4YCUA

Crystal structure of cladosporin in complex with human lysyl-trna synthetase
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
505
structure length
505
Chain Sequence
b'DPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPHLHFGLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine--tRNA ligase
publication title Structural Basis for Specific Inhibition of tRNA Synthetase by an ATP Competitive Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/ ligase inhibitor
total genus 162
structure length 505
sequence length 505
chains with identical sequence B
ec nomenclature ec 6.1.1.6: Lysine--tRNA ligase.
pdb deposition date 2015-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00152 tRNA-synt_2 tRNA synthetases class II (D, K and N)
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ycuA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4ycuA02
3S1MH 2KCMA 5LMUQ 5C44G 3HKSA 1R9TH 4RQFA 2E8GA 2ZT8A 3T1HQ 3D0FA 1UE1A 5IYCH 1Q81C 4YRMA 2Z6KC 1N33L 3CAMA 4P71A 3S17H 2VNUD 4IOAA 3AEVA 4H02A 1A62A 4NPSA 2PMZE 3G71A 1G5IA 4H2UA 4NXNQ 1BVSA 2ZT5A 2PQAA 4HWTA 3J80i 5JEAJ 3FJPA 1X54A 1G6PA 4DUZQ 3A32A 1XPRA 4ZTUB 3E9IA 1HNZL 2HNIA 5IYCG 3EIVA 4CH4A 3FHWA 5IYBH 3MEYA 1NMFA 1SROA 3PO3H 3A5ZA 5C4XH 1FVIA 4CS2A 5C51B 3RLFA 1D7QA 3L2PA 3ERSX 3NELA 4DR1Q 4GKJL 2NN6G 4Q6GA 2IY5A 3HOVH 1VS0A 4HIDA 2K5VA 3HXZA 1HR0W 3J80c 3HY1A 5IYBG 1BBUA 3S1QH 3CF5A 1H4SA 4LF8L 4YRGA 3PO3G 5C52B 3OTOQ 1WU7A 3ER0A 2I4LA 4CH5A 3M7NA 2MFIA 5ELOA 3CCMA 3HOVG 3PUYA 4LUOA 4QJFA 3M4PA 3T1YQ 1WCMG 4JV5L 2Q2UA 5FLMG 2OTJA 3UGTA 4RQEA 4BA1I 2JA5H 4DK3C 1BKBA 4P73A 4PZ8A 1ADYA 1NJ2A 4LF4Q 2C35B 3A5UA 4BY7H 2Q5HA 3L7ZC 4YRCA 5BR8Q 2QHTA 3HXVA 1IZ6A 1VQJA 1G5HA 3K0XA 3A7RA 1HZBA 2ZNIA 1KMMA 4OONA 2F4VL 4DV4L 2ID0A 4OWTB 3KFUA 3PUWA 4GS3A 3UDIA 4B3ML 3KF6A 4BA2I 4AH6A 5IP7G 3HOUH 2EXDA 3DM3A 2I5MX 4XTUA 3WWVA 3SGIA 4XIGS 1VQMA 2FXQA 2E64A 1J5EL 4KLKA 1CUKA 3A74A 2I4OA 4A3MH 4JI4Q 3QNEA 4JI7Q 4CS3A 1A8VA 5EAYA 1UWVA 4GNXB 2MO1A 4JC0A 5J3BA 3TEHB 3GTGH 5DLQE 2E5AA 3S1NH 2EJ9A 4HWOA 1D8LA 4BY1G 4OP0A 3PUVA 2E5LQ 2R92H 4OLFA 3UFGA 2LSSA 4YHHL 4JI0Q 4HWRA 1RIPA 2N8NA 1LUZA 4DV2L 4H2XA 4APVA 1Q1BA 1T9HA 3RUXA 3HFZB 4DR3L 2ATWA 1KHIA 2QEXA 3RACA 4DUYL 4B3TL 4DV3L 2HIXA 2UXDL 2G4CA 1SMXA 1KRTA 1VQ6A 1YFTA 4B3SQ 2IX0A 1NY4A 3MF2A 3I56A 1N8RC 3S1RH 1SERA 3P8YA 1YITA 4P3PA 1HJPA 2ARSA 3PO2H 5JJIA 1YHAA 1NYQA 2B63H 1OXXK 3U4VA 3FKIH 3VDYA 1SE8A 2F3IA 2K75A 2CJBA 4JYAL 2EIFA 3CCRA 1YHQA 2OWOA 3H15A 4TWAA 1TWGH 2RHSB 3V7SA 4FDBA 1VQPA 1JJCB 2F52A 3PO2G 3L1AA 1KQSA 1KL9A 2UUCQ 1DGSA 1MIUA 2PI2E 1KXLA 3HOXH 4IJHA 3LSQA 2B63G 1L1OA 3FKIG 4DR2L 2JA8G 1L0WA 1YB3A 1M90C 2E1HA 3RNUA 1KAWA 4QL5A 3QO5A 1WQWA 3CCSA 3PCOB 5F5WA 1VQ5A 1SLJA 1I5FA 1OXUA 4TQUS 3V7CA 1N36L 2Z0SA 3TQYA 4JBMA 3HOXG 1X9NA 2DXTA 5C3EH 2MO0A 2WAQE 2ZNJA 4H2TA 1WOCA 2GVBA 4R1JA 2VL6A 2VUMG 1Q12A 5IT9c 2GN5A 3TREA 2R93G 3RIRA 3K7UC 2UUAL 4Q15A 2ZM6L 2ALYA 4LF5L 5H1SE 1YJNA 4LUVA 4L87A 2KBNA 2JA9A 1YVCA 1EQQA 1E7ZA 1G51A 3TEHA 3HOWG 4JI5L 3PF5A 4DV6L 1X3EA 1XTDA 2A19A 1VQOA 4ME3A 4A3CG 4P72A 3IRBA 3AFQA 3DSQA 2JE6I 4HJAA 4A3BH 3F2DA 4X62L 2E2IH 4LFAQ 4WF2A 2B3GA 3K80C 4LUZA 2ZIMA 4JOIA 2DU5A 2KENA 1X3FA 2AMCA 2YTYA 1XNRQ 4DV0L 3HFZA 3CCEA 2E3CA 3J81j 4XU1A 5FLXc 2QHSA 3CC2A 1YZ6A 3L4GA 2DUDA 4WJ4A 4LNQA 4YCUA 1WJJA 4LFCQ 4KHZA 2ASBA 2ARTA 4RMFA 3EFRA 1EUJA 3K8AA 5LMUL 2Q2TA 1U5KA 2JA6H 1C7YA 4YRPA 1NJ6A 3KF6B 2ZXFA 3CCJA 2CJ9A 1H4QA 4P72C 4B3RQ 1Q7YC 1Z7NA 3T1HL 4OO1I 3J81i 3W1GA 1IBKL 1I50H 2AKWB 3UE1A 1HZCA 4P75C 4YY3L 2ZR3A 2CQOA 3CW2C 4KR3A 4JBKA 4UP8A 3FP9A 3ICAA 2VW9A 2ZGWA 2EL9A 4BBRG 4IPDA 5M3FH 4HIMA 4DAMA 1IYJB 3S2DH 2ZTEA 2BA0A 2DJZA 5M5YH 5IE8A 4A3LH 2P0LA 2PMEA 5GAHC 1QZHA 4A3IG 4X65Q 1WQ7A 4PZ7A 4LFBQ 1JJCA 3HKZE 2VY3A 4X64Q 1XMOQ 4LF9Q 4DR7Q 2RHQB 2E65A 1N32Q 1NE3A 1B70B 1MJCA 1Z9FA 3J81c 4H2XB 2ZJRA 4DR5L 4IPCA 3OD1A 3I4NG 5M3FG 2VQEQ 1HNWL 5AJ3Q 1FJGQ 4IPGA 1HTTA 1VQ8A 3PUZA 2DVEA 2VZAA 4DV5L 3PGZA 4TQFA 3PCOA 2J3MA 1VQBA 1W66A 1OXVA 5K1XA 2DEQA 1IBLQ 1Y1WH 3RKWA 4P3OA 3F2CA 3S2HH 3H3VI 4O2DA 1CKOA 3RL6A 4POGA 1XNQQ 1LM0A 4ALPA 1OXTA 2QHVA 3H3VH 4XTCS 3U58A 3GTMH 4PZ6A 4AQYQ 3AQQA 4JBJA 4OX9Q 4NXMQ 4BW9A 2EJGA 1V43A 4KR2A 3KF8B 2R7FA 4J15A 5LMNL 1VQDA 3L2ZA 3PUXA 4A3JH 4LF4L 3I7FA 3NENA 2K50A 4BWAA 5BR8L 3HOZH 3R07A 5HGQA 1Z47A 2P5IA 4DV1L 3A7UA 1TWFH 2EJFA 2UXCQ 1HNXQ 5C0XJ 4X66Q 3NBHB 5IP9H 3QO8A 4IFDJ 5C4XG 3I55A 3GTPH 4BXXH 2C7IA 1VCIA 1L1OB 3HRIA 1E1TA 1UE5A 1KOGA 4HWPA 4JI7L 3RF1A 3IG2A 3QO7A 3CXCA 2ZT7A 2H5XA 3AYHB 4HIOA 4H2VA 4JI6Q 3QTCA 4YROA 4DV7L 1VQ9A 2JA7H 3OW2A 3ERRA 2E5LL 2ZZGA 2QA4A 2NVQH 4A75A 3JAMi 4BXXG 4JI0L 1VQCA 4R4IA 1YEZA 2NVTH 3HFVA 2LXKA 1BIBA 1PH5A 3BZKA 2OTLA 2AKWA 4YRKA 2JA5G 4JI8L 4TVAA 1NMGA 2R7ZH 2ALYB 4YP0A 4HWSA 4X5OA 4BY7G 2D0PA 4LF8Q 4A3DH 3KYHC 4K0KQ 3F1ZA 4TVWA 4ZIBA 1A63A 2MQHA 4LF6L 2EQSA 1JT8A 3MXNB 4B3SL 4ZTZB 4L5RC 4IPHA 1VQIA 1USYA 3ULLA 1B7YB 1B76A 4LF7Q 4CH3A 4XTYA 2DQ3A 3HOUG 3DLLA 1K0RA 3JAMc 2IHEA 1G291 1MKHA 2HIVA 3HY0A 1FL0A 4HJ9A 3W1BA 5LMNW 4K88A 3EFSA 2JEBI 3ULPA 3H0GH 4O0AA 1SR3A 2RHQA 2Q7EA 4A3MG 2PMFA 1X2HA 4C2MH 1B70A 2AMCB 4A3DG 4UP9A 2YYZA 3BJUA 3RLNA 4A3EH 1EIYB 4C3JH 1YI2A 1X3GA 2UXBQ 3L4GB 1CSQA 1HXDA 3LSSA 1GD7A 2R92G 3NETA 4TTVA 3ZJYC 4G85A 2DGYA 1XMQQ 4A3KH 2WP8J 3H0GG 2AHOB 1USYC 3CMEA 1XPUA 3W3SA 1Q82C 1ASYA 1Q1EA 1PH3A 2ZIOA 1W3SA 2ODRC 2ZTCA 4XTVA 1WFQA 3LC0A 1NYRA 4UPAA 4UP7A 1HZ9A 1C0AA 3CCVA 1EVLA 1VQFA 4DQ2A 4X6AH 2PNHA 4A3KG 3MEFA 3AFPA 2ODRD 4DV2Q 4WJ3M 1BBWA 3CCQA 5IWAL 4HJ7A 1CSPA 2DQ0A 3G4SA 4OWXB 4L5TA 2I5HA 1PVOA 1UEBA 1E3PA 4DKAC 4AIMA 1J5WA 2ZZFA 3CC4A 5GQOA 4YYEA 4A3FH 1PA6A 2DTHA 2DXUA 1PYSB 2E2JH 4JBWA 1VQEA 4DPGA 3J7ZC 1X56A 2A8VA 2UU9Q 3CP0A 3TUPA 4KI0A 2ZTDA 2NZOA 2AWOA 3I4MH 5IYDH 3CPWA 1VQNA 5C4JH 1PH8A 1JJGA 2GVAA 5E3IA 5JEAG 4P3NA 1Z7MA 3HXWA 4JI3Q 2CWPA 5C0XI 4A3FG 1PH6A 4QY7A 4A93H 3G1ZA 4AYBE 4IFDI 3KJPA 3VQWA 4DR6Q 4LFAL 3JC66 4GKKQ 1BIAA 2ZZEA 3BFMA 3KDFB 2VQFL 3RN5A 3S14H 1SESA 2PI2A 4YRQA 1S72A 1GVPA 3GTOH 3G48A 1X55A 1SETA 3HRKA 4XTWA 3VQYA 2UUBQ 3HOYH 5ELNA 5C3EG 4DR2Q 4POFA 4CH6A 3CC7A 1B7YA 2HHHQ 5GAEC 5FJ8H 4B3RL 2D62A 4P75A 1KC8C 2EAYA 2YTXA 3HXYA 1EYGA 1K8GA 3BZCA 3E0EA 3HOYG 2Q7GA 4TVYA 2Q2IA 3F2BA 1KMNA 3I2ZA 1ADJA 1IXRA 1EIYA 3GO5A 4DR4Q 2NZHA 2E41A 2CKZB 5M5XH 1GGMA 3UDFA 5K1PA 11ASA 5FJ8G 4A3BG 2MNAA 4X65L 1FGUA 4BBSH 4X64L 2WAQG 1XMOL 4GN3B 4DR7L 1PH7A 1NJ8A 3VQXA 3HXUA 4A3GH 4UY8C 4LF5Q 1CKNA 2ZJPA 1X2GA 2ZT6A 3GTJH 4RDXA 3HXXA 4KHPQ 5E7NA 4TVAB 2VQEL 1N34Q 3E9HA 1QF6A 2Q2HA 1Y1VH 5AJ3L 4YRSA 1FJGL 4IO9A 4JI2Q 1H4TA 2K4KA 3WQZA 4EX5A 4XU3A 4YCVA 4X62Q 1EIFA 4NXNL 2C8MA 5M3MH 1IBLL 1CKMA 2JQOA 2B29A 4NCXA 5C44H 4JI1Q 2HQLA 3M85A 4DUZL 2JA6G 3V8JA 1SFOH 4C3IH 1EVKA 4GOPC 4PHCA 1K8AC 4DAYB 2XGTA 3EN2A 1XNQL 2Y0SE 4DV0Q 3TS0A 4L5QA 1YNXA 3UGQA 2CJAA 1WI5A 2K14A 1SN8A 4AQYL 4OO1G 3P8VA 2DZ9A 1KIXA 3W5OA 1GO3E 4NXML 1NJ5A 4RG1A 1PYSA 1EQRA 1HZAA 1MJEA 3GTLH 4YCWA 4DR1L 4A3LG 1HR0Q 3RN2A 3UH0A 3TS2A 1VQZA 2L15A 3RGLA 1RL2A 1IBKQ 1UE6A 4QIWE 1VQAA 1JJ2A 4LNSA 4EO4A 4YY3Q 1AH9A 2UXCL 5GADC 1I94Q 1HNXL 2IHFA 3OYYA 4X66L 4IOCA 1K73C 3VBBA 4R4QA 4MZ9A 2ZR2A 3TEGA 2NN6I 1NJIC 4HJ8A 4Y7NH 1PH1A 1XPOA 1PYBA 3A0JA 3OTOL 3PZCA 2R7DA 1WPYA 2DKGA 3KDFA 3D31A 1IBMQ 3T1YL 5JJLA 2ZCEA 1WNLA 2Q5IA 2XTIA 5HY6A 3L0OA 1Y1WG 4JI6L 1GM5A 3CCLA 4GN4B 3EBEA 1J6QA 4PG3A 4GLAC 1YBYA 3STBC 1QVGA 4DR5Q 4DK6C 1S40A 2I5LX 1N33Q 3KJOA 3J7A5 1E22A 3V8KA 4YWLA 2Y0SG 3HKZG 1HNWQ 3G6EA 2ES2A 4LW1A 4K87A 12ASA 1WCMH 4DV5Q 4P71C 4QQBX 3STBD 5FLMH 3IKLA 1C9OA 3PF4A 4A3JG 5C53B 2VS1A 4JI4L 1KD1C 1HC7A 3M3YH 4K0KL 3HOZG 1EWIA 2YU9H 1HNZQ 3CQZH 3UDXA 1PH4A 2KHJA 3TRZA 4H2SA 3M4OH 3REXA 1NBWA 4HA8A 1TXYA 5IP9G 4LF7L 5IP7H 5LMNQ 2K52A 4A4IA 1V1QA 2WB1E 2A1AA 2AWNA 5JJKA 4YWKA 4OWWB 1H95A 1X65A 4GKJQ 5GAGC 2D0OA 1OTCA 2JJQA 1YFSA 4DV1Q 1LYLA 1QZGA 1VQ4A 2UXBL 4BY1H 1V9PA 2JA7G 1AE2A 1FYFA 2IX1A 1H4VB 1XMQL 4JCVE 3MF1A 4GLXA 2OQ0A 1VQGA 4JV5Q 4K86A 1S3OA 3REUA 4EQ5A 2DTOA 2R7ZG 3KLWA 4YWMA 3CMQA 4DV7Q 4P73C 3M4QA 3LGJA 4QGUA 1O7IA 4H2YA 3A31A 2CWAA 3RKXA 1HH2P 4G84A 1K83H 2RF4A 2F4VQ 4DV4Q 4GOPB 4B3MQ 1E24A 4XEOA 2ARUA 3U4ZA 4YRJA 3U50C 4XU0A 1TWHH 3A7AA 2YV5A 3PIPA 3PIOA 2DDZA 2ZINA 4JI8Q 1J5EQ 1X6OA 2YTVA 2WB1G 4H2WA 2UUCL 1TWCH 1CKNB 2I0QA 3S16H 4TQDA 1SRUA 4A3EG 1PH2A 3VQVA 4LF6Q 1IL2A 2UU9L 4R4CA 4WI1A 1QUQB 4R4TA 2E2HH 1E1OA 1RIQA 1X01A 4YRNA 4E51A 5M5WH 3V8LA 1XJVA 3CMAA 4YHHQ 2WFWA 4YRTA 1JMCA 1WYDA 4JI3L 2N78A 4KQEA 1YHBA 1W2BA 4HVCA 2N49A 2NVYH 2RCNA 4DR6L 4GKKL 4DR3Q 4XTXA 4XEMA 3M9BA 2JA8H 4DUYQ 4IJLA 4DV3Q 4B3TQ 4YRFA 3RKYA 3UDGA 2UXDQ 3CPFA 2CCZA 3BU2A 3IKMB 1A0IA 2BH2A 4HJ5A 4PMWA 1Q86C 2UUBL 2K5NA 1N9WA 2QHUA 4CS4A 2I4MA 2EWNA 2I4NA 4JG2A 3GTQH 2CIMA 1OXSC 1QVFA 2FYKA 2HHHL 2DU7A 2ZJQA 2VUMH 4LWCA 2V1CC 1VQHA 2R93H 2E10A 3RZDH 2PQAB 3B6YA 1VQLA 4R4OA 4XU2A 2K5HA 4JYAQ 3A5YA 3I4MG 4XTZA 5IYDG 3NEMA 5IWAQ 1XNRL 1ATIA 2CFMA 3ULJA 4OXPA 2BH8A 4DR4L 3HOWH 1YFRA 1YIJA 1L2FA 3CCUA 4A3CH 2DZCA 2N3SA 4YDQA 1QE0A 2Q7HA 3A5ZB 1U0LA 4A93G 2IT1A 1Q46A 2LXJA 4LFCL 3Q8DA 3KOJA 3RR5A 4A76A 1AE3A 4C3HH 1GKHA 5C0XG 1EFWA 1L1OC 3GDEA 2IY5B 3P8TA 4IFDG 1I3QH 4YRRA 4MNOA 4GNXA 1Q8KA 4YPFA 1LTLA 1I6HH 5KNNA 1PV4A 4KHPL 1JE5A 1N34L 5K36G 4JI2L 3V7RA 2HT1A 1K3RA 1N36Q 1QVCA 1M1KC 2KHIA 2KCTA 5GROA 1PFSA 3S15H 3PSIA 2J3LA 2VQFQ 4JI1L 4GOPA 1WLEA 1VQ7A 3F8TA 1UE7A 2R6GA 4GLVB 1Y14B 4AYBG 4HIKA 4LFBL 4MTNA 2UUAQ 1KRSA 3ICEA 4P74A 2ZM6Q 4LF9L 1B8AA 1YJ9A 1N32L 3GTKH 4YRIA 1JB7A 3RZOH 1EOVA 4BBRH 1PHJA 2CGHA 4JI5Q 4DNIA 4GNXC 1NNHA 3IALA 1P16A 4DV6Q 1VQKA 4L5SA 3I4OA 4NB3A 1QUQA 1NJ1A 1HR0L 2OCEA 3GD7A 2Z6KA 2JK8A 4A3IH 1NTGA 4BBSG 1YGBA 4YREA 1I94L 3CD6A 4A3GG 1P8LA 4Y52H 1PH9A 3K81C 2JEAI 2ZTGA 4JOIC 4YRLA 1SRYA 3HTZA 3RLOA 3S24A 3UE0A 2QGQA 2OQKA 3I4NH 1TWAH 1Y1VG 5IY0A 1K9MC 1YJWA 1IBML 4OX9L 4P74C 3K7AH 2BA1A 2RHSA 4GN5A 2DTIA 2NVXH 1ASZA 5M3MG 3PV0A
chains in the Genus database with same CATH superfamily
