp120 Displaying a Major ADCC Target of the A32 Region.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 37
structure length 223
sequence length 224
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yc2B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yc2B01
2HG5A 5EC2B 1OGTB 1PX4A 3NZ8A 3FB8B 1N2RA 4KTEH 4DN3L 5I30L 1JZ4A 1WICA 3HAEA 4MQXC 5F88A 1R3KB 1FG2B 3SDXA 1FVDA 1NPUA 3OKOA 4H8WH 4TRPH 5F9DC 1ES0A 2BOCA 1U58B 1CL7L 3EYSH 3H9SD 1A6ZA 4X5LA 9CGTA 5HPOA 4JN2B 5IFHH 2E9WA 4PJAA 4OT1L 1LP9F 5KVFL 1OAUL 1YMHA 1KJMA 4HSQA 3QIUC 1TPXC 3WIIH 1ZGLM 2OR8A 3VH8A 5JIPA 1S7RA 4QRRB 2VXSH 2XQYG 1B0GA 4EN3D 4M62L 3KAAA 4RIRA 5DZLA 2VDOH 2DQJL 1GHFL 3ZSSA 3TBWB 3UPRB 3TBTB 1MWAL 1MI5D 4HD9A 2EYRA 1NCWL 5IBTH 1AXSB 2IAMA 1NCTA 5MEND 4FS0A 2NY2C 4IRJD 3RIFF 1LD9A 1GSMA 4J4PD 4YXHL 2C1OB 4LCCC 1EJOL 2F53B 3V79C 2ICWJ 4HMEA 4EI5B 2ZOLB 3IFNH 5FGSA 2QSTA 3WS6A 3MBEB 3ZTJG 4M3JA 4R4BA 1HN1A 1FL3B 5EU4A 3OX8B 2I9TA 1V3KA 4G43B 4HJ0C 1JWSB 1OTSD 1QFHA 1GAFH 3OB0H 5GGRA 5D1XC 1WZMA 4NO2A 4ONHA 1YEGL 3HR5A 4D9LL 2H32H 2ESVB 2WUBH 4XTRC 2PYED 1FGVL 3K4AA 3RBSA 4AIOA 1ZVSA 4I0PB 3W2DH 5FO8A 1U8HB 3JVGA 5E1AB 5KANG 2BNQE 2SEBA 2EEDA 4X6DE 2A83A 2DMBA 4KH2A 5L2KD 1JMZA 1S9KC 3S36X 1WBXB 5T3ZH 2X5PA 5T1KB 1YN6A 5J6GA 3VGBA 1KLUA 3K46A 5ACMA 3VFRB 4ZFGH 5I17A 3P77A 3K8LA 5HSFA 1FNGB 1XZ0A 1JPGA 5CKGA 4KTDH 1NL0L 5EC2A 3C2AL 3EOTL 4NZUL 3X3FH 1EEQA 3I6LD 3DMMA 4YHZH 4KHTH 5A16A 3O6LL 4P9MH 1MFNA 3WO4C 3ECBB 2MNUA 2COQA 5B4MC 1KB9J 1P1ZB 5JA9A 4M7JH 4MQXD 4UDTB 3QIUB 4J8RA 4Q6IA 1TPXB 1JUFB 1GOHA 4LVEA 1HOCB 3D9AH 3BWAA 3CVHA 3D1MC 5ADOL 3QWOA 3SJVA 5C0NC 4OF7A 1PG7X 1RZ8B 4H0IA 5E8PA 3BFOA 1FLTX 4RWYH 1QFWL 5EU3A 5A1AA 1X5ZA 3D2UD 3BDYL 4EUPA 1P6AB 2VN4A 4UBDD 4G8GE 5CD3A 4D3CL 3L5WB 1QLEH 4QOKE 4E42B 3PP4H 3UTSB 1DZBA 3TBWA 3BQUC 3TBTA 3C6SB 3GMNA 2FH8A 2RGSA 3BX7C 4S1RL 5I2IA 1AXSA 2NY2B 5E94B 1KIQA 5MP6L 1WAAA 4R0LC 2DF3A 4TNVK 3HN3A 2VLRA 3OPZH 3OTTA 4DVRL 2ZOLA 4OUOA 2F58H 3MBEA 4AEHL 1YY8B 1OVZA 4J6RL 3CUPB 4G43A 4I0CC 4CNIA 2X4NA 4GAYA 2PYFA 3QFJB 4DGIL 1U6AH 5D1XB 1IM3B 1K8DA 3S35H 3O2DH 3MGAA 3HFMH 4JREC 2CO6B 3S3PA 4FQXC 1G7IA 3U9UA 5HXMA 3VDAA 2R1XA 2LTQB 3BH8B 1EGJA 4OF6A 5GZND 3RGVC 4XBPB 1MFDH 5C0CE 1I9JL 3MACH 2IQAB 1F6LL 5D7IF 4PJBF 3CXDH 3ROOA 2DQHL 3V4VL 2IGFL 3WHXB 1W72B 4KVCL 5T5FL 2Z92A 4MSWB 4Z7OF 2NR6D 2DDQH 1VSCA 1FV1B 3GIVA 2O5YH 3IT8D 1E6OL 3K0WA 3WS3A 1FL6A 4JPWH 5T1KA 1PEWA 3VFRA 5HHME 2B4CC 3ZE1E 3CDFA 3FQTB 1LDPH 1LEKB 4G6JL 4N5EC 1JVKA 2Z4QB 1CE6A 3WO4B 2QQNL 1A6VH 4KKLC 4U05A 2HFEB 5LXGL 1M4KA 5AAMA 1CTNA 4YWGL 4X5XA 1P1ZA 1CZ8L 4ZUSB 3VD5A 1FE8L 1Q9WA 3S36L 3GHBL 3BPNC 4UV7L 4OLZH 3BD5A 1BF2A 1HOCA 1L6ZA 2BXZA 4HS3B 1I7UB 4WO4B 4HCRH 2X4RA 4Y5VC 2JJWA 4OLUH 5EO1A 3CDYA 4CJ1A 4OF5A 1BMGA 3ARDA 3DLQR 5J3HD 3UTTA 3KGRA 3PV7A 2DQDL 4JN1H 1NFDB 3BQUB 1N5AB 4LSUH 2NW3B 1WIOA 3FMGH 4E42A 4AY0A 1ZHNA 3TLRA 2HJFA 5E5MA 4QNPE 4YXLL 3DOSA 1S9WB 3A67H 1JRHL 4R0LB 1FNSH 5EWIH 5C07B 1CE1L 2BSTB 3AAZB 4JQXA 1PG7L 3OHXA 1FL5A 5DRWA 4DK3A 3X12B 4YC2B 1INEH 3AM8C 3RUGB 3OR6B 1MFAL 1KB5H 1YY8A 5HYQB 4GT7A 3MRIA 3CUPA 1FNEA 4DQOH 5IVZA 4O00A 2ZUVA 4WVRA 3PHQB 5I74C 2ICWI 5E6IB 4XNYH 2H9GB 4PJ9D 4YDVA 4KKAD 5EOCL 4ISVA 3BH8A 4JRXD 4PJ7A 5CCKL 2NY7H 4XBPA 4GXVH 2VDKH 1NCBL 4JO3L 2YWZA 1PSKH 1HWHB 3P3YA 4JFQA 2VRAA 5D71H 3AFLA 5IKCA 4OZIF 4FQXD 2E7MA 4FQLH 3RGVD 5A3ID 1JHTA 1W72A 1WEJL 3SDDB 4M6OL 2DLFL 3MRBB 4F8TA 5JHDB 1FV1A 4MHHI 4J3UA 4RGMC 3WJJC 2Z35B 1WFNA 5FGBA 4YXKH 2YN5A 4XPFH 1K9TA 3WNNA 1HQ4B 2HT3D 1H3XA 1BBDH 2XTJB 4LBEB 4CVZB 4NBXB 5E08L 5FHBL 4X9IA 5HI4C 5DJ8B 3GSWB 4WHCA 2EDHA 5D5MF 4L3CB 4HXBH 1KACB 1XT5A 3G5VA 3BPNB 1OD7A 5FYLH 4FA8A 1Z5LA 3IF1B 3SDYH 4L3EE 4ZUSA 4M4PA 4GG6F 3CLFH 2V17H 2YPLB 3LZFL 1CS6A 3IDGA 1WVZA 2UUDH 5L88H 5CLWA 2NW2B 1MCHA 4Y5VB 5MEOB 1U8MA 4WO4A 4K07A 4NYLB 2FR4B 1NC2A 2L0DA 2P4AB 4LLVB 1OAYH 2XWTB 32C2A 3VI3E 2R4SL 4Q6YA 1T1ZB 5JOPE 4N8VB 4ALAH 3MREB 4LGPB 3VMNA 1NAMB 2V2XB 2QR0B 1UXSA 3AAZA 3UYRL 1A6AA 1G9MH 1Y0LB 2DQFB 5KW9L 5TFSL 3LEXA 3PWUB 1I3RB 2V9RA 4UT9L 1AHWC 5HYQA 5L7XL 2CK2A 2VL5B 3PHQA 5JORB 3QI9D 5E6IA 1EFXA 5EU6A 4WI7A 1EVTC 4G9FE 1O7SA 2AK4E 1UJ3B 2RB8A 3UROR 2KZWA 3INUL 5AUMB 1OGAE 3OKKB 3BEWB 2B4CL 4GMSH 4K7PX 5IOPA 1FG9C 4NQDD 5FB8B 1RMFH 2UZXB 4H0HB 1A0QH 4PJFB 4IS6B 5FYLE 5ID0B 3MRBA 2HFFA 4RGMB 3T08A 3WCYA 4GRWF 2Z8SA 3VMPA 3CZFB 1X5JA 1A1OA 3NTCH 3O81A 4YIQB 1WZLA 4X9BA 4LBEA 5F1SA 4CVZA 3QJHA 1D6VL 1BFOB 2Q7YA 1MQ8A 3GSWA 3CFDA 3L7EB 1KCVL 3T2NH 1CXLA 1RZ7L 2C3WA 5CSBA 3FFCE 3TYFA 1FO0H 2XFXB 3DX6B 3MROB 4M7ZB 1JZ3A 1RUKL 1WCBB 2CLZB 3HLAB 3EJZC 5IB1B 4LSQH 1IAKB 3O9WC 1KXVC 2EE3A 4HUVB 1JV5B 5MEOA 5E2JA 3QEGH 3MA9L 1AXTH 1BM3H 4I3SH 4JO4H 3JTTA 4OCWL 2VAAB 3L3DB 2R0WL 4YFEA 4KRPD 1BJ8A 2XWTA 3UAJC 3QG7L 4YE4L 1JNHB 5JR1H 4C56D 1T1ZA 3HE7A 4V1DD 4L4VD 5DD6B 3U79A 3MREA 2BJMH 5LVEA 1JN6B 2NCMA 4HWZB 4Y2DC 5GSVA 3EFFA 5KVEH 4XAWH 3RPIB 3NFPB 3O2WH 1RZFL 1XGPA 4MD5A 3DO3A 3KJ4C 5E4IA 3MRCB 3PWUA 5DDHB 1TJIL 4Z77B 4LSPH 2DD8L 1JNLH 