4YCUA

Crystal structure of cladosporin in complex with human lysyl-trna synthetase
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
505
structure length
505
Chain Sequence
DPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPHLHFGLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Specific Inhibition of tRNA Synthetase by an ATP Competitive Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/ ligase inhibitor
molecule keywords Lysine--tRNA ligase
total genus 162
structure length 505
sequence length 505
chains with identical sequence B
ec nomenclature ec 6.1.1.6: Lysine--tRNA ligase.
pdb deposition date 2015-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00152 tRNA-synt_2 tRNA synthetases class II (D, K and N)
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ycuA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4ycuA02
1H4TA 3UGQA 2LXKA 4TVYA 4K86A 5C52B 4A3LH 2A19A 3HOWG 4YCVA 1YZ6A 3J80c 3CCSA 3VQVA 5IT9c 3STBD 2XGTA 4PG3A 1YFTA 2XTIA 2ID0A 4L5SA 3M4OH 4DV7Q 2ZGWA 3GO5A 1X55A 1ATIA 3PSIA 4EX5A 2FYKA 4DQ2A 4WJ3M 2PI2E 5IP7H 2F3IA 2VZAA 2F4VL 1JJGA 2CJAA 3GTGH 2QEXA 4QIWE 3JC66 1RL2A 3CAMA 3HXWA 4AYBG 3PGZA 3FHWA 2DQ3A 3ZJYC 4A4IA 4GN4B 1KMNA 3UGTA 5FLMH 2Z6KC 3J81c 2E8GA 2AMCA 3MF1A 3G48A 4P71C 1FYFA 2QHUA 2B3GA 2IX0A 4A3FH 4LF7L 5F5WA 4JI3Q 2E65A 3NELA 1QE0A 1X56A 4AYBE 3F2BA 3S24A 4YRIA 1YHQA 1HH2P 2B29A 3UE0A 5JJIA 2YV5A 4Q15A 1VQGA 2DEQA 1N32Q 4BY7G 3OYYA 4CH6A 3WQZA 2C35B 5DLQE 2UUCQ 3A74A 4X64Q 2HIVA 2JE6I 4TQFA 1U0LA 2R7DA 4A3IG 1S3OA 2FXQA 2UXDQ 2UUBL 2OQ0A 3K7UC 3HOYG 1SRYA 3STBC 4DUZL 4DR5Q 2E64A 4YDQA 4A93G 1TWCH 3OW2A 1FVIA 4R4QA 5AJ3L 4KR2A 2QHSA 2JA5H 1WFQA 4X64L 4LW1A 4LF6Q 3QTCA 4X66Q 1EIFA 1BIBA 1D7QA 1NE3A 3HOVG 3PUVA 4JCVE 4GKJQ 4XTWA 4NPSA 1EQRA 1SN8A 3FKIG 1TWGH 1XMOL 4LFBL 1L1OC 4JI7L 4A3CG 1WQ7A 1KC8C 1G291 4IOCA 1GKHA 3G71A 3P8YA 3RACA 4L5QA 5C4XH 3IKMB 2CWAA 2RHQB 1I5FA 4GKKL 2OTLA 1E7ZA 3H0GG 4LFCQ 1VQPA 4DPGA 3T1HQ 2R93H 4HWSA 4P3OA 2B63H 2MO0A 4YCUA 2F4VQ 1UE6A 2RF4A 1OXSC 5LMUL 3CC4A 4GKJL 1TWAH 1NMGA 4H2SA 4DV6L 2RHQA 4JI1Q 2F52A 4TVAB 5LMNQ 1K73C 2BA0A 2YTVA 5H1SE 1LTLA 3A5ZB 2OWOA 3GTKH 4BY1H 1CKOA 2VQFL 1UEBA 4ZTUB 3CP0A 4GKKQ 4LWCA 3G6EA 1ADJA 1QF6A 2EL9A 4LF9Q 1XNQL 1JT8A 4LF4Q 4JOIA 1VQKA 3TUPA 4YWKA 1Y1VH 4QGUA 2GN5A 1JJCA 3BZKA 4CS3A 3MEFA 4OLFA 3CC7A 1KHIA 2RHSA 3ERRA 1BBWA 1PVOA 5IYCG 2D0OA 4YRGA 1HNZQ 3E0EA 2VQEQ 4BXXH 3CCQA 5IYCH 1E3PA 3U4ZA 4GOPB 1PFSA 1SERA 1P16A 4POGA 2EWNA 3T1HL 4IFDJ 4G85A 3R07A 3KJOA 2Q2TA 1YNXA 4TWAA 4DV0Q 3PUZA 3RZDH 3KDFB 2VW9A 1YGBA 4DR7L 3DSQA 4LF5L 4P3NA 3V7CA 5C3EG 2NVTH 1SFOH 3IRBA 2DZCA 2VL6A 3FJPA 5M5WH 2GVAA 2E2IH 2DJZA 3CMAA 2RCNA 1RIQA 4Y7NH 1V9PA 5IP9H 1B8AA 1L1OB 11ASA 1B7YA 5EAYA 1YIJA 1SROA 5KNNA 1X2HA 1IXRA 3HY1A 4GS3A 1W3SA 4R4OA 3ER0A 1UE7A 2ARTA 4DUYL 2VUMG 4DV2Q 2OQKA 1YB3A 3U50C 1FJGL 5BR8L 4B3RL 4JI0Q 1PH4A 3RIRA 3F1ZA 4GN3B 4TQUS 1B7YB 2K75A 1IBKQ 1J5EL 3PZCA 4JC0A 2KCTA 2CFMA 4P75C 1QVCA 1CKNB 4NXNQ 3VDYA 1WJJA 4P72C 4TQDA 4LF5Q 1E22A 2N3SA 3A32A 4C3HH 5AJ3Q 3I4MH 3S1MH 3PUWA 3IG2A 4TTVA 3UH0A 1BBUA 2L15A 4G84A 1NJ6A 2UXBQ 3A0JA 4XTVA 4UPAA 4BY7H 5GROA 2AKWB 4KI0A 3S2DH 4DK6C 3CCUA 4XU2A 1FJGQ 2K14A 1MIUA 4XU0A 3M3YH 2NZHA 1LUZA 4GLVB 2LXJA 4P3PA 5ELOA 2WFWA 4MNOA 3KF6A 2UUAQ 1PH3A 5M3MH 5C0XG 4A3KG 5IE8A 3H3VH 4A3KH 3BU2A 1M90C 4O0AA 4PMWA 4YRLA 4NXML 1PYSA 4DR1L 3LC0A 1Q7YC 4DV1Q 2CIMA 4Q6GA 1ASZA 1N34L 1XJVA 4YRJA 2K4KA 4JV5L 2EIFA 3I4NG 1KMMA 3PO3H 4LUVA 5FLXc 2I5LX 4YRKA 4JI4L 4B3SL 3V8KA 3S14H 3CMQA 2MQHA 1KL9A 4TVAA 5JEAG 4QJFA 4H2XA 4RMFA 2CGHA 2ZCEA 4HJ7A 5LMNW 4DR3Q 4WF2A 1YHBA 4AQYL 4PHCA 4JI6Q 2HQLA 4XTYA 3M7NA 1KIXA 3ICAA 4DAYB 1EIYA 2UUAL 3S1NH 4CH5A 1Q86C 4C3IH 2WAQE 3PF4A 2JA8G 2ZZFA 4DV5L 1YITA 2UU9Q 4C2MH 2JK8A 5C44H 4BBRG 4LFAL 2UXBL 3PF5A 4GNXB 1WU7A 4BBRH 1A0IA 4WI1A 3MF2A 3GTMH 3L4GA 1GGMA 1VQ9A 1KD1C 3HOZG 3L7ZC 2Z0SA 5IYDG 1UE1A 3L4GB 3ULLA 1OTCA 1J6QA 3J7A5 4GLAC 4XIGS 5JJLA 3ICEA 1SMXA 4K88A 1H95A 3U4VA 3CD6A 1Q12A 1V1QA 2KCMA 3W5OA 2AWNA 3CF5A 4YCWA 4JBWA 3A5YA 4OO1G 3HKZG 1I94L 2DUDA 4AIMA 1HTTA 1PH5A 2Q7GA 1PA6A 4LF9L 2LSSA 4XTCS 4H2XB 4Y52H 3QO8A 4RG1A 2Q2HA 3T1YL 4DR6L 1A62A 1VQJA 2UU9L 3TS0A 4YHHL 3WWVA 3K81C 1E1OA 3EN2A 4DR1Q 2R92G 2ZTDA 4P73A 4BBSG 5M5XH 1LM0A 4A3JH 4JYAL 1SE8A 2R92H 4KQEA 4YRTA 2K52A 4YRMA 1HZ9A 5IYBG 1HR0Q 5E3IA 1C7YA 3EFRA 4H2TA 4A3DG 1V43A 2DVEA 4EQ5A 2DDZA 4LF7Q 4KHPL 1JE5A 3UDFA 2CKZB 1XNQQ 4AH6A 2GVBA 1WCMG 4DR2Q 4X6AH 1QVGA 3AFQA 4X62Q 3CC2A 3QO7A 4IPHA 5IWAQ 1YJ9A 4BA1I 3GDEA 4XTUA 2R6GA 2ES2A 2VQFQ 1VS0A 4RDXA 4IJHA 1X54A 1EYGA 1YI2A 2ZZGA 1EUJA 1X6OA 3L0OA 1J5WA 4UP7A 3F2DA 4B3MQ 1YFSA 4XU3A 3HOUG 2C8MA 4JI6L 4X62L 4OXPA 1OXVA 1A8VA 2DZ9A 1X9NA 5C0XI 4YY3L 2PMFA 2IX1A 2D62A 3GTJH 1EVKA 4K0KL 5JJKA 4JI7Q 1CSPA 3V7RA 1OXUA 3HOWH 4WJ4A 2PI2A 4B3TL 1AH9A 1G5HA 4CS4A 5C53B 1WPYA 3W3SA 2ASBA 1EWIA 4P71A 3VQXA 2EAYA 3FKIH 4DK3C 1S72A 1KRSA 4OX9Q 1VQAA 1B70B 3PUYA 3V8LA 4KHZA 3W1BA 4OO1I 3M4QA 3OTOQ 2IHEA 1EFWA 3RR5A 3TRZA 4UP9A 1P8LA 1VQCA 2PQAA 1HZCA 3BFMA 1L0WA 5M3FG 3A5UA 3JAMc 4YRPA 3KJPA 3HXXA 1JJ2A 4DV7L 1C0AA 1UWVA 4DKAC 2E5AA 3BJUA 2I4MA 1KQSA 3ULPA 1IBLL 3D0FA 2DTHA 3S2HH 4XTXA 2NZOA 3RL6A 2DTOA 3P8TA 2R7ZG 3TEGA 1FL0A 4CH4A 3I4NH 3IALA 4HIKA 3KDFA 5HGQA 4TVWA 3M9BA 5FJ8G 3P8VA 4DV5Q 4JI8Q 4GNXC 4YRCA 3DLLA 3OTOL 2J3MA 4GOPA 1R9TH 4BWAA 3KOJA 4HJAA 2VNUD 1VQOA 3M4PA 4JI3L 1XNRQ 3GTPH 3E9HA 2HIXA 3A7UA 4DR3L 2Q7HA 2CJBA 1VQLA 2K5NA 4P74A 2ARSA 2BH2A 3GTOH 2RHSB 4A3GH 1G51A 3RLOA 1GD7A 2NVXH 3NEMA 2E1HA 1JJCB 1E1TA 1L2FA 4UP8A 1TWFH 2Q2UA 4DV6Q 4OWWB 1IBMQ 4A3MH 4O2DA 1N36Q 3GTQH 1NMFA 4APVA 4H2YA 5C51B 2MO1A 4GNXA 1VQ7A 1N8RC 3H3VI 1A63A 3UDXA 4JI0L 2ZNIA 2R93G 4R4IA 1MKHA 2UXDL 5IYBH 3D31A 4IPCA 1N33Q 3S16H 2I5HA 4HIMA 3K0XA 3L2ZA 3EBEA 4QQBX 4LFBQ 1LYLA 1Y1WG 3E9IA 3NENA 3GD7A 3K80C 2VQEL 1BVSA 2VY3A 1IBKL 2E5LQ 3RKYA 1MJEA 4H02A 1HNXL 2ZINA 4BW9A 2ZT7A 4JOIC 2NN6G 4JYAQ 3PUXA 1XPOA 4FDBA 1IL2A 3A7RA 4IFDG 3I2ZA 1VQBA 2DKGA 3VBBA 4YHHQ 3CCVA 4K87A 4BBSH 4YROA 4R4TA 3PIOA 4UY8C 1FGUA 2JQOA 4A3JG 4JBMA 4MZ9A 3PIPA 2ZTEA 3T1YQ 2DXUA 5HY6A 3HXVA 4BY1G 3MXNB 2N78A 4YRRA 3HXYA 2E2JH 5C3EH 1PH9A 1H4SA 4R1JA 4IFDI 1QZGA 4XEOA 5LMNL 2EXDA 4EO4A 4DV3L 1EIYB 4A75A 1WCMH 1VCIA 2PNHA 2QA4A 3BZCA 4YRNA 3KF6B 2JJQA 1TWHH 4YRSA 1K0RA 4QL5A 3RNUA 1I50H 3HXUA 2YTYA 2ZR3A 2DTIA 1YHAA 1N9WA 2AKWA 4DR6Q 4DV0L 1HC7A 4DUZQ 4DR5L 3Q8DA 5M3FH 3RZOH 3ERSX 1IZ6A 1Q82C 2ARUA 1VQ5A 2QHTA 4A3DH 3HY0A 4IO9A 5GAGC 2JA6H 4OX9L 3RF1A 3CPFA 3HFZB 4LUZA 4LF4L 1W2BA 2JEAI 2YYZA 2Q2IA 4PZ6A 3S17H 1SESA 2AMCB 4DV3Q 4CH3A 4L5RC 2HHHL 2MFIA 1EQQA 1XMQL 3KFUA 1C9OA 3S1QH 2N49A 1PYBA 5J3BA 2PMZE 4JI1L 1VQ6A 1X65A 4NCXA 1HNWL 2EJFA 4JBJA 1VQMA 3HOYH 4GLXA 1YJNA 4HWOA 4POFA 1NJ2A 3CW2C 4DV1L 1E24A 2OTJA 1CKNA 1VQFA 3AQQA 2Y0SG 4RQFA 1QUQA 2ZXFA 3PCOA 3M85A 2ZM6Q 4HWRA 2HNIA 4DAMA 3KF8B 4AQYQ 1HR0W 4DR2L 1NJ8A 3HOVH 3A31A 1Z9FA 1WQWA 1IYJB 3HTZA 3S15H 3ULJA 3NBHB 4B3TQ 5IYDH 3HKSA 4H2VA 1W66A 4XTZA 2HHHQ 4B3SQ 1H4QA 1CKMA 4BA2I 4IJLA 3REXA 2WP8J 3UFGA 1I6HH 4R4CA 4L5TA 2DU7A 1USYA 1XTDA 4JV5Q 5FLMG 5GAEC 1Z7MA 4LNSA 3VQWA 4X5OA 1X3EA 1H4VB 4A3FG 1GO3E 2ODRD 1M1KC 2P0LA 4ZTZB 2CQOA 4YWLA 1ADYA 1PH2A 3I55A 4JI8L 3I4OA 3H15A 4HJ5A 1SLJA 1HNXQ 4GOPC 1K83H 1TXYA 4JG2A 5FJ8H 1QVFA 3RGLA 3FP9A 2KENA 1KAWA 2ZTGA 2IHFA 4DV2L 1XPUA 1U5KA 3A5ZA 3RN2A 2I4OA 4JI4Q 4KLKA 1NJ5A 1KOGA 3CCMA 2JA9A 2YU9H 1SETA 5C4XG 4LFAQ 1YBYA 4ALPA 4A3EG 1Q8KA 3UE1A 5C0XJ 2JEBI 4OWXB 1XPRA 4X66L 4LF6L 4H2WA 1XNRL 3KYHC 4LF8Q 1YFRA 4A3GG 4MTNA 1KRTA 1N33L 1WYDA 3DM3A 1Y1WH 2UXCL 4HJ8A 2NN6I 1VQ4A 1ASYA 1N32L 1S40A 3J81i 1X3FA 1T9HA 1DGSA 1NJ1A 2E5LL 2ZIMA 4QY7A 4GN5A 5C44G 3HOZH 4B3RQ 3K8AA 3J81j 1PH8A 4A3MG 4X65L 3HOXH 1XMQQ 2ZR2A 3VQYA 1PH7A 1HZAA 4DV4L 1VQNA 3K7AH 2CJ9A 2K50A 2P5IA 5GQOA 3IKLA 4J15A 4HWTA 4LNQA 1G6PA 4OONA 2ZNJA 2ALYA 4XEMA 3GTLH 3F2CA 3U58A 1VQIA 2I4NA 2B63G 5IP9G 2HT1A 4P73C 3JAMi 1YEZA 3I7FA 2JA7H 1SR3A 1I3QH 1EOVA 3CCRA 2VS1A 3CQZH 1B76A 3RUXA 3RLFA 1AE3A 5JEAJ 4DV4Q 3AYHB 3SGIA 2IT1A 3QNEA 1VQHA 5GAHC 1HXDA 4IOAA 1BKBA 4DUYQ 2I5MX 1YVCA 3TEHA 2PMEA 4LF8L 1WI5A 1Y14B 2WAQG 2VUMH 4NXMQ 3LGJA 3NETA 2E10A 3EIVA 1HNZL 1X3GA 1NNHA 1SRUA 5K36G 3AEVA 4HIOA 3PCOB 5K1PA 4A3LG 4L87A 1QUQB 1Q46A 4JBKA 1PYSB 4HWPA 4YPFA 3CXCA 2ZT5A 4NB3A 4LFCL 3UDGA 2R7ZH 3MEYA 1NYQA 4A76A 1AE2A 5IWAL 1VQZA 3HRIA 1WNLA 1NTGA 3I4MG 4JI2L 2IY5B 2EJ9A 3TREA 3G1ZA 5IP7G 1G5IA 3PO2H 1NY4A 4E51A 1RIPA 1OXXK 3LSQA 2IY5A 5M3MG 4A3IH 3PV0A 1HJPA 1NBWA 3HKZE 3EFSA 2H5XA 4DR7Q 4H2UA 3CCJA 3J7ZC 3G4SA 4A93H 3HOUH 2ZJPA 3HFZA 5GADC 3J80i 2JA5G 1WOCA 4DR4L 3AFPA 1Q1EA 3CPWA 2EJGA 2ZJQA 1PHJA 4YP0A 2ZIOA 2BA1A 3PO3G 2ZTCA 4JI2Q 2ZJRA 4HA8A 2D0PA 3TS2A 4LUOA 2DXTA 4JI5L 4XU1A 3TEHB 4HJ9A 1YJWA 2UXCQ 3CCLA 2KHJA 4KHPQ 3UDIA 1I94Q 1KXLA 1D8LA 2OCEA 2Y0SE 4A3BH 1PH6A 4K0KQ 1BIAA 2G4CA 4A3BG 1L1OA 4C3JH 2C7IA 4YREA 1IBML 1Q81C 2KHIA 1VQDA 4B3ML 2Q5IA 4A3EH 2N8NA 2AHOB 3B6YA 2AWOA 2I4LA 2NVQH 3HFVA 2JA8H 4JI5Q 1HR0L 2Q5HA 2ALYB 4PZ7A 2CCZA 2ODRC 3RN5A 3TQYA 4P74C 1NYRA 2Q7EA 2V1CC 2R7FA 3HRKA 1K8AC 3LSSA 2ZZEA 3REUA 1JB7A 1USYC 2K5HA 1X01A 4CS2A 1EVLA 1UE5A 4P72A 1Z47A 1GM5A 2A8VA 3OD1A 2J3LA 3S1RH 1HNWQ 1VQ8A 1PH1A 3L1AA 1HZBA 2MNAA 2NVYH 3RLNA 1X2GA 5K1XA 2ATWA 1CSQA 4YYEA 5ELNA 3A7AA 4YY3Q 2ZT6A 3W1GA 4PZ8A 1MJCA 2JA7G 4YRFA 2E3CA 5E7NA 4OWTB 1OXTA 2EQSA 1O7IA 2ZM6L 4BXXG 2UUBQ 3L2PA 3HOXG 5LMUQ 1JMCA 3KLWA 4A3CH 4RQEA 12ASA 5C4JH 4NXNL 4IPDA 2UUCL 1Q1BA 5M5YH 4HVCA 2ZT8A 1QZHA 1WLEA 3RKXA 2A1AA 3H0GH 4P75A 2E41A 2K5VA 4OP0A 2BH8A 2DGYA 4IPGA 2QGQA 4HIDA 5BR8Q 2WB1E 1GVPA 3I56A 3V8JA 4DR4Q 1Y1VG 5IY0A 1IBLQ 2JA6G 3V7SA 2KBNA 1VQEA 1XMOQ 4ME3A 4X65Q 2I0QA 2DQ0A 4YWMA 2DU5A 1NJIC 1N34Q 2WB1G 2CWPA 2PQAB 3QO5A 1K3RA 2QHVA 2Z6KA 3F8TA 1N36L 1K9MC 1B70A 4DNIA 3PO2G 1CUKA 3CMEA 4YRQA 3HXZA 4ZIBA 2E2HH 1K8GA 4KR3A 1PV4A 1J5EQ 3CCEA 3RKWA 2YTXA 1Z7NA
chains in the Genus database with same CATH superfamily
