4YCUA

Crystal structure of cladosporin in complex with human lysyl-trna synthetase
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
505
structure length
505
Chain Sequence
DPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPHLHFGLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine--tRNA ligase
publication title Structural Basis for Specific Inhibition of tRNA Synthetase by an ATP Competitive Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/ ligase inhibitor
total genus 162
structure length 505
sequence length 505
chains with identical sequence B
ec nomenclature ec 6.1.1.6: Lysine--tRNA ligase.
pdb deposition date 2015-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00152 tRNA-synt_2 tRNA synthetases class II (D, K and N)
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ycuA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4ycuA02
4BBSH 3PCOA 1HH2P 4A3CH 1MJEA 1O7IA 3HOZG 2FYKA 1H4QA 4QJFA 4DV4Q 3EIVA 5ELOA 1KMNA 2Z6KA 3GD7A 4UY8C 2VZAA 4JV5L 4GKJQ 4G84A 2NZHA 4DR1L 5JEAG 2IX0A 3V8JA 3CMEA 3V7CA 4P3OA 1VQCA 1GM5A 2DQ3A 3HY0A 1KQSA 2ODRD 2I0QA 4YRTA 4KQEA 5C4XG 1J5WA 3RR5A 3I4NG 4YHHQ 2Q7HA 1HZBA 1IYJB 2DEQA 4QY7A 3PSIA 1CKNA 4DUZQ 2N8NA 2CFMA 4UP8A 1HNWQ 4PHCA 1MKHA 2UXDQ 5HY6A 3ZJYC 3UDFA 3S16H 3EBEA 3MEFA 1I3QH 3JAMc 3D0FA 4PZ8A 1EQRA 4JI2Q 2OQKA 1H95A 4LF9Q 4TQFA 3I2ZA 1MIUA 4AQYQ 2Q2UA 4XU3A 1OXVA 3U4VA 1EOVA 4PZ6A 2PI2E 4XTVA 4A75A 3T1HQ 4A3KH 1HJPA 4G85A 3AQQA 5GROA 4GLXA 2IX1A 5IP7H 1KC8C 1Z47A 4OX9L 1PH6A 4JBMA 3RGLA 1L1OA 2DZ9A 1I94L 1XNRL 2ZCEA 3MEYA 4TVWA 2R7ZG 2LSSA 2JJQA 2DDZA 3KOJA 2DXUA 3CC2A 3KDFA 4HVCA 5C4JH 1SROA 2MFIA 1VQIA 3RIRA 2VL6A 2JQOA 2JA7H 1I50H 1EUJA 1CKMA 4LW1A 2JE6I 3RLOA 1G291 4JI3Q 4P72C 3HOXH 4P75A 4UP9A 3HXZA 3QO7A 4JI4Q 1Q82C 4YP0A 4JI7L 2Q5IA 1YEZA 5FLXc 3RKWA 1C0AA 4NB3A 3KJPA 3J81j 3CQZH 1IXRA 3UDIA 4JBJA 4XTWA 3V7RA 4IJHA 4LFBQ 4L5TA 5E7NA 1ATIA 2VUMG 1E1OA 3H3VH 1SR3A 2ZIOA 5F5WA 5C3EG 3NETA 2ODRC 2ZINA 1VQ8A 4B3MQ 1WFQA 2EJFA 3T1YL 2RF4A 4XTZA 2K5NA 1K8GA 2NVYH 3R07A 4JI8L 2H5XA 1S72A 1OXXK 3H0GH 3KF6A 1PH2A 2UUCL 1YI2A 1NYRA 4TVAA 1WLEA 4TQDA 1RIPA 1HZCA 4H2XA 4R4OA 2VS1A 1HR0L 3VDYA 5GAHC 4DV2Q 4A3EG 1WCMG 1PH3A 1GD7A 4LF6L 2B63G 4C2MH 1PA6A 4JOIA 1SRYA 2E5LL 3M85A 2DU5A 2LXKA 2ZTGA 4YY3L 1AH9A 4L5SA 2NVTH 5IP9G 3CCRA 4LF5L 1Q81C 2K14A 1IBMQ 4K0KL 2AMCA 3CCUA 1WQWA 1YHAA 1YVCA 2YYZA 4IPDA 1Y14B 1CSQA 1XMQQ 1KAWA 5HGQA 4DAYB 2EQSA 4GNXC 4BW9A 2YU9H 3S1QH 2JA5G 2E3CA 1X3GA 1A8VA 1EIYB 4DUYQ 5M3MG 1NJ5A 3S17H 2BA1A 1WOCA 3LSQA 3CCLA 4HWTA 3HKSA 2A19A 3PCOB 3HFZB 1BIBA 1VQ5A 3HOUH 3FKIH 3RNUA 1N33Q 4E51A 3OYYA 4XU0A 3A32A 1QUQA 4DK3C 1PH1A 2UUAL 1MJCA 5DLQE 4DR7Q 2Q2HA 1U5KA 3PO2G 4YRMA 1YJWA 1Z7MA 1ADJA 2N49A 4C3JH 3GTGH 1YFRA 4AH6A 4HIKA 1USYA 3PIOA 1FJGL 4JI6Q 3OTOL 4H02A 4ALPA 2CJ9A 2F52A 1PYBA 3TRZA 2OTJA 1PYSB 3IRBA 3K80C 2DTIA 1CKNB 4HJAA 2I5LX 4GN5A 3HTZA 2GVBA 2JA9A 1N32L 4YRJA 1XTDA 5ELNA 1BBUA 3U50C 1U0LA 3UE0A 3S1RH 1BIAA 3M4PA 1G5IA 1CKOA 5FJ8H 1L1OC 4PZ7A 4YROA 1WI5A 3GTOH 1Y1WG 1SLJA 4YDQA 1TXYA 1PV4A 1E22A 2YTXA 4X65Q 2ZIMA 4GOPB 4H2TA 1M1KC 4R1JA 2CCZA 4GS3A 4AYBG 4CH5A 4DV7L 4KHPL 3CPWA 4L5RC 3RL6A 4WJ3M 1X54A 1L0WA 1PH5A 3BZKA 4P75C 1VQBA 3KDFB 2E64A 3CCSA 4BBRH 1Q86C 5AJ3Q 3TS0A 1PFSA 4DV1L 4L87A 4QIWE 1EYGA 4A3FH 2G4CA 1WJJA 1VQKA 3AFQA 4B3SL 5IE8A 1Q46A 3HOVH 5LMNQ 3CXCA 1NYQA 3I4MH 2B3GA 1B70B 1NMGA 3CAMA 5LMUQ 5JJKA 3CC4A 3A7UA 1K73C 4DAMA 1EVKA 1SERA 1OXSC 1NNHA 4P73A 1V9PA 2C8MA 4A3DH 3HRKA 3F2DA 3CMAA 1YJ9A 2B29A 2UXCL 1NJ6A 2EXDA 4DV6Q 3KLWA 1J6QA 1KOGA 2ZNJA 3L2PA 3TEGA 3GO5A 3RUXA 1NTGA 5C4XH 1PH8A 1QVFA 3CCJA 1J5EL 3I4NH 3LSSA 1N34Q 2OWOA 2UXBQ 3FHWA 4A3GG 1M90C 4CH4A 5IYBH 2ZT5A 4X6AH 4DV4L 4YRKA 3E0EA 4LFCQ 4YCVA 1YBYA 3CMQA 3GTQH 3KF6B 1UWVA 3HXWA 1JMCA 2JK8A 2C35B 4GKJL 2DQ0A 3MF1A 1FVIA 3IG2A 2YTYA 1VQJA 2NVXH 1KRTA 3J80c 2E2IH 1TWGH 4H2XB 1QVGA 4X5OA 2KHIA 2CJAA 4A93G 2ZTDA 4HWPA 4DR5Q 2JA8G 2ZT7A 4P71A 1B8AA 4HJ5A 4YHHL 2HT1A 1G6PA 3M3YH 4GKKQ 5EAYA 4YWKA 1EIYA 1YZ6A 1E1TA 4K87A 4DR6Q 2R7ZH 4DUZL 3H15A 1HNWL 2VQFQ 4BWAA 2F4VQ 3HFZA 3U4ZA 1IBKQ 5C44G 2AMCB 2DJZA 4OLFA 1HZ9A 4YWMA 3DM3A 4JI2L 4KI0A 4IPHA 3KYHC 4LF9L 5C0XI 2R93H 4AQYL 1LUZA 1Z9FA 2ZZGA 3T1HL 4IFDI 4OP0A 1I6HH 1Y1VH 2I5HA 3TQYA 3A0JA 2E1HA 4R4CA 3J7ZC 1S40A 1YFTA 1DGSA 4A3BG 3NBHB 4A3IH 2Q2TA 3STBC 2QA4A 4NXNQ 3H3VI 2KHJA 1PYSA 1W3SA 2ZXFA 4A3MH 4HJ7A 2J3MA 1JJ2A 4X66Q 2UU9L 2ZR3A 2VUMH 1QUQB 3HOWG 2PMFA 4GLVB 1PH9A 2ZZEA 5C3EH 4JI3L 3A5YA 1NE3A 4YRIA 3IKMB 1HR0W 1FL0A 4JI4L 4JI1Q 3S15H 3A5UA 1PHJA 1H4SA 3S1MH 4A76A 1GGMA 5IYDH 4A3JG 1N36Q 4GOPA 3HXYA 3M9BA 2E65A 3PUVA 3PO3G 3ERSX 4LF8Q 1D8LA 4LF7L 4LFBL 2CJBA 4LUOA 4X62Q 2BH2A 5M5YH 3REXA 3BZCA 2D0OA 1VQDA 3CCQA 4JI0Q 3I7FA 3ULLA 5FLMG 1L2FA 3J81i 2B63H 1KIXA 2LXJA 4B3ML 3K7UC 1VQ6A 4HJ8A 3F8TA 1XPOA 5C52B 3RN2A 4BBSG 2ASBA 1B70A 5IP9H 2RCNA 2WB1E 4WF2A 4IJLA 1VQOA 3GDEA 2BH8A 3S24A 1K9MC 4DR2Q 2NVQH 1UE6A 3L7ZC 4BY1G 1EFWA 2K52A 1Q8KA 5M3FG 3RKYA 3KFUA 1CUKA 1NJIC 2AKWB 3S1NH 3PGZA 4POFA 2L15A 2HIXA 1XPRA 2QGQA 3WQZA 3UH0A 3L1AA 1PVOA 4DR3L 1I94Q 1XNRQ 1IBML 5K36G 3A31A 5M5XH 4CH3A 3L2ZA 2ZT8A 2PQAB 3QTCA 2QHUA 3PO2H 2WB1G 4XTXA 5IYCG 1XNQQ 2VY3A 3D31A 3CCEA 4IOAA 2JA6H 1KHIA 4HIDA 3A7AA 3M7NA 4DUYL 4H2YA 3TEHA 3HXXA 1A0IA 1IBLQ 3HKZE 1BKBA 1R9TH 4KR3A 1X55A 5C0XJ 3V8LA 2F3IA 2D0PA 1VQ4A 1BVSA 1N33L 3HY1A 4XTUA 1VQLA 4CS3A 3RN5A 1H4VB 4IPGA 1IZ6A 4DR7L 3J80i 4RQFA 3S2DH 3TUPA 3UFGA 4DV0Q 4BA1I 1ADYA 3FJPA 1UE7A 1X2GA 4R4QA 4JI6L 1RL2A 4CS4A 2E2JH 4KHZA 5C53B 4CH6A 4DV5L 1NY4A 5C0XG 2WP8J 3Q8DA 3ERRA 1WQ7A 2Z6KC 4YREA 2N3SA 4DPGA 1SESA 3ICEA 4R4TA 4IFDG 1WYDA 1AE2A 4B3RQ 3VQVA 2WAQE 3HKZG 2K75A 2AHOB 3OD1A 1HR0Q 1NJ2A 4K86A 4IPCA 3UDXA 4YRLA 3M4OH 1FYFA 1SETA 1X01A 3CCVA 2EWNA 3OW2A 4ZTUB 3CC7A 3P8TA 4DV3Q 4JYAQ 2ALYA 4DQ2A 3GTMH 4X65L 1TWAH 1V43A 4AYBE 1YGBA 1QZGA 3ICAA 1HNXQ 3H0GG 4B3TQ 3NENA 4IO9A 3G48A 1HXDA 2HNIA 3BFMA 1KL9A 4JC0A 1X56A 5GQOA 3W5OA 3EN2A 2K4KA 2K5HA 1VQNA 2UUBQ 2VNUD 3RKXA 2Q7EA 3UGQA 4RQEA 2R92H 1VQFA 2OQ0A 2CIMA 4XTCS 4GOPC 4Q6GA 3VBBA 5LMNL 2WAQG 3NEMA 1WNLA 2EJGA 2NN6I 1A63A 4ZTZB 1VQHA 4ME3A 2DTOA 4XTYA 5LMUL 4A3GH 4GLAC 3J81c 3EFRA 1Q1BA 4ZIBA 1D7QA 4XEOA 2CWPA 1JJCB 4YRNA 1KXLA 2VQEQ 2ZJQA 1K83H 4JBKA 5JJLA 1T9HA 1JJGA 4DV6L 1KD1C 4WJ4A 1JB7A 4WI1A 1GO3E 2JA8H 3VQXA 1NMFA 2MO0A 2KCMA 1OXTA 2AKWA 2PNHA 1QZHA 1SMXA 1VCIA 1X2HA 1XJVA 2UXBL 1VQAA 2ARSA 3K81C 1HNZQ 4P72A 4NXMQ 1UE1A 3HOUG 1N32Q 4LF4Q 3HOZH 3GTPH 3M4QA 3STBD 3G4SA 2RHQB 2CKZB 4OWTB 2Q7GA 4HJ9A 2PQAA 4JI5Q 3RLFA 4QGUA 1XMOQ 4OWWB 4YYEA 4DR5L 4LFAQ 1WU7A 3EFSA 2R7FA 1YNXA 2AWNA 4KR2A 4H2WA 4AIMA 1PH4A 3RZOH 4A3BH 4GKKL 2ZGWA 4DR6L 4DV7Q 3DSQA 2CGHA 3LC0A 2VQFL 3PZCA 2EJ9A 3CP0A 2F4VL 3K0XA 5IT9c 4XU1A 1YHBA 2R7DA 4YRCA 2NZOA 3DLLA 3P8VA 5BR8Q 3HOWH 1E3PA 2XTIA 1QF6A 2P0LA 4XEMA 4JOIC 1UEBA 3GTLH 2DKGA 4H2UA 4BY7G 3ULJA 2R6GA 5M5WH 2I5MX 1SE8A 3RACA 3TEHB 5C51B 3V7SA 4DR4Q 2E10A 2ZM6Q 1UE5A 3CD6A 4NXNL 1OXUA 3W1BA 1EIFA 3QO5A 2UXCQ 4FDBA 4BBRG 2UXDL 2ATWA 4A3FG 4LWCA 5FLMH 5IWAQ 4X64Q 2A8VA 2HIVA 4GN3B 1S3OA 3I4MG 3VQWA 2I4LA 2YTVA 4APVA 4JI1L 4A3LG 3ULPA 1YFSA 1P8LA 1K8AC 1HZAA 3REUA 4BXXG 1N36L 4GNXA 2HHHQ 4OO1I 4QL5A 4A3DG 4HWOA 4LF8L 1X3EA 3IALA 1VQZA 4BY1H 4X62L 1QVCA 4TTVA 3GTKH 5JJIA 1USYC 4YWLA 3WWVA 4JI0L 5M3FH 2MO1A 4RDXA 1LM0A 3NELA 2DGYA 3F2CA 2ZJPA 1K3RA 4KLKA 1LTLA 3F1ZA 4OXPA 4LUZA 2ALYB 3PUXA 4TWAA 2GN5A 1YB3A 5IYBG 1VQGA 2NN6G 4O2DA 4DR2L 4IOCA 1G5HA 1JJCA 4K88A 4DK6C 5IYCH 2FXQA 2AWOA 5GAGC 3HOYG 4JV5Q 3KF8B 4C3IH 1AE3A 4DR1Q 2ES2A 3F2BA 3HXVA 4A3EH 4RMFA 3PUWA 1SFOH 1WCMH 1EVLA 4GN4B 5GAEC 2VW9A 2DVEA 4JBWA 3UE1A 3G71A 1VQPA 3V8KA 4A3CG 1E24A 3UDGA 3AEVA 5KNNA 3I56A 4UP7A 4QQBX 2UU9Q 3K7AH 2I4MA 4CS2A 1XNQL 1VQ9A 2GVAA 2A1AA 2RHQA 2R93G 1VQMA 1HTTA 2IHEA 1I5FA 2JEAI 4HIMA 4DV2L 1TWHH 4PG3A 2QHSA 3L4GB 2ARUA 1NBWA 1Y1VG 4BA2I 1IBLL 4P73C 2JA5H 1C7YA 1NJ8A 4UPAA 3A7RA 5M3MH 4A3IG 3A5ZB 4JG2A 1G51A 3JC66 4RG1A 4OX9Q 1YIJA 4NCXA 2K50A 2KCTA 4LF7Q 4C3HH 1GVPA 4XU2A 4A3MG 5K1PA 3PF5A 3QO8A 4P3PA 1Q12A 3G6EA 4DV0L 1OTCA 2DXTA 4HWRA 1XMQL 2QHTA 4OWXB 2K5VA 1QE0A 1W2BA 3FP9A 2ZJRA 4LUVA 3HFVA 4P74A 4HIOA 1X3FA 5IYDG 4A3KG 2IY5A 5LMNW 2KENA 1VQEA 3MXNB 4JI7Q 2BA0A 3KJOA 2XGTA 3PUZA 5IP7G 2J3LA 2KBNA 3TREA 4B3RL 4PMWA 3GTJH 2P5IA 2N78A 2Q5HA 4YRPA 1Q7YC 3J7A5 2Y0SE 1RIQA 2WFWA 2QEXA 3RF1A 1P16A 1TWCH 4P71C 4IFDJ 4R4IA 2CWAA 2JA7G 2DTHA 2E2HH 4DV3L 4JYAL 1EWIA 3AFPA 1Y1WH 4DR3Q 2MQHA 3HOXG 1B7YB 1N8RC 3T1YQ 1HNXL 4B3TL 3W3SA 4JI8Q 4O0AA 2YV5A 4JCVE 2MNAA 4XIGS 2UUBL 2UUCQ 3TS2A 1CSPA 2D62A 1ASYA 4OO1G 4YPFA 11ASA 2RHSB 1W66A 2QHVA 4HWSA 3S14H 1YHQA 2Y0SG 2HQLA 4DKAC 4YRFA 4LF6Q 1V1QA 3CW2C 1K0RA 2EL9A 2E5LQ 2E41A 3PUYA 1E7ZA 2Z0SA 4YRSA 1X9NA 1X6OA 3A74A 1XPUA 4YY3Q 4GNXB 2VQEL 4LF5Q 5IY0A 1SRUA 3I4OA 2IHFA 4K0KQ 2ZZFA 3E9HA 5E3IA 1Z7NA 3CPFA 3CF5A 2JA6G 4LNQA 3CCMA 3SGIA 5AJ3L 4HA8A 4MZ9A 2Q2IA 3PF4A 2JEBI 4DV5Q 3AYHB 1HC7A 3U58A 1YITA 1HNZL 3P8YA 4Q15A 4NXML 1X65A 4LF4L 1TWFH 3JAMi 2EIFA 1IL2A 1KRSA 3LGJA 5GADC 4P3NA 3IKLA 2V1CC 2DU7A 2UUAQ 4JI5L 4BY7H 3MF2A 1XMOL 1FGUA 3G1ZA 4TVYA 2IT1A 4LFAL 4YRGA 4MNOA 4L5QA 1FJGQ 4A93H 1PH7A 2E8GA 3OTOQ 3L4GA 3ER0A 4DNIA 4LNSA 4MTNA 3S2HH 1L1OB 2E5AA 1A62A 4YCUA 1N34L 2ID0A 1BBWA 2ZR2A 3W1GA 4H2VA 3A5ZA 4H2SA 2DZCA 4LFCL 5BR8L 1KMMA 3E9IA 3FKIG 5C44H 2PMEA 1JE5A 1SN8A 4Y7NH 1YJNA 4TQUS 4A3LH 3L0OA 3HXUA 4Y52H 4EX5A 3RZDH 3QNEA 4DR4L 4BXXH 1H4TA 1B76A 12ASA 2ZM6L 1JT8A 2EAYA 1EQQA 5J3BA 4KHPQ 4OONA 1WPYA 2I4NA 5K1XA 1C9OA 2OTLA 2ZT6A 2R92G 4P74C 1GKHA 1IBKL 5IWAL 4YRRA 3PIPA 3K8AA 2PMZE 3I55A 1Q1EA 4X64L 4POGA 1NJ1A 3HRIA 4DV1Q 2I4OA 4B3SQ 5FJ8G 4YCWA 3B6YA 4EQ5A 3BU2A 2CQOA 3BJUA 2HHHL 2PI2A 2IY5B 1B7YA 2ARTA 1ASZA 2DUDA 4A3JH 1LYLA 4NPSA 4TVAB 2ZTCA 3PO3H 5H1SE 3RLNA 3VQYA 2ZTEA 3HOYH 4EO4A 1VS0A 4J15A 3UGTA 4X66L 4YRQA 4A4IA 5JEAJ 3PV0A 2OCEA 2RHSA 2ZNIA 3HOVG 1N9WA 2C7IA 1J5EQ 1VQ7A
chains in the Genus database with same CATH superfamily