3MV7E 3QISA 3QQNA 1XR8A 1WTLA 4A2MA 5C0RH 4NWTL 2HMIC 1Q9LB 3FO0L 4IRSC 5JORA 5FK9B 4TSBH 1B0RB 2IQ9H 2OQJB 3DTXB 5I8OL 5KJRH 4XPBL 4WFFE 3MA7B 5C2BH 3KPTA 3RIAF 5IW6B 4W81A 1ZMYA 4MNHB 1UJ3A 2P5WB 5C0AE 1GJIA 1VFOA 3VFVB 1HINH 3HI1B 4URTB 4Y5XC 3BYYA 3EFDL 43CAB 1QOKA 1UB6A 4KKNA 2E7LC 1NC4D 1JHLL 1RUAH 3QAZB 4S1QL 2NXYB 4ONOA 2H8PB 3B9EA 1UACL 1AQKH 1YQVH 5MEQB 4LASL 5GGVL 1R5VA 4OJFH 5CP3A 3C09C 1DFBH 5IG7B 1G7PB 1Y6KR 3ISWA 2AJ3B 2Z91B 2BVYA 3CZFA 2D7QA 2EZ0D 2P49B 4X8XA 1I1CA 1MY7A 3X3GH 1KXTB 5DRXB 2X4PB 4XP5L 2BSSB 5JW4N 4NDMB 1MF2L 3QUYC 4U1MA 1N6QH 5D7JD 1MQKH 4MB4A 1KENL 4MA3A 1PQZB 2HJLB 3DVIA 5IVXF 2W91A 1Y6MR 3L7EA 5DFVC 3KG5A 1C12A 4JM2F 5BW7A 2FBJL 3DX6A 1F58H 2XN9A 4QTIH 4NUGH 2NX5A 2AABL 3HLAA 5IB1A 1SVZA 5FUCE 1IBGH 4HUVA 1JV5A 4NM8H 4PJ5A 2EO1A 4HS8L 1A9EB 4XPTH 3O9WD 1KG0B 5CD5C 3WHE1 2PETA 5C0BA 4Z0BH 3NPZB 3ZTNH 2I9LB 6CGTA 5D7IE 1SY6H 3I50H 4PJBE 4HEPG 2DL9A 1JGEB 2AJVL 4M9OA 4O51B 5F89B 5DD6A 3G6JA 1YEHL 3RTQD 1JGLH 3FOMB 4Z7OE 3O4OB 2F5AH 1TENA 3KJ4B 1QSZA 4IOSD 2E8ZA 1NQBA 4RFOL 3C60C 2D0HA 5KZCB 1VPOL 4Y2DD 2FEEL 1G7JB 3NCYS 4Y89A 3G04B 3GSXB 4X80L 4P4RB 1IEBB 2IAND 2F5BL 3MLYL 4IRSB 4OIIH 2ID5A 4ZNEA 4KZDL 1QRND 1Q9LA 2HRLA 1KUMA 3WFBH 2F8VA 2X1OA 3DTXA 4KKBC 1OTUC 5CLTA 5IW6A 3UTZA 4QRPD 4JPIB 5LJYH 4C83A 3HC0A 1CT8A 2P5WA 2HMID 1BGXL 1FNHA 3CSPA 1F8TH 4HC1A 1A6TA 2AKRA 4Z5RB 43CAA 1QNZH 2EYTA 5C0IB 3F7VB 2H8PA 2Q76B 1XCTB 3JV5A 2XNAA 3FB6A 5IG7A 1G7PA 2AJ3A 4DGVH 1BWWA 1BHGA 3O8XC 4C54A 5D1QB 1VERA 1X9QA 4K3EH 2DM3A 3PDOB 4JGMA 3QUYB 1A7OH 2LVEA 3GSNH 3OGCA 1CFNA 4NDMA 2BVQB 3CD4A 5GJTH 1S7UA 2EIBA 3MGOA 5F9JB 1OT1A 1R3JA 1AD0B 1JWUB 1XF1A 4KAQL 4JKMA 1IGML 1BVKA 1KPRA 4Y16B 3WDIA 1FPTL 3STLA 2R2BB 1FIGL 4AEFA 4CDHA 4WDIB 2VDNL 2AJSH 3L9RB 1MUJB 1MLBB 1N8ZA 3VFWA 4XBEH 2XWBA 1FYTB 4P2RA 3K2MC 4M1DH 2A1WL 4HKJB 5D4QA 1A9EA 4MB5A 3ALXA 3HHRB 1KPVB 2XKNB 4QKXB 4AIZA 4A6YL 2V5MA 1U42A 4OZIE 5EIVA 5FO9B 3VGEA 4O51A 4Z76B 4CU8A 3D3VB 3FOMA 4FFWC 2QSVA 5GRYA 1K2DB 3VXRD 2WBKA 1L7IH 4WUUB 2VB5A 4OZFH 5FYJH 3C60B 1EEUA 4GRLB 4X4YA 4H1LH 2HA1A 4JLRB 3KNBA 4OFKA 5EO0B 1MCDA 4EZMA 1T03L 2C3VA 5I0ZA 2ED7A 1G7JA 5HHOB 1CD9B 4BUHA 1P4IH 3EYOB 4P4RA 4POUB 2RCSL 3RZCD 1HNFA 2PO6C 1G0DA 2WUCL 3IDJB 1WBYA 5D5ME 3GJEB 1TITA 4H20H 1CDCA 1Q38A 2QSQA 1S9YA 4IJ3C 4EI6B 4KKCC 4M7KH 2AXGB 1T89A 3MLWL 3BE1L 4DAGL 3E3QC 3OG6B 4AQ1B 4GRWH 4GG6E 2F8OA 4X8JA 2YD8A 3BP7B 2DQTH 2A9NH 1A8JH 4LNRB 1OTUD 3AS0A 3OZ9L 3PUCA 1QBML 1B0WA 1D5XA 4JFFA 5C0IA 3F7VA 4YHKH 4KUCD 4HULB 5I1IH 12E8L 4P48A 3E6FB 3QDGB 4ZO6A 1BZ9B 3O8XB 1IGYA 5D6CB 4XCNA 4N9GB 1LK3H 3D25B 3C8DA 5CZXC 3IKKA 5D1QA 2XXMB 4QCIB 1SJEA 2ZUQC 3LHPL 4HDIA 4MAYC 3R06B 4ZPTA 3HI6L 1S9XA 5SV4A 1ACYL 4PRHE 2BVOB 3DWTA 4EOWL 4XX1E 5D72H 2PW1B 4P4KC 2B1HH 1GC1H 2VXVH 2C1PB 2OMNA 5KVDL 2LU3A 4OFVA 4Y16A 5C6WH 4JFZL 5GJSH 2R2BA 5BV7C 2YK1L 5E2TH 1CFVH 3BPLC 3L9RA 2XA8L 1MUJA 5FYJE 1TDQA 5FUZH 1MLBA 2V7HB 3LB6C 4LQFL 1CGXA 1FYTA 4F58H 1NGXA 2C3HA 4NIKB 3KPPA 1KPVA 1IC7L 1R24B 5J89A 1F6AB 4NKOA 3LQZA 4XAKD 2NLJB 4KROB 4EBQL 3Q0HA 2R56H 4R4FH 4Z76A 2W07A 1KBGH 1A7RH 1Z9MA 4AK1A 2IMNA 1LO2L 2OTPA 2V6HA 3VFMB 1MCIA 1I7TB 4FTVB 5H94B 4UV4L 4GRLA 4Z7WF 4EEEA 1IGIH 5DQ9A 3LKRA 5EULV 3RI5F 1YMME 3H0TB 5HHOA 5C0JB 3EYOA 1NUDA 3QXWA 1EXUB 1R5IB 3EBAA 5CIPH 4BJLA 3GMLB 3GJEA 3ZKQD 4I9WE 2AV1A 1S8DA 2D31A 3MJ9H 1UWEL 3KPQA 4JFEE 2HT4C 3RY6C 4P3WA 5EIIB 2ZUSA 5D2NE 5BOPA 3ES6B 3VFUA 1L0XA 5SV3A 4WV1B 3ELAT 3V5DA 3WNMA 1LMKA 1GPOL 4PV9B 5FOBB 3DVFA 3O45B 5IJKA 2X4TA 2JJSA 5I30H 1AI1L 4DN3H 4CMMB 4PP1D 3CMOL 5KBNC 5J12B 2IF7A 4X7TB 5D6CA 4A2LA 5KS9F 3D25A 1RZIA 2ZUQB 3K81A 1CL7H 4IEFB 4KJYA 3TN0C 1G7LB 4QCIA 2BDNL 3OB8A 1ZA6A 3WS6C 5IMMA 2VKXA 5EBMA 3K7UA 4OT1H 3R06A 5KVFH 1OAUH 4PRID 3ILPB 1DBJL 4OV6F 3TNMA 4U4BA 1SVCP 3K4DA 3SCMD 3S88L 4MAYD 3RVXC 4XXCA 4MJIB 1DLFL 2OJEB 3IDUA 1XF5B 5IHUL 4M62H 1CXKA 1T1YB 4LSRL 3F7YB 4QRQB 4XGZA 1NFDF 2DQJH 5F7DB 4OZHE 1MWAH 4F7TB 4PGJA 1NCWH 5SWSA 2OXHA 2YN3A 3EYVB 5LAXB 4YHML 3TT1L 1L9MA 3TFKC 2BERA 4PRPA 3FB7B 3S97C 1NCCL 1RJZB 2PTTA 4YXHH 3LB6D 3FAXA 1LO5B 1EJOH 4JY4B 5EC1A 1F3JB 2Q8AL 2NLJA 2FX7L 1J05B 1WTGT 1YQ2A 3V7AE 2LAGB 3EHBC 3NIGF 2IG2L 4PTTB 1GVIA 3DETD 3I9GL 2NNAB 4TN9A 3SOBL 4PJHA 4FTVA 3AXLB 3QNYA 2CGRL 1YEGH 3HNSL 4J3VA 3SKNA 3SO5A 4D9LH 4NQEB 4GW4A 1OSPL 1UGNA 2ZNWA 1GYAA 2QHRL 2EIZA 1YEDA 5IQ7L 2GK0A 1PG7W 4OCSL 8CGTA 4P46B 4HWBA 1R5IA 4ZUWB 1FGVH 1KN4L 5MHSE 4FHBD 1S7WB 1DVFB 1PAMA 4H88L 4NUJB 5EA0L 5IVXE 4LLUA 1UM6L 2HVJA 3G5XA 5IM7B 3DHJA 3SKUD 4HT1L 3MV8A 4XWGL 3SKMB 1DBML 3BP5A 3DI2B 1RIHL 5IFAL 1TZIA 3MX0A 1D5BB 3ES6A 3MRMB 4BQ9A 1AIFB 1HYRC 2R2CA 1DUZB 1NL0H 3C2AH 4NZUH 1A2YA 3T4YA 4X5WB 1BFVL 3KPSB 3E0GA 3O6LH 4X6BA 2E6JA 4I18C 1UVQB 1I1RA 4YZFE 4PRDB 2ZUTA 2NXZD 4KUZL 4YX2L 1CG9A 1OP5K 2J8OA 2IAMD 2CQVA 1G7LA 1IAII 3CH1B 4FXKB 5L8KB 5KOMC 5EZLA 2ADJA 4FQ1L 2A2QT 3UEZA 1CFQA 1EH9A 5BV7L 3ILPA 3LEVL 5KSVB 3TN0D 3WFZA 3ARBC 3H3KA 5ADOH 5J7CC 1NANH 3CX2A 5LGHL 3QIWB 1DN0B 1RHHB 1QFWH 1ZT4B 2M26A 3JUZA 