4K5WA 3S1MH 1Q8IA 2KCMA 4ILWA 1G91A 1ENCA 2LFNA 5LMUQ 4PMCA 5C44G 3HKSA 1R9TH 3WOEA 1TWHB 4C3IG 4RQFA 2E8GA 2ZT8A 3T1HQ 3R3OA 3D0FA 1UE1A 2EYPA 4JPBW 5IYCH 1Q81C 4YRMA 1B53A 3BYYB 1JOQA 2Z6KC 1N33L 4KJOA 1LV9A 1HPCA 1VF5C 3CAMA 1TWCB 3T56B 3AU7A 1MGSA 4P71A 3S17H 3S16B 1PFBA 2VNUD 3J81L 4L8JA 4IOAA 3AEVA 4H02A 1A62A 4NPSA 2PMZE 3G71A 1G5IA 1S5ED 4H2UA 2F0OA 4NXNQ 1BVSA 2ZT5A 2PQAA 4HWTA 3J80i 5JEAJ 1GHKA 3FJPA 2EY6A 1ICFB 1HCZA 1X54A 2E2HB 2E75C 1G6PA 4DUZQ 1Q90A 3A7LA 3A32A 1XPRA 4ZTUB 3BG3A 5M5WB 1PZID 3E9IA 2PPBC 1KLGD 1QG7A 1QJOA 4QUCA 5IYCG 1HNZL 2FMCA 3EIVA 2HNIA 3TDQA 4CH4A 2EYOA 1SE3A 3FHWA 5IYBH 1LT3D 5IIFA 2F0DA 2CQAA 3MEYA 2K01A 5DEHA 2J0TD 4HCEA 2NWGA 1NMFA 1SROA 2NVYB 1DJRD 1WTRA 1BR9A 2M2LA 3P20A 3PO3H 2B2UA 4K5VA 1EY5A 3A5ZA 5C4XH 1DYQA 1FNUA 1FVIA 4V190 4M1UB 2K04A 3TP8A 4CS2A 3X3NA 5C51B 1STYA 1TQOA 4R9WA 3ITPA 3K5LA 3RLFA 1D7QA 3M4YA 2A5HA 3DEOA 5COYA 5FKAC 3L2PA 1Y8OB 3ERSX 4KJNA 3NELA 4DR1Q 4GKJL 2NN6G 4Q6GA 2IY5A 1H9MA 4I7AA 3HOVH 1VS0A 1LT4D 4HIDA 3R93A 1DM0B 3FEWX 2K5VA 3HXZA 2K6AA 1AP0A 1HR0W 4RGNA 3J80c 2A8EA 4ZK9B 3D6WA 3GQBA 3HY1A 5IYBG 1BBUA 1JE4A 3S1QH 3MVVA 3TMEA 3CF5A 1H4SA 4LF8L 4YRGA 3PO3G 4IQZA 5C52B 3VR6A 1B3QA 1AZQA 2NTTA 3GTQB 4N9PA 4QUFA 3OTOQ 1WU7A 4ZCKA 3ER0A 4I7ZC 2I4LA 4OEMB 2TSSA 4CH5A 1LTSD 3M7NA 1D1IA 2MFIA 5ELOA 3CCMA 3HOVG 3PUYA 4LUOA 4QJFA 2VUMB 1DOKA 3C1EA 3M4PA 1Y8NB 3T1YQ 1WCMG 4JV5L 3GV3A 2Q2UA 1EZ6A 2R93B 3A8IE 3RZDB 5FLMG 2EJGC 2OTJA 3UGTA 4RQEA 3SXHA 2QDBA 4BA1I 3L3OC 4H44C 2JA5H 4DK3C 1BKBA 3KBGA 3VYSA 4P73A 4PZ8A 1ADYA 1NJ2A 2NB0A 4LF4Q 2C35B 2QW7A 3A5UA 2FHTA 4BY7H 2Q5HA 3L7ZC 4YRCA 5BR8Q 1TS5A 4FYDA 1TR5A 2QHTA 3HXVA 1IZ6A 2TMPA 1VQJA 1G5HA 2XWJB 3K0XA 4RGMA 1HZBA 3A7RA 2ZNIA 3LWEA 1KMMA 4OONA 2F4VL 4DV4L 2ID0A 4OWTB 1O7LA 5CV5A 3KFUA 3PUWA 2EJFC 4GS3A 3UDIA 4B3ML 3KF6A 4BA2I 4J8QA 4AH6A 5IP7G 3HOUH 1MI2A 4C3HB 2EXDA 3DM3A 2I5MX 3HRZC 4XTUA 3WWVA 3SGIA 4XIGS 1JOKA 1VQMA 1HA6A 2FINB 2B8GA 2FXQA 2E64A 2A6HD 2G9DA 4KLKA 4PQXA 1J5EL 1CUKA 1I3QB 2XRQD 3A74A 4FNFA 2I4OA 3K6OA 4A3MH 1QNKA 4JI4Q 2Z1CA 4TKOB 3QNEA 2V4DA 4JI7Q 2I46A 4CS3A 1A8VA 3NK9A 1I6HB 4K8IA 5EAYA 4AYBB 1GUTA 1UWVA 2MO1A 1YNNC 4JC0A 5J3BA 1JWMD 4GNXB 3CKIB 3TEHB 5A35A 2EOTA 3GTGH 5DLQE 1SE4A 2E5AA 1QWYA 1PXUA 4KK7A 4O1NA 5EKIA 3S1NH 4L63B 2F0SA 2EJ9A 4HWOA 4NDXA 1D8LA 2E76C 4ME5A 4BY1G 3D4WA 4OP0A 3PUVA 1WD1A 1CI3M 1GUOA 3Q24A 1H9JA 2E5LQ 1D1KA 5CC4A 2R92H 1MHWC 1FR3A 4C1NI 1CTMA 1YNND 4IUTA 4OLFA 2PO4A 3UFGA 1D5ZC 2LSSA 1A3UA 3S15B 4DK1A 4KN7C 4YHHL 1F2MA 5D3DA 2HCIA 2XRSD 4JI0Q 4HWRA 1RIPA 2N8NA 5FK9C 1LUZA 1TY0A 1UUPA 4DV2L 3JAML 1BCPF 4BBSB 4H2XA 4APVA 3BDOA 1Q1BA 1T9HA 3RUXA 1CA6A 3HFZB 1ICWA 4DR3L 3SVMA 2ATWA 1KHIA 2QEXA 3GTKB 3RACA 4DUYL 3A8JE 4B3TL 4DV3L 3RMHA 2HIXA 1KNEA 2UXDL 2G4CA 1SMXA 4BBRB 1KRTA 1EIHA 1VQ6A 2XWBB 1YFTA 1SYEA 1GJXA 5DNFA 4QMGA 4B3SQ 2MHVA 4G4KA 2IX0A 1NY4A 3MF2A 3I56A 3P75A 1N8RC 3KBXA 3S1RH 4A3IB 3EA6A 1SERA 2F1MA 2L5TA 4HSPA 3P8YA 1YITA 5E3FA 1D6EC 2SDFA 1U4PA 2B2YA 4P3PA 3UI2A 5C44B 1HJPA 2DNCA 4OIKA 2ARSA 1FNVA 3PO2H 3K0YA 5C5MA 5JVG3 4XDXA 2CHBD 4RFBA 5JJIA 1X32A 1YHAA 1NYQA 2B63H 5EPJA 5JJZA 1UAPA 1ILQA 1OXXK 1TWAB 4X3TA 4X3SA 3U4VA 1XX8A 3FKIH 3VDYA 1SE8A 4RA8A 2F3IA 5C5LA 2K75A 1JWUD 2CJBA 1KAAA 2OXPA 4JYAL 3K57A 3K7AB 2EIFA 3NP8A 4BWGB 2RDHA 3CCRA 1YHQA 2OWOA 1ZEQX 4H7BA 1SBBB 4E6IA 1TWGH 3H15A 2NVXB 2RHSB 4TWAA 3V7SA 4FDBA 1EWCA 5JEAH 3VYUA 1VQPA 1JJCB 3S1MB 4GZYC 2F52A 4FF1A 3MTSA 3PO2G 1R9TB 3L1AA 5G3LD 3DWPA 1KQSA 1KL9A 2L55A 1DGSA 2UUCQ 1MIUA 3KUPA 2PI2E 3MFYA 5E4XA 4G7HC 1KXLA 3HOXH 4IJHA 3LSQA 1HXYD 2B63G 4PMBA 1L1OA 3FKIG 2B2TA 3HEJA 3ND9A 4HSVA 3S17B 4LVMA 2B2YC 4DR2L 2F0HA 2JA8G 3MA2B 1L0WA 1YB3A 1M90C 2E1HA 3RNUA 5G3LF 3E0JA 2ENBA 1KAWA 1CA5A 2A68C 4QL5A 3QO5A 1WQWA 3CCSA 3PCOB 5KYIA 2QF7A 1SYDA 5F5WA 1VQ5A 1SLJA 1I5FA 1OXUA 3H91A 5L37A 4TQUS 1U4LA 3V7CA 4LVLA 1N36L 2Z0SA 3TQYA 4JBMA 2A68D 3HOXG 3BS1A 2SEBD 5I6WA 1X9NA 2DXTA 4DF7A 5C3EH 1EIGA 1LTTD 1ZYRC 1WD0A 2MO0A 2WAQE 3URYA 2ZNJA 3QR8A 4KKSA 4KY7A 1EU3A 1A3VA 4H2TA 2JP1A 1WOCA 2GVBA 3PO3B 4HEDA 5C4ZA 1VMPA 5C4XB 4R1JA 2VL6A 4RGOS 5EPKA 1JQYD 1Q12A 4B9WA 2VUMG 4NP5A 5IT9c 2GN5A 3TREA 2EDGA 1TKWB 2F0FA 1DOMA 2R93G 5CV4A 2HUGA 1ZYRD 3RIRA 1ONLA 3K7UC 2J4XA 2UUAL 1CM9A 3HOVB 4Q15A 1F9QA 2ZM6L 2Q8RE 2ALYA 1EQTA 1SDFA 4LF5L 1CQVA 5H1SE 4LUVA 1YJNA 4L87A 2KBNA 2JA9A 1YVCA 2PMZB 4WORA 5F2DA 1E7ZA 1EQQA 2K5QA 1G51A 5D65A 4DGZA 3TEHA 1A6XA 3HOWG 4JI5L 3S1QB 4EQNA 3PF5A 4DV6L 1X3EA 4N9TA 1RCVD 1XTDA 3MHBA 2A19A 1VQOA 1A2TA 4ME3A 1CZWA 4A3CG 4P72A 3IRBA 3AFQA 2PQEA 4K6LA 2YU9B 3DSQA 3CQZB 1B50A 1WTXA 5DAUA 2JE6I 4HJAA 4A3BH 3F2DA 5C6AA 1S4ZA 4X62L 1ML0D 1RODA 3SR1A 2E2IH 4LFAQ 4WF2A 2B3GA 3K80C 4LUZA 2R3ZA 2ZIMA 1AN8A 4JOIA 2RDFA 2DU5A 2KENA 1X3FA 2AMCA 4KTAA 2YTYA 5D14A 1XNRQ 1W6JA 2JA5B 5CYUA 2MGSA 3HP3A 4DV0L 3HFZA 3CCEA 2E3CA 3J81j 4XU1A 5FLXc 2QHSA 3CC2A 2FJ2A 1YZ6A 4BY7B 3L4GA 2DUDA 1F9SA 4LVJA 3QJYA 4WJ4A 3A8KE 1UNSA 4LNQA 2LY7A 1JC7A 1LACA 4YCUA 2SNSA 1WJJA 5CV9A 4LFCQ 4HT4A 4L6TB 4KHZA 1RKNA 2ASBA 3VYTA 2ARTA 2DJGC 4RMFA 3VYRA 1DONA 3EFRA 1EUJA 3K8AA 5LMUL 3T53B 4DAVA 2Q2TA 1U5KA 2JA6H 1C7YA 4YRPA 3HOUB 1NJ6A 4PNYA 3KF6B 2ZXFA 3CCJA 3IFDA 2CJ9A 4P72C 4B3RQ 1Q7YC 1Z7NA 1H4QA 3T1HL 4CDFC 4OO1I 3J81i 4CDEC 3PMFA 3W1GA 1IBKL 1ZXTA 1I50H 2AKWB 3O13A 3UE1A 1HZCA 4P75C 4YY3L 4KMUC 4A3MB 2Z4HA 4OO1H 2ZR3A 2CQOA 2MPMA 3CW2C 4KR3A 5E4WC 4JBKA 1DZ1A 2CW0C 4UP8A 3DHQA 3FP9A 3ICAA 3GTGB 3MWYW 2VW9A 2ZGWA 1OO9B 2QCPX 2EL9A 4BBRG 4IPDA 5M3FH 4HIMA 3S1NB 4DAMA 1IYJB 3AMUA 3S2DH 2FFKB 2ZTEA 2BA0A 4KD3A 2DJZA 3V05A 4HTHA 5M5YH 5IE8A 2NYZD 2R92B 4A3LH 2WACA 1WTHA 2P0LA 4OELB 2CW0D 2PMEA 5GAHC 1QZHA 4A3IG 2VB3X 3OW7A 4X65Q 5ELBA 1WQ7A 4PZ7A 4LFBQ 2Z9HA 1S5DD 3HKZE 5DM73 2EY1A 1JJCA 2VY3A 4X64Q 2WIIB 2PYKA 1XMOQ 4LF9Q 4DR7Q 2RHQB 3FPPA 2LMCB 1N32Q 2E65A 3NWSA 1NE3A 5FO9B 1B70B 3NBIA 1MJCA 1Z9FA 5IGBA 3J81c 2ZJRA 4H2XB 2K5WA 4DR5L 4DU9A 4IPCA 3OD1A 5JOBA 3I4NG 5M3FG 2VQEQ 4XYQA 4IUUA 2KUMA 4CJ2C 1HNWL 5AJ3Q 1FJGQ 5T1GA 4HAEA 4IPGA 1HTTA 1VQ8A 4CBVA 3PUZA 2DVEA 2VZAA 4DV5L 3PGZA 1II3A 3EFXD 4TQFA 2K32A 3PCOA 2J3MA 1VQBA 3CHBD 1W66A 3N6RA 2IL8A 1OXVA 5K1XA 4KN4C 3K58A 1IBLQ 2DEQA 1Y1WH 1BNZA 3RKWA 4EQOA 4P3OA 3I72A 5LHY1 2E2DC 2A69C 1ESFA 5KIXA 4JK1C 3ND8A 3F2CA 3S1RB 4LAAA 3GP7A 3S2HH 5NUCA 3DWQA 3H3VI 4O2DA 1CKOA 3RL6A 4ZRZA 4POGA 1XNQQ 1LM0A 5KGUA 4ALPA 1OXTA 2QHVA 3PO2B 2F0IA 2VXWA 3H3VH 4XTCS 4DN4M 2A69D 3U58A 3GTMH 1Q3LA 3BVZA 4PZ6A 4AQYQ 3AQQA 5I6YA 4JBJA 3Q6SA 4NXMQ 4OX9Q 2B63B 4KD4A 2EJGA 4BW9A 1IL8A 1V43A 4G57A 4KR2A 3MXUA 3KF8B 1I4GA 2R7FA 4J15A 4EGVA 1GXDC 1XYIA 5LMNL 1SYBA 1SE2A 1VQDA 3FKIB 3L2ZA 3PUXA 5CGKA 4Q5VA 2JA8B 4A3JH 1KNAA 1W6KA 3J7AF 5CORA 4LF4L 2NTSA 3R8BA 3I7FA 4OGQC 1TWGB 2OT2A 2K50A 3NENA 4BWAA 1TU2B 4MIUA 1B44D 1ENAA 5BN3A 5BR8L 3HOZH 3R07A 5HGQA 1F2LA 1Z47A 2R61A 4HCSA 2P5IA 4G7OC 4DV1L 1WTWA 3A7UA 1TWFH 2EJFA 2K03A 2Z8LA 1B1ZA 1HNXQ 2UXCQ 5C0XJ 3IAYA 4X66Q 1AZPA 3HOXB 3NBHB 3QWNA 3MAQA 3T51B 5IP9H 3QO8A 4IFDJ 5C4XG 3I55A 3OPOA 3GTPH 1HQRD 4BXXH 2C7IA 1VCIA 1L1OB 4OL7A 1HQMC 1G8ZD 4IUQA 3H3VC 3HRIA 1E1TA 1UE5A 1WTVA 4ZQ3A 1WVLA 2JN4A 5C4HA 2BOSA 1KOGA 5CBEE 4HWPA 1AW7A 4JI7L 4FXKC 3RF1A 3IG2A 3QO7A 4DAPA 3CXCA 2ZT7A 1HTLD 2H5XA 3AYHB 1KTKA 4HIOA 4H2VA 3HG9A 4EQPA 4JI6Q 4IUPA 3QTCA 1O7YA 4YROA 1LTGD 2P5ZX 4DV7L 1VQ9A 2JA7H 3OW2A 3ERRA 2E5LL 4V0BA 2ZZGA 2QA4A 2NVQH 3OOCA 4A75A 1F9PA 5C3EB 3HOWB 5IGGA 3JAMi 4BXXG 1NAPA 5K5PA 1TVXA 4JI0L 1VQCA 4R4IA 1YEZA 1KDAA 3K59A 2NVTH 3HFVA 1I4PA 2EYMA 2LXKA 1FD7D 2N88A 5C3XA 1BIBA 1U4MA 1PH5A 3BZKA 2OTLA 2PZWA 2AKWA 4ABNA 2JA5G 4YRKA 4JI8L 4TVAA 1NMGA 1EY9A 1BDOA 2R7ZH 2RCFA 1BOSA 2ALYB 4YP0A 1A15A 4HWSA 4X5OA 3DEPA 2BDOA 4BY7G 1SNQA 2D0PA 4LF8Q 1BCPC 5I2YA 1QCBD 4A3DH 4CKEA 3KYHC 4K0KQ 5CV7A 4DXGA 3F1ZA 4TVWA 4ZIBA 3A55A 1A63A 2MQHA 4LF6L 4RHSA 1HUNA 1DOLA 1K8OA 2EQSA 1JT8A 3MXNB 4B3SL 4ZTZB 4K8JA 4L5RC 4IPHA 1VQIA 1USYA 3ULLA 1B7YB 1B76A 1BCPD 4LF7Q 3BDCA 4A3BB 4CH3A 4OIJA 4XTYA 2DQ3A 4UDUC 3HOUG 3DLLA 4DAYA 2E2IB 1K0RA 3JAMc 2IHEA 1G291 1MKHA 2HIVA 3HY0A 1EU4A 1FL0A 4FF4A 1KLUD 2WAQB 1SNOA 4HJ9A 3W1BA 5LMNW 2WKCA 2RSNA 4K88A 3EFSA 5AFWA 2JEBI 3ULPA 3H0GH 4O0AA 5I9PA 1SR3A 1SNDA 2RHQA 2Q7EA 4A3MG 2PMFA 2Z6BA 5KNCA 1X2HA 4C2MH 1B70A 2AMCB 4A3DG 1U9RA 4UP9A 2YYZA 2QDLA 3BJUA 4B08A 3RLNA 4K14A 4A3EH 1EIYB 3A56A 4C3JH 2A6EC 1YI2A 3OIPA 1X3GA 3VR4A 1PRTC 2UXBQ 3L4GB 4FF3A 1CSQA 1HXDA 1LTBD 3R2IA 3LSSA 3RZOB 3U9OA 2NBFA 4PV1C 1NR4A 1GD7A 3NXWA 2R92G 2A74C 3NETA 2EYFA 2K5DA 4TTVA 2F0WA 3ZJYC 4G85A 3DUZA 1EYAA 2A6ED 2DGYA 4WRDA 1XMQQ 2JA6B 1F2YA 1PRTD 5CV6A 4A3KH 2WP8J 3ZYYX 3H0GG 2RVLA 4O42A 2AHOB 3EVQA 3I8ZA 1USYC 3CMEA 1XPUA 2X6LA 1EY8A 4NKLA 3W3SA 1Q82C 2O5IC 1ASYA 1Q1EA 3C3LA 1STAA 1PRTF 1PH3A 2ZIOA 1W3SA 2ODRC 2G5DA 3ERQA 2ZTCA 4XTVA 3C2PA 4IUNA 1WFQA 3KF8A 5IGDA 3LC0A 1NYRA 2EYJA 1A3TA 4UPAA 4UP7A 1HZ9A 3I4NB 5M3FB 1C0AA 3CCVA 3S2DB 3H09A 1X3PA 4IURA 2QILA 1EVLA 1VQFA 4ULLA 4DQ2A 4X6AH 2PNHA 3SE0A 5M5YB 1DXMA 2DY7A 4A3KG 3MEFA 3AFPA 3KK7A 2ODRD 3BVMA 3QOJA 4DV2Q 4WJ3M 2RQXA 1BBWA 4HR7B 3CCQA 5IWAL 2PZUA 3MXGA 4HJ7A 1CSPA 2DQ0A 3G4SA 4OWXB 1RTNA 3QIAA 3VA5A 2HCCA 4L5TA 1DD2A 2I5HA 1PVOA 1UEBA 3D6CA 1E3PA 4DKAC 1IYVA 4AIMA 2J7ZA 2HQEA 1J5WA 2ZZFA 3OWEB 1EFID 3CC4A 3MFGA 5GQOA 2AQ2B 3NBHA 4YYEA 4A3FH 1PA6A 2EYHA 1SNMA 2DTHA 4IUVA 2DXUA 1PYSB 2NUCA 2E2JH 4JBWA 1VQEA 4DPGA 1Z6HA 1TS2A 3V96A 3J7ZC 1EWHA 1X56A 2A8VA 3OMCA 3CP0A 2UU9Q 4C56C 3TUPA 4KI0A 2ZTDA 4NMZA 2ZT9C 3TP7A 2NZOA 2AWOA 3I4MH 5IYDH 4CKCA 3CPWA 1J8IA 3SEBA 3KLSA 1VQNA 1NCVA 5C4JH 1PH8A 1JJGA 2GVAA 5E3IA 2B2VC 1Y1WB 4MHEA 5JEAG 1WTOA 4P3NA 1Y8PB 4K2LA 4H0LC 1Z7MA 3S2HB 3HXWA 4JI3Q 1GUNA 2CWPA 5J22A 1NSNS 5C0XI 4A3FG 1PH6A 4QY7A 1PTOH 4A93H 3VA7A 2LS01 3G1ZA 1YNJC 4AYBE 2C9OA 4IFDI 1VMCA 3KJPA 3VQWA 4DR6Q 3GTMB 4LFAL 3HKZB 3JC66 4GKKQ 1BIAA 5JPNC 5C0XH 2B2WC 2ZZEA 3BFMA 3KDFB 3S9WA 2VQFL 3RN5A 3S14H 1SESA 5DM63 1IKLA 2C5CA 4IFDH 2PI2A 4F87A 2CH4A 4LVKA 2CH4W 4YRQA 3NPPA 1S72A 1E0BA 1YNJD 1GVPA 3P7JA 3GTOH 1CK1A 2E74C 2KJXA 1X55A 2JXMB 3G48A 3NE5B 2HDMA 4CKBA 1CHQD 4A3JB 1SETA 1SYCA 3HRKA 4XTWA 5A2QL 5E1FA 1RTOA 3VQYA 4ID6A 2IX3A 1XXGA 5K36H 2UUBQ 1FNWA 4ZKBB 3HOZB 3HOYH 2KHSA 3TP5A 3QOLA 5D3IB 1SAPA 1RHPA 1UEAB 1LTRD 1TWFB 5ELNA 3T13A 1CFMA 5C3EG 2EY2A 2F3WA 3L9AX 4DR2Q 3MXNA 4POFA 4CH6A 1EQVA 3CC7A 4ZYSA 1B7YA 2HHHQ 5GAEC 3W2DA 3GTPB 5FJ8H 4CGYB 4B3RL 2D62A 4DNRB 4U673 5I9OA 1PTOC 4K2KA 1SYGA 4RHRA 4P75A 4KY5A 1KC8C 1EY4A 2EAYA 2YTXA 1BCPB 3GV6A 4C1NK 2ZXPA 3HXYA 1EYGA 3KLRA 1K8GA 3BZCA 5I2XA 3E0EA 3EJIA 3HOYG 2Q7GA 1SNCA 4TVYA 2Q2IA 3F2BA 1KDBA 1KMNA 1PTOD 1EOTA 1PZJD 3I2ZA 1ADJA 1IXRA 3MQZA 1EIYA 1E2WA 3GO5A 4DR4Q 2ZXRA 3J7AV 2O2LD 2NZHA 2F0PA 1PFNA 2E41A 1I4QA 2JA7B 1AFPA 2CKZB 2F0MA 5M5XH 1GGMA 4IN3A 3UDFA 2NVQB 5K1PA 1FYCA 11ASA 5FJ8G 4A3BG 2MNAA 2CVRA 2KVMA 3OHXC 1H9SB 1PTOF 4X65L 1FGUA 4BBSH 4FP5D 3VR5A 4FO2A 4X64L 2HDLA 1M4VA 3NHHA 1D2BA 2WAQG 2NVTB 1XMOL 2D5DA 4GN3B 5A2QE 4DR7L 1PH7A 1NJ8A 3VQXA 1KDCA 3HXUA 4A3GH 4UY8C 4LF5Q 1CKNA 4RWSC 2ZJPA 1V1PA 1X2GA 1CZGA 2ZT6A 3D4DA 3GTJH 4RDXA 1PRTB 2R7ZB 3HXXA 4ZAIA 4KHPQ 5E7NA 1V1OA 4TVAB 1S5FD 2VQEL 3G6JB 2F03A 1N34Q 3E9HA 1QF6A 2Q2HA 1Y1VH 2F0KA 5AJ3L 4YRSA 1FJGL 4IO9A 2N55A 4JI2Q 4KHVA 2K4KA 4A3DB 1H4TA 3WQZA 4EX5A 3I91A 4S3SA 4XU3A 2DY8A 4YCVA 4MN3A 4RCOA 5IT9E 4X62Q 2EVBA 1EIFA 4NXNL 4FF2A 2C8MA 5M3MH 1BF4A 1CKMA 1IBLL 3N52A 3RD4A 2JQOA 2PW5A 3CU7A 1L0XB 2IJ0A 3PIP3 2B29A 3PIO3 4NCXA 1VDZA 5C44H 4JI1Q 4BS9A 2HQLA 3M85A 5EBCA 4DUZL 2JA6G 2L4NA 3V8JA 3TSSA 3CRLC 1SFOH 4C3IH 1EVKA 4GOPC 4PHCA 1K8AC 4DAYB 1ET6A 1QNUA 2XGTA 3EN2A 3U9SA 1XNQL 4DK0A 2Y0SE 4DV0Q 2H4OA 3H94A 3TS0A 4L5QA 1YNXA 1CHPD 3UGQA 2CJAA 1WI5A 1G2TA 3H0GB 2K14A 1SN8A 3E5SA 3NTHA 2G9HD 4AQYL 4OO1G 3P8VA 4C2MB 5HGTA 3SHLA 2DZ9A 1KIXA 4F8MA 3W5OA 1GO3E 4NXML 1NJ5A 4RG1A 2UXCL 1C48A 1F9RA 3NUCA 1PYSA 1EQRA 2BDNA 3SK5A 4A3EB 3F2UA 1HZAA 4XYOA 4C3JB 2MJ8A 1LTID 1MJEA 3SK8A 4K5XA 3GTLH 4YCWA 4XQNA 4UAIA 1F77A 3FMCA 4ZUJA 2EY5A 3NWTA 1V8QA 4DR1L 4QF4A 3J7YW 4A3LG 1HR0Q 1WTPA 3DXJC 3RN2A 3UH0A 1QOHA 1K28A 3A7AB 5CMDA 2F0GA 3TS2A 1VQZA 1SJED 2L15A 3RGLA 1RL2A 1BQQT 1IBKQ 1HRJA 1UE6A 4HN7A 4QIWE 1VQAA 4A3KB 5FLXE 1JJ2A 4LNSA 4EO4A 4I65A 1S5CD 4X3UA 4YY3Q 3K5NA 2K28A 4KY6A 1AH9A 3P1HA 5LL6X 5GADC 1WTQA 1I94Q 1HNXL 1ENFA 1BUVT 2IHFA 3OYYA 1EYDA 4X66L 4IOCA 1K73C 1STHA 3VBBA 4R4QA 2XNAC 4MZ9A 2ZR2A 4CHTB 3TEGA 3NQTA 5M9OA 2NN6I 1NJIC 4ODGA 4HJ8A 4Y7NH 3TZUA 1PH1A 1XPOA 1H9KA 1PZKD 2KEEA 5J1ZA 3K5OA 1PYBA 3A0JA 3OTOL 3PZCA 2R7DA 1WPYA 3Q0AA 5ELEA 2DKGA 3KDFA 5T1IA 3D31A 2NN6H 1IBMQ 1B2TA 2OEOA 1O80A 4HMJA 4ZLTF 3T1YL 1JR0D 3HS0C 2RBMA 5JJLA 5EJWA 2ZCEA 1WNLA 2Q5IA 2XN9C 1ET9A 2XTIA 2RDGA 5HY6A 3L0OA 2NZ1D 1Y1WG 2EJMA 4JI6L 1GM5A 2X69A 3CCLA 2KA7A 4RCNA 2EPBA 4GN4B 1ESRA 1GUWA 3EBEA 1J6QA 4PG3A 4OHJA 2F4IA 4CDCC 4GLAC 1YBYA 3STBC 1EY6A 4DR5Q 1QVGA 4DK6C 1S40A 1EL0A 3E3XA 2I5LX 1N33Q 3KJOA 