1H4TA 1PTOH 3UGQA 2LXKA 4TVYA 4K86A 5C52B 3TDQA 4A3LH 2TSSA 2A19A 3SHLA 3HOWG 3H94A 4YCVA 1ESRA 2J7ZA 4NKLA 1YZ6A 4M1UB 1PRTF 4C56C 3J80c 3CCSA 1VMCA 3OWFA 3VQVA 5IT9c 3FDTA 3STBD 4H44C 2HDLA 2XGTA 1BQQT 5DM63 2EOTA 2R92B 4PG3A 1BUVT 2XTIA 1YFTA 2ID0A 4L5SA 4LVIA 4ULLA 3M4OH 4DV7Q 4KMUC 2ZGWA 3S2HB 1JORA 3GO5A 1X55A 1ATIA 3PSIA 5F2DA 5AFWA 4EX5A 4KKTA 2FYKA 4DQ2A 4WJ3M 2PI2E 5IP7H 2F0WA 1QE6A 2F3IA 5M3FB 2VZAA 1G2SA 2F4VL 1YNNC 1JJGA 2CJAA 3GTGH 2QEXA 4QIWE 2L12A 3JC66 4KY7A 4HSPA 1RL2A 2DY7A 3CAMA 3HXWA 5D14A 4AYBG 3PGZA 3FHWA 1GHJA 3DWAA 2DQ3A 3ZJYC 1LTGD 3RMHA 4A4IA 4GN4B 2KHSA 4DXFA 1KMNA 3UGTA 5FLMH 1UAPA 2Z6KC 2CH4A 3MFGA 2PW7A 4QIWB 2E8GA 3J81c 2AMCA 3MF1A 3G48A 4P71C 5KYIA 5EPLA 1FYFA 2B3GA 2QHUA 2IX0A 3K5NA 1ILPA 4A3FH 2VB2X 4LF7L 3E3XA 2F03A 4FF3A 5F5WA 4JI3Q 3A56A 2EYLA 2E65A 1RCVD 1DXMA 1VF7A 2KOLA 4KHVA 3DWQA 2F3WA 3NELA 1QE0A 1X56A 4AYBE 2PZWA 3F2BA 2Z1CA 1EZ6A 4LK1C 3S24A 4MIUA 1Y1WB 4YRIA 1YHQA 2D5DA 1HH2P 3QR8A 2B29A 4CDEC 3UE0A 5JJIA 2ICIA 2YV5A 4Q15A 2JYOA 2NZ1D 1VQGA 2K04A 4A3EB 3MQZA 2DEQA 4FNFA 1XX8A 1R9TB 1N32Q 3EQLC 3VYTA 2F0EA 2F1MA 4BY7G 2NWGA 3OYYA 4PQXA 4CH6A 3WQZA 1KDCA 2C35B 4F87A 5K5PA 2E2DC 4IALA 3A74A 3D3RA 5DLQE 2UUCQ 4HR7B 4X64Q 2EPBA 2HIVA 4C3JB 2J0TD 2JE6I 4TQFA 1JOKA 1U0LA 4KJOA 2FJ2A 5JEAH 2R7DA 4A3IG 1S3OA 2FXQA 1EYAA 2UXDQ 2UUBL 2JXMB 2OQ0A 3K7UC 4A3BB 1EY7A 5FO7B 3HOYG 2MP1A 1WTPA 1SRYA 3GV6A 5JPMC 3STBC 1ZYRD 4DUZL 4DR5Q 5CV7A 1SAPA 4HN7A 2E64A 4YDQA 4A93G 3NE5B 1TWCH 3OW2A 2ZXOA 1FVIA 4R4QA 5AJ3L 3BVGA 1CM9A 3MEHA 1HFGA 1F2LA 3S1NB 4KR2A 2QHSA 3RZOB 1BCPD 2JA5H 3J7AF 1WFQA 2L0CA 4IN3A 4X64L 4WRDA 4LW1A 1BF4A 4LF6Q 3QTCA 4CHTB 4X66Q 2RA4A 4GZYC 3K7AB 1EIFA 3VA5A 1BIBA 1TS5A 5C6AA 4KD4A 3K5OA 1NE3A 1D7QA 3HOVG 3PUVA 1PLFA 3NTIA 4JCVE 3T13A 4DFAA 3VR6A 2A68D 4GKJQ 4XTWA 4NPSA 1EQRA 1SN8A 3FKIG 2C9OA 3HOXB 3BS1A 1TWGH 1XMOL 4LFBL 3TMEA 1K0SA 3PIP3 1L1OC 2EE1A 2LY7A 4JI7L 4A3CG 1WQ7A 3X3NA 1KC8C 1G291 2F0KA 4IOCA 1SMYD 2L9HA 1GKHA 4A3IB 3G71A 3P8YA 3RACA 5BN4A 4C3JG 4RHRA 1RDPD 4QMGA 4L5QA 5C4XH 3SK6A 3IKMB 1O7YA 2CWAA 2RHQB 1I5FA 3SEBA 4RGNA 4V190 2OTLA 1E7ZA 4GKKL 3H0GG 1ICFB 1LACA 2SNSA 3S15B 3DM1A 4LFCQ 1VQPA 4DPGA 3T1HQ 2R93H 4HWSA 4OHJA 2B2UA 4P3OA 2B63H 2MO0A 1TKWB 4YCUA 2PYKA 4NMZA 4KKUA 2F4VQ 1UE6A 2RF4A 3U9OA 1OXSC 5LMUL 5FKAC 1SJHD 1FGBD 1VF5C 1W6JA 4IUUA 3KLSX 4AYBB 3CC4A 4ID6A 5KGUA 4GKJL 1TWAH 3W2DA 1SYDA 2OEOA 2RBMA 1NMGA 4H2SA 4DV6L 2B8GA 2RHQA 4JI1Q 2PPBC 4BS9A 2F52A 2HD3A 5C3XA 3AMUA 4TVAB 5LMNQ 1K73C 2A69D 2BA0A 2IL8A 2YTVA 5H1SE 1KABA 3RUZA 1K83B 1LTLA 3A5ZB 5L37A 3BYYB 1B1ZA 1SNCA 2OWOA 2BE5C 4K6DA 4HT4A 5CC4A 4HCEA 3GTKH 3TSSA 4BY1H 1CKOA 2JSOA 2VQFL 1UEBA 4B9WA 4C3HB 1QCBD 4ZTUB 1L0YB 3CP0A 4GKKQ 4LWCA 3G6EA 2MPMA 2K01A 4N9TA 1ADJA 1QF6A 4H0LC 2EL9A 2QDBA 2N88A 4LF9Q 2JP1A 1XNQL 5IIFA 1JT8A 4LF4Q 4JOIA 1VQKA 4K6LA 2F0FA 2A68C 4BBRB 1EYDA 1DYQA 1WVLA 2HCCA 3TUPA 2EYPA 4YWKA 1Y1VH 4PNYA 1CK1A 1STBA 2EDGA 2GN5A 4QGUA 5EPKA 1JJCA 3VR5A 5FOBB 3BZKA 4TRDA 4CS3A 3MEFA 3NBIA 5JVH3 2F0UA 4OLFA 3CC7A 1KHIA 4DAYA 5KNDA 4XYOA 5IOCA 2RHSA 3ERRA 1BBWA 1EY9A 1PVOA 5IYCG 3A54A 3GTQB 2D0OA 4YRGA 1HNZQ 4C3IB 1H9RA 1K8MA 3EFXD 3E0EA 2VQEQ 2WAQB 1A3UA 4BXXH 1KLGD 1WTQA 2NN6H 3CCQA 5IYCH 2CQAA 1E3PA 4RAUC 3U4ZA 1KNAA 1EU4A 1PFSA 4GOPB 1SERA 3KBGA 3HOVB 1P16A 2D9UA 5KNCA 4POGA 2EWNA 4XYQA 2EJGC 3T1HL 4IFDJ 5EKIA 4G85A 3R07A 3KJOA 4Y7NB 2Q2TA 1I4QA 1YNXA 3OIPA 3JAME 3T51B 1EY8A 3J7AV 4TWAA 2ENBA 4DV0Q 3PUZA 1ET9A 2EYMA 3KF8A 2E2IB 3RZDH 1M8AA 2Y0SB 1SFOB 1LTRD 5DM73 2O5IC 4OO1H 3KDFB 2VW9A 2WB1B 1YGBA 4DR7L 4RA8A 3DSQA 4LF5L 4P3NA 1LLRD 1B9NA 2NTSA 4IUNA 3I90A 5EQ0A 3V7CA 5C3EG 5EBCA 2NVTH 1Z6HA 1SFOH 3IRBA 2DZCA 2VL6A 3FJPA 1WCMB 5M5WH 2GVAA 2E2IH 4K5VA 3K57A 2DJZA 3CMAA 5I6YA 3DEPA 5EKKA 2RCNA 1RIQA 4Y7NH 3K59A 1V9PA 5IP9H 1B8AA 1L1OB 11ASA 1G6ZA 2B2WA 1NSNS 5EAYA 1B7YA 3MXGA 1YIJA 1GUSA 1SROA 1EZ8A 5KNNA 1PFMA 1X2HA 1IXRA 3HY1A 3Q22A 3J80L 4KN7C 4GS3A 5E1FA 1W3SA 4R4OA 3ER0A 1UE7A 2ARTA 4DUYL 2VUMG 4IUQA 4DV2Q 2OQKA 3I4NB 1YB3A 3P1HA 3U50C 1ICWA 1FJGL 4J8QA 3A55A 4BBSB 5BR8L 4B3RL 4JI0Q 1PH4A 1RJTA 3RIRA 3F1ZA 4GN3B 1LT5D 1KTKA 4TQUS 4CGYB 4X3TA 1B7YB 2K75A 5FO9B 1IBKQ 1J5EL 3PZCA 1QOHA 1Y1VB 4N8FA 3S2DB 4JC0A 3UI2A 2KCTA 3JAML 1H9KA 2CFMA 2XIWA 4P75C 1E2ZA 1QVCA 4PMBA 5A35A 1CKNB 1DOMA 4NXNQ 1HHVA 1J9OA 1GUWA 1LTTD 3VDYA 1WJJA 3Q23A 4P72C 3U9SA 4TQDA 4LF5Q 1E22A 2N3SA 3GP7A 3A32A 4C3HH 5AJ3Q 3I4MH 3S1MH 5CORA 3PUWA 3IG2A 4TTVA 4I7ZC 3UH0A 1BBUA 3D4DA 1U4RA 2HCIA 1BCPC 1IKLA 2L15A 2F4IA 4G84A 1NJ6A 2UXBQ 3A0JA 4XTVA 5JJZA 3TN2A 4FO2A 4UPAA 4BY7H 5GROA 2AKWB 1F9RA 4KI0A 3S2DH 4DK6C 3CCUA 4XU2A 1M4VA 3A8JE 1FJGQ 3M4YA 3HG9A 2K14A 1MIUA 4XU0A 3M3YH 1TS2A 2CW0D 2NZHA 1LUZA 4GLVB 2LXJA 1CQVA 4P3PA 3ITPA 5ELOA 5M5XB 1SE2A 1EWHA 2WFWA 4MNOA 3KF6A 2UUAQ 1PH3A 5M3MH 5C0XG 4A3KG 3HOWB 1Q3LA 2GA4B 2MUYA 5IE8A 3R8BA 2QF7A 2O2LD 4DN4M 5ELEA 3H3VH 4A3KH 3BU2A 1M90C 4O0AA 4PMWA 1PRTD 4YRLA 3NWTA 4NXML 1PYSA 1EOTA 4DR1L 3LC0A 3S9WA 4EVOA 4FP5D 1Q7YC 5NUCA 3J81L 2OXPA 4DV1Q 2CIMA 4Q6GA 3A8IE 1ASZA 1N34L 3NHHA 1XJVA 3WDNA 1MBYA 4YRJA 5KRUA 1STYA 2K4KA 4JV5L 1L0XB 2EIFA 3I4NG 1XYIA 1OO9B 1KMMA 3PO3H 2RVLA 4LUVA 5FLXc 2B2YC 2I5LX 2BOSA 4YRKA 1ENCA 4ZKCB 4JI4L 3IFTA 2PW5A 4B3SL 3V8KA 4HMJA 4RCOA 3S14H 3CMQA 2F0TA 5CV5A 5T1IA 2MQHA 4KJNA 3GTPB 1JR0D 1KL9A 1EY6A 4TVAA 1EIGA 1GUOA 3MTSA 5JEAG 4QJFA 1HUMA 2F0OA 4H2XA 3TZUA 1H9MA 4RMFA 2CGHA 1HQMC 1ILQA 4U673 4HJ7A 2ZCEA 5LMNW 4DR3Q 4WF2A 1YHBA 4AQYL 4PHCA 4JI6Q 3ND8A 5CMDA 4DXGA 2HQLA 4XTYA 1EWCA 1KIXA 5J22A 4G7ZC 4DAYB 3M7NA 2UUAL 3ICAA 1EIYA 3GTMB 2AUJD 3S1NH 4CH5A 1Q86C 3FPUB 3T16A 1TS3A 3S17B 4C3IH 2IPKD 3L3OC 2Q8IB 2WAQE 3PF4A 4IURA 4F8MA 2JA8G 2ZZFA 3QG1A 2FHTA 5EPJA 3KLRA 4DV5L 2J4XA 3MXPA 1YITA 2UU9Q 1YNJD 4C2MH 2JK8A 2DN8A 3PQIA 3E5SA 5C44H 4BBRG 4LFAL 2UXBL 4R8IA 3PF5A 1IHZA 1JQYD 4GNXB 2WKCA 2KQ3A 2R3ZA 1WU7A 3F2UA 1A0IA 4BBRH 1PRTC 1CA5A 3MF2A 4WI1A 4QUCA 4ZAIA 3GTMH 1GGMA 3L4GA 5M9OA 1VQ9A 1KD1C 4A3MB 2Z6BA 3HOZG 3OIQA 1K28A 3L7ZC 2Z0SA 3MZ5A 5IYDG 1UE1A 3L4GB 3FPPA 1ZXTA 2F0LA 5C4HA 3ULLA 1OTCA 5IGDA 1CZWA 1J6QA 1C8CA 1ESFA 3FVQA 3J7A5 4O1NA 1MSHA 5CGKA 4GLAC 2A6ED 4XIGS 5JJLA 1A3TA 2WKDA 3P7JA 3ICEA 1SMXA 4KK7A 1WTVA 4K88A 1H95A 4RH6A 1TWHB 2X6LA 1GXDC 3U4VA 3CD6A 1Q12A 1V1QA 2KCMA 3W5OA 1AN8A 2AWNA 2LS01 3CF5A 1DZ1A 4YCWA 2K5DA 4JBWA 3A5YA 4OO1G 3D6WA 1SNMA 3VR4A 1D6EC 3HKZG 5JVG3 1I94L 2DUDA 4AIMA 2EVBA 2B8FA 1HTTA 1PH5A 1B3QA 2Q7GA 1BXTA 1PA6A 4LF9L 2LSSA 3H3VC 3HRZC 4WORA 4XTCS 4H2XB 5C3EB 4R9WA 4Y52H 3QO8A 4RG1A 2Q2HA 3T1YL 4DR6L 1A62A 3CRLC 1VQJA 2B39A 2UU9L 3KK7A 3IFDA 1U4PA 3TS0A 4J1MA 2IW3A 4YHHL 1RKNA 4IFDH 3I4LA 3WWVA 3K81C 1E1OA 3EN2A 2F3VA 1NR2A 4DR1Q 2R92G 1PTOD 4QUFA 2ZTDA 4P73A 4BBSG 5M5XH 1LM0A 1PZJD 4C2MB 1HQRD 3VR3A 4A3JH 4OIKA 1HTPA 4JYAL 1SE8A 2Q8TA 2XWBB 2R92H 1KAAA 4KQEA 4YRTA 2K52A 1E2VA 2A5HA 1TU2B 4YRMA 5IGBA 1HZ9A 4MN3A 5IYBG 1HR0Q 1H9SB 5E3IA 2B2YA 3CU7A 1C7YA 3EFRA 5K36H 4JVZA 4H2TA 3EJIA 4A3DG 1V43A 2C5CA 5DNFA 1TY2A 2Z9HA 2PZUA 2DVEA 1HXYD 4EQ5A 4FYDA 2DDZA 5ISRA 4LF7Q 4KHPL 4CKEA 3M7GA 1JE5A 4JPBW 3UDFA 2E76C 2CKZB 4BY1B 1XNQQ 2B2UC 4ZUJA 4H13C 4AH6A 2GVBA 1WCMG 4DR2Q 3GTKB 3HEJA 1QVGA 4X6AH 3AFQA 2RQXA 3K0YA 4X62Q 4IQZA 3CC2A 2JA5B 4LVKA 3QO7A 4IPHA 1SE4A 5IWAQ 1YJ9A 2EYFA 2XRQD 1XXGA 3GDEA 4BA1I 3C46A 3SK5A 4XTUA 4FF4A 2R6GA 2ES2A 2VQFQ 3C1FA 1VS0A 4XQQA 3FEWX 1HA5A 4RDXA 2F0MA 4IJHA 1X54A 1EYGA 3NBHA 5J1ZA 3PO3B 1YI2A 2EYJA 4XT3B 2O5JC 2ZZGA 1EUJA 1X6OA 3L0OA 1J5WA 1Y69U 1AZQA 1FNUA 4B9XA 2KJXA 2F0PA 4UP7A 3F2DA 4RGMA 4B3MQ 1QB5D 4L63B 5CV4A 1YFSA 2EJMA 1YNJC 2Q8RE 1CFMA 4XU3A 3SXHA 3HOUG 3BYTB 4KY6A 2C8MA 4JI6L 4X62L 4ZKBB 4OXPA 1D1KA 1OXVA 1A8VA 2DZ9A 1X9NA 5C0XI 1ENAA 4YY3L 2PMFA 3ND9A 2IX1A 2D62A 3GTJH 1EVKA 4K0KL 3NK9A 4A3KB 1E0BA 5JJKA 4JI7Q 1CSPA 3V7RA 1OXUA 1BO0A 3SVMA 2B2WC 4V0BA 5C4XB 3HOWH 4WJ4A 2PI2A 4B3TL 1JB3A 5M3MB 1AH9A 1G5HA 4CS4A 5C53B 2P5ZX 3I3CA 3OSOA 1WPYA 2NB0A 2NVXB 3W3SA 2ASBA 1EWIA 4DGZA 5J39A 4KY5A 1K3BC 4A3GB 1WD0A 3NUCA 3IAYA 4P71A 3VYUA 3VQXA 2EAYA 1WTOA 1SYBA 5C4JB 1FNVA 3FKIH 4DK3C 1DOKA 1S72A 1CQFA 1KRSA 4BY7B 2RSOA 4OX9Q 1VQAA 4RCNA 1AW7A 2EY5A 1B70B 3PUYA 3V8LA 4KHZA 3W1BA 4OO1I 3P20A 3M4QA 3OTOQ 2IHEA 1EFWA 3RR5A 2NBFA 2CVRA 4DF7A 3S1MB 3TRZA 4UP9A 1P8LA 1VQCA 2PQAA 4KN4C 1HZCA 3BFMA 2LKVA 3C1EA 1L0WA 2BE5D 5M3FG 3A5UA 4WFN3 3QIAA 2FMMA 3JAMc 4YRPA 5CV9A 3KJPA 4IUVA 1EFID 3HXXA 1JJ2A 3Q6SA 4DV7L 5I4DA 3PMFA 1C0AA 4RHSA 1O80A 2FINB 3A7LA 4X3SA 1UWVA 4DKAC 2E5AA 3V2TA 2QEJC 3BJUA 1STHA 2I4MA 1KQSA 3ULPA 1IBLL 3D0FA 1EIHA 2DTHA 3S2HH 1DONA 3BDOA 4XTXA 1CI3M 3EA6A 2NZOA 3RL6A 2EJFC 4A3JB 2F0HA 2DTOA 1O7LA 3P8TA 2R7ZG 3TEGA 4CJ1B 1FL0A 1B2TA 5IGEA 4CH4A 3I4NH 3IALA 2KEEA 4HIKA 3LWUA 1WTHA 3KDFA 4QF4A 2ZXRA 1J8IA 5HGQA 5FLXE 4TVWA 3M9BA 5FJ8G 4HCSA 3P8VA 4DV5Q 4JI8Q 4GNXC 4QCLA 4YRCA 1TR5A 3DLLA 1IYUA 1HUNA 3OTOL 1RTOA 2J3MA 3HP3A 4GOPA 1R9TH 4BWAA 2NS6A 3KOJA 4HJAA 2VNUD 2HDMA 3HS0C 2K03A 4BWGB 1VQOA 1SXTA 3M4PA 4JI3L 1XNRQ 1B53A 4K5XA 5C3WA 3GTPH 4F7XA 3E0JA 5KYLA 1BOSA 3GQBA 3E9HA 3S14B 2HIXA 1AP0A 3A7UA 3N6RA 2PO4A 4DR3L 1I4PA 2CJBA 2Q7HA 2IJ0A 1VQLA 3FKIB 5E3FA 1QJOA 1HTLD 2K33A 2K5NA 2K5QA 4P74A 2BH2A 2ARSA 1I4HA 3GTOH 2E75C 2RHSB 1GJXA 4A3GH 1G51A 3RLOA 1GD7A 2NVXH 1NNXA 3NEMA 1EU3A 4IUTA 2E1HA 1JJCB 1SYFA 1D2BA 2K7VA 4ME5A 2L5TA 1I4RA 2PMZB 4H7BA 4K8JA 5D3DA 1E1TA 2PCFB 1L2FA 2AQ3B 4UP8A 1TWFH 2Q2UA 5LL6X 2EXZA 2N55A 4DV6Q 4OWWB 1ET6A 1IBMQ 2B63B 4O42A 3GTGB 2K05A 1PZKD 3GTJB 4A3MH 3NQIA 3NP8A 2NTTA 5BN3A 3Q24A 3K5LA 4O2DA 5FLXL 1N36Q 1D1IA 3GTQH 3QWNA 4ZCKA 5C44B 3D8GA 1S5FD 1NMFA 1CTMA 4APVA 4RFBA 1GHKA 3MA2B 4H2YA 5C51B 1IW7C 2MO1A 5A2QL 4GNXA 1VQ7A 1II3A 1N8RC 2A69C 3H3VI 1A63A 3UDXA 3MXUA 3KBXA 4JI0L 1DCZA 2R93G 2ZNIA 1Y8PB 1CHQD 4R4IA 1DM0B 1MKHA 2UXDL 5IYBH 4ZQ3A 2G9DA 3URYA 2XNAC 3D31A 4IPCA 1KLUD 1N33Q 3S16H 2I5HA 4HIMA 3K0XA 3L2ZA 1H9JA 2L55A 2K32A 3I4MB 3EBEA 2F0JA 5JAVA 4ILWA 4LFBQ 4QQBX 4XDXA 1GOZA 1LYLA 1Y1WG 3E9IA 3NENA 5DEHA 4I7AA 3GD7A 1SYGA 3H09A 3K80C 2VQEL 1BVSA 2VY3A 1IBKL 4I65A 2E5LQ 3RKYA 1MJEA 4H02A 1HNXL 2ZINA 2EYHA 3VYSA 3MHBA 1D5ZC 4BW9A 2ZT7A 4JOIC 4DAVA 2NN6G 4JYAQ 1F77A 3PUXA 1XPOA 1MD2D 4FDBA 1IL2A 3S1RB 3A7RA 2PQEA 2EY1A 1B44D 4IFDG 3I2ZA 1VQBA 2DKGA 3VBBA 4DK0A 5EJWA 4OL7A 4RWSC 4YHHQ 3CCVA 4K87A 4CDFC 1A15A 4BBSH 4YROA 4R4TA 3PIOA 1FGUA 4UY8C 1TT2A 2JQOA 4A3JG 4JBMA 4MZ9A 1IKMA 3PIPA 2ZTEA 3T1YQ 2QW7A 2DXUA 5HY6A 1MHWC 5IGCA 3HXVA 4BY1G 3OMCA 2NUCA 3MXNB 1LTAD 2N78A 1NAPA 4YRRA 1STGA 3HXYA 5G3LF 2E2JH 2OF1A 2XWJB 1Y8OB 2VB3X 5EGTA 1JWUD 1BR9A 1X3PA 2K1BA 5C3EH 1PH9A 2BDNA 1H4SA 4R1JA 4DNTB 4IFDI 1GUNA 2DJGC 1QZGA 1AZPA 1NCVA 4XEOA 1JOOA 3D4RA 5LMNL 4JK1C 2A6HC 2EXDA 4EO4A 4HTHA 4DV3L 4C3HG 3LNNA 1EIYB 3K6OA 1PFBA 4A75A 1WCMH 4EQOA 1VCIA 2NVTB 2PNHA 2QA4A 3BZCA 2MGSA 3C3LA 2RDGA 4YRNA 3KF6B 4RGTA 2JJQA 1TWHH 1LTSD 2XRSD 4YRSA 1SNQA 3QJYA 3RZDB 1K0RA 4MHEA 4QL5A 3C2PA 3BDLA 3RNUA 4G7OC 1QNKA 1I50H 5E4WC 2YTYA 3HXUA 2ZR3A 2B2VC 2DTIA 3OPOA 1YHAA 2Z4HA 1N9WA 2AKWA 1U9RA 3W3AA 4DR6Q 2JA7B 1IL8A 3MAQA 4DV0L 4FXDA 1HC7A 4DUZQ 4DR5L 3Q8DA 4K2LA 5M3FH 5I6WA 1UUPA 1W6KA 2VXWA 3RZOH 2H4OA 3ERSX 1IZ6A 1Q82C 3GTLB 5CBEE 2XVSA 2ARUA 5LL6S 1VQ5A 2QHTA 4UAIA 1TWCB 4A3DH 3HY0A 4IO9A 5GAGC 2JA6H 4K14A 4OX9L 1BNZA 3ERQA 4Q5VA 3RF1A 4XT1B 3P75A 3CPFA 3HFZB 4LUZA 4LF4L 1KDBA 1SMYC 1W2BA 2SEBD 2JEAI 2LFNA 1TQOA 1V1PA 2YYZA 2Q2IA 4PZ6A 1AEXA 3TP8A 3S17H 1SESA 1UEAB 2AMCB 5FK9C 1A2UA 4JW0A 1TY0A 5COYA 3I91A 1JOQA 4DV3Q 1WTWA 4CH3A 4L5RC 1Y8NB 2EYOA 2HHHL 2MFIA 4OIJA 3X3MA 3HOZB 1SEBD 1EQQA 2KECA 1XMQL 5IGFA 1I4XA 3KFUA 1C9OA 3DXJC 3S1QH 4G4KA 2N49A 5ELBA 2JA8B 1PYBA 2QILA 5J3BA 2PMZE 4JI1L 1VQ6A 1X65A 4NCXA 1HNWL 2EJFA 1BDOA 4JBJA 1DOLA 1VQMA 5KNBA 3HOYH 4ZRZA 4GLXA 1YJNA 4X3KA 4HWOA 4POFA 1EQVA 1ZEQX 3SE0A 1NJ2A 5KIXA 3CW2C 4DV1L 1E24A 1F2ZA 4C3IG 4HMIA 1RTNA 2OTJA 1CKNA 1VQFA 3AQQA 2Y0SG 4RQFA 1QUQA 3FMCA 2ZXFA 3V05A 1IYVA 3PCOA 4ZUIA 3M85A 3AU7A 1X3QA 4FVMA 5I9PA 2ZM6Q 4HWRA 2HNIA 4DAMA 3KF8B 1NUCA 2XSCA 4LJZC 4AQYQ 1HR0W 1WTXA 4DR2L 5C5MA 1NJ8A 3HOVH 2A73B 2B2TA 4U68A 3A31A 1Z9FA 1WQWA 1IYJB 3HTZA 3S15H 3ULJA 4CBVA 5C5LA 4ODGA 2KA7A 2K5WA 3NBHB 4B3TQ 1LV9A 4XQJA 2K6AA 1ZYRC 5IYDH 1T5EA 3HKSA 4H2VA 4HEDA 1F2MA 5G3LD 5C0XH 3M4OB 1W66A 4XTZA 2HHHQ 2IX3A 2RKSA 4B3SQ 1H4QA 5LHY1 4EQNA 4C1NI 1CKMA 4OELB 4BA2I 3M3YB 4IJLA 3REXA 1HPCA 2WP8J 3R93A 3UFGA 1I6HH 2MJ8A 2QDLA 3A8KE 4R4CA 4L5TA 2DU7A 1USYA 1XTDA 4P2CB 4CJ0B 4KV6A 2F0DA 4JV5Q 5FLMG 5GAEC 1LO5D 1TWGB 4DAPA 1Z7MA 4LNSA 3VQWA 2ICEC 4X5OA 5CV8A 3EVQA 1X3EA 1H4VB 4A3FG 1GO3E 1O7ZA 1PTOB 1EQTA 3OW7A 2EZVA 2ODRD 2F0IA 1M1KC 2P0LA 1QG7A 4ZTZB 2CQOA 4YWLA 1ADYA 4A93B 1PH2A 3LX0A 3I55A 1I6HB 4JI8L 3I4OA 3H15A 4DA2A 4S3SA 4HJ5A 1STEA 4R8NA 2NYZD 1FD7D 1SLJA 2E74C 1HNXQ 4GOPC 4UHVA 1K83H 1TXYA 4JG2A 1EL0A 1STNA 3BDCA 3EROA 1F9SA 5FJ8H 2F0GA 1QVFA 3RGLA 1Z7NA 3BVMA 2KENA 1KAWA 3I8ZA 5CBAE 2ZTGA 2IHFA 1IW7D 4DV2L 2L4NA 3MVVA 