3BDYH 1F4HA 5BS0E 2J5LB 3QDME 4G8EA 4QRQA 3KYNA 4PD4K 4D3CH 4PJGA 1BFSA 3VGFA 3PXHA 4F7EB 3MFGB 5IEHA 5KANI 3CSGA 4S1RH 6FABL 2BHZA 2O61B 4O58L 3TBVB 3QWRA 1GOFA 1MCPL 3CAFA 5MP6H 3Q5YA 2IH3A 5JZ7C 4WU7B 4PRBA 3O3AB 1RJZA 2BFVL 2DQEL 1JZ6A 1MY5A 4JY4A 5DURD 4DVRH 3DRTA 1J05A 4AEHH 3TM6A 3WE6B 4J6RH 2D9CA 2AXHA 3H9SE 4PTTA 1B6UA 4DGIH 2NNAA 4GKOA 4D0BB 3GUTB 3GRWA 2CLRB 5AG9A 1A22B 3DMMD 5J0BA 5AZ2L 1XGQA 3HZVB 1DQLL 3TV3L 1I9JH 3WV0A 1K5NB 3U2SA 4PIRF 4P46A 5C09A 4HKZA 5T1MB 3FKUS 4ZUWA 2DQHH 4FABL 3V4VH 2IGFH 1WWWX 4KVCH 5T5FH 1S7WA 1DVFA 2WQRA 3TBSB 4GO6B 2PR4L 5DFTA 3NFNB 1Q9OB 2ZKHL 1MI5E 3SJVD 1E6OH 3DSFL 2GSIA 4WENB 3SKMA 1JGDB 5JO5A 2VE6B 5MENE 2J7LA 4G6JH 1AIFA 4YBLC 1CVSC 5C08A 1CICA 3BN9D 1DUZA 3P4LA 3FAWA 5DYOA 4ENED 2OL3A 4I18B 5HHNB 5SWZE 3VI4E 2QQNH 4F15B 1F45A 3NCBB 3ORJA 1DQDL 5LXGH 4OI7A 2D0GA 4YWGH 3TZVB 1KLFA 5JA8B 1CZ8H 1FE8H 3IXTA 1MHCB 3S36H 3ZT7A 4DUVA 2X09A 3CH1A 3GHBH 4UV7H 5I1HL 5JPMB 4FXKA 4GBXC 3HNVL 3EZJB 4F9PC 2VLRD 5DD0L 5IQ9B 1MRCL 4KJQD 5ACZB 2Z8WC 4U1HA 5KSVA 3WLBA 2PKDA 3MBED 4LHJB 3VCLA 3B5GA 3QT2A 4E5XB 1RHHA 1T04B 4TULL 4ZO9A 2J8UF 2D4FA 1HH9A 1AGFB 5JW4Q 2PYEE 4GKSA 4PBVC 1DANT 3BGAA 2P43B 4KJWC 3P30L 1JYNA 2DQDH 3CFBB 4M03A 3UC0L 2X4SB 1UKSA 3PABB 1RPQA 3F8UB 3H8NA 5DGRA 4YXLH 1LNUB 4OM0L 1JRHH 1ORSB 3TBVA 5ECJE 1CE1H 4WEUD 1U3JA 4KK9C 1BBJB 1PG7H 5ESQA 4IMLB 2CLVA 4U49A 4BFIB 4YHIB 4N0RA 3VRJA 1MFAH 5T1KD 4NSKA 4Z7UA 1T6VN 2R1YB 4XH2A 5HHPB 4O2CA 1ZANL 3OKDB 3SGDH 3I6GB 3U36B 5HYJD 1M71A 2AV7B 3PDGA 3GUTA 2CLRA 5CEYB 3FQWB 1S7XB 2FZ3A 5EOCH 1WWAX 3Q3GB 5CCKH 4JB9L 3D85B 1NCBH 4JO3H 2X6MA 1K5NA 4OD3L 5BXFA 2J6EA 5I1CL 2GJZB 3HPJB 5IIEB 2OCFD 2ZSWA 3EDEA 1WEJH 2CKBL 4M6OH 4TVPL 2DLFH 4OZGE 3P4OB 4KMQA 4YPGB 2DTML 4EDXA 3T3PF 4H26A 1UYWL 3W9DB 5GIRA 5HI3D 3PWPB 5TE6L 4DFHA 2DLEA 4YBLB 4HIJB 4LCWA 1X5IA 2CUHA 3IJHA 3ARDD 2DN7A 3KPRA 3UTTD 5E08H 2MKWA 5FHBH 4LRNL 1LEIB 4O2EA 2VISB 4LVOC 3F5WB 5HGBB 1N7ML 2G9HA 3PP3K 3FT4B 1KCUL 3RX5A 1MNUL 4L8DB 1INQB 3TZVA 5EH1A 2DQGL 4GBXB 3R8QA 3T2OA 1MHCA 1U8NA 1OTTC 1ITCA 1OL0A 1ADQL 5JPMA 1T21A 3LZFH 4IOFD 3P4NB 1UH2A 2AJZB 4F37K 4CADB 1NFKA 2G5RA 1WUNT 3GHEL 1P5VA 4Z7WE 2YR3A 2GJ6A 4RCAA 2A9ML 3CFIC 4R3SA 4BSVB 4MCZA 4F33B 2ZPKL 4QHLB 4NQSB 2R4SH 1HIML 4PB9L 1J11A 4HAFA 1LILA 3U7AA 3QRFM 3E6HB 3DUSB 4HJGB 4KJWD 3SGKC 5CEZD 1ORSA 1JPSL 2X1WL 4W6YB 1T6WA 1W0WA 3UYRH 3VRIB 5DEGB 3S3SA 1C5BL 4IMLA 2AEIT 5KW9H 5TFSH 2XI9A 4UT9H 4BFIA 4YHIA 2ATKB 1M6OA 4JQVA 1QSFB 3V6FB 5I71B 5L7XH 1FFOB 5HHPA 3SN6N 1GH7A 2B5IB 3MOAL 3MUGA 3B6SB 5DRZB 4C57C 5KS9E 3B3IA 3M17B 5ICXB 3FQWA 4QY8B 1HKLL 3D85A 1ED3B 2ENSA 4RAUA 4C58B 2JIXB 3INUH 2FDBP 4I2XE 2B4CH 4PP2A 5C0DA 4AENB 1T0PB 5GS1A 3HPJA 3ARFA 4QEGA 3P9LB 3OAZH 1DQQB 2IC2A 3P4OA 4YPGA 1GCFA 1I3GL 3NA9L 3T4AA 2ZG2A 3MNWB 4WO4D 3DNKA 1J87A 1DCLA 1CTOA 3W9DA 4NNXB 5C3TA 4NJ9L 5LWYL 2ZOKB 3PWPA 3AC0A 1NC2D 4KXZI 1QHPA 2W0FA 1FLRL 3DX8B 3U6RA 4LMQI 4MNGE 3UXFA 1WZ1L 1H3WM 4LVOB 1MJJB 5EUOA 2FJGA 1D6VH 2VISA 3PL6C 2A6IA 5HGBA 1YEIL 3TC9A 3B9DA 1ZSDB 3WUZA 1K4CB 1PKQB 4TUOB 1KCVH 3FFDB 1RZ7H 1PX3A 3KVQA 4RBPK 2XZQL 1S7VA 3QUZA 5C0FB 5AZEL 1RUKH 2GT9B 3QHZL 3P4NA 2AJZA 3NIGE 4CADA 1A7BA 1OTTD 2G60L 5CILL 3MA9H 3O6FC 4OCWH 2R0WH 5ITFB 3OKMB 2R15A 5ICZB 4BSVA 4DVBA 1U3HC 1EFXD 3QG7H 4YE4H 2AP2A 5F3BB 5EU6D 5SWQA 4MVBC 2AS5M 4GS7B 2Y7QB 5B22A 4ZDHB 4I0KA 4HJGA 3K4ZA 1R3HB 2CK0L 2VL4A 5C92A 1NGQL 4N90E 5I76B 4FN0A 4ERSL 1YC8A 4QXGL 3LKSA 4M6AA 1RZFH 3VRIA 2PF6A 5JQHC 1HH6B 2UVFA 4M1GL 4XC1L 1TJIH 5BRZB 2BXYA 2ATKA 5I8EB 2DD8H 1BQLL 4ELMB 4ODXA 4PLKD 4LFHD 4LF3B 2WBJA 4Z0XB 5DS8B 5T5NG 4NWTH 1T7ZA 2MHAA 3FO0H 2XTJD 5HGAB 5DRZA 2N56A 5GGTA 3VFPA 5I8OH 4XPBH 2NYYC 3M17A 4LCYB 4KUCF 2WZPD 4QY8A 2JIXA 1F3DH 3EFDH 4JANB 1KF9B 5DSCA 1JHLH 3ET9F 4S1QH 1Y18B 2WQ8A 1UACH 3P9LA 5GGVH 1S5HB 1PZUB 3FB5A 2E3VA 1U36A 1WSST 1QVOB 1DQQA 3CFKB 3ZO0A 4WEMB 3EYQD 1I1YB 3L5XL 3FO1A 1QPXA 2OM5A 5J57B 4NNXA 4ONGL 3TT3L 5D9SB 1F2QA 5DMYA 3AY4C 2DICA 1EEYA 1CLOL 3QHFL 1NBQA 4XP5H 1KIRB 1MF2H 3PL6B 4C55A 2PW2A 5F8RC 4R4ND 3W0WB 1KENH 4RAVA 3HE7D 2FNBA 3B9VA 4J3OC 7FABL 4DFIA 2FBJH 4OGAC 5C0FA 4ZTPL 5IGXL 2W92A 2UVEA 4EVNA 3MO1B 2AABH 1T0NA 3DX7A 4PJ8A 3BHBB 1UQSB 4YHNB 3MRDB 3KYAA 5JHLL 4J7RA 3OSKA 4J2XA 4HS8H 1QO3B 4B7LA 2KPNA 4NQDE 5ITFA 4S0SD 3N1FC 3CFEB 1BAFL 4DOHB 2YEZB 4X4MA 3A6BL 3O6FD 2AJVH 2LV4A 3HUJA 2Y7QA 3VG9C 4ZDHA 1YEHH 2V9TA 4XHJD 1GGUA 5DXWA 4MD0A 1R3HA 2HWZL 5I76A 2EDBA 1FFNA 1T5XB 1P4BL 3QXTA 4IBLT 4HKBA 4HUUA 4JY5L 4RFOH 3ZKXC 4CN4A 4L4TA 2FX9L 1VPOH 4HH9B 5H37G 5BRZA 3WIHA 4H25A 1U95B 4U6HB 5I8EA 3TPKA 4MLSA 3DURB 4X80H 4ELMA 2F5BH 4LF3A 3MLYH 3RZWA 5IVNA 1ND0A 5DS8A 2DB8A 1RZGB 4KZDH 1T83C 1VGKA 1NAKL 2VZ1A 4JRWA 4NQXB 4PJXB 5C70A 1BD2A 5HGAA 5IUSA 4MA8L 3OMZA 3A6CL 4Z78B 4OCYL 1EV2E 1BGXH 4P57B 2F54B 2FJHA 5TJWK 1FZJB 1MCOL 4JANA 2XN9D 4OKVB 3QA3A 3RKDC 2BNUA 2NX5D 1RK0A 3VGAC 3C6LC 4GKZA 3BN3B 2J8UE 1S5HA 5GZOC 4V1DE 3FZUC 1CGVA 4JFHD 1I1YA 2IPKB 5HVHB 4PJ5D 1X4YA 3A0OA 2B7DT 5D9SA 1DLHA 4O5LL 