4V190 3K0YA 4KN7C 4BBSH 3PCOA 2A6ED 1HH2P 4ZYSA 5BN3A 4A3CH 1MJEA 1O7IA 2G5DA 3HOZG 2FYKA 4JW0A 1H4QA 4QJFA 5KNDA 3PIO3 4DV4Q 3EIVA 5ELOA 2R92B 1KMNA 2Z6KA 1H9JA 1NAPA 2NUCA 3GD7A 5FLXL 4UY8C 2VZAA 2LS01 2TSSA 4JV5L 2BCOA 4GKJQ 3QWNA 4G84A 1A15A 1ET9A 2NZHA 4OL7A 4DR1L 1L0XB 5JEAG 3S1RB 2IX0A 3TBIB 3V8JA 1SSOA 3CMEA 3V7CA 3U9SA 4P3OA 3QR8A 1BCPF 1VQCA 4A3GB 1GM5A 2DQ3A 3HY0A 1KQSA 3QO2A 3K58A 2ODRD 2I0QA 4YRTA 1DD2A 4KQEA 5C4XG 1J5WA 1SMYC 2F4IA 3RR5A 1SNMA 4M1UB 4NKLA 3NP8A 2ICIA 1K8MA 4YHHQ 3I4NG 1K83B 2E74C 1IYJB 1HZBA 3NWTA 2Q7HA 1I4PA 5I4DA 2DEQA 4QY7A 3PSIA 5G3LD 1CKNA 4OHJA 1U4LA 2C9OA 4LVMA 4DUZQ 2N8NA 2CFMA 4UP8A 1HNWQ 5K36H 4C56C 1MKHA 2UXDQ 1E2VA 5HY6A 2EVBA 4PHCA 2XVSA 1MI2A 3HP3A 3ZJYC 3UDFA 2JA8B 3S16H 2EY1A 3EBEA 3MEFA 4N8FA 1I3QH 1PTOC 3JAMc 5KNBA 2VB2X 3D0FA 1EQRA 4PZ8A 4JI2Q 2EJGC 4QB4A 1G6ZA 2OQKA 4N9TA 4V0BA 2K03A 1H95A 4LF9Q 4TQFA 2G9HD 1MIUA 3I2ZA 4AQYQ 2Q2UA 4XU3A 1OXVA 3U4VA 1EOVA 1HQRD 1PDQA 4PZ6A 2PI2E 4XTVA 5HURA 1EY8A 4A75A 3T1HQ 5ISRA 1LLRD 4A3KH 3EA6A 1HJPA 2DJGC 3BG3A 2BDNA 3AQQA 3VR6A 4G85A 2DNCA 1YNNC 5GROA 4ZUIA 4GLXA 2XRQD 3HOZB 2IX1A 4IUNA 3GTPB 5IP7H 1KC8C 1Z47A 4OX9L 1PH6A 4JBMA 3RGLA 1L1OA 2DZ9A 1I94L 1XNRL 2ZCEA 4KHVA 5D3IB 3MEYA 1UEAB 4G7HC 4TVWA 2R7ZG 2LSSA 1PRTF 2Q8RE 4Q5VA 2JJQA 3C2PA 2DDZA 3KOJA 2DXUA 1D1KA 3CC2A 3KDFA 5BN4A 4HVCA 5C4JH 2IPKD 1II3A 3NQTA 1SROA 2MFIA 1VQIA 4OELB 1I4XA 3RIRA 2VL6A 2JQOA 1O7LA 2JA7H 1BCPD 1JWUD 1I50H 1EUJA 1CKMA 4LW1A 2JE6I 4NW2A 2NS6A 1EIGA 3FVQA 3RZOB 4A3BB 2D5DA 2H1EA 1PZJD 3RLOA 1G291 4J1MA 4JI3Q 4P72C 5C3XA 3HOXH 4P75A 2N55A 3BS1A 3KBXA 2XWJB 4HTHA 4UP9A 3HXZA 3QO7A 3H91A 4JI4Q 1Q82C 4YP0A 3MXPA 4JI7L 3DEOA 2Q5IA 2NZ1D 1Q3LA 1YEZA 2M9VA 4CDFC 5FLXc 2A6EC 3Q0AA 3RKWA 1C0AA 1YNJD 4NB3A 3KJPA 3J81j 3CQZH 2LY7A 3E0JA 4IFDH 1IXRA 2EYPA 2RA4A 2A5HA 3UDIA 4OO1H 3QIAA 4JBJA 1AZPA 3GTLB 4XTWA 3V7RA 4IJHA 5D14A 4DAPA 4Z9CB 4LFBQ 3RUZA 3MC0B 4L5TA 3HZXA 5E7NA 3CHBD 1KAAA 1ATIA 2NVXB 5M5WB 1CFMA 2VUMG 1K0SA 1E1OA 5EBDA 4UHVA 4ZUJA 3H3VH 2FJ2A 2RSNA 1F2LA 3I4LA 3VR4A 1SR3A 3P7JA 5JOBA 2ZIOA 1UAPA 4EQPA 2ZXOA 5F5WA 2X69A 3J7AV 5C3EG 3NETA 2ODRC 1TS4A 1TQOA 2ZINA 1VQ8A 4B3MQ 1EY4A 1WFQA 3OW7A 1IKLA 4FYDA 3T1YL 2F0UA 2B2YA 2RF4A 3K5NA 2EJFA 1FYCA 2CH4W 1IYVA 4EVOA 1A2UA 4XTZA 2K5NA 1K8GA 2TMPA 2NVYH 3R07A 4JI8L 2H5XA 2RVLA 1S72A 1OXXK 5D65A 3H0GH 1PRTD 3KF6A 1PH2A 2UUCL 1EY6A 1SYEA 2F0IA 1JCKB 1YI2A 1NYRA 4G7OC 4TVAA 1WLEA 1RDPD 5A35A 3VYTA 4C3IG 2AQ1B 5CBAE 3SHLA 4TQDA 1RIPA 1HZCA 1HPCA 4H2XA 4R4OA 2VS1A 1HR0L 3VDYA 4JVZA 5GAHC 4DV2Q 2B2TA 1LT6D 3H09A 4A3EG 1LTID 4LVJA 1WCMG 1PH3A 1GD7A 4LF6L 2B63G 4C2MH 1CK1A 5CV5A 5CGKA 1PA6A 3FPPA 4JOIA 1SRYA 2E5LL 4XQJA 4DAVA 1SNPA 1ZEQX 3M85A 2DU5A 2LXKA 4ZCKA 5KNCA 2ZTGA 4YY3L 1AH9A 5KIXA 1ILQA 4BY1B 4L5SA 2NVTH 4DXFA 5IP9G 1QJOA 3CCRA 3GTKB 1F9RA 4LF5L 1Q81C 2K14A 1IBMQ 4K0KL 4IZ8A 1STNA 3NBIA 2AMCA 3CCUA 5M3FB 1WQWA 4IN3A 1YHAA 5FOBB 5ELEA 2NB0A 1YVCA 1K8OA 2YYZA 1PZID 4IPDA 1Y14B 1CSQA 1XMQQ 4U68A 1KAWA 5CBEE 1ENCA 5HGQA 1UUPA 5A2QE 2MUYA 3K6OA 2ZXPA 2K1BA 2I46A 1ICFB 1QCBD 4FP5D 4DAYB 3ND8A 3TZUA 2EQSA 4GNXC 1GUSA 2ZXRA 4BW9A 2YU9H 3S1QH 3T56B 2JA5G 2E3CA 4K2KA 1X3GA 1A8VA 1EIYB 4DUYQ 1GHJA 5M3MG 1NJ5A 4OIKA 3S17H 2BA1A 4CJ2C 1WOCA 4DXGA 4RGOS 1I4HA 3LSQA 3CCLA 4HWTA 4FNFA 3NBHA 3HKSA 2A19A 3PCOB 2F0FA 3BYTB 4QCLA 3HFZB 1Y69U 1BIBA 1F9SA 4C3IB 1LO5D 1VQ5A 3HOUH 3FKIH 3RNUA 5KEEA 1N33Q 2FINB 3OYYA 4XU0A 4E51A 4HMIA 4ODGA 2EPBA 4B08A 3A32A 1QUQA 4DK3C 1PH1A 2UUAL 1Y8OB 1MJCA 5DAUA 5DLQE 4DR7Q 2Q2HA 1U5KA 3J7YW 3PO2G 4YRMA 1YJWA 5FLXE 4A3EB 1Z7MA 3A8JE 1SNQA 2NWGA 1HHVA 1ADJA 3IFTA 1SFOB 2N49A 4C3JH 3GTGH 1YFRA 1WCMB 3E5SA 4AH6A 4HIKA 1G8ZD 1USYA 3DUZA 3PIOA 1FJGL 4JI6Q 1SXTA 3OTOL 2VB3X 4H02A 2A73B 5IOCA 4QF4A 4FF1A 1RTOA 4ALPA 4X3UA 2CJ9A 3URYA 3T4AC 3OIQA 2F52A 1PYBA 3TRZA 2OTJA 1PYSB 3IRBA 2EJMA 3SE0A 3K7AB 3SXHA 1T5EA 5I6WA 3K80C 1PRTC 3SEBA 1SNOA 5CC4A 2DTIA 1CKNB 3N52A 4HJAA 5JPNC 1D6EC 4HMJA 2I5LX 4GN5A 1D5MC 3HTZA 2GVBA 2JA9A 1N32L 2K5WA 1DXMA 4YRJA 2F0MA 2AUJD 2NTSA 4ABNA 1XTDA 5C5LA 5ELNA 1SJHD 2E76C 1BBUA 3U50C 1U0LA 3UE0A 2BE5C 3S1RH 5K5PA 1BIAA 4FF2A 1TWHB 3M4PA 4H7BA 2B8GA 1WTXA 1G5IA 1CKOA 5FJ8H 3NTHA 3NUCA 1L1OC 4PZ7A 4YROA 1WI5A 1GUNA 1FR3A 3OHXC 2JA5B 2QILA 3GTOH 1Y1WG 2HUGA 3D6WA 5M3MB 3Q22A 3TMEA 1FD7D 4ILWA 1SLJA 2HD3A 4YDQA 1TXYA 5IGBA 1PV4A 1B50A 3HS0C 1E22A 2YTXA 4X65Q 2ZIMA 1CHQD 4GOPB 4C3HB 4H2TA 4XQNA 1M1KC 1G2TA 1LTRD 4R1JA 2CCZA 2FFKB 4GS3A 3S9WA 2K01A 4AYBG 4CH5A 4DV7L 1QE6A 4KHPL 3CPWA 4L5RC 3RL6A 3Q6SA 4WJ3M 2EOTA 1W6JA 1X54A 4XYQA 1L0WA 1PH5A 1SNCA 2F0SA 4CKBA 1KDCA 3BZKA 4P75C 1VQBA 4R8NA 3KDFB 3MQZA 2F0PA 2E64A 3CCSA 4BBRH 2KQ3A 1Q86C 1L0YB 1RF2D 5AJ3Q 3TS0A 5I6YA 4CDEC 1PFSA 1WD1A 4DV1L 4L87A 4QIWE 5ELBA 4RKLA 1EYGA 4A3FH 4HN7A 1O80A 2G4CA 1WJJA 1VQKA 3MEHA 1MGSA 3AFQA 4B3SL 3KUPA 1LT4D 5IE8A 4X3KA 2RQXA 1Q46A 1MD2D 3HOVH 1A6XA 5LMNQ 4XDXA 2D9UA 5DM73 3CXCA 3I4MH 1NYQA 2B3GA 1B70B 3O13A 1NMGA 3CAMA 2B2VC 5LMUQ 5LL6X 5JJKA 3CC4A 3A7UA 1K73C 4DAMA 1HTPA 1EVKA 3GTJB 1SERA 1HRJA 3R3OA 2XSCA 3R93A 1OXSC 1EY9A 1NNHA 3OIPA 1STYA 4P73A 5I2YA 1V9PA 2C8MA 4A3DH 3HRKA 3F2DA 1QNKA 4UAIA 3CMAA 1YJ9A 2B29A 2UXCL 5JEAH 4K5WA 5E1FA 1PLFA 1NJ6A 2WAQB 2EXDA 1M4VA 1QILA 4DV6Q 3KLWA 1BF4A 2E2HB 1J6QA 1KOGA 2A69D 2ZNJA 3L2PA 3TEGA 1Y1WB 3P20A 3GO5A 3RUXA 1TS5A 2F1MA 4WORA 1NTGA 1STAA 4X3TA 5C4XH 1PH8A 1TS3A 1QVFA 4XYOA 3CCJA 1J5EL 3K5OA 3I4NH 4CJ0B 4PNYA 2DY8A 3LSSA 1A2TA 1N34Q 3KBGA 2OWOA 2O5IC 2UXBQ 3FHWA 4A3GG 5NUCA 2XWBB 1EQTA 4AYBB 1M90C 4CH4A 1CHPD 5IYBH 4X6AH 2ZT5A 1YNND 4DV4L 4YRKA 3E0EA 4LFCQ 4YCVA 1YBYA 1H9SA 2B2TC 2IX3A 3CMQA 3GTQH 2NN6H 3KF6B 1UWVA 3HXWA 3FRPB 3IAYA 1JMCA 2JK8A 2C35B 2MHVA 4L63B 1CZGA 4GKJL 2DQ0A 4PV1C 1JR0D 3S14B 3MF1A 3HGBA 1FVIA 3IG2A 4P2CB 2YTYA 1VQJA 1JORA 4IUTA 1Y8PB 2NVXH 3A7AB 1KRTA 3J80c 5FK9C 1TWGH 2E2IH 3AMUA 3H6MA 4H2XB 3I8ZA 1QVGA 5EPLA 4X5OA 1U9RA 3SK6A 2KHIA 2CJAA 1WTQA 2ZTDA 2CH4A 2EYJA 1PYWD 5CMDA 4CGYB 3C46A 4DR5Q 2JA8G 2ZT7A 5COYA 4P71A 1Z6HA 1B8AA 3SK4A 4MIUA 4RCNA 4HJ5A 3LNNA 4YHHL 2HT1A 1G6PA 2PZTA 3M3YH 4GKKQ 5EAYA 4YWKA 1UNSA 1SAPA 1YZ6A 1EIYA 3E3XA 1E1TA 2Z4HA 4K87A 3FMCA 2R7ZH 4DR6Q 1SYGA 4DUZL 1STEA 3H15A 2VQFQ 1HNWL 2X6LA 3NHHA 4BWAA 2F4VQ 1EU3A 1FNVA 3HFZA 3D3RA 3U4ZA 1IBKQ 5C44G 2AMCB 2DJZA 4OLFA 1HZ9A 4YWMA 3DM3A 3EFXD 4JI2L 3NE5B 2CHBD 4KI0A 4IPHA 3KYHC 2IL8A 4G7ZC 4LF9L 5C0XI 4RAUC 2R93H 4AQYL 5HGTA 1S5FD 2WACA 1NR2A 4LAAA 1LUZA 1Z9FA 3MZ5A 2ZZGA 1A3TA 2JP1A 4JK1C 3T1HL 4IFDI 4OP0A 4QIWB 1BQQT 3OSOA 5J1ZA 1A3VA 1I6HH 1Y1VH 1A3UA 2I5HA 3PQIA 3TQYA 1TWFB 3A0JA 1NNXA 4R4CA 5CV6A 3TP8A 2E1HA 1I4QA 3J7ZC 1S40A 2MJ8A 1VMCA 1YFTA 1DGSA 4EQNA 4A3BG 1DOMA 3NBHB 4A3IH 2Q2TA 3STBC 4NDXA 5KYIA 2QA4A 4NXNQ 2QEJC 2KHJA 3H3VI 1PYSA 1W3SA 3VR3A 1BUVT 3WOFA 4BY7B 2ZXFA 3G7LA 1EYDA 5LHY1 4HJ7A 1B1ZA 4A3MH 1JJ2A 2J3MA 4X66Q 2UU9L 2ZR3A 2VUMH 2L55A 2KEEA 3MFYA 1QUQB 3V96A 3HOWG 1U4PA 2A69C 4A93B 2PMFA 4GLVB 1PH9A 1CM9A 2ZZEA 5C3EH 4JI3L 3S2HB 1STHA 2O4XA 2L1BA 3A5YA 1NE3A 3L3OC 2EYOA 2IW3A 4YRIA 3IKMB 4CBVA 1HR0W 2R3ZA 1FL0A 3TP6A 3NSWA 1EZ6A 4JI4L 4JI1Q 3S15H 3A5UA 1PHJA 1H4SA 2F0NA 4ZKCB 5IGEA 4A76A 3S1MH 1GGMA 5IYDH 1IKMA 4A3JG 5IGGA 1BR9A 3DWAA 3V2TA 1N36Q 4GOPA 3HXYA 3M9BA 2E65A 5EBCA 2L12A 3PUVA 4R9WA 3PO3G 5C44B 1XXGA 5DM63 3ERSX 1ZKOA 1VF5C 3TDQA 5EJWA 2WKDA 4LF8Q 1IW7D 1D8LA 3R2TA 4LF7L 4LFBL 4Y7NB 3CRKC 2CJBA 1STGA 3NK9A 4LUOA 4X62Q 1XTCD 2IJ0A 1CTMA 2BH2A 5M5YH 1O78A 3REXA 5JAVA 4BS9A 3BZCA 3VA7A 1SYDA 2D0OA 1VQDA 1F77A 3CCQA 1CA5A 4JI0Q 4FF3A 3I7FA 1EYAA 5IIFA 4EQOA 3ULLA 3RZDB 5FLMG 2WKCA 1L2FA 3J81i 2B63H 1KIXA 1SYBA 2LXJA 3MWYW 4B3ML 3BDLA 1T5XD 3K7UC 1VQ6A 1EU4A 4HJ8A 3F8TA 1XPOA 5C52B 1ESRA 2F03A 3RN2A 1WTRA 4BBSG 2ASBA 1PFMA 1B70A 1TS2A 5IP9H 2RCNA 2WB1E 2KUMA 3J80E 4WF2A 3LWUA 4IJLA 1XWEA 1VQOA 1XX8A 3GDEA 2BH8A 2K33A 3S24A 1K9MC 3I91A 4DR2Q 2NVQH 1UE6A 3L7ZC 3HOWB 2KCNA 4BY1G 1EFWA 5IODA 1PXUA 1JOQA 3I90A 5BN5A 4OEMB 4DK1A 1TIID 2K52A 4KKUA 2SEBD 1JOKA 2J4XA 2Z9HA 1Q8KA 1WTOA 5M3FG 3RKYA 3KFUA 1CUKA 4TRDA 1NJIC 4HSVA 2AKWB 5AFWA 3S1NH 3PGZA 4POFA 2A6HC 1EWCA 1H9KA 1LT3D 2HIXA 2L15A 5EGTA 3PIP3 3SDZA 2QGQA 2RCFA 1XPRA 3WQZA 4RHSA 2MP1A 4A3JB 3C3LA 3UH0A 3L1AA 1PVOA 4DR3L 4IUPA 1I94Q 1XNRQ 1ML0D 3PO3B 1CT1D 1IBML 3HOYB 5K36G 3A31A 4N8X1 5M5XH 2SNSA 4CH3A 2KVMA 3L2ZA 2ZT8A 2PQAB 3QTCA 3EVQA 4RGNA 2QHUA 2NYZD 3PO2H 2WB1G 4XTXA 5IYCG 2JSOA 1AW7A 1XNQQ 2ZT9C 2VY3A 3D31A 4BWGB 3F2UA 3CCEA 4IOAA 3BDOA 1B9MA 2JA6H 1KHIA 1Q90A 1GHKA 4HIDA 1PZKD 3A7AA 2BE5D 4KD4A 2RDHA 3AU7A 3M7NA 2RKSA 4EGVA 3AB9A 1JQYD 2B2UA 4BBSB 1EY7A 4DUYL 4H2YA 3BVMA 3TEHA 5IGCA 4KJNA 3HXXA 1S5CD 1A0IA 1IBLQ 3HKZE 1BKBA 1R9TH 4KR3A 1X55A 1F9QA 1V1PA 4NMZA 5C0XJ 3V8LA 2L11A 1HQMC 2D0PA 2F3IA 3HRZC 4LVKA 2B2WC 5JVH3 1VQ4A 1BVSA 4K2LA 1N33L 1DZ1A 3HY1A 4XTUA 3NQIA 1H9SB 2K6AA 3J81L 1IW7C 1VQLA 1EWHA 4CKCA 4CS3A 3RN5A 1BNZA 1FNWA 3E6ZX 3T51B 1H4VB 3P75A 4IPGA 5M9OA 1IZ6A 4DR7L 3J80i 1NCVA 4RQFA 5F2DA 4HR7B 3S2DH 3TUPA 3UFGA 1S4ZA 3OOCA 3DXJC 4DV0Q 3I3CA 4BA1I 1ADYA 3FJPA 4F87A 1UE7A 1X2GA 4IURA 4R4QA 4JI6L 4MHEA 1RL2A 4CS4A 2E2JH 4LJZC 3GV3A 3QJYA 2SOBA 2DN8A 5EQ0A 4KHZA 3MXUA 5C53B 4PMCA 4CH6A 4DV5L 1NY4A 5C0XG 2E2DC 2WP8J 4KKTA 3Q8DA 2EZVA 1WQ7A 3ERRA 2Z6KC 3K5LA 3DEPA 4LVIA 2NTTA 2K04A 4YREA 1D1IA 2N3SA 4DPGA 1SESA 3ICEA 5ELFA 4R4TA 4IFDG 1WYDA 2Z1CA 3S16B 1AE2A 3NPPA 2WB1B 4B3RQ 3BZDB 1E2ZA 4C3HG 4DGZA 1H9RA 2E75C 2WAQE 3HKZG 3VQVA 2K75A 1CZWA 1LABA 2AHOB 3DMUA 3OD1A 3M7GA 1O7YA 1HR0Q 1I6VC 3SVMA 1NJ2A 4K86A 4IPCA 3UDXA 4YRLA 4FF4A 3M4OH 1FYFA 1SETA 1G91A 1B3AA 4A3KB 4XQQA 4KK7A 1X01A 1KTKA 3ZYYX 1PFBA 3CCVA 1BCPB 1NR4A 4QUFA 4WFN3 2EWNA 3OW2A 4ZTUB 3CC7A 3T16A 3P8TA 4J8QA 4DV3Q 4JYAQ 3DHQA 3J7AF 2ALYA 4DQ2A 3GTMH 4X65L 1SJED 1EY0A 1TWAH 4J6HA 2PQEA 3FDTA 3OPOA 1V43A 2CW0D 4AYBE 5E4WC 1SE2A 1YGBA 1QZGA 3ICAA 1HNXQ 3H0GG 3MXGA 4B3TQ 3NENA 2FMMA 4IO9A 1SNDA 3G48A 1HXDA 5C4JB 2HNIA 3BFMA 1KL9A 4JC0A 1X56A 5GQOA 4WJWA 4KMUC 5C6AA 1GUTA 3W5OA 1S5BD 3EN2A 2K4KA 2K5HA 5JJZA 5I9PA 1VQNA 2UUBQ 1KDBA 2VNUD 4CKEA 3RKXA 1Z7TA 3KF8A 2Q7EA 3UGQA 4RQEA 4F8MA 5IT9L 2R92H 1KNEA 3MVVA 1VQFA 2OQ0A 2DY7A 2CIMA 2WIIB 5CORA 3HOXB 4K5VA 4XTCS 4GOPC 4H13C 4Q6GA 3VBBA 2NBFA 1PMRA 5LMNL 2WAQG 1LTSD 3NEMA 1WNLA 1RJTA 1BDOA 2EJGA 2NN6I 1A63A 1KDAA 1VQHA 4ZTZB 4ME3A 2DTOA 4XTYA 5LMUL 4C1NK 4A3GH 4GLAC 4OGQC 1BXTA 3CQZB 3J81c 2ICEC 3J80L 3NXWA 3EFRA 1Q1BA 4ZIBA 1D7QA 4XEOA 2CWPA 2EY2A 1JJCB 4YRNA 1KXLA 5D3DA 3HKZB 2VQEQ 2ZJQA 3N6RA 1K83H 4JBKA 5JJLA 3NTKA 4TSSA 1PRTB 2HDMA 2WV6D 1T9HA 2P5ZX 4RKBA 1JJGA 4DV6L 3VR2A 1R4PB 2A74C 3BVGA 2OF1A 1KD1C 4WJ4A 1DM0B 2CVRA 4HEDA 1QOHA 1JB7A 4WI1A 3QOLA 1GO3E 2JA8H 3VQXA 1OO9B 2LKVA 1QNUA 1O7ZA 1NMFA 1GUGA 2MO0A 1LV9A 1EEID 2F0LA 2KCMA 2NVYB 1OXTA 2AKWA 2PNHA 1S5ED 4KJOA 1SMXA 1VCIA 3SR1A 5KYLA 1QZHA 1X2HA 1XJVA 3H0GB 2UXBL 1VQAA 4KKSA 2DNEA 3TSSA 5JPMC 2ARSA 2A68D 1DCZA 3K81C 2QDBA 1HNZQ 4P72A 1Q8IA 4NXMQ 1UE1A 5T1IA 3HOUG 1B3QA 2HQEA 1N32Q 4LF4Q 4DFAA 3HOZH 3GTPH 2F0KA 5FKAC 3M4QA 3STBD 2GA4B 2M00A 1NUCA 3G4SA 2RHQB 2CKZB 4OWTB 2Q7GA 1QB5D 4HJ9A 3NTIA 2PQAA 3CRLC 1TWCB 3D6CA 4MTKA 4DNTB 2JN4A 3H94A 4C3JG 2RBMA 3MA2B 1E2WA 4C2MB 1IYUA 3RLFA 1F9PA 4JI5Q 4QGUA 1XMOQ 3D8GA 4OWWB 2EJFC 4YYEA 2B2YC 4DR5L 4LFAQ 1WU7A 1HXYD 5EKKA 5I9OA 3EFSA 2R7FA 1YNXA 2AWNA 4KR2A 2F3WA 1DJRD 2KEDA 2QF7A 2NVTB 4IUQA 4YIJA 2F0HA 4H2WA 4AIMA 4GZYC 1PH4A 3R2IA 1F2YA 3RZOH 4A3BH 4GKKL 2EYHA 3GP7A 2CW0C 2K05A 2QKIC 2ZGWA 1ENFA 4DR6L 4DV7Q 4I7ZC 3DSQA 2CGHA 3LC0A 3DWQA 2VQFL 4M8AA 1EFID 3PZCA 2AQ3B 1KLUD 3DWPA 2EJ9A 3CP0A 2F4VL 3K0XA 5IT9c 4XU1A 1YHBA 4CDCC 3A8KE 2R7DA 4YRCA 1K28A 1AP0A 2NZOA 3DLLA 3P8VA 2B2UC 5FO7B 5BR8Q 3U9OA 3HOWH 1E3PA 2D2CC 4JPBW 3EQLC 2XTIA 4KY6A 1QF6A 2P0LA 2QDLA 4XEMA 1X32A 4JOIC 1UEBA 2YU9B 3GTLH 3S1QB 2DKGA 1HCZA 4H2UA 4BY7G 1SEBD 1AZQA 3ULJA 2R6GA 1MSGA 5M5WH 2I5MX 3S17B 3GQBA 1SE8A 2AUKA 1LACA 1ET6A 3MAQA 3RACA 4RGMA 2KHSA 3IKJA 1KABA 3TEHB 5C51B 3V7SA 4DR4Q 2E10A 2OT2A 3HOUB 3FKIB 5G3LF 2ZM6Q 1UE5A 3A56A 1BOSA 2OXPA 2Z4IA 4K8IA 1OXUA 1V1PB 4NXNL 1EIFA 3W1BA 3CD6A 1ILPA 4QUCA 5DNFA 1BBXC 3QO5A 1BO0A 2UXCQ 3I73A 4DK0A 2XN9C 2Z8LA 1JC7A 4UDUC 4FDBA 4BBRG 4HT4A 1B53A 3GTGB 4C3JB 2UXDL 4ZRZA 2IWHA 2C5CA 4DNRB 2V4DA 2ATWA 1CI3M 2QW7A 1WTWA 3J81E 5C4HA 4A3FG 2CQAA 4OIJA 1GOZA 1JICA 2MPMA 4LWCA 2EY6A 2N88A 1SBBB 5IWAQ 5FLMH 1B2TA 1RODA 1I4RA 4X64Q 2K5QA 2A8VA 2HIVA 1TY0A 1S3OA 4GN3B 3I4MG 3VQWA 2I4LA 1IL8A 2YTVA 4APVA 2KECA 4PQXA 2F0DA 4JI1L 4A3LG 3ULPA 3D4DA 1YFSA 3MFGA 1EEFD 3DM1A 1P8LA 2JYOA 1K8AC 1HZAA 3BVZA 2A6HD 2A68C 1J8IA 3REUA 4BXXG 3C1EA 1N36L 4GNXA 5J39A 2HHHQ 1AN8A 4OO1I 4FXDA 4Q0FA 4QL5A 4A3DG 4HWOA 4LF8L 1X3EA 1LTAD 1EIHA 3IALA 2K32A 1VQZA 4BY1H 1MHWC 3KK7A 3Q24A 4X62L 1QVCA 4TTVA 3GTKH 5JJIA 1USYC 4YWLA 4ME5A 3WWVA 3GTOB 4JI0L 4L8JA 5M3FH 2MO1A 2F0WA 5CV4A 2KOLA 2LFNA 4H44C 4RDXA 2L4NA 1LM0A 3LWEA 3NELA 4CDDC 5KRUA 4N9PA 2DGYA 3F2CA 3LX0A 2ZJPA 1AEXA 