3FPUB 1E22A 3OSOA 3J7A5 4YWLA 3V8KA 2Y0SG 3V2TA 3HKZG 1HNWQ 4Z9CB 3G6EA 3BZDB 2ES2A 4A3FB 4LW1A 4K87A 2E2JB 1LTAD 1RD9D 5FO8B 1F2ZA 1HUMA 12ASA 1WCMH 4DXFA 4DV5Q 4FVMA 4HMIA 4QQBX 4P71C 2WV6D 1EZ8A 3DM1A 3STBD 5FLMH 3IKLA 1G2SA 1C9OA 3PF4A 4F7XA 4N8FA 3LWUA 4A3JG 5C53B 1EEID 4LJZC 2VS1A 3I4MB 3R2TA 1PLFA 4JI4L 5TSSA 1KD1C 4RKLA 5C4JB 1HC7A 1Y69U 1SSOA 1IW7C 4IZ8A 3M3YH 2F0NA 4K0KL 1EWIA 3J81E 3HOZG 3J80L 2YU9H 1HNZQ 3CQZH 3UDXA 1PH4A 2KHJA 3TRZA 3Q22A 4H2SA 3M4OH 5EKLA 2HD3A 3REXA 1BXTA 2L9HA 4U68A 1NBWA 2K1BA 4HA8A 1TXYA 1PTOB 5IP9G 4LF7L 4A93B 3LNNA 1IW7D 3D8GA 5IP7H 1EYCA 5LMNQ 3NSWA 1H9SA 2B2UC 4CJ1B 1BO0A 2D9UA 2K52A 3A54A 4A4IA 2O5JC 1V1QA 2WB1E 2X6GA 1Z7TA 2A1AA 2AWNA 3S14B 5JJKA 4YWKA 1IHZA 3C1FA 4OWWB 1H95A 3WOFA 5IGEA 1X65A 1B3AA 1KABA 4GKJQ 3NTIA 2DJFC 5GAGC 2L11A 2D0OA 3GTOB 1OTCA 5KNDA 1D5XC 4X3KA 2F0VA 2JJQA 1YFSA 4XQJA 2ICEC 3HZXA 4DV1Q 1LYLA 4KKUA 1QZGA 2A6HC 1VQ4A 2PNRC 2UXBL 4LK1C 4BY1H 1STEA 3HOYB 4EVOA 1V9PA 3C46A 1IKMA 1S5BD 2JA7G 3IL8A 1PYWD 1HTPA 5ISRA 2B8FA 1C4QA 2IWHA 1AE2A 1T5XD 1FYFA 2IX1A 1CQFA 3X3MA 5KRUA 1XMQL 1H4VB 4JCVE 3MF1A 2SNMA 4GLXA 3SK6A 1TS4A 1I4HA 2AQ1B 2OQ0A 4XT1B 1VQGA 4JV5Q 2F0TA 3HGBA 1EY7A 1TS3A 1LT5D 4RGTA 1BBXC 1RDPD 4K86A 3NTKA 1S3OA 4DFAA 3REUA 4EQ5A 3J80E 2DTOA 3T16A 3DMUA 2R7ZG 3KLWA 4YWMA 3CMQA 4DV7Q 4P73C 2B39A 3M4QA 1SMYC 3LGJA 4QGUA 2K05A 2QKIC 1O7IA 2PCFB 5BN5A 4H2YA 3A31A 2CWAA 3MC0B 3FDTA 2L12A 1G6ZA 3RKXA 2EXZA 1HH2P 4G84A 1K83H 2RF4A 2F4VQ 5M5XB 4DV4Q 4XT3B 2KCNA 4GOPB 3M7GA 2Z4IA 3FRPB 3W3AA 4B3MQ 2JSOA 1SMYD 4RKBA 1E24A 2AUJD 3T4AC 1HHVA 4XEOA 2PZTA 2ARUA 3U4ZA 4YRJA 3U50C 4XU0A 1TWHH 3A7AA 1JICA 2YV5A 4XXEA 3PIPA 3PIOA 4QB4A 2DDZA 2ZINA 2WKDA 2OF1A 2PW7A 4JI8Q 1J5EQ 4XQQA 5JAVA 1X6OA 3QO2A 3I73A 2YTVA 2WB1G 4A3GB 5ELCA 4H2WA 2UUCL 1M8AA 1TWCH 1CKNB 2I0QA 1V1PB 3S16H 5EBDA 3QB3A 1PDQA 1SRUA 3G7LA 3GTJB 4TQDA 1I50B 3TP6A 5IODA 4A3EG 1PH2A 3VQVA 4LF6Q 1IL2A 3WDNA 1Y1VB 4C3JG 3VR3A 2UU9L 1TY2A 4Q0FA 4R4CA 3D4RA 3OMGA 1STNA 2RKSA 4WI1A 1QUQB 4R4TA 2A73B 2E2HH 1R4QB 1E1OA 1O78A 2B2VA 1RIQA 4RAUC 1X01A 1JORA 4YRNA 4E51A 5M5WH 3V8LA 5M3MB 4QCLA 1XJVA 3E6ZX 3CMAA 4YHHQ 2WFWA 1H9RA 2L1BA 4KKTA 4YRTA 1JMCA 5CBAE 1SYFA 1WYDA 4JI3L 1SFOB 1VF7A 2N78A 4C3IB 2F0UA 4YIJA 5J39A 2DN8A 4KQEA 3I90A 1YHBA 2F0LA 1W2BA 4HVCA 2N49A 2NVYH 4N8X1 2RCNA 2B2WA 1PMRA 3TZDA 3EROA 4DR6L 3MXPA 3AB9A 5BN4A 1EEFD 4DR3Q 4GKKL 4XTXA 2H1EA 4TRDA 4XEMA 3M9BA 2JA8H 4DUYQ 4IJLA 4DV3Q 4B3TQ 1LT6D 4YRFA 3RKYA 1K3BC 1SXTA 3H6MA 2RA4A 3LX0A 3UDGA 3EQLC 2XIWA 2UXDQ 3CPFA 3GTLB 1NR2A 2D2CC 3NQIA 2CCZA 5C3WA 3I3CA 3JAME 3BU2A 2KEDA 3IKMB 1A0IA 2BH2A 2NS6A 2MUYA 1SNPA 1MBYA 4HJ5A 5ELDA 4PMWA 1Q86C 5JPMC 2UUBL 1GUGA 2K5NA 1B9NA 1N9WA 1NNXA 4P2CB 2KQ3A 2QHUA 4CS4A 1LABA 2I4MA 2EWNA 2I4NA 2IW3A 4JG2A 1GUSA 2F0QA 1HA5A 2DNEA 5CV8A 3GTQH 2CIMA 1OXSC 3RUZA 1QILA 5EKKA 1QVFA 2FYKA 4NW2A 4JVZA 2HHHL 2FMMA 2MP1A 1MSGA 2ICIA 4Y7NB 2ZJQA 2VUMH 4LWCA 2DU7A 2V1CC 4ZUIA 1VQHA 2Q8IB 2R93H 2E10A 2Y0SB 3RZDH 1I4RA 2PQAB 3B6YA 1VQLA 4R4OA 4XU2A 2K5HA 4JYAQ 4J6HA 3A5YA 3I4MG 4XTZA 1FGBD 4JW0A 5IYDG 2BE5C 2BCOA 3NEMA 4M8AA 5KYLA 5IWAQ 3ONAB 2SOBA 1XNRL 1ATIA 1B9MA 2CFMA 4KV6A 4K6DA 3ULJA 4OXPA 1GHJA 1I6VC 2BH8A 3HOWH 4DR4L 4B9XA 1HFGA 1YFRA 1CT1D 1JB3A 1YIJA 1L2FA 1MD2D 4R8NA 3CCUA 2K33A 2EZVA 4A3CH 2DZCA 2N3SA 4YDQA 1QE0A 2BE5D 2Q7HA 2EE1A 2JYOA 1NUCA 2M9VA 3A5ZB 1DCZA 1U0LA 1X3QA 1D5MC 2IT1A 1Q46A 4A93G 2LXJA 4MTKA 4LFCL 1JOOA 3Q8DA 3KOJA 3RR5A 1XWEA 4A76A 4QIWB 1AE3A 3BYTB 4C3HH 1LLRD 1SJHD 1GKHA 5C0XG 3MZ5A 1EFWA 5EGTA 1ILPA 1L1OC 3GDEA 1QE6A 2B2TC 2IY5B 3P8TA 3IFTA 1WCMB 4ZKCB 4IFDG 1I3QH 5IT9L 5FO7B 1GOZA 4YRRA 2QEJC 4MNOA 1E2ZA 4GNXA 1Q8KA 4YPFA 1J9OA 1LTLA 2XSCA 1SEBD 1I6HH 5KNNA 1PV4A 4KHPL 1JE5A 2AQ3B 1N34L 4J1MA 4F88A 2Q8TA 1STBA 2RSOA 5K36G 3SK4A 1TT2A 4JI2L 3V7RA 2HT1A 1K3RA 1N36Q 3M3YB 3KLSX 1QVCA 3TBIB 1LO5D 5KNBA 2M00A 1M1KC 2KHIA 3M4OB 2KCTA 5LL6S 5I4DA 4C3HG 5GROA 2KOLA 1PFSA 3S15H 3PSIA 3BVGA 4LVIA 2J3LA 2VQFQ 4JI1L 1I4XA 4GOPA 1WLEA 1C8CA 1VQ7A 3F8TA 3K5MA 1UE7A 2I07B 1STGA 1RF2D 3OWFA 5IGCA 2KCCA 2R6GA 4LMQD 4GLVB 1Y14B 2LKVA 3CRKC 4AYBG 4HIKA 4LFBL 5EQ0A 4MTNA 2UUAQ 3SDZA 1KRSA 3ICEA 4P74A 5IGFA 1R4PB 3TN2A 2ZM6Q 4FXGC 4LF9L 1B8AA 3DWAA 1YJ9A 4UHVA 1N32L 1AEXA 3GTKH 1HFNA 2F0JA 2KECA 1XTCD 4WFN3 3I4LA 4YRIA 4CJ0B 1JB7A 2GA4B 3RZOH 5IOCA 3IKJA 1EOVA 4H13C 5FLXL 3BDLA 4G7ZC 4RH6A 4FXDA 1O7ZA 2L0CA 4BBRH 1PHJA 2CGHA 4JI5Q 5JVH3 4DNIA 4GNXC 3FVQA 3I70A 1NNHA 3IALA 1P16A 4DV6Q 4BY1B 5FOBB 1VQKA 4L5SA 2O4XA 3I4OA 2VB2X 4IALA 4DA2A 4NB3A 4R8IA 1QUQA 1NJ1A 5KEEA 1HR0L 2OCEA 4WJWA 3GD7A 2WINB 2Z6KA 2JK8A 1K0SA 4A3IH 1NTGA 1K8MA 5ELFA 4BBSG 1E2VA 1YGBA 1U4RA 2F0EA 4YREA 1I94L 1TIID 2ZXOA 1L0YB 4DNTB 3MEHA 5CR3A 3CD6A 1IYUA 4A3GG 1P8LA 4Y52H 1ZKOA 1PH9A 3K81C 2JEAI 2ZTGA 4JOIC 1RJTA 4YRLA 1SRYA 2F3VA 1A2UA 3HTZA 1PFMA 3RLOA 3S24A 3UE0A 2QGQA 2OQKA 1MSHA 2WB1B 3I4NH 1QB5D 1B4OA 1TWAH 2EYLA 1Y1VG 5IY0A 1K9MC 3PQIA 3Q23A 1JCKB 2IPKD 3VR2A 1YJWA 1IBML 2K7VA 3OIQA 4OX9L 4P74C 5HURA 3K7AH 2BA1A 4CDDC 3D3RA 2RHSA 4GN5A 2DTIA 1T5EA 3QG1A 2NVXH 1ASZA 1JWSD 1K83B 2XVSA 5M3MG 4TSSA 1EY0A 5EPLA 3PV0A 2AUKA
chains in the Genus database with same CATH topology
3S1MH 2KCMA 5LMUQ 5C44G 3HKSA 1R9TH 4RQFA 2E8GA 2ZT8A 3T1HQ 3D0FA 1UE1A 5IYCH 1Q81C 4YRMA 2Z6KC 1N33L 3CAMA 4P71A 3S17H 2VNUD 4IOAA 3AEVA 4H02A 1A62A 4NPSA 2PMZE 3G71A 1G5IA 4H2UA 4NXNQ 1BVSA 2ZT5A 2PQAA 4HWTA 3J80i 5JEAJ 3FJPA 1X54A 1G6PA 4DUZQ 3A32A 1XPRA 4ZTUB 3E9IA 1HNZL 2HNIA 5IYCG 3EIVA 4CH4A 3FHWA 5IYBH 3MEYA 1NMFA 1SROA 3PO3H 3A5ZA 5C4XH 1FVIA 4CS2A 5C51B 3RLFA 1D7QA 3L2PA 3ERSX 3NELA 4DR1Q 4GKJL 2NN6G 4Q6GA 2IY5A 3HOVH 1VS0A 4HIDA 2K5VA 3HXZA 1HR0W 3J80c 2A8EA 3HY1A 5IYBG 1BBUA 3S1QH 3CF5A 1H4SA 4LF8L 4YRGA 3PO3G 5C52B 3OTOQ 1WU7A 3ER0A 2I4LA 4CH5A 3M7NA 2MFIA 5ELOA 3CCMA 3HOVG 3PUYA 4LUOA 4QJFA 3M4PA 3T1YQ 1WCMG 4JV5L 2Q2UA 5FLMG 2OTJA 3UGTA 4RQEA 4BA1I 2JA5H 4DK3C 1BKBA 4P73A 4PZ8A 1ADYA 1NJ2A 4LF4Q 2C35B 3A5UA 4BY7H 2Q5HA 3L7ZC 4YRCA 5BR8Q 2QHTA 3HXVA 1IZ6A 1VQJA 1G5HA 3K0XA 3A7RA 1HZBA 2ZNIA 1KMMA 4OONA 2F4VL 4DV4L 2ID0A 4OWTB 3KFUA 3PUWA 4GS3A 3UDIA 4B3ML 3KF6A 4BA2I 4AH6A 5IP7G 3HOUH 2EXDA 3DM3A 2I5MX 4XTUA 3WWVA 3SGIA 4XIGS 1VQMA 2FXQA 2E64A 1J5EL 4KLKA 1CUKA 3A74A 2I4OA 4A3MH 4JI4Q 3QNEA 4JI7Q 4CS3A 1A8VA 5EAYA 1UWVA 4GNXB 2MO1A 4JC0A 5J3BA 3TEHB 3GTGH 5DLQE 2E5AA 3S1NH 2EJ9A 4HWOA 1D8LA 4BY1G 4OP0A 3PUVA 2E5LQ 2R92H 4OLFA 3UFGA 2LSSA 4YHHL 4JI0Q 4HWRA 1RIPA 2N8NA 1LUZA 4DV2L 4H2XA 4APVA 1Q1BA 1T9HA 3RUXA 3HFZB 4DR3L 2ATWA 1KHIA 2QEXA 3RACA 4DUYL 4B3TL 4DV3L 2HIXA 2UXDL 2G4CA 1SMXA 1KRTA 1VQ6A 1YFTA 4B3SQ 2IX0A 1NY4A 3MF2A 3I56A 1N8RC 3S1RH 1SERA 3P8YA 1YITA 4P3PA 1HJPA 2ARSA 3PO2H 5JJIA 1YHAA 1NYQA 2B63H 1OXXK 3U4VA 3FKIH 3VDYA 1SE8A 2F3IA 2K75A 2CJBA 4JYAL 2EIFA 3CCRA 1YHQA 2OWOA 3H15A 4TWAA 1TWGH 2RHSB 3V7SA 4FDBA 1VQPA 1JJCB 2F52A 3PO2G 3L1AA 1KQSA 1KL9A 2UUCQ 1DGSA 1MIUA 2PI2E 1KXLA 3HOXH 4IJHA 3LSQA 2B63G 1L1OA 3FKIG 4LVMA 4DR2L 2JA8G 1L0WA 1YB3A 1M90C 2E1HA 3RNUA 1KAWA 4QL5A 3QO5A 1WQWA 3CCSA 3PCOB 5F5WA 1VQ5A 1SLJA 1I5FA 1OXUA 4TQUS 3V7CA 4LVLA 1N36L 2Z0SA 3TQYA 4JBMA 3HOXG 1X9NA 2DXTA 5C3EH 2MO0A 2WAQE 2ZNJA 4H2TA 1WOCA 2GVBA 4R1JA 2VL6A 2VUMG 1Q12A 5IT9c 2GN5A 3TREA 2R93G 3RIRA 3K7UC 2UUAL 4Q15A 2ZM6L 2ALYA 4LF5L 5H1SE 1YJNA 4LUVA 4L87A 2KBNA 2JA9A 1YVCA 1EQQA 1E7ZA 1G51A 3TEHA 3HOWG 4JI5L 3PF5A 4DV6L 1X3EA 1XTDA 2A19A 1VQOA 4ME3A 4A3CG 4P72A 3IRBA 3AFQA 3DSQA 2JE6I 4HJAA 4A3BH 3F2DA 4X62L 2E2IH 4LFAQ 4WF2A 2B3GA 3K80C 4LUZA 2ZIMA 4JOIA 2DU5A 2KENA 1X3FA 2AMCA 2YTYA 1XNRQ 4DV0L 3HFZA 3CCEA 2E3CA 3J81j 4XU1A 5FLXc 2QHSA 3CC2A 1YZ6A 3L4GA 2DUDA 4LVJA 4WJ4A 4LNQA 4YCUA 1WJJA 4HT4A 4LFCQ 4KHZA 2ASBA 2ARTA 4RMFA 3EFRA 1EUJA 3K8AA 5LMUL 2Q2TA 1U5KA 2JA6H 1C7YA 4YRPA 1NJ6A 3KF6B 2ZXFA 3CCJA 2CJ9A 1H4QA 4P72C 4B3RQ 1Q7YC 1Z7NA 3T1HL 4OO1I 3J81i 3W1GA 1IBKL 1I50H 2AKWB 3UE1A 1HZCA 4P75C 4YY3L 2ZR3A 2CQOA 3CW2C 4KR3A 4JBKA 4UP8A 3FP9A 3ICAA 2VW9A 2ZGWA 2EL9A 4BBRG 4IPDA 5M3FH 4HIMA 4DAMA 1IYJB 3S2DH 2ZTEA 2BA0A 2DJZA 5M5YH 5IE8A 4A3LH 2P0LA 2PMEA 5GAHC 1QZHA 4A3IG 4X65Q 1WQ7A 4PZ7A 4LFBQ 1JJCA 3HKZE 2VY3A 4X64Q 1XMOQ 4LF9Q 4DR7Q 2RHQB 2E65A 1N32Q 1NE3A 1B70B 1MJCA 1Z9FA 3J81c 4H2XB 2ZJRA 4DR5L 4IPCA 3OD1A 3I4NG 5M3FG 2VQEQ 1HNWL 5AJ3Q 1FJGQ 4IPGA 1HTTA 1VQ8A 3PUZA 2DVEA 2VZAA 4DV5L 3PGZA 4TQFA 3PCOA 2J3MA 1VQBA 1W66A 1OXVA 5K1XA 2DEQA 1IBLQ 1Y1WH 3RKWA 4P3OA 3F2CA 3S2HH 3H3VI 4O2DA 1CKOA 3RL6A 4POGA 1XNQQ 1LM0A 4ALPA 1OXTA 2QHVA 3H3VH 4XTCS 3U58A 3GTMH 4PZ6A 4AQYQ 3AQQA 4JBJA 4OX9Q 4NXMQ 4BW9A 2EJGA 1V43A 4KR2A 3KF8B 2R7FA 4J15A 5LMNL 1VQDA 3L2ZA 3PUXA 4A3JH 4LF4L 3I7FA 3NENA 2K50A 4BWAA 5BR8L 3HOZH 3R07A 5HGQA 1Z47A 2P5IA 4DV1L 3A7UA 1TWFH 2EJFA 2UXCQ 1HNXQ 5C0XJ 4X66Q 3NBHB 5IP9H 3QO8A 4IFDJ 5C4XG 3I55A 3GTPH 4BXXH 2C7IA 1VCIA 1L1OB 3HRIA 1E1TA 1UE5A 1KOGA 4HWPA 4JI7L 3RF1A 3IG2A 3QO7A 3CXCA 2ZT7A 2H5XA 3AYHB 4HIOA 4H2VA 4JI6Q 3QTCA 4YROA 4DV7L 1VQ9A 2JA7H 3OW2A 3ERRA 2E5LL 2ZZGA 2QA4A 2NVQH 4A75A 3JAMi 4BXXG 4JI0L 1VQCA 4R4IA 1YEZA 2NVTH 3HFVA 2LXKA 1BIBA 1PH5A 3BZKA 2OTLA 2AKWA 4YRKA 2JA5G 4JI8L 4TVAA 1NMGA 2R7ZH 2ALYB 4YP0A 4HWSA 4X5OA 4BY7G 2D0PA 4LF8Q 4A3DH 3KYHC 4K0KQ 3F1ZA 4TVWA 4ZIBA 1A63A 2MQHA 4LF6L 2EQSA 1JT8A 3MXNB 4B3SL 4ZTZB 4L5RC 4IPHA 1VQIA 1USYA 3ULLA 1B7YB 1B76A 4LF7Q 4CH3A 4XTYA 2DQ3A 3HOUG 3DLLA 1K0RA 3JAMc 2IHEA 1G291 1MKHA 2HIVA 3HY0A 1FL0A 4HJ9A 3W1BA 5LMNW 4K88A 3EFSA 2JEBI 3ULPA 3H0GH 4O0AA 1SR3A 2RHQA 2Q7EA 4A3MG 2PMFA 1X2HA 4C2MH 1B70A 2AMCB 4A3DG 4UP9A 2YYZA 3BJUA 3RLNA 4A3EH 1EIYB 4C3JH 1YI2A 1X3GA 2UXBQ 3L4GB 1CSQA 1HXDA 3LSSA 1GD7A 2R92G 3NETA 4TTVA 3ZJYC 4G85A 2DGYA 1XMQQ 4A3KH 2WP8J 3H0GG 2AHOB 1USYC 3CMEA 1XPUA 3W3SA 1Q82C 1ASYA 1Q1EA 1PH3A 2ZIOA 1W3SA 2ODRC 2ZTCA 4XTVA 1WFQA 3LC0A 1NYRA 4UPAA 4UP7A 1HZ9A 1C0AA 3CCVA 1EVLA 1VQFA 4DQ2A 4X6AH 2PNHA 4A3KG 3MEFA 3AFPA 2ODRD 4DV2Q 4WJ3M 1BBWA 3CCQA 5IWAL 4HJ7A 1CSPA 2DQ0A 3G4SA 4OWXB 4L5TA 2I5HA 1PVOA 1UEBA 1E3PA 4DKAC 4AIMA 1J5WA 2ZZFA 3CC4A 5GQOA 4YYEA 4A3FH 1PA6A 2DTHA 2DXUA 1PYSB 2E2JH 4JBWA 1VQEA 4DPGA 3J7ZC 1X56A 2A8VA 2UU9Q 3CP0A 3TUPA 4KI0A 2ZTDA 2NZOA 2AWOA 3I4MH 5IYDH 3CPWA 1VQNA 5C4JH 1PH8A 1JJGA 2GVAA 5E3IA 5JEAG 4P3NA 1Z7MA 3HXWA 4JI3Q 2CWPA 5C0XI 4A3FG 1PH6A 4QY7A 4A93H 3G1ZA 4AYBE 4IFDI 3KJPA 3VQWA 4DR6Q 4LFAL 3JC66 4GKKQ 1BIAA 2ZZEA 3BFMA 3KDFB 2VQFL 3RN5A 3S14H 1SESA 2PI2A 4LVKA 4YRQA 1S72A 1GVPA 3GTOH 3G48A 1X55A 1SETA 3HRKA 4XTWA 3VQYA 2UUBQ 3HOYH 5ELNA 5C3EG 4DR2Q 4POFA 4CH6A 3CC7A 1B7YA 2HHHQ 5GAEC 5FJ8H 4B3RL 2D62A 4P75A 1KC8C 2EAYA 2YTXA 3HXYA 1EYGA 1K8GA 3BZCA 3E0EA 3HOYG 2Q7GA 4TVYA 2Q2IA 3F2BA 1KMNA 3I2ZA 1ADJA 1IXRA 3MQZA 1EIYA 3GO5A 4DR4Q 2NZHA 2E41A 2CKZB 5M5XH 1GGMA 3UDFA 5K1PA 11ASA 5FJ8G 4A3BG 2MNAA 4X65L 1FGUA 4BBSH 4X64L 2WAQG 1XMOL 4GN3B 4DR7L 1PH7A 1NJ8A 3VQXA 3HXUA 4A3GH 4UY8C 4LF5Q 1CKNA 2ZJPA 1X2GA 2ZT6A 3GTJH 4RDXA 3HXXA 4KHPQ 5E7NA 4TVAB 2VQEL 1N34Q 3E9HA 1QF6A 2Q2HA 1Y1VH 5AJ3L 4YRSA 1FJGL 4IO9A 4JI2Q 1H4TA 2K4KA 3WQZA 4EX5A 4XU3A 4YCVA 4X62Q 1EIFA 4NXNL 2C8MA 5M3MH 1IBLL 1CKMA 2JQOA 2B29A 4NCXA 5C44H 4JI1Q 2HQLA 3M85A 4DUZL 2JA6G 3V8JA 1SFOH 4C3IH 1EVKA 4GOPC 4PHCA 1K8AC 4DAYB 2XGTA 3EN2A 1XNQL 2Y0SE 4DV0Q 3TS0A 4L5QA 1YNXA 3UGQA 2CJAA 1WI5A 2K14A 1SN8A 4AQYL 4OO1G 3P8VA 2DZ9A 1KIXA 3W5OA 1GO3E 4NXML 1NJ5A 4RG1A 1PYSA 1EQRA 1HZAA 1MJEA 3GTLH 4YCWA 4DR1L 4A3LG 1HR0Q 3RN2A 3UH0A 3TS2A 1VQZA 2L15A 3RGLA 1RL2A 1IBKQ 1UE6A 4QIWE 1VQAA 1JJ2A 4LNSA 4EO4A 4YY3Q 1AH9A 2UXCL 