3V6OC 3UDWC 5E5RB 5C0BD 1RHFA 1EAPA 1HXYA 2VZSA 3WJLA 3CU1A 5CMAB 3C5SB 1XAUA 4JHBA 1N4XL 3T65B 4KAQH 2Y07L 3BIBX 1BLNB 1FPTH 1FIGH 4Z7VB 3BHBA 2VDNH 1MFBL 2BNRB 3FCTB 4RDQG 4YHNA 4D0DA 3L7FA 3MRDA 3N9GL 4JZNB 1E28B 2Z31C 2A1WH 2NY4C 2K1MA 5EOTB 4PJEF 4R7NB 4A6YH 3CFEA 4WTWA 4E9LA 3BSZL 4U6YB 2YEZA 4RRPG 4KJPC 4LLMB 3VG9B 3O3EA 3P2TA 2P5WD 4KZEL 1I8KA 1P84J 5DTFB 3ARZA 3MV9B 3UPCA 4U1LB 4NOBA 5H8DA 4MXVF 3ZKXB 3GSRB 4PJAF 1T03H 1CDHA 3VWKB 3Q5TA 1ZWIB 4TSAL 4U6HA 1AP2A 2FYYB 2DIBA 2B39A 2XG4A 3DURA 5T3XD 1KIUA 2RCSH 2ZUXA 1T5WB 1YJDC 3H9HB 2FSEB 1RZGA 3NGBC 1OD9A 4WGWB 2BSRA 3QZWG 3MLWH 3BE1H 4Z78A 4DAGH 4KWUA 1X6LA 5DHVB 3MJ8A 1LO3L 2D7OA 4UOW0 3IFOA 1BOGB 2C4FU 4XMKL 1MCBA 3OZ9H 4DTGL 1HHKB 2XZCL 1QBMH 3C6LB 2DWDB 3BKCL 3T04D 3MXVL 12E8H 2YHGA 2C3XA 3H7BA 3RHWK 1U8JB 1A5FL 2P5EA 4I5BB 2EDLA 4XVJL 4P2RD 1EK3A 3RPKA 4AT6A 1BZ7A 2VH5L 3QIBA 4UIMB 5INCB 3LHPH 3MMEB 3LN5A 3MLPA 3EW3B 3HI6H 1ACYH 1VEOA 3F58L 3GB7B 5CJQL 3N1PC 3OKLA 5CMAA 4EOWH 5JDSB 1C08B 3GEWB 2IANE 1TNMA 2X4OB 1U8OB 4XXDB 4KPHL 1J7VR 1MREL 3TP4A 3V5KB 2IFGA 4Y1AA 5KVDH 4ZOCA 1U8PA 4JFZH 2YK1H 3O3DB 1D9KC 1ZT1A 4DK6A 1AC0A 2BNRA 2YA0A 3IETA 2Z31B 4JZNA 4LQFH 4EXPX 2NY4B 5JIKA 4QF1A 1F11B 2NQCA 3QDJE 3D18B 1EJ6A 4DN4L 1XGUA 3Q5OA 5EOTA 4R7NA 4R26L 2ORBL 1QR4A 2NY1C 4LEXL 4OV5A 1IC7H 4N0FB 1A9BB 1X6NA 1CLCA 1J9CT 4YPJA 4EBQH 4X6DB 2J3SA 5IJKC 4RFNB 4X9HA 1PVHA 5DTFA 2DIAA 3WD5L 1LO2H 3VFOB 3AUVA 4JFFD 3NAAL 4U1LA 4G42A 5FKPB 4UV4H 2ERJC 3LKNB 1CXFA 2QJDA 5CHNB 5E99L 4AYFA 3VWKA 3BXNB 2Q6WB 3NFSL 4K7FA 4MA1C 1X4XA 2GITB 2FYYA 5D1QD 2PXYC 3B9AA 3NGBB 3L3GA 2EXYC 4HK0B 3EUUA 2AXFB 2GW5A 2O26U 1ZHLA 4NT6B 1UWEH 5B3JF 3MSPA 3CDGB 2W60A 1QLFA 1EO8L 1QTYT 1XIWC 3WFDL 5KAQF 1B4RA 4TNWF 5CSGA 3OJDB 1RZJC 1HHKA 1A7QL 1GPOH 4Y16D 3ULVD 2DWDA 3RJDA 2R2HB 1AI1H 5LGJB 5I15L 3QRGL 1YN7B 3CMOH 4G8GB 3ZKSD 4QHKI 3SE4A 4KQ4L 4P23C 4MXQD 4QOKB 1FYTD 3VXRE 4RNRB 4I77L 4HS6B 2BDNH 2UY7A 1IZKA 3MMEA 2H32B 4W6WB 5CGMA 4PUBL 1DBJH 1UWXK 3D3VE 1G7MA 2QKIA 5TGBB 1P7KB 3S88H 4N0CD 4BZ1L 2NY0D 2X4OA 4JVWA 1DLFH 1U8OA 4XXDA 3MZGB 3I2CL 1UH4A 4PPTA 5IHUH 3KHQA 1D9KB 1DQMH 4XHQA 3QCUL 1K3ZA 3HZKA 4LSRH 4D0CB 3DROB 3QXAB 3TCLB 3QZWB 1ZXQA 4GRMA 3EGSB 4X9GA 3MGTB 1J0YA 3GSVB 3V6ZB 4JRYE 1A1MA 3TVMC 5C0CB 4L4JA 4PLJC 4YHMH 3TT1H 3RY4A 2E7BA 1NCCH 1XFPA 4N0FA 2Q8AH 4XP4L 3MJ6A 2FX7H 2BNQA 4MS8C 3DYPA 2NY1D 5HJ3A 2IG2H 1QACA 3O3UN 3I9GH 3FQNB 4GG8B 5HD8D 1YJDL 1MEXL 2X40A 3CZJA 3U7YL 2ERJB 4OI8A 3QUKA 5D2LF 5HHMB 5FCUL 3MRNB 4YHPA 2CGRH 5E9DD 3TO2A 3BJ91 1FJ1A 3HNSH 3VFSA 1Q9KA 3VWJA 4ORGB 1OSPH 2PXYB 2QHRH 2Q6WA 5KVMC 5IQ7H 1S78C 4UAOB 5CAYB 1OAZL 3MCLL 4OCSH 1XGRB 1KN4H 1A47A 2AXFA 3HB3C 4P5TC 1W0VA 2Q86B 2GIYA 5BZDA 2CR3A 4H88H 5EA0H 1XIWB 1UM6H 1PDKA 4BFGA 2O5ZL 4I48A 4NT6A 4OM1L 2EXYD 4HT1H 2H3NB 4XWGH 1DBMH 1DANU 1U8IA 1RIHH 5IFAH 3RWJB 4JAMB 2WIIB 3OJDA 4PGCB 3O41B 1DE4B 3TA3C 3P0VL 4K3JL 1MCFA 3RNKB 2G75A 3KXFE 4U1IB 1OP3H 4GW5A 1IE5A 1BFVH 2HFGL 4RRPA 5I1EL 5J6HB 1EO7A 4KUZH 4YAQA 4QOKA 3B9KC 4YX2H 2BP3A 5SWSD 2JCCF 1B4JL 3U83A 4HS6A 1IKNA 4PRPD 5CJXA 4FQ1H 4W4OA 2H32A 3JV4B 5BV7H 4Y4HC 2PCPB 3JV0A 3LEVH 3T1FB 4FFZL 4N1CA 1XR9B 4KROD 2P45B 1T1WB 4HKXB 1P7KA 5C0EA 2Y5EA 3AB0B 5LGHH 3OV6A 5FDWB 4PJ7F 4YO0B 2KZ1B 2L7UA 4EKXA 4WWKC 3ZE2F 3P4MA 4FTVD 1T0MA 5DZNA 4MX7B 3AGVA 3QXAA 3B2UD 3TCLA 3QZWA 3EGSA 3MGTA 4BK5A 6FABH 3GJFB 1VKXB 4HH8A 2YRZA 4O58H 3MRGA 2C7UA 5E4EB 1MCPH 5IWLA 5GQBA 3MLXL 2BFVH 2DQEH 4OCRL 1YPZA 1IFHL 1RFDL 4HZLB 5IESL 3MV8D 1DBAL 3PIQA 3VFTB 1MIML 1AXIB 4PYGA 1KLGB 5CBAB 5DEFB 5FM8A 3R1GL 4KVNL 4LSVL 5JOEA 4PRIE 4NRZA 4R6UA 4KY1L 5AZ2H 4OIAA 4W68A 1IQDB 3BRFA 4ZSOE 1DQLH 4ORGA 3TV3H 3Q1SL 1JYVA 1NDGA 4YDJB 1WZKA 1BVLB 1PFCA 3W11C 3OB0K 2HLFC 1P7QA 4DKFL 5GRJL 4FABH 1RZJL 4LCIL 4MNQE 4PGBA 4G6AD 5J1AB 2YBRA 2EKSB 4L3EB 2BRRL 3LN9A 4NCC1 4PJDE 2PR4H 1G7HB 2F58L 2ZKHH 4JKLA 3CIQA 2H3NA 2XWJB 3DSFH 3OXRB 3HB3D 4XPAL 1JF1B 4N5UA 4JAMA 4RMTA 1X5AA 3SBWC 1IAIM 1CN4A 3O41A 2NTSP 1DE4A 2ADFL 4DKAA 4J3SA 4WW2B 3RNKA 1KB5B 4HZAA 5D1ZB 4JVUA 5HDBF 3B9KB 4PJEE 3TA3D 5IR1B 1DQDH 4NN5B 5EFIB 5CEXB 2VTFA 4UNTA 3O2DA 1ORQB 3QWRD 5EPMA 5I1HH 2A6KA 4K94C 3HZMB 4Y4HB 3HNVH 4PG9B 5DD0H 1MRCH 3JV4A 3T1FA 3SDXE 3BZEA 5C0GB 3CX5K 3B83A 4ZOEA 3EDDA 3ARVA 5AWNL 4TULH 4L29B 3QXDB 3QUXB 1VDGA 1ZE3C 3BJLA 4UDUB 3X13A 4PJAE 1I9IL 4PB0L 1OM3H 3P30H 3UC0H 4MX7A 4GOSA 3DV4B 4HK3N 4G9FB 4UU9B 2AK4B 4GKNA 1MJ8L 5JW5B 4L8CA 5EORL 5C09D 4OM0H 3RDTC 3MODL 3D39A 1OGAB 1XGTA 2BK8A 3DGGA 1CFBA 4ZAKC 1VFAB 4MWFB 3BOVA 3OG4B 4JHZA 3RU8L 3QXVA 3BZ4A 3PWJA 5SX4H 3HG1A 7CGTA 1S7SA 4OLUL 1RJYA 4WHTA 5CBAA 4UTBL 4LVNC 1ZANH 1GGYA 1I85A 4KRLB 4I4WB 4N68A 4PBXA 2R0LL 5C08D 3N06B 4MDJA 1CICD 5I1LB 5ETUB 1SHMA 4HCRA 3LQMA 2MCPL 3AMKA 4JB9H 4EUPH 4M4RA 4HIEB 3VE0A 1BVLA 3T0XA 4LPXA 1IT9L 1KJVB 5E56A 5I1CH 1KTDA 1VEPA 3FFCB 1MCSA 1RVFL 2CKBH 2EKSA 4TVPH 5I8KL 2XPGA 4TOYL 4YNYA 2HLFD 3S4SB 5D93C 1PZ5B 2DTMH 1UYWH 5DMKB 2ZSVB 5TE6H 4C4KT 4PLOB 4LRNH 3CFJA 4GW1B 1IGFL 4WHDA 3GMOB 5D1ZA 1N7MH 