1K3RA 3OWEB 2OEOA 4KLKA 1LTLA 2EYLA 5T1GA 5TSSA 3F1ZA 4OXPA 4LUZA 2KA7A 1SYFA 1K3BC 2QCPX 5EKIA 2F3VA 2ALYB 3PUXA 1ONLA 1ZYRC 4TWAA 2GN5A 1YB3A 4L6TB 1GXDC 1CQFA 1RTNA 4RGTA 5IYBG 3OMGA 4IQZA 2HCCA 3ITPA 5C3WA 4LMQD 2A8EA 3WDNA 2F0JA 2PZUA 1AFPA 1VQGA 2NN6G 4O2DA 4BBRB 3TN2A 4R8IA 3TZDA 1B44D 3K57A 4DR2L 4IOCA 1G5HA 1JJCA 1RD9D 4RH6A 5CR3A 4K88A 4DK6C 5IYCH 4A3FB 4K8JA 3ERQA 2FXQA 2AWOA 5GAGC 3HOYG 4JV5Q 3KF8B 1JB3A 4C3IH 1AE3A 4DR1Q 3HOVB 2ES2A 3F2BA 3KLSA 3I4MB 1FGBD 4CHTB 2PMZB 4ZAIA 4KY7A 5IT9E 3HXVA 4RA8A 2L5TA 4RMFA 3PUWA 4A3EH 5CYUA 2RDFA 1PTOB 3A7LA 1SFOH 1WCMH 1EVLA 4GN4B 3X3NA 1VDZA 4K14A 2VXWA 4PMBA 1DONA 5GAEC 2VW9A 2DVEA 1D5ZC 2PW5A 4A3DB 2MGSA 4ZLTF 4JBWA 3UE1A 1SE3A 3G71A 3A8IE 1VQPA 3V8KA 4A3CG 1E24A 3UDGA 3AEVA 5KNNA 3I56A 4UP7A 4QQBX 2UU9Q 3K7AH 2I4MA 3A55A 1DOKA 1ZXTA 4CS2A 1XNQL 2M2LA 1VQ9A 2GVAA 2R61A 2A1AA 2R93G 2RHQA 1M8AA 5C4XB 1VQMA 1X3PA 2Q8IB 3HEJA 1HTTA 3I4NB 2IHEA 2BOSA 2K7VA 1I5FA 2FHTA 4KV6A 4HIMA 2JEAI 4DV2L 1TWHH 4PG3A 2QHSA 4KTAA 2ARUA 4ZQ3A 3L4GB 1NBWA 1QWYA 1Y1VG 5C0XH 1TKWB 4BA2I 1IBLL 1TU2B 4P73C 2JA5H 1C7YA 4RWSC 1NJ8A 1LTGD 4UPAA 3A7RA 1B4OA 2L9HA 3MTSA 3GTQB 5M3MH 1HTLD 4A3IG 3A5ZB 4JG2A 1G51A 4FXKC 3JC66 4RG1A 4OX9Q 1YIJA 4NCXA 2K50A 2X6GA 2F0GA 2KCTA 4LF7Q 1W6KA 2B2VA 4C3HH 4HAEA 1GVPA 4XU2A 4A3MG 1GUOA 2E2IB 1G2SA 1TWGB 5K1PA 3PF5A 1LT5D 3QO8A 3NWSA 4P3PA 1JOOA 1C4QA 1Q12A 5ELDA 3G6EA 1SDFA 1STBA 4KD3A 4HCSA 2PCFB 2PNRC 3KLRA 4DV0L 1OTCA 2DXTA 4HWRA 4ID6A 1XMQL 2QHTA 2PO4A 4HCEA 4OWXB 4K6DA 2K5VA 1GUWA 3FPUB 1QE0A 4MN3A 1W2BA 3FP9A 1SYCA 3M3YB 2ZJRA 4LUVA 2WINB 3HFVA 4P74A 5KGUA 2R7ZB 4HIOA 1X3FA 5IYDG 4A3KG 2IY5A 4RCOA 4FXGC 2KENA 5LMNW 1VQEA 5FO9B 3MXNB 4JI7Q 2BA0A 3KJOA 2EE1A 2XGTA 3PUZA 5IP7G 2J3LA 2KBNA 4G4KA 3TREA 4B3RL 4PMWA 3GTJH 3QOJA 2P5IA 2N78A 4XT1B 2Q5HA 4YRPA 2R93B 1Q7YC 4ZK9B 3J7A5 2Y0SE 4WRDA 3G6JB 3RMHA 1RIQA 2WFWA 2QEXA 3RF1A 1P16A 1TWCH 1HFNA 1SE4A 4P71C 4S3SA 4IFDJ 1MBYA 1KLGD 4LVLA 4R4IA 2CWAA 2JA7G 1I6HB 1Y1VB 3L9AX 1U4RA 2DTHA 2E2HH 2RDGA 2H4OA 2L0CA 3OMCA 4DV3L 3JAME 4JYAL 1EWIA 4HSPA 1DYQA 3AFPA 1Y1WH 4DR3Q 3RD4A 2MQHA 3VR5A 4A3IB 1MSHA 3HOXG 1B7YB 1EOTA 1N8RC 1VF7A 3T1YQ 2B39A 1HNXL 2RSOA 3HG9A 4B3TL 3W3SA 2HCIA 4JI8Q 5CV8A 4K5XA 4A3MB 4O0AA 2YV5A 2G9DA 4JCVE 2VUMB 4C1NI 2MNAA 1D5XC 4XIGS 2UUBL 2UUCQ 2Z6BA 4I7AA 1F2MA 3TS2A 4ZKBB 1BCPC 3SK5A 1CSPA 1EZ8A 1I3QB 2D62A 1ASYA 4OO1G 1EYCA 5C3EB 4YPFA 1HA6A 3KLSX 3QG1A 4B9XA 11ASA 2F0VA 2RHSB 1HUMA 3MHBA 1W66A 1X3QA 2QHVA 4HWSA 3S14H 5J22A 3OWFA 3S15B 1YHQA 5IGDA 1D2BA 1HUNA 1LTBD 2Y0SG 3S1MB 2HQLA 2KJXA 4DKAC 4YRFA 4LF6Q 1V1QA 1DOLA 3CW2C 1K0RA 1C8CA 2EL9A 3IL8A 2E5LQ 2E41A 3PUYA 3QB3A 1TR5A 1E7ZA 2Z0SA 3P1HA 1YNJC 4YRSA 3VYRA 1X9NA 2J7ZA 2XIWA 1WD0A 1EY5A 4X3SA 1X6OA 1ESFA 3A74A 4F7XA 1XPUA 4YY3Q 4GNXB 3T53B 2K5DA 3UI2A 1KNAA 2VQEL 1HFGA 4LF5Q 5M5YB 4QMGA 5IY0A 1SRUA 3I4OA 2IHFA 4K0KQ 1JWMD 2ZZFA 3E9HA 5E3IA 1TY2A 5I2XA 1C48A 3K5MA 2KCCA 4DN4M 1Z7NA 2B63B 4RFBA 2JA7B 3CPFA 3CF5A 1I50B 2JA6G 1JWSD 4LNQA 3CCMA 3SGIA 5AJ3L 2PPBC 4HA8A 3C1FA 4MZ9A 1EQVA 1ENAA 4FO2A 3TP7A 2Q2IA 3PF4A 5LL6S 1QG7A 2JEBI 4DV5Q 3AYHB 1HC7A 3U58A 4IUUA 1WTHA 4U673 1V1OA 1YITA 1HA5A 2FMCA 4IALA 1HNZL 3BDCA 2O5JC 2B8FA 3P8YA 3EJIA 4Q15A 1WTPA 1IHZA 4NXML 2EXZA 1X65A 3H3VC 3D4RA 2J0TD 2NVQB 4LF4L 1TWFH 3JAMi 5C5MA 2EIFA 5FO8B 2EDGA 3X3MA 1IL2A 1KRSA 4G57A 5ELCA 3LGJA 5GADC 4P3NA 4A93G 3IKLA 2V1CC 2DU7A 2UUAQ 4JI5L 3VYSA 4BY7H 3MF2A 3S1NB 1XMOL 1FGUA 2XNAC 1PTOF 3G1ZA 4TVYA 2XRSD 2IT1A 4LFAL 4YRGA 2Y0SB 4CJ1B 4LK1C 1U4MA 5EPJA 4MNOA 5L37A 4L5QA 2EYFA 1FJGQ 1PH7A 4A93H 2E8GA 3V05A 3OTOQ 4IUVA 3L4GA 3ER0A 4DNIA 4LNSA 4MTNA 5M5XB 3S2HH 1L1OB 2E5AA 1A62A 4XXEA 1E0BA 4YCUA 4DF7A 1N34L 3T13A 2ID0A 1BBWA 2ZR2A 3W1GA 2PW7A 1RCVD 3PO2B 4H2VA 3A5ZA 4KY5A 4H2SA 2BDOA 1CA6A 1V8QA 2DZCA 4LFCL 5BR8L 1KMMA 1VMPA 1PFNA 3E9IA 2AQ2B 3FKIG 1GJXA 5C44H 2JA6B 2PMEA 1JE5A 4TKOB 4XT3B 1FNUA 1SN8A 4RHRA 4Y7NH 1WVLA 1YJNA 4I65A 5JVG3 3R8BA 1B9NA 2SNMA 4TQUS 1R9TB 1XYIA 2HDLA 2F0OA 4A3LH 1H9MA 3L0OA 3HXUA 4Y52H 1PTOH 4EX5A 2O2LD 4K6LA 1SMYD 3RZDH 3QNEA 4DR4L 3ONAB 2LMCB 4BXXH 3CU7A 4E6IA 1EL0A 1H4TA 1B76A 12ASA 3W2DA 5IGFA 3EROA 4ULLA 2ZM6L 4DU9A 1JE4A 2SDFA 1JT8A 3GV6A 5E3FA 5CV7A 2PZWA 4DA2A 3BYYB 1ZYRD 4NP5A 2EAYA 5E4XA 1RKNA 3VYUA 3MXNA 4KN4C 2I07B 1EQQA 4F88A 1CQVA 2JXMB 5J3BA 5EKLA 4KHPQ 3S2DB 3FEWX 4OONA 5CV9A 1WPYA 2I4NA 3SK8A 1R4QB 5K1XA 1C9OA 2OTLA 2ZT6A 2R92G 4P74C 1GKHA 1TVXA 1IBKL 1PTOD 5IWAL 4YRRA 2E2JB 3PIPA 3W3AA 3K8AA 2PMZE 3I55A 1Q1EA 4X64L 4POGA 1NJ1A 3HRIA 3ND9A 4DV1Q 3IFDA 2I4OA 1F2ZA 2PYKA 4B3SQ 5FJ8G 2DJFC 3CKIB 4YCWA 3JAML 1WTVA 3B6YA 4EQ5A 3VA5A 4FVMA 5DEHA 2EY5A 2CQOA 2F0TA 3BU2A 3I70A 3BJUA 2HHHL 2PI2A 2IY5B 2ENBA 1B7YA 4B9WA 2K28A 2EYMA 3Q23A 2ARTA 1ASZA 2DUDA 4A3JH 1LYLA 1TT2A 4NPSA 1RHPA 4O42A 1I4GA 4TVAB 2ZTCA 3PO3H 5H1SE 3RLNA 3M4OB 3VQYA 2ZTEA 3HOYH 3TP5A 4EO4A 5A2QL 1VS0A 2B2WA 3A54A 1NSNS 3K59A 4J15A 3UGTA 4X66L 4YRQA 4A4IA 5JEAJ 3GTMB 2F0EA 3PV0A 3M4YA 4DAYA 4HWPA 1ICWA 4H0LC 1S5DD 1TWAB 2Q8TA 2OCEA 2RHSA 1Y8NB 1LTTD 2ZNIA 3WOEA 1J9OA 3I72A 3HOVG 1N9WA 2F0QA 4O1NA 2C7IA 1J5EQ 1VQ7A 5EPKA 3PMFA 5C4ZA 3D4WA
chains in the Genus database with same CATH topology
4BBSH 3PCOA 1HH2P 4A3CH 1MJEA 1O7IA 3HOZG 2FYKA 1H4QA 4QJFA 4DV4Q 3EIVA 5ELOA 1KMNA 2Z6KA 3GD7A 4UY8C 2VZAA 4JV5L 4GKJQ 4G84A 2NZHA 4DR1L 5JEAG 2IX0A 3V8JA 3CMEA 3V7CA 4P3OA 1VQCA 1GM5A 2DQ3A 3HY0A 1KQSA 2ODRD 2I0QA 4YRTA 4KQEA 5C4XG 1J5WA 3RR5A 3I4NG 4YHHQ 2Q7HA 1HZBA 1IYJB 2DEQA 4QY7A 3PSIA 1CKNA 4LVMA 4DUZQ 2N8NA 2CFMA 4UP8A 1HNWQ 4PHCA 1MKHA 2UXDQ 5HY6A 3ZJYC 3UDFA 3S16H 3EBEA 3MEFA 1I3QH 3JAMc 3D0FA 4PZ8A 1EQRA 4JI2Q 2OQKA 1H95A 4LF9Q 4TQFA 3I2ZA 1MIUA 4AQYQ 2Q2UA 4XU3A 1OXVA 3U4VA 1EOVA 4PZ6A 2PI2E 4XTVA 4A75A 3T1HQ 4A3KH 1HJPA 4G85A 3AQQA 5GROA 4GLXA 2IX1A 5IP7H 1KC8C 1Z47A 4OX9L 1PH6A 4JBMA 3RGLA 1L1OA 2DZ9A 1I94L 1XNRL 2ZCEA 3MEYA 4TVWA 2R7ZG 2LSSA 2JJQA 2DDZA 3KOJA 2DXUA 3CC2A 3KDFA 4HVCA 5C4JH 1SROA 2MFIA 1VQIA 3RIRA 2VL6A 2JQOA 2JA7H 1I50H 1EUJA 1CKMA 4LW1A 2JE6I 2NS6A 3RLOA 1G291 4JI3Q 4P72C 3HOXH 4P75A 4UP9A 3HXZA 3QO7A 4JI4Q 1Q82C 4YP0A 4JI7L 2Q5IA 1YEZA 5FLXc 3RKWA 1C0AA 4NB3A 3KJPA 3J81j 3CQZH 1IXRA 3UDIA 4JBJA 4XTWA 3V7RA 4IJHA 4LFBQ 4L5TA 5E7NA 1ATIA 2VUMG 1E1OA 3H3VH 1SR3A 2ZIOA 5F5WA 5C3EG 3NETA 2ODRC 2ZINA 1VQ8A 4B3MQ 1WFQA 2EJFA 3T1YL 2RF4A 4XTZA 2K5NA 1K8GA 2NVYH 3R07A 4JI8L 2H5XA 1S72A 1OXXK 3H0GH 3KF6A 1PH2A 2UUCL 1YI2A 1NYRA 4TVAA 1WLEA 4TQDA 1RIPA 1HZCA 4H2XA 4R4OA 2VS1A 1HR0L 3VDYA 5GAHC 4DV2Q 4A3EG 4LVJA 1WCMG 1PH3A 1GD7A 4LF6L 2B63G 4C2MH 1PA6A 4JOIA 1SRYA 2E5LL 3M85A 2DU5A 2LXKA 2ZTGA 4YY3L 1AH9A 4L5SA 2NVTH 5IP9G 3CCRA 4LF5L 1Q81C 2K14A 1IBMQ 4K0KL 2AMCA 3CCUA 1WQWA 1YHAA 1YVCA 2YYZA 4IPDA 1Y14B 1CSQA 1XMQQ 1KAWA 5HGQA 4DAYB 2EQSA 4GNXC 4BW9A 2YU9H 3S1QH 2JA5G 2E3CA 1X3GA 1A8VA 1EIYB 4DUYQ 5M3MG 1NJ5A 3S17H 2BA1A 1WOCA 3LSQA 3CCLA 4HWTA 3HKSA 2A19A 3PCOB 3HFZB 1BIBA 1VQ5A 3HOUH 3FKIH 3RNUA 1N33Q 4E51A 3OYYA 4XU0A 3A32A 1QUQA 4DK3C 1PH1A 2UUAL 1MJCA 5DLQE 4DR7Q 2Q2HA 1U5KA 3PO2G 4YRMA 1YJWA 1Z7MA 1ADJA 2N49A 4C3JH 3GTGH 1YFRA 4AH6A 4HIKA 1USYA 3PIOA 1FJGL 4JI6Q 3OTOL 4H02A 4ALPA 2CJ9A 2F52A 1PYBA 3TRZA 2OTJA 1PYSB 3IRBA 3K80C 2DTIA 1CKNB 4HJAA 2I5LX 4GN5A 3HTZA 2GVBA 2JA9A 1N32L 4YRJA 1XTDA 5ELNA 1BBUA 3U50C 1U0LA 3UE0A 3S1RH 1BIAA 3M4PA 1G5IA 1CKOA 5FJ8H 1L1OC 4PZ7A 4YROA 1WI5A 3GTOH 1Y1WG 1SLJA 4YDQA 1TXYA 1PV4A 1E22A 2YTXA 4X65Q 2ZIMA 4GOPB 4H2TA 1M1KC 4R1JA 2CCZA 4GS3A 4AYBG 4CH5A 4DV7L 4KHPL 3CPWA 4L5RC 3RL6A 4WJ3M 1X54A 1L0WA 1PH5A 3BZKA 4P75C 1VQBA 3KDFB 3MQZA 2E64A 3CCSA 4BBRH 1Q86C 5AJ3Q 3TS0A 1PFSA 4DV1L 4L87A 4QIWE 1EYGA 4A3FH 2G4CA 1WJJA 1VQKA 3AFQA 4B3SL 5IE8A 1Q46A 3HOVH 5LMNQ 3CXCA 1NYQA 3I4MH 2B3GA 1B70B 1NMGA 3CAMA 5LMUQ 5JJKA 3CC4A 3A7UA 1K73C 4DAMA 1EVKA 1SERA 1OXSC 1NNHA 4P73A 1V9PA 2C8MA 4A3DH 3HRKA 3F2DA 3CMAA 1YJ9A 2B29A 2UXCL 1NJ6A 2EXDA 4DV6Q 3KLWA 1J6QA 1KOGA 2ZNJA 3L2PA 3TEGA 3GO5A 3RUXA 1NTGA 5C4XH 1PH8A 1QVFA 3CCJA 1J5EL 3I4NH 3LSSA 1N34Q 2OWOA 2UXBQ 3FHWA 4A3GG 1M90C 4CH4A 5IYBH 2ZT5A 4X6AH 4DV4L 4YRKA 3E0EA 4LFCQ 4YCVA 1YBYA 3CMQA 3GTQH 3KF6B 1UWVA 3HXWA 1JMCA 2JK8A 2C35B 4GKJL 2DQ0A 3MF1A 1FVIA 3IG2A 2YTYA 1VQJA 2NVXH 1KRTA 3J80c 2E2IH 1TWGH 4H2XB 1QVGA 4X5OA 2KHIA 2CJAA 4A93G 2ZTDA 4HWPA 4DR5Q 2JA8G 2ZT7A 4P71A 1B8AA 4HJ5A 4YHHL 2HT1A 1G6PA 3M3YH 4GKKQ 5EAYA 4YWKA 1EIYA 1YZ6A 1E1TA 4K87A 4DR6Q 2R7ZH 4DUZL 3H15A 1HNWL 2VQFQ 4BWAA 2F4VQ 3HFZA 3U4ZA 1IBKQ 5C44G 2AMCB 2DJZA 4OLFA 1HZ9A 4YWMA 3DM3A 4JI2L 4KI0A 4IPHA 3KYHC 4LF9L 5C0XI 2R93H 4AQYL 1LUZA 1Z9FA 2ZZGA 3T1HL 4IFDI 4OP0A 1I6HH 1Y1VH 2I5HA 3TQYA 3A0JA 2E1HA 4R4CA 3J7ZC 1S40A 1YFTA 1DGSA 4A3BG 3NBHB 4A3IH 2Q2TA 3STBC 2QA4A 4NXNQ 3H3VI 2KHJA 1PYSA 1W3SA 2ZXFA 4A3MH 4HJ7A 2J3MA 1JJ2A 4X66Q 2UU9L 2ZR3A 2VUMH 1QUQB 3HOWG 2PMFA 4GLVB 1PH9A 2ZZEA 5C3EH 4JI3L 3A5YA 1NE3A 4YRIA 3IKMB 1HR0W 1FL0A 4JI4L 4JI1Q 3S15H 3A5UA 1PHJA 1H4SA 3S1MH 4A76A 1GGMA 5IYDH 4A3JG 1N36Q 4GOPA 3HXYA 3M9BA 2E65A 3PUVA 3PO3G 3ERSX 4LF8Q 1D8LA 4LF7L 4LFBL 2CJBA 4LUOA 4X62Q 2BH2A 5M5YH 3REXA 3BZCA 2D0OA 1VQDA 3CCQA 4JI0Q 3I7FA 3ULLA 5FLMG 1L2FA 3J81i 2B63H 1KIXA 2LXJA 4B3ML 3K7UC 1VQ6A 4HJ8A 3F8TA 1XPOA 5C52B 3RN2A 4BBSG 2ASBA 1B70A 5IP9H 2RCNA 2WB1E 4WF2A 4IJLA 1VQOA 3GDEA 2BH8A 3S24A 1K9MC 4DR2Q 2NVQH 1UE6A 3L7ZC 4BY1G 1EFWA 2K52A 1Q8KA 5M3FG 3RKYA 3KFUA 1CUKA 1NJIC 2AKWB 3S1NH 3PGZA 4POFA 2L15A 2HIXA 1XPRA 2QGQA 3WQZA 3UH0A 3L1AA 1PVOA 4DR3L 1I94Q 1XNRQ 1IBML 5K36G 3A31A 5M5XH 4CH3A 3L2ZA 2ZT8A 2PQAB 3QTCA 2QHUA 3PO2H 2WB1G 4XTXA 5IYCG 1XNQQ 2VY3A 3D31A 3CCEA 4IOAA 2JA6H 1KHIA 4HIDA 3A7AA 3M7NA 4DUYL 4H2YA 3TEHA 3HXXA 1A0IA 1IBLQ 3HKZE 1BKBA 1R9TH 4KR3A 1X55A 5C0XJ 3V8LA 2F3IA 2D0PA 4LVKA 1VQ4A 1BVSA 1N33L 3HY1A 4XTUA 1VQLA 4CS3A 3RN5A 1H4VB 4IPGA 1IZ6A 4DR7L 3J80i 4RQFA 3S2DH 3TUPA 3UFGA 4DV0Q 4BA1I 1ADYA 3FJPA 1UE7A 1X2GA 4R4QA 4JI6L 1RL2A 4CS4A 2E2JH 4KHZA 5C53B 4CH6A 4DV5L 1NY4A 5C0XG 2WP8J 3Q8DA 3ERRA 1WQ7A 2Z6KC 4LVIA 4YREA 2N3SA 4DPGA 1SESA 3ICEA 4R4TA 4IFDG 1WYDA 1AE2A 4B3RQ 3VQVA 2WAQE 3HKZG 2K75A 2AHOB 3OD1A 1HR0Q 1NJ2A 4K86A 4IPCA 3UDXA 4YRLA 3M4OH 1FYFA 1SETA 1X01A 3CCVA 2EWNA 3OW2A 4ZTUB 3CC7A 3P8TA 4DV3Q 4JYAQ 2ALYA 4DQ2A 3GTMH 4X65L 1TWAH 1V43A 4AYBE 1YGBA 1QZGA 3ICAA 1HNXQ 3H0GG 4B3TQ 3NENA 4IO9A 3G48A 1HXDA 2HNIA 3BFMA 1KL9A 4JC0A 1X56A 5GQOA 3W5OA 3EN2A 2K4KA 2K5HA 1VQNA 2UUBQ 2VNUD 3RKXA 2Q7EA 3UGQA 4RQEA 2R92H 1VQFA 2OQ0A 2CIMA 4XTCS 4GOPC 4Q6GA 3VBBA 5LMNL 2WAQG 3NEMA 1WNLA 2EJGA 2NN6I 1A63A 4ZTZB 1VQHA 4ME3A 2DTOA 4XTYA 5LMUL 4A3GH 4GLAC 3J81c 3EFRA 1Q1BA 4ZIBA 1D7QA 4XEOA 2CWPA 1JJCB 4YRNA 1KXLA 2VQEQ 2ZJQA 1K83H 4JBKA 5JJLA 1T9HA 1JJGA 4DV6L 1KD1C 4WJ4A 1JB7A 4WI1A 1GO3E 2JA8H 3VQXA 1NMFA 2MO0A 2KCMA 1OXTA 2AKWA 2PNHA 1QZHA 1SMXA 1VCIA 1X2HA 1XJVA 2UXBL 1VQAA 2ARSA 3K81C 1HNZQ 4P72A 4NXMQ 1UE1A 3HOUG 1N32Q 4LF4Q 3HOZH 3GTPH 3M4QA 3STBD 3G4SA 2RHQB 2CKZB 4OWTB 2Q7GA 4HJ9A 2PQAA 4JI5Q 3RLFA 4QGUA 1XMOQ 4OWWB 4YYEA 4DR5L 4LFAQ 1WU7A 3EFSA 2R7FA 1YNXA 2AWNA 4KR2A 4H2WA 4AIMA 1PH4A 3RZOH 4A3BH 4GKKL 2ZGWA 4DR6L 4DV7Q 3DSQA 2CGHA 3LC0A 2VQFL 3PZCA 2EJ9A 3CP0A 2F4VL 3K0XA 5IT9c 4XU1A 1YHBA 2R7DA 4YRCA 2NZOA 3DLLA 3P8VA 5BR8Q 3HOWH 1E3PA 2XTIA 1QF6A 2P0LA 4XEMA 4JOIC 1UEBA 3GTLH 2DKGA 4H2UA 4BY7G 3ULJA 2R6GA 5M5WH 2I5MX 1SE8A 3RACA 3TEHB 5C51B 3V7SA 4DR4Q 2E10A 2ZM6Q 1UE5A 3CD6A 4NXNL 1OXUA 3W1BA 1EIFA 3QO5A 2UXCQ 4FDBA 4BBRG 4HT4A 2UXDL 2ATWA 4A3FG 4LWCA 5FLMH 5IWAQ 4X64Q 2A8VA 2HIVA 4GN3B 1S3OA 3I4MG 3VQWA 