4YCCA

Structure of a single tryptophan mutant of acetobacter aceti pure with y154l mutation
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
160
structure length
160
Chain Sequence
SAPVVGIIMGSQSDFETMRHADALLTELEIPHETLIVSAHRTPDRLADYARTAAERGLNVIIAGAGGAAHLPGMCAAWTRLPVLGVPVESRALKGMDSLLSIVQMPGGVPVGTLAIGASGAKNAALLAASILALLNPALAARLETFRALQTASVPNSPIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a single tryptophan mutant of Acetobacter aceti PurE
rcsb
source organism Acetobacter aceti 1023
molecule tags Isomerase
molecule keywords N5-carboxyaminoimidazole ribonucleotide mutase
total genus 54
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature ec 5.4.99.18: 5-(carboxyamino)imidazole ribonucleotide mutase.
pdb deposition date 2015-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 4yccA00
4AY3A 2FW8A 4ZK2A 5BOSA 2FWAA 4YCJA 5CVTA 2YWXA 4YCCA 4AY4A 2FW1A 2FWIA 3OOWA 5BORA 4ZMBA 4Z7JA 4ZC8A 2FWPA 3KUUA 5CLHA 5CTJA 5BOSB 3RG8A 2NSJA 2ATEA 5CLGA 3RGGA 3OPQA 5CLJA 2FW6A 1U11A 4JA0A 3LP6A 4YCDA 4YCBA 2FW9A 1D7AA 2H31A 2FWJA 3TRHA 5CLFA 4GRDA 5C5DA 2FWBA 1XMPA 2FW7A 2NSHA 5CLIA 1QCZA 3ORSA 2NSLA 4B4KA 4ZJYA 1O4VA
chains in the Genus database with same CATH superfamily
1Q1NA 1R8QA 5JFOA 2FZGA 2ECOA 4YALA 1NMEA 1E8NA 4AJ9A 4CUJA 3KEOA 1GGNA 2R68A 2PJRA 1E8DA 1VBMA 2H8GA 5ICSA 1QH8A 2M1XA 4M1EA 4KYIB 5T6MA 2HJHA 3DMGA 1RRMA 2R7KA 2I1QA 3F8WA 1XTIA 5FPPA 1QB7A 2BGIA 4LJKA 4JYCA 2BFFA 2HLDA 3QF4B 1SUPA 3IB3A 4Z9XA 1PEKE 1IVSA 5K0SA 2DXIA 2DWUA 3CLRC 2XLCA 4WBXC 4B85A 3AT1A 3DH0A 2RHWA 4EEKA 2O1WA 2Y9PB 3BSFA 3KSAC 3OOYA 1DINA 1U7TA 4PFQA 4UUQA 5D5QA 1G41A 2EEPA 2PS9A 2CHGA 1QP8A 1SKQA 3L7MA 3LYUA 4LVCA 4NBKA 3FPAA 4L02A 1J21A 2X6RA 2Z5VA 4NARA 4G2NA 1DAPA 1CLEA 4DZTA 3GT3A 2FWMX 5A9SB 3P71T 4WZBB 4B83A 4XR9A 3BWXA 3CMMA 3FHJA 3FWNA 1D1PA 4MKRA 5B4UA 1NBEA 1LBTA 4P38A 4TT8A 4R3UC 4MPDA 2MSCB 1SWWA 3ROPA 1PBTA 2AN3A 3LF2A 4NK5A 5I7OA 3Q8KA 2Q5CA 2GN0A 3N0WA 4WVFA 2QA5A 1D4AA 3N2KB 3V8MA 3CA8A 4AX4A 5DNCA 2Z2YA 5I9NA 4AKGA 4M9XA 3CB4A 1VIDA 4NRDA 4BUCA 1DUSA 1O6BA 3FMVA 2HWXA 1CRWG 3GCZA 2Q2VA 1TQ8A 1U0RA 5EIWA 4BP3A 4A0FA 1W25A 3FYCA 1KDPA 1T24A 1MQSA 4RY8A 4W5QA 3QPCA 2I76A 1O77A 4TKMA 1YZGA 4HCJA 4A73A 3E1KA 3K9GA 4PNHA 2PFSA 3KB2A 1GO2A 1TVKB 1ILWA 4YRNA 2QGNA 2H3HA 4E5SA 4B4OA 1FJGB 4E08A 1G0OA 1ESDA 3NU1A 3S5UA 1NJ1A 1CUGA 3DZDA 3K53A 4JJ4A 1Z6XA 2QY6A 4LK2A 5D00A 3O3CA 2ESRA 1XWIA 2GTHA 2PYDA 4AK9A 3I1YA 2Y93A 4HRVA 5HJ7A 4GXQA 1G5IA 2WHPB 2UU9B 2CDAA 2H92A 4MP8A 3M6VA 2EJUA 2YCLA 3GT0A 2VJQA 4YDRA 3ZX4A 4F3TA 2SCUA 3ASYA 3HVIA 3DHWC 1L8AA 2IYSA 4CHGA 5KVCA 1J0BA 1L8XA 5A7HA 2FX5A 4TWBA 3PNBA 3STUA 5D01A 3L7LA 1IHYA 3L49A 2JD2A 4ZA2A 3WKAA 3RYIB 1P29A 3LQQA 5BN3B 1DOAA 2ZWPA 5JY1A 2AFRA 5CDGA 4J7UA 2DY0A 5SZIA 1MJGA 3D0QA 3EG5A 2HU2A 3W6PA 1MB4A 3CW2A 1W36C 3SC3A 3RB8A 5A6SA 2B83A 2QPOA 3PGA1 5TPZA 4E1BA 1P0QA 3F1KA 1CQJB 1OFIA 1Z2AA 2GZ2A 1JAHA 3KWJA 4NMHA 4OGKA 2Y1LA 4K6CA 2FR0A 2HFJA 3O8QB 4MWCA 2WJAA 4GX1A 2VUIB 3SMVA 2WKQA 5A5DA 2IHVA 3BBLA 3JR3A 4MDHA 2RKOA 4U63A 1FX0B 3UJ3X 4ZOBA 2XB8A 4PLTA 1EB8A 4ZGWA 5CB4B 1NU8A 1IXYA 4B7AA 1JKIA 2QE7D 3A6HA 4GMKA 1RLUA 1XDDA 4J0QA 1SXHA 2BFDA 1QPZA 1J1ZA 3UJ8A 3MTDA 2HU5A 3IQIX 2WWRA 3NDRA 5BORA 4K28A 4OJKA 1X70A 4HQLA 3TSYA 3NLLA 4AKHA 1ZN9A 1G3IA 4HHEA 3KJFA 4G0NA 3BREA 1WP4A 3M6LA 2G1KA 4O5OA 3RG8A 2QVZX 4QPNA 4BV9A 3QU4A 2IYUA 4OX9Y 1BIFA 3QX8A 2B1JA 4GPIB 1UDCA 3MMXA 5CCEA 2CL5A 1N8SA 4LGMA 1RTTA 1WMDA 4WINA 4ZQFA 2JD0A 1ZMXA 4KLRA 1D2NA 1MJNA 1E5DA 1JR2A 4NCNA 3CG4A 5ARCA 4NULA 3ZLJA 2KE5A 2I8AA 3GPDG 4QBKA 2ODBA 5EHNA 4M6WA 5HIJA 2PLAA 1W9HA 4F6RA 3CNNA 3ODGA 4TWRA 1X19A 2IU0A 1AKEA 5DMXA 1CUEA 4DE5A 3HYCA 1JV2B 2GFHA 2Z57A 4OV6B 4YRDA 5JYBA 1EUQA 5FOUA 1QDUA 4B6RA 2VBGA 4W5JA 1Z22A 4JQOA 2C0CA 4BMZA 1SXGA 3KT3A 2DJ5A 3KVRA 2X6QA 3SOPA 3NM4A 3KQWA 1EFAA 1T15A 3RWMB 1S02A 4NIMA 1T4CA 1XU7A 4D46A 1N2EA 1WHTA 3SGLA 1CF4A 2ONJA 3SXUB 1ELOA 1KI2A 5IAOA 4IGIA 2A1TR 3R40A 3GLFB 5ADUS 3TXAA 3LA8A 3CUUA 4FT4A 2GRAA 1WZEA 4AF6A 2ACWA 3U60B 2CXNA 2WB4A 2HB6A 4PLGA 3AI7A 1PX2A 2PMWB 3I8OA 3VVMA 3TPZA 3L5KA 1Y3IA 4O2LA 4XSGA 4ACAA 5E8RA 1SULA 2CWDA 1TW3A 4DQLA 1NNLA 3G5LA 5BYJA 3UWOA 2OILA 3SIRA 3KXIA 5TGZA 5IMSA 2RGYA 3LCJA 4L78A 1SOMA 1NSFA 2E1RA 3FI0A 5K3SA 1FCJA 1H85A 4NH0A 3VM6A 5EHZA 4J75A 1Q7BA 1KETA 5J2TF 4U6SA 1XD8A 4R1OA 1T0BA 5B6PA 4WT7A 4L7QA 1DBVO 3QPUA 4OAQA 2O2IA 1YDGA 1LQUA 4CYMA 4CM1A 2ZUDA 5JAUA 3VC7A 4QGSA 3VJRA 2GNAA 3DV0A 1M6HA 3AP2A 3WL7A 3KZMA 2RI1A 4RK6A 1JR3E 4KLNA 4LJ4A 1ZVJA 3T35A 2YZNA 2R6ZA 4D9IA 4ED9A 5EJ4A 1SVMA 3JW8A 4KREA 5LWQA 5HFJA 3MOGA 3O74A 2P79A 3IDFA 5DM2A 3LUPA 4EGSA 4O4HB 1XQ6A 4LF5B 3HC7A 3FAZA 5DHRA 4JVOA 3HDGA 2HNAA 4J6FA 5C35A 3AUKA 4JEHA 1EJBA 3WYBA 1NUAA 4LX8A 4RMNA 4PS0A 2YJ5A 3CNBA 1OKKD 1U3FA 4YQFA 4KQGA 3D2LA 1L5NA 4X93A 2CWWA 2ISCA 4A2WA 1ODJA 2BM1A 4WI1A 3Q7SA 3NNSA 4NOJA 4F04A 1QU2A 5ETJA 1YR2A 2WFLA 3CHYA 2AFVA 4PCAA 4TXHA 2RAFA 3KHKA 3INGA 2XMQA 2Y1FA 2XUIA 4C07A 2D0PB 2PBRA 3ZWYA 1P19A 1G8JA 4HWSA 3GEBA 5AXDA 4H3HB 4M0EA 3C1OA 4NEHB 3R8XA 4LDNA 1VRWA 2WKSA 3RKUA 