5EG6C 2Y06L 3DV6B 1MNUH 2ZUYA 3ZT6A 2DQGH 1ORQA 4JE4B 1I7ZB 4JQVC 1ADQH 5HDOA 3HZMA 4Y4KA 3NBNA 4R7DB 4N0YL 1TLKA 2CDFB 1LEGB 2EYSB 3JWOL 3MCKA 4KMTL 4FXGB 3GHEH 4NPYB 3QXDA 3PGDA 3MV7B 5JUEL 2A9MH 3WIFB 4JFXB 4GLRI 4PRNB 4V2BA 4Y19A 2ZPKH 1HIMH 1SMAA 35C8H 4PB9H 2VITB 2WINB 3SDCB 4PGEA 3SJVE 3ARGA 1P5UA 5MI0B 4G9FA 3RDTB 2MKLC 4UU9A 4ETQA 2AK4A 2OL3L 5DVLA 1IL1B 5TF0A 4ZAKB 5C0AB 5EZIL 4ODWB 1JPSH 5B3JE 5EN2A 2EE9A 1LP9A 1OGAA 3MLUL 5JDJA 1KSRA 1IC1A 1IGJA 1VEMA 1C5BH 3DVGA 4MWFA 4POYA 1WC7B 2BVPA 2Q8BH 1RZKC 2EDEA 5GGUB 1YNLH 4LVNB 2QHLA 1A7NL 4U1JB 1FYHB 1OW0C 1JJUA 1RV6X 3REWB 1WAAE 2DIJA 5ESVB 4LCWD 2EDXA 1HHHA 3MOAH 3KPRD 2VLRE 4PJXF 1B9ZA 5ETUA 3QO1B 4WGVB 2V2WA 2V5YA 3CSYA 3BP6B 5I6XC 1HKLH 1LWRA 3EOBA 3MUY1 1KGCD 2MPAL 3SKOA 1ZHBB 3HI5L 3RVTD 4M8QB 3TZVD 3O4LE 2ATPA 1KJVA 3SE3C 5M7QA 1CI5A 1QBBA 4UIKL 1QBAA 2LVCA 5FKAA 5D93B 5IHZA 1FFRA 1I3GH 1PZ5A 3NA9H 4L8SC 5B39G 4Q9CA 3KLAB 4NJ9H 5LWYH 4APQA 4HIHB 2GJ6D 1FLRH 3TJHD 1FZKB 4LIQE 1WZ1H 4K94L 1REIA 5DO2D 3MR9A 5MERA 1YEFL 2VLKA 4GUPB 4YGVB 4CW1B 4GW1A 3VXQB 1S7TA 3GMOA 1YEIH 2GYSA 1TTFA 2F74A 2D7NA 3C5JB 5D7IB 4PJBB 5AYQA 4F57L 5B8CB 2GAZB 4IIQC 3DVNB 2XZQH 3EO9L 2YC1B 1ZLUH 5HYJE 3P0YL 5AZEH 4WU5B 1I7ZA 3TBYB 3QJFA 1F3RB 3QHZH 4OUUA 4Z7VF 1LEGA 1T7WA 2EYSA 3DI3B 5JW3L 1DUYA 3EOAA 2G60H 5D2LE 5CILH 1T22B 2XV6B 2IADA 3IDNA 4FXGA 4NPYA 3VMOA 5GGVY 2UUDK 5F6HJ 3L3HB 3WIFA 5JNYA 5ENWB 2WINA 3LPGA 3SDCA 1ONQB 4OZFG 1WK0A 2Y9RT 4H1LG 1S5IL 2CK0H 1NGQH 1YA5A 3ARFD 4QXGH 4HLJA 3UTTE 4F2MA 1SJXA 4EQ3A 3ZTJH 1WC7A 3FQXB 4M1GH 4FZ8L 4XC1H 5F6IB 4F9LC 3RVWD 5GGUA 1FO0A 1I1AC 1BQLH 2VYRE 3IFLL 4JZJA 4KRMB 4U1JA 3HCVA 3PWPD 4HUNB 4OD1L 2HJKB 4L9DA 5ESVA 3UPAA 4HBCL 4HF5L 4LPCA 2QQQA 5I6XB 5KSBA 2JCCE 2DM2A 1CDIA 4LHUA 3BP4B 1HHJB 4PJ8C 2QBWA 4JDZB 4G6KL 3QUZD 4M8QA 5HHVL 1VADA 3ROLB 3TNNB 1R5WB 3BESR 3OJVC 2GSGA 3TIEB 4RGND 2LU4A 2G2RB 5CJBA 3U46B 4PJ7E 4L8SB 1TJGL 4JEGB 3L5XH 1JTPA 5EIQA 2BOBA 2KBGA 3ZE2E 1SEBA 4ONGH 5BMFL 1JFQL 3TT3H 5CEZE 3QUMB 3F6LA 1E27B 1MJ7L 1CLOH 3QHFH 3BYTA 1D5ZB 3NN8B 1YEKL 4HMDA 1FZOB 1N26A 3BD3A 4GUPA 4CW1A 5IROA 1MRDL 1AKJB 4OZIB 3IGAB 5D7IA 4TVSa 5IB2B 3UTQB 2GAZA 5B8CA 3MFFA 3QEHB 3V0VB 2N7BA 7FABH 4UNUA 4ZTPH 5IGXH 4WU5A 3ABZA 4NQTA 2ZUUA 5HYFA 4MCYB 4B7IA 2H2SD 3RQ3A 3UBXG 1RAMA 1A4JB 3P9MA 5IBUG 5FYKD 4BUGA 4WUKL 5JHLH 1DDHB 4G6ML 1T22A 1BFTA 1MVUB 2WBJD 2P48B 5C9KA 2V9QA 5T1LD 3ARPA 3X14B 1X7QB 4PFEA 1BAFH 3A6BH 4J23A 1MRFL 4NQCD 5D5MB 1RZKL 4K3DL 4QHNB 1ONQA 1I8MA 1E4WL 4X6DF 5A2LH 2ZZUT 4NO5B 5B39B 2HAZA 1MAML 2R1WB 4N0UE 4GG6B 4L8BA 1U93A 2HWZH 4K55A 5A2IH 3KPNB 5D2NC 5CGTA 4U1KA 4UB0L 5FYJU 4JY5H 3ZZ1A 4MAUL 4G6FB 4AZ8A 1I1AB 2FX9H 3CLEL 3KPOA 2RAMA 1T7VA 2ED9A 5IJVB 1GIGL 4Y4FA 1IM9A 3MJ7B 2HJKA 1N59B 3EDKA 5HDBE 4C59B 1NAKH 4M5ZL 4ACPA 4G3YL 4TTDD 5JXEA 3LPWA 4DUWA 3A6CH 3U4BL 2OYPA 4OCYH 4PRHB 1Q0XL 1HHJA 4WNQA 4KK6C 4G7VL 5TDPB 1MCOH 4XPGL 1WT5C 3HKFA 5IMOB 1SY6A 3FT3B 3QUML 1R5WA 1QR1B 3HZYB 5EU6E 3VA2C 4GH7B 4PJ8D 1J1XL 2AERT 5F70A 4OQTL 5D8JL 1P7HL 2QV2A 1M7IB 5D6DA 1SM3L 1NCUA 4UMGA 3RWHB 5M95B 3VFGL 5FHAL 4QRUB 4OFIA 4O5LH 5DUBA 4LGRB 1ROWA 1T4KB 3J7HA 2APBA 3NVQA 4JDVB 1Z0NA 3WFEL 5CWSB 1JYXA 1AGCB 3F65A 5GGTL 1GGTA 3AREC 4JG1L 2FD6L 2EXWC 1N4XH 2X10A 2MQCA 4LAJH 3V0VA 2Y07H 1G9NH 4Z18A 1AO7E 3HRPA 3DECA 3RVVD 3SDAC 4HG4J 1MFBH 3WSQL 4AL8L 1A4KB 4L4TD 1A4JA 5BRZD 2CPCA 3SEPA 3N9GH 1YY9C 2VDQL 2VXTL 1DDHA 1ZS8B 1MVUA 5KSAC 3QPQC 2R9HC 1KJ2A 5E8EB 4BFBD 2BVTA 4Y8AA 1BD2D 3BSZH 4MQ7B 2X70A 2NY3C 2OK0L 2I07B 3TO4B 1MCJA 4QRTB 1KPUA 1G1CA 3WFCL 4KZEH 2BC4A 4JFEB 3QEQA 3GSNA 3PV6B 2VAJA 1DP0A 1D7FA 2Y4SA 4NO5A 2R1WA 4JM2C 1E4XI 3PHOA 4WY7L 3C5ZB 5D2NB 1GRWA 1OOAA 1P53A 1EHNA 3LRSB 1Z9SA 2GTWA 3BGFC 4OLWL 3BEVB 4N1HB 3GSOB 1UJTA 4OQ1A 2MQ0A 4TSAH 2ICCA 3PWVA 2V2TB 2EDDA 1MHHB 5IJVA 4ZXBC 3H6JA 3EJYC 1X5XA 1F5WA 1JI2A 1HSBB 1XF4B 2ITDA 5C3LD 4GAJL 1K4DA 4DCQA 1KCKA 4UQ2A 4PRHA 3UBXB 4YDKL 2EDKA 2H41A 1LO3H 1XF2A 4XVUD 5FECB 4XMKH 4DTGH 2XZCH 3FT3A 1A6PA 3BKCH 3MXVH 1D5IL 2A0LD 4YFLF 4KK6D 4PRAB 2WMPA 3STZB 2E6PA 5L6YL 4QXWA 3SKJH 1A5FH 4K8RC 5IK3A 4OZHB 3DO7B 4OZFA 4XVJH 4YDLC 4TUJA 1QA9B 4H1LA 2VH5H 3WIHL 5E95B 1MCLA 4JFYB 3LKOB 4NO0A 3QFDA 2YXFA 3F58H 4HFWA 1JI1A 1ZGLP 4O4YH 5CJQH 3LS4L 4BQ8A 4ODUA 3AREB 2ZWLT 4UQ3B 5CIPB 3ZDYF 1AGCA 3VRLF 1KTKE 4CVXB 5ISZA 4KPHH 1MREH 4G80B 1I8LA 3SDAB 3RAJL 2WM0A 3C08L 3WN5A 4HGMA 2EO9A 1IAOB 1A4KA 4JZOB 4BK4A 1UEMA 1TQCC 4PJXE 4JY6B 2DMCA 1XMWA 1GZQB 2XN9E 3TPUB 1YMMA 4DN4H 1CWVA 2BHUA 1W0YT 1UCBL 4R26H 2ORBH 4YBQC 1FN4B 2NX5E 4LEXH 1VCAA 1YY9D 4ZS6D 5KSAD 4EN3C 1FVEB 2I07A 3O3BB 5IVXB 4JFHE 5I1AA 4ODTL 4PJ5E 4ESKA 4PTUA 3LQAC 4JM2B 3VXOB 1F3DJ 2VC2L 3PV6A 3WD5H 5ABDE 2NY3D 3LN4B 1E4KA 4ZNCD 3C5ZA 2ARJB 3NAAH 3SE4C 5C0BE 3LRSA 4K9EL 2UYLA 5E99H 5L8LB 3BEVA 4IRJC 3OKEB 4J4PC 3G6JE 3NFSH 2P5ED 2V2TA 4ZXBB 1KJ3L 5DHVH 3OAYK 3FOLB 3QIBD 4LLQB 5TH2B 4LLWB 1HSBA 4BH8A 1AE6L 1MWAB 3IAGC 3WFDH 3RKPA 1EO8H 2GQHA 3OBAA 5F7MC 4PY8I 3LV3A 3UBXA 3HC3L 3WHE0 4PR5A 1DR9A 2P42B 1KYOJ 