2I4LA 2YTVA 4APVA 4JI1L 4A3LG 3ULPA 1YFSA 1P8LA 1K8AC 1HZAA 3REUA 4BXXG 1N36L 4GNXA 2HHHQ 4OO1I 4QL5A 4A3DG 4HWOA 4LF8L 1X3EA 3IALA 1VQZA 4BY1H 4X62L 1QVCA 4TTVA 3GTKH 5JJIA 1USYC 4YWLA 3WWVA 4JI0L 5M3FH 2MO1A 4RDXA 1LM0A 3NELA 2DGYA 3F2CA 2ZJPA 1K3RA 4KLKA 1LTLA 3F1ZA 4OXPA 4LUZA 2ALYB 3PUXA 4TWAA 2GN5A 1YB3A 5IYBG 2A8EA 1VQGA 2NN6G 4O2DA 4DR2L 4IOCA 1G5HA 1JJCA 4K88A 4DK6C 5IYCH 2FXQA 2AWOA 5GAGC 3HOYG 4JV5Q 3KF8B 4C3IH 1AE3A 4DR1Q 2ES2A 3F2BA 3HXVA 4A3EH 4RMFA 3PUWA 1SFOH 1WCMH 1EVLA 4GN4B 5GAEC 2VW9A 2DVEA 4JBWA 3UE1A 3G71A 1VQPA 3V8KA 4A3CG 1E24A 3UDGA 3AEVA 5KNNA 3I56A 4UP7A 4QQBX 2UU9Q 3K7AH 2I4MA 4CS2A 1XNQL 1VQ9A 2GVAA 2A1AA 2RHQA 2R93G 1VQMA 1HTTA 2IHEA 1I5FA 2JEAI 4HIMA 4DV2L 1TWHH 4PG3A 2QHSA 3L4GB 2ARUA 1NBWA 1Y1VG 4BA2I 1IBLL 4P73C 2JA5H 1C7YA 1NJ8A 4UPAA 3A7RA 5M3MH 4A3IG 3A5ZB 4JG2A 1G51A 3JC66 4RG1A 4OX9Q 1YIJA 4NCXA 2K50A 2KCTA 4LF7Q 4C3HH 1GVPA 4XU2A 4A3MG 5K1PA 3PF5A 3QO8A 4P3PA 1Q12A 3G6EA 4DV0L 1OTCA 2DXTA 4HWRA 1XMQL 2QHTA 4OWXB 2K5VA 1QE0A 1W2BA 3FP9A 2ZJRA 4LUVA 3HFVA 4P74A 4HIOA 1X3FA 5IYDG 4A3KG 2IY5A 5LMNW 2KENA 1VQEA 3MXNB 4JI7Q 2BA0A 3KJOA 2XGTA 3PUZA 5IP7G 2J3LA 2KBNA 3TREA 4B3RL 4PMWA 3GTJH 2P5IA 2N78A 2Q5HA 4YRPA 1Q7YC 3J7A5 2Y0SE 1RIQA 2WFWA 2QEXA 3RF1A 1P16A 1TWCH 4P71C 4IFDJ 4LVLA 4R4IA 2CWAA 2JA7G 2DTHA 2E2HH 4DV3L 4JYAL 1EWIA 3AFPA 1Y1WH 4DR3Q 2MQHA 3HOXG 1B7YB 1N8RC 3T1YQ 1HNXL 4B3TL 3W3SA 4JI8Q 4O0AA 2YV5A 4JCVE 2MNAA 4XIGS 2UUBL 2UUCQ 3TS2A 1CSPA 2D62A 1ASYA 4OO1G 4YPFA 11ASA 2RHSB 1W66A 2QHVA 4HWSA 3S14H 1YHQA 2Y0SG 2HQLA 4DKAC 4YRFA 4LF6Q 1V1QA 3CW2C 1K0RA 2EL9A 2E5LQ 2E41A 3PUYA 1E7ZA 2Z0SA 4YRSA 1X9NA 1X6OA 3A74A 1XPUA 4YY3Q 4GNXB 2VQEL 4LF5Q 5IY0A 1SRUA 3I4OA 2IHFA 4K0KQ 2ZZFA 3E9HA 5E3IA 1Z7NA 3CPFA 3CF5A 2JA6G 4LNQA 3CCMA 3SGIA 5AJ3L 4HA8A 4MZ9A 2Q2IA 3PF4A 2JEBI 4DV5Q 3AYHB 1HC7A 3U58A 1YITA 1HNZL 3P8YA 4Q15A 4NXML 1X65A 4LF4L 1TWFH 3JAMi 2EIFA 1IL2A 1KRSA 3LGJA 5GADC 4P3NA 3IKLA 2V1CC 2DU7A 2UUAQ 4JI5L 4BY7H 3MF2A 1XMOL 1FGUA 3G1ZA 4TVYA 2IT1A 4LFAL 4YRGA 4MNOA 4L5QA 1FJGQ 4A93H 1PH7A 2E8GA 3OTOQ 3L4GA 3ER0A 4DNIA 4LNSA 4MTNA 3S2HH 1L1OB 2E5AA 1A62A 4YCUA 1N34L 2ID0A 1BBWA 2ZR2A 3W1GA 4H2VA 3A5ZA 4H2SA 2DZCA 4LFCL 5BR8L 1KMMA 3E9IA 3FKIG 5C44H 2PMEA 1JE5A 1SN8A 4Y7NH 1YJNA 4TQUS 4A3LH 3L0OA 3HXUA 4Y52H 4EX5A 3RZDH 3QNEA 4DR4L 4BXXH 1H4TA 1B76A 12ASA 2ZM6L 1JT8A 2EAYA 1EQQA 5J3BA 4KHPQ 4OONA 1WPYA 2I4NA 5K1XA 1C9OA 2OTLA 2ZT6A 2R92G 4P74C 1GKHA 1IBKL 5IWAL 4YRRA 3PIPA 3K8AA 2PMZE 3I55A 1Q1EA 4X64L 4POGA 1NJ1A 3HRIA 4DV1Q 2I4OA 4B3SQ 5FJ8G 4YCWA 3B6YA 4EQ5A 3BU2A 2CQOA 3BJUA 2HHHL 2PI2A 2IY5B 1B7YA 2ARTA 1ASZA 2DUDA 4A3JH 1LYLA 4NPSA 4TVAB 2ZTCA 3PO3H 5H1SE 3RLNA 3VQYA 2ZTEA 3HOYH 4EO4A 1VS0A 4J15A 3UGTA 4X66L 4YRQA 4A4IA 5JEAJ 3PV0A 2OCEA 2RHSA 2ZNIA 3HOVG 1N9WA 2C7IA 1J5EQ 1VQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BBS H;  3PCO A;  1HH2 P;  4A3C H;  1MJE A;  1O7I A;  3HOZ G;  2FYK A;  1H4Q A;  4QJF A;  4DV4 Q;  3EIV A;  5ELO A;  1KMN A;  2Z6K A;  3GD7 A;  4UY8 C;  2VZA A;  4JV5 L;  4GKJ Q;  4G84 A;  2NZH A;  4DR1 L;  5JEA G;  2IX0 A;  3V8J A;  3CME A;  3V7C A;  4P3O A;  1VQC A;  1GM5 A;  2DQ3 A;  3HY0 A;  1KQS A;  2ODR D;  2I0Q A;  4YRT A;  4KQE A;  5C4X G;  1J5W A;  3RR5 A;  3I4N G;  4YHH Q;  2Q7H A;  1HZB A;  1IYJ B;  2DEQ A;  4QY7 A;  3PSI A;  1CKN A;  4DUZ Q;  2N8N A;  2CFM A;  4UP8 A;  1HNW Q;  4PHC A;  1MKH A;  2UXD Q;  5HY6 A;  3ZJY C;  3UDF A;  3S16 H;  3EBE A;  3MEF A;  1I3Q H;  3JAM c;  3D0F A;  4PZ8 A;  1EQR A;  4JI2 Q;  2OQK A;  1H95 A;  4LF9 Q;  4TQF A;  3I2Z A;  1MIU A;  4AQY Q;  2Q2U A;  4XU3 A;  1OXV A;  3U4V A;  1EOV A;  4PZ6 A;  2PI2 E;  4XTV A;  4A75 A;  3T1H Q;  4A3K H;  1HJP A;  4G85 A;  3AQQ A;  5GRO A;  4GLX A;  2IX1 A;  5IP7 H;  1KC8 C;  1Z47 A;  4OX9 L;  1PH6 A;  4JBM A;  3RGL A;  1L1O A;  2DZ9 A;  1I94 L;  1XNR L;  2ZCE A;  3MEY A;  4TVW A;  2R7Z G;  2LSS A;  2JJQ A;  2DDZ A;  3KOJ A;  2DXU A;  3CC2 A;  3KDF A;  4HVC A;  5C4J H;  1SRO A;  2MFI A;  1VQI A;  3RIR A;  2VL6 A;  2JQO A;  2JA7 H;  1I50 H;  1EUJ A;  1CKM A;  4LW1 A;  2JE6 I;  3RLO A;  1G29 1;  4JI3 Q;  4P72 C;  3HOX H;  4P75 A;  4UP9 A;  3HXZ A;  3QO7 A;  4JI4 Q;  1Q82 C;  4YP0 A;  4JI7 L;  2Q5I A;  1YEZ A;  5FLX c;  3RKW A;  1C0A A;  4NB3 A;  3KJP A;  3J81 j;  3CQZ H;  1IXR A;  3UDI A;  4JBJ A;  4XTW A;  3V7R A;  4IJH A;  4LFB Q;  4L5T A;  5E7N A;  1ATI A;  2VUM G;  1E1O A;  3H3V H;  1SR3 A;  2ZIO A;  5F5W A;  5C3E G;  3NET A;  2ODR C;  2ZIN A;  1VQ8 A;  4B3M Q;  1WFQ A;  2EJF A;  3T1Y L;  2RF4 A;  4XTZ A;  2K5N A;  1K8G A;  2NVY H;  3R07 A;  4JI8 L;  2H5X A;  1S72 A;  1OXX K;  3H0G H;  3KF6 A;  1PH2 A;  2UUC L;  1YI2 A;  1NYR A;  4TVA A;  1WLE A;  4TQD A;  1RIP A;  1HZC A;  4H2X A;  4R4O A;  2VS1 A;  1HR0 L;  3VDY A;  5GAH C;  4DV2 Q;  4A3E G;  1WCM G;  1PH3 A;  1GD7 A;  4LF6 L;  2B63 G;  4C2M H;  1PA6 A;  4JOI A;  1SRY A;  2E5L L;  3M85 A;  2DU5 A;  2LXK A;  2ZTG A;  4YY3 L;  1AH9 A;  4L5S A;  2NVT H;  5IP9 G;  3CCR A;  4LF5 L;  1Q81 C;  2K14 A;  1IBM Q;  4K0K L;  2AMC A;  3CCU A;  1WQW A;  1YHA A;  1YVC A;  2YYZ A;  4IPD A;  1Y14 B;  1CSQ A;  1XMQ Q;  1KAW A;  5HGQ A;  4DAY B;  2EQS A;  4GNX C;  4BW9 A;  2YU9 H;  3S1Q H;  2JA5 G;  2E3C A;  1X3G A;  1A8V A;  1EIY B;  4DUY Q;  5M3M G;  1NJ5 A;  3S17 H;  2BA1 A;  1WOC A;  3LSQ A;  3CCL A;  4HWT A;  3HKS A;  2A19 A;  3PCO B;  3HFZ B;  1BIB A;  1VQ5 A;  3HOU H;  3FKI H;  3RNU A;  1N33 Q;  4E51 A;  3OYY A;  4XU0 A;  3A32 A;  1QUQ A;  4DK3 C;  1PH1 A;  2UUA L;  1MJC A;  5DLQ E;  4DR7 Q;  2Q2H A;  1U5K A;  3PO2 G;  4YRM A;  1YJW A;  1Z7M A;  1ADJ A;  2N49 A;  4C3J H;  3GTG H;  1YFR A;  4AH6 A;  4HIK A;  1USY A;  3PIO A;  1FJG L;  4JI6 Q;  3OTO L;  4H02 A;  4ALP A;  2CJ9 A;  2F52 A;  1PYB A;  3TRZ A;  2OTJ A;  1PYS B;  3IRB A;  3K80 C;  2DTI A;  1CKN B;  4HJA A;  2I5L X;  4GN5 A;  3HTZ A;  2GVB A;  2JA9 A;  1N32 L;  4YRJ A;  1XTD A;  5ELN A;  1BBU A;  3U50 C;  1U0L A;  3UE0 A;  3S1R H;  1BIA A;  3M4P A;  1G5I A;  1CKO A;  5FJ8 H;  1L1O C;  4PZ7 A;  4YRO A;  1WI5 A;  3GTO H;  1Y1W G;  1SLJ A;  4YDQ A;  1TXY A;  1PV4 A;  1E22 A;  2YTX A;  4X65 Q;  2ZIM A;  4GOP B;  4H2T A;  1M1K C;  4R1J A;  2CCZ A;  4GS3 A;  4AYB G;  4CH5 A;  4DV7 L;  4KHP L;  3CPW A;  4L5R C;  3RL6 A;  4WJ3 M;  1X54 A;  1L0W A;  1PH5 A;  3BZK A;  4P75 C;  1VQB A;  3KDF B;  2E64 A;  3CCS A;  4BBR H;  1Q86 C;  5AJ3 Q;  3TS0 A;  1PFS A;  4DV1 L;  4L87 A;  4QIW E;  1EYG A;  4A3F H;  2G4C A;  1WJJ A;  1VQK A;  3AFQ A;  4B3S L;  5IE8 A;  1Q46 A;  3HOV H;  5LMN Q;  3CXC A;  1NYQ A;  3I4M H;  2B3G A;  1B70 B;  1NMG A;  3CAM A;  5LMU Q;  5JJK A;  3CC4 A;  3A7U A;  1K73 C;  4DAM A;  1EVK A;  1SER A;  1OXS C;  1NNH A;  4P73 A;  1V9P A;  2C8M A;  4A3D H;  3HRK A;  3F2D A;  3CMA A;  1YJ9 A;  2B29 A;  2UXC L;  1NJ6 A;  2EXD A;  4DV6 Q;  3KLW A;  1J6Q A;  1KOG A;  2ZNJ A;  3L2P A;  3TEG A;  3GO5 A;  3RUX A;  1NTG A;  5C4X H;  1PH8 A;  1QVF A;  3CCJ A;  1J5E L;  3I4N H;  3LSS A;  1N34 Q;  2OWO A;  2UXB Q;  3FHW A;  4A3G G;  1M90 C;  4CH4 A;  5IYB H;  2ZT5 A;  4X6A H;  4DV4 L;  4YRK A;  3E0E A;  4LFC Q;  4YCV A;  1YBY A;  3CMQ A;  3GTQ H;  3KF6 B;  1UWV A;  3HXW A;  1JMC A;  2JK8 A;  2C35 B;  4GKJ L;  2DQ0 A;  3MF1 A;  1FVI A;  3IG2 A;  2YTY A;  1VQJ A;  2NVX H;  1KRT A;  3J80 c;  2E2I H;  1TWG H;  4H2X B;  1QVG A;  4X5O A;  2KHI A;  2CJA A;  4A93 G;  2ZTD A;  4HWP A;  4DR5 Q;  2JA8 G;  2ZT7 A;  4P71 A;  1B8A A;  4HJ5 A;  4YHH L;  2HT1 A;  1G6P A;  3M3Y H;  4GKK Q;  5EAY A;  4YWK A;  1EIY A;  1YZ6 A;  1E1T A;  4K87 A;  4DR6 Q;  2R7Z H;  4DUZ L;  3H15 A;  1HNW L;  2VQF Q;  4BWA A;  2F4V Q;  3HFZ A;  3U4Z A;  1IBK Q;  5C44 G;  2AMC B;  2DJZ A;  4OLF A;  1HZ9 A;  4YWM A;  3DM3 A;  4JI2 L;  4KI0 A;  4IPH A;  3KYH C;  4LF9 L;  5C0X I;  2R93 H;  4AQY L;  1LUZ A;  1Z9F A;  2ZZG A;  3T1H L;  4IFD I;  4OP0 A;  1I6H H;  1Y1V H;  2I5H A;  3TQY A;  3A0J A;  2E1H A;  4R4C A;  3J7Z C;  1S40 A;  1YFT A;  1DGS A;  4A3B G;  3NBH B;  4A3I H;  2Q2T A;  3STB C;  2QA4 A;  4NXN Q;  3H3V I;  2KHJ A;  1PYS A;  1W3S A;  2ZXF A;  4A3M H;  4HJ7 A;  2J3M A;  1JJ2 A;  4X66 Q;  2UU9 L;  2ZR3 A;  2VUM H;  1QUQ B;  3HOW G;  2PMF A;  4GLV B;  1PH9 A;  2ZZE A;  5C3E H;  4JI3 L;  3A5Y A;  1NE3 A;  4YRI A;  3IKM B;  1HR0 W;  1FL0 A;  4JI4 L;  4JI1 Q;  3S15 H;  3A5U A;  1PHJ A;  1H4S A;  3S1M H;  4A76 A;  1GGM A;  5IYD H;  4A3J G;  1N36 Q;  4GOP A;  3HXY A;  3M9B A;  2E65 A;  3PUV A;  3PO3 G;  3ERS X;  4LF8 Q;  1D8L A;  4LF7 L;  4LFB L;  2CJB A;  4LUO A;  4X62 Q;  2BH2 A;  5M5Y H;  3REX A;  3BZC A;  2D0O A;  1VQD A;  3CCQ A;  4JI0 Q;  3I7F A;  3ULL A;  5FLM G;  1L2F A;  3J81 i;  2B63 H;  1KIX A;  2LXJ A;  4B3M L;  3K7U C;  1VQ6 A;  4HJ8 A;  3F8T A;  1XPO A;  5C52 B;  3RN2 A;  4BBS G;  2ASB A;  1B70 A;  5IP9 H;  2RCN A;  2WB1 E;  4WF2 A;  4IJL A;  1VQO A;  3GDE A;  2BH8 A;  3S24 A;  1K9M C;  4DR2 Q;  2NVQ H;  1UE6 A;  3L7Z C;  4BY1 G;  1EFW A;  2K52 A;  1Q8K A;  5M3F G;  3RKY A;  3KFU A;  1CUK A;  1NJI C;  2AKW B;  3S1N H;  3PGZ A;  4POF A;  2L15 A;  2HIX A;  1XPR A;  2QGQ A;  3WQZ A;  3UH0 A;  3L1A A;  1PVO A;  4DR3 L;  1I94 Q;  1XNR Q;  1IBM L;  5K36 G;  3A31 A;  5M5X H;  4CH3 A;  3L2Z A;  2ZT8 A;  2PQA B;  3QTC A;  2QHU A;  3PO2 H;  2WB1 G;  4XTX A;  5IYC G;  1XNQ Q;  2VY3 A;  3D31 A;  3CCE A;  4IOA A;  2JA6 H;  1KHI A;  4HID A;  3A7A A;  3M7N A;  4DUY L;  4H2Y A;  3TEH A;  3HXX A;  1A0I A;  1IBL Q;  3HKZ E;  1BKB A;  1R9T H;  4KR3 A;  1X55 A;  5C0X J;  3V8L A;  2F3I A;  2D0P A;  1VQ4 A;  1BVS A;  1N33 L;  3HY1 A;  4XTU A;  1VQL A;  4CS3 A;  3RN5 A;  1H4V B;  4IPG A;  1IZ6 A;  4DR7 L;  3J80 i;  4RQF A;  3S2D H;  3TUP A;  3UFG A;  4DV0 Q;  4BA1 I;  1ADY A;  3FJP A;  1UE7 A;  1X2G A;  4R4Q A;  4JI6 L;  1RL2 A;  4CS4 A;  2E2J H;  4KHZ A;  5C53 B;  4CH6 A;  4DV5 L;  1NY4 A;  5C0X G;  2WP8 J;  3Q8D A;  3ERR A;  1WQ7 A;  2Z6K C;  4YRE A;  2N3S A;  4DPG A;  1SES A;  3ICE A;  4R4T A;  4IFD G;  1WYD A;  1AE2 A;  4B3R Q;  3VQV A;  2WAQ E;  3HKZ G;  2K75 A;  2AHO B;  3OD1 A;  1HR0 Q;  1NJ2 A;  4K86 A;  4IPC A;  3UDX A;  4YRL A;  3M4O H;  1FYF A;  1SET A;  1X01 A;  3CCV A;  2EWN A;  3OW2 A;  4ZTU B;  3CC7 A;  3P8T A;  4DV3 Q;  4JYA Q;  2ALY A;  4DQ2 A;  3GTM H;  4X65 L;  1TWA H;  1V43 A;  4AYB E;  1YGB A;  1QZG A;  3ICA A;  1HNX Q;  3H0G G;  4B3T Q;  3NEN A;  4IO9 A;  3G48 A;  1HXD A;  2HNI A;  3BFM A;  1KL9 A;  4JC0 A;  1X56 A;  5GQO A;  3W5O A;  3EN2 A;  2K4K A;  2K5H A;  1VQN A;  2UUB Q;  2VNU D;  3RKX A;  2Q7E A;  3UGQ A;  4RQE A;  2R92 H;  1VQF A;  2OQ0 A;  2CIM A;  4XTC S;  4GOP C;  4Q6G A;  3VBB A;  5LMN L;  2WAQ G;  3NEM A;  1WNL A;  2EJG A;  2NN6 I;  1A63 A;  4ZTZ B;  1VQH A;  4ME3 A;  2DTO A;  4XTY A;  5LMU L;  4A3G H;  4GLA C;  3J81 c;  3EFR A;  1Q1B A;  4ZIB A;  1D7Q A;  4XEO A;  2CWP A;  1JJC B;  4YRN A;  1KXL A;  2VQE Q;  2ZJQ A;  1K83 H;  4JBK A;  5JJL A;  1T9H A;  1JJG A;  4DV6 L;  1KD1 C;  4WJ4 A;  1JB7 A;  4WI1 A;  1GO3 E;  2JA8 H;  3VQX A;  1NMF A;  2MO0 A;  2KCM A;  1OXT A;  2AKW A;  2PNH A;  1QZH A;  1SMX A;  1VCI A;  1X2H A;  1XJV A;  2UXB L;  1VQA A;  2ARS A;  3K81 C;  1HNZ Q;  4P72 A;  4NXM Q;  1UE1 A;  3HOU G;  1N32 Q;  4LF4 Q;  3HOZ H;  3GTP H;  3M4Q A;  3STB D;  3G4S A;  2RHQ B;  2CKZ B;  4OWT B;  2Q7G A;  4HJ9 A;  2PQA A;  4JI5 Q;  3RLF A;  4QGU A;  1XMO Q;  4OWW B;  4YYE A;  4DR5 L;  4LFA Q;  1WU7 A;  3EFS A;  2R7F A;  1YNX