5GADC 1I94Q 1HNXL 2IHFA 3OYYA 4X66L 4IOCA 1K73C 3VBBA 4R4QA 4MZ9A 2ZR2A 3TEGA 2NN6I 1NJIC 4HJ8A 4Y7NH 1PH1A 1XPOA 1PYBA 3A0JA 3OTOL 3PZCA 2R7DA 1WPYA 2DKGA 3KDFA 3D31A 1IBMQ 3T1YL 5JJLA 2ZCEA 1WNLA 2Q5IA 2XTIA 5HY6A 3L0OA 1Y1WG 4JI6L 1GM5A 3CCLA 4GN4B 3EBEA 1J6QA 4PG3A 4GLAC 1YBYA 3STBC 1QVGA 4DR5Q 4DK6C 1S40A 2I5LX 1N33Q 3KJOA 3J7A5 1E22A 3V8KA 4YWLA 2Y0SG 3HKZG 1HNWQ 3G6EA 2ES2A 4LW1A 4K87A 12ASA 1WCMH 4DV5Q 4P71C 4QQBX 3STBD 5FLMH 3IKLA 1C9OA 3PF4A 4A3JG 5C53B 2VS1A 4JI4L 1KD1C 1HC7A 3M3YH 4K0KL 3HOZG 1EWIA 2YU9H 1HNZQ 3CQZH 3UDXA 1PH4A 2KHJA 3TRZA 4H2SA 3M4OH 3REXA 1NBWA 4HA8A 1TXYA 5IP9G 4LF7L 5IP7H 5LMNQ 2K52A 4A4IA 1V1QA 2WB1E 2A1AA 2AWNA 5JJKA 4YWKA 4OWWB 1H95A 1X65A 4GKJQ 5GAGC 2D0OA 1OTCA 2JJQA 1YFSA 4DV1Q 1LYLA 1QZGA 1VQ4A 2UXBL 4BY1H 1V9PA 2JA7G 1AE2A 1FYFA 2IX1A 1H4VB 1XMQL 4JCVE 3MF1A 4GLXA 2OQ0A 1VQGA 4JV5Q 4K86A 1S3OA 3REUA 4EQ5A 2DTOA 2R7ZG 3KLWA 4YWMA 3CMQA 4DV7Q 4P73C 3M4QA 3LGJA 4QGUA 1O7IA 4H2YA 3A31A 2CWAA 3RKXA 1HH2P 4G84A 1K83H 2RF4A 2F4VQ 4DV4Q 4GOPB 4B3MQ 1E24A 4XEOA 2ARUA 3U4ZA 4YRJA 3U50C 4XU0A 1TWHH 3A7AA 2YV5A 3PIPA 3PIOA 2DDZA 2ZINA 4JI8Q 1J5EQ 1X6OA 2YTVA 2WB1G 4H2WA 2UUCL 1TWCH 1CKNB 2I0QA 3S16H 4TQDA 1SRUA 4A3EG 1PH2A 3VQVA 4LF6Q 1IL2A 2UU9L 4R4CA 4WI1A 1QUQB 4R4TA 2E2HH 1E1OA 1RIQA 1X01A 4YRNA 4E51A 5M5WH 3V8LA 1XJVA 3CMAA 4YHHQ 2WFWA 4YRTA 1JMCA 1WYDA 4JI3L 2N78A 4KQEA 1YHBA 1W2BA 4HVCA 2N49A 2NVYH 2RCNA 4DR6L 4GKKL 4DR3Q 4XTXA 4XEMA 3M9BA 2JA8H 4DUYQ 4IJLA 4DV3Q 4B3TQ 4YRFA 3RKYA 3UDGA 2UXDQ 3CPFA 2CCZA 3BU2A 3IKMB 1A0IA 2BH2A 2NS6A 4HJ5A 4PMWA 1Q86C 2UUBL 2K5NA 1N9WA 2QHUA 4CS4A 2I4MA 2EWNA 2I4NA 4JG2A 3GTQH 2CIMA 1OXSC 1QVFA 2FYKA 2HHHL 2DU7A 2ZJQA 2VUMH 4LWCA 2V1CC 1VQHA 2R93H 2E10A 3RZDH 2PQAB 3B6YA 1VQLA 4R4OA 4XU2A 2K5HA 4JYAQ 3A5YA 3I4MG 4XTZA 5IYDG 3NEMA 5IWAQ 1XNRL 1ATIA 2CFMA 3ULJA 4OXPA 2BH8A 4DR4L 3HOWH 1YFRA 1YIJA 1L2FA 3CCUA 4A3CH 2DZCA 2N3SA 4YDQA 1QE0A 2Q7HA 3A5ZB 1U0LA 4A93G 2IT1A 1Q46A 2LXJA 4LFCL 3Q8DA 3KOJA 3RR5A 4A76A 1AE3A 4C3HH 1GKHA 5C0XG 1EFWA 1L1OC 3GDEA 2IY5B 3P8TA 4IFDG 1I3QH 4YRRA 4MNOA 4GNXA 1Q8KA 4YPFA 1LTLA 1I6HH 5KNNA 1PV4A 4KHPL 1JE5A 1N34L 5K36G 4JI2L 3V7RA 2HT1A 1K3RA 1N36Q 1QVCA 1M1KC 2KHIA 2KCTA 5GROA 1PFSA 3S15H 3PSIA 4LVIA 2J3LA 2VQFQ 4JI1L 4GOPA 1WLEA 1VQ7A 3F8TA 1UE7A 2R6GA 4GLVB 1Y14B 4AYBG 4HIKA 4LFBL 4MTNA 2UUAQ 1KRSA 3ICEA 4P74A 2ZM6Q 4LF9L 1B8AA 1YJ9A 1N32L 3GTKH 4YRIA 1JB7A 3RZOH 1EOVA 4BBRH 1PHJA 2CGHA 4JI5Q 4DNIA 4GNXC 1NNHA 3IALA 1P16A 4DV6Q 1VQKA 4L5SA 3I4OA 4NB3A 1QUQA 1NJ1A 1HR0L 2OCEA 3GD7A 2Z6KA 2JK8A 4A3IH 1NTGA 4BBSG 1YGBA 4YREA 1I94L 3CD6A 4A3GG 1P8LA 4Y52H 1PH9A 3K81C 2JEAI 2ZTGA 4JOIC 4YRLA 1SRYA 3HTZA 3RLOA 3S24A 3UE0A 2QGQA 2OQKA 3I4NH 1TWAH 1Y1VG 5IY0A 1K9MC 1YJWA 1IBML 4OX9L 4P74C 3K7AH 2BA1A 2RHSA 4GN5A 2DTIA 2NVXH 1ASZA 5M3MG 3PV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S1M H;  2KCM A;  5LMU Q;  5C44 G;  3HKS A;  1R9T H;  4RQF A;  2E8G A;  2ZT8 A;  3T1H Q;  3D0F A;  1UE1 A;  5IYC H;  1Q81 C;  4YRM A;  2Z6K C;  1N33 L;  3CAM A;  4P71 A;  3S17 H;  2VNU D;  4IOA A;  3AEV A;  4H02 A;  1A62 A;  4NPS A;  2PMZ E;  3G71 A;  1G5I A;  4H2U A;  4NXN Q;  1BVS A;  2ZT5 A;  2PQA A;  4HWT A;  3J80 i;  5JEA J;  3FJP A;  1X54 A;  1G6P A;  4DUZ Q;  3A32 A;  1XPR A;  4ZTU B;  3E9I A;  1HNZ L;  2HNI A;  5IYC G;  3EIV A;  4CH4 A;  3FHW A;  5IYB H;  3MEY A;  1NMF A;  1SRO A;  3PO3 H;  3A5Z A;  5C4X H;  1FVI A;  4CS2 A;  5C51 B;  3RLF A;  1D7Q A;  3L2P A;  3ERS X;  3NEL A;  4DR1 Q;  4GKJ L;  2NN6 G;  4Q6G A;  2IY5 A;  3HOV H;  1VS0 A;  4HID A;  2K5V A;  3HXZ A;  1HR0 W;  3J80 c;  3HY1 A;  5IYB G;  1BBU A;  3S1Q H;  3CF5 A;  1H4S A;  4LF8 L;  4YRG A;  3PO3 G;  5C52 B;  3OTO Q;  1WU7 A;  3ER0 A;  2I4L A;  4CH5 A;  3M7N A;  2MFI A;  5ELO A;  3CCM A;  3HOV G;  3PUY A;  4LUO A;  4QJF A;  3M4P A;  3T1Y Q;  1WCM G;  4JV5 L;  2Q2U A;  5FLM G;  2OTJ A;  3UGT A;  4RQE A;  4BA1 I;  2JA5 H;  4DK3 C;  1BKB A;  4P73 A;  4PZ8 A;  1ADY A;  1NJ2 A;  4LF4 Q;  2C35 B;  3A5U A;  4BY7 H;  2Q5H A;  3L7Z C;  4YRC A;  5BR8 Q;  2QHT A;  3HXV A;  1IZ6 A;  1VQJ A;  1G5H A;  3K0X A;  3A7R A;  1HZB A;  2ZNI A;  1KMM A;  4OON A;  2F4V L;  4DV4 L;  2ID0 A;  4OWT B;  3KFU A;  3PUW A;  4GS3 A;  3UDI A;  4B3M L;  3KF6 A;  4BA2 I;  4AH6 A;  5IP7 G;  3HOU H;  2EXD A;  3DM3 A;  2I5M X;  4XTU A;  3WWV A;  3SGI A;  4XIG S;  1VQM A;  2FXQ A;  2E64 A;  1J5E L;  4KLK A;  1CUK A;  3A74 A;  2I4O A;  4A3M H;  4JI4 Q;  3QNE A;  4JI7 Q;  4CS3 A;  1A8V A;  5EAY A;  1UWV A;  4GNX B;  2MO1 A;  4JC0 A;  5J3B A;  3TEH B;  3GTG H;  5DLQ E;  2E5A A;  3S1N H;  2EJ9 A;  4HWO A;  1D8L A;  4BY1 G;  4OP0 A;  3PUV A;  2E5L Q;  2R92 H;  4OLF A;  3UFG A;  2LSS A;  4YHH L;  4JI0 Q;  4HWR A;  1RIP A;  2N8N A;  1LUZ A;  4DV2 L;  4H2X A;  4APV A;  1Q1B A;  1T9H A;  3RUX A;  3HFZ B;  4DR3 L;  2ATW A;  1KHI A;  2QEX A;  3RAC A;  4DUY L;  4B3T L;  4DV3 L;  2HIX A;  2UXD L;  2G4C A;  1SMX A;  1KRT A;  1VQ6 A;  1YFT A;  4B3S Q;  2IX0 A;  1NY4 A;  3MF2 A;  3I56 A;  1N8R C;  3S1R H;  1SER A;  3P8Y A;  1YIT A;  4P3P A;  1HJP A;  2ARS A;  3PO2 H;  5JJI A;  1YHA A;  1NYQ A;  2B63 H;  1OXX K;  3U4V A;  3FKI H;  3VDY A;  1SE8 A;  2F3I A;  2K75 A;  2CJB A;  4JYA L;  2EIF A;  3CCR A;  1YHQ A;  2OWO A;  3H15 A;  4TWA A;  1TWG H;  2RHS B;  3V7S A;  4FDB A;  1VQP A;  1JJC B;  2F52 A;  3PO2 G;  3L1A A;  1KQS A;  1KL9 A;  2UUC Q;  1DGS A;  1MIU A;  2PI2 E;  1KXL A;  3HOX H;  4IJH A;  3LSQ A;  2B63 G;  1L1O A;  3FKI G;  4DR2 L;  2JA8 G;  1L0W A;  1YB3 A;  1M90 C;  2E1H A;  3RNU A;  1KAW A;  4QL5 A;  3QO5 A;  1WQW A;  3CCS A;  3PCO B;  5F5W A;  1VQ5 A;  1SLJ A;  1I5F A;  1OXU A;  4TQU S;  3V7C A;  1N36 L;  2Z0S A;  3TQY A;  4JBM A;  3HOX G;  1X9N A;  2DXT A;  5C3E H;  2MO0 A;  2WAQ E;  2ZNJ A;  4H2T A;  1WOC A;  2GVB A;  4R1J A;  2VL6 A;  2VUM G;  1Q12 A;  5IT9 c;  2GN5 A;  3TRE A;  2R93 G;  3RIR A;  3K7U C;  2UUA L;  4Q15 A;  2ZM6 L;  2ALY A;  4LF5 L;  5H1S E;  1YJN A;  4LUV A;  4L87 A;  2KBN A;  2JA9 A;  1YVC A;  1EQQ A;  1E7Z A;  1G51 A;  3TEH A;  3HOW G;  4JI5 L;  3PF5 A;  4DV6 L;  1X3E A;  1XTD A;  2A19 A;  1VQO A;  4ME3 A;  4A3C G;  4P72 A;  3IRB A;  3AFQ A;  3DSQ A;  2JE6 I;  4HJA A;  4A3B H;  3F2D A;  4X62 L;  2E2I H;  4LFA Q;  4WF2 A;  2B3G A;  3K80 C;  4LUZ A;  2ZIM A;  4JOI A;  2DU5 A;  2KEN A;  1X3F A;  2AMC A;  2YTY A;  1XNR Q;  4DV0 L;  3HFZ A;  3CCE A;  2E3C A;  3J81 j;  4XU1 A;  5FLX c;  2QHS A;  3CC2 A;  1YZ6 A;  3L4G A;  2DUD A;  4WJ4 A;  4LNQ A;  4YCU A;  1WJJ A;  4LFC Q;  4KHZ A;  2ASB A;  2ART A;  4RMF A;  3EFR A;  1EUJ A;  3K8A A;  5LMU L;  2Q2T A;  1U5K A;  2JA6 H;  1C7Y A;  4YRP A;  1NJ6 A;  3KF6 B;  2ZXF A;  3CCJ A;  2CJ9 A;  1H4Q A;  4P72 C;  4B3R Q;  1Q7Y C;  1Z7N A;  3T1H L;  4OO1 I;  3J81 i;  3W1G A;  1IBK L;  1I50 H;  2AKW B;  3UE1 A;  1HZC A;  4P75 C;  4YY3 L;  2ZR3 A;  2CQO A;  3CW2 C;  4KR3 A;  4JBK A;  4UP8 A;  3FP9 A;  3ICA A;  2VW9 A;  2ZGW A;  2EL9 A;  4BBR G;  4IPD A;  5M3F H;  4HIM A;  4DAM A;  1IYJ B;  3S2D H;  2ZTE A;  2BA0 A;  2DJZ A;  5M5Y H;  5IE8 A;  4A3L H;  2P0L A;  2PME A;  5GAH C;  1QZH A;  4A3I G;  4X65 Q;  1WQ7 A;  4PZ7 A;  4LFB Q;  1JJC A;  3HKZ E;  2VY3 A;  4X64 Q;  1XMO Q;  4LF9 Q;  4DR7 Q;  2RHQ B;  2E65 A;  1N32 Q;  1NE3 A;  1B70 B;  1MJC A;  1Z9F A;  3J81 c;  4H2X B;  2ZJR A;  4DR5 L;  4IPC A;  3OD1 A;  3I4N G;  5M3F G;  2VQE Q;  1HNW L;  5AJ3 Q;  1FJG Q;  4IPG A;  1HTT A;  1VQ8 A;  3PUZ A;  2DVE A;  2VZA A;  4DV5 L;  3PGZ A;  4TQF A;  3PCO A;  2J3M A;  1VQB A;  1W66 A;  1OXV A;  5K1X A;  2DEQ A;  1IBL Q;  1Y1W H;  3RKW A;  4P3O A;  3F2C A;  3S2H H;  3H3V I;  4O2D A;  1CKO A;  3RL6 A;  4POG A;  1XNQ Q;  1LM0 A;  4ALP A;  1OXT A;  2QHV A;  3H3V H;  4XTC S;  3U58 A;  3GTM H;  4PZ6 A;  4AQY Q;  3AQQ A;  4JBJ A;  4OX9 Q;  4NXM Q;  4BW9 A;  2EJG A;  1V43 A;  4KR2 A;  3KF8 B;  2R7F A;  4J15 A;  5LMN L;  1VQD A;  3L2Z A;  3PUX A;  4A3J H;  4LF4 L;  3I7F A;  3NEN A;  2K50 A;  4BWA A;  5BR8 L;  3HOZ H;  3R07 A;  5HGQ A;  1Z47 A;  2P5I A;  4DV1 L;  3A7U A;  1TWF H;  2EJF A;  2UXC Q;  1HNX Q;  5C0X J;  4X66 Q;  3NBH B;  5IP9 H;  3QO8 A;  4IFD J;  5C4X G;  3I55 A;  3GTP H;  4BXX H;  2C7I A;  1VCI A;  1L1O B;  3HRI A;  1E1T A;  1UE5 A;  1KOG A;  4HWP A;  4JI7 L;  3RF1 A;  3IG2 A;  3QO7 A;  3CXC A;  2ZT7 A;  2H5X A;  3AYH B;  4HIO A;  4H2V A;  4JI6 Q;  3QTC A;  4YRO A;  4DV7 L;  1VQ9 A;  2JA7 H;  3OW2 A;  3ERR A;  2E5L L;  2ZZG A;  2QA4 A;  2NVQ H;  4A75 A;  3JAM i;  4BXX G;  4JI0 L;  1VQC A;  4R4I A;  1YEZ A;  2NVT H;  3HFV A;  2LXK A;  1BIB A;  1PH5 A;  3BZK A;  2OTL A;  2AKW A;  4YRK A;  2JA5 G;  4JI8 L;  4TVA A;  1NMG A;  2R7Z H;  2ALY B;  4YP0 A;  4HWS A;  4X5O A;  4BY7 G;  2D0P A;  4LF8 Q;  4A3D H;  3KYH C;  4K0K Q;  3F1Z A;  4TVW A;  4ZIB A;  1A63 A;  2MQH A;  4LF6 L;  2EQS A;  1JT8 A;  3MXN B;  4B3S L;  4ZTZ B;  4L5R C;  4IPH A;  1VQI A;  1USY A;  3ULL A;  1B7Y B;  1B76 A;  4LF7 Q;  4CH3 A;  4XTY A;  2DQ3 A;  3HOU G;  3DLL A;  1K0R A;  3JAM c;  2IHE A;  1G29 1;  1MKH A;  2HIV A;  3HY0 A;  1FL0 A;  4HJ9 A;  3W1B A;  5LMN W;  4K88 A;  3EFS A;  2JEB I;  3ULP A;  3H0G H;  4O0A A;  1SR3 A;  2RHQ A;  2Q7E A;  4A3M G;  2PMF A;  1X2H A;  4C2M H;  1B70 A;  2AMC B;  4A3D G;  4UP9 A;  2YYZ A;  3BJU A;  3RLN A;  4A3E H;  1EIY B;  4C3J H;  1YI2 A;  1X3G A;  2UXB Q;  3L4G B;  1CSQ A;  1HXD A;  3LSS A;  1GD7 A;  2R92 G;  3NET A;  4TTV A;  3ZJY C;  4G85 A;  2DGY A;  1XMQ Q;  4A3K H;  2WP8 J;  3H0G G;  2AHO B;  1USY C;  3CME A;  1XPU A;  3W3S A;  1Q82 C;  1ASY A;  1Q1E A;  1PH3 A;  2ZIO A;  1W3S A;  2ODR C;  2ZTC A;  4XTV A;  1WFQ A;  3LC0 A;  1NYR A;  4UPA A;  4UP7 A;  1HZ9 A;  1C0A A;  3CCV A;  1EVL A;  1VQF A;  4DQ2 A;  4X6A H;  2PNH A;  4A3K G;  3MEF A;  3AFP A;  2ODR D;  4DV2 Q;  4WJ3 M;  1BBW A;  3CCQ A;  5IWA L;  4HJ7 A;  1CSP A;  2DQ0 A;  3G4S A;  4OWX B;  4L5T A;  2I5H A;  1PVO A;  1UEB A;  1E3P A;  4DKA C;  4AIM A;  1J5W A;  2ZZF A;  3CC4 A;  5GQO A;  4YYE A;  4A3F H;  1PA6 A;  2DTH A;  2DXU A;  1PYS B;  2E2J H;  4JBW A;  1VQE A;  4DPG A;  3J7Z C;  1X56 A;  2A8V A;  2UU9 Q;  3CP0 A;  3TUP A;  4KI0 A;  2ZTD A;  2NZO A;  2AWO A;  3I4M H;  5IYD H;  3CPW A;  1VQN A;  5C4J H;  1PH8 A;  1JJG A;  2GVA A;  5E3I A;  5JEA G;  4P3N A;  1Z7M A;  3HXW A;  4JI3 Q;  2CWP A;  5C0X I;  4A3F G;  1PH6 A;  4QY7 A;  4A93 H;  3G1Z A;  4AYB E;  4IFD I;  3KJP A;  3VQW A;  4DR6 Q;  4LFA L;  3JC6 6;  4GKK Q;  1BIA A;  2ZZE A;  3BFM A;  3KDF B;  2VQF L;  3RN5 A;  3S14 H;  1SES A;  2PI2 A;  4YRQ A;  1S72 A;  1GVP A;  3GTO H;  3G48 A;  1X55 A;  1SET A;  3HRK A;  4XTW A;  3VQY A;  2UUB Q;  3HOY H;  5ELN A;  5C3E G;  4DR2 Q;  4POF A;  4CH6 A;  3CC7 A;  1B7Y A;  2HHH Q;  5GAE C;  5FJ8 H;  4B3R L;  2D62 A;  4P75 A;  1KC8 C;  2EAY A;  2YTX A;  3HXY A;  1EYG A;  1K8G A;  3BZC A;  3E0E A;  3HOY G;  2Q7G A;  4TVY A;  2Q2I A;  3F2B A;  1KMN A;  3I2Z A;  1ADJ A;  1IXR A;  1EIY A;  3GO5 A;  4DR4 Q;  2NZH A;  2E41 A;  2CKZ B;  5M5X H;  1GGM A;  3UDF A;  5K1P A;  11AS A;  5FJ8 G;  4A3B G;  2MNA A;  4X65 L;  1FGU A;  4BBS H;  4X64 L;  2WAQ G;  1XMO L;  4GN3 B;  4DR7 L;  1PH7 A;  1NJ8 A;  3VQX A;  3HXU A;  4A3G H;  4UY8 C;  4LF5 Q;  1CKN A;  2ZJP A;  1X2G A;  2ZT6 A;  3GTJ H;  4RDX A;  3HXX A;  4KHP Q;  5E7N A;  4TVA B;  2VQE L;  1N34 Q;  3E9H A;  1QF6 A;  2Q2H A;  1Y1V H;  5AJ3 L;  4YRS A;  1FJG L;  4IO9 A;  4JI2 Q;  1H4T A;  2K4K A;  3WQZ A;  4EX5 