2QJWA 4Q3KA 1XHEA 1TAQA 5LIPA 1VYTA 2GBIA 2W9XA 4EY8A 1X86B 2OGTA 4RZQA 2JJ1A 1HWYA 4TLCA 2O19A 2QSUA 1CE8B 2X0NA 2ZKLA 3SX4A 3OPYA 2PR2A 4BAGA 3BGSA 5F78A 1YUMA 3MTAA 3OZFA 3GEPA 1YR3A 3GUCA 4FW8A 2HIGA 4IQ4A 4L50A 4OLFA 1OX4B 4Q01A 1GRQA 1OBFO 4QRHA 3CVXA 3FOFC 1FLVA 4ZT3A 4MGIR 3ETEA 4P3KA 4LZLA 1L6IA 3S29A 1QP4A 1AGRA 1RWOA 1N9ZA 1YNSA 4MLDA 2A9RA 4NCIA 3LFTA 3QWAA 4JX8A 4XYBA 1SVKA 4IS3A 2G77B 1NVEA 2XQFA 5HS6A 5LDGA 3SYRA 3ZQKA 3SQWA 3DDWA 2C96A 2Z5GA 1W59A 2P8SA 2QP4A 3VOSA 4F56A 2VT7A 2JIMA 4X6XA 3WIOA 2ZXEA 2PLFA 4JOCA 2X5OA 1JQEA 4M8NE 2PWZA 3CZ5A 1GZHB 4TMYA 1V2GA 5B55A 3M33A 5IWCA 1NYRA 2C8KA 3ZU4A 5FTJA 3FHOA 2NZVG 1GCOA 5G02A 3RGGA 4AD8A 4E32A 4RTQA 2EC5A 2QLMA 3PDUA 4R2MA 2ZUCA 2O0JA 5EZ5A 2RGCA 1KRXA 4UNQA 1WULS 1MEOA 2CLMB 2NU9A 1GCAA 3FZEA 2FGKA 3HRKA 3HYSA 2JJ1D 1T2AA 3B52X 4B0OA 4PSUA 3PQFA 3L6DA 4MVCA 4MR8A 1Q95A 4DMCA 3BN3A 3KQNA 2ABWA 1DT5A 3TF5A 4JLBA 2I54A 2ZJAA 2WB2A 4KW7A 2IYQA 1N2BA 3W8NA 3M5PA 2GETA 2V4UA 1U2EA 4LHYA 1DIRA 1KMCA 2OCAA 4DLSA 4CKXA 5I6DA 4DQKA 3K0CC 4YS6A 4FS3A 4LPKA 4FYIA 4P1ZA 4AP5A 5C7LO 1N5LA 3X1DA 5FXMA 1OKKA 4NBSA 1FSSA 3HFRA 3T7EA 1BO6A 2PYIA 1RMYA 2CEAA 2PH7A 1WUHS 2A86A 1MJ5A 1II8B 2ZAIA 1QZ3A 3ELUA 3MCWA 3M7IA 1UT8A 3KD2A 2KB0A 3H3JA 3CH5A 5TDHA 3ZE6A 4FFVA 1T43A 3OQJA 1JEDA 1RYNA 2BGGA 4A8TA 4LE0A 2PWPA 1VCOA 3GN2A 5IAGA 1Y0BA 1XP5A 3ACDA 5DM70 2HXYA 1V3QE 1QKJA 4LOLA 5E9WA 3RGWS 3CRRA 1ZN8A 1M2JA 2G8NA 2MU1A 1P2GA 2X8WA 3F8SA 4H2DA 2Z4RA 4Q3NA 2IUUA 3UYKA 1U8FO 5AW7A 1CCWA 5EA2A 1MA0A 3LCVB 3T41A 5M34A 1XKLA 3VZSA 1O1YA 3PIIA 2G4CA 5A0VA 2EZUA 1F3LA 3ETHA 3WYNA 4F4HA 1KGSA 2VI5A 3ZXYA 4PAQA 3P9PA 2YV1A 4FFPA 4BEJA 2Q7XA 1N2OA 4F06A 3RAEC 1VBNA 4KEAA 1EU1A 2W4MA 4IMRA 5G1PA 4BYGA 4JT8A 2YFYA 3BIJA 1DOHA 4KMRA 1U4OA 4PFJA 3WGZA 1S0UA 3Q6IA 4K26A 4ND4A 5JQWA 3N2GB 1HDRA 5HKAA 2BFMA 1FJ2A 1YDEA 2AOXA 3EVGA 4PGHA 4UU8A 4UTXA 4N47A 3TPFA 4HWKA 3TS1A 5LQMA 1VHQA 2BFPA 1ML3A 2Z0MA 2FH5B 3HZRA 4NE7A 3FUTA 4PRLA 3VPDA 3O82A 4HRXA 2EIHA 1VKJA 3PIRA 1KC3A 3PC7A 1CHNA 2ILVA 2B8WA 4X8HA 3THYB 5LQCA 1PJQA 1PYOA 4IXMA 1RI4A 3RIEA 1PNQA 4LI3X 1E89A 3FBGA 4MH0R 4B8WA 3A7EA 5EIXA 2AWNA 3ZZUA 1V3VA 2WHPA 3B2QA 2RD2A 1I4DD 3BFXA 3SQOA 4HADA 2QX7A 2H5IA 3CEPB 3WGVA 1JJFA 2W0SA 1T9BA 1SR8A 3K05A 8AT1A 3NKFA 3QJ5A 2HRCA 3O38A 3O9VA 4R2WA 1P7CA 3DEKA 3P96A 3S1LA 3P32A 1TUGA 3UPUA 2PKYX 3DF7A 3IIIA 3L0OA 3LVFO 2PH5A 4NBLA 3WNCA 5AI9A 3U7RA 1GL7A 3WAKA 3ADPA 1VCIA 4G5RA 2GBGA 2HYDA 1X8XA 2YYSA 1PZXA 5B4VA 2H11A 3O3MB 1FTYA 2QD4A 1YHYA 1JDPA 2J9GA 3O2NA 4D81A 2OT3B 1BH6A 5M2QA 1YCDA 5HMLA 4WJLA 5JROA 3W5VA 3I2JA 2PN1A 2D2EA 5JAOA 4INAA 2JLZA 1QRDA 2WIAA 2C82A 2ZULA 3I0NA 4HDSA 4NFSA 4OQEA 4WNCA 1AIPA 1KNXA 4MW1A 3FJ1A 1JLMA 4XOIA 2WFAA 5EE9A 1F2DA 2CMGA 1NI4A 3B3QA 3LV8A 2PBZA 2GXQA 4UC0A 5KX5B 3ZVMA 3IUQA 4BFVA 2ONCA 5G40A 4I08A 1CJBA 3KSZO 4YCJA 5JU6A 1W96A 4IQFA 5FADA 4BNWA 2B4KA 5A4KA 1AUPA 1CQIA 1PSWA 1XDUA 2X7JA 4LMRA 4OD0A 4OQQA 4F8JA 3HABA 5C5EA 1QQAA 2O8DA 3WV4A 3PNMA 4MIKA 4K6OA 5CM2Z 1ZSVA 4OAOA 3OFNA 3GRZA 3WL6A 5A3JA 2ZWOA 1SXJC 4YAEA 2OBLA 3EK2A 5LYJA 4YAUA 1Z5ZA 2GH1A 3PA8A 3UXHA 2X5XA 3ONNA 2DWOA 1DKOA 2GGSA 2ZIGA 3D4BA 4J94A 5EKDA 5GMOA 4C0SA 2IP1A 2NPFA 1GPUA 4P82A 4B2IA 3EDRA 2HCBA 2DQ4A 2WJHA 3IR7A 3LL4A 4UVDA 4I99A 3RTDA 5IU6A 3CF2A 5IVIA 1E3IA 1M2NA 4KPUB 1GPLA 2PSHA 1CNFA 2K6GA 4E2FA 1RYZA 3QV2A 3X43A 4YMVA 5JDIC 4GZLA 1QLWA 3OCJA 4M1KA 4ND3A 1MW8X 2YY7A 3LDGA 3ZI4A 3I4LA 3MT8A 3R77A 4RIGA 1OU4A 1OYYA 2VK4A 3NM6B 1YTUA 3MFQA 5HTKA 3W1WA 1EA7A 1BJKA 2AVNA 2K2QB 3LECA 4I5EA 5AIAA 3VJMA 1ODKA 1DBQA 1VRCA 2QRGA 3KOUA 3RS8A 3RU7A 3ZWMA 4Q4DA 3TEMA 4NBUA 1DU4A 4MVJM 4XR4A 4JL6A 2BEKA 3SCZA 4LWOA 3ISTA 3PA6A 1GQYA 4KQ2A 4EKYA 4AJHA 1SOVA 3IOEA 1EK0A 5TARA 4R8SA 1Z4NA 1GPBA 1M1UA 1TGVA 2H7VA 2WU8A 1BXGB 3CZQA 3QVGA 4LOHA 1SOWA 2A4KA 3OAAA 2I2XB 2CSUA 3CR3C 4KP7A 5DNAA 1N6HA 4ZTUB 1ISHA 2XZOA 4FJ0A 4MI9A 2XQKA 3V2UA 2ST1A 4FP9A 4DNQA 1E3WB 1SQSA 2A59A 3ABSB 4Q4AB 2XXJA 2C4UA 3FBTA 4G3XA 5FFFA 4XJTA 3T15A 2Q2OA 4MTCA 3U3OA 3TK1A 1YQDA 3FYDA 4ZRNA 1KWGA 5E1MA 5AVJA 4C0JA 3B82A 3GQBA 2NN3C 4DMRA 3U2QA 3P9RA 3ODPA 16PKA 2DPHA 1C3XA 1UCFA 2I62A 2IPOA 4D9HA 4NZMA 4MAMA 1Q21A 1RC0A 2UKDA 4CF5A 4MVYA 3TTXA 3VAYA 2HQBA 4R1PA 2B1QA 3BXFA 3PFCA 5COQA 3T6KA 4CT0A 5J5VA 3Q0EA 1RAGA 1G21E 2PH1A 3GRKA 2OL4A 1B14A 3L6OO 1QZTA 3GLGB 3IV9A 2EFCB 3N58A 3WYAA 2BZ0A 4BC1A 3GJYA 2DMRA 2AT1A 4CTMA 1CSEE 1E79A 1QMPA 1F0KA 2GNPA 3PICA 3KKMA 4GI1A 5AM2A 2W22A 3GUYA 3KFXA 3TCXB 5L3SA 2P6PA 3AJAA 5HRUA 4HWGA 3WGYA 5HDBB 3W7VA 4XPZA 2OBMA 2HADA 3T4XA 3VR4H 3F6YA 1TIKA 2P1ZA 3GFTA 1RQRA 3NORA 4O4JB 4YH1A 4D9KA 4O4HF 5CHEA 4PC1A 2XB4A 1XZMA 2WQZA 4P3YA 4D4IA 2ZFUA 4Q3AA 2WF6A 4P80A 2R6GA 1N0IA 1JFTA 1GA1A 1V7PC 1Z4LA 2LD4A 4URYR 5IKMA 1J09A 2Y8EA 3A31A 4F5YA 5D3MA 3BJZA 4I19A 4ZVVA 1KKLA 3V1NA 5B7GA 4QPJC 3H3FA 2CLLB 1WLYA 2PL3A 2QGZA 2G4LA 1DAKA 1NQ5A 4I4NA 4MKXA 3OTGA 4Y7CA 1QTQA 2IIQA 2A6PA 1SXJD 4HTAA 3S55A 2A0UA 3OPYB 1X14A 2YJ4A 3B7PA 3ILSA 3PEUA 1TYAE 3LQ2A 1ISIA 4B9AA 5ALKA 3NEAA 2QX8A 3QMWA 2IIPA 3ZWBA 2IS2A 3IIMA 1QX3A 4C06A 3VDXA 3B6JA 4TXMA 