A;  2AWN A;  4KR2 A;  4H2W A;  4AIM A;  1PH4 A;  3RZO H;  4A3B H;  4GKK L;  2ZGW A;  4DR6 L;  4DV7 Q;  3DSQ A;  2CGH A;  3LC0 A;  2VQF L;  3PZC A;  2EJ9 A;  3CP0 A;  2F4V L;  3K0X A;  5IT9 c;  4XU1 A;  1YHB A;  2R7D A;  4YRC A;  2NZO A;  3DLL A;  3P8V A;  5BR8 Q;  3HOW H;  1E3P A;  2XTI A;  1QF6 A;  2P0L A;  4XEM A;  4JOI C;  1UEB A;  3GTL H;  2DKG A;  4H2U A;  4BY7 G;  3ULJ A;  2R6G A;  5M5W H;  2I5M X;  1SE8 A;  3RAC A;  3TEH B;  5C51 B;  3V7S A;  4DR4 Q;  2E10 A;  2ZM6 Q;  1UE5 A;  3CD6 A;  4NXN L;  1OXU A;  3W1B A;  1EIF A;  3QO5 A;  2UXC Q;  4FDB A;  4BBR G;  2UXD L;  2ATW A;  4A3F G;  4LWC A;  5FLM H;  5IWA Q;  4X64 Q;  2A8V A;  2HIV A;  4GN3 B;  1S3O A;  3I4M G;  3VQW A;  2I4L A;  2YTV A;  4APV A;  4JI1 L;  4A3L G;  3ULP A;  1YFS A;  1P8L A;  1K8A C;  1HZA A;  3REU A;  4BXX G;  1N36 L;  4GNX A;  2HHH Q;  4OO1 I;  4QL5 A;  4A3D G;  4HWO A;  4LF8 L;  1X3E A;  3IAL A;  1VQZ A;  4BY1 H;  4X62 L;  1QVC A;  4TTV A;  3GTK H;  5JJI A;  1USY C;  4YWL A;  3WWV A;  4JI0 L;  5M3F H;  2MO1 A;  4RDX A;  1LM0 A;  3NEL A;  2DGY A;  3F2C A;  2ZJP A;  1K3R A;  4KLK A;  1LTL A;  3F1Z A;  4OXP A;  4LUZ A;  2ALY B;  3PUX A;  4TWA A;  2GN5 A;  1YB3 A;  5IYB G;  1VQG A;  2NN6 G;  4O2D A;  4DR2 L;  4IOC A;  1G5H A;  1JJC A;  4K88 A;  4DK6 C;  5IYC H;  2FXQ A;  2AWO A;  5GAG C;  3HOY G;  4JV5 Q;  3KF8 B;  4C3I H;  1AE3 A;  4DR1 Q;  2ES2 A;  3F2B A;  3HXV A;  4A3E H;  4RMF A;  3PUW A;  1SFO H;  1WCM H;  1EVL A;  4GN4 B;  5GAE C;  2VW9 A;  2DVE A;  4JBW A;  3UE1 A;  3G71 A;  1VQP A;  3V8K A;  4A3C G;  1E24 A;  3UDG A;  3AEV A;  5KNN A;  3I56 A;  4UP7 A;  4QQB X;  2UU9 Q;  3K7A H;  2I4M A;  4CS2 A;  1XNQ L;  1VQ9 A;  2GVA A;  2A1A A;  2RHQ A;  2R93 G;  1VQM A;  1HTT A;  2IHE A;  1I5F A;  2JEA I;  4HIM A;  4DV2 L;  1TWH H;  4PG3 A;  2QHS A;  3L4G B;  2ARU A;  1NBW A;  1Y1V G;  4BA2 I;  1IBL L;  4P73 C;  2JA5 H;  1C7Y A;  1NJ8 A;  4UPA A;  3A7R A;  5M3M H;  4A3I G;  3A5Z B;  4JG2 A;  1G51 A;  3JC6 6;  4RG1 A;  4OX9 Q;  1YIJ A;  4NCX A;  2K50 A;  2KCT A;  4LF7 Q;  4C3H H;  1GVP A;  4XU2 A;  4A3M G;  5K1P A;  3PF5 A;  3QO8 A;  4P3P A;  1Q12 A;  3G6E A;  4DV0 L;  1OTC A;  2DXT A;  4HWR A;  1XMQ L;  2QHT A;  4OWX B;  2K5V A;  1QE0 A;  1W2B A;  3FP9 A;  2ZJR A;  4LUV A;  3HFV A;  4P74 A;  4HIO A;  1X3F A;  5IYD G;  4A3K G;  2IY5 A;  5LMN W;  2KEN A;  1VQE A;  3MXN B;  4JI7 Q;  2BA0 A;  3KJO A;  2XGT A;  3PUZ A;  5IP7 G;  2J3L A;  2KBN A;  3TRE A;  4B3R L;  4PMW A;  3GTJ H;  2P5I A;  2N78 A;  2Q5H A;  4YRP A;  1Q7Y C;  3J7A 5;  2Y0S E;  1RIQ A;  2WFW A;  2QEX A;  3RF1 A;  1P16 A;  1TWC H;  4P71 C;  4IFD J;  4R4I A;  2CWA A;  2JA7 G;  2DTH A;  2E2H H;  4DV3 L;  4JYA L;  1EWI A;  3AFP A;  1Y1W H;  4DR3 Q;  2MQH A;  3HOX G;  1B7Y B;  1N8R C;  3T1Y Q;  1HNX L;  4B3T L;  3W3S A;  4JI8 Q;  4O0A A;  2YV5 A;  4JCV E;  2MNA A;  4XIG S;  2UUB L;  2UUC Q;  3TS2 A;  1CSP A;  2D62 A;  1ASY A;  4OO1 G;  4YPF A;  11AS A;  2RHS B;  1W66 A;  2QHV A;  4HWS A;  3S14 H;  1YHQ A;  2Y0S G;  2HQL A;  4DKA C;  4YRF A;  4LF6 Q;  1V1Q A;  3CW2 C;  1K0R A;  2EL9 A;  2E5L Q;  2E41 A;  3PUY A;  1E7Z A;  2Z0S A;  4YRS A;  1X9N A;  1X6O A;  3A74 A;  1XPU A;  4YY3 Q;  4GNX B;  2VQE L;  4LF5 Q;  5IY0 A;  1SRU A;  3I4O A;  2IHF A;  4K0K Q;  2ZZF A;  3E9H A;  5E3I A;  1Z7N A;  3CPF A;  3CF5 A;  2JA6 G;  4LNQ A;  3CCM A;  3SGI A;  5AJ3 L;  4HA8 A;  4MZ9 A;  2Q2I A;  3PF4 A;  2JEB I;  4DV5 Q;  3AYH B;  1HC7 A;  3U58 A;  1YIT A;  1HNZ L;  3P8Y A;  4Q15 A;  4NXM L;  1X65 A;  4LF4 L;  1TWF H;  3JAM i;  2EIF A;  1IL2 A;  1KRS A;  3LGJ A;  5GAD C;  4P3N A;  3IKL A;  2V1C C;  2DU7 A;  2UUA Q;  4JI5 L;  4BY7 H;  3MF2 A;  1XMO L;  1FGU A;  3G1Z A;  4TVY A;  2IT1 A;  4LFA L;  4YRG A;  4MNO A;  4L5Q A;  1FJG Q;  4A93 H;  1PH7 A;  2E8G A;  3OTO Q;  3L4G A;  3ER0 A;  4DNI A;  4LNS A;  4MTN A;  3S2H H;  1L1O B;  2E5A A;  1A62 A;  4YCU A;  1N34 L;  2ID0 A;  1BBW A;  2ZR2 A;  3W1G A;  4H2V A;  3A5Z A;  4H2S A;  2DZC A;  4LFC L;  5BR8 L;  1KMM A;  3E9I A;  3FKI G;  5C44 H;  2PME A;  1JE5 A;  1SN8 A;  4Y7N H;  1YJN A;  4TQU S;  4A3L H;  3L0O A;  3HXU A;  4Y52 H;  4EX5 A;  3RZD H;  3QNE A;  4DR4 L;  4BXX H;  1H4T A;  1B76 A;  12AS A;  2ZM6 L;  1JT8 A;  2EAY A;  1EQQ A;  5J3B A;  4KHP Q;  4OON A;  1WPY A;  2I4N A;  5K1X A;  1C9O A;  2OTL A;  2ZT6 A;  2R92 G;  4P74 C;  1GKH A;  1IBK L;  5IWA L;  4YRR A;  3PIP A;  3K8A A;  2PMZ E;  3I55 A;  1Q1E A;  4X64 L;  4POG A;  1NJ1 A;  3HRI A;  4DV1 Q;  2I4O A;  4B3S Q;  5FJ8 G;  4YCW A;  3B6Y A;  4EQ5 A;  3BU2 A;  2CQO A;  3BJU A;  2HHH L;  2PI2 A;  2IY5 B;  1B7Y A;  2ART A;  1ASZ A;  2DUD A;  4A3J H;  1LYL A;  4NPS A;  4TVA B;  2ZTC A;  3PO3 H;  5H1S E;  3RLN A;  3VQY A;  2ZTE A;  3HOY H;  4EO4 A;  1VS0 A;  4J15 A;  3UGT A;  4X66 L;  4YRQ A;  4A4I A;  5JEA J;  3PV0 A;  2OCE A;  2RHS A;  2ZNI A;  3HOV G;  1N9W A;  2C7I A;  1J5E Q;  1VQ7 A; 
#chains in the Genus database with same CATH topology
 4V19 0;  3K0Y A;  4KN7 C;  4BBS H;  3PCO A;  2A6E D;  1HH2 P;  4ZYS A;  5BN3 A;  4A3C H;  1MJE A;  1O7I A;  2G5D A;  3HOZ G;  2FYK A;  4JW0 A;  1H4Q A;  4QJF A;  5KND A;  3PIO 3;  4DV4 Q;  3EIV A;  5ELO A;  2R92 B;  1KMN A;  2Z6K A;  1H9J A;  1NAP A;  2NUC A;  3GD7 A;  5FLX L;  4UY8 C;  2VZA A;  2LS0 1;  2TSS A;  4JV5 L;  2BCO A;  4GKJ Q;  3QWN A;  4G84 A;  1A15 A;  1ET9 A;  2NZH A;  4OL7 A;  4DR1 L;  1L0X B;  5JEA G;  3S1R B;  2IX0 A;  3TBI B;  3V8J A;  1SSO A;  3CME A;  3V7C A;  3U9S A;  4P3O A;  3QR8 A;  1BCP F;  1VQC A;  4A3G B;  1GM5 A;  2DQ3 A;  3HY0 A;  1KQS A;  3QO2 A;  3K58 A;  2ODR D;  2I0Q A;  4YRT A;  1DD2 A;  4KQE A;  5C4X G;  1J5W A;  1SMY C;  2F4I A;  3RR5 A;  1SNM A;  4M1U B;  4NKL A;  3NP8 A;  2ICI A;  1K8M A;  4YHH Q;  3I4N G;  1K83 B;  2E74 C;  1IYJ B;  1HZB A;  3NWT A;  2Q7H A;  1I4P A;  5I4D A;  2DEQ A;  4QY7 A;  3PSI A;  5G3L D;  1CKN A;  4OHJ A;  1U4L A;  2C9O A;  4LVM A;  4DUZ Q;  2N8N A;  2CFM A;  4UP8 A;  1HNW Q;  5K36 H;  4C56 C;  1MKH A;  2UXD Q;  1E2V A;  5HY6 A;  2EVB A;  4PHC A;  2XVS A;  1MI2 A;  3HP3 A;  3ZJY C;  3UDF A;  2JA8 B;  3S16 H;  2EY1 A;  3EBE A;  3MEF A;  4N8F A;  1I3Q H;  1PTO C;  3JAM c;  5KNB A;  2VB2 X;  3D0F A;  1EQR A;  4PZ8 A;  4JI2 Q;  2EJG C;  4QB4 A;  1G6Z A;  2OQK A;  4N9T A;  4V0B A;  2K03 A;  1H95 A;  4LF9 Q;  4TQF A;  2G9H D;  1MIU A;  3I2Z A;  4AQY Q;  2Q2U A;  4XU3 A;  1OXV A;  3U4V A;  1EOV A;  1HQR D;  1PDQ A;  4PZ6 A;  2PI2 E;  4XTV A;  5HUR A;  1EY8 A;  4A75 A;  3T1H Q;  5ISR A;  1LLR D;  4A3K H;  3EA6 A;  1HJP A;  2DJG C;  3BG3 A;  2BDN A;  3AQQ A;  3VR6 A;  4G85 A;  2DNC A;  1YNN C;  5GRO A;  4ZUI A;  4GLX A;  2XRQ D;  3HOZ B;  2IX1 A;  4IUN A;  3GTP B;  5IP7 H;  1KC8 C;  1Z47 A;  4OX9 L;  1PH6 A;  4JBM A;  3RGL A;  1L1O A;  2DZ9 A;  1I94 L;  1XNR L;  2ZCE A;  4KHV A;  5D3I B;  3MEY A;  1UEA B;  4G7H C;  4TVW A;  2R7Z G;  2LSS A;  1PRT F;  2Q8R E;  4Q5V A;  2JJQ A;  3C2P A;  2DDZ A;  3KOJ A;  2DXU A;  1D1K A;  3CC2 A;  3KDF A;  5BN4 A;  4HVC A;  5C4J H;  2IPK D;  1II3 A;  3NQT A;  1SRO A;  2MFI A;  1VQI A;  4OEL B;  1I4X A;  3RIR A;  2VL6 A;  2JQO A;  1O7L A;  2JA7 H;  1BCP D;  1JWU D;  1I50 H;  1EUJ A;  1CKM A;  4LW1 A;  2JE6 I;  4NW2 A;  2NS6 A;  1EIG A;  3FVQ A;  3RZO B;  4A3B B;  2D5D A;  2H1E A;  1PZJ D;  3RLO A;  1G29 1;  4J1M A;  4JI3 Q;  4P72 C;  5C3X A;  3HOX H;  4P75 A;  2N55 A;  3BS1 A;  3KBX A;  2XWJ B;  4HTH A;  4UP9 A;  3HXZ A;  3QO7 A;  3H91 A;  4JI4 Q;  1Q82 C;  4YP0 A;  3MXP A;  4JI7 L;  3DEO A;  2Q5I A;  2NZ1 D;  1Q3L A;  1YEZ A;  2M9V A;  4CDF C;  5FLX c;  2A6E C;  3Q0A A;  3RKW A;  1C0A A;  1YNJ D;  4NB3 A;  3KJP A;  3J81 j;  3CQZ H;  2LY7 A;  3E0J A;  4IFD H;  1IXR A;  2EYP A;  2RA4 A;  2A5H A;  3UDI A;  4OO1 H;  3QIA A;  4JBJ A;  1AZP A;  3GTL B;  4XTW A;  3V7R A;  4IJH A;  5D14 A;  4DAP A;  4Z9C B;  4LFB Q;  3RUZ A;  3MC0 B;  4L5T A;  3HZX A;  5E7N A;  3CHB D;  1KAA A;  1ATI A;  2NVX B;  5M5W B;  1CFM A;  2VUM G;  1K0S A;  1E1O A;  5EBD A;  4UHV A;  4ZUJ A;  3H3V H;  2FJ2 A;  2RSN A;  1F2L A;  3I4L A;  3VR4 A;  1SR3 A;  3P7J A;  5JOB A;  2ZIO A;  1UAP A;  4EQP A;  2ZXO A;  5F5W A;  2X69 A;  3J7A V;  5C3E G;  3NET A;  2ODR C;  1TS4 A;  1TQO A;  2ZIN A;  1VQ8 A;  4B3M Q;  1EY4 A;  1WFQ A;  3OW7 A;  1IKL A;  4FYD A;  3T1Y L;  2F0U A;  2B2Y A;  2RF4 A;  3K5N A;  2EJF A;  1FYC A;  2CH4 W;  1IYV A;  4EVO A;  1A2U A;  4XTZ A;  2K5N A;  1K8G A;  2TMP A;  2NVY H;  3R07 A;  4JI8 L;  2H5X A;  2RVL A;  1S72 A;  1OXX K;  5D65 A;  3H0G H;  1PRT D;  3KF6 A;  1PH2 A;  2UUC L;  1EY6 A;  1SYE A;  2F0I A;  1JCK B;  1YI2 A;  1NYR A;  4G7O C;  4TVA A;  1WLE A;  1RDP D;  5A35 A;  3VYT A;  4C3I G;  2AQ1 B;  5CBA E;  3SHL A;  4TQD A;  1RIP A;  1HZC A;  1HPC A;  4H2X A;  4R4O A;  2VS1 A;  1HR0 L;  3VDY A;  4JVZ A;  5GAH C;  4DV2 Q;  2B2T A;  1LT6 D;  3H09 A;  4A3E G;  1LTI D;  4LVJ A;  1WCM G;  1PH3 A;  1GD7 A;  4LF6 L;  2B63 G;  4C2M H;  1CK1 A;  5CV5 A;  5CGK A;  1PA6 A;  3FPP A;  4JOI A;  1SRY A;  2E5L L;  4XQJ A;  4DAV A;  1SNP A;  1ZEQ X;  3M85 A;  2DU5 A;  2LXK A;  4ZCK A;  5KNC A;  2ZTG A;  4YY3 L;  1AH9 A;  5KIX A;  1ILQ A;  4BY1 B;  4L5S A;  2NVT H;  4DXF A;  5IP9 G;  1QJO A;  3CCR A;  3GTK B;  1F9R A;  4LF5 L;  1Q81 C;  2K14 A;  1IBM Q;  4K0K L;  4IZ8 A;  1STN A;  3NBI A;  2AMC A;  3CCU A;  5M3F B;  1WQW A;  4IN3 A;  1YHA A;  5FOB B;  5ELE A;  2NB0 A;  1YVC A;  1K8O A;  2YYZ A;  1PZI D;  4IPD A;  1Y14 B;  1CSQ A;  1XMQ Q;  4U68 A;  1KAW A;  5CBE E;  1ENC A;  5HGQ A;  1UUP A;  5A2Q E;  2MUY A;  3K6O A;  2ZXP A;  2K1B A;  2I46 A;  1ICF B;  1QCB D;  4FP5 D;  4DAY B;  3ND8 A;  3TZU A;  2EQS A;  4GNX C;  1GUS A;  2ZXR A;  4BW9 A;  2YU9 H;  3S1Q H;  3T56 B;  2JA5 G;  2E3C A;  4K2K A;  1X3G A;  1A8V A;  1EIY B;  4DUY Q;  1GHJ A;  5M3M G;  1NJ5 A;  4OIK A;  3S17 H;  2BA1 A;  4CJ2 C;  1WOC A;  4DXG A;  4RGO S;  1I4H A;  3LSQ A;  3CCL A;  4HWT A;  4FNF A;  3NBH A;  3HKS A;  2A19 A;  3PCO B;  2F0F A;  3BYT B;  4QCL A;  3HFZ B;  1Y69 U;  1BIB A;  1F9S A;  4C3I B;  1LO5 D;  1VQ5 A;  3HOU H;  3FKI H;  3RNU A;  5KEE A;  1N33 Q;  2FIN B;  3OYY A;  4XU0 A;  4E51 A;  4HMI A;  4ODG A;  2EPB A;  4B08 A;  3A32 A;  1QUQ A;  4DK3 C;  1PH1 A;  2UUA L;  1Y8O B;  1MJC A;  5DAU A;  5DLQ E;  4DR7 Q;  2Q2H A;  1U5K A;  3J7Y W;  3PO2 G;  4YRM A;  1YJW A;  5FLX E;  4A3E B;  1Z7M A;  3A8J E;  1SNQ A;  2NWG A;  1HHV A;  1ADJ A;  3IFT A;  1SFO B;  2N49 A;  4C3J H;  3GTG H;  1YFR A;  1WCM B;  3E5S A;  4AH6 A;  4HIK A;  1G8Z D;  1USY A;  3DUZ A;  3PIO A;  1FJG L;  4JI6 Q;  1SXT A;  3OTO L;  2VB3 X;  4H02 A;  2A73 B;  5IOC A;  4QF4 A;  4FF1 A;  1RTO A;  4ALP A;  4X3U A;  2CJ9 A;  3URY A;  3T4A C;  3OIQ A;  2F52 A;  1PYB A;  3TRZ A;  2OTJ A;  1PYS B;  3IRB A;  2EJM A;  3SE0 A;  3K7A B;  3SXH A;  1T5E A;  5I6W A;  3K80 C;  1PRT C;  3SEB A;  1SNO A;  5CC4 A;  2DTI A;  1CKN B;  3N52 A;  4HJA A;  5JPN C;  1D6E C;  4HMJ A;  2I5L X;  4GN5 A;  1D5M C;  3HTZ A;  2GVB A;  2JA9 A;  1N32 L;  2K5W A;  1DXM A;  4YRJ A;  2F0M A;  2AUJ D;  2NTS A;  4ABN A;  1XTD A;  5C5L A;  5ELN A;  1SJH D;  2E76 C;  1BBU A;  3U50 C;  1U0L A;  3UE0 A;  2BE5 C;  3S1R H;  5K5P A;  1BIA A;  4FF2 A;  1TWH B;  3M4P A;  4H7B A;  2B8G A;  1WTX A;  1G5I A;  1CKO A;  5FJ8 H;  3NTH A;  3NUC A;  1L1O C;  4PZ7 A;  4YRO A;  1WI5 A;  1GUN A;  1FR3 A;  3OHX C;  2JA5 B;  2QIL A;  3GTO H;  1Y1W G;  2HUG A;  3D6W A;  5M3M