1XPUA 1U5KA 3A5ZA 3CRKC 3AB9A 3RN2A 1ZKOA 2BCOA 2I4OA 4JI4Q 4KLKA 2R7ZB 1NJ5A 1KOGA 2KUMA 3CCMA 2JA9A 5HURA 2YU9H 1SETA 5DAUA 5C4XG 1YNND 2KEDA 1LTID 1SSOA 4LFAQ 3G7LA 1YBYA 3TZDA 1G8ZD 1PYWD 4CKBA 4ALPA 4A3EG 3J81E 2R93B 1Q8KA 3UE1A 5C0XJ 2JEBI 4OWXB 1XPRA 4X66L 3OOCA 3QO2A 4LF6L 5EBDA 1XNRL 4H2WA 3KYHC 3A7AB 1O78A 4LF8Q 4MTNA 4A3GG 1YFRA 1KRTA 1N33L 1KDAA 3J7YW 1X32A 1WYDA 3H0GB 3DM3A 1Y1WH 3DEOA 3RD4A 4HJ8A 2NN6I 2JN4A 1VQ4A 2UXCL 4YIJA 1ENFA 1NR4A 1LT4D 1ASYA 1N32L 1S40A 3J81i 5M5WB 1X3FA 1S5BD 1T9HA 2VUMB 5M5YB 1DGSA 1NJ1A 2E5LL 5IT9L 1TIID 2ZIMA 1SYEA 4GN5A 1SNPA 4QY7A 5C44G 3Q0AA 3HOZH 4B3RQ 4LAAA 3K8AA 3J81j 1PH8A 4A3MG 3TP5A 4X65L 3HOXH 1LABA 4DU9A 4G7HC 4EQPA 4E6IA 1EEFD 1GUGA 1XMQQ 4M8AA 2ZR2A 1D5MC 3VQYA 2AQ2B 1PH7A 1PXUA 4LVMA 1HZAA 4RKLA 4DV4L 2MHVA 1VQNA 3K7AH 1I3QB 2DJFC 2QKIC 2CJ9A 1RHPA 2K50A 3G6JB 5IGGA 2P5IA 1MGSA 2ZXPA 5GQOA 2F0SA 3DMUA 3IKLA 2JA6B 4J15A 4HWTA 3I70A 4LNQA 1G6PA 1FR3A 2XN9C 1D5XC 4OONA 2ZNJA 2NVYB 2ALYA 4XEMA 5TSSA 3GTLH 3F2CA 3U58A 1PMRA 3TP7A 1VQIA 2I4NA 2B63G 5IP9G 2BDOA 2HT1A 1U4LA 5D65A 4P73C 3JAMi 1YEZA 2CHBD 3I7FA 2JA7H 1SR3A 1I3QH 1EOVA 3VYRA 3CCRA 1B3AA 1DD2A 2VS1A 3CQZH 1B76A 5CV6A 1I50B 2I07B 2WV6D 3RUXA 3I72A 1PDQA 2ZT9C 3ONAB 3RLFA 1AE3A 5JEAJ 3MC0B 1SBBB 4DV4Q 1JICA 3AYHB 3SGIA 2IT1A 1WD1A 3QNEA 1VQHA 5GAHC 4DNRB 1HXDA 4IOAA 1BKBA 3VR2A 4DUYQ 2I5MX 2KCCA 1YVCA 3TEHA 4LF8L 1WI5A 2PMEA 1ML0D 1KNEA 1Y14B 2WAQG 2VUMH 4NXMQ 4IZ8A 3KLSA 4LVLA 2F0QA 3LGJA 3NETA 2A74C 3ZYYX 1LT6D 2E10A 3IL8A 3EIVA 1HNZL 1X3GA 4EGVA 1NNHA 1V1PB 3T53B 3NXWA 1SRUA 5K36G 3AEVA 4HIOA 4A3FB 3PCOB 5I2XA 5K1PA 2FFKB 4KD3A 4A3LG 4L87A 1QUQB 1Q46A 4JBKA 2KVMA 2E2JB 4NP5A 1HFNA 1PYSB 4HWPA 1TWAB 4YPFA 3NPPA 3CXCA 1SYCA 3SR1A 2RCFA 2X69A 1S5CD 2ZT5A 4NB3A 4LFCL 1GUTA 3UDGA 5JPNC 2R7ZH 1QWYA 3MEYA 1NYQA 4A76A 2EY6A 1AE2A 5IWAL 1VQZA 3HRIA 4ZLTF 3BZDB 1WNLA 1NTGA 1UNSA 2A8EA 1SE3A 1EY4A 3I4MG 4JI2L 5I2YA 2IY5B 4ZK9B 2DNCA 2EJ9A 3TP6A 3TREA 3G1ZA 5IP7G 1G5IA 3PO2H 1NY4A 2CH4W 1Q8IA 4E51A 3O13A 1RIPA 3CHBD 1OXXK 3LSQA 2H1EA 2IY5A 5M3MG 4A3IH 2G9HD 3PV0A 1HJPA 4KKSA 5BN5A 3QOJA 1NBWA 3SK4A 1WTRA 3HKZE 3EFSA 2LMCB 3WOFA 2H5XA 3HZXA 4DR7Q 4H2UA 1F9PA 3CCJA 3J7ZC 2O4XA 3G4SA 5KEEA 4A93H 4K8IA 3HOUH 2ZJPA 1BBXC 2SNMA 1E2WA 3TBIB 3HFZA 2B2TC 5GADC 1B9MA 1CHPD 3HOUB 3J80i 4NDXA 2JA5G 1WOCA 3CQZB 4DR4L 2Z4IA 3AFPA 1Q1EA 3CPWA 2EJGA 2ZJQA 4CDDC 1PHJA 4YP0A 2ZIOA 2BA1A 4CDCC 1T5XD 3PO3G 2ZTCA 4JI2Q 3MWYW 2ZJRA 4X3UA 3MXNA 3DUZA 4L6TB 4TSSA 2D2CC 4A3DB 4HA8A 2D0PA 1H9SA 3TS2A 3MFYA 4LUOA 1B50A 2DXTA 4JI5L 1S5ED 4XU1A 3J80E 3TEHB 4HJ9A 3PIO3 1V8QA 2L1BA 1YJWA 1MI2A 2UXCQ 3CCLA 2KHJA 1B4OA 3UDIA 4KHPQ 1I94Q 1KXLA 4Q0FA 1CT1D 1EY0A 1CA6A 4FXGC 1D8LA 2DY8A 3I73A 2OCEA 1C48A 1XWEA 2Y0SE 3GV3A 3OMGA 1PH6A 4A3BH 3H6MA 1TVXA 4K0KQ 2PZTA 1BIAA 2G4CA 2WINB 5EKLA 1S5DD 4K2KA 4A3BG 1L1OA 1LT3D 4C3JH 2C7IA 2B2VA 3SK8A 4YREA 1IBML 1JC7A 1Q81C 2KHIA 1VQDA 3VA7A 3L9AX 3GTOB 1SNOA 4B3ML 4FF2A 2Q5IA 4A3EH 2N8NA 4PMCA 2AHOB 3R3OA 1JWMD 2SOBA 3B6YA 3FRPB 2AWOA 3D4WA 2RDHA 2I4LA 1HCZA 2A6EC 4DK1A 3H91A 3BVZA 2NVQH 1RODA 2AUKA 3HFVA 4IUPA 1JCKB 4JI5Q 2JA8H 1HR0L 2Q5HA 3S1QB 2ALYB 4PZ7A 5HGTA 2CCZA 3OWEB 2ODRC 4F88A 3RN5A 4KTAA 3TQYA 1I6VC 1RF2D 5C4ZA 4P74C 1NYRA 4C1NK 2Q7EA 2V1CC 5IT9E 3SDZA 2R7FA 4LVJA 2WIIB 4TKOB 5I9OA 3HRKA 1K8AC 3LSSA 1FNWA 2EY2A 2ZZEA 3REUA 1G91A 1JB7A 3N52A 3QOLA 1USYC 1SNDA 1SJED 3D6CA 3HKZB 2K5HA 2Z8LA 1X01A 4CS2A 5CR3A 1EVLA 5A2QE 3DWPA 1UE5A 4P72A 1R4PB 2CW0C 1Z47A 1GM5A 2A6HD 4XXEA 2A8VA 2R61A 1CZGA 2DNEA 1G2TA 3OD1A 2HUGA 2J3LA 3S1RH 2AQ1B 1HA6A 1HNWQ 3KUPA 4RGOS 1VQ8A 1PH1A 3L1AA 1HZBA 2MNAA 2NVYH 1R4QB 1LTBD 1F9QA 4J6HA 4OEMB 2X6GA 1F2YA 3RLNA 2IWHA 5T1GA 4FF1A 1I4GA 5ELCA 1X2GA 1A2TA 2F0NA 5K1XA 4Z9CB 2ATWA 1PRTB 1CSQA 1EY5A 4YYEA 3NSWA 5ELNA 3A7AA 4ZYSA 4NW2A 4YY3Q 2ZT6A 5JOBA 3W1GA 3NQTA 4PZ8A 1MJCA 3DHQA 1V1OA 2M00A 2JA7G 2E3CA 4YRFA 5E7NA 2HQEA 4CKCA 4OWTB 1ONLA 1OXTA 2EQSA 1U4MA 1O7IA 2ZM6L 4BXXG 1HRJA 1K8OA 1Z7TA 3NTKA 2UUBQ 2WACA 3L2PA 3HOXG 5LMUQ 1JMCA 3KLWA 4A3CH 2F0VA 4RQEA 4L8JA 2KCNA 12ASA 1QILA 5C4JH 2V4DA 4XQNA 4NXNL 2G5DA 4IPDA 2E2HB 2UUCL 1BCPB 1Q1BA 5M5YH 4HVCA 2NVQB 1JWSD 2ZT8A 1QZHA 3CKIB 1PTOC 1WLEA 3RKXA 2A1AA 3R2IA 1PTOF 2L11A 3H0GH 4PV1C 4P75A 4N9PA 2E41A 2K5VA 2RDFA 2M9VA 4OP0A 4G57A 3V96A 2SDFA 3PO2B 3IKJA 1BCPF 1PFNA 2BH8A 2DGYA 4IPGA 4HSVA 2QGQA 4HIDA 5BR8Q 3BG3A 3NWSA 4N8X1 3WOEA 2WB1E 1GVPA 1S4ZA 4QB4A 3I56A 2QCPX 4LMQD 2TMPA 3V8JA 3QB3A 3T4AC 4DR4Q 1Y1VG 3K5MA 4CJ2C 2RSNA 5IY0A 1IBLQ 2JA6G 1A3VA 3V7SA 2KBNA 1VQEA 2YU9B 1C4QA 1TWFB 1FYCA 5ELDA 1JE4A 1XMOQ 2FMCA 4ME3A 1Q90A 4X65Q 1QNUA 1DJRD 1MSGA 5FO8B 1VDZA 2I0QA 2DQ0A 4YWMA 2DU5A 1STAA 4FXKC 1NJIC 1RD9D 5CYUA 3LWEA 3HGBA 1A6XA 2PNRC 2OT2A 1N34Q 2WB1G 2CWPA 2PQAB 4K5WA 3QO5A 1PZID 1K3RA 3HOYB 2QHVA 5E4XA 2Z6KA 3F8TA 1N36L 3NTHA 1K9MC 1B70A 3R2TA 4DNIA 3PO2G 3E6ZX 4MTKA 1CUKA 4UDUC 4WJWA 5ELFA 5IODA 3K58A 1VMPA 3CMEA 4YRQA 3HXZA 4HAEA 1EYCA 4B08A 4ZIBA 4RKBA 2E2HH 4ABNA 1K8GA 4KR3A 1PV4A 1J5EQ 3CCEA 1AFPA 2K28A 3RKWA 3T56B 4OGQC 1TS4A 1SDFA 2YTXA 3S16B 1EEID 2M2LA 3OHXC 2I46A 3FP9A 5D3IB 1XTCD
chains in the Genus database with same CATH topology
1H4TA 3UGQA 2LXKA 4TVYA 4K86A 5C52B 4A3LH 2A19A 3HOWG 4YCVA 1YZ6A 3J80c 3CCSA 3VQVA 5IT9c 3STBD 2XGTA 4PG3A 1YFTA 2XTIA 2ID0A 4L5SA 4LVIA 3M4OH 4DV7Q 2ZGWA 3GO5A 1X55A 1ATIA 3PSIA 4EX5A 2FYKA 4DQ2A 4WJ3M 2PI2E 5IP7H 2F3IA 2VZAA 2F4VL 1JJGA 2CJAA 3GTGH 2QEXA 4QIWE 3JC66 1RL2A 3CAMA 3HXWA 4AYBG 3PGZA 3FHWA 2DQ3A 3ZJYC 4A4IA 4GN4B 1KMNA 3UGTA 5FLMH 2Z6KC 3J81c 2E8GA 2AMCA 3MF1A 3G48A 4P71C 1FYFA 2QHUA 2B3GA 2IX0A 4A3FH 4LF7L 5F5WA 4JI3Q 2E65A 3NELA 1QE0A 1X56A 4AYBE 3F2BA 3S24A 4YRIA 1YHQA 1HH2P 2B29A 3UE0A 5JJIA 2YV5A 4Q15A 1VQGA 3MQZA 2DEQA 1N32Q 4BY7G 3OYYA 4CH6A 3WQZA 2C35B 5DLQE 2UUCQ 3A74A 4X64Q 2HIVA 2JE6I 4TQFA 1U0LA 2R7DA 4A3IG 1S3OA 2FXQA 2UXDQ 2UUBL 2OQ0A 3K7UC 3HOYG 1SRYA 3STBC 4DUZL 4DR5Q 2E64A 4YDQA 4A93G 1TWCH 3OW2A 1FVIA 4R4QA 5AJ3L 4KR2A 2QHSA 2JA5H 1WFQA 4X64L 4LW1A 4LF6Q 3QTCA 4X66Q 1EIFA 1BIBA 1D7QA 1NE3A 3HOVG 3PUVA 4JCVE 4GKJQ 4XTWA 4NPSA 1EQRA 1SN8A 3FKIG 1TWGH 1XMOL 4LFBL 1L1OC 4JI7L 4A3CG 1WQ7A 1KC8C 1G291 4IOCA 1GKHA 3G71A 3P8YA 3RACA 4L5QA 5C4XH 3IKMB 2CWAA 2RHQB 1I5FA 4GKKL 2OTLA 1E7ZA 3H0GG 4LFCQ 1VQPA 4DPGA 3T1HQ 2R93H 4HWSA 4P3OA 2B63H 2MO0A 4YCUA 2F4VQ 1UE6A 2RF4A 1OXSC 5LMUL 3CC4A 4GKJL 1TWAH 1NMGA 4H2SA 4DV6L 2RHQA 4JI1Q 2F52A 4TVAB 5LMNQ 1K73C 2BA0A 2YTVA 5H1SE 1LTLA 3A5ZB 2OWOA 4HT4A 3GTKH 4BY1H 1CKOA 2VQFL 1UEBA 4ZTUB 3CP0A 4GKKQ 4LWCA 3G6EA 1ADJA 1QF6A 2EL9A 4LF9Q 1XNQL 1JT8A 4LF4Q 4JOIA 1VQKA 3TUPA 4YWKA 1Y1VH 4QGUA 2GN5A 1JJCA 3BZKA 4CS3A 3MEFA 4OLFA 3CC7A 1KHIA 2RHSA 3ERRA 1BBWA 1PVOA 5IYCG 2D0OA 4YRGA 1HNZQ 3E0EA 2VQEQ 4BXXH 3CCQA 5IYCH 1E3PA 3U4ZA 4GOPB 1PFSA 1SERA 1P16A 4POGA 2EWNA 3T1HL 4IFDJ 4G85A 3R07A 3KJOA 2Q2TA 1YNXA 4TWAA 4DV0Q 3PUZA 3RZDH 3KDFB 2VW9A 1YGBA 4DR7L 3DSQA 4LF5L 4P3NA 3V7CA 5C3EG 2NVTH 1SFOH 3IRBA 2DZCA 2VL6A 3FJPA 5M5WH 2GVAA 2E2IH 2DJZA 3CMAA 2RCNA 1RIQA 4Y7NH 1V9PA 5IP9H 1B8AA 1L1OB 11ASA 1B7YA 5EAYA 1YIJA 1SROA 5KNNA 1X2HA 1IXRA 3HY1A 4GS3A 1W3SA 4R4OA 3ER0A 1UE7A 2ARTA 4DUYL 2VUMG 4DV2Q 2OQKA 1YB3A 3U50C 1FJGL 5BR8L 4B3RL 4JI0Q 1PH4A 3RIRA 3F1ZA 4GN3B 4TQUS 1B7YB 2K75A 1IBKQ 1J5EL 3PZCA 4JC0A 2KCTA 2CFMA 4P75C 1QVCA 1CKNB 4NXNQ 3VDYA 1WJJA 4P72C 4TQDA 4LF5Q 1E22A 2N3SA 3A32A 4C3HH 5AJ3Q 3I4MH 3S1MH 3PUWA 3IG2A 4TTVA 3UH0A 1BBUA 2L15A 4G84A 1NJ6A 2UXBQ 3A0JA 4XTVA 4UPAA 4BY7H 5GROA 2AKWB 4KI0A 3S2DH 4DK6C 3CCUA 4XU2A 1FJGQ 2K14A 1MIUA 4XU0A 3M3YH 2NZHA 1LUZA 4GLVB 2LXJA 4P3PA 5ELOA 2WFWA 4MNOA 3KF6A 2UUAQ 1PH3A 5M3MH 5C0XG 4A3KG 5IE8A 3H3VH 4A3KH 3BU2A 1M90C 4O0AA 4PMWA 4YRLA 4NXML 1PYSA 4DR1L 3LC0A 1Q7YC 4DV1Q 2CIMA 4Q6GA 1ASZA 1N34L 1XJVA 4YRJA 2K4KA 4JV5L 2EIFA 3I4NG 1KMMA 3PO3H 4LUVA 5FLXc 2I5LX 4YRKA 4JI4L 4B3SL 3V8KA 3S14H 3CMQA 2MQHA 1KL9A 4TVAA 5JEAG 4QJFA 4H2XA 4RMFA 2CGHA 2ZCEA 4HJ7A 5LMNW 4DR3Q 4WF2A 1YHBA 4AQYL 4PHCA 4JI6Q 2HQLA 4XTYA 3M7NA 1KIXA 3ICAA 4DAYB 1EIYA 2UUAL 3S1NH 4CH5A 1Q86C 4C3IH 2WAQE 3PF4A 2JA8G 2ZZFA 4DV5L 1YITA 2UU9Q 4C2MH 2JK8A 5C44H 4BBRG 4LFAL 2UXBL 3PF5A 4GNXB 1WU7A 4BBRH 1A0IA 4WI1A 3MF2A 3GTMH 3L4GA 1GGMA 1VQ9A 1KD1C 3HOZG 3L7ZC 2Z0SA 5IYDG 1UE1A 3L4GB 3ULLA 1OTCA 1J6QA 3J7A5 4GLAC 4XIGS 5JJLA 3ICEA 1SMXA 4K88A 1H95A 3U4VA 3CD6A 1Q12A 1V1QA 2KCMA 3W5OA 2AWNA 3CF5A 4YCWA 4JBWA 3A5YA 4OO1G 3HKZG 1I94L 2DUDA 4AIMA 1HTTA 1PH5A 2Q7GA 1PA6A 4LF9L 2LSSA 4XTCS 4H2XB 4Y52H 3QO8A 4RG1A 2Q2HA 3T1YL 4DR6L 1A62A 1VQJA 2UU9L 3TS0A 4YHHL 3WWVA 3K81C 1E1OA 3EN2A 4DR1Q 2R92G 2ZTDA 4P73A 4BBSG 5M5XH 1LM0A 4A3JH 4JYAL 1SE8A 2R92H 4KQEA 4YRTA 2K52A 4YRMA 1HZ9A 5IYBG 1HR0Q 5E3IA 1C7YA 3EFRA 4H2TA 4A3DG 1V43A 2DVEA 4EQ5A 2DDZA 4LF7Q 4KHPL 1JE5A 3UDFA 2CKZB 1XNQQ 4AH6A 2GVBA 1WCMG 4DR2Q 4X6AH 1QVGA 3AFQA 4X62Q 3CC2A 4LVKA 3QO7A 4IPHA 5IWAQ 1YJ9A 4BA1I 3GDEA 4XTUA 2R6GA 2ES2A 2VQFQ 1VS0A 4RDXA 4IJHA 1X54A 1EYGA 1YI2A 2ZZGA 1EUJA 1X6OA 3L0OA 1J5WA 4UP7A 3F2DA 4B3MQ 1YFSA 4XU3A 3HOUG 2C8MA 4JI6L 4X62L 4OXPA 1OXVA 1A8VA 2DZ9A 1X9NA 5C0XI 4YY3L 2PMFA 2IX1A 2D62A 3GTJH 1EVKA 4K0KL 5JJKA 4JI7Q 1CSPA 3V7RA 1OXUA 3HOWH 4WJ4A 2PI2A 4B3TL 1AH9A 1G5HA 4CS4A 5C53B 1WPYA 3W3SA 2ASBA 1EWIA 4P71A 3VQXA 2EAYA 3FKIH 4DK3C 1S72A 1KRSA 4OX9Q 1VQAA 1B70B 3PUYA 3V8LA 4KHZA 3W1BA 4OO1I 3M4QA 3OTOQ 2IHEA 1EFWA 3RR5A 3TRZA 4UP9A 1P8LA 1VQCA 2PQAA 1HZCA 3BFMA 1L0WA 5M3FG 3A5UA 3JAMc 4YRPA 3KJPA 3HXXA 1JJ2A 4DV7L 1C0AA 1UWVA 4DKAC 2E5AA 3BJUA 2I4MA 1KQSA 3ULPA 1IBLL 3D0FA 2DTHA 3S2HH 4XTXA 2NZOA 3RL6A 2DTOA 3P8TA 2R7ZG 3TEGA 1FL0A 4CH4A 3I4NH 3IALA 4HIKA 3KDFA 5HGQA 4TVWA 3M9BA 5FJ8G 3P8VA 4DV5Q 4JI8Q 4GNXC 4YRCA 3DLLA 3OTOL 2J3MA 4GOPA 1R9TH 4BWAA 2NS6A 3KOJA 4HJAA 2VNUD 1VQOA 3M4PA 4JI3L 1XNRQ 3GTPH 3E9HA 2HIXA 3A7UA 4DR3L 2Q7HA 2CJBA 1VQLA 2K5NA 4P74A 2ARSA 2BH2A 3GTOH 2RHSB 4A3GH 1G51A 3RLOA 1GD7A 2NVXH 3NEMA 2E1HA 1JJCB 1E1TA 1L2FA 4UP8A 1TWFH 2Q2UA 4DV6Q 4OWWB 1IBMQ 4A3MH 4O2DA 1N36Q 3GTQH 1NMFA 4APVA 4H2YA 5C51B 2MO1A 4GNXA 1VQ7A 1N8RC 3H3VI 1A63A 3UDXA 4JI0L 2ZNIA 2R93G 4R4IA 1MKHA 2UXDL 5IYBH 3D31A 4IPCA 1N33Q 3S16H 2I5HA 4HIMA 3K0XA 3L2ZA 3EBEA 4QQBX 4LFBQ 1LYLA 1Y1WG 3E9IA 3NENA 3GD7A 3K80C 2VQEL 1BVSA 2VY3A 1IBKL 2E5LQ 3RKYA 1MJEA 4H02A 1HNXL 2ZINA 4BW9A 2ZT7A 4JOIC 2NN6G 4JYAQ 3PUXA 1XPOA 4FDBA 1IL2A 3A7RA 4IFDG 3I2ZA 1VQBA 2DKGA 3VBBA 4YHHQ 3CCVA 4K87A 4BBSH 4YROA 4R4TA 3PIOA 4UY8C 1FGUA 2JQOA 4A3JG 4JBMA 4MZ9A 3PIPA 2ZTEA 3T1YQ 2DXUA 5HY6A 3HXVA 4BY1G 3MXNB 2N78A 4YRRA 3HXYA 2E2JH 5C3EH 1PH9A 1H4SA 4R1JA 4IFDI 1QZGA 4XEOA 5LMNL 2EXDA 4EO4A 4DV3L 1EIYB 4A75A 1WCMH 1VCIA 2PNHA 2QA4A 3BZCA 4YRNA 3KF6B 2JJQA 1TWHH 4YRSA 1K0RA 4QL5A 3RNUA 1I50H 3HXUA 2YTYA 2ZR3A 2DTIA 1YHAA 1N9WA 2AKWA 4DR6Q 4DV0L 1HC7A 4DUZQ 4DR5L 3Q8DA 5M3FH 3RZOH 3ERSX 1IZ6A 1Q82C 2ARUA 1VQ5A 2QHTA 4A3DH 3HY0A 4IO9A 5GAGC 2JA6H 4OX9L 3RF1A 3CPFA 3HFZB 4LUZA 4LF4L 1W2BA 2JEAI 2YYZA 2Q2IA 4PZ6A 3S17H 1SESA 2AMCB 4DV3Q 4CH3A 4L5RC 2HHHL 2MFIA 1EQQA 1XMQL 3KFUA 1C9OA 3S1QH 2N49A 1PYBA 5J3BA 2PMZE 4JI1L 1VQ6A 1X65A 4NCXA 1HNWL 2EJFA 4JBJA 1VQMA 3HOYH 4GLXA 1YJNA 4HWOA 4POFA 1NJ2A 3CW2C 4DV1L 1E24A 2OTJA 1CKNA 1VQFA 3AQQA 2Y0SG 4RQFA 1QUQA 2ZXFA 3PCOA 3M85A 2ZM6Q 4HWRA 2HNIA 4DAMA 3KF8B 4AQYQ 1HR0W 4DR2L 1NJ8A 3HOVH 3A31A 1Z9FA 1WQWA 1IYJB 3HTZA 3S15H 3ULJA 3NBHB 4B3TQ 5IYDH 3HKSA 4H2VA 1W66A 4XTZA 2HHHQ 4B3SQ 1H4QA 1CKMA 4BA2I 4IJLA 3REXA 2WP8J 3UFGA 1I6HH 4R4CA 4L5TA 2DU7A 1USYA 1XTDA 4JV5Q 5FLMG 