3VMFA 5JYDA 1MHTA 4DR4B 2R6AA 2R97A 2EZ4A 2DTEA 4DSZA 4GG1A 1RXWA 2QS9A 1XA4A 4TMVA 3GCGA 1SVWA 1JYEA 3T99A 2PMDA 1KFBB 2QE7A 3DL4A 2VZ8A 3PUVA 1N33B 2GAAA 1G20E 3NW9A 3BE4A 2OO3A 2XOXA 5LZ5A 5BSFA 3QIVA 1JDTA 3JCZA 2XSZA 1FS5A 1AT1A 1C0EA 1I5OA 1GG8A 3PNLA 1EWRA 3IP8A 1C7QA 1W5AA 4RE5A 1B6RA 1U0GA 4N5DA 1MT0A 3I58A 5CYPA 1LS1A 1W4CA 4X65B 4HL6A 1ZPDA 3M6FA 1X1SA 4U7GA 4FKZA 4UCXA 2C7RA 3FUCA 3SPXA 4MW2A 1G1AA 3ETNA 4XSVA 1N5KA 2H1LA 1DXHA 3OECA 4Q7MB 1PU2A 1AUQA 2QHXA 3C87A 4F1JA 1DJQA 2REQA 5M3BA 3CB2A 1CFZA 4NICA 1WY7A 3M3HA 4OI0A 2EFYA 4PW0A 2EKDA 2X2EA 4DCJA 2PLNA 1EHIA 1SVIA 4DTCA 2V58A 1ULBA 4RL6A 4NKRA 4E09A 4B7ZA 1EDEA 1YGPA 5IBCA 1DT3A 4A10A 5J40A 1G291 1P62B 2VDRB 3RC1A 4CODB 3SBXA 5AVKA 4QLBA 1D5CA 5AM1A 1Z25A 5AO9A 1SVSA 4URWR 3HGTA 4G5OA 2OSVA 2ZCUA 4DZZA 1OBCA 3WXBA 1B73A 2QMOA 3AF2A 2HHHB 1O9GA 1XRMA 3OCYA 4RXMA 3OSUA 4Z1MA 4KMSA 3COZA 4RNDB 2GZDA 2N0SA 3DE3X 3H0KA 3O92A 1PZFA 3T4EA 1N2IA 3HP4A 1Y4DE 4N7MA 3VKVA 3BHMA 4HLCA 4MJ7A 3FJYA 1NNI1 1VCHA 1Q92A 2AL7A 4KN5A 3VNRA 4B3HA 1CKEA 4ZYVA 5LMCA 2O06A 4AKEA 1HF3A 2ZI5A 4BZZA 2BFWA 3L4EA 2LXNA 2Q99A 3IOCA 1DTWA 1JEAA 4Q3LA 1Q0UA 1FFEA 4WCDA 4F97A 5BXQC 3LH5A 2XNSA 5I7FA 1M1YA 2DBYA 3Q2OA 2I3BA 1QIEA 4LCEA 4REMA 1Q74A 1T5TA 1IHPA 1HOXA 3P5SA 2CYAA 4GGPA 5CAEA 1OYVA 3ZDAA 3DE5X 3NI2A 4DXAA 4OA8A 3DXZA 3WS7A 3WGLA 3BS4A 2H00A 3T7JA 3KLNA 4P84A 4GMGA 4RH1A 3DDZX 2JHAA 4Y6SA 4BV3A 2M98A 3FXAA 2CUZA 1DC4A 3A2LA 3EDCA 4IJWA 1BHSA 1T5OA 1XRSB 1Z0IA 1U8UA 1YKFA 4GYKA 4BN4A 2F3QA 2R47A 4K9DA 2QMYA 5CLQA 5LKRA 1NN5A 4HN9A 3VZQA 4CGZA 3HKDA 2P0EA 4JI7B 4J4BA 5F1KA 1UC8A 2P9JA 4G81A 1W94A 4M4SA 1Z4JA 1Q7RA 1N1MA 2PX5A 2UVQA 3RFUA 4QLAA 5JH7B 1NZJA 1T3GA 3N76A 4NEGA 1NYQA 1SMKA 2G76A 4OFWA 2ZIXB 5KYYA 3FFTA 5E1DA 4RPIA 2N75A 2XRZA 3L93A 3IHKA 3AWDA 3LUAA 4Q48A 1YZ3A 1ISRA 4R9NA 2OGWA 1ESNA 3GGGA 1GN9A 5GZ6A 2YWFA 1KXZA 1K08A 3V5NA 1ST3A 4HXYA 4BMSA 4ZZ3A 4I14A 5JD4A 2NGRA 5JTUA 2XUGA 4Z6KA 2G5TA 4XZ3A 4CM9D 2VVTA 1BCRB 3DDOA 1IAVA 2PA0A 3L6UA 3OQOA 1LF0A 2FQYA 1UJMA 3RVNA 1QR2A 2Y1WA 1ZW1A 3EY4A 4C9BA 4ENWA 5B2ZA 4DRZA 1GUFA 5EXEA 1DLJA 5IBRA 1Y5IA 1RZRA 3PGJA 3L07A 5CBPB 4E14A 4M0KA 2IBSA 4PN3A 4DUYB 4BWVA 3ZLTA 2B4AA 2FN9A 3PC2A 1H5NA 3B3AA 3AVPA 3CUEF 4L08A 3RC2A 2PBFA 4WERA 1A9XB 2O2HA 3A6KA 3EEFA 3OIFA 5JHHB 5HKKD 1NLYA 1I13A 3L8FA 3AVYA 5KVSA 2C2YA 3TJMA 4TVOA 1IB0A 4LVUA 3E4CA 3U56A 3K16A 4Q1VA 5DTEA 1Z6PA 2CJXA 4GZ6A 2PX3A 4WH0A 1YS7A 3DBHB 4HGYA 5PNTA 2QQ5A 2AZDA 2V1XA 4GYYA 5CPFA 1J8QA 4EEXA 1KK0A 1TF7A 2P9QA 4CCWA 1CUAA 1HFWA 3EW7A 4B2PA 4QFCA 4TVKA 2XOKA 3ELWA 2AQ8A 2G09A 4GKVA 1XTKA 1EA5A 4EKEA 1ZAYA 3BG5A 4HLUC 3AC0A 4RIEA 4DIOA 4L9WA 1REQA 1XTUA 1PHPA 4EJ6A 1Z6TA 4KGXA 4NHEA 4QUAA 3VUEA 1TF5A 1KDRA 3D7RA 4MWTA 2V54A 1F2VA 1VKZA 2ZT5A 4FOOA 4FFWA 4G1EB 3I5MA 4N1AA 4X3OA 1X80A 2EDAA 3DYVA 5DMHA 1U0JA 4B84A 4D9GA 3C3WA 1VI2A 1TRHA 1E6KA 4A8HA 3T8YA 4C7OA 1YQUA 3TAHA 1D5WA 3Q88A 4JSYA 1T35A 1KI6B 2RHRA 3LG2A 1MB2A 1L4HA 1SQ5A 4UEJA 1DCKA 4RHTA 4W8GA 4IDPA 3WB9A 1IRXA 1UK8A 3INRA 1NXXA 2Z56A 5CXSA 2ZJOA 3HYRA 1V11B 2D7JA 1T8PA 1PQUA 2I34A 3LSYA 4DBLC 5J4YA 2E89A 1GRVA 4UUBA 4DV1B 2BELA 3OLCX 4JT9A 3UFXA 1C8VB 3GHHA 3GPIA 3D8BA 2IYTA 4I9GA 4FLFA 1PIWA 2B92A 4KR2A 1QGED 1CUBA 5CVVA 3ZU2A 2ZJ0A 3HBLA 3U5ZB 1R1DA 2PX2A 3JAWB 4J76A 2P5UA 1Z33A 2QTHA 5K03A 1GLNA 5KNDH 3CWCA 3MINA 2EGHA 1FS4A 2FXIA 4M54A 5LA6B 3VISA 3TGLA 2J3DA 4IZ6A 3FCUB 3OE1A 4MVJI 2VCHA 4C2AA 2G70A 5I48A 3MJ4A 1E58A 4DCNA 2ZP1A 1US8A 2FPIB 2DPMA 5DTMA 4YXWA 3HDVA 3AY7A 1NRJB 4GPEA 1Y6QA 4JB8A 2PJZA 1N9KA 5DVZA 1PQPA 2DHRA 3DLIA 1V8ZA 2I3ZA 3N5KA 2AN5A 2ID8A 4WNAA 3LC0A 4E13A 1HQCA 4FTWA 2REXB 3RJ9A 1D2AA 1W76A 2QRUA 3K9LA 2G40A 2PD6A 2FW9A 2Q3FA 2YIJA 3VPHA 4EB3A 5AW3A 2ZLBA 3BXZA 4PLYA 4X95A 5TR9A 2NYUA 5DLEA 2LE0A 4EHDA 4YJ2A 3CRW1 4JYPA 1RAEA 3QGMA 2VAXA 2ZVPX 1ZRMA 2RBGA 3S44A 5JD5A 1SXJE 2IXEA 3B5IA 2G04A 1KZ1A 1NXQA 1P1JA 1TT5A 3D54D 3FHLA 5FUYA 4BKMA 3LCUA 4YMHA 2WEKA 1YVEI 3DEJA 4US1R 5IBQA 5L3QA 5EYPA 4FZVA 4QM7A 1RP7A 3U4HA 4Q7JB 4Z8YA 1ZUNA 1PS8A 3CWQA 4TQGA 4Z7JA 2AJDA 1Z12A 2R8PA 2W42A 2GD2A 4NZOA 3VDRA 4MEBA 1C4XA 4O4JA 4GLBA 3CO0S 1VC2A 1A8UA 1D9ZA 3H4MA 1Z2PX 2QMEA 4KIUA 1GUZA 2NZXA 3FPCA 3DL0A 1GG5A 2GEUA 3ZY4A 1GLGA 1OLXB 2EVWX 1SD1A 1NVTA 3VYWA 3QJGA 1CF9A 3TGPA 2WAXA 1ZZGA 3ZCQA 3U4AA 3F49S 3TZQA 4BMYA 1NY5A 1O7JA 1CE8A 4ITUA 3W5HA 4YDSA 3EHDA 3LBHA 2SNIE 2DLNA 1FFHA 2EARA 4GOLD 4Y2RA 4AT1A 4DYDA 2PSSA 2BMDA 3LLMA 2J8ZA 4FOPA 1OXBB 2XOKD 1RAIA 2EFJA 4LDAA 2AEMA 4F72A 4G9EA 3VPCA 4PSAA 1L5MA 1G7CA 2O50A 3NYQA 4O33A 2J08A 3WLSA 3C74A 4A8JC 4BO4A 5HOEA 3GF4A 3LW7A 1F1BA 1U28A 1TMKA 1XV5A 2OZPA 3OZEA 1W73A 3NTXA 3QF4A 4L8YA 2WU4A 1U0TA 4IXDA 2X5KO 4II2A 3WL8A 2JLVA 3HWSA 4UQPA 2E3JA 1V5IA 3CE9A 3ZQUA 3DLCA 4E5VA 5K3OA 1XAJA 1ZCFA 1XFDA 2N3ZA 3AFMA 4MIOA 1EWVA 4KAJA 1RXIA 4O3MA 1Z5PA 4OQNA 1JJBA 4DDTA 2DF8A 3JRXA 1IWPB 2BGKA 2NZYA 1LXCA 4I66A 1ABFA 1ECBA 1AKTA 3IHWA 5GONA 4WNYA 1KE1A 7AT1A 1NL3A 1RZRD 4MR8B 3LLUA 4J9UE 2DFNA 4KFTA 1BJTA 1PGNA 4Q00A 4YRSA 1E6WA 1OLSB 2ONZA 3AETA 2GCEA 2OZEA 3KAKA 3LPMA 3M5WA 3QLTA 821PA 2D1FA 