B;  3Q22 A;  3TME A;  1FD7 D;  4ILW A;  1SLJ A;  2HD3 A;  4YDQ A;  1TXY A;  5IGB A;  1PV4 A;  1B50 A;  3HS0 C;  1E22 A;  2YTX A;  4X65 Q;  2ZIM A;  1CHQ D;  4GOP B;  4C3H B;  4H2T A;  4XQN A;  1M1K C;  1G2T A;  1LTR D;  4R1J A;  2CCZ A;  2FFK B;  4GS3 A;  3S9W A;  2K01 A;  4AYB G;  4CH5 A;  4DV7 L;  1QE6 A;  4KHP L;  3CPW A;  4L5R C;  3RL6 A;  3Q6S A;  4WJ3 M;  2EOT A;  1W6J A;  1X54 A;  4XYQ A;  1L0W A;  1PH5 A;  1SNC A;  2F0S A;  4CKB A;  1KDC A;  3BZK A;  4P75 C;  1VQB A;  4R8N A;  3KDF B;  3MQZ A;  2F0P A;  2E64 A;  3CCS A;  4BBR H;  2KQ3 A;  1Q86 C;  1L0Y B;  1RF2 D;  5AJ3 Q;  3TS0 A;  5I6Y A;  4CDE C;  1PFS A;  1WD1 A;  4DV1 L;  4L87 A;  4QIW E;  5ELB A;  4RKL A;  1EYG A;  4A3F H;  4HN7 A;  1O80 A;  2G4C A;  1WJJ A;  1VQK A;  3MEH A;  1MGS A;  3AFQ A;  4B3S L;  3KUP A;  1LT4 D;  5IE8 A;  4X3K A;  2RQX A;  1Q46 A;  1MD2 D;  3HOV H;  1A6X A;  5LMN Q;  4XDX A;  2D9U A;  5DM7 3;  3CXC A;  3I4M H;  1NYQ A;  2B3G A;  1B70 B;  3O13 A;  1NMG A;  3CAM A;  2B2V C;  5LMU Q;  5LL6 X;  5JJK A;  3CC4 A;  3A7U A;  1K73 C;  4DAM A;  1HTP A;  1EVK A;  3GTJ B;  1SER A;  1HRJ A;  3R3O A;  2XSC A;  3R93 A;  1OXS C;  1EY9 A;  1NNH A;  3OIP A;  1STY A;  4P73 A;  5I2Y A;  1V9P A;  2C8M A;  4A3D H;  3HRK A;  3F2D A;  1QNK A;  4UAI A;  3CMA A;  1YJ9 A;  2B29 A;  2UXC L;  5JEA H;  4K5W A;  5E1F A;  1PLF A;  1NJ6 A;  2WAQ B;  2EXD A;  1M4V A;  1QIL A;  4DV6 Q;  3KLW A;  1BF4 A;  2E2H B;  1J6Q A;  1KOG A;  2A69 D;  2ZNJ A;  3L2P A;  3TEG A;  1Y1W B;  3P20 A;  3GO5 A;  3RUX A;  1TS5 A;  2F1M A;  4WOR A;  1NTG A;  1STA A;  4X3T A;  5C4X H;  1PH8 A;  1TS3 A;  1QVF A;  4XYO A;  3CCJ A;  1J5E L;  3K5O A;  3I4N H;  4CJ0 B;  4PNY A;  2DY8 A;  3LSS A;  1A2T A;  1N34 Q;  3KBG A;  2OWO A;  2O5I C;  2UXB Q;  3FHW A;  4A3G G;  5NUC A;  2XWB B;  1EQT A;  4AYB B;  1M90 C;  4CH4 A;  1CHP D;  5IYB H;  4X6A H;  2ZT5 A;  1YNN D;  4DV4 L;  4YRK A;  3E0E A;  4LFC Q;  4YCV A;  1YBY A;  1H9S A;  2B2T C;  2IX3 A;  3CMQ A;  3GTQ H;  2NN6 H;  3KF6 B;  1UWV A;  3HXW A;  3FRP B;  3IAY A;  1JMC A;  2JK8 A;  2C35 B;  2MHV A;  4L63 B;  1CZG A;  4GKJ L;  2DQ0 A;  4PV1 C;  1JR0 D;  3S14 B;  3MF1 A;  3HGB A;  1FVI A;  3IG2 A;  4P2C B;  2YTY A;  1VQJ A;  1JOR A;  4IUT A;  1Y8P B;  2NVX H;  3A7A B;  1KRT A;  3J80 c;  5FK9 C;  1TWG H;  2E2I H;  3AMU A;  3H6M A;  4H2X B;  3I8Z A;  1QVG A;  5EPL A;  4X5O A;  1U9R A;  3SK6 A;  2KHI A;  2CJA A;  1WTQ A;  2ZTD A;  2CH4 A;  2EYJ A;  1PYW D;  5CMD A;  4CGY B;  3C46 A;  4DR5 Q;  2JA8 G;  2ZT7 A;  5COY A;  4P71 A;  1Z6H A;  1B8A A;  3SK4 A;  4MIU A;  4RCN A;  4HJ5 A;  3LNN A;  4YHH L;  2HT1 A;  1G6P A;  2PZT A;  3M3Y H;  4GKK Q;  5EAY A;  4YWK A;  1UNS A;  1SAP A;  1YZ6 A;  1EIY A;  3E3X A;  1E1T A;  2Z4H A;  4K87 A;  3FMC A;  2R7Z H;  4DR6 Q;  1SYG A;  4DUZ L;  1STE A;  3H15 A;  2VQF Q;  1HNW L;  2X6L A;  3NHH A;  4BWA A;  2F4V Q;  1EU3 A;  1FNV A;  3HFZ A;  3D3R A;  3U4Z A;  1IBK Q;  5C44 G;  2AMC B;  2DJZ A;  4OLF A;  1HZ9 A;  4YWM A;  3DM3 A;  3EFX D;  4JI2 L;  3NE5 B;  2CHB D;  4KI0 A;  4IPH A;  3KYH C;  2IL8 A;  4G7Z C;  4LF9 L;  5C0X I;  4RAU C;  2R93 H;  4AQY L;  5HGT A;  1S5F D;  2WAC A;  1NR2 A;  4LAA A;  1LUZ A;  1Z9F A;  3MZ5 A;  2ZZG A;  1A3T A;  2JP1 A;  4JK1 C;  3T1H L;  4IFD I;  4OP0 A;  4QIW B;  1BQQ T;  3OSO A;  5J1Z A;  1A3V A;  1I6H H;  1Y1V H;  1A3U A;  2I5H A;  3PQI A;  3TQY A;  1TWF B;  3A0J A;  1NNX A;  4R4C A;  5CV6 A;  3TP8 A;  2E1H A;  1I4Q A;  3J7Z C;  1S40 A;  2MJ8 A;  1VMC A;  1YFT A;  1DGS A;  4EQN A;  4A3B G;  1DOM A;  3NBH B;  4A3I H;  2Q2T A;  3STB C;  4NDX A;  5KYI A;  2QA4 A;  4NXN Q;  2QEJ C;  2KHJ A;  3H3V I;  1PYS A;  1W3S A;  3VR3 A;  1BUV T;  3WOF A;  4BY7 B;  2ZXF A;  3G7L A;  1EYD A;  5LHY 1;  4HJ7 A;  1B1Z A;  4A3M H;  1JJ2 A;  2J3M A;  4X66 Q;  2UU9 L;  2ZR3 A;  2VUM H;  2L55 A;  2KEE A;  3MFY A;  1QUQ B;  3V96 A;  3HOW G;  1U4P A;  2A69 C;  4A93 B;  2PMF A;  4GLV B;  1PH9 A;  1CM9 A;  2ZZE A;  5C3E H;  4JI3 L;  3S2H B;  1STH A;  2O4X A;  2L1B A;  3A5Y A;  1NE3 A;  3L3O C;  2EYO A;  2IW3 A;  4YRI A;  3IKM B;  4CBV A;  1HR0 W;  2R3Z A;  1FL0 A;  3TP6 A;  3NSW A;  1EZ6 A;  4JI4 L;  4JI1 Q;  3S15 H;  3A5U A;  1PHJ A;  1H4S A;  2F0N A;  4ZKC B;  5IGE A;  4A76 A;  3S1M H;  1GGM A;  5IYD H;  1IKM A;  4A3J G;  5IGG A;  1BR9 A;  3DWA A;  3V2T A;  1N36 Q;  4GOP A;  3HXY A;  3M9B A;  2E65 A;  5EBC A;  2L12 A;  3PUV A;  4R9W A;  3PO3 G;  5C44 B;  1XXG A;  5DM6 3;  3ERS X;  1ZKO A;  1VF5 C;  3TDQ A;  5EJW A;  2WKD A;  4LF8 Q;  1IW7 D;  1D8L A;  3R2T A;  4LF7 L;  4LFB L;  4Y7N B;  3CRK C;  2CJB A;  1STG A;  3NK9 A;  4LUO A;  4X62 Q;  1XTC D;  2IJ0 A;  1CTM A;  2BH2 A;  5M5Y H;  1O78 A;  3REX A;  5JAV A;  4BS9 A;  3BZC A;  3VA7 A;  1SYD A;  2D0O A;  1VQD A;  1F77 A;  3CCQ A;  1CA5 A;  4JI0 Q;  4FF3 A;  3I7F A;  1EYA A;  5IIF A;  4EQO A;  3ULL A;  3RZD B;  5FLM G;  2WKC A;  1L2F A;  3J81 i;  2B63 H;  1KIX A;  1SYB A;  2LXJ A;  3MWY W;  4B3M L;  3BDL A;  1T5X D;  3K7U C;  1VQ6 A;  1EU4 A;  4HJ8 A;  3F8T A;  1XPO A;  5C52 B;  1ESR A;  2F03 A;  3RN2 A;  1WTR A;  4BBS G;  2ASB A;  1PFM A;  1B70 A;  1TS2 A;  5IP9 H;  2RCN A;  2WB1 E;  2KUM A;  3J80 E;  4WF2 A;  3LWU A;  4IJL A;  1XWE A;  1VQO A;  1XX8 A;  3GDE A;  2BH8 A;  2K33 A;  3S24 A;  1K9M C;  3I91 A;  4DR2 Q;  2NVQ H;  1UE6 A;  3L7Z C;  3HOW B;  2KCN A;  4BY1 G;  1EFW A;  5IOD A;  1PXU A;  1JOQ A;  3I90 A;  5BN5 A;  4OEM B;  4DK1 A;  1TII D;  2K52 A;  4KKU A;  2SEB D;  1JOK A;  2J4X A;  2Z9H A;  1Q8K A;  1WTO A;  5M3F G;  3RKY A;  3KFU A;  1CUK A;  4TRD A;  1NJI C;  4HSV A;  2AKW B;  5AFW A;  3S1N H;  3PGZ A;  4POF A;  2A6H C;  1EWC A;  1H9K A;  1LT3 D;  2HIX A;  2L15 A;  5EGT A;  3PIP 3;  3SDZ A;  2QGQ A;  2RCF A;  1XPR A;  3WQZ A;  4RHS A;  2MP1 A;  4A3J B;  3C3L A;  3UH0 A;  3L1A A;  1PVO A;  4DR3 L;  4IUP A;  1I94 Q;  1XNR Q;  1ML0 D;  3PO3 B;  1CT1 D;  1IBM L;  3HOY B;  5K36 G;  3A31 A;  4N8X 1;  5M5X H;  2SNS A;  4CH3 A;  2KVM A;  3L2Z A;  2ZT8 A;  2PQA B;  3QTC A;  3EVQ A;  4RGN A;  2QHU A;  2NYZ D;  3PO2 H;  2WB1 G;  4XTX A;  5IYC G;  2JSO A;  1AW7 A;  1XNQ Q;  2ZT9 C;  2VY3 A;  3D31 A;  4BWG B;  3F2U A;  3CCE A;  4IOA A;  3BDO A;  1B9M A;  2JA6 H;  1KHI A;  1Q90 A;  1GHK A;  4HID A;  1PZK D;  3A7A A;  2BE5 D;  4KD4 A;  2RDH A;  3AU7 A;  3M7N A;  2RKS A;  4EGV A;  3AB9 A;  1JQY D;  2B2U A;  4BBS B;  1EY7 A;  4DUY L;  4H2Y A;  3BVM A;  3TEH A;  5IGC A;  4KJN A;  3HXX A;  1S5C D;  1A0I A;  1IBL Q;  3HKZ E;  1BKB A;  1R9T H;  4KR3 A;  1X55 A;  1F9Q A;  1V1P A;  4NMZ A;  5C0X J;  3V8L A;  2L11 A;  1HQM C;  2D0P A;  2F3I A;  3HRZ C;  4LVK A;  2B2W C;  5JVH 3;  1VQ4 A;  1BVS A;  4K2L A;  1N33 L;  1DZ1 A;  3HY1 A;  4XTU A;  3NQI A;  1H9S B;  2K6A A;  3J81 L;  1IW7 C;  1VQL A;  1EWH A;  4CKC A;  4CS3 A;  3RN5 A;  1BNZ A;  1FNW A;  3E6Z X;  3T51 B;  1H4V B;  3P75 A;  4IPG A;  5M9O A;  1IZ6 A;  4DR7 L;  3J80 i;  1NCV A;  4RQF A;  5F2D A;  4HR7 B;  3S2D H;  3TUP A;  3UFG A;  1S4Z A;  3OOC A;  3DXJ C;  4DV0 Q;  3I3C A;  4BA1 I;  1ADY A;  3FJP A;  4F87 A;  1UE7 A;  1X2G A;  4IUR A;  4R4Q A;  4JI6 L;  4MHE A;  1RL2 A;  4CS4 A;  2E2J H;  4LJZ C;  3GV3 A;  3QJY A;  2SOB A;  2DN8 A;  5EQ0 A;  4KHZ A;  3MXU A;  5C53 B;  4PMC A;  4CH6 A;  4DV5 L;  1NY4 A;  5C0X G;  2E2D C;  2WP8 J;  4KKT A;  3Q8D A;  2EZV A;  1WQ7 A;  3ERR A;  2Z6K C;  3K5L A;  3DEP A;  4LVI A;  2NTT A;  2K04 A;  4YRE A;  1D1I A;  2N3S A;  4DPG A;  1SES A;  3ICE A;  5ELF A;  4R4T A;  4IFD G;  1WYD A;  2Z1C A;  3S16 B;  1AE2 A;  3NPP A;  2WB1 B;  4B3R Q;  3BZD B;  1E2Z A;  4C3H G;  4DGZ A;  1H9R A;  2E75 C;  2WAQ E;  3HKZ G;  3VQV A;  2K75 A;  1CZW A;  1LAB A;  2AHO B;  3DMU A;  3OD1 A;  3M7G A;  1O7Y A;  1HR0 Q;  1I6V C;  3SVM A;  1NJ2 A;  4K86 A;  4IPC A;  3UDX A;  4YRL A;  4FF4 A;  3M4O H;  1FYF A;  1SET A;  1G91 A;  1B3A A;  4A3K B;  4XQQ A;  4KK7 A;  1X01 A;  1KTK A;  3ZYY X;  1PFB A;  3CCV A;  1BCP B;  1NR4 A;  4QUF A;  4WFN 3;  2EWN A;  3OW2 A;  4ZTU B;  3CC7 A;  3T16 A;  3P8T A;  4J8Q A;  4DV3 Q;  4JYA Q;  3DHQ A;  3J7A F;  2ALY A;  4DQ2 A;  3GTM H;  4X65 L;  1SJE D;  1EY0 A;  1TWA H;  4J6H A;  2PQE A;  3FDT A;  3OPO A;  1V43 A;  2CW0 D;  4AYB E;  5E4W C;  1SE2 A;  1YGB A;  1QZG A;  3ICA A;  1HNX Q;  3H0G G;  3MXG A;  4B3T Q;  3NEN A;  2FMM A;  4IO9 A;  1SND A;  3G48 A;  1HXD A;  5C4J B;  2HNI A;  3BFM A;  1KL9 A;  4JC0 A;  1X56 A;  5GQO A;  4WJW A;  4KMU C;  5C6A A;  1GUT A;  3W5O A;  1S5B D;  3EN2 A;  2K4K A;  2K5H A;  5JJZ A;  5I9P A;  1VQN A;  2UUB Q;  1KDB A;  2VNU D;  4CKE A;  3RKX A;  1Z7T A;  3KF8 A;  2Q7E A;  3UGQ A;  4RQE A;  4F8M A;  5IT9 L;  2R92 H;  1KNE A;  3MVV A;  1VQF A;  2OQ0 A;  2DY7 A;  2CIM A;  2WII B;  5COR A;  3HOX B;  4K5V A;  4XTC S;  4GOP C;  4H13 C;  4Q6G A;  3VBB A;  2NBF A;  1PMR A;  5LMN L;  2WAQ G;  1LTS D;  3NEM A;  1WNL A;  1RJT A;  1BDO A;  2EJG A;  2NN6 I;  1A63 A;  1KDA A;  1VQH A;  4ZTZ B;  4ME3 A;  2DTO A;  4XTY A;  5LMU L;  4C1N K;  4A3G H;  4GLA C;  4OGQ C;  1BXT A;  3CQZ B;  3J81 c;  2ICE C;  3J80 L;  3NXW A;  3EFR A;  1Q1B A;  4ZIB A;  1D7Q A;  4XEO A;  2CWP A;  2EY2 A;  1JJC B;  4YRN A;  1KXL A;  5D3D A;  3HKZ B;  2VQE Q;  2ZJQ A;  3N6R A;  1K83 H;  4JBK A;  5JJL A;  3NTK A;  4TSS A;  1PRT B;  2HDM A;  2WV6 D;  1T9H A;  2P5Z X;  4RKB A;  1JJG A;  4DV6 L;  3VR2 A;  1R4P B;  2A74 C;  3BVG A;  2OF1 A;  1KD1 C;  4WJ4 A;  1DM0 B;  2CVR A;  4HED A;  1QOH A;  1JB7 A;  4WI1 A;  3QOL A;  1GO3 E;  2JA8 H;  3VQX A;  1OO9 B;  2LKV A;  1QNU A;  1O7Z A;  1NMF A;  1GUG A;  2MO0 A;  1LV9 A;  1EEI D;  2F0L A;  2KCM A;  2NVY B;  1OXT A;  2AKW A;  2PNH A;  1S5E D;  4KJO A;  1SMX A;  1VCI A;  3SR1 A;  5KYL A;  1QZH A;  1X2H A;  1XJV A;  3H0G B;  2UXB L;  1VQA A;  4KKS A;  2DNE A;  3TSS A;  5JPM C;  2ARS A;  2A68 D;  1DCZ A;  3K81 C;  2QDB A;  1HNZ Q;  4P72 A;  1Q8I A;  4NXM Q;  1UE1 A;  5T1I A;  3HOU G;  1B3Q A;  2HQE A;  1N32 Q;  4LF4 Q;  4DFA A;  3HOZ H;  3GTP H;  2F0K A;  5FKA C;  3M4Q A;  3STB D;  2GA4 B;  2M00 A;  1NUC A;  3G4S A;  2RHQ B;  2CKZ B;  4OWT B;  2Q7G A;  1QB5 D;  4HJ9 A;  3NTI A;  2PQA A;  3CRL C;  1TWC B;  3D6C A;  4MTK A;  4DNT B;  2JN4 A;  3H94 A;  4C3J G;  2RBM A;  3MA2 B;  1E2W A;  4C2M B;  1IYU A;  3RLF A;  1F9P A;  4JI5 Q;  4QGU A;  1XMO Q;  3D8G A;  4OWW B;  2EJF C;  4YYE A;  2B2Y C;  4DR5 L;  4LFA Q;  1WU7 A;  1HXY D;  5EKK A;  5I9O A;  3EFS A;  2R7F A;  1YNX A;  2AWN A;  4KR2 A;  2F3W A;  1DJR D;  2KED A;  2QF7 A;  2NVT B;  4IUQ A;  4YIJ A;  2F0H A;  4H2W A;  4AIM A;  4GZY C;  1PH4 A;  3R2I A;  1F2Y A;  3RZO H;  4A3B H;  4GKK L;  2EYH A;  3GP7 A;  2CW0 C;  2K05 A;  2QKI C;  2ZGW A;  1ENF A;  4DR6 L;  4DV7 Q;  4I7Z C;  3DSQ A;  2CGH A;  3LC0 A;  3DWQ A;  2VQF L;  4M8A A;  1EFI D;  3PZC A;  2AQ3 B;  1KLU D;  3DWP A;  2EJ9 A;  3CP0 A;  2F4V L;  3K0X A;  5IT9 c;  4XU1 A;  1YHB A;  4CDC C;  3A8K E;  2R7D A;  4YRC A;  1K28 A;  1AP0 A;  2NZO A;  3DLL A;  3P8V A;  2B2U C;  5FO7 B;  5BR8 Q;  3U9O A;  3HOW H;  1E3P A;  2D2C C;  4JPB W;  3EQL C;  2XTI A;  4KY6 A;  1QF6 A;  2P0L A;  2QDL A;  4XEM A;  1X32 A;  4JOI C;  1UEB A;  2YU9 B;  3GTL H;  3S1Q B;  2DKG A;  1HCZ A;  4H2U A;  4BY7 G;  1SEB D;  1AZQ A;  3ULJ A;  2R6G A;  1MSG A;  5M5W H;  2I5M X;  3S17 B;  3GQB A;  1SE8 A;  2AUK A;  1LAC A;  1ET6 A;  3MAQ A;  3RAC A;  4RGM A;  2KHS A;  3IKJ A;  1KAB A;  3TEH B;  5C51 B;  3V7S A;  