5GAEC 1Z7MA 4LNSA 3VQWA 4X5OA 1X3EA 1H4VB 4A3FG 1GO3E 2ODRD 1M1KC 2P0LA 4ZTZB 2CQOA 4YWLA 1ADYA 1PH2A 3I55A 4JI8L 3I4OA 3H15A 4HJ5A 1SLJA 1HNXQ 4GOPC 1K83H 1TXYA 4JG2A 5FJ8H 1QVFA 3RGLA 3FP9A 2KENA 1KAWA 2ZTGA 2IHFA 4DV2L 1XPUA 1U5KA 3A5ZA 3RN2A 2I4OA 4JI4Q 4KLKA 1NJ5A 1KOGA 3CCMA 2JA9A 2YU9H 1SETA 5C4XG 4LFAQ 1YBYA 4ALPA 4A3EG 1Q8KA 3UE1A 5C0XJ 2JEBI 4OWXB 1XPRA 4X66L 4LF6L 4H2WA 1XNRL 3KYHC 4LF8Q 1YFRA 4A3GG 4MTNA 1KRTA 1N33L 1WYDA 3DM3A 1Y1WH 2UXCL 4HJ8A 2NN6I 1VQ4A 1ASYA 1N32L 1S40A 3J81i 1X3FA 1T9HA 1DGSA 1NJ1A 2E5LL 2ZIMA 4QY7A 4GN5A 5C44G 3HOZH 4B3RQ 3K8AA 3J81j 1PH8A 4A3MG 4X65L 3HOXH 1XMQQ 2ZR2A 3VQYA 1PH7A 4LVMA 1HZAA 4DV4L 1VQNA 3K7AH 2CJ9A 2K50A 2P5IA 5GQOA 3IKLA 4J15A 4HWTA 4LNQA 1G6PA 4OONA 2ZNJA 2ALYA 4XEMA 3GTLH 3F2CA 3U58A 1VQIA 2I4NA 2B63G 5IP9G 2HT1A 4P73C 3JAMi 1YEZA 3I7FA 2JA7H 1SR3A 1I3QH 1EOVA 3CCRA 2VS1A 3CQZH 1B76A 3RUXA 3RLFA 1AE3A 5JEAJ 4DV4Q 3AYHB 3SGIA 2IT1A 3QNEA 1VQHA 5GAHC 1HXDA 4IOAA 1BKBA 4DUYQ 2I5MX 1YVCA 3TEHA 2PMEA 4LF8L 1WI5A 1Y14B 2WAQG 2VUMH 4NXMQ 4LVLA 3LGJA 3NETA 2E10A 3EIVA 1HNZL 1X3GA 1NNHA 1SRUA 5K36G 3AEVA 4HIOA 3PCOB 5K1PA 4A3LG 4L87A 1QUQB 1Q46A 4JBKA 1PYSB 4HWPA 4YPFA 3CXCA 2ZT5A 4NB3A 4LFCL 3UDGA 2R7ZH 3MEYA 1NYQA 4A76A 1AE2A 5IWAL 1VQZA 3HRIA 1WNLA 1NTGA 2A8EA 3I4MG 4JI2L 2IY5B 2EJ9A 3TREA 3G1ZA 5IP7G 1G5IA 3PO2H 1NY4A 4E51A 1RIPA 1OXXK 3LSQA 2IY5A 5M3MG 4A3IH 3PV0A 1HJPA 1NBWA 3HKZE 3EFSA 2H5XA 4DR7Q 4H2UA 3CCJA 3J7ZC 3G4SA 4A93H 3HOUH 2ZJPA 3HFZA 5GADC 3J80i 2JA5G 1WOCA 4DR4L 3AFPA 1Q1EA 3CPWA 2EJGA 2ZJQA 1PHJA 4YP0A 2ZIOA 2BA1A 3PO3G 2ZTCA 4JI2Q 2ZJRA 4HA8A 2D0PA 3TS2A 4LUOA 2DXTA 4JI5L 4XU1A 3TEHB 4HJ9A 1YJWA 2UXCQ 3CCLA 2KHJA 4KHPQ 3UDIA 1I94Q 1KXLA 1D8LA 2OCEA 2Y0SE 4A3BH 1PH6A 4K0KQ 1BIAA 2G4CA 4A3BG 1L1OA 4C3JH 2C7IA 4YREA 1IBML 1Q81C 2KHIA 1VQDA 4B3ML 2Q5IA 4A3EH 2N8NA 2AHOB 3B6YA 2AWOA 2I4LA 2NVQH 3HFVA 2JA8H 4JI5Q 1HR0L 2Q5HA 2ALYB 4PZ7A 2CCZA 2ODRC 3RN5A 3TQYA 4P74C 1NYRA 2Q7EA 2V1CC 2R7FA 4LVJA 3HRKA 1K8AC 3LSSA 2ZZEA 3REUA 1JB7A 1USYC 2K5HA 1X01A 4CS2A 1EVLA 1UE5A 4P72A 1Z47A 1GM5A 2A8VA 3OD1A 2J3LA 3S1RH 1HNWQ 1VQ8A 1PH1A 3L1AA 1HZBA 2MNAA 2NVYH 3RLNA 1X2GA 5K1XA 2ATWA 1CSQA 4YYEA 5ELNA 3A7AA 4YY3Q 2ZT6A 3W1GA 4PZ8A 1MJCA 2JA7G 4YRFA 2E3CA 5E7NA 4OWTB 1OXTA 2EQSA 1O7IA 2ZM6L 4BXXG 2UUBQ 3L2PA 3HOXG 5LMUQ 1JMCA 3KLWA 4A3CH 4RQEA 12ASA 5C4JH 4NXNL 4IPDA 2UUCL 1Q1BA 5M5YH 4HVCA 2ZT8A 1QZHA 1WLEA 3RKXA 2A1AA 3H0GH 4P75A 2E41A 2K5VA 4OP0A 2BH8A 2DGYA 4IPGA 2QGQA 4HIDA 5BR8Q 2WB1E 1GVPA 3I56A 3V8JA 4DR4Q 1Y1VG 5IY0A 1IBLQ 2JA6G 3V7SA 2KBNA 1VQEA 1XMOQ 4ME3A 4X65Q 2I0QA 2DQ0A 4YWMA 2DU5A 1NJIC 1N34Q 2WB1G 2CWPA 2PQAB 3QO5A 1K3RA 2QHVA 2Z6KA 3F8TA 1N36L 1K9MC 1B70A 4DNIA 3PO2G 1CUKA 3CMEA 4YRQA 3HXZA 4ZIBA 2E2HH 1K8GA 4KR3A 1PV4A 1J5EQ 3CCEA 3RKWA 2YTXA 1Z7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H4T A;  3UGQ A;  2LXK A;  4TVY A;  4K86 A;  5C52 B;  4A3L H;  2A19 A;  3HOW G;  4YCV A;  1YZ6 A;  3J80 c;  3CCS A;  3VQV A;  5IT9 c;  3STB D;  2XGT A;  4PG3 A;  1YFT A;  2XTI A;  2ID0 A;  4L5S A;  3M4O H;  4DV7 Q;  2ZGW A;  3GO5 A;  1X55 A;  1ATI A;  3PSI A;  4EX5 A;  2FYK A;  4DQ2 A;  4WJ3 M;  2PI2 E;  5IP7 H;  2F3I A;  2VZA A;  2F4V L;  1JJG A;  2CJA A;  3GTG H;  2QEX A;  4QIW E;  3JC6 6;  1RL2 A;  3CAM A;  3HXW A;  4AYB G;  3PGZ A;  3FHW A;  2DQ3 A;  3ZJY C;  4A4I A;  4GN4 B;  1KMN A;  3UGT A;  5FLM H;  2Z6K C;  3J81 c;  2E8G A;  2AMC A;  3MF1 A;  3G48 A;  4P71 C;  1FYF A;  2QHU A;  2B3G A;  2IX0 A;  4A3F H;  4LF7 L;  5F5W A;  4JI3 Q;  2E65 A;  3NEL A;  1QE0 A;  1X56 A;  4AYB E;  3F2B A;  3S24 A;  4YRI A;  1YHQ A;  1HH2 P;  2B29 A;  3UE0 A;  5JJI A;  2YV5 A;  4Q15 A;  1VQG A;  2DEQ A;  1N32 Q;  4BY7 G;  3OYY A;  4CH6 A;  3WQZ A;  2C35 B;  5DLQ E;  2UUC Q;  3A74 A;  4X64 Q;  2HIV A;  2JE6 I;  4TQF A;  1U0L A;  2R7D A;  4A3I G;  1S3O A;  2FXQ A;  2UXD Q;  2UUB L;  2OQ0 A;  3K7U C;  3HOY G;  1SRY A;  3STB C;  4DUZ L;  4DR5 Q;  2E64 A;  4YDQ A;  4A93 G;  1TWC H;  3OW2 A;  1FVI A;  4R4Q A;  5AJ3 L;  4KR2 A;  2QHS A;  2JA5 H;  1WFQ A;  4X64 L;  4LW1 A;  4LF6 Q;  3QTC A;  4X66 Q;  1EIF A;  1BIB A;  1D7Q A;  1NE3 A;  3HOV G;  3PUV A;  4JCV E;  4GKJ Q;  4XTW A;  4NPS A;  1EQR A;  1SN8 A;  3FKI G;  1TWG H;  1XMO L;  4LFB L;  1L1O C;  4JI7 L;  4A3C G;  1WQ7 A;  1KC8 C;  1G29 1;  4IOC A;  1GKH A;  3G71 A;  3P8Y A;  3RAC A;  4L5Q A;  5C4X H;  3IKM B;  2CWA A;  2RHQ B;  1I5F A;  4GKK L;  2OTL A;  1E7Z A;  3H0G G;  4LFC Q;  1VQP A;  4DPG A;  3T1H Q;  2R93 H;  4HWS A;  4P3O A;  2B63 H;  2MO0 A;  4YCU A;  2F4V Q;  1UE6 A;  2RF4 A;  1OXS C;  5LMU L;  3CC4 A;  4GKJ L;  1TWA H;  1NMG A;  4H2S A;  4DV6 L;  2RHQ A;  4JI1 Q;  2F52 A;  4TVA B;  5LMN Q;  1K73 C;  2BA0 A;  2YTV A;  5H1S E;  1LTL A;  3A5Z B;  2OWO A;  3GTK H;  4BY1 H;  1CKO A;  2VQF L;  1UEB A;  4ZTU B;  3CP0 A;  4GKK Q;  4LWC A;  3G6E A;  1ADJ A;  1QF6 A;  2EL9 A;  4LF9 Q;  1XNQ L;  1JT8 A;  4LF4 Q;  4JOI A;  1VQK A;  3TUP A;  4YWK A;  1Y1V H;  4QGU A;  2GN5 A;  1JJC A;  3BZK A;  4CS3 A;  3MEF A;  4OLF A;  3CC7 A;  1KHI A;  2RHS A;  3ERR A;  1BBW A;  1PVO A;  5IYC G;  2D0O A;  4YRG A;  1HNZ Q;  3E0E A;  2VQE Q;  4BXX H;  3CCQ A;  5IYC H;  1E3P A;  3U4Z A;  4GOP B;  1PFS A;  1SER A;  1P16 A;  4POG A;  2EWN A;  3T1H L;  4IFD J;  4G85 A;  3R07 A;  3KJO A;  2Q2T A;  1YNX A;  4TWA A;  4DV0 Q;  3PUZ A;  3RZD H;  3KDF B;  2VW9 A;  1YGB A;  4DR7 L;  3DSQ A;  4LF5 L;  4P3N A;  3V7C A;  5C3E G;  2NVT H;  1SFO H;  3IRB A;  2DZC A;  2VL6 A;  3FJP A;  5M5W H;  2GVA A;  2E2I H;  2DJZ A;  3CMA A;  2RCN A;  1RIQ A;  4Y7N H;  1V9P A;  5IP9 H;  1B8A A;  1L1O B;  11AS A;  1B7Y A;  5EAY A;  1YIJ A;  1SRO A;  5KNN A;  1X2H A;  1IXR A;  3HY1 A;  4GS3 A;  1W3S A;  4R4O A;  3ER0 A;  1UE7 A;  2ART A;  4DUY L;  2VUM G;  4DV2 Q;  2OQK A;  1YB3 A;  3U50 C;  1FJG L;  5BR8 L;  4B3R L;  4JI0 Q;  1PH4 A;  3RIR A;  3F1Z A;  4GN3 B;  4TQU S;  1B7Y B;  2K75 A;  1IBK Q;  1J5E L;  3PZC A;  4JC0 A;  2KCT A;  2CFM A;  4P75 C;  1QVC A;  1CKN B;  4NXN Q;  3VDY A;  1WJJ A;  4P72 C;  4TQD A;  4LF5 Q;  1E22 A;  2N3S A;  3A32 A;  4C3H H;  5AJ3 Q;  3I4M H;  3S1M H;  3PUW A;  3IG2 A;  4TTV A;  3UH0 A;  1BBU A;  2L15 A;  4G84 A;  1NJ6 A;  2UXB Q;  3A0J A;  4XTV A;  4UPA A;  4BY7 H;  5GRO A;  2AKW B;  4KI0 A;  3S2D H;  4DK6 C;  3CCU A;  4XU2 A;  1FJG Q;  2K14 A;  1MIU A;  4XU0 A;  3M3Y H;  2NZH A;  1LUZ A;  4GLV B;  2LXJ A;  4P3P A;  5ELO A;  2WFW A;  4MNO A;  3KF6 A;  2UUA Q;  1PH3 A;  5M3M H;  5C0X G;  4A3K G;  5IE8 A;  3H3V H;  4A3K H;  3BU2 A;  1M90 C;  4O0A A;  4PMW A;  4YRL A;  4NXM L;  1PYS A;  4DR1 L;  3LC0 A;  1Q7Y C;  4DV1 Q;  2CIM A;  4Q6G A;  1ASZ A;  1N34 L;  1XJV A;  4YRJ A;  2K4K A;  4JV5 L;  2EIF A;  3I4N G;  1KMM A;  3PO3 H;  4LUV A;  5FLX c;  2I5L X;  4YRK A;  4JI4 L;  4B3S L;  3V8K A;  3S14 H;  3CMQ A;  2MQH A;  1KL9 A;  4TVA A;  5JEA G;  4QJF A;  4H2X A;  4RMF A;  2CGH A;  2ZCE A;  4HJ7 A;  5LMN W;  4DR3 Q;  4WF2 A;  1YHB A;  4AQY L;  4PHC A;  4JI6 Q;  2HQL A;  4XTY A;  3M7N A;  1KIX A;  3ICA A;  4DAY B;  1EIY A;  2UUA L;  3S1N H;  4CH5 A;  1Q86 C;  4C3I H;  2WAQ E;  3PF4 A;  2JA8 G;  2ZZF A;  4DV5 L;  1YIT A;  2UU9 Q;  4C2M H;  2JK8 A;  5C44 H;  4BBR G;  4LFA L;  2UXB L;  3PF5 A;  4GNX B;  1WU7 A;  4BBR H;  1A0I A;  4WI1 A;  3MF2 A;  3GTM H;  3L4G A;  1GGM A;  1VQ9 A;  1KD1 C;  3HOZ G;  3L7Z C;  2Z0S A;  5IYD G;  1UE1 A;  3L4G B;  3ULL A;  1OTC A;  1J6Q A;  3J7A 5;  4GLA C;  4XIG S;  5JJL A;  3ICE A;  1SMX A;  4K88 A;  1H95 A;  3U4V A;  3CD6 A;  1Q12 A;  1V1Q A;  2KCM A;  3W5O A;  2AWN A;  3CF5 A;  4YCW A;  4JBW A;  3A5Y A;  4OO1 G;  3HKZ G;  1I94 L;  2DUD A;  4AIM A;  1HTT A;  1PH5 A;  2Q7G A;  1PA6 A;  4LF9 L;  2LSS A;  4XTC S;  4H2X B;  4Y52 H;  3QO8 A;  4RG1 A;  2Q2H A;  3T1Y L;  4DR6 L;  1A62 A;  1VQJ A;  2UU9 L;  3TS0 A;  4YHH L;  3WWV A;  3K81 C;  1E1O A;  3EN2 A;  4DR1 Q;  2R92 G;  2ZTD A;  4P73 A;  4BBS G;  5M5X H;  1LM0 A;  4A3J H;  4JYA L;  1SE8 A;  2R92 H;  4KQE A;  4YRT A;  2K52 A;  4YRM A;  1HZ9 A;  5IYB G;  1HR0 Q;  5E3I A;  1C7Y A;  3EFR A;  4H2T A;  4A3D G;  1V43 A;  2DVE A;  4EQ5 A;  2DDZ A;  4LF7 Q;  4KHP L;  1JE5 A;  3UDF A;  2CKZ B;  1XNQ Q;  4AH6 A;  2GVB A;  1WCM G;  4DR2 Q;  4X6A H;  1QVG A;  3AFQ A;  4X62 Q;  3CC2 A;  3QO7 A;  4IPH A;  5IWA Q;  1YJ9 A;  4BA1 I;  3GDE A;  4XTU A;  2R6G A;  2ES2 A;  2VQF Q;  1VS0 A;  4RDX A;  4IJH A;  1X54 A;  1EYG A;  1YI2 A;  2ZZG A;  1EUJ A;  1X6O A;  3L0O A;  1J5W A;  4UP7 A;  3F2D A;  4B3M Q;  1YFS A;  4XU3 A;  3HOU G;  2C8M A;  4JI6 L;  4X62 L;  4OXP A;  1OXV A;  1A8V A;  2DZ9 A;  1X9N A;  5C0X I;  4YY3 L;  2PMF A;  2IX1 A;  2D62 A;  3GTJ H;  1EVK A;  4K0K L;  5JJK A;  4JI7 Q;  1CSP A;  3V7R A;  1OXU A;  3HOW H;  4WJ4 A;  2PI2 A;  4B3T L;  1AH9 A;  1G5H A;  4CS4 A;  5C53 B;  1WPY A;  3W3S A;  2ASB A;  1EWI A;  4P71 A;  3VQX A;  2EAY A;  3FKI H;  4DK3 C;  1S72 A;  1KRS A;  4OX9 Q;  1VQA A;  1B70 B;  3PUY A;  3V8L A;  4KHZ A;  3W1B A;  4OO1 I;  3M4Q A;  3OTO Q;  2IHE A;  1EFW A;  3RR5 A;  3TRZ A;  4UP9 A;  1P8L A;  1VQC A;  2PQA A;  1HZC A;  3BFM A;  1L0W A;  5M3F G;  3A5U A;  3JAM c;  4YRP A;  3KJP A;  3HXX A;  1JJ2 A;  4DV7 L;  1C0A A;  1UWV A;  4DKA C;  2E5A A;  3BJU A;  2I4M A;  1KQS A;  3ULP A;  1IBL L;  3D0F A;  2DTH A;  3S2H H;  4XTX A;  2NZO A;  3RL6 A;  2DTO A;  3P8T A;  2R7Z G;  3TEG A;  1FL0 A;  4CH4 A;  3I4N H;  3IAL A;  4HIK A;  3KDF A;  5HGQ A;  4TVW A;  3M9B A;  5FJ8 G;  3P8V A;  4DV5 Q;  4JI8 Q;  4GNX C;  4YRC A;  3DLL A;  3OTO L;  2J3M A;  4GOP A;  1R9T H;  4BWA A;  3KOJ A;  4HJA A;  2VNU D;  1VQO A;  3M4P A;  4JI3 L;  1XNR Q;  3GTP H;  3E9H A;  2HIX A;  3A7U A;  4DR3 L;  2Q7H A;  2CJB A;  1VQL A;  2K5N A;  4P74 A;  2ARS A;  2BH2 A;  3GTO H;  2RHS B;  4A3G H;  1G51 A;  3RLO A;  1GD7 A;  2NVX H;  3NEM A;  2E1H A;  1JJC B;  1E1T A;  1L2F A;  4UP8 A;  1TWF H;  2Q2U A;  4DV6 Q;  4OWW B;  1IBM Q;  4A3M H;  4O2D A;  1N36 Q;  3GTQ H;  1NMF A;  4APV A;  4H2Y A;  5C51 B;  2MO1 A;  4GNX A;  1VQ7 A;  1N8R C;  3H3V I;  1A63 A;  3UDX A;  4JI0 L;  2ZNI A;  2R93 G;  4R4I A;  1MKH A;  2UXD L;  5IYB H;  3D31 A;  4IPC A;  1N33 Q;  3S16 H;  2I5H A;  4HIM A;  3K0X A;  3L2Z A;  3EBE A;  4QQB X;  4LFB Q;  1LYL A;  1Y1W G;  3E9I A;  3NEN A;  3GD7 A;  3K80 C;  2VQE L;  1BVS A;  2VY3 A;  1IBK L;  2E5L Q;  3RKY A;  1MJE A;  4H02 A;  1HNX L;  2ZIN A;  4BW9 A;  2ZT7 A;  4JOI C;  2NN6 G;  4JYA Q;  3PUX A;  1XPO A;  4FDB A;  1IL2 A;  3A7R A;  4IFD G;  3I2Z A;  1VQB A;  2DKG A;  3VBB A;  4YHH Q;  3CCV A;  4K87 A;  4BBS H;  4YRO A;  4R4T A;  3PIO A;  4UY8 C;  1FGU A;  2JQO A;  4A3J G;  4JBM A;  4MZ9 A;  3PIP A;  2ZTE A;  3T1Y Q;  2DXU A;  5HY6 A;  3HXV A;  4BY1 G;  3MXN B;  2N78 A;  4YRR A;  3HXY A;  2E2J H;  5C3E H;  1PH9 A;  1H4S A;  4R1J A;  4IFD I;  1QZG A;  4XEO A;  5LMN L;  2EXD A;  4EO4 A;  4DV3 L;  1EIY B;  4A75 A;  1WCM H;  1VCI A;  2PNH A;  2QA4 A;  3BZC A;  4YRN A;  3KF6 B;  2JJQ A;  1TWH H;  4YRS A;  1K0R A;  4QL5 A;  3RNU A;  1I50 H;  3HXU A;  2YTY A;  2ZR3 A;  2DTI A;  1YHA A;  1N9W A;  2AKW A;  4DR6 Q;  4DV0 L;  1HC7 A;  4DUZ Q;  4DR5 L;  3Q8D A;  5M3F H;  3RZO H;  3ERS X;  1IZ6 A;  1Q82 C;  2ARU A;  1VQ5 A;  2QHT A;  4A3D H;  3HY0 A;  4IO9 A;  5GAG C;  2JA6 H;  4OX9 L;  3RF1 A;  3CPF A;  3HFZ B;  4LUZ A;  4LF4 L;  1W2B A;  2JEA I;  2YYZ A;  2Q2I A;  4PZ6 A;  3S17 H;  1SES A;  2AMC B;  4DV3 Q;  4CH3 A;  4L5R