5SV2A 1PT8A 2P91A 1RLJA 1QH9A 4J07A 2W6CX 4C08A 2XRMA 1UQRA 4JLVA 1U7XA 3EBLA 3WIDA 1TFUA 2CLEB 3X1ZA 1TC2A 3TLXA 1JBKA 4NC9A 4NMMA 3HVRA 5I7VA 2GWHA 1LBEA 4AU1A 3EISA 4O5AA 4NQRA 4AO6A 1E9SA 1K5PA 1UPAA 1B93A 4B71A 5IM4A 1GUYA 5D1HA 2A7QA 3O73A 4JMLA 2DPYA 4LJ7A 5DISB 5CEFA 1R6BX 4FX5A 2CHUA 2HJSA 1E61A 4KAFA 2OOSA 4MW4A 3JAKA 3IUMA 4JVSB 2AJBA 4ZREA 1XMXA 3AEZA 1IK6A 3CH4B 4G4SO 2Q3DA 4WK0B 4EG6A 4AY6A 3PHBE 3SVZA 1RBYA 1XK7A 2ONYA 3D6VA 1F38A 3F6CA 1Z0AA 2W71A 1EEXB 1G5RA 4IM7A 2WBLC 1PW5A 2W00A 1OFUX 2BGUA 4OHFA 3DFKA 3T9CA 1IWOA 2QBYA 4GPAA 4B80A 4LHWA 2CNDA 1CS0A 2VRCD 5DEOA 5H1YA 5KMGA 2SCUB 4NX2A 1FL9A 4DFDA 1J0DA 2CVFA 3QXCA 3N9IA 3EXIB 1DAEA 2AW3A 1U7ZA 1WB4A 2XMDA 1GFZA 4G2TA 5B3AA 3HB1A 4D0LB 1R5BA 1XTBA 5REQA 5KJ1A 1JWBB 2JL1A 5THKA 1E5TA 2XXAB 3ABOB 4X8LA 4E21A 1SZPA 1P3DA 3AFIA 4FX2A 3TQRA 3W5IA 1CZNA 2REBA 4LOJA 4CNQA 4ZVMA 2VQFB 3ANXA 4NU6A 1KQPA 4PAOA 2H1RA 2D1SA 4XIYA 1S7GA 4YT2A 4R9UC 3HU1A 2AH5A 1NUPA 4BQPA 1ZVVA 3LX4A 5F2KA 3V4OA 3BCSA 4QUJA 1PEAA 4A1OA 4DGQA 4FEGA 2PO7A 4KXVA 3IT2A 2FFQA 2VRNA 4JBLA 1ESZA 4C89A 3D7MA 3PHIA 1V96A 3KVYA 2OGSA 2GRUA 2R44A 1NI5A 2RB4A 1JXAA 2GN9A 4RETA 3T3MB 1H8HD 3IT3A 5EJEA 3OQIA 2QNRA 2IY7A 3IXQA 5FO0A 5DM0A 5IX8A 4M7WA 1P2DA 1ZM7A 1Z15A 4GRAA 4E4RA 2PSDA 1DO0A 1U5BB 1PS9A 2GJAA 3FFBA 3OSZA 1V6CA 2DFKB 1CF2O 3ZQ4A 4FFDA 3VSBA 5LYJF 1I24A 4I8DA 3DM5A 2QU8A 3M0EA 3M9WA 4LMPA 5J63A 1E62A 4FKMA 4AICA 4D80A 4OVKA 3W06A 3LRTA 2AXQA 2WSMA 3AM3A 3IAAA 4C1BA 3HJCA 1F0YA 1PFVA 3ISJA 2C4TA 3N8HA 1R0RE 3LIIA 1U8TA 3T3IA 1DFIA 4BJ3A 3NHYA 4QATA 2Q3LA 3UMMA 1LPOA 4P3NA 4QDXA 4S0ZA 1BEUB 3UBTA 1IK4A 4DQ0A 5JASA 5BYAA 2ARKA 3LQRA 5CDTA 2QTZA 3NWJA 1WU7A 4IIFA 1L1RA 1SBCA 4Y0VA 1TJ4A 4FYXA 1OVGA 4AG3A 3FZYA 2JI8A 3WX0A 3UMRA 4I1YA 3LK6A 4O2BF 1TAHA 4KQEA 2GYVA 4CFYA 1G8GA 3NYIA 1DBRA 1IEXA 1MJFA 3W79A 1BG6A 2ENWA 4EO7A 2MYNA 1RYYA 2P35A 3IPYA 2ZIFA 5E6SA 1FNDA 4CE6A 5BSWA 3UB2A 3DZIA 1PV1A 3EMVA 3R8CA 1D0VA 1F9AA 5BNZA 1C0KA 1QUEA 3DE0X 4FW9A 3RVOA 3I1JA 5H9VA 3UWMA 3IPRA 3QXJA 1AD2A 1NP6A 2QQFA 4NONA 4L0DA 1Y1TA 4TYMA 4NFLA 1QPGA 3DBVO 2HJVA 4ER3A 4FZ5A 1R8YA 1NWHA 2XCIA 5DASA 4G56A 1BD4A 2OQRA 3RYCB 1OREA 4WDRA 4BPRA 3PRHA 4NOMA 3MEQA 1KPHA 1Y5MA 1UT6A 2PS1A 5JVDB 5ICMA 5DE3A 3GK3A 2G72A 4ICIA 2QAJA 4M3NA 1E9FA 1IOZA 3JU3A 1NASA 2RHLA 3CR7A 4OP2A 2YH2A 4N4AA 4RNCA 4AS1A 3EXAA 2EWMA 2QR2A 2ZB8A 3DT6A 3FKSD 4PPFA 4R7TA 3BXHA 3ESDA 5DM4A 5J1TB 2Q1WA 1I32A 4P6VF 5JSZA 2ZYWX 1KXJA 3L6EA 4ENRA 4H9GA 4C0QC 5AHWA 2MT9A 5BOVA 1BTOA 1CNEA 2CZQA 2XZTA 4W7IA 4WJZA 3H19A 3HXTA 3N7AA 3Q3VA 4JJZA 4BAUA 2QL5A 4I2NA 3T3GA 3GIDA 4HX5A 4RVCA 4K05A 4IF6A 3SZLA 4ZPJA 3V80A 1E3SA 4GNKA 1GTVA 4IGFA 2DY1A 2VT6A 1VXOA 1O94A 1U3DA 4FN5A 3ROXA 5C9ZA 1JU9A 5I47A 2H16A 3L84A 1M8KA 1Z2CA 2O7QA 3KEQA 2QM7A 2W8BA 1GZDA 2JZOA 4E33A 1YXMA 3NIFB 4BVKA 5HUQA 4I50F 2BEUA 4UARA 5AI0A 4H4EA 4HNAA 1U3UA 5DLDA 1N0WA 1KAEA 1QRTA 2ADMA 1K4YA 2JCGA 3HMKA 5H83A 1SC1A 2F1IA 4OBEA 5C7YA 2WI8A 3DNPA 2F4VB 1PJ3A 4WY2A 3JASA 4DR7B 1GNPA 5DGCA 4EVSA 1HYGA 1KO7A 1XQXA 4X92A 1XR3A 3BSSA 1LJLA 4D45A 5LNK1 2RB5A 3ZIUA 1WB9A 2X0IA 3CSSA 1JPJA 3N86A 3CPEA 1CQWA 2OE2A 3BJIC 4N40A 5ALPA 4YO7A 2ZSBA 3SHFA 1N4DA 2QTWB 5BW6B 4PNPA 2V7GA 2QTRA 1QFSA 4RD3A 2PUAA 4NZZA 4DIBA 2E4VA 1A98A 3SLGA 2HAEA 3I9V6 1Y3BE 1SPXA 5AI8A 1SOAA 1UUFA 1WM1A 4D56A 2WW8A 2ZAOA 4F93B 4MPJA 5KI6A 2E6KA 1I2AA 2WR8A 4JLAA 1UIMA 3OLZA 4WZBA 1H1LA 1XB2A 3KR2A 4AY2A 4PXYA 4TTTS 4BQQA 1MTOA 1S4MA 1MOSA 1XA3A 3HDQA 3GFRA 1RBZA 2DQSA 4XGRA 1WPQA 1VB5A 1AB5A 3H5VA 1MQ9A 3NASA 3L7DA 4BQRA 5KCZA 1W2WB 1HA3A 1XXHB 3RS7A 2NZJA 4WOBA 3QNMA 1W4AA 4B3BA 2DKFA 2P2NA 3R3UA 1EVIA 2C59A 1GZ4A 3UAWA 3ZWOA 2JGLA 3D0KA 2DHDA 2XF2A 3V8BA 2XUHA 3JQ7A 5EZYF 3IDZA 1BVRA 4CKCA 5C5DA 2L2QA 1GPWB 1VCMA 1VM6A 1JLLB 2JHGA 3H4TA 5AI4A 3WSTA 4BP8A 4MV7A 5C7OO 3MUFA 3R9XA 3CLTC 4Y1GA 1TQ2A 1TVKA 2AK3A 1XZGA 3WLNA 3L7OA 5ADHA 3HM2A 3ESQA 4GT1A 3A0UA 4G8DA 3VZPA 4DA8A 5GVSA 4XD7A 5IKXA 4RA9B 4HNHA 4V02A 3T1NA 1RE1A 2QM8A 1RI5A 1G5QA 3PIDA 5JAMA 1MCZA 1ZO8A 2QTNA 1ECPA 1V95A 1SQ6A 3R0XA 2MYPA 3PENA 4HAYA 5SY6A 1OJLA 1WXHA 1YVRA 3JYPA 1FYVA 2WMOB 1U94A 2CHEA 4PFSA 3JD2A 3N3BC 4IIDA 3GH3A 3K09C 4H7IA 4U9UA 3AR4A 5G0UA 1U99A 4KOEC 2OYCA 1RRKA 3ZK8A 4MR7A 4EW2A 3LXMA 4NK4A 4BMCA 1DG3A 5JAHA 1HFJA 1I30A 4HQRA 4TZ0A 1JE1A 4GSYA 1JAYA 1K92A 1YT5A 1B7GO 4AUNA 4UNIA 5J58A 3F4BA 1WVGA 1J5PA 3K4QA 1H2YA 4ZVSA 2WM3A 4ZI3A 3GV0A 2B3TA 3WNQA 4NZPA 3O7MA 3M6MD 5TPWB 3IXMA 3OZUA 3BWDD 5A6SB 2OHFA 2HWKA 4LY9A 4M7PA 2C00A 4ZI7F 4CMIB 1IUKA 2O4CA 2ODQA 3FLAA 1TU3A 3Q5DA 1RQ7A 3UCEA 2OHHA 3EQZA 3CZ4A 1RJGA 3ZPXA 2O5EA 3P5BA 3CKKA 2UYCA 1I2CA 3UCFA 3DPIA 4EJSB 4ZIRB 4JYAB 1MX5A 3MGCA 3ESCA 4TT3D 4MWGA 4QOHA 1K6EA 3HEMA 1MBZA 1S6YA 4NH4A 3L1IA 4WCFB 5TJ9A 1LK0A 2MSWA 3GJ4A 3NC0C 1GTRA 2P9GA 4DANA 2AUNA 1OA1A 4WJKB 1Z47A 1VMEA 4X1OA 2RBKA 1EFTA 3KQPA 2YIVX 3L92A 1UC5B 4G0MA 1CT9A 1SCUA 3B6MA 4H3KB 4S2EA 7MDHA 1EE2A 4QQNA 3BK2A 1NMSA 3ZHSA 2HHCA 2ZDGA 3WLLA 2ZSHA 4RMIA 4TXLA 4WTOA 4LGVA 1DVRA 3K6JA 1NDQA 4R5HA 5AOVA 2QJTA 1U1FA 5B64A 1Z5GA 5LBTA 4LWPA 1JDZA 1KJJA 