1BX2B 4ZNEE 4Y1AD 3MC0A 4Z7VE 1A7QH 1IMHC 5E70A 5HTSA 4U3XA 5I15H 1OPGL 5BS0B 3QRGH 4NRYA 3QDMB 4B0MM 3STZA 2BNRD 1J88A 3LSOB 4YDLB 4KQ4H 5I75C 1YZZA 5I66B 1NCAL 1YNTB 4I77H 1QA9A 2GCYB 3PQYD 3QP3A 5CP7B 4Q7DA 1VENA 4K8RD 2DWEB 2CRMA 4PUBH 1ZAGA 3ULUC 3ARXA 4LMQE 2YRPA 4RA3A 4BZ1H 5D7KD 1UZ8B 2FL5B 1NCDL 3I2CH 3H9SB 5DK2A 4P5KA 1DTUA 3C8KA 3QCUH 3ZKMD 4ZFOA 1H5BC 1HCVA 3NIDE 1ERNA 3KS0J 4JZOA 3VWKD 2W9DL 4K2UL 1I3UA 4JY6A 3BKML 4G8FA 1P9MA 4OF8A 4M61B 3EYFA 2WW8A 5C6TL 4XP4H 2IALA 3SPVA 3O3BA 5IVXA 4UBDC 3CC5A 4YBQD 4P2RE 1OF2B 3VXOA 3T0EA 1MI5B 4WI6A 2FIKB 1YJDH 3UO1L 5K9KA 1MEXH 3U7YH 2XIDA 2ARJA 5FCUH 5MENB 3LCYA 3QBTB 5FUOL 2JK5A 1RSFA 4IRJB 5IT2L 4XZUB 5I0DA 4RGOL 2BY2A 3V6OE 1ZA3A 4FQ2L 3OGOE 5B21A 5SWZB 1AR1D 1OAZH 3MCLH 2GTZB 1LE9B 2VDLL 3EO1B 4HEME 3OKNB 3VXNB 5C6PB 2NMSA 4M93C 3RIAK 2BVEA 1HEZB 1MWAA 3WDHA 5IB3A 2O5ZH 4RQQB 4HX1A 4OM1H 2D0FA 5CBEB 4PREA 4S1DD 4P2OA 1IKFL 1U91A 1VFBA 4K8RL 5DJYB 3RL1B 1Z3GL 2F9BT 5GZNC 1BX2A 5FV1L 2PYEB 3P0VH 4K3JH 2FGWL 5GS2H 3RVUD 2OS7A 3JV6B 5I75B 2HFGH 1S7QB 5I1EH 2VLJA 2NR6C 4NC0B 3G08A 1HHIA 4KTYA 1B4JH 3KYOB 1YNTA 4JFFE 4NC1E 3KPLA 5ANME 5C8JB 1OSZB 4Z7UF 3E1F1 3TH3T 4LSSL 4IMKC 3STBA 2VABA 4FFZH 4F7CA 2BNQD 1QKZL 5AYUL 2Q3AA 1WCQA 3KHOA 1CGWA 5JLZB 1UZ8A 2A6JB 3ULUD 1OGTA 4ZYKB 3IRPX 1H5BB 3FB8A 1AJ7L 2W65B 1JK8B 1JTTA 3T2PA 1R3KA 1FG2A 3VWJD 5BQ7B 3MRPB 1U58A 2O5XL 3LQAL 5GXBB 4QHUB 1CF8L 2K3TA 1YC7A 1ULVA 3IVKB 4AMKL 3BZFB 5J13C 4JN2A 2BCKB 4XCYB 3ULVE 1NGYB 3ULSB 2VR9A 3MLXH 3I84A 3D2UB 1BQSA 3DUUB 2DRUA 2VSCA 4OCRH 2FB4L 4M5YL 1IFHH 1RFDH 5IESH 4YK4C 4F7MB 5J3HC 5J8OA 1DBAH 4OZGB 4X98B 1MIMH 1MLCB 3OKYA 2GUOB 3I85A 4QRRA 2JJVA 1BF8A 3T09A 3R1GH 1SQ2N 4KVNH 1FCCA 4PY7B 4LSVH 2YD7A 4J1UB 4FQIL 1B88A 2G5BB 4OAWB 4KY1H 3UPRA 4OFYA 2XKSA 3Q1SH 5SWZA 4PJIF 2GTZA 1LE9A 5DD3L 4JGJA 4DKFH 5GRJH 4LCCB 1RZJH 4LCIH 4FQQB 4S11A 1JWMB 2C1OA 1A1NB 2F53A 4KDTA 1HEZA 2BRRH 3HE6C 3QEUB 4EI5A 1WV7T 3REVB 2CSPA 5FGCE 1FL3A 4PJ9C 3OX8A 4E41E 4KKAC 4XPAH 4K3GA 3D0LB 5DJYA 3NMEA 3V8CA 5GPRA 1T1XB 3RL1A 1BIHA 1LE5B 1JWSA 5TDNB 5ILTL 1TXKA 1E4XL 5DHYB 4Z7WB 2ADFH 3DPBA 2LU7A 4XCEB 5GRVL 5T3ZD 3JUYA 4UINL 5A3IC 3TGXA 3MRFB 3ULUL 1S7QA 2ESVA 2H2PC 4XI5D 3S3JA 1NGWB 4YEFA 5C8JA 4I0PA 2HH0L 4NBZB 4ODVL 1U8HA 1Q1JL 5E1AA 5E9DE 4KFZC 4N8VG 2V5RA 5EBLB 4R8WL 4NKDB 1I85C 2HT3C 4FP8L 4KMLB 1WBXA 4NNPL 5AWNH 3H42L 3BIKB 4NN7C 3CSBA 1FNGA 1RJLB 3EOYG 1I9IH 3GJFH 1FORL 1QLRB 4PB0H 5JW4M 3FHQA 1BJ1J 3ILQC 1JPFB 5KS9B 3ECBA 5DLML 2VIRB 5J13B 1RJCA 1MJ8H 3F7RA 2MFNA 5EORH 2LFGA 1P7QD 3IVKA 4UI2A 3MODH 4UDTA 1HDMB 1D5MB 3QIUA 4M48L 3ULSA 4I2XB 4LRIC 4OF3A 1JUFA 1A6WL 4XNMB 3DUUA 4YK4B 4Q9BA 4OKDA 3RU8H 5JW4R 4G8IB 4F7MA 1RZ8A 3RA7L 1MHEB 4X98A 5SWSE 1MLCA 2VQ1B 2GUOA 4UTBH 1HILB 4X6CF 4PRPE 4IHOB 2R0LH 5GRUL 4NHUB 2G5BA 1JMXA 2KDGA 3L5WA 4MNGB 4WJ5B 2VSDA 2MCPH 3QQ9D 2R23B 3UTSA 5F1NB 3C6SA 2JJUA 1M05B 4K23H 1NGZB 1WLHA 3ZDZF 1BIIB 43C9B 1HQRB 2P46B 1R3LB 5E94A 1IT9H 3K1DA 4PJHE 1RVFH 2E7CA 3ZDYE 1KTLB 3VRLE 5HBBA 5I8KH 2VUOA 4TOYH 4QGYA 4PJ9B 3QI9C 1VA9A 2D4DA 2FHBA 5I73C 3K8MA 8FABB 3HE6D 5DFWH 3QFJA 1T1XA 5D1XA 4JREB 1IM3A 4FQXB 1G6RL 2FO4B 4PV8B 3MOBL 1BECA 5DHYA 4FMKA 3RGVB 1E6JL 3B43A 5FM4A 2NZ9D 2B2XL 1IGFH 1U8QB 2V5SA 3MV8E 5E8OB 4U6VL 4NKMB 3MRFA 4QWWD 3S5LG 2Y06H 2IQAA 1H3UA 4TTGA 3P11L 3NPSC 4D9RD 3WHXA 4HHAB 3D39D 4Q97A 5I1GL 3VXSE 2H2PD 4MSWA 2WLYA 1T7XA 4JFDE 4N0YH 2GK2A 2EH8L 3VA6A 1CLZL 3HG1D 3JWOH 4KMTH 5J1TC 2E8YA 3FQTA 1LEKA 5JUEH 4LEOB 3KLDA 5E24E 1NGPL 4FNLL 5IW1B 3DYOA 2Z4QA 5GGSB 2Y36L 3I6KB 2WBWB 4N1EA 5KS9A 2EIDA 2HFEA 3V0AC 4UILL 5DK0B 5J9PB 2OL3H 3MRJB 1AD9B 5EZIH 5D7LD 3ILQD 2VXUL 2KL6A 3MLUH 1D5MA 1RY7B 2PTVA 1YYLL 3BKYL 3BPOC 4NCDA 1Q0YL 4PJGE 4HS3A 3MLRL 2MOVA 1N3NB 1I7UA 4KRPC 4G8IA 2X9WA 5HI5C 3S37X 1FFPB 1A7NH 2VQ1A 3QXUA 3TIDB 4YR6B 5CINL 1NBYB 5EU7C 1NFDA 1I75A 3O6KL 3BQUA 1N5AA 3HMXA 2NW3A 1TZGL 3I75B 5D1ZD 3RI5K 1C16B 5F9WC 3WKML 5E0QA 2MPAH 5DJZB 1NGZA 1S9WA 2CRIA 3QG6B 5FM5M 5EDXA 3HI5H 5F72S 4R0LA 1R3LA 5C07A 2BSTA 4BFEA 2XQYK 4MYWB 3X12A 4UIKH 4Y4KD 1KN2L 3IDIB 3QI9B 1KTLA 3RUGA 5F7WC 1N6VA 1L7TL 1JPST 3OR6A 5I73B 2WLZA 2C9AA 5I74B 5C09E 1NEUA 3HUJF 3S7GA 2X1QA 1NDMB 4Y19D 4K94H 2H9GA 3EAKA 5I8CB 4NQDB 4Y5YC 5C7XL 1YEFH 4G5ZH 5EZJB 2QL1A 5F44A 5EZOL 1HSAB 3ARGD 5E8OA 1L4IA 1QQDB 1JYWA 4F57H 4G9FD 4CGTA 3EO9H 1F4WL 2LAAA 2OI9C 3P0YH 3U82B 1ZLSL 5C08E 5HVFB 3RWCB 4Q0XL 4LP4A 2IBBA 4JZJC 2EZ0C 3SDDA 1YDPB 1KOAA 5JHDA 1N0LA 3GFUA 4CRPA 5D7JC 5JW3H 2W0LA 1J0IA 2Z35A 3NCMA 3L5HA 4QGTA 1HQ4A 4NJAL 5K9JL 4LEOA 2Q87A 1X5YA 1AGEB 2YMXL 2ITCB 1XF3B 2MWCA 1FP5A 5DVNA 5DJ8A 3I6KA 4HPOL 5E2UL 4L3CA 5J9PA 5DK0A 4ZO7A 5HHQB 1S5IH 3IF1A 3WMSA 1AD9A 5C2UB 2YPLA 3BPCB 3UCRA 4FZ8H 2NW2A 4Y5VA 5HVWA 2J8UB 4NYLA 3MV11 4ZMAT 3IFLH 4V1DB 3T0DA 2FR4A 3S5LB 1CR9L 4APQD 4JO1L 1GGBL 4OD1H 1FZMB 1P4LB 3MOQA 1MCWM 4LLVA 4HBCH 4HF5H 3RTQC 4YR6A 2HN7B 5HI5D 2XKUA 1MHPL 1JNNL 2VLKD 1UFUA 3CFCL 3RWGB 2IPTL 5DT1L 3BD4A 2XY2A 4N8VA 3CMGA 5H35B 1C16A 4Z7UE 1KFAL 3JSSA 