C;  2HHH L;  2MFI A;  1EQQ A;  1XMQ L;  3KFU A;  1C9O A;  3S1Q H;  2N49 A;  1PYB A;  5J3B A;  2PMZ E;  4JI1 L;  1VQ6 A;  1X65 A;  4NCX A;  1HNW L;  2EJF A;  4JBJ A;  1VQM A;  3HOY H;  4GLX A;  1YJN A;  4HWO A;  4POF A;  1NJ2 A;  3CW2 C;  4DV1 L;  1E24 A;  2OTJ A;  1CKN A;  1VQF A;  3AQQ A;  2Y0S G;  4RQF A;  1QUQ A;  2ZXF A;  3PCO A;  3M85 A;  2ZM6 Q;  4HWR A;  2HNI A;  4DAM A;  3KF8 B;  4AQY Q;  1HR0 W;  4DR2 L;  1NJ8 A;  3HOV H;  3A31 A;  1Z9F A;  1WQW A;  1IYJ B;  3HTZ A;  3S15 H;  3ULJ A;  3NBH B;  4B3T Q;  5IYD H;  3HKS A;  4H2V A;  1W66 A;  4XTZ A;  2HHH Q;  4B3S Q;  1H4Q A;  1CKM A;  4BA2 I;  4IJL A;  3REX A;  2WP8 J;  3UFG A;  1I6H H;  4R4C A;  4L5T A;  2DU7 A;  1USY A;  1XTD A;  4JV5 Q;  5FLM G;  5GAE C;  1Z7M A;  4LNS A;  3VQW A;  4X5O A;  1X3E A;  1H4V B;  4A3F G;  1GO3 E;  2ODR D;  1M1K C;  2P0L A;  4ZTZ B;  2CQO A;  4YWL A;  1ADY A;  1PH2 A;  3I55 A;  4JI8 L;  3I4O A;  3H15 A;  4HJ5 A;  1SLJ A;  1HNX Q;  4GOP C;  1K83 H;  1TXY A;  4JG2 A;  5FJ8 H;  1QVF A;  3RGL A;  3FP9 A;  2KEN A;  1KAW A;  2ZTG A;  2IHF A;  4DV2 L;  1XPU A;  1U5K A;  3A5Z A;  3RN2 A;  2I4O A;  4JI4 Q;  4KLK A;  1NJ5 A;  1KOG A;  3CCM A;  2JA9 A;  2YU9 H;  1SET A;  5C4X G;  4LFA Q;  1YBY A;  4ALP A;  4A3E G;  1Q8K A;  3UE1 A;  5C0X J;  2JEB I;  4OWX B;  1XPR A;  4X66 L;  4LF6 L;  4H2W A;  1XNR L;  3KYH C;  4LF8 Q;  1YFR A;  4A3G G;  4MTN A;  1KRT A;  1N33 L;  1WYD A;  3DM3 A;  1Y1W H;  2UXC L;  4HJ8 A;  2NN6 I;  1VQ4 A;  1ASY A;  1N32 L;  1S40 A;  3J81 i;  1X3F A;  1T9H A;  1DGS A;  1NJ1 A;  2E5L L;  2ZIM A;  4QY7 A;  4GN5 A;  5C44 G;  3HOZ H;  4B3R Q;  3K8A A;  3J81 j;  1PH8 A;  4A3M G;  4X65 L;  3HOX H;  1XMQ Q;  2ZR2 A;  3VQY A;  1PH7 A;  1HZA A;  4DV4 L;  1VQN A;  3K7A H;  2CJ9 A;  2K50 A;  2P5I A;  5GQO A;  3IKL A;  4J15 A;  4HWT A;  4LNQ A;  1G6P A;  4OON A;  2ZNJ A;  2ALY A;  4XEM A;  3GTL H;  3F2C A;  3U58 A;  1VQI A;  2I4N A;  2B63 G;  5IP9 G;  2HT1 A;  4P73 C;  3JAM i;  1YEZ A;  3I7F A;  2JA7 H;  1SR3 A;  1I3Q H;  1EOV A;  3CCR A;  2VS1 A;  3CQZ H;  1B76 A;  3RUX A;  3RLF A;  1AE3 A;  5JEA J;  4DV4 Q;  3AYH B;  3SGI A;  2IT1 A;  3QNE A;  1VQH A;  5GAH C;  1HXD A;  4IOA A;  1BKB A;  4DUY Q;  2I5M X;  1YVC A;  3TEH A;  2PME A;  4LF8 L;  1WI5 A;  1Y14 B;  2WAQ G;  2VUM H;  4NXM Q;  3LGJ A;  3NET A;  2E10 A;  3EIV A;  1HNZ L;  1X3G A;  1NNH A;  1SRU A;  5K36 G;  3AEV A;  4HIO A;  3PCO B;  5K1P A;  4A3L G;  4L87 A;  1QUQ B;  1Q46 A;  4JBK A;  1PYS B;  4HWP A;  4YPF A;  3CXC A;  2ZT5 A;  4NB3 A;  4LFC L;  3UDG A;  2R7Z H;  3MEY A;  1NYQ A;  4A76 A;  1AE2 A;  5IWA L;  1VQZ A;  3HRI A;  1WNL A;  1NTG A;  3I4M G;  4JI2 L;  2IY5 B;  2EJ9 A;  3TRE A;  3G1Z A;  5IP7 G;  1G5I A;  3PO2 H;  1NY4 A;  4E51 A;  1RIP A;  1OXX K;  3LSQ A;  2IY5 A;  5M3M G;  4A3I H;  3PV0 A;  1HJP A;  1NBW A;  3HKZ E;  3EFS A;  2H5X A;  4DR7 Q;  4H2U A;  3CCJ A;  3J7Z C;  3G4S A;  4A93 H;  3HOU H;  2ZJP A;  3HFZ A;  5GAD C;  3J80 i;  2JA5 G;  1WOC A;  4DR4 L;  3AFP A;  1Q1E A;  3CPW A;  2EJG A;  2ZJQ A;  1PHJ A;  4YP0 A;  2ZIO A;  2BA1 A;  3PO3 G;  2ZTC A;  4JI2 Q;  2ZJR A;  4HA8 A;  2D0P A;  3TS2 A;  4LUO A;  2DXT A;  4JI5 L;  4XU1 A;  3TEH B;  4HJ9 A;  1YJW A;  2UXC Q;  3CCL A;  2KHJ A;  4KHP Q;  3UDI A;  1I94 Q;  1KXL A;  1D8L A;  2OCE A;  2Y0S E;  4A3B H;  1PH6 A;  4K0K Q;  1BIA A;  2G4C A;  4A3B G;  1L1O A;  4C3J H;  2C7I A;  4YRE A;  1IBM L;  1Q81 C;  2KHI A;  1VQD A;  4B3M L;  2Q5I A;  4A3E H;  2N8N A;  2AHO B;  3B6Y A;  2AWO A;  2I4L A;  2NVQ H;  3HFV A;  2JA8 H;  4JI5 Q;  1HR0 L;  2Q5H A;  2ALY B;  4PZ7 A;  2CCZ A;  2ODR C;  3RN5 A;  3TQY A;  4P74 C;  1NYR A;  2Q7E A;  2V1C C;  2R7F A;  3HRK A;  1K8A C;  3LSS A;  2ZZE A;  3REU A;  1JB7 A;  1USY C;  2K5H A;  1X01 A;  4CS2 A;  1EVL A;  1UE5 A;  4P72 A;  1Z47 A;  1GM5 A;  2A8V A;  3OD1 A;  2J3L A;  3S1R H;  1HNW Q;  1VQ8 A;  1PH1 A;  3L1A A;  1HZB A;  2MNA A;  2NVY H;  3RLN A;  1X2G A;  5K1X A;  2ATW A;  1CSQ A;  4YYE A;  5ELN A;  3A7A A;  4YY3 Q;  2ZT6 A;  3W1G A;  4PZ8 A;  1MJC A;  2JA7 G;  4YRF A;  2E3C A;  5E7N A;  4OWT B;  1OXT A;  2EQS A;  1O7I A;  2ZM6 L;  4BXX G;  2UUB Q;  3L2P A;  3HOX G;  5LMU Q;  1JMC A;  3KLW A;  4A3C H;  4RQE A;  12AS A;  5C4J H;  4NXN L;  4IPD A;  2UUC L;  1Q1B A;  5M5Y H;  4HVC A;  2ZT8 A;  1QZH A;  1WLE A;  3RKX A;  2A1A A;  3H0G H;  4P75 A;  2E41 A;  2K5V A;  4OP0 A;  2BH8 A;  2DGY A;  4IPG A;  2QGQ A;  4HID A;  5BR8 Q;  2WB1 E;  1GVP A;  3I56 A;  3V8J A;  4DR4 Q;  1Y1V G;  5IY0 A;  1IBL Q;  2JA6 G;  3V7S A;  2KBN A;  1VQE A;  1XMO Q;  4ME3 A;  4X65 Q;  2I0Q A;  2DQ0 A;  4YWM A;  2DU5 A;  1NJI C;  1N34 Q;  2WB1 G;  2CWP A;  2PQA B;  3QO5 A;  1K3R A;  2QHV A;  2Z6K A;  3F8T A;  1N36 L;  1K9M C;  1B70 A;  4DNI A;  3PO2 G;  1CUK A;  3CME A;  4YRQ A;  3HXZ A;  4ZIB A;  2E2H H;  1K8G A;  4KR3 A;  1PV4 A;  1J5E Q;  3CCE A;  3RKW A;  2YTX A;  1Z7N A; 
#chains in the Genus database with same CATH topology
 1H4T A;  1PTO H;  3UGQ A;  2LXK A;  4TVY A;  4K86 A;  5C52 B;  3TDQ A;  4A3L H;  2TSS A;  2A19 A;  3SHL A;  3HOW G;  3H94 A;  4YCV A;  1ESR A;  2J7Z A;  4NKL A;  1YZ6 A;  4M1U B;  1PRT F;  4C56 C;  3J80 c;  3CCS A;  1VMC A;  3OWF A;  3VQV A;  5IT9 c;  3FDT A;  3STB D;  4H44 C;  2HDL A;  2XGT A;  1BQQ T;  5DM6 3;  2EOT A;  2R92 B;  4PG3 A;  1BUV T;  2XTI A;  1YFT A;  2ID0 A;  4L5S A;  4LVI A;  4ULL A;  3M4O H;  4DV7 Q;  4KMU C;  2ZGW A;  3S2H B;  1JOR A;  3GO5 A;  1X55 A;  1ATI A;  3PSI A;  5F2D A;  5AFW A;  4EX5 A;  4KKT A;  2FYK A;  4DQ2 A;  4WJ3 M;  2PI2 E;  5IP7 H;  2F0W A;  1QE6 A;  2F3I A;  5M3F B;  2VZA A;  1G2S A;  2F4V L;  1YNN C;  1JJG A;  2CJA A;  3GTG H;  2QEX A;  4QIW E;  2L12 A;  3JC6 6;  4KY7 A;  4HSP A;  1RL2 A;  2DY7 A;  3CAM A;  3HXW A;  5D14 A;  4AYB G;  3PGZ A;  3FHW A;  1GHJ A;  3DWA A;  2DQ3 A;  3ZJY C;  1LTG D;  3RMH A;  4A4I A;  4GN4 B;  2KHS A;  4DXF A;  1KMN A;  3UGT A;  5FLM H;  1UAP A;  2Z6K C;  2CH4 A;  3MFG A;  2PW7 A;  4QIW B;  2E8G A;  3J81 c;  2AMC A;  3MF1 A;  3G48 A;  4P71 C;  5KYI A;  5EPL A;  1FYF A;  2B3G A;  2QHU A;  2IX0 A;  3K5N A;  1ILP A;  4A3F H;  2VB2 X;  4LF7 L;  3E3X A;  2F03 A;  4FF3 A;  5F5W A;  4JI3 Q;  3A56 A;  2EYL A;  2E65 A;  1RCV D;  1DXM A;  1VF7 A;  2KOL A;  4KHV A;  3DWQ A;  2F3W A;  3NEL A;  1QE0 A;  1X56 A;  4AYB E;  2PZW A;  3F2B A;  2Z1C A;  1EZ6 A;  4LK1 C;  3S24 A;  4MIU A;  1Y1W B;  4YRI A;  1YHQ A;  2D5D A;  1HH2 P;  3QR8 A;  2B29 A;  4CDE C;  3UE0 A;  5JJI A;  2ICI A;  2YV5 A;  4Q15 A;  2JYO A;  2NZ1 D;  1VQG A;  2K04 A;  4A3E B;  3MQZ A;  2DEQ A;  4FNF A;  1XX8 A;  1R9T B;  1N32 Q;  3EQL C;  3VYT A;  2F0E A;  2F1M A;  4BY7 G;  2NWG A;  3OYY A;  4PQX A;  4CH6 A;  3WQZ A;  1KDC A;  2C35 B;  4F87 A;  5K5P A;  2E2D C;  4IAL A;  3A74 A;  3D3R A;  5DLQ E;  2UUC Q;  4HR7 B;  4X64 Q;  2EPB A;  2HIV A;  4C3J B;  2J0T D;  2JE6 I;  4TQF A;  1JOK A;  1U0L A;  4KJO A;  2FJ2 A;  5JEA H;  2R7D A;  4A3I G;  1S3O A;  2FXQ A;  1EYA A;  2UXD Q;  2UUB L;  2JXM B;  2OQ0 A;  3K7U C;  4A3B B;  1EY7 A;  5FO7 B;  3HOY G;  2MP1 A;  1WTP A;  1SRY A;  3GV6 A;  5JPM C;  3STB C;  1ZYR D;  4DUZ L;  4DR5 Q;  5CV7 A;  1SAP A;  4HN7 A;  2E64 A;  4YDQ A;  4A93 G;  3NE5 B;  1TWC H;  3OW2 A;  2ZXO A;  1FVI A;  4R4Q A;  5AJ3 L;  3BVG A;  1CM9 A;  3MEH A;  1HFG A;  1F2L A;  3S1N B;  4KR2 A;  2QHS A;  3RZO B;  1BCP D;  2JA5 H;  3J7A F;  1WFQ A;  2L0C A;  4IN3 A;  4X64 L;  4WRD A;  4LW1 A;  1BF4 A;  4LF6 Q;  3QTC A;  4CHT B;  4X66 Q;  2RA4 A;  4GZY C;  3K7A B;  1EIF A;  3VA5 A;  1BIB A;  1TS5 A;  5C6A A;  4KD4 A;  3K5O A;  1NE3 A;  1D7Q A;  3HOV G;  3PUV A;  1PLF A;  3NTI A;  4JCV E;  3T13 A;  4DFA A;  3VR6 A;  2A68 D;  4GKJ Q;  4XTW A;  4NPS A;  1EQR A;  1SN8 A;  3FKI G;  2C9O A;  3HOX B;  3BS1 A;  1TWG H;  1XMO L;  4LFB L;  3TME A;  1K0S A;  3PIP 3;  1L1O C;  2EE1 A;  2LY7 A;  4JI7 L;  4A3C G;  1WQ7 A;  3X3N A;  1KC8 C;  1G29 1;  2F0K A;  4IOC A;  1SMY D;  2L9H A;  1GKH A;  4A3I B;  3G71 A;  3P8Y A;  3RAC A;  5BN4 A;  4C3J G;  4RHR A;  1RDP D;  4QMG A;  4L5Q A;  5C4X H;  3SK6 A;  3IKM B;  1O7Y A;  2CWA A;  2RHQ B;  1I5F A;  3SEB A;  4RGN A;  4V19 0;  2OTL A;  1E7Z A;  4GKK L;  3H0G G;  1ICF B;  1LAC A;  2SNS A;  3S15 B;  3DM1 A;  4LFC Q;  1VQP A;  4DPG A;  3T1H Q;  2R93 H;  4HWS A;  4OHJ A;  2B2U A;  4P3O A;  2B63 H;  2MO0 A;  1TKW B;  4YCU A;  2PYK A;  4NMZ A;  4KKU A;  2F4V Q;  1UE6 A;  2RF4 A;  3U9O A;  1OXS C;  5LMU L;  5FKA C;  1SJH D;  1FGB D;  1VF5 C;  1W6J A;  4IUU A;  3KLS X;  4AYB B;  3CC4 A;  4ID6 A;  5KGU A;  4GKJ L;  1TWA H;  3W2D A;  1SYD A;  2OEO A;  2RBM A;  1NMG A;  4H2S A;  4DV6 L;  2B8G A;  2RHQ A;  4JI1 Q;  2PPB C;  4BS9 A;  2F52 A;  2HD3 A;  5C3X A;  3AMU A;  4TVA B;  5LMN Q;  1K73 C;  2A69 D;  2BA0 A;  2IL8 A;  2YTV A;  5H1S E;  1KAB A;  3RUZ A;  1K83 B;  1LTL A;  3A5Z B;  5L37 A;  3BYY B;  1B1Z A;  1SNC A;  2OWO A;  2BE5 C;  4K6D A;  4HT4 A;  5CC4 A;  4HCE A;  3GTK H;  3TSS A;  4BY1 H;  1CKO A;  2JSO A;  2VQF L;  1UEB A;  4B9W A;  4C3H B;  1QCB D;  4ZTU B;  1L0Y B;  3CP0 A;  4GKK Q;  4LWC A;  3G6E A;  2MPM A;  2K01 A;  4N9T A;  1ADJ A;  1QF6 A;  4H0L C;  2EL9 A;  2QDB A;  2N88 A;  4LF9 Q;  2JP1 A;  1XNQ L;  5IIF A;  1JT8 A;  4LF4 Q;  4JOI A;  1VQK A;  4K6L A;  2F0F A;  2A68 C;  4BBR B;  1EYD A;  1DYQ A;  1WVL A;  2HCC A;  3TUP A;  2EYP A;  4YWK A;  1Y1V H;  4PNY A;  1CK1 A;  1STB A;  2EDG A;  2GN5 A;  4QGU A;  5EPK A;  1JJC A;  3VR5 A;  5FOB B;  3BZK A;  4TRD A;  4CS3 A;  3MEF A;  3NBI A;  5JVH 3;  2F0U A;  4OLF A;  3CC7 A;  1KHI A;  4DAY A;  5KND A;  4XYO A;  5IOC A;  2RHS A;  3ERR A;  1BBW A;  1EY9 A;  1PVO A;  5IYC G;  3A54 A;  3GTQ B;  2D0O A;  4YRG A;  1HNZ Q;  4C3I B;  1H9R A;  1K8M A;  3EFX D;  3E0E A;  2VQE Q;  2WAQ B;  1A3U A;  4BXX H;  1KLG D;  1WTQ A;  2NN6 H;  3CCQ A;  5IYC H;  2CQA A;  1E3P A;  4RAU C;  3U4Z A;  1KNA A;  1EU4 A;  1PFS A;  4GOP B;  1SER A;  3KBG A;  3HOV B;  1P16 A;  2D9U A;  5KNC A;  4POG A;  2EWN A;  4XYQ A;  2EJG C;  3T1H L;  4IFD J;  5EKI A;  4G85 A;  3R07 A;  3KJO A;  4Y7N B;  2Q2T A;  1I4Q A;  1YNX A;  3OIP A;  3JAM E;  3T51 B;  1EY8 A;  3J7A V;  4TWA A;  2ENB A;  4DV0 Q;  3PUZ A;  1ET9 A;  2EYM A;  3KF8 A;  2E2I B;  3RZD H;  1M8A A;  2Y0S B;  1SFO B;  1LTR D;  5DM7 3;  2O5I C;  4OO1 H;  3KDF B;  2VW9 A;  2WB1 B;  1YGB A;  4DR7 L;  4RA8 A;  3DSQ A;  4LF5 L;  4P3N A;  1LLR D;  1B9N A;  2NTS A;  4IUN A;  3I90 A;  5EQ0 A;  3V7C A;  5C3E G;  5EBC A;  2NVT H;  1Z6H A;  1SFO H;  3IRB A;  2DZC A;  2VL6 A;  3FJP A;  1WCM B;  5M5W H;  2GVA A;  2E2I H;  4K5V A;  3K57 A;  2DJZ A;  3CMA A;  5I6Y A;  3DEP A;  5EKK A;  2RCN A;  1RIQ A;  4Y7N H;  3K59 A;  1V9P A;  5IP9 H;  1B8A A;  1L1O B;  11AS A;  1G6Z A;  2B2W A;  1NSN S;  5EAY A;  1B7Y A;  3MXG A;  1YIJ A;  1GUS A;  1SRO A;  1EZ8 A;  5KNN A;  1PFM A;  1X2H A;  1IXR A;  3HY1 A;  3Q22 A;  3J80 L;  4KN7 C;  4GS3 A;  5E1F A;  1W3S A;  4R4O A;  3ER0 A;  1UE7 A;  2ART A;  4DUY L;  2VUM G;  4IUQ A;  4DV2 Q;  2OQK A;  3I4N B;  1YB3 A;  3P1H A;  3U50 C;  1ICW A;  1FJG L;  4J8Q A;  3A55 A;  4BBS B;  5BR8 L;  4B3R L;  4JI0 Q;  1PH4 A;  1RJT A;  3RIR A;  3F1Z A;  4GN3 B;  1LT5 D;  1KTK A;  4TQU S;  4CGY B;  4X3T A;  1B7Y B;  2K75 A;  5FO9 B;  1IBK Q;  1J5E L;  3PZC A;  1QOH A;  1Y1V B;  4N8F A;  3S2D B;  4JC0 A;  3UI2 A;  2KCT A;  3JAM L;  1H9K A;  2CFM A;  2XIW A;  4P75 C;  1E2Z A;  1QVC A;  4PMB A;  