1ZINA 2FUG1 4K81B 1K98A 1A96A 2E0IA 2YOFA 4UUOA 1VJRA 3KQTA 2H1IA 4ZO4A 1OH5A 1NT4A 2PRKA 3QYPA 4RK4A 3FTCA 5GINE 3OIVA 2CB0A 3HKEB 3LWBA 1RHUA 2PPVA 1Z2EA 3A4LA 5CG1A 4WBNB 3TFOA 2MMGA 3KQHA 1IZ9A 1PWZA 1CQXA 3QA3E 4GX0A 2QENA 2FU5C 4MUFA 4QGHA 4B8ZA 3RROA 4EPYA 4ZZ1A 1JLRA 1XMOB 3D59A 4UHHA 3MLEA 2OUIA 2P8JA 4V0OA 2AC7A 3DHEA 3VZDA 1SHJA 1AN9A 3W4JA 3AU9A 2Y71A 1ZR2A 1O03A 1T1RA 3P19A 5COAA 3RV4A 1TQDA 5ENDA 4DRYA 4LXXA 4R8RA 1RHJA 2WKWA 2HUPA 4YRLA 1LDMA 5ECWA 1OY1A 3H3XA 3JQGB 1YFZA 3CKMA 4MGYR 4NLLA 1I3NA 3M34A 3ITEA 1MRSA 4DJTA 2JLYA 1A2KC 3KXLA 4XWOA 2IHNA 1HG0A 3RT1A 3C45A 1GZ7A 4ERXA 5FL7A 1J2EA 1OF1A 2D0OB 1ZBQA 2B9VA 2BH9A 4CEIB 4G8JA 2QN9A 2PKQO 4TZ6A 1Z6AA 2X5JO 4YIHA 2BFDB 4LDZA 3I2FA 4AY4A 3GDOA 3EGVA 1D4OA 2X3UA 2DUWA 3U40A 7GPBA 2YY5A 1MAWA 1JAXA 4LKOA 4NDNE 5AM0A 2P4EA 1IOWA 4AF7A 3H04A 4CPDA 2Z6VA 3AILA 4DARA 1NVFA 5JZOA 2QYTA 2BY4A 4N6NA 3PNYA 5GJWC 1SBQA 3H0CA 3E9EA 4JBWA 4OQLA 4EG1A 4UHBA 1QIJA 4OLAA 2XCUA 4M0CA 1RXYA 4BVGA 4RCYA 2ES4A 4IIXA 4L4ZA 2E9SA 1NRXA 3KC2A 1Z37A 1RHRA 1B8NA 2WSYB 4IHJA 5EJ2A 3T5GA 3W6ZA 5BPFA 1K6MA 3JPWA 2IEAA 4ETNA 3UJNA 1GNSA 2PMFA 1JPNA 1CULC 3I5YA 1R12A 2O8NA 5E2AA 4P54A 4K6HA 2OHOA 2WLSA 4DLXA 2BJWA 2BZ1A 4F6RB 4BUZA 3O4RA 1PVVA 1P0FA 1W0CA 2X5NA 4S3MA 2GK4A 3AMVA 4MINA 4P4SA 1A9RA 5BSUA 1FRNA 3B36A 5F35A 4B6JA 1AURA 3TXYA 5C37A 5T5QA 3RSSA 3ZEIA 1PUJA 4MQBA 1IBSA 1NKTA 3I2GA 3JQFC 3IR5A 4ISBA 3CO5A 4H0CA 4Z54A 5FQOA 3W5SA 3T5PA 1DCTA 1U0BB 3DMPA 1G8SA 3DCYA 3G85A 2EP5A 3EXEB 1Y8QB 4L1KA 3VYTB 3NWEA 4B6PA 4HWRA 3JYLA 5TJHA 3DFUA 2VHYA 1FQOA 4KJXA 1AQIA 5JANA 3LT4A 5EKUA 1JYSA 2IPXA 3GLTA 2F59A 4BAZA 5TS2A 4ZYWA 1GZSA 1OIVA 1P1RA 2LIPA 4EYKA 5AVYA 4G0QA 1RXVA 3SHOA 4DIMA 3PVSA 2V6BA 3DMTC 4RQTA 1NPTO 5D2CA 3SYLA 4D97A 4ENQA 2C2GA 2W2VA 2WUEA 4J2OA 3OQBA 2P3LA 3U3MA 4X97A 1EM8A 1N36B 5C18A 1S89A 3ENNA 4OUKX 1PWXA 1W5BA 1NI3A 2QAGC 3VDQA 3R0VA 2EYUA 3AM5A 2NX2A 4C0XA 3MLBA 2O1SA 5G3ZA 1YRBA 3RS5A 8MHTA 1WU8A 2OVBA 1ISPA 3QNUA 3IX7A 3T9FA 4YR7A 5EHIA 2D1QA 1DBWA 1D3AA 4M89A 4UQLA 2OY0A 3WLAA 3BTVA 2Q2QA 5EY5B 3WWEA 3PFKA 2REOA 4QELA 2MR5A 3CQ9A 3BK7A 4E22A 2RDMA 4QOFA 1L5GB 1X7HA 3AEXA 3DM9B 3UV3A 4DJEC 3FTEA 4K8OA 4GOND 3QVTA 1P9NA 2O7SA 1O94C 2WT9A 1OWPA 1EFCA 3G8CA 2V6IA 3Q2KA 2OEPA 5LB4A 4HAVA 2DBQA 3B53X 4JFAA 2OV4A 4PYNA 1SKBA 3ZGVA 3MWLA 1XJ0A 1BGVA 2YN4A 5KKNB 2ZR7A 4RKYA 1TX4B 2F4NA 4EH1A 5FPKA 2AN1A 4JXXA 3VVBA 2Q07A 1QAMA 2A58A 3RRYA 1V5EA 2ZJ3A 4FNAA 1LTKA 1ZK2A 4NCJA 3EASA 4U2DA 3JARB 3S27A 2C9MA 3HJAA 3UW1A 4R2IA 1QQ5A 2J0QA 3KG2A 1VJCA 4PX5A 3PC3A 2HIHA 4UCQA 5FEUA 3HQ4O 4L2IB 4TYWA 1D1QA 3QU2A 1L8QA 1N9GB 2AOVA 1QVRA 4DIDA 5PGMA 4AY5A 1WNFA 5HIKA 2EW1A 2JJQA 3RTGA 4RV5A 3SS9X 1PD0A 4HEA1 2Z8XA 4YP0A 2P5SA 3PHGA 5K45A 3OE5A 3RSCA 1TT5B 4BNMA 1D2EA 1N3YA 1JZQA 1T8UA 3B1YA 1IHDA 2O2JA 1XMPA 4FNMA 4X0EA 4L74A 5JFGA 3K9HA 2A5FA 1DPFA 5IJ0A 1JHQA 1VLHA 2QQEA 2ZBDA 4G37A 1N7JA 1U3GA 2ZIAA 3BCUA 4LPSA 3CF6R 1P0PA 3H7AA 5F21A 1BS2A 1EHCA 3BE6A 2GN8A 4XDGA 1QOPB 2Y4NA 3SS8A 1RYFA 4AQYB 3B9RA 3I9JA 3MCTA 3KZKA 3LCRA 2FMFA 2O1XA 3F5FA 3X1KA 1H2FA 3NBUA 4LA4A 4S1NA 2FG5A 5EP4A 2F6RA 2FPSA 2G9ZA 3A0RB 2WG2A 3A9VA 2NTYC 2XCOA 3T4UA 5ABPA 1RRPA 4J1NA 2Q9UA 3B51X 3P9KA 3ZHVA 1ZJZA 3BFVA 3BGVA 4TGLA 4QBGB 1Q0LA 1P7ZA 2A0WA 3AY0A 4HZGA 3U4CA 2O3QA 4KDCA 1WE2A 1DSSG 4XOUA 5K01A 3ESBA 2Q21A 3F3MA 1MRZA 4HVTA 5FIUA 3W9UA 3UPDA 2R85A 4E11A 4MVJA 2HXSA 2IOFK 4BBZA 3O4IA 2BSXA 2E5WA 2R60A 3EA0A 3RHZA 1LD3A 1HLGA 3QFSA 4JI4B 3A6EA 1QXSA 2ZANA 1YS4A 2V55B 3N07A 4YHHB 3V4PB 3ND8A 3AV0B 8GPBA 1PTJC 4R9SA 4AI6A 2XCQA 2WIGA 1EFHA 1I6MA 4AW9A 3LZDA 3C3XA 1CUDA 3NCHA 2XMSA 3PGLA 1FNSA 3NHKA 4FSDA 4MQMA 5K8TA 2RK6A 4EHNA 3K2IA 3JQQA 5KZMB 2XCSB 3U3DA 3EVTA 3Q0TA 4U8HA 4KLZA 3VH1A 5LZ4A 2Y1EA 1ZJJA 1WA5A 2VNKA 3ABRB 4PIPA 5TMEA 4AKSA 2Z1MA 1W1UA 2CV1A 1MC5A 4MCAA 2JHCA 3JS5A 4I0WB 3T3EA 4GVXA 3PQ3A 4A2CA 4DA0A 1PTJA 1WDTA 3CRMA 4UD2A 2CN1A 5TPWA 2NTVA 2PS3A 3JZFA 4NJMB 3OMWA 4FYMA 5D5PA 2HF8A 4WACA 2YASA 4Q93A 2C1EA 3SD7A 4H7KA 1XTSA 3K8QA 2OG1A 3NTQA 4E70A 4B3FX 3QP9A 4F96A 1XIVA 3V8PA 4DB2A 4ISCA 4P31A 3ZDRA 4YV2A 1KA9H 2A78A 1MUUA 1VSTA 1ZI6A 3PX2A 4RQAA 1HSZA 2GCIA 1CJKC 1ZYUA 3DLPX 1AOXA 1RRVA 4ZIRA 4DV5B 4KAXA 5K4HA 4EIWA 2BR3A 2QUJA 3LKVA 3GJSA 3L43A 1P4GA 4UQOA 3I45A 2CJYA 3MUOA 3CURA 4HQOA 3D4LA 3AHGA 4E6EA 1N2XA 1VE1A 3ZHRA 1B8UA 5BR8B 5KOHA 2PGDA 1H2HA 2OLKA 5BQXA 5ARDA 1SZCA 4A26A 2I2DA 1C1DB 2BFEA 2DM6A 2P5YA 4CIDA 4KXMA 5DPMA 2D0DA 2B20A 4O8CA 4I4TF 1KIFA 2HT6A 2V98A 2J4CA 4MV4A 1EK1A 4HNTA 4AJKA 3TTTA 1KBOA 1QIMA 3MD9A 1HT0A 2FEAA 3AV3A 3E7WA 3EZ6A 5EE1A 4FB5A 1XJ5A 3PUWA 2AOUB 3VKFA 1DV2A 4FDAA 2FSIA 4M0LA 1NE2A 3V33A 1CS4C 1VSUA 4FSHA 4OQMA 1FW6A 2ZG6A 3T1YB 4U5XA 4QASA 4ABTA 3FTQA 1IIBA 3S4YA 1JQJC 1DEHA 2IE0A 2ZZKA 3KXDA 3J81A 2XUZA 5FH9A 1XRRA 2XT0A 3S6JA 3GJXC 3V48A 2BYTA 1PR4A 1SUFA 1PNTA 2D54A 2V3VA 1GR0A 3GEIA 1KFKB 5DCYA 1T9DA 3ZUGA 1AXEA 1XD2B 2B94A 3TVTA 3W5CA 2FLWA 3P4UA 4OK5A 3ZY5A 1C9MA 1Q1BA 3EXIA 3GH1A 3H8SA 4WZAE 5G41A 3VZCA 3KK0A 5KHLB 2BFAA 4GXRA 1M2VB 2ROQA 1WUYA 4UDYX 3O83A 2WTNA 5H3HA 4BX0A 3K1AB 