A;  4XU3 A;  4YCV A;  4X62 Q;  1EIF A;  4NXN L;  2C8M A;  5M3M H;  1IBL L;  1CKM A;  2JQO A;  2B29 A;  4NCX A;  5C44 H;  4JI1 Q;  2HQL A;  3M85 A;  4DUZ L;  2JA6 G;  3V8J A;  1SFO H;  4C3I H;  1EVK A;  4GOP C;  4PHC A;  1K8A C;  4DAY B;  2XGT A;  3EN2 A;  1XNQ L;  2Y0S E;  4DV0 Q;  3TS0 A;  4L5Q A;  1YNX A;  3UGQ A;  2CJA A;  1WI5 A;  2K14 A;  1SN8 A;  4AQY L;  4OO1 G;  3P8V A;  2DZ9 A;  1KIX A;  3W5O A;  1GO3 E;  4NXM L;  1NJ5 A;  4RG1 A;  1PYS A;  1EQR A;  1HZA A;  1MJE A;  3GTL H;  4YCW A;  4DR1 L;  4A3L G;  1HR0 Q;  3RN2 A;  3UH0 A;  3TS2 A;  1VQZ A;  2L15 A;  3RGL A;  1RL2 A;  1IBK Q;  1UE6 A;  4QIW E;  1VQA A;  1JJ2 A;  4LNS A;  4EO4 A;  4YY3 Q;  1AH9 A;  2UXC L;  5GAD C;  1I94 Q;  1HNX L;  2IHF A;  3OYY A;  4X66 L;  4IOC A;  1K73 C;  3VBB A;  4R4Q A;  4MZ9 A;  2ZR2 A;  3TEG A;  2NN6 I;  1NJI C;  4HJ8 A;  4Y7N H;  1PH1 A;  1XPO A;  1PYB A;  3A0J A;  3OTO L;  3PZC A;  2R7D A;  1WPY A;  2DKG A;  3KDF A;  3D31 A;  1IBM Q;  3T1Y L;  5JJL A;  2ZCE A;  1WNL A;  2Q5I A;  2XTI A;  5HY6 A;  3L0O A;  1Y1W G;  4JI6 L;  1GM5 A;  3CCL A;  4GN4 B;  3EBE A;  1J6Q A;  4PG3 A;  4GLA C;  1YBY A;  3STB C;  1QVG A;  4DR5 Q;  4DK6 C;  1S40 A;  2I5L X;  1N33 Q;  3KJO A;  3J7A 5;  1E22 A;  3V8K A;  4YWL A;  2Y0S G;  3HKZ G;  1HNW Q;  3G6E A;  2ES2 A;  4LW1 A;  4K87 A;  12AS A;  1WCM H;  4DV5 Q;  4P71 C;  4QQB X;  3STB D;  5FLM H;  3IKL A;  1C9O A;  3PF4 A;  4A3J G;  5C53 B;  2VS1 A;  4JI4 L;  1KD1 C;  1HC7 A;  3M3Y H;  4K0K L;  3HOZ G;  1EWI A;  2YU9 H;  1HNZ Q;  3CQZ H;  3UDX A;  1PH4 A;  2KHJ A;  3TRZ A;  4H2S A;  3M4O H;  3REX A;  1NBW A;  4HA8 A;  1TXY A;  5IP9 G;  4LF7 L;  5IP7 H;  5LMN Q;  2K52 A;  4A4I A;  1V1Q A;  2WB1 E;  2A1A A;  2AWN A;  5JJK A;  4YWK A;  4OWW B;  1H95 A;  1X65 A;  4GKJ Q;  5GAG C;  2D0O A;  1OTC A;  2JJQ A;  1YFS A;  4DV1 Q;  1LYL A;  1QZG A;  1VQ4 A;  2UXB L;  4BY1 H;  1V9P A;  2JA7 G;  1AE2 A;  1FYF A;  2IX1 A;  1H4V B;  1XMQ L;  4JCV E;  3MF1 A;  4GLX A;  2OQ0 A;  1VQG A;  4JV5 Q;  4K86 A;  1S3O A;  3REU A;  4EQ5 A;  2DTO A;  2R7Z G;  3KLW A;  4YWM A;  3CMQ A;  4DV7 Q;  4P73 C;  3M4Q A;  3LGJ A;  4QGU A;  1O7I A;  4H2Y A;  3A31 A;  2CWA A;  3RKX A;  1HH2 P;  4G84 A;  1K83 H;  2RF4 A;  2F4V Q;  4DV4 Q;  4GOP B;  4B3M Q;  1E24 A;  4XEO A;  2ARU A;  3U4Z A;  4YRJ A;  3U50 C;  4XU0 A;  1TWH H;  3A7A A;  2YV5 A;  3PIP A;  3PIO A;  2DDZ A;  2ZIN A;  4JI8 Q;  1J5E Q;  1X6O A;  2YTV A;  2WB1 G;  4H2W A;  2UUC L;  1TWC H;  1CKN B;  2I0Q A;  3S16 H;  4TQD A;  1SRU A;  4A3E G;  1PH2 A;  3VQV A;  4LF6 Q;  1IL2 A;  2UU9 L;  4R4C A;  4WI1 A;  1QUQ B;  4R4T A;  2E2H H;  1E1O A;  1RIQ A;  1X01 A;  4YRN A;  4E51 A;  5M5W H;  3V8L A;  1XJV A;  3CMA A;  4YHH Q;  2WFW A;  4YRT A;  1JMC A;  1WYD A;  4JI3 L;  2N78 A;  4KQE A;  1YHB A;  1W2B A;  4HVC A;  2N49 A;  2NVY H;  2RCN A;  4DR6 L;  4GKK L;  4DR3 Q;  4XTX A;  4XEM A;  3M9B A;  2JA8 H;  4DUY Q;  4IJL A;  4DV3 Q;  4B3T Q;  4YRF A;  3RKY A;  3UDG A;  2UXD Q;  3CPF A;  2CCZ A;  3BU2 A;  3IKM B;  1A0I A;  2BH2 A;  4HJ5 A;  4PMW A;  1Q86 C;  2UUB L;  2K5N A;  1N9W A;  2QHU A;  4CS4 A;  2I4M A;  2EWN A;  2I4N A;  4JG2 A;  3GTQ H;  2CIM A;  1OXS C;  1QVF A;  2FYK A;  2HHH L;  2DU7 A;  2ZJQ A;  2VUM H;  4LWC A;  2V1C C;  1VQH A;  2R93 H;  2E10 A;  3RZD H;  2PQA B;  3B6Y A;  1VQL A;  4R4O A;  4XU2 A;  2K5H A;  4JYA Q;  3A5Y A;  3I4M G;  4XTZ A;  5IYD G;  3NEM A;  5IWA Q;  1XNR L;  1ATI A;  2CFM A;  3ULJ A;  4OXP A;  2BH8 A;  4DR4 L;  3HOW H;  1YFR A;  1YIJ A;  1L2F A;  3CCU A;  4A3C H;  2DZC A;  2N3S A;  4YDQ A;  1QE0 A;  2Q7H A;  3A5Z B;  1U0L A;  4A93 G;  2IT1 A;  1Q46 A;  2LXJ A;  4LFC L;  3Q8D A;  3KOJ A;  3RR5 A;  4A76 A;  1AE3 A;  4C3H H;  1GKH A;  5C0X G;  1EFW A;  1L1O C;  3GDE A;  2IY5 B;  3P8T A;  4IFD G;  1I3Q H;  4YRR A;  4MNO A;  4GNX A;  1Q8K A;  4YPF A;  1LTL A;  1I6H H;  5KNN A;  1PV4 A;  4KHP L;  1JE5 A;  1N34 L;  5K36 G;  4JI2 L;  3V7R A;  2HT1 A;  1K3R A;  1N36 Q;  1QVC A;  1M1K C;  2KHI A;  2KCT A;  5GRO A;  1PFS A;  3S15 H;  3PSI A;  2J3L A;  2VQF Q;  4JI1 L;  4GOP A;  1WLE A;  1VQ7 A;  3F8T A;  1UE7 A;  2R6G A;  4GLV B;  1Y14 B;  4AYB G;  4HIK A;  4LFB L;  4MTN A;  2UUA Q;  1KRS A;  3ICE A;  4P74 A;  2ZM6 Q;  4LF9 L;  1B8A A;  1YJ9 A;  1N32 L;  3GTK H;  4YRI A;  1JB7 A;  3RZO H;  1EOV A;  4BBR H;  1PHJ A;  2CGH A;  4JI5 Q;  4DNI A;  4GNX C;  1NNH A;  3IAL A;  1P16 A;  4DV6 Q;  1VQK A;  4L5S A;  3I4O A;  4NB3 A;  1QUQ A;  1NJ1 A;  1HR0 L;  2OCE A;  3GD7 A;  2Z6K A;  2JK8 A;  4A3I H;  1NTG A;  4BBS G;  1YGB A;  4YRE A;  1I94 L;  3CD6 A;  4A3G G;  1P8L A;  4Y52 H;  1PH9 A;  3K81 C;  2JEA I;  2ZTG A;  4JOI C;  4YRL A;  1SRY A;  3HTZ A;  3RLO A;  3S24 A;  3UE0 A;  2QGQ A;  2OQK A;  3I4N H;  1TWA H;  1Y1V G;  5IY0 A;  1K9M C;  1YJW A;  1IBM L;  4OX9 L;  4P74 C;  3K7A H;  2BA1 A;  2RHS A;  4GN5 A;  2DTI A;  2NVX H;  1ASZ A;  5M3M G;  3PV0 A; 
#chains in the Genus database with same CATH topology
 4K5W A;  3S1M H;  1Q8I A;  2KCM A;  4ILW A;  1G91 A;  1ENC A;  2LFN A;  5LMU Q;  4PMC A;  5C44 G;  3HKS A;  1R9T H;  3WOE A;  1TWH B;  4C3I G;  4RQF A;  2E8G A;  2ZT8 A;  3T1H Q;  3R3O A;  3D0F A;  1UE1 A;  2EYP A;  4JPB W;  5IYC H;  1Q81 C;  4YRM A;  1B53 A;  3BYY B;  1JOQ A;  2Z6K C;  1N33 L;  4KJO A;  1LV9 A;  1HPC A;  1VF5 C;  3CAM A;  1TWC B;  3T56 B;  3AU7 A;  1MGS A;  4P71 A;  3S17 H;  3S16 B;  1PFB A;  2VNU D;  3J81 L;  4L8J A;  4IOA A;  3AEV A;  4H02 A;  1A62 A;  4NPS A;  2PMZ E;  3G71 A;  1G5I A;  1S5E D;  4H2U A;  2F0O A;  4NXN Q;  1BVS A;  2ZT5 A;  2PQA A;  4HWT A;  3J80 i;  5JEA J;  1GHK A;  3FJP A;  2EY6 A;  1ICF B;  1HCZ A;  1X54 A;  2E2H B;  2E75 C;  1G6P A;  4DUZ Q;  1Q90 A;  3A7L A;  3A32 A;  1XPR A;  4ZTU B;  3BG3 A;  5M5W B;  1PZI D;  3E9I A;  2PPB C;  1KLG D;  1QG7 A;  1QJO A;  4QUC A;  5IYC G;  1HNZ L;  2FMC A;  3EIV A;  2HNI A;  3TDQ A;  4CH4 A;  2EYO A;  1SE3 A;  3FHW A;  5IYB H;  1LT3 D;  5IIF A;  2F0D A;  2CQA A;  3MEY A;  2K01 A;  5DEH A;  2J0T D;  4HCE A;  2NWG A;  1NMF A;  1SRO A;  2NVY B;  1DJR D;  1WTR A;  1BR9 A;  2M2L A;  3P20 A;  3PO3 H;  2B2U A;  4K5V A;  1EY5 A;  3A5Z A;  5C4X H;  1DYQ A;  1FNU A;  1FVI A;  4V19 0;  4M1U B;  2K04 A;  3TP8 A;  4CS2 A;  3X3N A;  5C51 B;  1STY A;  1TQO A;  4R9W A;  3ITP A;  3K5L A;  3RLF A;  1D7Q A;  3M4Y A;  2A5H A;  3DEO A;  5COY A;  5FKA C;  3L2P A;  1Y8O B;  3ERS X;  4KJN A;  3NEL A;  4DR1 Q;  4GKJ L;  2NN6 G;  4Q6G A;  2IY5 A;  1H9M A;  4I7A A;  3HOV H;  1VS0 A;  1LT4 D;  4HID A;  3R93 A;  1DM0 B;  3FEW X;  2K5V A;  3HXZ A;  2K6A A;  1AP0 A;  1HR0 W;  4RGN A;  3J80 c;  2A8E A;  4ZK9 B;  3D6W A;  3GQB A;  3HY1 A;  5IYB G;  1BBU A;  1JE4 A;  3S1Q H;  3MVV A;  3TME A;  3CF5 A;  1H4S A;  4LF8 L;  4YRG A;  3PO3 G;  4IQZ A;  5C52 B;  3VR6 A;  1B3Q A;  1AZQ A;  2NTT A;  3GTQ B;  4N9P A;  4QUF A;  3OTO Q;  1WU7 A;  4ZCK A;  3ER0 A;  4I7Z C;  2I4L A;  4OEM B;  2TSS A;  4CH5 A;  1LTS D;  3M7N A;  1D1I A;  2MFI A;  5ELO A;  3CCM A;  3HOV G;  3PUY A;  4LUO A;  4QJF A;  2VUM B;  1DOK A;  3C1E A;  3M4P A;  1Y8N B;  3T1Y Q;  1WCM G;  4JV5 L;  3GV3 A;  2Q2U A;  1EZ6 A;  2R93 B;  3A8I E;  3RZD B;  5FLM G;  2EJG C;  2OTJ A;  3UGT A;  4RQE A;  3SXH A;  2QDB A;  4BA1 I;  3L3O C;  4H44 C;  2JA5 H;  4DK3 C;  1BKB A;  3KBG A;  3VYS A;  4P73 A;  4PZ8 A;  1ADY A;  1NJ2 A;  2NB0 A;  4LF4 Q;  2C35 B;  2QW7 A;  3A5U A;  2FHT A;  4BY7 H;  2Q5H A;  3L7Z C;  4YRC A;  5BR8 Q;  1TS5 A;  4FYD A;  1TR5 A;  2QHT A;  3HXV A;  1IZ6 A;  2TMP A;  1VQJ A;  1G5H A;  2XWJ B;  3K0X A;  4RGM A;  1HZB A;  3A7R A;  2ZNI A;  3LWE A;  1KMM A;  4OON A;  2F4V L;  4DV4 L;  2ID0 A;  4OWT B;  1O7L A;  5CV5 A;  3KFU A;  3PUW A;  2EJF C;  4GS3 A;  3UDI A;  4B3M L;  3KF6 A;  4BA2 I;  4J8Q A;  4AH6 A;  5IP7 G;  3HOU H;  1MI2 A;  4C3H B;  2EXD A;  3DM3 A;  2I5M X;  3HRZ C;  4XTU A;  3WWV A;  3SGI A;  4XIG S;  1JOK A;  1VQM A;  1HA6 A;  2FIN B;  2B8G A;  2FXQ A;  2E64 A;  2A6H D;  2G9D A;  4KLK A;  4PQX A;  1J5E L;  1CUK A;  1I3Q B;  2XRQ D;  3A74 A;  4FNF A;  2I4O A;  3K6O A;  4A3M H;  1QNK A;  4JI4 Q;  2Z1C A;  4TKO B;  3QNE A;  2V4D A;  4JI7 Q;  2I46 A;  4CS3 A;  1A8V A;  3NK9 A;  1I6H B;  4K8I A;  5EAY A;  4AYB B;  1GUT A;  1UWV A;  2MO1 A;  1YNN C;  4JC0 A;  5J3B A;  1JWM D;  4GNX B;  3CKI B;  3TEH B;  5A35 A;  2EOT A;  3GTG H;  5DLQ E;  1SE4 A;  2E5A A;  1QWY A;  1PXU A;  4KK7 A;  4O1N A;  5EKI A;  3S1N H;  4L63 B;  2F0S A;  2EJ9 A;  4HWO A;  4NDX A;  1D8L A;  2E76 C;  4ME5 A;  4BY1 G;  3D4W A;  4OP0 A;  3PUV A;  1WD1 A;  1CI3 M;  1GUO A;  3Q24 A;  1H9J A;  2E5L Q;  1D1K A;  5CC4 A;  2R92 H;  1MHW C;  1FR3 A;  4C1N I;  1CTM A;  1YNN D;  4IUT A;  4OLF A;  2PO4 A;  3UFG A;  1D5Z C;  2LSS A;  1A3U A;  3S15 B;  4DK1 A;  4KN7 C;  4YHH L;  1F2M A;  5D3D A;  2HCI A;  2XRS D;  4JI0 Q;  4HWR A;  1RIP A;  2N8N A;  5FK9 C;  1LUZ A;  1TY0 A;  1UUP A;  4DV2 L;  3JAM L;  1BCP F;  4BBS B;  4H2X A;  4APV A;  3BDO A;  1Q1B A;  1T9H A;  3RUX A;  1CA6 A;  3HFZ B;  1ICW A;  4DR3 L;  3SVM A;  2ATW A;  1KHI A;  2QEX A;  3GTK B;  3RAC A;  4DUY L;  3A8J E;  4B3T L;  4DV3 L;  3RMH A;  2HIX A;  1KNE A;  2UXD L;  2G4C A;  1SMX A;  4BBR B;  1KRT A;  1EIH A;  1VQ6 A;  2XWB B;  1YFT A;  1SYE A;  1GJX A;  5DNF A;  4QMG A;  4B3S Q;  2MHV A;  4G4K A;  2IX0 A;  1NY4 A;  3MF2 A;  3I56 A;  3P75 A;  1N8R C;  3KBX A;  3S1R H;  4A3I B;  3EA6 A;  1SER A;  2F1M A;  2L5T A;  4HSP A;  3P8Y A;  1YIT A;  5E3F A;  1D6E C;  2SDF A;  1U4P A;  2B2Y A;  4P3P A;  3UI2 A;  5C44 B;  1HJP A;  2DNC A;  4OIK A;  2ARS A;  1FNV A;  3PO2 H;  3K0Y A;  5C5M A;  5JVG 3;  4XDX A;  2CHB D;  4RFB A;  5JJI A;  1X32 A;  1YHA A;  1NYQ A;  2B63 H;  5EPJ A;  5JJZ A;  1UAP A;  1ILQ A;  1OXX K;  1TWA B;  4X3T A;  4X3S A;  3U4V A;  1XX8 A;  3FKI H;  3VDY A;  1SE8 A;  4RA8 A;  2F3I A;  5C5L A;  2K75 A;  1JWU D;  2CJB A;  1KAA A;  2OXP A;  4JYA L;  3K57 A;  3K7A B;  2EIF A;  3NP8 A;  4BWG B;  2RDH A;  3CCR A;  1YHQ A;  2OWO A;  1ZEQ X;  4H7B A;  1SBB B;  4E6I A;  1TWG H;  3H15 A;  2NVX B;  2RHS B;  4TWA A;  3V7S A;  4FDB A;  1EWC A;  5JEA H;  3VYU A;  1VQP A;  1JJC B;  3S1M B;  4GZY C;  2F52 A;  4FF1 A;  3MTS A;  3PO2 G;  1R9T B;  3L1A A;  5G3L D;  3DWP A;  1KQS A;  1KL9 A;  2L55 A;  1DGS A;  2UUC Q;  1MIU A;  3KUP A;  2PI2 E;  3MFY A;  5E4X A;  4G7H C;  1KXL A;  3HOX H;  4IJH A;  3LSQ A;  1HXY D;  2B63 G;  4PMB A;  1L1O A;  3FKI G;  2B2T A;  3HEJ A;  3ND9 A;  4HSV A;  3S17 B;  4LVM A;  2B2Y C;  4DR2 L;  2F0H A;  2JA8 G;  3MA2 B;  1L0W A;  1YB3 A;  1M90 C;  2E1H A;  3RNU A;  5G3L F;  3E0J A;  2ENB A;  1KAW A;  1CA5 A;  2A68 C;  4QL5 A;  3QO5 A;  1WQW A;  3CCS A;  3PCO B;  5KYI A;  2QF7 A;  1SYD A;  5F5W A;  1VQ5 A;  1SLJ A;  1I5F A;  1OXU A;  3H91 A;  5L37 A;  4TQU S;  1U4L A;  3V7C A;  4LVL A;  1N36 L;  2Z0S A;  3TQY A;  4JBM A;  2A68 D;  3HOX G;  3BS1 A;  2SEB D;  5I6W A;  1X9N A;  2DXT A;  4DF7 A;  5C3E H;  1EIG A;  1LTT D;  1ZYR C;  1WD0 A;  2MO0 A;  2WAQ E;  3URY A;  2ZNJ A;  3QR8 A;  4KKS A;  4KY7 A;  1EU3 A;  1A3V A;  4H2T A;  2JP1 A;  1WOC A;  2GVB A;  3PO3 B;  4HED A;  5C4Z A;  1VMP A;  5C4X B;  4R1J A;  2VL6 A;  4RGO S;  5EPK A;  1JQY D;  1Q12 A;  4B9W A;  2VUM G;  4NP5 A;  5IT9 c;  2GN5 A;  3TRE A;  2EDG A;  1TKW B;  2F0F A;  1DOM A;  2R93 G;  5CV4 A;  2HUG A;  1ZYR D;  3RIR A;  1ONL A;  3K7U C;  2J4X A;  2UUA L;  1CM9 A;  3HOV B;  4Q15 A;  1F9Q A;  2ZM6 