5A35 A;  1CKN B;  1DOM A;  4NXN Q;  1HHV A;  1J9O A;  1GUW A;  1LTT D;  3VDY A;  1WJJ A;  3Q23 A;  4P72 C;  3U9S A;  4TQD A;  4LF5 Q;  1E22 A;  2N3S A;  3GP7 A;  3A32 A;  4C3H H;  5AJ3 Q;  3I4M H;  3S1M H;  5COR A;  3PUW A;  3IG2 A;  4TTV A;  4I7Z C;  3UH0 A;  1BBU A;  3D4D A;  1U4R A;  2HCI A;  1BCP C;  1IKL A;  2L15 A;  2F4I A;  4G84 A;  1NJ6 A;  2UXB Q;  3A0J A;  4XTV A;  5JJZ A;  3TN2 A;  4FO2 A;  4UPA A;  4BY7 H;  5GRO A;  2AKW B;  1F9R A;  4KI0 A;  3S2D H;  4DK6 C;  3CCU A;  4XU2 A;  1M4V A;  3A8J E;  1FJG Q;  3M4Y A;  3HG9 A;  2K14 A;  1MIU A;  4XU0 A;  3M3Y H;  1TS2 A;  2CW0 D;  2NZH A;  1LUZ A;  4GLV B;  2LXJ A;  1CQV A;  4P3P A;  3ITP A;  5ELO A;  5M5X B;  1SE2 A;  1EWH A;  2WFW A;  4MNO A;  3KF6 A;  2UUA Q;  1PH3 A;  5M3M H;  5C0X G;  4A3K G;  3HOW B;  1Q3L A;  2GA4 B;  2MUY A;  5IE8 A;  3R8B A;  2QF7 A;  2O2L D;  4DN4 M;  5ELE A;  3H3V H;  4A3K H;  3BU2 A;  1M90 C;  4O0A A;  4PMW A;  1PRT D;  4YRL A;  3NWT A;  4NXM L;  1PYS A;  1EOT A;  4DR1 L;  3LC0 A;  3S9W A;  4EVO A;  4FP5 D;  1Q7Y C;  5NUC A;  3J81 L;  2OXP A;  4DV1 Q;  2CIM A;  4Q6G A;  3A8I E;  1ASZ A;  1N34 L;  3NHH A;  1XJV A;  3WDN A;  1MBY A;  4YRJ A;  5KRU A;  1STY A;  2K4K A;  4JV5 L;  1L0X B;  2EIF A;  3I4N G;  1XYI A;  1OO9 B;  1KMM A;  3PO3 H;  2RVL A;  4LUV A;  5FLX c;  2B2Y C;  2I5L X;  2BOS A;  4YRK A;  1ENC A;  4ZKC B;  4JI4 L;  3IFT A;  2PW5 A;  4B3S L;  3V8K A;  4HMJ A;  4RCO A;  3S14 H;  3CMQ A;  2F0T A;  5CV5 A;  5T1I A;  2MQH A;  4KJN A;  3GTP B;  1JR0 D;  1KL9 A;  1EY6 A;  4TVA A;  1EIG A;  1GUO A;  3MTS A;  5JEA G;  4QJF A;  1HUM A;  2F0O A;  4H2X A;  3TZU A;  1H9M A;  4RMF A;  2CGH A;  1HQM C;  1ILQ A;  4U67 3;  4HJ7 A;  2ZCE A;  5LMN W;  4DR3 Q;  4WF2 A;  1YHB A;  4AQY L;  4PHC A;  4JI6 Q;  3ND8 A;  5CMD A;  4DXG A;  2HQL A;  4XTY A;  1EWC A;  1KIX A;  5J22 A;  4G7Z C;  4DAY B;  3M7N A;  2UUA L;  3ICA A;  1EIY A;  3GTM B;  2AUJ D;  3S1N H;  4CH5 A;  1Q86 C;  3FPU B;  3T16 A;  1TS3 A;  3S17 B;  4C3I H;  2IPK D;  3L3O C;  2Q8I B;  2WAQ E;  3PF4 A;  4IUR A;  4F8M A;  2JA8 G;  2ZZF A;  3QG1 A;  2FHT A;  5EPJ A;  3KLR A;  4DV5 L;  2J4X A;  3MXP A;  1YIT A;  2UU9 Q;  1YNJ D;  4C2M H;  2JK8 A;  2DN8 A;  3PQI A;  3E5S A;  5C44 H;  4BBR G;  4LFA L;  2UXB L;  4R8I A;  3PF5 A;  1IHZ A;  1JQY D;  4GNX B;  2WKC A;  2KQ3 A;  2R3Z A;  1WU7 A;  3F2U A;  1A0I A;  4BBR H;  1PRT C;  1CA5 A;  3MF2 A;  4WI1 A;  4QUC A;  4ZAI A;  3GTM H;  1GGM A;  3L4G A;  5M9O A;  1VQ9 A;  1KD1 C;  4A3M B;  2Z6B A;  3HOZ G;  3OIQ A;  1K28 A;  3L7Z C;  2Z0S A;  3MZ5 A;  5IYD G;  1UE1 A;  3L4G B;  3FPP A;  1ZXT A;  2F0L A;  5C4H A;  3ULL A;  1OTC A;  5IGD A;  1CZW A;  1J6Q A;  1C8C A;  1ESF A;  3FVQ A;  3J7A 5;  4O1N A;  1MSH A;  5CGK A;  4GLA C;  2A6E D;  4XIG S;  5JJL A;  1A3T A;  2WKD A;  3P7J A;  3ICE A;  1SMX A;  4KK7 A;  1WTV A;  4K88 A;  1H95 A;  4RH6 A;  1TWH B;  2X6L A;  1GXD C;  3U4V A;  3CD6 A;  1Q12 A;  1V1Q A;  2KCM A;  3W5O A;  1AN8 A;  2AWN A;  2LS0 1;  3CF5 A;  1DZ1 A;  4YCW A;  2K5D A;  4JBW A;  3A5Y A;  4OO1 G;  3D6W A;  1SNM A;  3VR4 A;  1D6E C;  3HKZ G;  5JVG 3;  1I94 L;  2DUD A;  4AIM A;  2EVB A;  2B8F A;  1HTT A;  1PH5 A;  1B3Q A;  2Q7G A;  1BXT A;  1PA6 A;  4LF9 L;  2LSS A;  3H3V C;  3HRZ C;  4WOR A;  4XTC S;  4H2X B;  5C3E B;  4R9W A;  4Y52 H;  3QO8 A;  4RG1 A;  2Q2H A;  3T1Y L;  4DR6 L;  1A62 A;  3CRL C;  1VQJ A;  2B39 A;  2UU9 L;  3KK7 A;  3IFD A;  1U4P A;  3TS0 A;  4J1M A;  2IW3 A;  4YHH L;  1RKN A;  4IFD H;  3I4L A;  3WWV A;  3K81 C;  1E1O A;  3EN2 A;  2F3V A;  1NR2 A;  4DR1 Q;  2R92 G;  1PTO D;  4QUF A;  2ZTD A;  4P73 A;  4BBS G;  5M5X H;  1LM0 A;  1PZJ D;  4C2M B;  1HQR D;  3VR3 A;  4A3J H;  4OIK A;  1HTP A;  4JYA L;  1SE8 A;  2Q8T A;  2XWB B;  2R92 H;  1KAA A;  4KQE A;  4YRT A;  2K52 A;  1E2V A;  2A5H A;  1TU2 B;  4YRM A;  5IGB A;  1HZ9 A;  4MN3 A;  5IYB G;  1HR0 Q;  1H9S B;  5E3I A;  2B2Y A;  3CU7 A;  1C7Y A;  3EFR A;  5K36 H;  4JVZ A;  4H2T A;  3EJI A;  4A3D G;  1V43 A;  2C5C A;  5DNF A;  1TY2 A;  2Z9H A;  2PZU A;  2DVE A;  1HXY D;  4EQ5 A;  4FYD A;  2DDZ A;  5ISR A;  4LF7 Q;  4KHP L;  4CKE A;  3M7G A;  1JE5 A;  4JPB W;  3UDF A;  2E76 C;  2CKZ B;  4BY1 B;  1XNQ Q;  2B2U C;  4ZUJ A;  4H13 C;  4AH6 A;  2GVB A;  1WCM G;  4DR2 Q;  3GTK B;  3HEJ A;  1QVG A;  4X6A H;  3AFQ A;  2RQX A;  3K0Y A;  4X62 Q;  4IQZ A;  3CC2 A;  2JA5 B;  4LVK A;  3QO7 A;  4IPH A;  1SE4 A;  5IWA Q;  1YJ9 A;  2EYF A;  2XRQ D;  1XXG A;  3GDE A;  4BA1 I;  3C46 A;  3SK5 A;  4XTU A;  4FF4 A;  2R6G A;  2ES2 A;  2VQF Q;  3C1F A;  1VS0 A;  4XQQ A;  3FEW X;  1HA5 A;  4RDX A;  2F0M A;  4IJH A;  1X54 A;  1EYG A;  3NBH A;  5J1Z A;  3PO3 B;  1YI2 A;  2EYJ A;  4XT3 B;  2O5J C;  2ZZG A;  1EUJ A;  1X6O A;  3L0O A;  1J5W A;  1Y69 U;  1AZQ A;  1FNU A;  4B9X A;  2KJX A;  2F0P A;  4UP7 A;  3F2D A;  4RGM A;  4B3M Q;  1QB5 D;  4L63 B;  5CV4 A;  1YFS A;  2EJM A;  1YNJ C;  2Q8R E;  1CFM A;  4XU3 A;  3SXH A;  3HOU G;  3BYT B;  4KY6 A;  2C8M A;  4JI6 L;  4X62 L;  4ZKB B;  4OXP A;  1D1K A;  1OXV A;  1A8V A;  2DZ9 A;  1X9N A;  5C0X I;  1ENA A;  4YY3 L;  2PMF A;  3ND9 A;  2IX1 A;  2D62 A;  3GTJ H;  1EVK A;  4K0K L;  3NK9 A;  4A3K B;  1E0B A;  5JJK A;  4JI7 Q;  1CSP A;  3V7R A;  1OXU A;  1BO0 A;  3SVM A;  2B2W C;  4V0B A;  5C4X B;  3HOW H;  4WJ4 A;  2PI2 A;  4B3T L;  1JB3 A;  5M3M B;  1AH9 A;  1G5H A;  4CS4 A;  5C53 B;  2P5Z X;  3I3C A;  3OSO A;  1WPY A;  2NB0 A;  2NVX B;  3W3S A;  2ASB A;  1EWI A;  4DGZ A;  5J39 A;  4KY5 A;  1K3B C;  4A3G B;  1WD0 A;  3NUC A;  3IAY A;  4P71 A;  3VYU A;  3VQX A;  2EAY A;  1WTO A;  1SYB A;  5C4J B;  1FNV A;  3FKI H;  4DK3 C;  1DOK A;  1S72 A;  1CQF A;  1KRS A;  4BY7 B;  2RSO A;  4OX9 Q;  1VQA A;  4RCN A;  1AW7 A;  2EY5 A;  1B70 B;  3PUY A;  3V8L A;  4KHZ A;  3W1B A;  4OO1 I;  3P20 A;  3M4Q A;  3OTO Q;  2IHE A;  1EFW A;  3RR5 A;  2NBF A;  2CVR A;  4DF7 A;  3S1M B;  3TRZ A;  4UP9 A;  1P8L A;  1VQC A;  2PQA A;  4KN4 C;  1HZC A;  3BFM A;  2LKV A;  3C1E A;  1L0W A;  2BE5 D;  5M3F G;  3A5U A;  4WFN 3;  3QIA A;  2FMM A;  3JAM c;  4YRP A;  5CV9 A;  3KJP A;  4IUV A;  1EFI D;  3HXX A;  1JJ2 A;  3Q6S A;  4DV7 L;  5I4D A;  3PMF A;  1C0A A;  4RHS A;  1O80 A;  2FIN B;  3A7L A;  4X3S A;  1UWV A;  4DKA C;  2E5A A;  3V2T A;  2QEJ C;  3BJU A;  1STH A;  2I4M A;  1KQS A;  3ULP A;  1IBL L;  3D0F A;  1EIH A;  2DTH A;  3S2H H;  1DON A;  3BDO A;  4XTX A;  1CI3 M;  3EA6 A;  2NZO A;  3RL6 A;  2EJF C;  4A3J B;  2F0H A;  2DTO A;  1O7L A;  3P8T A;  2R7Z G;  3TEG A;  4CJ1 B;  1FL0 A;  1B2T A;  5IGE A;  4CH4 A;  3I4N H;  3IAL A;  2KEE A;  4HIK A;  3LWU A;  1WTH A;  3KDF A;  4QF4 A;  2ZXR A;  1J8I A;  5HGQ A;  5FLX E;  4TVW A;  3M9B A;  5FJ8 G;  4HCS A;  3P8V A;  4DV5 Q;  4JI8 Q;  4GNX C;  4QCL A;  4YRC A;  1TR5 A;  3DLL A;  1IYU A;  1HUN A;  3OTO L;  1RTO A;  2J3M A;  3HP3 A;  4GOP A;  1R9T H;  4BWA A;  2NS6 A;  3KOJ A;  4HJA A;  2VNU D;  2HDM A;  3HS0 C;  2K03 A;  4BWG B;  1VQO A;  1SXT A;  3M4P A;  4JI3 L;  1XNR Q;  1B53 A;  4K5X A;  5C3W A;  3GTP H;  4F7X A;  3E0J A;  5KYL A;  1BOS A;  3GQB A;  3E9H A;  3S14 B;  2HIX A;  1AP0 A;  3A7U A;  3N6R A;  2PO4 A;  4DR3 L;  1I4P A;  2CJB A;  2Q7H A;  2IJ0 A;  1VQL A;  3FKI B;  5E3F A;  1QJO A;  1HTL D;  2K33 A;  2K5N A;  2K5Q A;  4P74 A;  2BH2 A;  2ARS A;  1I4H A;  3GTO H;  2E75 C;  2RHS B;  1GJX A;  4A3G H;  1G51 A;  3RLO A;  1GD7 A;  2NVX H;  1NNX A;  3NEM A;  1EU3 A;  4IUT A;  2E1H A;  1JJC B;  1SYF A;  1D2B A;  2K7V A;  4ME5 A;  2L5T A;  1I4R A;  2PMZ B;  4H7B A;  4K8J A;  5D3D A;  1E1T A;  2PCF B;  1L2F A;  2AQ3 B;  4UP8 A;  1TWF H;  2Q2U A;  5LL6 X;  2EXZ A;  2N55 A;  4DV6 Q;  4OWW B;  1ET6 A;  1IBM Q;  2B63 B;  4O42 A;  3GTG B;  2K05 A;  1PZK D;  3GTJ B;  4A3M H;  3NQI A;  3NP8 A;  2NTT A;  5BN3 A;  3Q24 A;  3K5L A;  4O2D A;  5FLX L;  1N36 Q;  1D1I A;  3GTQ H;  3QWN A;  4ZCK A;  5C44 B;  3D8G A;  1S5F D;  1NMF A;  1CTM A;  4APV A;  4RFB A;  1GHK A;  3MA2 B;  4H2Y A;  5C51 B;  1IW7 C;  2MO1 A;  5A2Q L;  4GNX A;  1VQ7 A;  1II3 A;  1N8R C;  2A69 C;  3H3V I;  1A63 A;  3UDX A;  3MXU A;  3KBX A;  4JI0 L;  1DCZ A;  2R93 G;  2ZNI A;  1Y8P B;  1CHQ D;  4R4I A;  1DM0 B;  1MKH A;  2UXD L;  5IYB H;  4ZQ3 A;  2G9D A;  3URY A;  2XNA C;  3D31 A;  4IPC A;  1KLU D;  1N33 Q;  3S16 H;  2I5H A;  4HIM A;  3K0X A;  3L2Z A;  1H9J A;  2L55 A;  2K32 A;  3I4M B;  3EBE A;  2F0J A;  5JAV A;  4ILW A;  4LFB Q;  4QQB X;  4XDX A;  1GOZ A;  1LYL A;  1Y1W G;  3E9I A;  3NEN A;  5DEH A;  4I7A A;  3GD7 A;  1SYG A;  3H09 A;  3K80 C;  2VQE L;  1BVS A;  2VY3 A;  1IBK L;  4I65 A;  2E5L Q;  3RKY A;  1MJE A;  4H02 A;  1HNX L;  2ZIN A;  2EYH A;  3VYS A;  3MHB A;  1D5Z C;  4BW9 A;  2ZT7 A;  4JOI C;  4DAV A;  2NN6 G;  4JYA Q;  1F77 A;  3PUX A;  1XPO A;  1MD2 D;  4FDB A;  1IL2 A;  3S1R B;  3A7R A;  2PQE A;  2EY1 A;  1B44 D;  4IFD G;  3I2Z A;  1VQB A;  2DKG A;  3VBB A;  4DK0 A;  5EJW A;  4OL7 A;  4RWS C;  4YHH Q;  3CCV A;  4K87 A;  4CDF C;  1A15 A;  4BBS H;  4YRO A;  4R4T A;  3PIO A;  1FGU A;  4UY8 C;  1TT2 A;  2JQO A;  4A3J G;  4JBM A;  4MZ9 A;  1IKM A;  3PIP A;  2ZTE A;  3T1Y Q;  2QW7 A;  2DXU A;  5HY6 A;  1MHW C;  5IGC A;  3HXV A;  4BY1 G;  3OMC A;  2NUC A;  3MXN B;  1LTA D;  2N78 A;  1NAP A;  4YRR A;  1STG A;  3HXY A;  5G3L F;  2E2J H;  2OF1 A;  2XWJ B;  1Y8O B;  2VB3 X;  5EGT A;  1JWU D;  1BR9 A;  1X3P A;  2K1B A;  5C3E H;  1PH9 A;  2BDN A;  1H4S A;  4R1J A;  4DNT B;  4IFD I;  1GUN A;  2DJG C;  1QZG A;  1AZP A;  1NCV A;  4XEO A;  1JOO A;  3D4R A;  5LMN L;  4JK1 C;  2A6H C;  2EXD A;  4EO4 A;  4HTH A;  4DV3 L;  4C3H G;  3LNN A;  1EIY B;  3K6O A;  1PFB A;  4A75 A;  1WCM H;  4EQO A;  1VCI A;  2NVT B;  2PNH A;  2QA4 A;  3BZC A;  2MGS A;  3C3L A;  2RDG A;  4YRN A;  3KF6 B;  4RGT A;  2JJQ A;  1TWH H;  1LTS D;  2XRS D;  4YRS A;  1SNQ A;  3QJY A;  3RZD B;  1K0R A;  4MHE A;  4QL5 A;  3C2P A;  3BDL A;  3RNU A;  4G7O C;  1QNK A;  1I50 H;  5E4W C;  2YTY A;  3HXU A;  2ZR3 A;  2B2V C;  2DTI A;  3OPO A;  1YHA A;  2Z4H A;  1N9W A;  2AKW A;  1U9R A;  3W3A A;  4DR6 Q;  2JA7 B;  1IL8 A;  3MAQ A;  4DV0 L;  4FXD A;  1HC7 A;  4DUZ Q;  4DR5 L;  3Q8D A;  4K2L A;  5M3F H;  5I6W A;  1UUP A;  1W6K A;  2VXW A;  3RZO H;  2H4O A;  3ERS X;  1IZ6 A;  1Q82 C;  3GTL B;  5CBE E;  2XVS A;  2ARU A;  5LL6 S;  1VQ5 A;  2QHT A;  4UAI A;  1TWC B;  4A3D H;  3HY0 A;  4IO9 A;  5GAG C;  2JA6 H;  4K14 A;  4OX9 L;  1BNZ A;  3ERQ A;  4Q5V A;  3RF1 A;  4XT1 B;  3P75 A;  3CPF A;  3HFZ B;  4LUZ A;  4LF4 L;  1KDB A;  1SMY C;  1W2B A;  2SEB D;  2JEA I;  2LFN A;  1TQO A;  1V1P A;  2YYZ A;  2Q2I A;  4PZ6 A;  1AEX A;  3TP8 A;  3S17 H;  1SES A;  1UEA B;  2AMC B;  5FK9 C;  1A2U A;  4JW0 A;  1TY0 A;  5COY A;  3I91 A;  1JOQ A;  4DV3 Q;  1WTW A;  4CH3 A;  4L5R C;  1Y8N B;  2EYO A;  2HHH L;  2MFI A;  4OIJ A;  3X3M A;  3HOZ B;  1SEB D;  1EQQ A;  2KEC A;  1XMQ L;  5IGF A;  1I4X A;  3KFU A;  1C9O A;  3DXJ C;  3S1Q H;  4G4K A;  2N49 A;  5ELB A;  2JA8 B;  1PYB A;  2QIL A;  5J3B A;  2PMZ E;  4JI1 L;  1VQ6 A;  1X65 A;  4NCX A;  1HNW L;  2EJF A;  1BDO A;  4JBJ A;  1DOL A;  1VQM A;  5KNB A;  3HOY H;  4ZRZ A;  4GLX A;  1YJN A;  4X3K A;  4HWO A;  4POF A;  1EQV A;  1ZEQ X;  3SE0 A;  1NJ2 A;  5KIX A;  3CW2 C;  4DV1 L;  1E24 A;  1F2Z A;  4C3I G;  4HMI A;  1RTN A;  2OTJ A;  1CKN A;  1VQF A;  3AQQ A;  2Y0S G;  4RQF A;  1QUQ A;  3FMC A;  2ZXF A;  3V05 A;  1IYV A;  3PCO A;  4ZUI A;  3M85 A;  3AU7 