4GZ5A 1ZZEA 1RKQA 2O07A 4LDRA 1YE3A 1W5SA 2EBWA 2VDOB 4UDNA 2FETA 2JJMA 2Q6IA 3WBBA 5EAIA 1O94D 4V0MA 3E9YA 1W30A 5T41A 3L4BA 1QX4A 4PPYA 2HREA 1P74A 2F1JA 4EMSA 4W6QA 2VXOA 2I7TA 3AJDA 3JZMA 1O97C 4M0DA 4MVJP 4R98A 5H82A 5LL6P 3KKZA 2X7HA 4AZ0A 2Z5FA 3QPBA 4BHTA 1LZLA 4Q82A 1QKKA 4PG8A 3HXPA 4Q15A 2A1IA 5HKLA 3VR5D 1QFMA 1KE2A 1U2ZA 5F7ZA 2DEUA 5IASA 4KQIA 3OFKA 3KFVA 4INPA 5A3SA 1WSDA 3FVQA 4M49A 2ZIEA 1FFCA 4RANA 4NMWA 5ILGA 4XRGA 5KTMA 2NAFA 1SU8A 1M75A 2HPAA 3GJ5A 3OKAA 3BF8A 5D7NA 3RUHA 1KZGB 1H2BA 4ZKDA 5EJGA 3ETDA 1V8PA 2WY2D 4KOAA 6CHYA 2IZ7A 1CRZA 5TX7A 2GOYA 3SE7A 4HYYA 4O4IA 4MW9A 2B1RA 3KJGA 4JWKA 6ADHA 3GNLA 5LJLA 3FWPA 2Q1UA 2XJ4A 4R3WA 2NLOA 4NXMB 3OLVA 2AJCA 3OUUA 4PN7A 4YRIA 4BO2A 1FPMA 4GOXA 1E4EB 2FSGA 5KPJA 2VPIA 3FTFA 2POQX 2XH8A 1A5AB 3KR0A 4EGJA 4W9RA 3LBYA 1NV9A 2OCXA 3A70A 4FB4A 2BMEA 3PRJA 3TSAA 1YV9A 2QVYX 1GYQA 2JLQA 3CLHA 4ROSA 2RGDA 1F1JA 1RM4A 2NSYA 2R1ZA 2WG1A 3S81A 5HF6A 2JFWA 3RJZA 1X7YB 1VJ0A 1RVDA 3B70A 4GMFA 1LW7A 2HWWA 5AVTA 2Q46A 4CDGA 4RKWA 2G4VA 3MMPA 4RWZA 4KC0A 1OV4A 4PEVA 3S2ZA 1QZUA 3NRBA 4Z4CA 4GKKB 2RJNA 5B12A 1UZMA 3L7NA 2HA0A 1USVA 3DVAB 1ZD2P 4LSZA 2CNWD 3UG6A 1QHYA 3O4JA 4AJ2A 4RBNA 1Y9EA 3V3KA 5BYKA 5EE3A 1GLVA 1V26A 1Y7TA 3OQMA 3CWZA 3GG2A 3Q2IA 4MWOA 4ER6A 4PC3A 3X1YA 2NUTB 4NQZA 1IYZA 4YK7A 3TLKA 5IULC 2H2WA 3DPSA 5HCUA 3V6LA 3NBXX 4HGPA 2CE2X 4UFPA 4OP1A 1S2MA 5JLJA 5I8PA 2JA1A 2G7MC 4Q7QA 1QVVA 2FUKA 5JMTA 5CCXA 3QVGB 3PJGA 4MARA 2PZLA 1QHFA 1E5XA 3TJZA 1A5SB 1HORA 1RI3A 2FHPA 4JLDA 5EUQB 3N59A 1ZCZA 1X9HA 1TADA 2C4MA 2YV3A 3C6BA 3PD7A 1Q77A 5BSMA 2E4ZA 1UFKA 3HH8A 1JWLA 4KR6A 3R5SA 1EKXA 2PX8A 3QYAA 4L4RA 5F4ZA 3WRXA 2Q9BA 1S3IA 1JLSA 1Z07A 4GWKA 4HH4A 5EJ7A 3BEOA 5T3UA 1NQOA 3UMGA 4D3DA 2QT0A 3H97A 2DQZA 3CX7A 5ECGC 3TB4A 1LDEA 3WZMA 9ATCA 4XQGA 2L42A 1T2EA 2TRSB 3FPSA 4GI7A 4UU1A 3SBEA 5JDIA 2KM1A 1J2YA 4I7EA 5SYMA 3DULA 1HYQA 4WZ6A 4X94A 4D5EA 5C8YF 2VDMB 1YS9A 2WF9A 2HBYA 3LPNA 3AR2A 1ADJA 3OCXA 4P2BA 5HX7A 2R96A 2HSGA 3G5MA 1K88A 2JH8A 4XB1A 1KFJB 2CCKA 2XQGA 1F7VA 3NIDB 1LSJA 1FXUA 2JVJA 2REQB 4DNPA 1XOIA 2PX6A 2G82A 4NV3A 2XCRB 1QDLB 2QN3A 1U8ZA 5A9SA 5L3QB 1N6IA 5CIWA 2JGAA 5FEMA 4E3ZA 3OZVA 1IJEA 1OASA 1V3TA 5BSKA 1ZAKA 3O4FA 4MYTA 4FE7A 1V43A 2RHGB 1FUYB 2IEDA 4OOEA 4P4LA 4X1IA 1ZMRA 1DG9A 4G65A 1UKAA 9LDBA 5KQSA 2XXBA 5B3JA 3HI4A 3MWGA 4YYZA 1WXGA 1I7QB 4YXWD 5DJ5A 2JRCA 2OZVA 5LWHA 4R7ZA 5EKSA 3SIWA 3UH0A 5AFSA 1NQXA 2JFFA 4ZTZB 4MQ5A 1QK3A 1B1CA 2P62A 3RQIA 4MVJF 4JSRA 3H86A 3ZH9B 2OCYC 4LRUA 1N9GA 4JGGA 5EJFA 1V1RA 2RGBA 2VOJA 4BNDB 3AK4A 1Q2XA 1Q7EA 3FRHA 2WD7B 2QR3A 4EHJA 3LJKA 3BFPA 2YWGA 4FEAA 2I4LA 3G8AA 1WSAA 4RY0A 1H1LB 4RSHA 2ASEA 2P7HA 4UM5A 1KY4A 3KKQA 4CGYA 4JU8A 1WS6A 2ZI7A 2JFQA 1JSLA 3D8HA 4W5OA 1J8VA 4HRYA 1H2AS 4BRZA 4Q16A 2O8EB 4U0KA 4H31A 1KJWA 1FFWA 2HA7A 4KR7A 3PDJA 3FF4A 3NM5A 4FQ7A 5JE8A 3VR6H 2H2FA 3BE5A 1WPGA 3UH1A 4BVJA 4CWAA 2GUWA 3GXBA 4CKCB 2W6QA 2C7PA 4QTXA 1NHWA 1WUTA 1R37A 1FOEB 4BO3A 1B43A 2J09A 2ZETA 4I1OA 4DEVA 1USGA 2BHTA 2F43B 3O1HB 5TS3A 3ZJUA 3R9XB 1W88A 2OFXA 1JMVA 4ZVQA 3VR5H 6NULA 2FK8A 2YW2A 4FCCA 4AB1A 5INTA 3EG9A 4AJ1A 1NVXQ 2NQTA 2Q49A 1MXFA 5IM4F 2BLLA 1OHHA 421PA 1UAYA 1ADGA 1GYPA 1U5CA 3AEKB 4OF4A 4A9AA 1F60A 4PO8A 4EG7A 5T8KC 5ITSA 1HY3A 1MOZA 3EMBA 1PQYA 3VKWA 4G0UA 3ZVLA 1P7YA 5EERA 1PCXA 3KB1A 4KGDA 2UZ1B 4MPPA 2ZRCA 5ALIA 1V4BA 3LI2A 3OKFA 2DT5A 4PZLA 5HUHA 3W3AH 1W5EA 2E4WA 3T9DA 3E23A 2XE4A 2Q5HA 3PITA 2GRJA 3MYRA 3N2IA 1LPBB 2RC6A 5F5NA 4R1LA 2BUCA 3NOVA 4B3TB 4RPJA 2J0SA 3BMNB 3FCOA 1YO6A 2GDZA 4HNSA 1WHSA 4XWAA 3WY9A 1BNCA 3RS2A 5JNWA 2GZAA 4RMJA 4FE4A 5IAEA 3LUFA 1J5XA 3EZXA 4MGZR 2F7SA 2ISSD 4QARA 1NJSA 3QXSA 3P0HA 3OWHA 1MVOA 1JW9B 4MV6A 1I80A 5C2JB 5DYWA 3DWFA 3PXCX 4OHPA 2GA8A 4Q5IA 1ICEA 4MQLA 3HVJA 4P3OA 2Y0PA 4RD6A 5KU7A 3M3DA 3ILYA 4RHXA 3K0CA 2YC4C 3WLJA 3RVBA 2GA9A 3IQEA 3P4XA 2IV7A 3JVUA 2DTXA 3BOSA 2ZR0A 2WAAA 4OJQA 1PT7A 1XQ9A 2Z2IA 3LOPA 3SLRA 2C95A 3OHPA 5AHKA 4JROA 4Q3OA 4BLUA 2HQOA 5K09A 2NNLD 4OJTA 4AN1A 5H4GA 2ZOSA 3GUUA 3HKBB 4CQMA 3QOXA 1MNAA 5FLEX 5FLXA 3DW1X 5DBEX 3OBIA 2FRXA 4XQEA 2XYVA 5EPUA 2WP0A 1XDZA 4GLJA 3EOBI 3SVLA 3U7HB 1P5ZB 1DUIA 1WIWA 3G5AA 4IDBA 4PXAA 3AF0A 3NOOA 5T3YA 1KI4A 1ISSA 4RFSA 2HRBA 5GGXA 3WIVA 3EC2A 4TTIA 3W2TA 2VDNB 2XF8A 3FVVA 1CEYA 2G5PA 3JQBC 3ZKAA 1D0SA 1QTNA 1UMDA 4YV1A 4QAJA 5ALLA 4IIGA 3F1LA 4GZMA 1T3HA 4PGGA 1Z3IX 3KCQA 4E30A 1XC7A 4BLOA 4HVAA 3SICE 1P31A 1I36A 1SEPA 2YINC 2R00C 4YI5A 4Y2SA 3S2SA 4K88A 4CIAA 1CP3A 3IHLA 3DT9A 3IMKA 4XA8A 2JFVA 1RAHA 2YUTA 1FTWA 3ORFA 4PQFA 4TM8A 3RAJA 1KYQA 2I0FA 3LWNA 3T94A 3ZV6A 2DBVO 5MGNA 4G9BA 3CSDA 4BX2A 3K6RA 2HA4A 4U2CA 5DNUA 1QV7A 1QG0A 4CUZA 3GFFA 5JCZA 1ZLYA 1E98A 3KYCA 3MXTA 5KYWB 5I4CA 3E9DA 1O0SA 1RPNA 1LV7A 1WOYA 5L8VA 2B5VA 5CD9A 2C2OA 5EWJB 5AM4A 3JWPA 4B87A 3TM4A 2JFOA 4MS3B 4Z1MD 5D3QA 1ILEA 3ED5A 4PVDA 1ATIA 3ER9A 4ZVPA 3S5JA 3FYUB 4C4TA 4MEAA 1Q14A 1KWKA 1I51A 1PLKA 1CB0A 2R1VA 4DPKA 4AJLA 4ZI2A 1GPDG 4RX1A 5SICE 2J31A 5DI9A 4HV4A 3R5TA 1JKFA 4G8CA 5HHTA 1Y1SA 3IAEA 5E6SB 1BXRA 1MVNA 3PS9A 4JKYA 4JUBA 2VP2A 4URVR 3OI7A 1OI3A 