L;  2Q8R E;  2ALY A;  1EQT A;  1SDF A;  4LF5 L;  1CQV A;  5H1S E;  4LUV A;  1YJN A;  4L87 A;  2KBN A;  2JA9 A;  1YVC A;  2PMZ B;  4WOR A;  5F2D A;  1E7Z A;  1EQQ A;  2K5Q A;  1G51 A;  5D65 A;  4DGZ A;  3TEH A;  1A6X A;  3HOW G;  4JI5 L;  3S1Q B;  4EQN A;  3PF5 A;  4DV6 L;  1X3E A;  4N9T A;  1RCV D;  1XTD A;  3MHB A;  2A19 A;  1VQO A;  1A2T A;  4ME3 A;  1CZW A;  4A3C G;  4P72 A;  3IRB A;  3AFQ A;  2PQE A;  4K6L A;  2YU9 B;  3DSQ A;  3CQZ B;  1B50 A;  1WTX A;  5DAU A;  2JE6 I;  4HJA A;  4A3B H;  3F2D A;  5C6A A;  1S4Z A;  4X62 L;  1ML0 D;  1ROD A;  3SR1 A;  2E2I H;  4LFA Q;  4WF2 A;  2B3G A;  3K80 C;  4LUZ A;  2R3Z A;  2ZIM A;  1AN8 A;  4JOI A;  2RDF A;  2DU5 A;  2KEN A;  1X3F A;  2AMC A;  4KTA A;  2YTY A;  5D14 A;  1XNR Q;  1W6J A;  2JA5 B;  5CYU A;  2MGS A;  3HP3 A;  4DV0 L;  3HFZ A;  3CCE A;  2E3C A;  3J81 j;  4XU1 A;  5FLX c;  2QHS A;  3CC2 A;  2FJ2 A;  1YZ6 A;  4BY7 B;  3L4G A;  2DUD A;  1F9S A;  4LVJ A;  3QJY A;  4WJ4 A;  3A8K E;  1UNS A;  4LNQ A;  2LY7 A;  1JC7 A;  1LAC A;  4YCU A;  2SNS A;  1WJJ A;  5CV9 A;  4LFC Q;  4HT4 A;  4L6T B;  4KHZ A;  1RKN A;  2ASB A;  3VYT A;  2ART A;  2DJG C;  4RMF A;  3VYR A;  1DON A;  3EFR A;  1EUJ A;  3K8A A;  5LMU L;  3T53 B;  4DAV A;  2Q2T A;  1U5K A;  2JA6 H;  1C7Y A;  4YRP A;  3HOU B;  1NJ6 A;  4PNY A;  3KF6 B;  2ZXF A;  3CCJ A;  3IFD A;  2CJ9 A;  4P72 C;  4B3R Q;  1Q7Y C;  1Z7N A;  1H4Q A;  3T1H L;  4CDF C;  4OO1 I;  3J81 i;  4CDE C;  3PMF A;  3W1G A;  1IBK L;  1ZXT A;  1I50 H;  2AKW B;  3O13 A;  3UE1 A;  1HZC A;  4P75 C;  4YY3 L;  4KMU C;  4A3M B;  2Z4H A;  4OO1 H;  2ZR3 A;  2CQO A;  2MPM A;  3CW2 C;  4KR3 A;  5E4W C;  4JBK A;  1DZ1 A;  2CW0 C;  4UP8 A;  3DHQ A;  3FP9 A;  3ICA A;  3GTG B;  3MWY W;  2VW9 A;  2ZGW A;  1OO9 B;  2QCP X;  2EL9 A;  4BBR G;  4IPD A;  5M3F H;  4HIM A;  3S1N B;  4DAM A;  1IYJ B;  3AMU A;  3S2D H;  2FFK B;  2ZTE A;  2BA0 A;  4KD3 A;  2DJZ A;  3V05 A;  4HTH A;  5M5Y H;  5IE8 A;  2NYZ D;  2R92 B;  4A3L H;  2WAC A;  1WTH A;  2P0L A;  4OEL B;  2CW0 D;  2PME A;  5GAH C;  1QZH A;  4A3I G;  2VB3 X;  3OW7 A;  4X65 Q;  5ELB A;  1WQ7 A;  4PZ7 A;  4LFB Q;  2Z9H A;  1S5D D;  3HKZ E;  5DM7 3;  2EY1 A;  1JJC A;  2VY3 A;  4X64 Q;  2WII B;  2PYK A;  1XMO Q;  4LF9 Q;  4DR7 Q;  2RHQ B;  3FPP A;  2LMC B;  1N32 Q;  2E65 A;  3NWS A;  1NE3 A;  5FO9 B;  1B70 B;  3NBI A;  1MJC A;  1Z9F A;  5IGB A;  3J81 c;  2ZJR A;  4H2X B;  2K5W A;  4DR5 L;  4DU9 A;  4IPC A;  3OD1 A;  5JOB A;  3I4N G;  5M3F G;  2VQE Q;  4XYQ A;  4IUU A;  2KUM A;  4CJ2 C;  1HNW L;  5AJ3 Q;  1FJG Q;  5T1G A;  4HAE A;  4IPG A;  1HTT A;  1VQ8 A;  4CBV A;  3PUZ A;  2DVE A;  2VZA A;  4DV5 L;  3PGZ A;  1II3 A;  3EFX D;  4TQF A;  2K32 A;  3PCO A;  2J3M A;  1VQB A;  3CHB D;  1W66 A;  3N6R A;  2IL8 A;  1OXV A;  5K1X A;  4KN4 C;  3K58 A;  1IBL Q;  2DEQ A;  1Y1W H;  1BNZ A;  3RKW A;  4EQO A;  4P3O A;  3I72 A;  5LHY 1;  2E2D C;  2A69 C;  1ESF A;  5KIX A;  4JK1 C;  3ND8 A;  3F2C A;  3S1R B;  4LAA A;  3GP7 A;  3S2H H;  5NUC A;  3DWQ A;  3H3V I;  4O2D A;  1CKO A;  3RL6 A;  4ZRZ A;  4POG A;  1XNQ Q;  1LM0 A;  5KGU A;  4ALP A;  1OXT A;  2QHV A;  3PO2 B;  2F0I A;  2VXW A;  3H3V H;  4XTC S;  4DN4 M;  2A69 D;  3U58 A;  3GTM H;  1Q3L A;  3BVZ A;  4PZ6 A;  4AQY Q;  3AQQ A;  5I6Y A;  4JBJ A;  3Q6S A;  4NXM Q;  4OX9 Q;  2B63 B;  4KD4 A;  2EJG A;  4BW9 A;  1IL8 A;  1V43 A;  4G57 A;  4KR2 A;  3MXU A;  3KF8 B;  1I4G A;  2R7F A;  4J15 A;  4EGV A;  1GXD C;  1XYI A;  5LMN L;  1SYB A;  1SE2 A;  1VQD A;  3FKI B;  3L2Z A;  3PUX A;  5CGK A;  4Q5V A;  2JA8 B;  4A3J H;  1KNA A;  1W6K A;  3J7A F;  5COR A;  4LF4 L;  2NTS A;  3R8B A;  3I7F A;  4OGQ C;  1TWG B;  2OT2 A;  2K50 A;  3NEN A;  4BWA A;  1TU2 B;  4MIU A;  1B44 D;  1ENA A;  5BN3 A;  5BR8 L;  3HOZ H;  3R07 A;  5HGQ A;  1F2L A;  1Z47 A;  2R61 A;  4HCS A;  2P5I A;  4G7O C;  4DV1 L;  1WTW A;  3A7U A;  1TWF H;  2EJF A;  2K03 A;  2Z8L A;  1B1Z A;  1HNX Q;  2UXC Q;  5C0X J;  3IAY A;  4X66 Q;  1AZP A;  3HOX B;  3NBH B;  3QWN A;  3MAQ A;  3T51 B;  5IP9 H;  3QO8 A;  4IFD J;  5C4X G;  3I55 A;  3OPO A;  3GTP H;  1HQR D;  4BXX H;  2C7I A;  1VCI A;  1L1O B;  4OL7 A;  1HQM C;  1G8Z D;  4IUQ A;  3H3V C;  3HRI A;  1E1T A;  1UE5 A;  1WTV A;  4ZQ3 A;  1WVL A;  2JN4 A;  5C4H A;  2BOS A;  1KOG A;  5CBE E;  4HWP A;  1AW7 A;  4JI7 L;  4FXK C;  3RF1 A;  3IG2 A;  3QO7 A;  4DAP A;  3CXC A;  2ZT7 A;  1HTL D;  2H5X A;  3AYH B;  1KTK A;  4HIO A;  4H2V A;  3HG9 A;  4EQP A;  4JI6 Q;  4IUP A;  3QTC A;  1O7Y A;  4YRO A;  1LTG D;  2P5Z X;  4DV7 L;  1VQ9 A;  2JA7 H;  3OW2 A;  3ERR A;  2E5L L;  4V0B A;  2ZZG A;  2QA4 A;  2NVQ H;  3OOC A;  4A75 A;  1F9P A;  5C3E B;  3HOW B;  5IGG A;  3JAM i;  4BXX G;  1NAP A;  5K5P A;  1TVX A;  4JI0 L;  1VQC A;  4R4I A;  1YEZ A;  1KDA A;  3K59 A;  2NVT H;  3HFV A;  1I4P A;  2EYM A;  2LXK A;  1FD7 D;  2N88 A;  5C3X A;  1BIB A;  1U4M A;  1PH5 A;  3BZK A;  2OTL A;  2PZW A;  2AKW A;  4ABN A;  2JA5 G;  4YRK A;  4JI8 L;  4TVA A;  1NMG A;  1EY9 A;  1BDO A;  2R7Z H;  2RCF A;  1BOS A;  2ALY B;  4YP0 A;  1A15 A;  4HWS A;  4X5O A;  3DEP A;  2BDO A;  4BY7 G;  1SNQ A;  2D0P A;  4LF8 Q;  1BCP C;  5I2Y A;  1QCB D;  4A3D H;  4CKE A;  3KYH C;  4K0K Q;  5CV7 A;  4DXG A;  3F1Z A;  4TVW A;  4ZIB A;  3A55 A;  1A63 A;  2MQH A;  4LF6 L;  4RHS A;  1HUN A;  1DOL A;  1K8O A;  2EQS A;  1JT8 A;  3MXN B;  4B3S L;  4ZTZ B;  4K8J A;  4L5R C;  4IPH A;  1VQI A;  1USY A;  3ULL A;  1B7Y B;  1B76 A;  1BCP D;  4LF7 Q;  3BDC A;  4A3B B;  4CH3 A;  4OIJ A;  4XTY A;  2DQ3 A;  4UDU C;  3HOU G;  3DLL A;  4DAY A;  2E2I B;  1K0R A;  3JAM c;  2IHE A;  1G29 1;  1MKH A;  2HIV A;  3HY0 A;  1EU4 A;  1FL0 A;  4FF4 A;  1KLU D;  2WAQ B;  1SNO A;  4HJ9 A;  3W1B A;  5LMN W;  2WKC A;  2RSN A;  4K88 A;  3EFS A;  5AFW A;  2JEB I;  3ULP A;  3H0G H;  4O0A A;  5I9P A;  1SR3 A;  1SND A;  2RHQ A;  2Q7E A;  4A3M G;  2PMF A;  2Z6B A;  5KNC A;  1X2H A;  4C2M H;  1B70 A;  2AMC B;  4A3D G;  1U9R A;  4UP9 A;  2YYZ A;  2QDL A;  3BJU A;  4B08 A;  3RLN A;  4K14 A;  4A3E H;  1EIY B;  3A56 A;  4C3J H;  2A6E C;  1YI2 A;  3OIP A;  1X3G A;  3VR4 A;  1PRT C;  2UXB Q;  3L4G B;  4FF3 A;  1CSQ A;  1HXD A;  1LTB D;  3R2I A;  3LSS A;  3RZO B;  3U9O A;  2NBF A;  4PV1 C;  1NR4 A;  1GD7 A;  3NXW A;  2R92 G;  2A74 C;  3NET A;  2EYF A;  2K5D A;  4TTV A;  2F0W A;  3ZJY C;  4G85 A;  3DUZ A;  1EYA A;  2A6E D;  2DGY A;  4WRD A;  1XMQ Q;  2JA6 B;  1F2Y A;  1PRT D;  5CV6 A;  4A3K H;  2WP8 J;  3ZYY X;  3H0G G;  2RVL A;  4O42 A;  2AHO B;  3EVQ A;  3I8Z A;  1USY C;  3CME A;  1XPU A;  2X6L A;  1EY8 A;  4NKL A;  3W3S A;  1Q82 C;  2O5I C;  1ASY A;  1Q1E A;  3C3L A;  1STA A;  1PRT F;  1PH3 A;  2ZIO A;  1W3S A;  2ODR C;  2G5D A;  3ERQ A;  2ZTC A;  4XTV A;  3C2P A;  4IUN A;  1WFQ A;  3KF8 A;  5IGD A;  3LC0 A;  1NYR A;  2EYJ A;  1A3T A;  4UPA A;  4UP7 A;  1HZ9 A;  3I4N B;  5M3F B;  1C0A A;  3CCV A;  3S2D B;  3H09 A;  1X3P A;  4IUR A;  2QIL A;  1EVL A;  1VQF A;  4ULL A;  4DQ2 A;  4X6A H;  2PNH A;  3SE0 A;  5M5Y B;  1DXM A;  2DY7 A;  4A3K G;  3MEF A;  3AFP A;  3KK7 A;  2ODR D;  3BVM A;  3QOJ A;  4DV2 Q;  4WJ3 M;  2RQX A;  1BBW A;  4HR7 B;  3CCQ A;  5IWA L;  2PZU A;  3MXG A;  4HJ7 A;  1CSP A;  2DQ0 A;  3G4S A;  4OWX B;  1RTN A;  3QIA A;  3VA5 A;  2HCC A;  4L5T A;  1DD2 A;  2I5H A;  1PVO A;  1UEB A;  3D6C A;  1E3P A;  4DKA C;  1IYV A;  4AIM A;  2J7Z A;  2HQE A;  1J5W A;  2ZZF A;  3OWE B;  1EFI D;  3CC4 A;  3MFG A;  5GQO A;  2AQ2 B;  3NBH A;  4YYE A;  4A3F H;  1PA6 A;  2EYH A;  1SNM A;  2DTH A;  4IUV A;  2DXU A;  1PYS B;  2NUC A;  2E2J H;  4JBW A;  1VQE A;  4DPG A;  1Z6H A;  1TS2 A;  3V96 A;  3J7Z C;  1EWH A;  1X56 A;  2A8V A;  3OMC A;  3CP0 A;  2UU9 Q;  4C56 C;  3TUP A;  4KI0 A;  2ZTD A;  4NMZ A;  2ZT9 C;  3TP7 A;  2NZO A;  2AWO A;  3I4M H;  5IYD H;  4CKC A;  3CPW A;  1J8I A;  3SEB A;  3KLS A;  1VQN A;  1NCV A;  5C4J H;  1PH8 A;  1JJG A;  2GVA A;  5E3I A;  2B2V C;  1Y1W B;  4MHE A;  5JEA G;  1WTO A;  4P3N A;  1Y8P B;  4K2L A;  4H0L C;  1Z7M A;  3S2H B;  3HXW A;  4JI3 Q;  1GUN A;  2CWP A;  5J22 A;  1NSN S;  5C0X I;  4A3F G;  1PH6 A;  4QY7 A;  1PTO H;  4A93 H;  3VA7 A;  2LS0 1;  3G1Z A;  1YNJ C;  4AYB E;  2C9O A;  4IFD I;  1VMC A;  3KJP A;  3VQW A;  4DR6 Q;  3GTM B;  4LFA L;  3HKZ B;  3JC6 6;  4GKK Q;  1BIA A;  5JPN C;  5C0X H;  2B2W C;  2ZZE A;  3BFM A;  3KDF B;  3S9W A;  2VQF L;  3RN5 A;  3S14 H;  1SES A;  5DM6 3;  1IKL A;  2C5C A;  4IFD H;  2PI2 A;  4F87 A;  2CH4 A;  4LVK A;  2CH4 W;  4YRQ A;  3NPP A;  1S72 A;  1E0B A;  1YNJ D;  1GVP A;  3P7J A;  3GTO H;  1CK1 A;  2E74 C;  2KJX A;  1X55 A;  2JXM B;  3G48 A;  3NE5 B;  2HDM A;  4CKB A;  1CHQ D;  4A3J B;  1SET A;  1SYC A;  3HRK A;  4XTW A;  5A2Q L;  5E1F A;  1RTO A;  3VQY A;  4ID6 A;  2IX3 A;  1XXG A;  5K36 H;  2UUB Q;  1FNW A;  4ZKB B;  3HOZ B;  3HOY H;  2KHS A;  3TP5 A;  3QOL A;  5D3I B;  1SAP A;  1RHP A;  1UEA B;  1LTR D;  1TWF B;  5ELN A;  3T13 A;  1CFM A;  5C3E G;  2EY2 A;  2F3W A;  3L9A X;  4DR2 Q;  3MXN A;  4POF A;  4CH6 A;  1EQV A;  3CC7 A;  4ZYS A;  1B7Y A;  2HHH Q;  5GAE C;  3W2D A;  3GTP B;  5FJ8 H;  4CGY B;  4B3R L;  2D62 A;  4DNR B;  4U67 3;  5I9O A;  1PTO C;  4K2K A;  1SYG A;  4RHR A;  4P75 A;  4KY5 A;  1KC8 C;  1EY4 A;  2EAY A;  2YTX A;  1BCP B;  3GV6 A;  4C1N K;  2ZXP A;  3HXY A;  1EYG A;  3KLR A;  1K8G A;  3BZC A;  5I2X A;  3E0E A;  3EJI A;  3HOY G;  2Q7G A;  1SNC A;  4TVY A;  2Q2I A;  3F2B A;  1KDB A;  1KMN A;  1PTO D;  1EOT A;  1PZJ D;  3I2Z A;  1ADJ A;  1IXR A;  3MQZ A;  1EIY A;  1E2W A;  3GO5 A;  4DR4 Q;  2ZXR A;  3J7A V;  2O2L D;  2NZH A;  2F0P A;  1PFN A;  2E41 A;  1I4Q A;  2JA7 B;  1AFP A;  2CKZ B;  2F0M A;  5M5X H;  1GGM A;  4IN3 A;  3UDF A;  2NVQ B;  5K1P A;  1FYC A;  11AS A;  5FJ8 G;  4A3B G;  2MNA A;  2CVR A;  2KVM A;  3OHX C;  1H9S B;  1PTO F;  4X65 L;  1FGU A;  4BBS H;  4FP5 D;  3VR5 A;  4FO2 A;  4X64 L;  2HDL A;  1M4V A;  3NHH A;  1D2B A;  2WAQ G;  2NVT B;  1XMO L;  2D5D A;  4GN3 B;  5A2Q E;  4DR7 L;  1PH7 A;  1NJ8 A;  3VQX A;  1KDC A;  3HXU A;  4A3G H;  4UY8 C;  4LF5 Q;  1CKN A;  4RWS C;  2ZJP A;  1V1P A;  1X2G A;  1CZG A;  2ZT6 A;  3D4D A;  3GTJ H;  4RDX A;  1PRT B;  2R7Z B;  3HXX A;  4ZAI A;  4KHP Q;  5E7N A;  1V1O A;  4TVA B;  1S5F D;  2VQE L;  3G6J B;  2F03 A;  1N34 Q;  3E9H A;  1QF6 A;  2Q2H A;  1Y1V H;  2F0K A;  5AJ3 L;  4YRS A;  1FJG L;  4IO9 A;  2N55 A;  4JI2 Q;  4KHV A;  2K4K A;  4A3D B;  1H4T A;  3WQZ A;  4EX5 A;  3I91 A;  4S3S A;  4XU3 A;  2DY8 A;  4YCV A;  4MN3 A;  4RCO A;  5IT9 E;  4X62 Q;  2EVB A;  1EIF A;  4NXN L;  4FF2 A;  2C8M A;  5M3M H;  1BF4 A;  1CKM A;  1IBL L;  3N52 A;  3RD4 A;  2JQO A;  2PW5 A;  3CU7 A;  1L0X B;  2IJ0 A;  3PIP 3;  2B29 A;  3PIO 3;  4NCX A;  1VDZ A;  5C44 H;  4JI1 Q;  4BS9 A;  2HQL A;  3M85 A;  5EBC A;  4DUZ L;  2JA6 G;  2L4N A;  3V8J A;  3TSS A;  3CRL C;  1SFO H;  4C3I H;  1EVK A;  4GOP C;  4PHC A;  1K8A C;  4DAY B;  1ET6 A;  1QNU A;  2XGT A;  3EN2 A;  3U9S A;  1XNQ L;  4DK0 A;  2Y0S E;  4DV0 Q;  2H4O A;  3H94 A;  3TS0 A;  4L5Q A;  1YNX A;  1CHP D;  3UGQ A;  2CJA A;  1WI5 A;  1G2T A;  3H0G B;  2K14 A;  1SN8 A;  3E5S A;  3NTH A;  2G9H D;  4AQY L;  4OO1 G;  3P8V A;  4C2M B;  5HGT A;  3SHL A;  2DZ9 A;  1KIX A;  4F8M A;  3W5O A;  1GO3 E;  4NXM L;  1NJ5 A;  4RG1 A;  2UXC L;  1C48 A;  1F9R A;  3NUC A;  1PYS A;  1EQR A;  2BDN A;  3SK5 A;  4A3E B;  3F2U A;  1HZA A;  4XYO A;  4C3J B;  2MJ8 A;  1LTI D;  1MJE A;  3SK8 A;  