4DR4 Q;  2E10 A;  2OT2 A;  3HOU B;  3FKI B;  5G3L F;  2ZM6 Q;  1UE5 A;  3A56 A;  1BOS A;  2OXP A;  2Z4I A;  4K8I A;  1OXU A;  1V1P B;  4NXN L;  1EIF A;  3W1B A;  3CD6 A;  1ILP A;  4QUC A;  5DNF A;  1BBX C;  3QO5 A;  1BO0 A;  2UXC Q;  3I73 A;  4DK0 A;  2XN9 C;  2Z8L A;  1JC7 A;  4UDU C;  4FDB A;  4BBR G;  4HT4 A;  1B53 A;  3GTG B;  4C3J B;  2UXD L;  4ZRZ A;  2IWH A;  2C5C A;  4DNR B;  2V4D A;  2ATW A;  1CI3 M;  2QW7 A;  1WTW A;  3J81 E;  5C4H A;  4A3F G;  2CQA A;  4OIJ A;  1GOZ A;  1JIC A;  2MPM A;  4LWC A;  2EY6 A;  2N88 A;  1SBB B;  5IWA Q;  5FLM H;  1B2T A;  1ROD A;  1I4R A;  4X64 Q;  2K5Q A;  2A8V A;  2HIV A;  1TY0 A;  1S3O A;  4GN3 B;  3I4M G;  3VQW A;  2I4L A;  1IL8 A;  2YTV A;  4APV A;  2KEC A;  4PQX A;  2F0D A;  4JI1 L;  4A3L G;  3ULP A;  3D4D A;  1YFS A;  3MFG A;  1EEF D;  3DM1 A;  1P8L A;  2JYO A;  1K8A C;  1HZA A;  3BVZ A;  2A6H D;  2A68 C;  1J8I A;  3REU A;  4BXX G;  3C1E A;  1N36 L;  4GNX A;  5J39 A;  2HHH Q;  1AN8 A;  4OO1 I;  4FXD A;  4Q0F A;  4QL5 A;  4A3D G;  4HWO A;  4LF8 L;  1X3E A;  1LTA D;  1EIH A;  3IAL A;  2K32 A;  1VQZ A;  4BY1 H;  1MHW C;  3KK7 A;  3Q24 A;  4X62 L;  1QVC A;  4TTV A;  3GTK H;  5JJI A;  1USY C;  4YWL A;  4ME5 A;  3WWV A;  3GTO B;  4JI0 L;  4L8J A;  5M3F H;  2MO1 A;  2F0W A;  5CV4 A;  2KOL A;  2LFN A;  4H44 C;  4RDX A;  2L4N A;  1LM0 A;  3LWE A;  3NEL A;  4CDD C;  5KRU A;  4N9P A;  2DGY A;  3F2C A;  3LX0 A;  2ZJP A;  1AEX A;  1K3R A;  3OWE B;  2OEO A;  4KLK A;  1LTL A;  2EYL A;  5T1G A;  5TSS A;  3F1Z A;  4OXP A;  4LUZ A;  2KA7 A;  1SYF A;  1K3B C;  2QCP X;  5EKI A;  2F3V A;  2ALY B;  3PUX A;  1ONL A;  1ZYR C;  4TWA A;  2GN5 A;  1YB3 A;  4L6T B;  1GXD C;  1CQF A;  1RTN A;  4RGT A;  5IYB G;  3OMG A;  4IQZ A;  2HCC A;  3ITP A;  5C3W A;  4LMQ D;  2A8E A;  3WDN A;  2F0J A;  2PZU A;  1AFP A;  1VQG A;  2NN6 G;  4O2D A;  4BBR B;  3TN2 A;  4R8I A;  3TZD A;  1B44 D;  3K57 A;  4DR2 L;  4IOC A;  1G5H A;  1JJC A;  1RD9 D;  4RH6 A;  5CR3 A;  4K88 A;  4DK6 C;  5IYC H;  4A3F B;  4K8J A;  3ERQ A;  2FXQ A;  2AWO A;  5GAG C;  3HOY G;  4JV5 Q;  3KF8 B;  1JB3 A;  4C3I H;  1AE3 A;  4DR1 Q;  3HOV B;  2ES2 A;  3F2B A;  3KLS A;  3I4M B;  1FGB D;  4CHT B;  2PMZ B;  4ZAI A;  4KY7 A;  5IT9 E;  3HXV A;  4RA8 A;  2L5T A;  4RMF A;  3PUW A;  4A3E H;  5CYU A;  2RDF A;  1PTO B;  3A7L A;  1SFO H;  1WCM H;  1EVL A;  4GN4 B;  3X3N A;  1VDZ A;  4K14 A;  2VXW A;  4PMB A;  1DON A;  5GAE C;  2VW9 A;  2DVE A;  1D5Z C;  2PW5 A;  4A3D B;  2MGS A;  4ZLT F;  4JBW A;  3UE1 A;  1SE3 A;  3G71 A;  3A8I E;  1VQP A;  3V8K A;  4A3C G;  1E24 A;  3UDG A;  3AEV A;  5KNN A;  3I56 A;  4UP7 A;  4QQB X;  2UU9 Q;  3K7A H;  2I4M A;  3A55 A;  1DOK A;  1ZXT A;  4CS2 A;  1XNQ L;  2M2L A;  1VQ9 A;  2GVA A;  2R61 A;  2A1A A;  2R93 G;  2RHQ A;  1M8A A;  5C4X B;  1VQM A;  1X3P A;  2Q8I B;  3HEJ A;  1HTT A;  3I4N B;  2IHE A;  2BOS A;  2K7V A;  1I5F A;  2FHT A;  4KV6 A;  4HIM A;  2JEA I;  4DV2 L;  1TWH H;  4PG3 A;  2QHS A;  4KTA A;  2ARU A;  4ZQ3 A;  3L4G B;  1NBW A;  1QWY A;  1Y1V G;  5C0X H;  1TKW B;  4BA2 I;  1IBL L;  1TU2 B;  4P73 C;  2JA5 H;  1C7Y A;  4RWS C;  1NJ8 A;  1LTG D;  4UPA A;  3A7R A;  1B4O A;  2L9H A;  3MTS A;  3GTQ B;  5M3M H;  1HTL D;  4A3I G;  3A5Z B;  4JG2 A;  1G51 A;  4FXK C;  3JC6 6;  4RG1 A;  4OX9 Q;  1YIJ A;  4NCX A;  2K50 A;  2X6G A;  2F0G A;  2KCT A;  4LF7 Q;  1W6K A;  2B2V A;  4C3H H;  4HAE A;  1GVP A;  4XU2 A;  4A3M G;  1GUO A;  2E2I B;  1G2S A;  1TWG B;  5K1P A;  3PF5 A;  1LT5 D;  3QO8 A;  3NWS A;  4P3P A;  1JOO A;  1C4Q A;  1Q12 A;  5ELD A;  3G6E A;  1SDF A;  1STB A;  4KD3 A;  4HCS A;  2PCF B;  2PNR C;  3KLR A;  4DV0 L;  1OTC A;  2DXT A;  4HWR A;  4ID6 A;  1XMQ L;  2QHT A;  2PO4 A;  4HCE A;  4OWX B;  4K6D A;  2K5V A;  1GUW A;  3FPU B;  1QE0 A;  4MN3 A;  1W2B A;  3FP9 A;  1SYC A;  3M3Y B;  2ZJR A;  4LUV A;  2WIN B;  3HFV A;  4P74 A;  5KGU A;  2R7Z B;  4HIO A;  1X3F A;  5IYD G;  4A3K G;  2IY5 A;  4RCO A;  4FXG C;  2KEN A;  5LMN W;  1VQE A;  5FO9 B;  3MXN B;  4JI7 Q;  2BA0 A;  3KJO A;  2EE1 A;  2XGT A;  3PUZ A;  5IP7 G;  2J3L A;  2KBN A;  4G4K A;  3TRE A;  4B3R L;  4PMW A;  3GTJ H;  3QOJ A;  2P5I A;  2N78 A;  4XT1 B;  2Q5H A;  4YRP A;  2R93 B;  1Q7Y C;  4ZK9 B;  3J7A 5;  2Y0S E;  4WRD A;  3G6J B;  3RMH A;  1RIQ A;  2WFW A;  2QEX A;  3RF1 A;  1P16 A;  1TWC H;  1HFN A;  1SE4 A;  4P71 C;  4S3S A;  4IFD J;  1MBY A;  1KLG D;  4LVL A;  4R4I A;  2CWA A;  2JA7 G;  1I6H B;  1Y1V B;  3L9A X;  1U4R A;  2DTH A;  2E2H H;  2RDG A;  2H4O A;  2L0C A;  3OMC A;  4DV3 L;  3JAM E;  4JYA L;  1EWI A;  4HSP A;  1DYQ A;  3AFP A;  1Y1W H;  4DR3 Q;  3RD4 A;  2MQH A;  3VR5 A;  4A3I B;  1MSH A;  3HOX G;  1B7Y B;  1EOT A;  1N8R C;  1VF7 A;  3T1Y Q;  2B39 A;  1HNX L;  2RSO A;  3HG9 A;  4B3T L;  3W3S A;  2HCI A;  4JI8 Q;  5CV8 A;  4K5X A;  4A3M B;  4O0A A;  2YV5 A;  2G9D A;  4JCV E;  2VUM B;  4C1N I;  2MNA A;  1D5X C;  4XIG S;  2UUB L;  2UUC Q;  2Z6B A;  4I7A A;  1F2M A;  3TS2 A;  4ZKB B;  1BCP C;  3SK5 A;  1CSP A;  1EZ8 A;  1I3Q B;  2D62 A;  1ASY A;  4OO1 G;  1EYC A;  5C3E B;  4YPF A;  1HA6 A;  3KLS X;  3QG1 A;  4B9X A;  11AS A;  2F0V A;  2RHS B;  1HUM A;  3MHB A;  1W66 A;  1X3Q A;  2QHV A;  4HWS A;  3S14 H;  5J22 A;  3OWF A;  3S15 B;  1YHQ A;  5IGD A;  1D2B A;  1HUN A;  1LTB D;  2Y0S G;  3S1M B;  2HQL A;  2KJX A;  4DKA C;  4YRF A;  4LF6 Q;  1V1Q A;  1DOL A;  3CW2 C;  1K0R A;  1C8C A;  2EL9 A;  3IL8 A;  2E5L Q;  2E41 A;  3PUY A;  3QB3 A;  1TR5 A;  1E7Z A;  2Z0S A;  3P1H A;  1YNJ C;  4YRS A;  3VYR A;  1X9N A;  2J7Z A;  2XIW A;  1WD0 A;  1EY5 A;  4X3S A;  1X6O A;  1ESF A;  3A74 A;  4F7X A;  1XPU A;  4YY3 Q;  4GNX B;  3T53 B;  2K5D A;  3UI2 A;  1KNA A;  2VQE L;  1HFG A;  4LF5 Q;  5M5Y B;  4QMG A;  5IY0 A;  1SRU A;  3I4O A;  2IHF A;  4K0K Q;  1JWM D;  2ZZF A;  3E9H A;  5E3I A;  1TY2 A;  5I2X A;  1C48 A;  3K5M A;  2KCC A;  4DN4 M;  1Z7N A;  2B63 B;  4RFB A;  2JA7 B;  3CPF A;  3CF5 A;  1I50 B;  2JA6 G;  1JWS D;  4LNQ A;  3CCM A;  3SGI A;  5AJ3 L;  2PPB C;  4HA8 A;  3C1F A;  4MZ9 A;  1EQV A;  1ENA A;  4FO2 A;  3TP7 A;  2Q2I A;  3PF4 A;  5LL6 S;  1QG7 A;  2JEB I;  4DV5 Q;  3AYH B;  1HC7 A;  3U58 A;  4IUU A;  1WTH A;  4U67 3;  1V1O A;  1YIT A;  1HA5 A;  2FMC A;  4IAL A;  1HNZ L;  3BDC A;  2O5J C;  2B8F A;  3P8Y A;  3EJI A;  4Q15 A;  1WTP A;  1IHZ A;  4NXM L;  2EXZ A;  1X65 A;  3H3V C;  3D4R A;  2J0T D;  2NVQ B;  4LF4 L;  1TWF H;  3JAM i;  5C5M A;  2EIF A;  5FO8 B;  2EDG A;  3X3M A;  1IL2 A;  1KRS A;  4G57 A;  5ELC A;  3LGJ A;  5GAD C;  4P3N A;  4A93 G;  3IKL A;  2V1C C;  2DU7 A;  2UUA Q;  4JI5 L;  3VYS A;  4BY7 H;  3MF2 A;  3S1N B;  1XMO L;  1FGU A;  2XNA C;  1PTO F;  3G1Z A;  4TVY A;  2XRS D;  2IT1 A;  4LFA L;  4YRG A;  2Y0S B;  4CJ1 B;  4LK1 C;  1U4M A;  5EPJ A;  4MNO A;  5L37 A;  4L5Q A;  2EYF A;  1FJG Q;  1PH7 A;  4A93 H;  2E8G A;  3V05 A;  3OTO Q;  4IUV A;  3L4G A;  3ER0 A;  4DNI A;  4LNS A;  4MTN A;  5M5X B;  3S2H H;  1L1O B;  2E5A A;  1A62 A;  4XXE A;  1E0B A;  4YCU A;  4DF7 A;  1N34 L;  3T13 A;  2ID0 A;  1BBW A;  2ZR2 A;  3W1G A;  2PW7 A;  1RCV D;  3PO2 B;  4H2V A;  3A5Z A;  4KY5 A;  4H2S A;  2BDO A;  1CA6 A;  1V8Q A;  2DZC A;  4LFC L;  5BR8 L;  1KMM A;  1VMP A;  1PFN A;  3E9I A;  2AQ2 B;  3FKI G;  1GJX A;  5C44 H;  2JA6 B;  2PME A;  1JE5 A;  4TKO B;  4XT3 B;  1FNU A;  1SN8 A;  4RHR A;  4Y7N H;  1WVL A;  1YJN A;  4I65 A;  5JVG 3;  3R8B A;  1B9N A;  2SNM A;  4TQU S;  1R9T B;  1XYI A;  2HDL A;  2F0O A;  4A3L H;  1H9M A;  3L0O A;  3HXU A;  4Y52 H;  1PTO H;  4EX5 A;  2O2L D;  4K6L A;  1SMY D;  3RZD H;  3QNE A;  4DR4 L;  3ONA B;  2LMC B;  4BXX H;  3CU7 A;  4E6I A;  1EL0 A;  1H4T A;  1B76 A;  12AS A;  3W2D A;  5IGF A;  3ERO A;  4ULL A;  2ZM6 L;  4DU9 A;  1JE4 A;  2SDF A;  1JT8 A;  3GV6 A;  5E3F A;  5CV7 A;  2PZW A;  4DA2 A;  3BYY B;  1ZYR D;  4NP5 A;  2EAY A;  5E4X A;  1RKN A;  3VYU A;  3MXN A;  4KN4 C;  2I07 B;  1EQQ A;  4F88 A;  1CQV A;  2JXM B;  5J3B A;  5EKL A;  4KHP Q;  3S2D B;  3FEW X;  4OON A;  5CV9 A;  1WPY A;  2I4N A;  3SK8 A;  1R4Q B;  5K1X A;  1C9O A;  2OTL A;  2ZT6 A;  2R92 G;  4P74 C;  1GKH A;  1TVX A;  1IBK L;  1PTO D;  5IWA L;  4YRR A;  2E2J B;  3PIP A;  3W3A A;  3K8A A;  2PMZ E;  3I55 A;  1Q1E A;  4X64 L;  4POG A;  1NJ1 A;  3HRI A;  3ND9 A;  4DV1 Q;  3IFD A;  2I4O A;  1F2Z A;  2PYK A;  4B3S Q;  5FJ8 G;  2DJF C;  3CKI B;  4YCW A;  3JAM L;  1WTV A;  3B6Y A;  4EQ5 A;  3VA5 A;  4FVM A;  5DEH A;  2EY5 A;  2CQO A;  2F0T A;  3BU2 A;  3I70 A;  3BJU A;  2HHH L;  2PI2 A;  2IY5 B;  2ENB A;  1B7Y A;  4B9W A;  2K28 A;  2EYM A;  3Q23 A;  2ART A;  1ASZ A;  2DUD A;  4A3J H;  1LYL A;  1TT2 A;  4NPS A;  1RHP A;  4O42 A;  1I4G A;  4TVA B;  2ZTC A;  3PO3 H;  5H1S E;  3RLN A;  3M4O B;  3VQY A;  2ZTE A;  3HOY H;  3TP5 A;  4EO4 A;  5A2Q L;  1VS0 A;  2B2W A;  3A54 A;  1NSN S;  3K59 A;  4J15 A;  3UGT A;  4X66 L;  4YRQ A;  4A4I A;  5JEA J;  3GTM B;  2F0E A;  3PV0 A;  3M4Y A;  4DAY A;  4HWP A;  1ICW A;  4H0L C;  1S5D D;  1TWA B;  2Q8T A;  2OCE A;  2RHS A;  1Y8N B;  1LTT D;  2ZNI A;  3WOE A;  1J9O A;  3I72 A;  3HOV G;  1N9W A;  2F0Q A;  4O1N A;  2C7I A;  1J5E Q;  1VQ7 A;  5EPK A;  3PMF A;  5C4Z A;  3D4W A; 
#chains in the Genus database with same CATH homology
 4BBS H;  3PCO A;  1HH2 P;  4A3C H;  1MJE A;  1O7I A;  3HOZ G;  2FYK A;  1H4Q A;  4QJF A;  4DV4 Q;  3EIV A;  5ELO A;  1KMN A;  2Z6K A;  3GD7 A;  4UY8 C;  2VZA A;  4JV5 L;  4GKJ Q;  4G84 A;  2NZH A;  4DR1 L;  5JEA G;  2IX0 A;  3V8J A;  3CME A;  3V7C A;  4P3O A;  1VQC A;  1GM5 A;  2DQ3 A;  3HY0 A;  1KQS A;  2ODR D;  2I0Q A;  4YRT A;  4KQE A;  5C4X G;  1J5W A;  3RR5 A;  3I4N G;  4YHH Q;  2Q7H A;  1HZB A;  1IYJ B;  2DEQ A;  4QY7 A;  3PSI A;  1CKN A;  4LVM A;  4DUZ Q;  2N8N A;  2CFM A;  4UP8 A;  1HNW Q;  4PHC A;  1MKH A;  2UXD Q;  5HY6 A;  3ZJY C;  3UDF A;  3S16 H;  3EBE A;  3MEF A;  1I3Q H;  3JAM c;  3D0F A;  4PZ8 A;  1EQR A;  4JI2 Q;  2OQK A;  1H95 A;  4LF9 Q;  4TQF A;  3I2Z A;  1MIU A;  4AQY Q;  2Q2U A;  4XU3 A;  1OXV A;  3U4V A;  1EOV A;  4PZ6 A;  2PI2 E;  4XTV A;  4A75 A;  3T1H Q;  4A3K H;  1HJP A;  4G85 A;  3AQQ A;  5GRO A;  4GLX A;  2IX1 A;  5IP7 H;  1KC8 C;  1Z47 A;  4OX9 L;  1PH6 A;  4JBM A;  3RGL A;  1L1O A;  2DZ9 A;  1I94 L;  1XNR L;  2ZCE A;  3MEY A;  4TVW A;  2R7Z G;  2LSS A;  2JJQ A;  2DDZ A;  3KOJ A;  2DXU A;  3CC2 A;  3KDF A;  4HVC A;  5C4J H;  1SRO A;  2MFI A;  1VQI A;  3RIR A;  2VL6 A;  2JQO A;  2JA7 H;  1I50 H;  1EUJ A;  1CKM A;  4LW1 A;  2JE6 I;  2NS6 A;  3RLO A;  1G29 1;  4JI3 Q;  4P72 C;  3HOX H;  4P75 A;  4UP9 A;  3HXZ A;  3QO7 A;  4JI4 Q;  1Q82 C;  4YP0 A;  4JI7 L;  2Q5I A;  1YEZ A;  5FLX c;  3RKW A;  1C0A A;  4NB3 A;  3KJP A;  3J81 j;  3CQZ H;  1IXR A;  3UDI A;  4JBJ A;  4XTW A;  3V7R A;  4IJH A;  4LFB Q;  4L5T A;  5E7N A;  1ATI A;  2VUM G;  1E1O A;  3H3V H;  1SR3 A;  2ZIO A;  5F5W A;  5C3E G;  3NET A;  2ODR C;  2ZIN A;  1VQ8 A;  4B3M Q;  1WFQ A;  2EJF A;  3T1Y L;  2RF4 A;  4XTZ A;  2K5N A;  1K8G A;  2NVY H;  3R07 A;  4JI8 L;  2H5X A;  1S72 A;  1OXX K;  3H0G H;  3KF6 A;  1PH2 A;  2UUC L;  1YI2 A;  1NYR A;  4TVA A;  1WLE A;  4TQD A;  1RIP A;  1HZC A;  4H2X A;  4R4O A;  2VS1 A;  1HR0 L;  3VDY A;  5GAH C;  4DV2 Q;  4A3E G;  4LVJ A;  1WCM G;  1PH3 A;  1GD7 A;  4LF6 L;  2B63 G;  4C2M H;  1PA6 A;  4JOI A;  1SRY A;  2E5L L;  3M85 A;  2DU5 A;  2LXK A;  2ZTG A;  4YY3 L;  1AH9 A;  4L5S A;  2NVT H;  5IP9 G;  3CCR A;  4LF5 L;  1Q81 C;  2K14 A;  