2J9FB 2JI9A 1IDOA 2FMTA 4BASA 5EZQA 4RK5A 1M3SA 2W2PA 2WF5A 3CPSA 1Q0SA 3K9CA 2P2SA 5TXGA 1Y80A 5C46F 4LUCA 3W9BA 1M6NA 2RCNA 2VYCA 1TA9A 2EP8A 2X76A 5C80A 3A4MA 1BS9A 4I9UA 1XEAA 4GW3A 1YF3A 2XRYA 1BKDR 3ILXA 3ZLUA 1OB5A 3QI2A 2JGMA 1DFGA 4WGFA 4Z1OA 2C04A 4KR0A 4TTVA 2IKQA 3H2GA 5JVDA 3EUWA 3BA6A 3L1UA 4DCUA 2JIZD 2DGDA 2FAXA 3KYIB 4NE9A 1W6RA 2ZGVA 3K1ZA 3Q87B 4KWEA 3W78A 3VR3A 3IA2A 2WJ3A 4KN8A 2WZCA 3BZBA 4K86A 1ES9A 4O02B 4NTZA 4K1LA 4TPKA 5DULA 3M2PA 3L7KA 4LFBB 4DAEA 3OA2A 3DVAA 3S28A 5BOSB 4YAOA 3O21A 4JJ6A 1U7OA 1SB8A 2HK6A 1KJYA 4PTLA 4JXZA 2WJPA 2CJFA 4GBMA 2Q1YA 2OORC 1U9ZA 3W9SA 1QQ7A 2PCLA 3QOFA 4KWHA 5AK0A 3K15A 3JQCA 4B1FA 2QD5A 1UINA 2NSLA 1PE0A 2A1TS 3PXXA 1YU9A 2BEJA 4MITA 5L6LB 2CNOA 1FRVA 2VJNA 3IFSA 4UFNA 3ROQA 4B32A 3PDCA 3NHZA 1JSXA 4PPNA 3C98A 5AJUA 4GWGA 2AOTB 3UOGA 1OX6A 3Q6MA 4HNAB 1UH5A 1ZXLA 5EE5B 1U02A 2YMLA 1WNTA 2ZK7A 1O95A 1CY7A 3SLKA 1VXRA 2HI0A 2QSJA 3ONWA 1NQVA 4C76A 3H5IA 5EIFA 4WHMA 4QRIA 5C5IA 2OCLA 3I04M 2O7NA 4KQXA 4YCAA 4GEKA 2PNJA 1J56A 4RVUA 5B3JC 5BWNA 1RYMA 4QU9A 3G9QA 2I22A 4ZCPA 4JLWA 4X24A 3E7PA 2PPLA 3F7NA 3PPXA 3WDSA 5JC8A 3Q3CA 4YFYA 1HDGO 1NX6A 2ZYIA 1OT5A 3K8OE 5FF9A 1EFLA 4B7XA 1NQUA 1RQXA 1SC6A 3V3TA 4XGIA 2Q3HA 3PD0A 1J5EB 1O6CA 3IKTA 5JIBA 1BDJA 1H6AA 3UWDA 3FOEC 1WUKS 1PT9A 2VP4A 1EQAA 2DFVA 1OLSA 2JBAB 3WKDA 1KY2A 4FQ5A 4R40A 1I7LA 1XAIA 3ESAA 1FJHA 2FJUA 2F48A 3M4NA 3DCJA 4QGGA 5BWBA 4RZSA 2GEFA 4KGVA 3SQNA 4P5EA 2J9YB 1W7AA 1ZBDA 4YJ2F 2BKVA 2C5FA 1HT2E 2V7BA 3WDMA 5CFPA 1SA0A 4XFJA 2FQQA 2UUOA 4A5SA 4S1PA 4IXTA 4PZYA 4V3CA 3ADCA 4IGEA 1DWQA 2Q50A 5LLDA 1IQRA 3N2GA 2JIBA 3HCFA 3F5QA 4RFVA 1COWA 1H4TA 3VTZA 2Z9BA 5CP8A 3GGSA 5G4KB 2JIQA 4O63O 3G1TA 4E12A 4RELA 1N5DA 1C50A 4WKPA 3AVTA 2FWPA 1Z45A 2VBFA 2BBOA 4JQCA 1UT5A 4RVFA 4TZTA 3C7KA 3AEYA 5TSDA 2VK8A 5KNCA 1UBNA 1DTEA 1T5SA 1CJTC 2EFGA 2FCRA 2RHHA 2TMYA 2VF8A 3G59A 4JNCA 2BZSA 3FR7A 4WKBA 4YAWA 3RWBA 1DL5A 2FSPA 2J48A 3I04A 4FU0A 4A6PA 1DFHA 4DUPA 1JLKA 2DUJA 1T5HX 3KT8A 2D59A 3B6IA 4CEHB 2PGLA 1P4HA 3A9CA 5LP6F 3BSYA 4WL0A 2R9VA 4D4HA 4PLZA 1X39A 3NWPA 2RG1A 4TSFA 1XZKA 3UKDA 2DLCX 3LC2O 3E7XA 5SZHB 5SZKB 2ETXA 5FWAA 1KK2A 2YN0A 4I5DA 3HSSA 3SFTA 2FOIA 3TSWA 5C5CA 5ALHA 2P65A 3KR1A 4NYIR 1K86A 3VI4B 1NQTA 3C0KA 4ZVTA 3FI9A 2YWJA 4AJNA 1XDBA 4BIIA 1TZBA 3C8DA 3TLMA 1T6XA 3FGNA 3NB0A 3K9QO 3PP8A 5U4QA 3REGA 2FCAA 1MZPA 1T29A 5KTTA 1DCFA 2FK7A 3G8BA 5AKGA 5B1EA 3OHMA 1WV1A 5AW0A 3GD5A 2PZBA 1Y9AA 4FUQA 4HDSB 3HRIA 5CGQB 3U3JA 4E2WA 1J24A 1I1HA 4IDHA 2DETA 3BILA 3IPXA 3ZY2A 4YTEA 3N05A 5FLKA 1F6BA 5KOIA 2XW6A 3CF4G 3IOYA 3ZZ0A 3QU7A 1V4NA 3B1KA 3LUCA 4YPFA 3WGIA 3D0OA 1K7FB 1YK0A 3DFFA 5WRFA 1N1DA 621PA 1NW7A 1Z5NA 1WQ4A 1T2UA 2CL7X 2AB0A 4MI6A 1JBEA 1AGXA 3FE2A 1WW8A 3D7NA 3FDFA 5H59A 1PI3A 3KEFA 3UAXA 2X1HA 4RZ3A 4F6CA 3DA8A 1Q12A 1Y1QA 1UPUA 2QDXA 1H4VB 1K5DA 5JH7F 3TD9A 1T4DA 2E6UX 5LQNA 5CFRA 5JCOC 3OZRA 1ZUIA 3HCAA 4ARVA 1RKXA 4YWHA 1I8TA 1A4IA 1NN3A 2VTDA 1Z83A 2ZVQX 3SG0A 3USES 4BU0A 3H87A 2DYKA 4ZT7A 4QOEA 5CYGA 4RGVA 3FNGA 1C7ZA 1LQTA 2WAOA 3GI1A 1ORHA 3I39X 3OF3A 1YQTA 4G84A 1BX0A 4EQ6B 4IO0A 3HO1A 3LFUA 1A7UA 4EF4A 2HXGA 1MP0A 4TYPA 4LAFA 3QSGA 3TVYA 3WWYA 1T3SA 3NDJA 1LU9A 4RLFA 3RS9A 3CLUD 3JQBA 1FDVA 4RTRA 5EMKA 2KLHA 2J9ZB 3BM5A 3IV6A 3WL5A 1QHXA 4PBSA 4UTVA 1PHRA 1NF2A 3N6VA 2DLDA 5REQB 1R9JA 1KKUA 2C7BA 2JDIA 4F5DA 2RIRA 3TGWA 1A2QA 1DIBA 1ZSNA 4G5SA 1RI1A 2JKYA 3IEIA 5CA0A 5I4IA 3KFLA 3A9SA 4GH5A 3ZV4A 1CUYA 3WKEA 3UTCA 4TWZA 4U7HA 3ZV5A 4Z53A 1U2PA 1D8AA 4CQMB 3T5BA 2HLPA 3UXYA 3AR3A 3F98A 3L8ZA 4C6RA 2Y0BA 5G0WA 3IT0A 1I1QB 1TIBA 4JUAA 1QJCA 1S3GA 1XTZA 3G5UA 5EWLB 3IA7A 1EDDA 3OUZA 3TOXA 2YXLA 3VO2A 4KX5A 3ZBPA 2UYHA 4KTVE 4JVLA 4KNVA 4YJKA 1X77A 2H9AA 2ZE6A 2GVDC 3O31A 2QTAA 2J7KA 2LCQA 4CEIA 4LJLA 1U5AA 3C5CA 3Q40A 2B82A 2H18A 3ONDA 5FUMA 2R6DA 1W1WA 2JGFA 4JP5A 3U44B 1YZVA 2IZ1A 5JSKA 1U5BA 5ITVA 4UTPA 3EQ7A 4ZGGA 1HI9A 3L8MA 3MB8A 4DF3A 2WP8J 4NE2A 1M2VA 4Y2JA 3AL0C 4QPZA 3H7IA 3V97A 4ZWNA 5G53C 1H65A 2MTBA 2GBPA 5JJIA 4H6VA 3THXB 3MS2A 3ZYZA 4TN5A 3IMCA 3MTJA 2IHTA 1J8FA 4G25A 1E2EA 1MOQA 3BYZA 4R1UA 5F7JA 1QRRA 5FBWB 3BD6A 2BGLA 4P35A 3X1WA 2XTNA 4IJMA 1ICIA 3G0OA 1EJ6A 3JRWA 3IAHA 3ZDDA 1KU6A 4JYMA 1G1MA 1MMFB 2NUBA 3RIXA 4JI3B 4NJEA 4HXFB 1OOEA 2VF7A 4DG9A 3I09A 3ZW7A 3OEHA 4BXOB 3KS9A 2GEKA 1M34B 3AZPA 2C5BA 5JISA 2C3YA 4B73A 3MTIA 3SKXA 2VUTA 3AVVA 4EUHA 1YFLA 4L95C 2YVKA 1KJNA 5EESA 4RCVA 3GCWA 2B7LA 3DLAA 3JASB 4G0ZA 4W8HA 1PQ4A 3SKVA 5AESA 4F4CA 3GT4A 5K8JB 2II6A 5CIYA 1U1CA 2WQ6A 1EP1B 1YK1A 2X9LA 2EATA 2G83A 2P67A 4D9EA 5JYEA 4O4IB 4IHKA 1APBA 3D02A 2FPKA 5KSOA 1GSOA 1I4LD 4IEFB 2QIPA 3ZNNA 3OX2A 2QT1A 4RJLA 2FQXA 1I2MA 1I2DA 4C6HA 3ZH2A 2KX7A 1SXQA 4E5KA 2VHVA 4FE3A 1Q7GA 1X1TA 2E2WA 2VDLB 4QVKA 4HLUA 2GXAA 2GPWA 4MHSA 1R9MA 2BAGA 3EVZA 3SOZA 4D8UA 3UK0A 1KYVA 3TMKA 1KK1A 1N6NA 3JZAA 4CLHA 1X7YA 2VPXA 3NEJA 2B2CA 3DJFA 3PWSA 2WSBA 2DR0A 4MUKA 3QFTA 5ERXA 1W46A 3AR6A 3G9UA 1X9IA 2DBRA 3Q1LA 5FI3A 3E3NA 4W99A 5LM3A 3V9AA 3KOYA 1QYWA 2CVPA 1FU4A 1JSRA 2PZAA 3FW1A 1ZL2A 5GADl 2W6PA 2YZGA 1CVIA 5T8KA 3VYVA 1VLJA 