4K5X A;  3GTL H;  4YCW A;  4XQN A;  4UAI A;  1F77 A;  3FMC A;  4ZUJ A;  2EY5 A;  3NWT A;  1V8Q A;  4DR1 L;  4QF4 A;  3J7Y W;  4A3L G;  1HR0 Q;  1WTP A;  3DXJ C;  3RN2 A;  3UH0 A;  1QOH A;  1K28 A;  3A7A B;  5CMD A;  2F0G A;  3TS2 A;  1VQZ A;  1SJE D;  2L15 A;  3RGL A;  1RL2 A;  1BQQ T;  1IBK Q;  1HRJ A;  1UE6 A;  4HN7 A;  4QIW E;  1VQA A;  4A3K B;  5FLX E;  1JJ2 A;  4LNS A;  4EO4 A;  4I65 A;  1S5C D;  4X3U A;  4YY3 Q;  3K5N A;  2K28 A;  4KY6 A;  1AH9 A;  3P1H A;  5LL6 X;  5GAD C;  1WTQ A;  1I94 Q;  1HNX L;  1ENF A;  1BUV T;  2IHF A;  3OYY A;  1EYD A;  4X66 L;  4IOC A;  1K73 C;  1STH A;  3VBB A;  4R4Q A;  2XNA C;  4MZ9 A;  2ZR2 A;  4CHT B;  3TEG A;  3NQT A;  5M9O A;  2NN6 I;  1NJI C;  4ODG A;  4HJ8 A;  4Y7N H;  3TZU A;  1PH1 A;  1XPO A;  1H9K A;  1PZK D;  2KEE A;  5J1Z A;  3K5O A;  1PYB A;  3A0J A;  3OTO L;  3PZC A;  2R7D A;  1WPY A;  3Q0A A;  5ELE A;  2DKG A;  3KDF A;  5T1I A;  3D31 A;  2NN6 H;  1IBM Q;  1B2T A;  2OEO A;  1O80 A;  4HMJ A;  4ZLT F;  3T1Y L;  1JR0 D;  3HS0 C;  2RBM A;  5JJL A;  5EJW A;  2ZCE A;  1WNL A;  2Q5I A;  2XN9 C;  1ET9 A;  2XTI A;  2RDG A;  5HY6 A;  3L0O A;  2NZ1 D;  1Y1W G;  2EJM A;  4JI6 L;  1GM5 A;  2X69 A;  3CCL A;  2KA7 A;  4RCN A;  2EPB A;  4GN4 B;  1ESR A;  1GUW A;  3EBE A;  1J6Q A;  4PG3 A;  4OHJ A;  2F4I A;  4CDC C;  4GLA C;  1YBY A;  3STB C;  1EY6 A;  4DR5 Q;  1QVG A;  4DK6 C;  1S40 A;  1EL0 A;  3E3X A;  2I5L X;  1N33 Q;  3KJO A;  3FPU B;  1E22 A;  3OSO A;  3J7A 5;  4YWL A;  3V8K A;  2Y0S G;  3V2T A;  3HKZ G;  1HNW Q;  4Z9C B;  3G6E A;  3BZD B;  2ES2 A;  4A3F B;  4LW1 A;  4K87 A;  2E2J B;  1LTA D;  1RD9 D;  5FO8 B;  1F2Z A;  1HUM A;  12AS A;  1WCM H;  4DXF A;  4DV5 Q;  4FVM A;  4HMI A;  4QQB X;  4P71 C;  2WV6 D;  1EZ8 A;  3DM1 A;  3STB D;  5FLM H;  3IKL A;  1G2S A;  1C9O A;  3PF4 A;  4F7X A;  4N8F A;  3LWU A;  4A3J G;  5C53 B;  1EEI D;  4LJZ C;  2VS1 A;  3I4M B;  3R2T A;  1PLF A;  4JI4 L;  5TSS A;  1KD1 C;  4RKL A;  5C4J B;  1HC7 A;  1Y69 U;  1SSO A;  1IW7 C;  4IZ8 A;  3M3Y H;  2F0N A;  4K0K L;  1EWI A;  3J81 E;  3HOZ G;  3J80 L;  2YU9 H;  1HNZ Q;  3CQZ H;  3UDX A;  1PH4 A;  2KHJ A;  3TRZ A;  3Q22 A;  4H2S A;  3M4O H;  5EKL A;  2HD3 A;  3REX A;  1BXT A;  2L9H A;  4U68 A;  1NBW A;  2K1B A;  4HA8 A;  1TXY A;  1PTO B;  5IP9 G;  4LF7 L;  4A93 B;  3LNN A;  1IW7 D;  3D8G A;  5IP7 H;  1EYC A;  5LMN Q;  3NSW A;  1H9S A;  2B2U C;  4CJ1 B;  1BO0 A;  2D9U A;  2K52 A;  3A54 A;  4A4I A;  2O5J C;  1V1Q A;  2WB1 E;  2X6G A;  1Z7T A;  2A1A A;  2AWN A;  3S14 B;  5JJK A;  4YWK A;  1IHZ A;  3C1F A;  4OWW B;  1H95 A;  3WOF A;  5IGE A;  1X65 A;  1B3A A;  1KAB A;  4GKJ Q;  3NTI A;  2DJF C;  5GAG C;  2L11 A;  2D0O A;  3GTO B;  1OTC A;  5KND A;  1D5X C;  4X3K A;  2F0V A;  2JJQ A;  1YFS A;  4XQJ A;  2ICE C;  3HZX A;  4DV1 Q;  1LYL A;  4KKU A;  1QZG A;  2A6H C;  1VQ4 A;  2PNR C;  2UXB L;  4LK1 C;  4BY1 H;  1STE A;  3HOY B;  4EVO A;  1V9P A;  3C46 A;  1IKM A;  1S5B D;  2JA7 G;  3IL8 A;  1PYW D;  1HTP A;  5ISR A;  2B8F A;  1C4Q A;  2IWH A;  1AE2 A;  1T5X D;  1FYF A;  2IX1 A;  1CQF A;  3X3M A;  5KRU A;  1XMQ L;  1H4V B;  4JCV E;  3MF1 A;  2SNM A;  4GLX A;  3SK6 A;  1TS4 A;  1I4H A;  2AQ1 B;  2OQ0 A;  4XT1 B;  1VQG A;  4JV5 Q;  2F0T A;  3HGB A;  1EY7 A;  1TS3 A;  1LT5 D;  4RGT A;  1BBX C;  1RDP D;  4K86 A;  3NTK A;  1S3O A;  4DFA A;  3REU A;  4EQ5 A;  3J80 E;  2DTO A;  3T16 A;  3DMU A;  2R7Z G;  3KLW A;  4YWM A;  3CMQ A;  4DV7 Q;  4P73 C;  2B39 A;  3M4Q A;  1SMY C;  3LGJ A;  4QGU A;  2K05 A;  2QKI C;  1O7I A;  2PCF B;  5BN5 A;  4H2Y A;  3A31 A;  2CWA A;  3MC0 B;  3FDT A;  2L12 A;  1G6Z A;  3RKX A;  2EXZ A;  1HH2 P;  4G84 A;  1K83 H;  2RF4 A;  2F4V Q;  5M5X B;  4DV4 Q;  4XT3 B;  2KCN A;  4GOP B;  3M7G A;  2Z4I A;  3FRP B;  3W3A A;  4B3M Q;  2JSO A;  1SMY D;  4RKB A;  1E24 A;  2AUJ D;  3T4A C;  1HHV A;  4XEO A;  2PZT A;  2ARU A;  3U4Z A;  4YRJ A;  3U50 C;  4XU0 A;  1TWH H;  3A7A A;  1JIC A;  2YV5 A;  4XXE A;  3PIP A;  3PIO A;  4QB4 A;  2DDZ A;  2ZIN A;  2WKD A;  2OF1 A;  2PW7 A;  4JI8 Q;  1J5E Q;  4XQQ A;  5JAV A;  1X6O A;  3QO2 A;  3I73 A;  2YTV A;  2WB1 G;  4A3G B;  5ELC A;  4H2W A;  2UUC L;  1M8A A;  1TWC H;  1CKN B;  2I0Q A;  1V1P B;  3S16 H;  5EBD A;  3QB3 A;  1PDQ A;  1SRU A;  3G7L A;  3GTJ B;  4TQD A;  1I50 B;  3TP6 A;  5IOD A;  4A3E G;  1PH2 A;  3VQV A;  4LF6 Q;  1IL2 A;  3WDN A;  1Y1V B;  4C3J G;  3VR3 A;  2UU9 L;  1TY2 A;  4Q0F A;  4R4C A;  3D4R A;  3OMG A;  1STN A;  2RKS A;  4WI1 A;  1QUQ B;  4R4T A;  2A73 B;  2E2H H;  1R4Q B;  1E1O A;  1O78 A;  2B2V A;  1RIQ A;  4RAU C;  1X01 A;  1JOR A;  4YRN A;  4E51 A;  5M5W H;  3V8L A;  5M3M B;  4QCL A;  1XJV A;  3E6Z X;  3CMA A;  4YHH Q;  2WFW A;  1H9R A;  2L1B A;  4KKT A;  4YRT A;  1JMC A;  5CBA E;  1SYF A;  1WYD A;  4JI3 L;  1SFO B;  1VF7 A;  2N78 A;  4C3I B;  2F0U A;  4YIJ A;  5J39 A;  2DN8 A;  4KQE A;  3I90 A;  1YHB A;  2F0L A;  1W2B A;  4HVC A;  2N49 A;  2NVY H;  4N8X 1;  2RCN A;  2B2W A;  1PMR A;  3TZD A;  3ERO A;  4DR6 L;  3MXP A;  3AB9 A;  5BN4 A;  1EEF D;  4DR3 Q;  4GKK L;  4XTX A;  2H1E A;  4TRD A;  4XEM A;  3M9B A;  2JA8 H;  4DUY Q;  4IJL A;  4DV3 Q;  4B3T Q;  1LT6 D;  4YRF A;  3RKY A;  1K3B C;  1SXT A;  3H6M A;  2RA4 A;  3LX0 A;  3UDG A;  3EQL C;  2XIW A;  2UXD Q;  3CPF A;  3GTL B;  1NR2 A;  2D2C C;  3NQI A;  2CCZ A;  5C3W A;  3I3C A;  3JAM E;  3BU2 A;  2KED A;  3IKM B;  1A0I A;  2BH2 A;  2NS6 A;  2MUY A;  1SNP A;  1MBY A;  4HJ5 A;  5ELD A;  4PMW A;  1Q86 C;  5JPM C;  2UUB L;  1GUG A;  2K5N A;  1B9N A;  1N9W A;  1NNX A;  4P2C B;  2KQ3 A;  2QHU A;  4CS4 A;  1LAB A;  2I4M A;  2EWN A;  2I4N A;  2IW3 A;  4JG2 A;  1GUS A;  2F0Q A;  1HA5 A;  2DNE A;  5CV8 A;  3GTQ H;  2CIM A;  1OXS C;  3RUZ A;  1QIL A;  5EKK A;  1QVF A;  2FYK A;  4NW2 A;  4JVZ A;  2HHH L;  2FMM A;  2MP1 A;  1MSG A;  2ICI A;  4Y7N B;  2ZJQ A;  2VUM H;  4LWC A;  2DU7 A;  2V1C C;  4ZUI A;  1VQH A;  2Q8I B;  2R93 H;  2E10 A;  2Y0S B;  3RZD H;  1I4R A;  2PQA B;  3B6Y A;  1VQL A;  4R4O A;  4XU2 A;  2K5H A;  4JYA Q;  4J6H A;  3A5Y A;  3I4M G;  4XTZ A;  1FGB D;  4JW0 A;  5IYD G;  2BE5 C;  2BCO A;  3NEM A;  4M8A A;  5KYL A;  5IWA Q;  3ONA B;  2SOB A;  1XNR L;  1ATI A;  1B9M A;  2CFM A;  4KV6 A;  4K6D A;  3ULJ A;  4OXP A;  1GHJ A;  1I6V C;  2BH8 A;  3HOW H;  4DR4 L;  4B9X A;  1HFG A;  1YFR A;  1CT1 D;  1JB3 A;  1YIJ A;  1L2F A;  1MD2 D;  4R8N A;  3CCU A;  2K33 A;  2EZV A;  4A3C H;  2DZC A;  2N3S A;  4YDQ A;  1QE0 A;  2BE5 D;  2Q7H A;  2EE1 A;  2JYO A;  1NUC A;  2M9V A;  3A5Z B;  1DCZ A;  1U0L A;  1X3Q A;  1D5M C;  2IT1 A;  1Q46 A;  4A93 G;  2LXJ A;  4MTK A;  4LFC L;  1JOO A;  3Q8D A;  3KOJ A;  3RR5 A;  1XWE A;  4A76 A;  4QIW B;  1AE3 A;  3BYT B;  4C3H H;  1LLR D;  1SJH D;  1GKH A;  5C0X G;  3MZ5 A;  1EFW A;  5EGT A;  1ILP A;  1L1O C;  3GDE A;  1QE6 A;  2B2T C;  2IY5 B;  3P8T A;  3IFT A;  1WCM B;  4ZKC B;  4IFD G;  1I3Q H;  5IT9 L;  5FO7 B;  1GOZ A;  4YRR A;  2QEJ C;  4MNO A;  1E2Z A;  4GNX A;  1Q8K A;  4YPF A;  1J9O A;  1LTL A;  2XSC A;  1SEB D;  1I6H H;  5KNN A;  1PV4 A;  4KHP L;  1JE5 A;  2AQ3 B;  1N34 L;  4J1M A;  4F88 A;  2Q8T A;  1STB A;  2RSO A;  5K36 G;  3SK4 A;  1TT2 A;  4JI2 L;  3V7R A;  2HT1 A;  1K3R A;  1N36 Q;  3M3Y B;  3KLS X;  1QVC A;  3TBI B;  1LO5 D;  5KNB A;  2M00 A;  1M1K C;  2KHI A;  3M4O B;  2KCT A;  5LL6 S;  5I4D A;  4C3H G;  5GRO A;  2KOL A;  1PFS A;  3S15 H;  3PSI A;  3BVG A;  4LVI A;  2J3L A;  2VQF Q;  4JI1 L;  1I4X A;  4GOP A;  1WLE A;  1C8C A;  1VQ7 A;  3F8T A;  3K5M A;  1UE7 A;  2I07 B;  1STG A;  1RF2 D;  3OWF A;  5IGC A;  2KCC A;  2R6G A;  4LMQ D;  4GLV B;  1Y14 B;  2LKV A;  3CRK C;  4AYB G;  4HIK A;  4LFB L;  5EQ0 A;  4MTN A;  2UUA Q;  3SDZ A;  1KRS A;  3ICE A;  4P74 A;  5IGF A;  1R4P B;  3TN2 A;  2ZM6 Q;  4FXG C;  4LF9 L;  1B8A A;  3DWA A;  1YJ9 A;  4UHV A;  1N32 L;  1AEX A;  3GTK H;  1HFN A;  2F0J A;  2KEC A;  1XTC D;  4WFN 3;  3I4L A;  4YRI A;  4CJ0 B;  1JB7 A;  2GA4 B;  3RZO H;  5IOC A;  3IKJ A;  1EOV A;  4H13 C;  5FLX L;  3BDL A;  4G7Z C;  4RH6 A;  4FXD A;  1O7Z A;  2L0C A;  4BBR H;  1PHJ A;  2CGH A;  4JI5 Q;  5JVH 3;  4DNI A;  4GNX C;  3FVQ A;  3I70 A;  1NNH A;  3IAL A;  1P16 A;  4DV6 Q;  4BY1 B;  5FOB B;  1VQK A;  4L5S A;  2O4X A;  3I4O A;  2VB2 X;  4IAL A;  4DA2 A;  4NB3 A;  4R8I A;  1QUQ A;  1NJ1 A;  5KEE A;  1HR0 L;  2OCE A;  4WJW A;  3GD7 A;  2WIN B;  2Z6K A;  2JK8 A;  1K0S A;  4A3I H;  1NTG A;  1K8M A;  5ELF A;  4BBS G;  1E2V A;  1YGB A;  1U4R A;  2F0E A;  4YRE A;  1I94 L;  1TII D;  2ZXO A;  1L0Y B;  4DNT B;  3MEH A;  5CR3 A;  3CD6 A;  1IYU A;  4A3G G;  1P8L A;  4Y52 H;  1ZKO A;  1PH9 A;  3K81 C;  2JEA I;  2ZTG A;  4JOI C;  1RJT A;  4YRL A;  1SRY A;  2F3V A;  1A2U A;  3HTZ A;  1PFM A;  3RLO A;  3S24 A;  3UE0 A;  2QGQ A;  2OQK A;  1MSH A;  2WB1 B;  3I4N H;  1QB5 D;  1B4O A;  1TWA H;  2EYL A;  1Y1V G;  5IY0 A;  1K9M C;  3PQI A;  3Q23 A;  1JCK B;  2IPK D;  3VR2 A;  1YJW A;  1IBM L;  2K7V A;  3OIQ A;  4OX9 L;  4P74 C;  5HUR A;  3K7A H;  2BA1 A;  4CDD C;  3D3R A;  2RHS A;  4GN5 A;  2DTI A;  1T5E A;  3QG1 A;  2NVX H;  1ASZ A;  1JWS D;  1K83 B;  2XVS A;  5M3M G;  4TSS A;  1EY0 A;  5EPL A;  3PV0 A;  2AUK A; 
#chains in the Genus database with same CATH homology
 3S1M H;  2KCM A;  5LMU Q;  5C44 G;  3HKS A;  1R9T H;  4RQF A;  2E8G A;  2ZT8 A;  3T1H Q;  3D0F A;  1UE1 A;  5IYC H;  1Q81 C;  4YRM A;  2Z6K C;  1N33 L;  3CAM A;  4P71 A;  3S17 H;  2VNU D;  4IOA A;  3AEV A;  4H02 A;  1A62 A;  4NPS A;  2PMZ E;  3G71 A;  1G5I A;  4H2U A;  4NXN Q;  1BVS A;  2ZT5 A;  2PQA A;  4HWT A;  3J80 i;  5JEA J;  3FJP A;  1X54 A;  1G6P A;  4DUZ Q;  3A32 A;  1XPR A;  4ZTU B;  3E9I A;  1HNZ L;  2HNI A;  5IYC G;  3EIV A;  4CH4 A;  3FHW A;  5IYB H;  3MEY A;  1NMF A;  1SRO A;  3PO3 H;  3A5Z A;  5C4X H;  1FVI A;  4CS2 A;  5C51 B;  3RLF A;  1D7Q A;  3L2P A;  3ERS X;  3NEL A;  4DR1 Q;  4GKJ L;  2NN6 G;  4Q6G A;  2IY5 A;  3HOV H;  1VS0 A;  4HID A;  2K5V A;  3HXZ A;  1HR0 W;  3J80 c;  2A8E A;  3HY1 A;  5IYB G;  1BBU A;  3S1Q H;  3CF5 A;  1H4S A;  4LF8 L;  4YRG A;  3PO3 G;  5C52 B;  3OTO Q;  1WU7 A;  3ER0 A;  2I4L A;  4CH5 A;  3M7N A;  2MFI A;  5ELO A;  3CCM A;  3HOV G;  3PUY A;  4LUO A;  4QJF A;  3M4P A;  3T1Y Q;  1WCM G;  4JV5 L;  2Q2U A;  5FLM G;  2OTJ A;  3UGT A;  4RQE A;  4BA1 I;  2JA5 H;  4DK3 C;  1BKB A;  4P73 A;  4PZ8 A;  1ADY A;  1NJ2 A;  4LF4 Q;  2C35 B;  3A5U A;  4BY7 H;  2Q5H A;  3L7Z C;  4YRC A;  5BR8 Q;  2QHT A;  3HXV A;  1IZ6 A;  1VQJ A;  1G5H A;  3K0X A;  3A7R A;  1HZB A;  2ZNI A;  1KMM A;  4OON A;  2F4V L;  4DV4 L;  2ID0 A;  4OWT B;  3KFU A;  3PUW A;  4GS3 A;  3UDI A;  4B3M L;  3KF6 A;  4BA2 I;  4AH6 A;  5IP7 G;  3HOU H;  2EXD A;  3DM3 A;  2I5M X;  4XTU A;  3WWV A;  3SGI A;  4XIG S;  1VQM A;  2FXQ A;  2E64 A;  1J5E L;  4KLK A;  1CUK A;  3A74 A;  2I4O A;  4A3M H;  4JI4 Q;  3QNE A;  4JI7 Q;  4CS3 A;  1A8V A;  5EAY A;  1UWV A;  4GNX B;  2MO1 A;  4JC0 A;  5J3B A;  3TEH B;  3GTG H;  5DLQ E;  2E5A A;  3S1N H;  2EJ9 A;  4HWO A;  1D8L A;  4BY1 G;  4OP0 A;  3PUV A;  2E5L Q;  2R92 H;  4OLF A;  3UFG A;  2LSS A;  4YHH L;  4JI0 Q;  4HWR A;  1RIP A;  2N8N A;  1LUZ A;  4DV2 L;  4H2X A;  4APV A;  1Q1B A;  1T9H A;  3RUX A;  3HFZ B;  4DR3 L;  2ATW A;  1KHI A;  2QEX A;  3RAC A;  4DUY L;  4B3T L;  4DV3 L;  2HIX A;  2UXD L;  2G4C A;  1SMX A;  1KRT A;  1VQ6 A;  1YFT A;  4B3S Q;  2IX0 A;  1NY4 A;  3MF2 A;  3I56 A;  1N8R C;  3S1R H;  1SER A;  3P8Y