1NAMA 5ADPL 4G6KH 2V2XA 4GQ9L 5HHVH 4LLYB 3WXWL 2QR0A 3AM8A 3S37L 2FEDD 1ODAA 1Y0LA 2DQFA 4WFHD 1SEQL 1AGDB 1I3RA 4DKEL 1AHWB 1V05A 1TJGH 5K9OB 3TCXA 2J88L 5BMFH 1JFQH 4OZHF 2VL5A 1MJ7H 1TQBC 3M1BB 1YEKH 3OAZK 1CD1B 1NDMA 1NC4B 1RU9L 4ZD3L 5ACLA 5I8CA 4ODBD 5E5UB 4JCLA 5EZJA 3B5HA 1MRDH 3SDCD 1HSAA 2WIMA 4WFFD 2R4RL 2M8XA 2VLLB 5AUMA 2OI9B 3OKKA 2A6DB 3BEWA 4HQQL 1JGVL 4LCWE 2GFBB 5FB8A 4PJFA 4IS6A 4WFGD 5ID0A 4WEBH 1YDPA 5FIEA 3WJJA 1X5HA 4WUKH 5ITBL 4GXUN 2YD5A 4G6MH 3DX9B 4NN6C 5HDQL 4M43L 3KLHD 4WHYH 4YIQA 4WI8A 1I4FB 2VWEC 2ITCA 2VNCA 2F15A 2YUZA 1BFOA 1LQSR 4PJIE 1MRFH 1RZKH 4K3DH 4M7LL 3JWDC 4LHUD 1E4WH 4NP4L 2GJ6E 2XFXA 1MAMH 3P73B 3MROA 2ICWB 5DGQA 5L9DL 2MJWA 1G6VK 1WCBA 3O9WB 2YPKB 5D6DC 2CLZA 3BPCA 4UB0H 1IAKA 2FWOB 4MAUH 5IEKB 5TQ0L 3DYMA 2EDWA 3CLEH 3ZYIA 2J8UA 4X99B 3S5LA 4YJZL 3QQ4B 2VAAA 1UKQA 1GIGH 3L3DA 3RTQB 4YZFF 4RSVA 1L6XA 2FRGP 4Q9QL 4M5ZH 4G3YH 1JNHA 4BQBA 3RWGA 5F3HB 3U4BH 5E00B 5DD1L 5MEPB 1Q0XH 5FOJA 3IAPA 4Y2DB 4I1NB 3R4DA 4A6YB 1JN6A 4G7VH 4HWZA 1R3IL 4XPGH 2IANB 4Z95L 4Z7NF 4BQ6A 3RPIA 3NFPA 3QUMH 1U41A 4HWUA 4WI5A 3RZCC 5J1SC 3MRCA 1AGDA 4LDLB 2EDNA 5DDHA 1J1XH 2BX5A 4Z77A 4OQTH 1AHWA 5ALCL 5D8JH 5K9OA 4BKLB 1SM3H 2XG5A 2M1KA 3KYMB 3VFGH 3DIFB 3ARYA 5FHAH 4P59L 2LQRA 5FK9A 3QDJB 1B0RA 1P2CB 2JJTC 1CD1A 2OQJA 3MA7A 4MNHA 1TCRB 1UB5B 3WFEH 2WK2A 4Y5XB 3VFVA 4NOFA 5GGTH 3HI1A 1Q8MA 4JG1H 4PJCF 2FD6H 3FN0L 5KSUB 2A6DA 3WFHB 4F3FB 2GFBA 4GAGL 4DW2L 4OTXL 4JPKL 5EUOE 2GEEA 4U0RC 3C09B 5MEQA 4O02L 2UWEF 4AM0B 2DYPB 1J8HD 1SBSL 2R0ZL 5L0QC 3WSQH 4AL8H 2J4WL 5FEBA 4X6CE 1UXWB 2Z91A 4NN6B 4B53A 2VDQH 2VXTH 5AG8A 3U0PB 2HTLD 4Y4FD 1IM9D 5DRXA 2X4PA 2BSSA 4WFED 5F7NC 4RGNE 5JXED 3M45A 4MMXC 3ZDZE 4Q58C 2OK0H 3CK0L 3AMLA 1PQZA 2HJLA 1KEML 3WFCH 1EDQA 3Q6FB 2VO5A 4R96B 1CL7I 1UZ6F 4WY7H 2ICWA 1IZJA 4K71C 1DL7L 4R2GC 3HPLB 4OLWH 1MVFA 4IDJL 1RK1B 1TVHB 1HXMB 2FWOA 2I27N 1KEGL 2JF1A 3VI4F 1YECL 2DQUL 3W81A 1BZQK 3QQ4A 4HGKC 5DJ0B 1KG0A 4YDIL 4HPYL 3VXRB 1VHPA 3HRZB 3U4AA 3S34L 4LLAA 4GLRH 2I9LA 2UV3A 4GAJH 5F3HA 1JGEA 5FYKE 3WNLA 5E00A 5F89A 4ZFFB 5MEPA 4KK5D 4YDKH 2IBGA 4KI5C 3RJQB 3WYRA 2CUIA 1G7QB 5INDB 2IANA 5CJOL 3RZCB 2H6PB 1D5IH 2GJJA 4HUXB 4NQCE 2D2OA 3N1QC 2DTSA 4HAGA 3X11B 5L6YH 3GMRB 3I02B 3G04A 3GSXA 2Q3ZA 1IEBA 1RULL 4NNYB 3RWDB 4IRSA 3RRQA 3DIFA 3KYKL 3Q2CA 2L7JA 2FHFA 4JRYB 4L9LC 3WIHH 2OZ4L 3QDJA 1P2CA 1EZVX 1MCNA 3ULUF 4JPIA 3LS4H 1TCRA 2DLHA 1NMAL 4PP1C 1KELL 3QEQD 2E7LA 4Z5RA 1NUGA 4U0RB 4P5MB 1NEZB 1U92B 5L0QB 3B8YA 2NY6D 3RAJH 2DYPA 1XCTA 2Q76A 3C08H 4MJ4A 2HTKC 3GSQB 1FGNL 3JWDL 4HIIB 3MNZB 4WCYL 1MH5B 5E6ZA 3TYGL 4XRCB 5L2JB 5FF6B 3PDOA 3QUYA 3SCMC 1UCBH 2ZCKL 3L1OL 4J3XA 3VXMD 2BVQA 4MQSB 4CBPA 3U0TB 2GY5A 2EICA 5TDOB 4WI9A 2AAVA 2I5YL 2RHEA 5F9JA 3V4PL 4ODTH 1AD0A 4OZGF 2OSLB 1JWUA 4NWUL 2RFXB 4K71B 2VC2H 4Z8FL 4R96A 1F2XK 4NM4L 4ZOAA 3T0BA 4X4ME 3K80A 5DK3A 3MRLB 5FAAA 4WDIA 4K9EH 4XNUL 5BJTB 1IGTB 3HUJE 1ZKAA 3KXFB 2NTFB 4KK8C 2YPVL 1NANI 2X7LB 5D70L 1KJ3H 4R2GD 1CBVL 2Y5TB 4HKJA 1QFWI 2XKNA 5F7FA 5JXAL 3N85L 3VXRA 4FFYH 3P9WB 1AE6H 3DETC 4P2QE 4NO0D 1KB9K 4L4TE 5FO9A 1KJ2L 3OL2A 3QO0B 5CUSL 3PHSA 1E4JA 2QADC 3HC3H 1NUFA 5ISZD 3D3VA 2BRQA 1K2DA 4X6FB 1A3RL 4OGXL 1IAMA 4WUUA 4AIXA 1BD2E 3C60A 2H6PA 4KI5D 4JLRA 1OPGH 5EO0A 4HGWB 1YPZF 4XPHL 4HW6A 3I02A 3V9FA 5I1JL 1IEAB 2X4UB 4TSCL 2PO6B 1I8IB 1ZHKB 4L9LB 1YUHB 4R97C 2X9YA 1NCAH 1YMMD 1QSEE 2EDTA 4IJ3B 5K59F 3MXWL 2DAVA 2A77L 4JRYA 1PGRB 2V5TA 3IDJA 4JJ5B 4EI6A 5F7EL 1F90L 4XWOC 4ZTOL 2AXGA 4XNQB 4U0QB 2I25N 4BZYA 3BP7A 4LNRA 3UZQA 4P5MA 1NCDH 2NXZC 3C5ZD 4NFDA 1U92A 3DXAD 5CSZB 2XT1B 5DC4B 2CDGB 2IAMC 2W9EL 3E6FA 3QDGA 3VXUD 2BY0A 4PRIB 1BZ9A 3O8XA 2HVKB 2L4OA 2W9DH 4K2UH 4N9GA 1JTOA 4MXWL 3SCMB 3EJJX 4XRCA 4ZSOB 4MAYB 3BKMH 5FF6A 3C9NB 3N0PB 2HTKD 4U6XB 3GNML 2BVOA 3L95B 4P4KB 5C6TH 4MNQB 4GAFB 1AFVL 2PW1A 4JFOB 2CXGA 2AQ3A 4PJDB 5DZOA 4X0KB 1WF5A 2C1PA 2RFXA 1ZLVH 1HI6B 3UO1H 5BV7B 5B38G 4EUPG 4P3DB 4UNVA 1DQML 2C4FT 3BPLB 3MRLA 5FUOH 5IT2H 3QNXB 2VZ3A 4RGOH 2FLBT 2CIKB 2ZUWA 5BJTA 2AXJA 1TJHL 4FQ2H 2EDQA 5HPMB 3KXFA 2V7HA 3JVGC 3JWNC 5IF0B 3EDJA 4F8QA 5TE7L 1T2JA 3LIZL 4PJEB 2VDLH 1H8NA 4KK8D 1R24A 2HG5B 1F6AA 3NZ8B 1N2RB 4DKDC 1UM5L 4RMRA 3UJJL 5F88B 3IJSB 3SDXB 1FVDB 1VGEL 3DMMC 3OKOB 1IKFH 4K8RH 1ES0B 3DBXB 2BOCB 1Z3GH 3CU7A 3QDAA 5IW3A 5K93A 1JRHI 3VFMA 2VDRL 1I7TA 3B2VL 5I18L 5H94A 3UJTL 4GFTB 3OF6A 2FGWH 2QADD 1I9RL 3NOIA 4PJAB 1A3LL 5JPNB 1YMHB 4LK4A 1KJMB 4FFVD 4Q6IC 1A7PL 3H0TA 4R97B 2HKHL 1IEAA 2X4UA 3VH8B 1FNLA 2PO6A 3DJ9A 5C0JA 2X05A 2XOTA 1EXUA 1S7RB 1EX0A 3SGDI 1I7RB 1Z6JT 4LSSH 4Q74A 3GMLA 1B0GB 2DKMA 4BZ2L 1YNKL 1RURL 3BUTA 4JJ5A 1KIPB 4RIRB 1RUPL 1TFHA 3BN9C 1GGCL 3KWWB 1QKZH 2P5EE 5AYUH 4ENEC 5EIIA 3T0ED 2NXZB 4WV1A 4XWOD 2D7MA 2DM7A 2IAMB 1VB9A 4WI4A 4PV9A 5FOBA 5F7YC 3O45A 3R0NA 1AJ7H 4CMMA 1RUQL 4X7TA 4CU6A 3TN0B 4KJQC 4JQIL 2O5XH 3LQAH 1CF8H 5DJDB 5EU4B 5E8NB 2I9TB 2W38A 4Y1AE 4MAYA 4FQCL 4AMKH 3MBEC 4U6XA 3B4NA 3U0WL 2FB4H 4FZEL 4JDTL 4HMCA 4M5YH 5GGRB 4P4KA 4MNQA 2YUVA 