4Y18A 3KIPA 2EF0A 1STOA 3CZAA 1XRJA 3JRNA 3G5TA 1CDEA 4R69A 1A50B 1P6UA 2GK7A 2OP0A 3K73O 1JPUA 1CWUA 2IODA 3PQ4A 3T7AA 2QMZA 2VDJA 1E4VA 1GUDA 3AM1A 1ISFA 3FOBA 3ITDA 3OVMA 1SWVA 3U5TA 1P4SA 1AA6A 3MPOA 3EMDA 4TLBA 2OR3A 3OZBA 4UU0A 1BH2A 1H9CA 2IZ5A 4LDPA 3CU5A 3PQ8A 1L7QA 1B8PA 2P7IA 2FFHA 3NP7A 3HWX1 3IURA 4M1ZA 1Y4UA 1G0NA 1QF6A 1SK8A 1U1EA 1XDWA 4MAFA 1GITA 1CU1A 1RXUA 3O94A 2FEMA 1GGEA 4BGDA 5IHXA 1CUXA 2Q5OA 7REQB 3I9LA 3MGBA 4H1UA 3GEMA 5EEHA 3C5HA 3STTA 1Z5VA 2XCLA 2B5WA 1HLDA 1KR5A 4KH0A 1CIJA 5CJJA 3TEJA 1YFKA 2YJZA 4J3FA 4KVFA 4Q3DA 1TAUA 4RD0A 5E38A 1D04A 1XQYA 3FZGA 1KHHA 1WXQA 5KNBA 3K6SA 1LI7A 4MLCA 4J0EA 4K0RA 1SB9A 5LA6F 1GXSB 1IHUA 1E1DA 2O6HA 1NMZA 1ONOA 2C97A 3JATA 4J29A 5KQRA 2JAXA 4P7JA 1EINA 4DR2B 2ZJ8A 2AS0A 3IC5A 1U8EA 3HA7A 4HX9A 4QDUA 4V0RA 1DXQA 3HLKA 1H6BA 3HPQA 1SIUA 2P9FA 4EA7A 3T54A 1GU7A 4XI9A 2IKSA 4TQUS 5A7GA 2OTCA 3WGKA 1WDLA 3F2IA 3CRNA 5AW1A 1T91A 2F64A 4OHMA 4E46A 1L5WA 4KO3S 1J4AA 5I7AA 4JX9A 3MUEA 2PU7A 3EQ6A 2R66A 1Z0DA 2FR8A 3B20A 4JJFA 4TS1A 3I62A 2AEEA 5B4TA 1GEGA 4YRRA 5J1SB 1PO7A 3THWB 4DV4B 1Z0SA 4QT4A 4D0SA 1A2BA 3O75A 2WF7A 3UQZA 1M6WA 3PL5A 4UNRA 2N9UA 3GLFE 5BSEA 2A8YA 2ATXA 4FQ8A 1QDEA 2FWIA 1V71A 1LDBA 3AFGA 2BGMA 2BDUA 3PGKA 3CTPA 3LO8A 5JW6A 3IEVA 1U0OC 4KO1S 4ZXFA 2UXBB 2DBZA 1G6OA 1PWYE 2I6TA 2ZTMA 3PSAA 4U9IS 3LQYA 3ZIAD 4DLYA 1SK9A 1O8CA 5IKEA 4B3GA 4L4UA 2WV7A 1PJCA 4QM6A 3HVHA 4RO0A 3DOFA 3KQVA 3W5JA 3ESYA 1ABBA 2HWYA 4MR7B 4XXHA 3AHJA 4DNFA 1H5UA 3OJCA 2EU8A 4MXDA 4OI2A 1BCRA 1RWKA 3WOHA 5JRDS 2N1BA 5HGJA 3C3YA 4PQYA 2X3FA 4JEUA 1WR8A 4X41A 4BN0A 3P52A 1NLFA 3BULA 4UNNA 1ZISA 3QH4A 3MGAA 4KXFB 2ID9A 3GA0A 4OBBA 3JQGA 4RACA 4ZI5A 3RLIA 3AJRA 4Z8XA 1O57A 1EWKA 2QMHA 5DI3B 1INLA 3WLPA 1KZ4A 1NLUA 1A8HA 4D9FA 1MABB 2GZRA 2JCSA 2YVLA 3HBAA 4QD3A 5C31A 3VHLB 5JI2E 1U9YA 1VHLA 2O3UA 4YRFA 4PHTA 2OVFA 2R8ZA 3EPRA 3ZG6A 2XIJA 3L79A 1SHKA 3GY0A 3S99A 2HGZA 4RF4A 4LTMA 3OPXA 4G89A 2WT4A 3PNOA 1LCIA 3U1TA 3GMIA 3UK7A 2NZUG 4UTZA 4Y9TA 2I6UA 1VA4A 2HFKA 1T9GS 2OA0A 1UK9A 4O2RA 3M1LA 1SCUB 3VTAA 3DEZA 1C1DA 2BFEB 3GLVA 3VSCA 4KKVA 4ZODA 4CIVA 1S3SA 2HDOA 4GSLA 2HPVA 3OTQA 5EI5A 2YV4A 4QQRA 2G1PA 1ZUWA 1PGOA 2BT4A 1LV8A 2V9PA 1UFOA 5AJWA 4CM7A 2VYFA 3BMNA 2QRVB 1D9XA 1SBIA 4LV5B 1PJ4A 4OL9A 3A8TA 4HQ0A 1L1QA 1D7AA 1MN6A 3U4GA 3GN1A 4I81A 4Q9DA 4WOJA 1FW8A 2CLSA 4FONA 1PDVA 4BLQA 2DB3A 4J7CA 1PDWA 3DYBA 4PSKA 3WE7A 3X1JA 1IN4A 4RTJA 1N8NA 3D4NA 3Q4GA 1JZTA 4KG7A 3AW8A 1V16A 2WTEA 3H9QA 5C1OA 1DKRA 4EAAA 1EB9A 3K30A 5C0OE 4KACA 1O5OA 4IHQA 3PUYA 3I52A 4ENVA 1KI6A 4DLTA 1JGTA 1TE2A 2CMHA 2FY8A 3AKEA 3HDYA 4MNTA 2G9NA 5JS7A 5JY6A 1UBCA 3E84A 1L8LA 1NW6A 3BKWA 3F5MA 3C24A 3R1IA 5AK4A 1QBGA 3PL1A 4WKNA 2VIIA 3SJBA 3N5CA 3EZFA 4OHXA 4ZCSA 3SXJA 3UQYS 1YULA 4ODIA 3CINA 4FFLA 1CR1A 3UFXB 4PS1A 3C43A 1LI5A 5KOHB 4I3HA 1Z4KA 5K3CA 2FPOA 3Q41A 5EP1A 4RYLA 1JMYA 2IXDA 3DW3X 1I6WA 1SKYE 1YOVB 4MWDA 5AM5A 3A9TA 3JAWA 5K0FA 5LXTF 3IPCA 3RI3A 1CERA 3W05A 2NOAA 1OGIA 1E3DA 4RJIA 3BWMA 3OICA 2WJWA 4LY0A 5SY9A 1TA0A 5DN9A 5KTNA 2IGBA 1VJGA 2IF0A 1BEZA 2AC4A 3RSLA 1EBFA 2QRPA 3S8MA 2QTCA 1NJ8A 1BRMA 1F8YA 4JI5B 3O26A 5FCDA 3CCFA 3GL9A 2D7DA 2AE2A 3WBJA 2V9ZA 2H08A 1TCCA 3B3FA 2DHQA 4DIFA 4ZZ0A 5L4SA 2C7OA 2D4HA 4Y0NA 3N2EA 1OD6A 3QY9A 4ZCMA 1JHOA 5IFKA 5AKLA 1HQYE 5JO9A 1ZQ9A 3FPGA 5IXYA 3R0IA 4AC9A 1HDZA 1RU3A 4DMFA 3H2KA 4EVRA 1JVNA 1PAUA 4Z86A 5FI5A 2WYIA 1POWA 1Z4IA 3JD1A 2OC4A 4GR5A 4MW6A 1GKLA 4QO7A 5IJXA 3LRPA 5A5FA 2V0NA 3A1UA 2WE7A 4M21A 4NJEB 1DRKA 1P61B 3OFSA 5FWDA 5B58C 2C9CA 1EFPB 4DILA 4JWTA 2NXJA 4BNJA 3OJEA 2QPTA 3WQHA 5JPCA 2VBIA 2ID4A 3BDAA 4XCVA 4MUHA 5AK6A 4WFIA 4HH3C 3A1VA 2H51A 2RI6A 1ZIYA 4NYMQ 4B2LA 3AR5A 4KHZA 5IEBA 3VU9A 2H54A 4XAQA 3ZEAA 3AYXB 1V37A 3AI2A 5B1SA 1H6CA 3GVHA 1ZGJA 3X2FA 3QUSA 3A04A 3EDQA 1BXRB 1QFJA 1VL1A 1VSQA 3TX6A 3MAAC 4C0WA 4PPQA 4ZAXA 4EGAA 1TYBE 4UULA 3SHTA 3H65A 4OXXA 1WDWB 4GUAA 3PPIA 1VDMA 2FA9A 3M6AA 3QE4A 5GP1A 2NUTA 4DDMA 5K6AC 1ZOSA 3GJQA 2HL6A 2VG8A 4FJ1A 1A4UA 3NRJA 5F1OA 2JFPA 5T4BA 5HE9A 2MSLA 3CNLA 3PHJA 2C54A 3SN6A 4DS3A 2W37A 2ODAA 1RR6A 4YT8A 5F76A 4YPOA 4FFMA 4LZPA 1DAGA 3GQVA 4XUDA 2O57A 1QAQA 2F3PA 4JGIA 5IJ0B 5IM5A 1ISMA 3GMTA 1RMTA 3LP6A 1AQJA 4FHDA 2VKQA 4P7GA 4I9FA 5MFZA 4OY3A 1E7YA 3MBIA 5P8WA 3W5UA 3CX8A 2XVYA 8ATCA 6REQB 2C3OA 3CNQS 2UXCB 3RYHB 2C9BA 1AVTA 4MA5A 1GRRA 1PGPA 2C5SA 1I94B 4U6QA 3WA6A 1EVZA 1KP9A 1O96B 1GPH1 4ER7A 1XTQA 1FBTA 5IK2D 1GDDA 4G0VA 5KNLA 1G8AA 5KWEA 2SECE 4AF8A 1PNOA 1SOUA 4CMHA 1BQEA 2D3TA 3W2EA 2HDWA 2AI1A 3A10A 4LSMA 1SBYA 2W2NA 4IHAA 3I9OA 4G1MB 5KNCH 2UUCB 3FLMA 1AK1A 4FD2A 2QD2A 4UZEA 1F8FA 5GONB 4QLOA 5HW0A 1II9A 5GV7A 4ESHA 1P3Y1 1T1GA 5EHGA 2BISA 3PXDA 1SRQA 4B5KA 1KFEB 3ANMA 5AXBA 4XCXA 3AETB 1L9KA 2O54A 1MGPA 3KDSE 4OMFG 1M1ZA 3I92A 4O1HA 3G2HA 4N3CA 4DDKA 5FBKA 3BORA 3V1MA 4BNYA 1F8UA 1BVYF 3QMVA 2CLKB 2IHJA 3IJEB 2H4ZA 1EFVB 3P9QA 1FTSA 4DHEA 2GKGA 3WDLA 2CYBA 2Z3VA 1V1JA 3RRFA 1C9DB 2QTGA 4ZJZA 4XJVA 5CB8A 1PJBA 1VJTA 2GX6A 4RS3A 2JIPA 2C8VA 3WI7A 1WQ1R 3NHPA 3NT2A 5TF0A 3VHQA 5EJ8A 1B26A 2OQ2A 1TT7A 4FMCB 2WUDA 1IB6A 3H2IA