1IBM Q;  4K0K L;  2AMC A;  3CCU A;  1WQW A;  1YHA A;  1YVC A;  2YYZ A;  4IPD A;  1Y14 B;  1CSQ A;  1XMQ Q;  1KAW A;  5HGQ A;  4DAY B;  2EQS A;  4GNX C;  4BW9 A;  2YU9 H;  3S1Q H;  2JA5 G;  2E3C A;  1X3G A;  1A8V A;  1EIY B;  4DUY Q;  5M3M G;  1NJ5 A;  3S17 H;  2BA1 A;  1WOC A;  3LSQ A;  3CCL A;  4HWT A;  3HKS A;  2A19 A;  3PCO B;  3HFZ B;  1BIB A;  1VQ5 A;  3HOU H;  3FKI H;  3RNU A;  1N33 Q;  4E51 A;  3OYY A;  4XU0 A;  3A32 A;  1QUQ A;  4DK3 C;  1PH1 A;  2UUA L;  1MJC A;  5DLQ E;  4DR7 Q;  2Q2H A;  1U5K A;  3PO2 G;  4YRM A;  1YJW A;  1Z7M A;  1ADJ A;  2N49 A;  4C3J H;  3GTG H;  1YFR A;  4AH6 A;  4HIK A;  1USY A;  3PIO A;  1FJG L;  4JI6 Q;  3OTO L;  4H02 A;  4ALP A;  2CJ9 A;  2F52 A;  1PYB A;  3TRZ A;  2OTJ A;  1PYS B;  3IRB A;  3K80 C;  2DTI A;  1CKN B;  4HJA A;  2I5L X;  4GN5 A;  3HTZ A;  2GVB A;  2JA9 A;  1N32 L;  4YRJ A;  1XTD A;  5ELN A;  1BBU A;  3U50 C;  1U0L A;  3UE0 A;  3S1R H;  1BIA A;  3M4P A;  1G5I A;  1CKO A;  5FJ8 H;  1L1O C;  4PZ7 A;  4YRO A;  1WI5 A;  3GTO H;  1Y1W G;  1SLJ A;  4YDQ A;  1TXY A;  1PV4 A;  1E22 A;  2YTX A;  4X65 Q;  2ZIM A;  4GOP B;  4H2T A;  1M1K C;  4R1J A;  2CCZ A;  4GS3 A;  4AYB G;  4CH5 A;  4DV7 L;  4KHP L;  3CPW A;  4L5R C;  3RL6 A;  4WJ3 M;  1X54 A;  1L0W A;  1PH5 A;  3BZK A;  4P75 C;  1VQB A;  3KDF B;  3MQZ A;  2E64 A;  3CCS A;  4BBR H;  1Q86 C;  5AJ3 Q;  3TS0 A;  1PFS A;  4DV1 L;  4L87 A;  4QIW E;  1EYG A;  4A3F H;  2G4C A;  1WJJ A;  1VQK A;  3AFQ A;  4B3S L;  5IE8 A;  1Q46 A;  3HOV H;  5LMN Q;  3CXC A;  1NYQ A;  3I4M H;  2B3G A;  1B70 B;  1NMG A;  3CAM A;  5LMU Q;  5JJK A;  3CC4 A;  3A7U A;  1K73 C;  4DAM A;  1EVK A;  1SER A;  1OXS C;  1NNH A;  4P73 A;  1V9P A;  2C8M A;  4A3D H;  3HRK A;  3F2D A;  3CMA A;  1YJ9 A;  2B29 A;  2UXC L;  1NJ6 A;  2EXD A;  4DV6 Q;  3KLW A;  1J6Q A;  1KOG A;  2ZNJ A;  3L2P A;  3TEG A;  3GO5 A;  3RUX A;  1NTG A;  5C4X H;  1PH8 A;  1QVF A;  3CCJ A;  1J5E L;  3I4N H;  3LSS A;  1N34 Q;  2OWO A;  2UXB Q;  3FHW A;  4A3G G;  1M90 C;  4CH4 A;  5IYB H;  2ZT5 A;  4X6A H;  4DV4 L;  4YRK A;  3E0E A;  4LFC Q;  4YCV A;  1YBY A;  3CMQ A;  3GTQ H;  3KF6 B;  1UWV A;  3HXW A;  1JMC A;  2JK8 A;  2C35 B;  4GKJ L;  2DQ0 A;  3MF1 A;  1FVI A;  3IG2 A;  2YTY A;  1VQJ A;  2NVX H;  1KRT A;  3J80 c;  2E2I H;  1TWG H;  4H2X B;  1QVG A;  4X5O A;  2KHI A;  2CJA A;  4A93 G;  2ZTD A;  4HWP A;  4DR5 Q;  2JA8 G;  2ZT7 A;  4P71 A;  1B8A A;  4HJ5 A;  4YHH L;  2HT1 A;  1G6P A;  3M3Y H;  4GKK Q;  5EAY A;  4YWK A;  1EIY A;  1YZ6 A;  1E1T A;  4K87 A;  4DR6 Q;  2R7Z H;  4DUZ L;  3H15 A;  1HNW L;  2VQF Q;  4BWA A;  2F4V Q;  3HFZ A;  3U4Z A;  1IBK Q;  5C44 G;  2AMC B;  2DJZ A;  4OLF A;  1HZ9 A;  4YWM A;  3DM3 A;  4JI2 L;  4KI0 A;  4IPH A;  3KYH C;  4LF9 L;  5C0X I;  2R93 H;  4AQY L;  1LUZ A;  1Z9F A;  2ZZG A;  3T1H L;  4IFD I;  4OP0 A;  1I6H H;  1Y1V H;  2I5H A;  3TQY A;  3A0J A;  2E1H A;  4R4C A;  3J7Z C;  1S40 A;  1YFT A;  1DGS A;  4A3B G;  3NBH B;  4A3I H;  2Q2T A;  3STB C;  2QA4 A;  4NXN Q;  3H3V I;  2KHJ A;  1PYS A;  1W3S A;  2ZXF A;  4A3M H;  4HJ7 A;  2J3M A;  1JJ2 A;  4X66 Q;  2UU9 L;  2ZR3 A;  2VUM H;  1QUQ B;  3HOW G;  2PMF A;  4GLV B;  1PH9 A;  2ZZE A;  5C3E H;  4JI3 L;  3A5Y A;  1NE3 A;  4YRI A;  3IKM B;  1HR0 W;  1FL0 A;  4JI4 L;  4JI1 Q;  3S15 H;  3A5U A;  1PHJ A;  1H4S A;  3S1M H;  4A76 A;  1GGM A;  5IYD H;  4A3J G;  1N36 Q;  4GOP A;  3HXY A;  3M9B A;  2E65 A;  3PUV A;  3PO3 G;  3ERS X;  4LF8 Q;  1D8L A;  4LF7 L;  4LFB L;  2CJB A;  4LUO A;  4X62 Q;  2BH2 A;  5M5Y H;  3REX A;  3BZC A;  2D0O A;  1VQD A;  3CCQ A;  4JI0 Q;  3I7F A;  3ULL A;  5FLM G;  1L2F A;  3J81 i;  2B63 H;  1KIX A;  2LXJ A;  4B3M L;  3K7U C;  1VQ6 A;  4HJ8 A;  3F8T A;  1XPO A;  5C52 B;  3RN2 A;  4BBS G;  2ASB A;  1B70 A;  5IP9 H;  2RCN A;  2WB1 E;  4WF2 A;  4IJL A;  1VQO A;  3GDE A;  2BH8 A;  3S24 A;  1K9M C;  4DR2 Q;  2NVQ H;  1UE6 A;  3L7Z C;  4BY1 G;  1EFW A;  2K52 A;  1Q8K A;  5M3F G;  3RKY A;  3KFU A;  1CUK A;  1NJI C;  2AKW B;  3S1N H;  3PGZ A;  4POF A;  2L15 A;  2HIX A;  1XPR A;  2QGQ A;  3WQZ A;  3UH0 A;  3L1A A;  1PVO A;  4DR3 L;  1I94 Q;  1XNR Q;  1IBM L;  5K36 G;  3A31 A;  5M5X H;  4CH3 A;  3L2Z A;  2ZT8 A;  2PQA B;  3QTC A;  2QHU A;  3PO2 H;  2WB1 G;  4XTX A;  5IYC G;  1XNQ Q;  2VY3 A;  3D31 A;  3CCE A;  4IOA A;  2JA6 H;  1KHI A;  4HID A;  3A7A A;  3M7N A;  4DUY L;  4H2Y A;  3TEH A;  3HXX A;  1A0I A;  1IBL Q;  3HKZ E;  1BKB A;  1R9T H;  4KR3 A;  1X55 A;  5C0X J;  3V8L A;  2F3I A;  2D0P A;  4LVK A;  1VQ4 A;  1BVS A;  1N33 L;  3HY1 A;  4XTU A;  1VQL A;  4CS3 A;  3RN5 A;  1H4V B;  4IPG A;  1IZ6 A;  4DR7 L;  3J80 i;  4RQF A;  3S2D H;  3TUP A;  3UFG A;  4DV0 Q;  4BA1 I;  1ADY A;  3FJP A;  1UE7 A;  1X2G A;  4R4Q A;  4JI6 L;  1RL2 A;  4CS4 A;  2E2J H;  4KHZ A;  5C53 B;  4CH6 A;  4DV5 L;  1NY4 A;  5C0X G;  2WP8 J;  3Q8D A;  3ERR A;  1WQ7 A;  2Z6K C;  4LVI A;  4YRE A;  2N3S A;  4DPG A;  1SES A;  3ICE A;  4R4T A;  4IFD G;  1WYD A;  1AE2 A;  4B3R Q;  3VQV A;  2WAQ E;  3HKZ G;  2K75 A;  2AHO B;  3OD1 A;  1HR0 Q;  1NJ2 A;  4K86 A;  4IPC A;  3UDX A;  4YRL A;  3M4O H;  1FYF A;  1SET A;  1X01 A;  3CCV A;  2EWN A;  3OW2 A;  4ZTU B;  3CC7 A;  3P8T A;  4DV3 Q;  4JYA Q;  2ALY A;  4DQ2 A;  3GTM H;  4X65 L;  1TWA H;  1V43 A;  4AYB E;  1YGB A;  1QZG A;  3ICA A;  1HNX Q;  3H0G G;  4B3T Q;  3NEN A;  4IO9 A;  3G48 A;  1HXD A;  2HNI A;  3BFM A;  1KL9 A;  4JC0 A;  1X56 A;  5GQO A;  3W5O A;  3EN2 A;  2K4K A;  2K5H A;  1VQN A;  2UUB Q;  2VNU D;  3RKX A;  2Q7E A;  3UGQ A;  4RQE A;  2R92 H;  1VQF A;  2OQ0 A;  2CIM A;  4XTC S;  4GOP C;  4Q6G A;  3VBB A;  5LMN L;  2WAQ G;  3NEM A;  1WNL A;  2EJG A;  2NN6 I;  1A63 A;  4ZTZ B;  1VQH A;  4ME3 A;  2DTO A;  4XTY A;  5LMU L;  4A3G H;  4GLA C;  3J81 c;  3EFR A;  1Q1B A;  4ZIB A;  1D7Q A;  4XEO A;  2CWP A;  1JJC B;  4YRN A;  1KXL A;  2VQE Q;  2ZJQ A;  1K83 H;  4JBK A;  5JJL A;  1T9H A;  1JJG A;  4DV6 L;  1KD1 C;  4WJ4 A;  1JB7 A;  4WI1 A;  1GO3 E;  2JA8 H;  3VQX A;  1NMF A;  2MO0 A;  2KCM A;  1OXT A;  2AKW A;  2PNH A;  1QZH A;  1SMX A;  1VCI A;  1X2H A;  1XJV A;  2UXB L;  1VQA A;  2ARS A;  3K81 C;  1HNZ Q;  4P72 A;  4NXM Q;  1UE1 A;  3HOU G;  1N32 Q;  4LF4 Q;  3HOZ H;  3GTP H;  3M4Q A;  3STB D;  3G4S A;  2RHQ B;  2CKZ B;  4OWT B;  2Q7G A;  4HJ9 A;  2PQA A;  4JI5 Q;  3RLF A;  4QGU A;  1XMO Q;  4OWW B;  4YYE A;  4DR5 L;  4LFA Q;  1WU7 A;  3EFS A;  2R7F A;  1YNX A;  2AWN A;  4KR2 A;  4H2W A;  4AIM A;  1PH4 A;  3RZO H;  4A3B H;  4GKK L;  2ZGW A;  4DR6 L;  4DV7 Q;  3DSQ A;  2CGH A;  3LC0 A;  2VQF L;  3PZC A;  2EJ9 A;  3CP0 A;  2F4V L;  3K0X A;  5IT9 c;  4XU1 A;  1YHB A;  2R7D A;  4YRC A;  2NZO A;  3DLL A;  3P8V A;  5BR8 Q;  3HOW H;  1E3P A;  2XTI A;  1QF6 A;  2P0L A;  4XEM A;  4JOI C;  1UEB A;  3GTL H;  2DKG A;  4H2U A;  4BY7 G;  3ULJ A;  2R6G A;  5M5W H;  2I5M X;  1SE8 A;  3RAC A;  3TEH B;  5C51 B;  3V7S A;  4DR4 Q;  2E10 A;  2ZM6 Q;  1UE5 A;  3CD6 A;  4NXN L;  1OXU A;  3W1B A;  1EIF A;  3QO5 A;  2UXC Q;  4FDB A;  4BBR G;  4HT4 A;  2UXD L;  2ATW A;  4A3F G;  4LWC A;  5FLM H;  5IWA Q;  4X64 Q;  2A8V A;  2HIV A;  4GN3 B;  1S3O A;  3I4M G;  3VQW A;  2I4L A;  2YTV A;  4APV A;  4JI1 L;  4A3L G;  3ULP A;  1YFS A;  1P8L A;  1K8A C;  1HZA A;  3REU A;  4BXX G;  1N36 L;  4GNX A;  2HHH Q;  4OO1 I;  4QL5 A;  4A3D G;  4HWO A;  4LF8 L;  1X3E A;  3IAL A;  1VQZ A;  4BY1 H;  4X62 L;  1QVC A;  4TTV A;  3GTK H;  5JJI A;  1USY C;  4YWL A;  3WWV A;  4JI0 L;  5M3F H;  2MO1 A;  4RDX A;  1LM0 A;  3NEL A;  2DGY A;  3F2C A;  2ZJP A;  1K3R A;  4KLK A;  1LTL A;  3F1Z A;  4OXP A;  4LUZ A;  2ALY B;  3PUX A;  4TWA A;  2GN5 A;  1YB3 A;  5IYB G;  2A8E A;  1VQG A;  2NN6 G;  4O2D A;  4DR2 L;  4IOC A;  1G5H A;  1JJC A;  4K88 A;  4DK6 C;  5IYC H;  2FXQ A;  2AWO A;  5GAG C;  3HOY G;  4JV5 Q;  3KF8 B;  4C3I H;  1AE3 A;  4DR1 Q;  2ES2 A;  3F2B A;  3HXV A;  4A3E H;  4RMF A;  3PUW A;  1SFO H;  1WCM H;  1EVL A;  4GN4 B;  5GAE C;  2VW9 A;  2DVE A;  4JBW A;  3UE1 A;  3G71 A;  1VQP A;  3V8K A;  4A3C G;  1E24 A;  3UDG A;  3AEV A;  5KNN A;  3I56 A;  4UP7 A;  4QQB X;  2UU9 Q;  3K7A H;  2I4M A;  4CS2 A;  1XNQ L;  1VQ9 A;  2GVA A;  2A1A A;  2RHQ A;  2R93 G;  1VQM A;  1HTT A;  2IHE A;  1I5F A;  2JEA I;  4HIM A;  4DV2 L;  1TWH H;  4PG3 A;  2QHS A;  3L4G B;  2ARU A;  1NBW A;  1Y1V G;  4BA2 I;  1IBL L;  4P73 C;  2JA5 H;  1C7Y A;  1NJ8 A;  4UPA A;  3A7R A;  5M3M H;  4A3I G;  3A5Z B;  4JG2 A;  1G51 A;  3JC6 6;  4RG1 A;  4OX9 Q;  1YIJ A;  4NCX A;  2K50 A;  2KCT A;  4LF7 Q;  4C3H H;  1GVP A;  4XU2 A;  4A3M G;  5K1P A;  3PF5 A;  3QO8 A;  4P3P A;  1Q12 A;  3G6E A;  4DV0 L;  1OTC A;  2DXT A;  4HWR A;  1XMQ L;  2QHT A;  4OWX B;  2K5V A;  1QE0 A;  1W2B A;  3FP9 A;  2ZJR A;  4LUV A;  3HFV A;  4P74 A;  4HIO A;  1X3F A;  5IYD G;  4A3K G;  2IY5 A;  5LMN W;  2KEN A;  1VQE A;  3MXN B;  4JI7 Q;  2BA0 A;  3KJO A;  2XGT A;  3PUZ A;  5IP7 G;  2J3L A;  2KBN A;  3TRE A;  4B3R L;  4PMW A;  3GTJ H;  2P5I A;  2N78 A;  2Q5H A;  4YRP A;  1Q7Y C;  3J7A 5;  2Y0S E;  1RIQ A;  2WFW A;  2QEX A;  3RF1 A;  1P16 A;  1TWC H;  4P71 C;  4IFD J;  4LVL A;  4R4I A;  2CWA A;  2JA7 G;  2DTH A;  2E2H H;  4DV3 L;  4JYA L;  1EWI A;  3AFP A;  1Y1W H;  4DR3 Q;  2MQH A;  3HOX G;  1B7Y B;  1N8R C;  3T1Y Q;  1HNX L;  4B3T L;  3W3S A;  4JI8 Q;  4O0A A;  2YV5 A;  4JCV E;  2MNA A;  4XIG S;  2UUB L;  2UUC Q;  3TS2 A;  1CSP A;  2D62 A;  1ASY A;  4OO1 G;  4YPF A;  11AS A;  2RHS B;  1W66 A;  2QHV A;  4HWS A;  3S14 H;  1YHQ A;  2Y0S G;  2HQL A;  4DKA C;  4YRF A;  4LF6 Q;  1V1Q A;  3CW2 C;  1K0R A;  2EL9 A;  2E5L Q;  2E41 A;  3PUY A;  1E7Z A;  2Z0S A;  4YRS A;  1X9N A;  1X6O A;  3A74 A;  1XPU A;  4YY3 Q;  4GNX B;  2VQE L;  4LF5 Q;  5IY0 A;  1SRU A;  3I4O A;  2IHF A;  4K0K Q;  2ZZF A;  3E9H A;  5E3I A;  1Z7N A;  3CPF A;  3CF5 A;  2JA6 G;  4LNQ A;  3CCM A;  3SGI A;  5AJ3 L;  4HA8 A;  4MZ9 A;  2Q2I A;  3PF4 A;  2JEB I;  4DV5 Q;  3AYH B;  1HC7 A;  3U58 A;  1YIT A;  1HNZ L;  3P8Y A;  4Q15 A;  4NXM L;  1X65 A;  4LF4 L;  1TWF H;  3JAM i;  2EIF A;  1IL2 A;  1KRS A;  3LGJ A;  5GAD C;  4P3N A;  3IKL A;  2V1C C;  2DU7 A;  2UUA Q;  4JI5 L;  4BY7 H;  3MF2 A;  1XMO L;  1FGU A;  3G1Z A;  4TVY A;  2IT1 A;  4LFA L;  4YRG A;  4MNO A;  4L5Q A;  1FJG Q;  4A93 H;  1PH7 A;  2E8G A;  3OTO Q;  3L4G A;  3ER0 A;  4DNI A;  4LNS A;  4MTN A;  3S2H H;  1L1O B;  2E5A A;  1A62 A;  4YCU A;  1N34 L;  2ID0 A;  1BBW A;  2ZR2 A;  3W1G A;  4H2V A;  3A5Z A;  4H2S A;  2DZC A;  4LFC L;  5BR8 L;  1KMM A;  3E9I A;  3FKI G;  5C44 H;  2PME A;  1JE5 A;  1SN8 A;  4Y7N H;  1YJN A;  4TQU S;  4A3L H;  3L0O A;  3HXU A;  4Y52 H;  4EX5 A;  3RZD H;  3QNE A;  4DR4 L;  4BXX H;  1H4T A;  1B76 A;  12AS A;  2ZM6 L;  1JT8 A;  2EAY A;  1EQQ A;  5J3B A;  4KHP Q;  4OON A;  1WPY A;  2I4N A;  5K1X A;  1C9O A;  2OTL A;  2ZT6 A;  2R92 G;  4P74 C;  1GKH A;  1IBK L;  5IWA L;  4YRR A;  3PIP A;  3K8A A;  2PMZ E;  3I55 A;  1Q1E A;  4X64 L;  4POG A;  1NJ1 A;  3HRI A;  4DV1 Q;  2I4O A;  4B3S Q;  5FJ8 G;  4YCW A;  3B6Y A;  4EQ5 A;  3BU2 A;  2CQO A;  3BJU A;  2HHH L;  2PI2 A;  2IY5 B;  1B7Y A;  2ART A;  1ASZ A;  2DUD A;  4A3J H;  1LYL A;  4NPS A;  4TVA B;  2ZTC A;  3PO3 H;  5H1S E;  3RLN A;  3VQY A;  2ZTE A;  3HOY H;  4EO4 A;  1VS0 A;  4J15 A;  3UGT A;  4X66 L;  4YRQ A;  4A4I A;  5JEA J;  3PV0 A;  2OCE A;  2RHS A;  2ZNI A;  3HOV G;  1N9W A;  2C7I A;  1J5E Q;  1VQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...