A;  1X3Q A;  4FVM A;  5I9P A;  2ZM6 Q;  4HWR A;  2HNI A;  4DAM A;  3KF8 B;  1NUC A;  2XSC A;  4LJZ C;  4AQY Q;  1HR0 W;  1WTX A;  4DR2 L;  5C5M A;  1NJ8 A;  3HOV H;  2A73 B;  2B2T A;  4U68 A;  3A31 A;  1Z9F A;  1WQW A;  1IYJ B;  3HTZ A;  3S15 H;  3ULJ A;  4CBV A;  5C5L A;  4ODG A;  2KA7 A;  2K5W A;  3NBH B;  4B3T Q;  1LV9 A;  4XQJ A;  2K6A A;  1ZYR C;  5IYD H;  1T5E A;  3HKS A;  4H2V A;  4HED A;  1F2M A;  5G3L D;  5C0X H;  3M4O B;  1W66 A;  4XTZ A;  2HHH Q;  2IX3 A;  2RKS A;  4B3S Q;  1H4Q A;  5LHY 1;  4EQN A;  4C1N I;  1CKM A;  4OEL B;  4BA2 I;  3M3Y B;  4IJL A;  3REX A;  1HPC A;  2WP8 J;  3R93 A;  3UFG A;  1I6H H;  2MJ8 A;  2QDL A;  3A8K E;  4R4C A;  4L5T A;  2DU7 A;  1USY A;  1XTD A;  4P2C B;  4CJ0 B;  4KV6 A;  2F0D A;  4JV5 Q;  5FLM G;  5GAE C;  1LO5 D;  1TWG B;  4DAP A;  1Z7M A;  4LNS A;  3VQW A;  2ICE C;  4X5O A;  5CV8 A;  3EVQ A;  1X3E A;  1H4V B;  4A3F G;  1GO3 E;  1O7Z A;  1PTO B;  1EQT A;  3OW7 A;  2EZV A;  2ODR D;  2F0I A;  1M1K C;  2P0L A;  1QG7 A;  4ZTZ B;  2CQO A;  4YWL A;  1ADY A;  4A93 B;  1PH2 A;  3LX0 A;  3I55 A;  1I6H B;  4JI8 L;  3I4O A;  3H15 A;  4DA2 A;  4S3S A;  4HJ5 A;  1STE A;  4R8N A;  2NYZ D;  1FD7 D;  1SLJ A;  2E74 C;  1HNX Q;  4GOP C;  4UHV A;  1K83 H;  1TXY A;  4JG2 A;  1EL0 A;  1STN A;  3BDC A;  3ERO A;  1F9S A;  5FJ8 H;  2F0G A;  1QVF A;  3RGL A;  1Z7N A;  3BVM A;  2KEN A;  1KAW A;  3I8Z A;  5CBA E;  2ZTG A;  2IHF A;  1IW7 D;  4DV2 L;  2L4N A;  3MVV A;  1XPU A;  1U5K A;  3A5Z A;  3CRK C;  3AB9 A;  3RN2 A;  1ZKO A;  2BCO A;  2I4O A;  4JI4 Q;  4KLK A;  2R7Z B;  1NJ5 A;  1KOG A;  2KUM A;  3CCM A;  2JA9 A;  5HUR A;  2YU9 H;  1SET A;  5DAU A;  5C4X G;  1YNN D;  2KED A;  1LTI D;  1SSO A;  4LFA Q;  3G7L A;  1YBY A;  3TZD A;  1G8Z D;  1PYW D;  4CKB A;  4ALP A;  4A3E G;  3J81 E;  2R93 B;  1Q8K A;  3UE1 A;  5C0X J;  2JEB I;  4OWX B;  1XPR A;  4X66 L;  3OOC A;  3QO2 A;  4LF6 L;  5EBD A;  1XNR L;  4H2W A;  3KYH C;  3A7A B;  1O78 A;  4LF8 Q;  4MTN A;  4A3G G;  1YFR A;  1KRT A;  1N33 L;  1KDA A;  3J7Y W;  1X32 A;  1WYD A;  3H0G B;  3DM3 A;  1Y1W H;  3DEO A;  3RD4 A;  4HJ8 A;  2NN6 I;  2JN4 A;  1VQ4 A;  2UXC L;  4YIJ A;  1ENF A;  1NR4 A;  1LT4 D;  1ASY A;  1N32 L;  1S40 A;  3J81 i;  5M5W B;  1X3F A;  1S5B D;  1T9H A;  2VUM B;  5M5Y B;  1DGS A;  1NJ1 A;  2E5L L;  5IT9 L;  1TII D;  2ZIM A;  1SYE A;  4GN5 A;  1SNP A;  4QY7 A;  5C44 G;  3Q0A A;  3HOZ H;  4B3R Q;  4LAA A;  3K8A A;  3J81 j;  1PH8 A;  4A3M G;  3TP5 A;  4X65 L;  3HOX H;  1LAB A;  4DU9 A;  4G7H C;  4EQP A;  4E6I A;  1EEF D;  1GUG A;  1XMQ Q;  4M8A A;  2ZR2 A;  1D5M C;  3VQY A;  2AQ2 B;  1PH7 A;  1PXU A;  4LVM A;  1HZA A;  4RKL A;  4DV4 L;  2MHV A;  1VQN A;  3K7A H;  1I3Q B;  2DJF C;  2QKI C;  2CJ9 A;  1RHP A;  2K50 A;  3G6J B;  5IGG A;  2P5I A;  1MGS A;  2ZXP A;  5GQO A;  2F0S A;  3DMU A;  3IKL A;  2JA6 B;  4J15 A;  4HWT A;  3I70 A;  4LNQ A;  1G6P A;  1FR3 A;  2XN9 C;  1D5X C;  4OON A;  2ZNJ A;  2NVY B;  2ALY A;  4XEM A;  5TSS A;  3GTL H;  3F2C A;  3U58 A;  1PMR A;  3TP7 A;  1VQI A;  2I4N A;  2B63 G;  5IP9 G;  2BDO A;  2HT1 A;  1U4L A;  5D65 A;  4P73 C;  3JAM i;  1YEZ A;  2CHB D;  3I7F A;  2JA7 H;  1SR3 A;  1I3Q H;  1EOV A;  3VYR A;  3CCR A;  1B3A A;  1DD2 A;  2VS1 A;  3CQZ H;  1B76 A;  5CV6 A;  1I50 B;  2I07 B;  2WV6 D;  3RUX A;  3I72 A;  1PDQ A;  2ZT9 C;  3ONA B;  3RLF A;  1AE3 A;  5JEA J;  3MC0 B;  1SBB B;  4DV4 Q;  1JIC A;  3AYH B;  3SGI A;  2IT1 A;  1WD1 A;  3QNE A;  1VQH A;  5GAH C;  4DNR B;  1HXD A;  4IOA A;  1BKB A;  3VR2 A;  4DUY Q;  2I5M X;  2KCC A;  1YVC A;  3TEH A;  4LF8 L;  1WI5 A;  2PME A;  1ML0 D;  1KNE A;  1Y14 B;  2WAQ G;  2VUM H;  4NXM Q;  4IZ8 A;  3KLS A;  4LVL A;  2F0Q A;  3LGJ A;  3NET A;  2A74 C;  3ZYY X;  1LT6 D;  2E10 A;  3IL8 A;  3EIV A;  1HNZ L;  1X3G A;  4EGV A;  1NNH A;  1V1P B;  3T53 B;  3NXW A;  1SRU A;  5K36 G;  3AEV A;  4HIO A;  4A3F B;  3PCO B;  5I2X A;  5K1P A;  2FFK B;  4KD3 A;  4A3L G;  4L87 A;  1QUQ B;  1Q46 A;  4JBK A;  2KVM A;  2E2J B;  4NP5 A;  1HFN A;  1PYS B;  4HWP A;  1TWA B;  4YPF A;  3NPP A;  3CXC A;  1SYC A;  3SR1 A;  2RCF A;  2X69 A;  1S5C D;  2ZT5 A;  4NB3 A;  4LFC L;  1GUT A;  3UDG A;  5JPN C;  2R7Z H;  1QWY A;  3MEY A;  1NYQ A;  4A76 A;  2EY6 A;  1AE2 A;  5IWA L;  1VQZ A;  3HRI A;  4ZLT F;  3BZD B;  1WNL A;  1NTG A;  1UNS A;  2A8E A;  1SE3 A;  1EY4 A;  3I4M G;  4JI2 L;  5I2Y A;  2IY5 B;  4ZK9 B;  2DNC A;  2EJ9 A;  3TP6 A;  3TRE A;  3G1Z A;  5IP7 G;  1G5I A;  3PO2 H;  1NY4 A;  2CH4 W;  1Q8I A;  4E51 A;  3O13 A;  1RIP A;  3CHB D;  1OXX K;  3LSQ A;  2H1E A;  2IY5 A;  5M3M G;  4A3I H;  2G9H D;  3PV0 A;  1HJP A;  4KKS A;  5BN5 A;  3QOJ A;  1NBW A;  3SK4 A;  1WTR A;  3HKZ E;  3EFS A;  2LMC B;  3WOF A;  2H5X A;  3HZX A;  4DR7 Q;  4H2U A;  1F9P A;  3CCJ A;  3J7Z C;  2O4X A;  3G4S A;  5KEE A;  4A93 H;  4K8I A;  3HOU H;  2ZJP A;  1BBX C;  2SNM A;  1E2W A;  3TBI B;  3HFZ A;  2B2T C;  5GAD C;  1B9M A;  1CHP D;  3HOU B;  3J80 i;  4NDX A;  2JA5 G;  1WOC A;  3CQZ B;  4DR4 L;  2Z4I A;  3AFP A;  1Q1E A;  3CPW A;  2EJG A;  2ZJQ A;  4CDD C;  1PHJ A;  4YP0 A;  2ZIO A;  2BA1 A;  4CDC C;  1T5X D;  3PO3 G;  2ZTC A;  4JI2 Q;  3MWY W;  2ZJR A;  4X3U A;  3MXN A;  3DUZ A;  4L6T B;  4TSS A;  2D2C C;  4A3D B;  4HA8 A;  2D0P A;  1H9S A;  3TS2 A;  3MFY A;  4LUO A;  1B50 A;  2DXT A;  4JI5 L;  1S5E D;  4XU1 A;  3J80 E;  3TEH B;  4HJ9 A;  3PIO 3;  1V8Q A;  2L1B A;  1YJW A;  1MI2 A;  2UXC Q;  3CCL A;  2KHJ A;  1B4O A;  3UDI A;  4KHP Q;  1I94 Q;  1KXL A;  4Q0F A;  1CT1 D;  1EY0 A;  1CA6 A;  4FXG C;  1D8L A;  2DY8 A;  3I73 A;  2OCE A;  1C48 A;  1XWE A;  2Y0S E;  3GV3 A;  3OMG A;  1PH6 A;  4A3B H;  3H6M A;  1TVX A;  4K0K Q;  2PZT A;  1BIA A;  2G4C A;  2WIN B;  5EKL A;  1S5D D;  4K2K A;  4A3B G;  1L1O A;  1LT3 D;  4C3J H;  2C7I A;  2B2V A;  3SK8 A;  4YRE A;  1IBM L;  1JC7 A;  1Q81 C;  2KHI A;  1VQD A;  3VA7 A;  3L9A X;  3GTO B;  1SNO A;  4B3M L;  4FF2 A;  2Q5I A;  4A3E H;  2N8N A;  4PMC A;  2AHO B;  3R3O A;  1JWM D;  2SOB A;  3B6Y A;  3FRP B;  2AWO A;  3D4W A;  2RDH A;  2I4L A;  1HCZ A;  2A6E C;  4DK1 A;  3H91 A;  3BVZ A;  2NVQ H;  1ROD A;  2AUK A;  3HFV A;  4IUP A;  1JCK B;  4JI5 Q;  2JA8 H;  1HR0 L;  2Q5H A;  3S1Q B;  2ALY B;  4PZ7 A;  5HGT A;  2CCZ A;  3OWE B;  2ODR C;  4F88 A;  3RN5 A;  4KTA A;  3TQY A;  1I6V C;  1RF2 D;  5C4Z A;  4P74 C;  1NYR A;  4C1N K;  2Q7E A;  2V1C C;  5IT9 E;  3SDZ A;  2R7F A;  4LVJ A;  2WII B;  4TKO B;  5I9O A;  3HRK A;  1K8A C;  3LSS A;  1FNW A;  2EY2 A;  2ZZE A;  3REU A;  1G91 A;  1JB7 A;  3N52 A;  3QOL A;  1USY C;  1SND A;  1SJE D;  3D6C A;  3HKZ B;  2K5H A;  2Z8L A;  1X01 A;  4CS2 A;  5CR3 A;  1EVL A;  5A2Q E;  3DWP A;  1UE5 A;  4P72 A;  1R4P B;  2CW0 C;  1Z47 A;  1GM5 A;  2A6H D;  4XXE A;  2A8V A;  2R61 A;  1CZG A;  2DNE A;  1G2T A;  3OD1 A;  2HUG A;  2J3L A;  3S1R H;  2AQ1 B;  1HA6 A;  1HNW Q;  3KUP A;  4RGO S;  1VQ8 A;  1PH1 A;  3L1A A;  1HZB A;  2MNA A;  2NVY H;  1R4Q B;  1LTB D;  1F9Q A;  4J6H A;  4OEM B;  2X6G A;  1F2Y A;  3RLN A;  2IWH A;  5T1G A;  4FF1 A;  1I4G A;  5ELC A;  1X2G A;  1A2T A;  2F0N A;  5K1X A;  4Z9C B;  2ATW A;  1PRT B;  1CSQ A;  1EY5 A;  4YYE A;  3NSW A;  5ELN A;  3A7A A;  4ZYS A;  4NW2 A;  4YY3 Q;  2ZT6 A;  5JOB A;  3W1G A;  3NQT A;  4PZ8 A;  1MJC A;  3DHQ A;  1V1O A;  2M00 A;  2JA7 G;  2E3C A;  4YRF A;  5E7N A;  2HQE A;  4CKC A;  4OWT B;  1ONL A;  1OXT A;  2EQS A;  1U4M A;  1O7I A;  2ZM6 L;  4BXX G;  1HRJ A;  1K8O A;  1Z7T A;  3NTK A;  2UUB Q;  2WAC A;  3L2P A;  3HOX G;  5LMU Q;  1JMC A;  3KLW A;  4A3C H;  2F0V A;  4RQE A;  4L8J A;  2KCN A;  12AS A;  1QIL A;  5C4J H;  2V4D A;  4XQN A;  4NXN L;  2G5D A;  4IPD A;  2E2H B;  2UUC L;  1BCP B;  1Q1B A;  5M5Y H;  4HVC A;  2NVQ B;  1JWS D;  2ZT8 A;  1QZH A;  3CKI B;  1PTO C;  1WLE A;  3RKX A;  2A1A A;  3R2I A;  1PTO F;  2L11 A;  3H0G H;  4PV1 C;  4P75 A;  4N9P A;  2E41 A;  2K5V A;  2RDF A;  2M9V A;  4OP0 A;  4G57 A;  3V96 A;  2SDF A;  3PO2 B;  3IKJ A;  1BCP F;  1PFN A;  2BH8 A;  2DGY A;  4IPG A;  4HSV A;  2QGQ A;  4HID A;  5BR8 Q;  3BG3 A;  3NWS A;  4N8X 1;  3WOE A;  2WB1 E;  1GVP A;  1S4Z A;  4QB4 A;  3I56 A;  2QCP X;  4LMQ D;  2TMP A;  3V8J A;  3QB3 A;  3T4A C;  4DR4 Q;  1Y1V G;  3K5M A;  4CJ2 C;  2RSN A;  5IY0 A;  1IBL Q;  2JA6 G;  1A3V A;  3V7S A;  2KBN A;  1VQE A;  2YU9 B;  1C4Q A;  1TWF B;  1FYC A;  5ELD A;  1JE4 A;  1XMO Q;  2FMC A;  4ME3 A;  1Q90 A;  4X65 Q;  1QNU A;  1DJR D;  1MSG A;  5FO8 B;  1VDZ A;  2I0Q A;  2DQ0 A;  4YWM A;  2DU5 A;  1STA A;  4FXK C;  1NJI C;  1RD9 D;  5CYU A;  3LWE A;  3HGB A;  1A6X A;  2PNR C;  2OT2 A;  1N34 Q;  2WB1 G;  2CWP A;  2PQA B;  4K5W A;  3QO5 A;  1PZI D;  1K3R A;  3HOY B;  2QHV A;  5E4X A;  2Z6K A;  3F8T A;  1N36 L;  3NTH A;  1K9M C;  1B70 A;  3R2T A;  4DNI A;  3PO2 G;  3E6Z X;  4MTK A;  1CUK A;  4UDU C;  4WJW A;  5ELF A;  5IOD A;  3K58 A;  1VMP A;  3CME A;  4YRQ A;  3HXZ A;  4HAE A;  1EYC A;  4B08 A;  4ZIB A;  4RKB A;  2E2H H;  4ABN A;  1K8G A;  4KR3 A;  1PV4 A;  1J5E Q;  3CCE A;  1AFP A;  2K28 A;  3RKW A;  3T56 B;  4OGQ C;  1TS4 A;  1SDF A;  2YTX A;  3S16 B;  1EEI D;  2M2L A;  3OHX C;  2I46 A;  3FP9 A;  5D3I B;  1XTC D; 
#chains in the Genus database with same CATH homology
 1H4T A;  3UGQ A;  2LXK A;  4TVY A;  4K86 A;  5C52 B;  4A3L H;  2A19 A;  3HOW G;  4YCV A;  1YZ6 A;  3J80 c;  3CCS A;  3VQV A;  5IT9 c;  3STB D;  2XGT A;  4PG3 A;  1YFT A;  2XTI A;  2ID0 A;  4L5S A;  4LVI A;  3M4O H;  4DV7 Q;  2ZGW A;  3GO5 A;  1X55 A;  1ATI A;  3PSI A;  4EX5 A;  2FYK A;  4DQ2 A;  4WJ3 M;  2PI2 E;  5IP7 H;  2F3I A;  2VZA A;  2F4V L;  1JJG A;  2CJA A;  3GTG H;  2QEX A;  4QIW E;  3JC6 6;  1RL2 A;  3CAM A;  3HXW A;  4AYB G;  3PGZ A;  3FHW A;  2DQ3 A;  3ZJY C;  4A4I A;  4GN4 B;  1KMN A;  3UGT A;  5FLM H;  2Z6K C;  3J81 c;  2E8G A;  2AMC A;  3MF1 A;  3G48 A;  4P71 C;  1FYF A;  2QHU A;  2B3G A;  2IX0 A;  4A3F H;  4LF7 L;  5F5W A;  4JI3 Q;  2E65 A;  3NEL A;  1QE0 A;  1X56 A;  4AYB E;  3F2B A;  3S24 A;  4YRI A;  1YHQ A;  1HH2 P;  2B29 A;  3UE0 A;  5JJI A;  2YV5 A;  4Q15 A;  1VQG A;  3MQZ A;  2DEQ A;  1N32 Q;  4BY7 G;  3OYY A;  4CH6 A;  3WQZ A;  2C35 B;  5DLQ E;  2UUC Q;  3A74 A;  4X64 Q;  2HIV A;  2JE6 I;  4TQF A;  1U0L A;  2R7D A;  4A3I G;  1S3O A;  2FXQ A;  2UXD Q;  2UUB L;  2OQ0 A;  3K7U C;  3HOY G;  1SRY A;  3STB C;  4DUZ L;  4DR5 Q;  2E64 A;  4YDQ A;  4A93 G;  1TWC H;  3OW2 A;  1FVI A;  4R4Q A;  5AJ3 L;  4KR2 A;  2QHS A;  2JA5 H;  1WFQ A;  4X64 L;  4LW1 A;  4LF6 Q;  3QTC A;  4X66 Q;  1EIF A;  1BIB A;  1D7Q A;  1NE3 A;  3HOV G;  3PUV A;  4JCV E;  4GKJ Q;  4XTW A;  4NPS A;  1EQR A;  1SN8 A;  3FKI G;  1TWG H;  1XMO L;  4LFB L;  1L1O C;  4JI7 L;  4A3C G;  1WQ7 A;  1KC8 C;  1G29 1;  4IOC A;  1GKH A;  3G71 A;  3P8Y A;  3RAC A;  4L5Q A;  5C4X H;  3IKM B;  2CWA A;  2RHQ B;  1I5F A;  4GKK L;  2OTL A;  1E7Z A;  3H0G G;  4LFC Q;  1VQP A;  4DPG A;  3T1H Q;  2R93 H;  4HWS A;  4P3O A;  2B63 H;  2MO0 A;  4YCU A;  2F4V Q;  1UE6 A;  2RF4 A;  1OXS C;  5LMU L;  3CC4 A;  4GKJ L;  1TWA H;  1NMG A;  4H2S A;  4DV6 L;  2RHQ A;  4JI1 Q;  2F52 A;  4TVA B;  5LMN Q;  1K73 C;  2BA0 A;  2YTV A;  5H1S E;  1LTL A;  3A5Z B;  2OWO A;  4HT4 A;  3GTK H;  4BY1 H;  1CKO A;  2VQF L;  1UEB A;  4ZTU B;  3CP0 A;  4GKK Q;  4LWC A;  3G6E A;  1ADJ A;  1QF6 A;  2EL9 A;  4LF9 Q;  1XNQ L;  1JT8 A;  4LF4 Q;  4JOI A;  1VQK A;  3TUP A;  4YWK A;  1Y1V H;  4QGU A;  2GN5 A;  1JJC A;  3BZK A;  