A;  1YIT A;  4P3P A;  1HJP A;  2ARS A;  3PO2 H;  5JJI A;  1YHA A;  1NYQ A;  2B63 H;  1OXX K;  3U4V A;  3FKI H;  3VDY A;  1SE8 A;  2F3I A;  2K75 A;  2CJB A;  4JYA L;  2EIF A;  3CCR A;  1YHQ A;  2OWO A;  3H15 A;  4TWA A;  1TWG H;  2RHS B;  3V7S A;  4FDB A;  1VQP A;  1JJC B;  2F52 A;  3PO2 G;  3L1A A;  1KQS A;  1KL9 A;  2UUC Q;  1DGS A;  1MIU A;  2PI2 E;  1KXL A;  3HOX H;  4IJH A;  3LSQ A;  2B63 G;  1L1O A;  3FKI G;  4LVM A;  4DR2 L;  2JA8 G;  1L0W A;  1YB3 A;  1M90 C;  2E1H A;  3RNU A;  1KAW A;  4QL5 A;  3QO5 A;  1WQW A;  3CCS A;  3PCO B;  5F5W A;  1VQ5 A;  1SLJ A;  1I5F A;  1OXU A;  4TQU S;  3V7C A;  4LVL A;  1N36 L;  2Z0S A;  3TQY A;  4JBM A;  3HOX G;  1X9N A;  2DXT A;  5C3E H;  2MO0 A;  2WAQ E;  2ZNJ A;  4H2T A;  1WOC A;  2GVB A;  4R1J A;  2VL6 A;  2VUM G;  1Q12 A;  5IT9 c;  2GN5 A;  3TRE A;  2R93 G;  3RIR A;  3K7U C;  2UUA L;  4Q15 A;  2ZM6 L;  2ALY A;  4LF5 L;  5H1S E;  1YJN A;  4LUV A;  4L87 A;  2KBN A;  2JA9 A;  1YVC A;  1EQQ A;  1E7Z A;  1G51 A;  3TEH A;  3HOW G;  4JI5 L;  3PF5 A;  4DV6 L;  1X3E A;  1XTD A;  2A19 A;  1VQO A;  4ME3 A;  4A3C G;  4P72 A;  3IRB A;  3AFQ A;  3DSQ A;  2JE6 I;  4HJA A;  4A3B H;  3F2D A;  4X62 L;  2E2I H;  4LFA Q;  4WF2 A;  2B3G A;  3K80 C;  4LUZ A;  2ZIM A;  4JOI A;  2DU5 A;  2KEN A;  1X3F A;  2AMC A;  2YTY A;  1XNR Q;  4DV0 L;  3HFZ A;  3CCE A;  2E3C A;  3J81 j;  4XU1 A;  5FLX c;  2QHS A;  3CC2 A;  1YZ6 A;  3L4G A;  2DUD A;  4LVJ A;  4WJ4 A;  4LNQ A;  4YCU A;  1WJJ A;  4HT4 A;  4LFC Q;  4KHZ A;  2ASB A;  2ART A;  4RMF A;  3EFR A;  1EUJ A;  3K8A A;  5LMU L;  2Q2T A;  1U5K A;  2JA6 H;  1C7Y A;  4YRP A;  1NJ6 A;  3KF6 B;  2ZXF A;  3CCJ A;  2CJ9 A;  1H4Q A;  4P72 C;  4B3R Q;  1Q7Y C;  1Z7N A;  3T1H L;  4OO1 I;  3J81 i;  3W1G A;  1IBK L;  1I50 H;  2AKW B;  3UE1 A;  1HZC A;  4P75 C;  4YY3 L;  2ZR3 A;  2CQO A;  3CW2 C;  4KR3 A;  4JBK A;  4UP8 A;  3FP9 A;  3ICA A;  2VW9 A;  2ZGW A;  2EL9 A;  4BBR G;  4IPD A;  5M3F H;  4HIM A;  4DAM A;  1IYJ B;  3S2D H;  2ZTE A;  2BA0 A;  2DJZ A;  5M5Y H;  5IE8 A;  4A3L H;  2P0L A;  2PME A;  5GAH C;  1QZH A;  4A3I G;  4X65 Q;  1WQ7 A;  4PZ7 A;  4LFB Q;  1JJC A;  3HKZ E;  2VY3 A;  4X64 Q;  1XMO Q;  4LF9 Q;  4DR7 Q;  2RHQ B;  2E65 A;  1N32 Q;  1NE3 A;  1B70 B;  1MJC A;  1Z9F A;  3J81 c;  4H2X B;  2ZJR A;  4DR5 L;  4IPC A;  3OD1 A;  3I4N G;  5M3F G;  2VQE Q;  1HNW L;  5AJ3 Q;  1FJG Q;  4IPG A;  1HTT A;  1VQ8 A;  3PUZ A;  2DVE A;  2VZA A;  4DV5 L;  3PGZ A;  4TQF A;  3PCO A;  2J3M A;  1VQB A;  1W66 A;  1OXV A;  5K1X A;  2DEQ A;  1IBL Q;  1Y1W H;  3RKW A;  4P3O A;  3F2C A;  3S2H H;  3H3V I;  4O2D A;  1CKO A;  3RL6 A;  4POG A;  1XNQ Q;  1LM0 A;  4ALP A;  1OXT A;  2QHV A;  3H3V H;  4XTC S;  3U58 A;  3GTM H;  4PZ6 A;  4AQY Q;  3AQQ A;  4JBJ A;  4OX9 Q;  4NXM Q;  4BW9 A;  2EJG A;  1V43 A;  4KR2 A;  3KF8 B;  2R7F A;  4J15 A;  5LMN L;  1VQD A;  3L2Z A;  3PUX A;  4A3J H;  4LF4 L;  3I7F A;  3NEN A;  2K50 A;  4BWA A;  5BR8 L;  3HOZ H;  3R07 A;  5HGQ A;  1Z47 A;  2P5I A;  4DV1 L;  3A7U A;  1TWF H;  2EJF A;  2UXC Q;  1HNX Q;  5C0X J;  4X66 Q;  3NBH B;  5IP9 H;  3QO8 A;  4IFD J;  5C4X G;  3I55 A;  3GTP H;  4BXX H;  2C7I A;  1VCI A;  1L1O B;  3HRI A;  1E1T A;  1UE5 A;  1KOG A;  4HWP A;  4JI7 L;  3RF1 A;  3IG2 A;  3QO7 A;  3CXC A;  2ZT7 A;  2H5X A;  3AYH B;  4HIO A;  4H2V A;  4JI6 Q;  3QTC A;  4YRO A;  4DV7 L;  1VQ9 A;  2JA7 H;  3OW2 A;  3ERR A;  2E5L L;  2ZZG A;  2QA4 A;  2NVQ H;  4A75 A;  3JAM i;  4BXX G;  4JI0 L;  1VQC A;  4R4I A;  1YEZ A;  2NVT H;  3HFV A;  2LXK A;  1BIB A;  1PH5 A;  3BZK A;  2OTL A;  2AKW A;  4YRK A;  2JA5 G;  4JI8 L;  4TVA A;  1NMG A;  2R7Z H;  2ALY B;  4YP0 A;  4HWS A;  4X5O A;  4BY7 G;  2D0P A;  4LF8 Q;  4A3D H;  3KYH C;  4K0K Q;  3F1Z A;  4TVW A;  4ZIB A;  1A63 A;  2MQH A;  4LF6 L;  2EQS A;  1JT8 A;  3MXN B;  4B3S L;  4ZTZ B;  4L5R C;  4IPH A;  1VQI A;  1USY A;  3ULL A;  1B7Y B;  1B76 A;  4LF7 Q;  4CH3 A;  4XTY A;  2DQ3 A;  3HOU G;  3DLL A;  1K0R A;  3JAM c;  2IHE A;  1G29 1;  1MKH A;  2HIV A;  3HY0 A;  1FL0 A;  4HJ9 A;  3W1B A;  5LMN W;  4K88 A;  3EFS A;  2JEB I;  3ULP A;  3H0G H;  4O0A A;  1SR3 A;  2RHQ A;  2Q7E A;  4A3M G;  2PMF A;  1X2H A;  4C2M H;  1B70 A;  2AMC B;  4A3D G;  4UP9 A;  2YYZ A;  3BJU A;  3RLN A;  4A3E H;  1EIY B;  4C3J H;  1YI2 A;  1X3G A;  2UXB Q;  3L4G B;  1CSQ A;  1HXD A;  3LSS A;  1GD7 A;  2R92 G;  3NET A;  4TTV A;  3ZJY C;  4G85 A;  2DGY A;  1XMQ Q;  4A3K H;  2WP8 J;  3H0G G;  2AHO B;  1USY C;  3CME A;  1XPU A;  3W3S A;  1Q82 C;  1ASY A;  1Q1E A;  1PH3 A;  2ZIO A;  1W3S A;  2ODR C;  2ZTC A;  4XTV A;  1WFQ A;  3LC0 A;  1NYR A;  4UPA A;  4UP7 A;  1HZ9 A;  1C0A A;  3CCV A;  1EVL A;  1VQF A;  4DQ2 A;  4X6A H;  2PNH A;  4A3K G;  3MEF A;  3AFP A;  2ODR D;  4DV2 Q;  4WJ3 M;  1BBW A;  3CCQ A;  5IWA L;  4HJ7 A;  1CSP A;  2DQ0 A;  3G4S A;  4OWX B;  4L5T A;  2I5H A;  1PVO A;  1UEB A;  1E3P A;  4DKA C;  4AIM A;  1J5W A;  2ZZF A;  3CC4 A;  5GQO A;  4YYE A;  4A3F H;  1PA6 A;  2DTH A;  2DXU A;  1PYS B;  2E2J H;  4JBW A;  1VQE A;  4DPG A;  3J7Z C;  1X56 A;  2A8V A;  2UU9 Q;  3CP0 A;  3TUP A;  4KI0 A;  2ZTD A;  2NZO A;  2AWO A;  3I4M H;  5IYD H;  3CPW A;  1VQN A;  5C4J H;  1PH8 A;  1JJG A;  2GVA A;  5E3I A;  5JEA G;  4P3N A;  1Z7M A;  3HXW A;  4JI3 Q;  2CWP A;  5C0X I;  4A3F G;  1PH6 A;  4QY7 A;  4A93 H;  3G1Z A;  4AYB E;  4IFD I;  3KJP A;  3VQW A;  4DR6 Q;  4LFA L;  3JC6 6;  4GKK Q;  1BIA A;  2ZZE A;  3BFM A;  3KDF B;  2VQF L;  3RN5 A;  3S14 H;  1SES A;  2PI2 A;  4LVK A;  4YRQ A;  1S72 A;  1GVP A;  3GTO H;  3G48 A;  1X55 A;  1SET A;  3HRK A;  4XTW A;  3VQY A;  2UUB Q;  3HOY H;  5ELN A;  5C3E G;  4DR2 Q;  4POF A;  4CH6 A;  3CC7 A;  1B7Y A;  2HHH Q;  5GAE C;  5FJ8 H;  4B3R L;  2D62 A;  4P75 A;  1KC8 C;  2EAY A;  2YTX A;  3HXY A;  1EYG A;  1K8G A;  3BZC A;  3E0E A;  3HOY G;  2Q7G A;  4TVY A;  2Q2I A;  3F2B A;  1KMN A;  3I2Z A;  1ADJ A;  1IXR A;  3MQZ A;  1EIY A;  3GO5 A;  4DR4 Q;  2NZH A;  2E41 A;  2CKZ B;  5M5X H;  1GGM A;  3UDF A;  5K1P A;  11AS A;  5FJ8 G;  4A3B G;  2MNA A;  4X65 L;  1FGU A;  4BBS H;  4X64 L;  2WAQ G;  1XMO L;  4GN3 B;  4DR7 L;  1PH7 A;  1NJ8 A;  3VQX A;  3HXU A;  4A3G H;  4UY8 C;  4LF5 Q;  1CKN A;  2ZJP A;  1X2G A;  2ZT6 A;  3GTJ H;  4RDX A;  3HXX A;  4KHP Q;  5E7N A;  4TVA B;  2VQE L;  1N34 Q;  3E9H A;  1QF6 A;  2Q2H A;  1Y1V H;  5AJ3 L;  4YRS A;  1FJG L;  4IO9 A;  4JI2 Q;  1H4T A;  2K4K A;  3WQZ A;  4EX5 A;  4XU3 A;  4YCV A;  4X62 Q;  1EIF A;  4NXN L;  2C8M A;  5M3M H;  1IBL L;  1CKM A;  2JQO A;  2B29 A;  4NCX A;  5C44 H;  4JI1 Q;  2HQL A;  3M85 A;  4DUZ L;  2JA6 G;  3V8J A;  1SFO H;  4C3I H;  1EVK A;  4GOP C;  4PHC A;  1K8A C;  4DAY B;  2XGT A;  3EN2 A;  1XNQ L;  2Y0S E;  4DV0 Q;  3TS0 A;  4L5Q A;  1YNX A;  3UGQ A;  2CJA A;  1WI5 A;  2K14 A;  1SN8 A;  4AQY L;  4OO1 G;  3P8V A;  2DZ9 A;  1KIX A;  3W5O A;  1GO3 E;  4NXM L;  1NJ5 A;  4RG1 A;  1PYS A;  1EQR A;  1HZA A;  1MJE A;  3GTL H;  4YCW A;  4DR1 L;  4A3L G;  1HR0 Q;  3RN2 A;  3UH0 A;  3TS2 A;  1VQZ A;  2L15 A;  3RGL A;  1RL2 A;  1IBK Q;  1UE6 A;  4QIW E;  1VQA A;  1JJ2 A;  4LNS A;  4EO4 A;  4YY3 Q;  1AH9 A;  2UXC L;  5GAD C;  1I94 Q;  1HNX L;  2IHF A;  3OYY A;  4X66 L;  4IOC A;  1K73 C;  3VBB A;  4R4Q A;  4MZ9 A;  2ZR2 A;  3TEG A;  2NN6 I;  1NJI C;  4HJ8 A;  4Y7N H;  1PH1 A;  1XPO A;  1PYB A;  3A0J A;  3OTO L;  3PZC A;  2R7D A;  1WPY A;  2DKG A;  3KDF A;  3D31 A;  1IBM Q;  3T1Y L;  5JJL A;  2ZCE A;  1WNL A;  2Q5I A;  2XTI A;  5HY6 A;  3L0O A;  1Y1W G;  4JI6 L;  1GM5 A;  3CCL A;  4GN4 B;  3EBE A;  1J6Q A;  4PG3 A;  4GLA C;  1YBY A;  3STB C;  1QVG A;  4DR5 Q;  4DK6 C;  1S40 A;  2I5L X;  1N33 Q;  3KJO A;  3J7A 5;  1E22 A;  3V8K A;  4YWL A;  2Y0S G;  3HKZ G;  1HNW Q;  3G6E A;  2ES2 A;  4LW1 A;  4K87 A;  12AS A;  1WCM H;  4DV5 Q;  4P71 C;  4QQB X;  3STB D;  5FLM H;  3IKL A;  1C9O A;  3PF4 A;  4A3J G;  5C53 B;  2VS1 A;  4JI4 L;  1KD1 C;  1HC7 A;  3M3Y H;  4K0K L;  3HOZ G;  1EWI A;  2YU9 H;  1HNZ Q;  3CQZ H;  3UDX A;  1PH4 A;  2KHJ A;  3TRZ A;  4H2S A;  3M4O H;  3REX A;  1NBW A;  4HA8 A;  1TXY A;  5IP9 G;  4LF7 L;  5IP7 H;  5LMN Q;  2K52 A;  4A4I A;  1V1Q A;  2WB1 E;  2A1A A;  2AWN A;  5JJK A;  4YWK A;  4OWW B;  1H95 A;  1X65 A;  4GKJ Q;  5GAG C;  2D0O A;  1OTC A;  2JJQ A;  1YFS A;  4DV1 Q;  1LYL A;  1QZG A;  1VQ4 A;  2UXB L;  4BY1 H;  1V9P A;  2JA7 G;  1AE2 A;  1FYF A;  2IX1 A;  1H4V B;  1XMQ L;  4JCV E;  3MF1 A;  4GLX A;  2OQ0 A;  1VQG A;  4JV5 Q;  4K86 A;  1S3O A;  3REU A;  4EQ5 A;  2DTO A;  2R7Z G;  3KLW A;  4YWM A;  3CMQ A;  4DV7 Q;  4P73 C;  3M4Q A;  3LGJ A;  4QGU A;  1O7I A;  4H2Y A;  3A31 A;  2CWA A;  3RKX A;  1HH2 P;  4G84 A;  1K83 H;  2RF4 A;  2F4V Q;  4DV4 Q;  4GOP B;  4B3M Q;  1E24 A;  4XEO A;  2ARU A;  3U4Z A;  4YRJ A;  3U50 C;  4XU0 A;  1TWH H;  3A7A A;  2YV5 A;  3PIP A;  3PIO A;  2DDZ A;  2ZIN A;  4JI8 Q;  1J5E Q;  1X6O A;  2YTV A;  2WB1 G;  4H2W A;  2UUC L;  1TWC H;  1CKN B;  2I0Q A;  3S16 H;  4TQD A;  1SRU A;  4A3E G;  1PH2 A;  3VQV A;  4LF6 Q;  1IL2 A;  2UU9 L;  4R4C A;  4WI1 A;  1QUQ B;  4R4T A;  2E2H H;  1E1O A;  1RIQ A;  1X01 A;  4YRN A;  4E51 A;  5M5W H;  3V8L A;  1XJV A;  3CMA A;  4YHH Q;  2WFW A;  4YRT A;  1JMC A;  1WYD A;  4JI3 L;  2N78 A;  4KQE A;  1YHB A;  1W2B A;  4HVC A;  2N49 A;  2NVY H;  2RCN A;  4DR6 L;  4GKK L;  4DR3 Q;  4XTX A;  4XEM A;  3M9B A;  2JA8 H;  4DUY Q;  4IJL A;  4DV3 Q;  4B3T Q;  4YRF A;  3RKY A;  3UDG A;  2UXD Q;  3CPF A;  2CCZ A;  3BU2 A;  3IKM B;  1A0I A;  2BH2 A;  2NS6 A;  4HJ5 A;  4PMW A;  1Q86 C;  2UUB L;  2K5N A;  1N9W A;  2QHU A;  4CS4 A;  2I4M A;  2EWN A;  2I4N A;  4JG2 A;  3GTQ H;  2CIM A;  1OXS C;  1QVF A;  2FYK A;  2HHH L;  2DU7 A;  2ZJQ A;  2VUM H;  4LWC A;  2V1C C;  1VQH A;  2R93 H;  2E10 A;  3RZD H;  2PQA B;  3B6Y A;  1VQL A;  4R4O A;  4XU2 A;  2K5H A;  4JYA Q;  3A5Y A;  3I4M G;  4XTZ A;  5IYD G;  3NEM A;  5IWA Q;  1XNR L;  1ATI A;  2CFM A;  3ULJ A;  4OXP A;  2BH8 A;  4DR4 L;  3HOW H;  1YFR A;  1YIJ A;  1L2F A;  3CCU A;  4A3C H;  2DZC A;  2N3S A;  4YDQ A;  1QE0 A;  2Q7H A;  3A5Z B;  1U0L A;  4A93 G;  2IT1 A;  1Q46 A;  2LXJ A;  4LFC L;  3Q8D A;  3KOJ A;  3RR5 A;  4A76 A;  1AE3 A;  4C3H H;  1GKH A;  5C0X G;  1EFW A;  1L1O C;  3GDE A;  2IY5 B;  3P8T A;  4IFD G;  1I3Q H;  4YRR A;  4MNO A;  4GNX A;  1Q8K A;  4YPF A;  1LTL A;  1I6H H;  5KNN A;  1PV4 A;  4KHP L;  1JE5 A;  1N34 L;  5K36 G;  4JI2 L;  3V7R A;  2HT1 A;  1K3R A;  1N36 Q;  1QVC A;  1M1K C;  2KHI A;  2KCT A;  5GRO A;  1PFS A;  3S15 H;  3PSI A;  4LVI A;  2J3L A;  2VQF Q;  4JI1 L;  4GOP A;  1WLE A;  1VQ7 A;  3F8T A;  1UE7 A;  2R6G A;  4GLV B;  1Y14 B;  4AYB G;  4HIK A;  4LFB L;  4MTN A;  2UUA Q;  1KRS A;  3ICE A;  4P74 A;  2ZM6 Q;  4LF9 L;  1B8A A;  1YJ9 A;  1N32 L;  3GTK H;  4YRI A;  1JB7 A;  3RZO H;  1EOV A;  4BBR H;  1PHJ A;  2CGH A;  4JI5 Q;  4DNI A;  4GNX C;  1NNH A;  3IAL A;  1P16 A;  4DV6 Q;  1VQK A;  4L5S A;  3I4O A;  4NB3 A;  1QUQ A;  1NJ1 A;  1HR0 L;  2OCE A;  3GD7 A;  2Z6K A;  2JK8 A;  4A3I H;  1NTG A;  4BBS G;  1YGB A;  4YRE A;  1I94 L;  3CD6 A;  4A3G G;  1P8L A;  4Y52 H;  1PH9 A;  3K81 C;  2JEA I;  2ZTG A;  4JOI C;  4YRL A;  1SRY A;  3HTZ A;  3RLO A;  3S24 A;  3UE0 A;  2QGQ A;  2OQK A;  3I4N H;  1TWA H;  1Y1V G;  5IY0 A;  1K9M C;  1YJW A;  1IBM L;  4OX9 L;  4P74 C;  3K7A H;  2BA1 A;  2RHS A;  4GN5 A;  2DTI A;  2NVX H;  1ASZ A;  5M3M G;  3PV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...