4BQCA 4ONHB 4Z7NE 4JFOA 2I60L 4P2OD 5DUML 4MJIA 3ZDXF 2OJEA 5EO9B 1UA6L 1XF5A 3PQYE 2XZZA 1U2CA 5DQJB 3O11B 2D3VA 4FQIH 4JHWL 1T1YA 3F7YA 2CKNA 3QNXA 4PGZA 5F7DA 5ID1B 3W5NA 2A83B 5DURB 1F6FB 4F7TA 5HPMA 2VLJD 5IF0A 4ZO8A 2C26A 2DKUA 3ZHDA 4ZFOL 1YN6B 3EYVA 3H2WA 2WWMC 4PJEA 5DD3H 5LAXA 3I3DA 3ARQA 3FB7A 3P77B 4JKKA 5I17B 1XZ0B 3ZKNC 1JPGB 1LO5A 2EEAA 1F3JA 1L0YA 2JB6B 4PJCE 5B3NA 3DMMB 5A16B 3E8UL 3IJSA 4RX4A 2UWEE 3QQ3B 3DBXA 4HFUL 4HJJL 5ILTH 1J12A 1E4XH 3AXLA 2YA1A 3SE8L 2KQNA 2B0SL 2VLMD 2PUQT 4UTAL 5IVOA 4J8RB 4JR9L 4Q6IB 1CLYL 4UINH 3ZSTA 5JPNA 4NQEA 2MCG1 3ULUH 3BWAB 3CVHB 3QWOB 3SJVB 3C2SA 3BMWA 5E8PB 1V3LA 1OP3K 2HH0H 5EU3B 5HI3C 4I13B 4NUJA 4ODVH 1I7RA 1Q1JH 5B38B 4EUPB 3RY6A 4D9QD 5IM7A 4B50A 4R8WH 1KIPA 5CD3B 4FP8H 3ARDC 1UZ6E 3KWWA 4NNPH 1JBJA 3H42H 3GMNB 4QRRD 1D5BA 3MRMA 2CKBB 3VXTB 2HKFL 5I2IB 1KIQB 3TWCL 1FORH 3VD4A 4LU5L 4X5WA 3KPSA 2DMKA 2VLRB 2J12B 4JQXC 1UVQA 4OFYD 3D69B 4IOFC 5DUPL 1EIBA 4PRDA 3TN0A 5DLMH 5DRNB 2B1AL 5SWZD 3SGJA 1J86A 2FH6A 3PF2A 5DJDA 5E8NA 1FAIL 1CCZA 4CNIB 2X4NB 4GAYB 3HNTL 2X9XA 2PYFB 4M48H 3O4LB 1K85A 3ARBB 1A6WH 2F53D 2EC9T 1K8DB 1DBBL 3NH7L 5DEZA 1F02I 4EI5D 1G7IB 3U9UB 5LBSL 2R1XB 1A14L 3RA7H 3QIWA 1DN0A 1QEWB 2LTQC 1ZT4A 2EDFA 5EO9A 1U3ZA 3ROOB 3PNWB 4X7EC 5DQJA 5GRUH 3O11A 1OM3L 1CQYA 4M1CD 5L2KE 4OB5L 2Z92B 2DLGA 5ID1A 5K9QG 4F7EA 2ESVD 2VR4A 3GIVB 4NBYB 3C8HA 1PY9A 3WS3B 1FL6B 3CVIL 5DR5L 2O61A 3LRGA 5F97E 3ULUE 3MTRA 4I0PD 4WU7A 2B20A 3EYUL 3O3AA 5FGBC 3I6LE 5HYJB 2WNGA 1PKOA 2JB6A 2VZUA 2WWMD 1CE6B 4YQXL 2K9UA 3WE6A 3PG2A 5FXCH 3BKJL 3ZKND 3CVHL 3RWEB 3QQ3A 1X5KA 5D2LB 4JHAL 4X5XB 4QYOB 1G6RH 4D0BA 1Q9WB 3MOBH 4ONFL 1J5OL 3L5IA 4HLZG 1E6JH 2RJMA 3GO1L 2B2XH 5LCVL 3HZVA 2J1KA 4U6VH 3P11H 5T1MA 3BW9B 5E7BA 2X4RB 5EO1B 4WO4C 1KC5L 3QPXL 3QIUD 5I1GH 5B38A 3ARDB 3TBSA 3BIAX 1QG3A 3UTTB 4WRLA 2EH8H 3WXVL 3NFNA 1Q9OA 3IJYB 5DD5L 4DGYL 1CLZH 1HYSC 1JGDA 5KSBF 1ZHNB 2VE6A 2AJXL 2HJFB 4LFHG 5E5MB 2CKBA 3VXTA 4ODHL 1NGPH 1GL4B 5C9JB 4FNLH 5D96C 2APTA 1QHOA 4YLQT 3OHXB 1FL5B 4I18A 5DRWB 4U7MA 3GIZL 5HHNA 2Y36H 3UTSD 1EERB 3V7MA 15C8L 3D69A 4X7CC 1M7XA 4YC2C 2JCCB 2K7QA 4UILH 5DRNA 1EA9C 1O7VA 2DM4A 1J1PL 2EC8A 4ZFZB 2N7AA 2NY2D 1EGJL 2PTUA 3MRIB 1FNEB 5IVZB 2QSCL 2VXUH 2B8OT 1YYLH 3O4LA 3BKYH 3ARBA 2WP3T 5ELIA 5IQ9A 5T3ZE 3LAFA 5ACZA 1Q0YH 1MAJA 3SQOL 3MLRH 4YDVB 4HJ0D 4LIQL 5E6IC 2OTUB 4ISVB 4E5XA 1QEWA 4PJ7B 1T04A 1LVEA 1AGFA 2BVUA 1UADC 1ADQA 4PS4L 3QFJD 5D1XD 4JFQB 5IKCB 3PNWA 3NCCB 3IAQA 1YPZE 5CINH 35C8L 1PW3A 3CFBA 3O6KH 1JHTB 5IMLB 2X4SA 1TZGH 3PABA 2VZVA 5K59E 1FAKT 5FA3B 4XTRD 3SDDC 3WKMH 3OR7B 1LNUA 3UMTA 2JLLA 3FO2B 4XC3L 2DOCA 1BBJA 4PLKC 1KN2H 3FRUB 5HYJA 2Q8BL 4XP6L 1L7TH 5FFLA 2XTJC 1TVBB 1YNLL 2WWKO 4TNWK 2R1YA 1QFUL 3RWEA 1NKRA 3OKDA 3G5VB 3I6GA 5D2LA 3U36A 2AV7A 1Z5LB 2EKJA 4QYOA 4BA8A 1RIUL 5C7XH 5CEYA 1S7XA 3IDGB 3Q3GA 5EZOH 5B4MD 2FEEI 1B3JA 3IU4H 1U8MB 4LLDB 3BW9A 3EYQC 1F4WH 1JZ5A 2GJZA 5IIEA 1ZLSH 3EZ8A 1C1EL 1NC2B 5IFJB 4Q0XH 1RQ5A 2Z0BA 4N0UB 1CIDA 2X41A 4LDOB 2Y23A 32C2B 5C0ND 3IJYA 4OZ4B 1FDLL 1QYGH 3KLSA 4R4NC 3CGTA 3HE7C 4HIJA 3T2QA 2J2ZA 2BZDA 4NJAH 5K9JH 5D96B 3LMJL 1NSNL 5DVKA 5C9JA 3NCEB 1I3VA 1MFCL 1UXSB 2YMXH 1HYSD 1LEIA 4AEIL 3BQUD 2JB5L 1A6AB 3F5WA 3LEXB 2E9JA 5F8QC 4HPOH 5E2UH 1MJUL 3FT4A 4M6NL 2JCCA 4L8DA 2HP4A 1INQA 5BZWB 4GBXA 4ZFZA 5C07D 4F9PA 1PY4A 4DJMA 3ZYOA 4EDWL 5CEZL 4JRXE 1EFXB 3QDHA 1PLGL 5EU6B 1W72L 2OTUA 4Z7QF 3DARA 3ARWA 1CR9H 3RP1A 4F80A 4D9RE 1UJ3C 4JO1H 1GGBH 5E1HB 3D39E 1G9NC 4KDVA 1M1SA 4F33A 5E6ID 4XHJC 4QHLA 4NQSA 5A43C 5IOPB 1MHPH 1JNNH 3CFCH 3LKQB 5IMLA 2IPTH 3LEYL 5DT1H 3HG1E 2HFFB 2LABA 2QQLL 3E6HA 3O0RL 4XNXL 3DUSA 1KFAH 5FA3A 3OR7A 5ADPH 4PD4J 4GQ9H 3WXWH 3FO2A 1A1OB 1IAIL 5DEGA 3S37H 3OAUL 3SDDD 1SEQH 2XQBH 3FRUA 4N90D 4NQVB 5JHDD 3MRKB 3QJHB 4DKEH 1AO7B 5A40E 1TVBA 2Q7YB 1AR2A 1QSFA 3V6FA 25C8H 2J88H 3CFDB 1FFOA 4P0DA 4N5ED 5D7LE 2C5DC 3THMH 5DVOA 5DVMA 1JPTL 3VGGA 3TYFB 3B6SA 4C4KO 1RU9H 4QHMB 4RISL 4ZD3H 5BW7C 4KKLD 3GI9L 4P2CG 5ICXA 1HHGB 3NACL 4M7ZC 1WITA 3ARUA 1CVRA 1ED3A 2R4RH 3HMXL 4HQQH 1JGVH 4LLDA 4AENA 1V7NL 4PYHA 3ZL4L 3JTTB 2YPLD 1N64L 5IFJA 4N0UA 3HC4L 4EJ1C 3ZDXE 2JELL 2N1KA 4OZ4A 4NGHL 3MNWA 1ZLUK 5ITBH 3HE7B 4ORZC 1SMOA 2ZOKA 5HDQH 4M43H 1T66C 4I3RL 3MJGX 3DX8A 3O6ML 1WWCA 1Q94B 1MJJA 5GSVB 4YHOL 3EFFB 1XGPB 4MD5B 4CDGC 4M7LH 1ZSDA 1VACB 1K4CA 1PKQA 4TUOA 1LHZA 3FFDA 4NP4H 3ETBF 1Z2KA 5BZWA 1XR8B 1NCNA 5L9DH 4L5FL 4Y19E 2GT9A 2VUYA 1H3GA 4MDIB 5TQ0H 3O6FB 5KVGL 2DQCL 2W0KA 1MFEL 3IDXL 1U3HB 1WJ3A 1LP9E 3OKMA 5ICZA 5AEAA 4Q9QH 1UB6B 5GS0C 1UC6A 5F3BA 1GZPB 5DA0B 3LKQA 3QAZC 1R5VB 5DD1H 4UT6L 2NXYC 3SGKA 4OLXL 4KI5F 1W2KT 3TJEL 1ZEAL 1R6VA 1R3IH 4EIGB 2P47B 2XZAL 4Z95H 5F7KC 4OFDA 1A64A 1HH6A 4U1MB 4NQVA 3KS0H 3MRKA 5ALCH 1AO7A 3JBG7 4NQUA 3DGCR 4MA3B 3TESA 5SX5H 4Z0XA 2Y72A 4P59H 5HI4D 1C12B 1BOYA 4WWID 5IHBA 2XN9B 3QULB 4YH6A 4QHMA 2ENYA 2NX5B 1HHGA 1X4ZA 4LCYA 1N0XL 1MSPA 4RMVA 4QHKJ 4J12A 5CZKA 4OSUL 3FN0H 4PJ5B 2CH8A 4GAGH 4DW2H 4OTXH 4JPKH 1Y18A 4O02H 4C56E 2VLKE