4CS3 A;  3MEF A;  4OLF A;  3CC7 A;  1KHI A;  2RHS A;  3ERR A;  1BBW A;  1PVO A;  5IYC G;  2D0O A;  4YRG A;  1HNZ Q;  3E0E A;  2VQE Q;  4BXX H;  3CCQ A;  5IYC H;  1E3P A;  3U4Z A;  4GOP B;  1PFS A;  1SER A;  1P16 A;  4POG A;  2EWN A;  3T1H L;  4IFD J;  4G85 A;  3R07 A;  3KJO A;  2Q2T A;  1YNX A;  4TWA A;  4DV0 Q;  3PUZ A;  3RZD H;  3KDF B;  2VW9 A;  1YGB A;  4DR7 L;  3DSQ A;  4LF5 L;  4P3N A;  3V7C A;  5C3E G;  2NVT H;  1SFO H;  3IRB A;  2DZC A;  2VL6 A;  3FJP A;  5M5W H;  2GVA A;  2E2I H;  2DJZ A;  3CMA A;  2RCN A;  1RIQ A;  4Y7N H;  1V9P A;  5IP9 H;  1B8A A;  1L1O B;  11AS A;  1B7Y A;  5EAY A;  1YIJ A;  1SRO A;  5KNN A;  1X2H A;  1IXR A;  3HY1 A;  4GS3 A;  1W3S A;  4R4O A;  3ER0 A;  1UE7 A;  2ART A;  4DUY L;  2VUM G;  4DV2 Q;  2OQK A;  1YB3 A;  3U50 C;  1FJG L;  5BR8 L;  4B3R L;  4JI0 Q;  1PH4 A;  3RIR A;  3F1Z A;  4GN3 B;  4TQU S;  1B7Y B;  2K75 A;  1IBK Q;  1J5E L;  3PZC A;  4JC0 A;  2KCT A;  2CFM A;  4P75 C;  1QVC A;  1CKN B;  4NXN Q;  3VDY A;  1WJJ A;  4P72 C;  4TQD A;  4LF5 Q;  1E22 A;  2N3S A;  3A32 A;  4C3H H;  5AJ3 Q;  3I4M H;  3S1M H;  3PUW A;  3IG2 A;  4TTV A;  3UH0 A;  1BBU A;  2L15 A;  4G84 A;  1NJ6 A;  2UXB Q;  3A0J A;  4XTV A;  4UPA A;  4BY7 H;  5GRO A;  2AKW B;  4KI0 A;  3S2D H;  4DK6 C;  3CCU A;  4XU2 A;  1FJG Q;  2K14 A;  1MIU A;  4XU0 A;  3M3Y H;  2NZH A;  1LUZ A;  4GLV B;  2LXJ A;  4P3P A;  5ELO A;  2WFW A;  4MNO A;  3KF6 A;  2UUA Q;  1PH3 A;  5M3M H;  5C0X G;  4A3K G;  5IE8 A;  3H3V H;  4A3K H;  3BU2 A;  1M90 C;  4O0A A;  4PMW A;  4YRL A;  4NXM L;  1PYS A;  4DR1 L;  3LC0 A;  1Q7Y C;  4DV1 Q;  2CIM A;  4Q6G A;  1ASZ A;  1N34 L;  1XJV A;  4YRJ A;  2K4K A;  4JV5 L;  2EIF A;  3I4N G;  1KMM A;  3PO3 H;  4LUV A;  5FLX c;  2I5L X;  4YRK A;  4JI4 L;  4B3S L;  3V8K A;  3S14 H;  3CMQ A;  2MQH A;  1KL9 A;  4TVA A;  5JEA G;  4QJF A;  4H2X A;  4RMF A;  2CGH A;  2ZCE A;  4HJ7 A;  5LMN W;  4DR3 Q;  4WF2 A;  1YHB A;  4AQY L;  4PHC A;  4JI6 Q;  2HQL A;  4XTY A;  3M7N A;  1KIX A;  3ICA A;  4DAY B;  1EIY A;  2UUA L;  3S1N H;  4CH5 A;  1Q86 C;  4C3I H;  2WAQ E;  3PF4 A;  2JA8 G;  2ZZF A;  4DV5 L;  1YIT A;  2UU9 Q;  4C2M H;  2JK8 A;  5C44 H;  4BBR G;  4LFA L;  2UXB L;  3PF5 A;  4GNX B;  1WU7 A;  4BBR H;  1A0I A;  4WI1 A;  3MF2 A;  3GTM H;  3L4G A;  1GGM A;  1VQ9 A;  1KD1 C;  3HOZ G;  3L7Z C;  2Z0S A;  5IYD G;  1UE1 A;  3L4G B;  3ULL A;  1OTC A;  1J6Q A;  3J7A 5;  4GLA C;  4XIG S;  5JJL A;  3ICE A;  1SMX A;  4K88 A;  1H95 A;  3U4V A;  3CD6 A;  1Q12 A;  1V1Q A;  2KCM A;  3W5O A;  2AWN A;  3CF5 A;  4YCW A;  4JBW A;  3A5Y A;  4OO1 G;  3HKZ G;  1I94 L;  2DUD A;  4AIM A;  1HTT A;  1PH5 A;  2Q7G A;  1PA6 A;  4LF9 L;  2LSS A;  4XTC S;  4H2X B;  4Y52 H;  3QO8 A;  4RG1 A;  2Q2H A;  3T1Y L;  4DR6 L;  1A62 A;  1VQJ A;  2UU9 L;  3TS0 A;  4YHH L;  3WWV A;  3K81 C;  1E1O A;  3EN2 A;  4DR1 Q;  2R92 G;  2ZTD A;  4P73 A;  4BBS G;  5M5X H;  1LM0 A;  4A3J H;  4JYA L;  1SE8 A;  2R92 H;  4KQE A;  4YRT A;  2K52 A;  4YRM A;  1HZ9 A;  5IYB G;  1HR0 Q;  5E3I A;  1C7Y A;  3EFR A;  4H2T A;  4A3D G;  1V43 A;  2DVE A;  4EQ5 A;  2DDZ A;  4LF7 Q;  4KHP L;  1JE5 A;  3UDF A;  2CKZ B;  1XNQ Q;  4AH6 A;  2GVB A;  1WCM G;  4DR2 Q;  4X6A H;  1QVG A;  3AFQ A;  4X62 Q;  3CC2 A;  4LVK A;  3QO7 A;  4IPH A;  5IWA Q;  1YJ9 A;  4BA1 I;  3GDE A;  4XTU A;  2R6G A;  2ES2 A;  2VQF Q;  1VS0 A;  4RDX A;  4IJH A;  1X54 A;  1EYG A;  1YI2 A;  2ZZG A;  1EUJ A;  1X6O A;  3L0O A;  1J5W A;  4UP7 A;  3F2D A;  4B3M Q;  1YFS A;  4XU3 A;  3HOU G;  2C8M A;  4JI6 L;  4X62 L;  4OXP A;  1OXV A;  1A8V A;  2DZ9 A;  1X9N A;  5C0X I;  4YY3 L;  2PMF A;  2IX1 A;  2D62 A;  3GTJ H;  1EVK A;  4K0K L;  5JJK A;  4JI7 Q;  1CSP A;  3V7R A;  1OXU A;  3HOW H;  4WJ4 A;  2PI2 A;  4B3T L;  1AH9 A;  1G5H A;  4CS4 A;  5C53 B;  1WPY A;  3W3S A;  2ASB A;  1EWI A;  4P71 A;  3VQX A;  2EAY A;  3FKI H;  4DK3 C;  1S72 A;  1KRS A;  4OX9 Q;  1VQA A;  1B70 B;  3PUY A;  3V8L A;  4KHZ A;  3W1B A;  4OO1 I;  3M4Q A;  3OTO Q;  2IHE A;  1EFW A;  3RR5 A;  3TRZ A;  4UP9 A;  1P8L A;  1VQC A;  2PQA A;  1HZC A;  3BFM A;  1L0W A;  5M3F G;  3A5U A;  3JAM c;  4YRP A;  3KJP A;  3HXX A;  1JJ2 A;  4DV7 L;  1C0A A;  1UWV A;  4DKA C;  2E5A A;  3BJU A;  2I4M A;  1KQS A;  3ULP A;  1IBL L;  3D0F A;  2DTH A;  3S2H H;  4XTX A;  2NZO A;  3RL6 A;  2DTO A;  3P8T A;  2R7Z G;  3TEG A;  1FL0 A;  4CH4 A;  3I4N H;  3IAL A;  4HIK A;  3KDF A;  5HGQ A;  4TVW A;  3M9B A;  5FJ8 G;  3P8V A;  4DV5 Q;  4JI8 Q;  4GNX C;  4YRC A;  3DLL A;  3OTO L;  2J3M A;  4GOP A;  1R9T H;  4BWA A;  2NS6 A;  3KOJ A;  4HJA A;  2VNU D;  1VQO A;  3M4P A;  4JI3 L;  1XNR Q;  3GTP H;  3E9H A;  2HIX A;  3A7U A;  4DR3 L;  2Q7H A;  2CJB A;  1VQL A;  2K5N A;  4P74 A;  2ARS A;  2BH2 A;  3GTO H;  2RHS B;  4A3G H;  1G51 A;  3RLO A;  1GD7 A;  2NVX H;  3NEM A;  2E1H A;  1JJC B;  1E1T A;  1L2F A;  4UP8 A;  1TWF H;  2Q2U A;  4DV6 Q;  4OWW B;  1IBM Q;  4A3M H;  4O2D A;  1N36 Q;  3GTQ H;  1NMF A;  4APV A;  4H2Y A;  5C51 B;  2MO1 A;  4GNX A;  1VQ7 A;  1N8R C;  3H3V I;  1A63 A;  3UDX A;  4JI0 L;  2ZNI A;  2R93 G;  4R4I A;  1MKH A;  2UXD L;  5IYB H;  3D31 A;  4IPC A;  1N33 Q;  3S16 H;  2I5H A;  4HIM A;  3K0X A;  3L2Z A;  3EBE A;  4QQB X;  4LFB Q;  1LYL A;  1Y1W G;  3E9I A;  3NEN A;  3GD7 A;  3K80 C;  2VQE L;  1BVS A;  2VY3 A;  1IBK L;  2E5L Q;  3RKY A;  1MJE A;  4H02 A;  1HNX L;  2ZIN A;  4BW9 A;  2ZT7 A;  4JOI C;  2NN6 G;  4JYA Q;  3PUX A;  1XPO A;  4FDB A;  1IL2 A;  3A7R A;  4IFD G;  3I2Z A;  1VQB A;  2DKG A;  3VBB A;  4YHH Q;  3CCV A;  4K87 A;  4BBS H;  4YRO A;  4R4T A;  3PIO A;  4UY8 C;  1FGU A;  2JQO A;  4A3J G;  4JBM A;  4MZ9 A;  3PIP A;  2ZTE A;  3T1Y Q;  2DXU A;  5HY6 A;  3HXV A;  4BY1 G;  3MXN B;  2N78 A;  4YRR A;  3HXY A;  2E2J H;  5C3E H;  1PH9 A;  1H4S A;  4R1J A;  4IFD I;  1QZG A;  4XEO A;  5LMN L;  2EXD A;  4EO4 A;  4DV3 L;  1EIY B;  4A75 A;  1WCM H;  1VCI A;  2PNH A;  2QA4 A;  3BZC A;  4YRN A;  3KF6 B;  2JJQ A;  1TWH H;  4YRS A;  1K0R A;  4QL5 A;  3RNU A;  1I50 H;  3HXU A;  2YTY A;  2ZR3 A;  2DTI A;  1YHA A;  1N9W A;  2AKW A;  4DR6 Q;  4DV0 L;  1HC7 A;  4DUZ Q;  4DR5 L;  3Q8D A;  5M3F H;  3RZO H;  3ERS X;  1IZ6 A;  1Q82 C;  2ARU A;  1VQ5 A;  2QHT A;  4A3D H;  3HY0 A;  4IO9 A;  5GAG C;  2JA6 H;  4OX9 L;  3RF1 A;  3CPF A;  3HFZ B;  4LUZ A;  4LF4 L;  1W2B A;  2JEA I;  2YYZ A;  2Q2I A;  4PZ6 A;  3S17 H;  1SES A;  2AMC B;  4DV3 Q;  4CH3 A;  4L5R C;  2HHH L;  2MFI A;  1EQQ A;  1XMQ L;  3KFU A;  1C9O A;  3S1Q H;  2N49 A;  1PYB A;  5J3B A;  2PMZ E;  4JI1 L;  1VQ6 A;  1X65 A;  4NCX A;  1HNW L;  2EJF A;  4JBJ A;  1VQM A;  3HOY H;  4GLX A;  1YJN A;  4HWO A;  4POF A;  1NJ2 A;  3CW2 C;  4DV1 L;  1E24 A;  2OTJ A;  1CKN A;  1VQF A;  3AQQ A;  2Y0S G;  4RQF A;  1QUQ A;  2ZXF A;  3PCO A;  3M85 A;  2ZM6 Q;  4HWR A;  2HNI A;  4DAM A;  3KF8 B;  4AQY Q;  1HR0 W;  4DR2 L;  1NJ8 A;  3HOV H;  3A31 A;  1Z9F A;  1WQW A;  1IYJ B;  3HTZ A;  3S15 H;  3ULJ A;  3NBH B;  4B3T Q;  5IYD H;  3HKS A;  4H2V A;  1W66 A;  4XTZ A;  2HHH Q;  4B3S Q;  1H4Q A;  1CKM A;  4BA2 I;  4IJL A;  3REX A;  2WP8 J;  3UFG A;  1I6H H;  4R4C A;  4L5T A;  2DU7 A;  1USY A;  1XTD A;  4JV5 Q;  5FLM G;  5GAE C;  1Z7M A;  4LNS A;  3VQW A;  4X5O A;  1X3E A;  1H4V B;  4A3F G;  1GO3 E;  2ODR D;  1M1K C;  2P0L A;  4ZTZ B;  2CQO A;  4YWL A;  1ADY A;  1PH2 A;  3I55 A;  4JI8 L;  3I4O A;  3H15 A;  4HJ5 A;  1SLJ A;  1HNX Q;  4GOP C;  1K83 H;  1TXY A;  4JG2 A;  5FJ8 H;  1QVF A;  3RGL A;  3FP9 A;  2KEN A;  1KAW A;  2ZTG A;  2IHF A;  4DV2 L;  1XPU A;  1U5K A;  3A5Z A;  3RN2 A;  2I4O A;  4JI4 Q;  4KLK A;  1NJ5 A;  1KOG A;  3CCM A;  2JA9 A;  2YU9 H;  1SET A;  5C4X G;  4LFA Q;  1YBY A;  4ALP A;  4A3E G;  1Q8K A;  3UE1 A;  5C0X J;  2JEB I;  4OWX B;  1XPR A;  4X66 L;  4LF6 L;  4H2W A;  1XNR L;  3KYH C;  4LF8 Q;  1YFR A;  4A3G G;  4MTN A;  1KRT A;  1N33 L;  1WYD A;  3DM3 A;  1Y1W H;  2UXC L;  4HJ8 A;  2NN6 I;  1VQ4 A;  1ASY A;  1N32 L;  1S40 A;  3J81 i;  1X3F A;  1T9H A;  1DGS A;  1NJ1 A;  2E5L L;  2ZIM A;  4QY7 A;  4GN5 A;  5C44 G;  3HOZ H;  4B3R Q;  3K8A A;  3J81 j;  1PH8 A;  4A3M G;  4X65 L;  3HOX H;  1XMQ Q;  2ZR2 A;  3VQY A;  1PH7 A;  4LVM A;  1HZA A;  4DV4 L;  1VQN A;  3K7A H;  2CJ9 A;  2K50 A;  2P5I A;  5GQO A;  3IKL A;  4J15 A;  4HWT A;  4LNQ A;  1G6P A;  4OON A;  2ZNJ A;  2ALY A;  4XEM A;  3GTL H;  3F2C A;  3U58 A;  1VQI A;  2I4N A;  2B63 G;  5IP9 G;  2HT1 A;  4P73 C;  3JAM i;  1YEZ A;  3I7F A;  2JA7 H;  1SR3 A;  1I3Q H;  1EOV A;  3CCR A;  2VS1 A;  3CQZ H;  1B76 A;  3RUX A;  3RLF A;  1AE3 A;  5JEA J;  4DV4 Q;  3AYH B;  3SGI A;  2IT1 A;  3QNE A;  1VQH A;  5GAH C;  1HXD A;  4IOA A;  1BKB A;  4DUY Q;  2I5M X;  1YVC A;  3TEH A;  2PME A;  4LF8 L;  1WI5 A;  1Y14 B;  2WAQ G;  2VUM H;  4NXM Q;  4LVL A;  3LGJ A;  3NET A;  2E10 A;  3EIV A;  1HNZ L;  1X3G A;  1NNH A;  1SRU A;  5K36 G;  3AEV A;  4HIO A;  3PCO B;  5K1P A;  4A3L G;  4L87 A;  1QUQ B;  1Q46 A;  4JBK A;  1PYS B;  4HWP A;  4YPF A;  3CXC A;  2ZT5 A;  4NB3 A;  4LFC L;  3UDG A;  2R7Z H;  3MEY A;  1NYQ A;  4A76 A;  1AE2 A;  5IWA L;  1VQZ A;  3HRI A;  1WNL A;  1NTG A;  2A8E A;  3I4M G;  4JI2 L;  2IY5 B;  2EJ9 A;  3TRE A;  3G1Z A;  5IP7 G;  1G5I A;  3PO2 H;  1NY4 A;  4E51 A;  1RIP A;  1OXX K;  3LSQ A;  2IY5 A;  5M3M G;  4A3I H;  3PV0 A;  1HJP A;  1NBW A;  3HKZ E;  3EFS A;  2H5X A;  4DR7 Q;  4H2U A;  3CCJ A;  3J7Z C;  3G4S A;  4A93 H;  3HOU H;  2ZJP A;  3HFZ A;  5GAD C;  3J80 i;  2JA5 G;  1WOC A;  4DR4 L;  3AFP A;  1Q1E A;  3CPW A;  2EJG A;  2ZJQ A;  1PHJ A;  4YP0 A;  2ZIO A;  2BA1 A;  3PO3 G;  2ZTC A;  4JI2 Q;  2ZJR A;  4HA8 A;  2D0P A;  3TS2 A;  4LUO A;  2DXT A;  4JI5 L;  4XU1 A;  3TEH B;  4HJ9 A;  1YJW A;  2UXC Q;  3CCL A;  2KHJ A;  4KHP Q;  3UDI A;  1I94 Q;  1KXL A;  1D8L A;  2OCE A;  2Y0S E;  4A3B H;  1PH6 A;  4K0K Q;  1BIA A;  2G4C A;  4A3B G;  1L1O A;  4C3J H;  2C7I A;  4YRE A;  1IBM L;  1Q81 C;  2KHI A;  1VQD A;  4B3M L;  2Q5I A;  4A3E H;  2N8N A;  2AHO B;  3B6Y A;  2AWO A;  2I4L A;  2NVQ H;  3HFV A;  2JA8 H;  4JI5 Q;  1HR0 L;  2Q5H A;  2ALY B;  4PZ7 A;  2CCZ A;  2ODR C;  3RN5 A;  3TQY A;  4P74 C;  1NYR A;  2Q7E A;  2V1C C;  2R7F A;  4LVJ A;  3HRK A;  1K8A C;  3LSS A;  2ZZE A;  3REU A;  1JB7 A;  1USY C;  2K5H A;  1X01 A;  4CS2 A;  1EVL A;  1UE5 A;  4P72 A;  1Z47 A;  1GM5 A;  2A8V A;  3OD1 A;  2J3L A;  3S1R H;  1HNW Q;  1VQ8 A;  1PH1 A;  3L1A A;  1HZB A;  2MNA A;  2NVY H;  3RLN A;  1X2G A;  5K1X A;  2ATW A;  1CSQ A;  4YYE A;  5ELN A;  3A7A A;  4YY3 Q;  2ZT6 A;  3W1G A;  4PZ8 A;  1MJC A;  2JA7 G;  4YRF A;  2E3C A;  5E7N A;  4OWT B;  1OXT A;  2EQS A;  1O7I A;  2ZM6 L;  4BXX G;  2UUB Q;  3L2P A;  3HOX G;  5LMU Q;  1JMC A;  3KLW A;  4A3C H;  4RQE A;  12AS A;  5C4J H;  4NXN L;  4IPD A;  2UUC L;  1Q1B A;  5M5Y H;  4HVC A;  2ZT8 A;  1QZH A;  1WLE A;  3RKX A;  2A1A A;  3H0G H;  4P75 A;  2E41 A;  2K5V A;  4OP0 A;  2BH8 A;  2DGY A;  4IPG A;  2QGQ A;  4HID A;  5BR8 Q;  2WB1 E;  1GVP A;  3I56 A;  3V8J A;  4DR4 Q;  1Y1V G;  5IY0 A;  1IBL Q;  2JA6 G;  3V7S A;  2KBN A;  1VQE A;  1XMO Q;  4ME3 A;  4X65 Q;  2I0Q A;  2DQ0 A;  4YWM A;  2DU5 A;  1NJI C;  1N34 Q;  2WB1 G;  2CWP A;  2PQA B;  3QO5 A;  1K3R A;  2QHV A;  2Z6K A;  3F8T A;  1N36 L;  1K9M C;  1B70 A;  4DNI A;  3PO2 G;  1CUK A;  3CME A;  4YRQ A;  3HXZ A;  4ZIB A;  2E2H H;  1K8G A;  4KR3 A;  1PV4 A;  1J5E Q;  3CCE A;  3RKW A;  2YTX A;  1Z7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...