4YCUA

Crystal structure of cladosporin in complex with human lysyl-trna synthetase
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
505
structure length
505
Chain Sequence
DPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPHLHFGLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine--tRNA ligase
publication title Structural Basis for Specific Inhibition of tRNA Synthetase by an ATP Competitive Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/ ligase inhibitor
total genus 162
structure length 505
sequence length 505
chains with identical sequence B
ec nomenclature ec 6.1.1.6: Lysine--tRNA ligase.
pdb deposition date 2015-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00152 tRNA-synt_2 tRNA synthetases class II (D, K and N)
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ycuA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4ycuA02
1HNXL 5M3MG 3UGTA 3BFMA 4B3RL 1PHJA 4DK3C 1LM0A 4OO1I 5C51B 3NETA 2F4VL 1EVLA 1YFTA 2ZM6Q 5M5WH 4R4IA 2YTXA 2E65A 4DUYL 3AYHB 3PCOB 1VCIA 2ALYB 1IBMQ 3EBEA 3QTCA 4BY7G 4OLFA 2E2IH 1KQSA 4ZTUB 1X65A 3AFPA 3HKZE 4OWXB 4YRJA 3VQYA 2Z0SA 1KXLA 1XPRA 3PCOA 2PQAB 2ALYA 3K7UC 4OWTB 1VQOA 3HFZB 2OTJA 3G1ZA 2N3SA 2MO1A 3HKSA 4IPCA 2UXBQ 2EIFA 1XNRQ 2NVXH 1OXTA 2UUBL 12ASA 3MEYA 2PQAA 2DDZA 2E3CA 5H1SE 2VW9A 1CSQA 3U4ZA 3L4GB 3GTPH 4CH4A 4LFCQ 1HNWQ 4JBJA 2PI2E 3QO7A 1IL2A 5IYDH 1IBKQ 4LF4Q 3QNEA 1X55A 3MEFA 3S24A 4IO9A 5GAHC 4DR5Q 3KDFB 3W1BA 1TWHH 4R1JA 2OWOA 4XTVA 3CMAA 1NJ8A 4DR6Q 1SRYA 1WU7A 4WI1A 3KDFA 4H02A 2Y0SE 1X3EA 4P73C 3T1YL 4LF8L 1KOGA 1NY4A 2RHSB 2OCEA 2Q7GA 1YVCA 3L1AA 4TVAA 1XJVA 4EQ5A 2R92G 3PUZA 4IFDG 2VL6A 4HJ5A 3VBBA 2H5XA 1ATIA 1CKNB 2RHSA 3TEGA 4A3EG 4Q6GA 3HFVA 3CD6A 1IBLL 3T1HL 3H0GG 1UE1A 3GTMH 1CKNA 1G51A 3M4QA 4DAYB 3PZCA 3J80i 3OW2A 3EN2A 4GKKQ 4AYBG 4HJAA 1XMQL 5IP7H 3TUPA 1RIPA 4YDQA 4DV2L 3K0XA 2R93G 3MF1A 2PNHA 4P72C 3CCVA 3J7A5 2VUMG 3OTOL 1NJ2A 1PV4A 1Q86C 1SMXA 4A3DG 3P8TA 3KOJA 4IPHA 4A3FH 4JYAL 2ODRD 1FJGL 4H2XB 3S15H 5IP9H 1H4SA 3EIVA 1USYC 1K0RA 2ZT5A 2IT1A 2CKZB 2JA6G 4POFA 4H2XA 1YGBA 2E41A 1C0AA 4UP9A 4WJ3M 4DUZL 2MNAA 4GOPB 1Y1VH 5C44G 1CUKA 2Y0SG 4L5TA 4HWOA 1GM5A 1VQKA 2HHHL 1W2BA 1VQFA 4GN3B 1WFQA 1K3RA 4GOPA 1Y1WG 3EFSA 1SROA 2BA0A 4A3GH 1WYDA 3G71A 2GVBA 1PH1A 2YYZA 1VQPA 3W1GA 4DV6Q 3FKIH 4X64L 3ICAA 4GNXA 3AFQA 3CCMA 1Q81C 1EFWA 4XU2A 4GS3A 4A3MH 2JEAI 1I5FA 2ZM6L 1J5EQ 2Q7HA 1TWGH 5IYBH 1IBML 3GTQH 3DLLA 1KC8C 2NN6G 3AEVA 4A3KH 5M3FG 4Q15A 3K7AH 4TQUS 4LFBL 3RLFA 2Q2TA 4BXXG 3BU2A 4X6AH 3RZOH 3BZCA 2V1CC 2ARUA 3CPWA 4DV3Q 2UXBL 3W3SA 1XNRL 2BH8A 2Q7EA 1B7YB 3D31A 2ZNJA 2E5LQ 5M3MH 1MJEA 4LFCL 3U50C 3CCEA 1W66A 4XU1A 1WQ7A 1IBKL 4LF4L 3V7RA 4DR5L 4CH6A 4DR6L 5DLQE 1M90C 4BY7H 1G6PA 5KNNA 3TEHB 1Q82C 3P8VA 2VQEQ 2J3MA 1TWAH 2K14A 1N32L 2GVAA 4H2UA 5IYCG 1YZ6A 4LUOA 3S1QH 2K52A 3V8KA 4KLKA 2A8VA 5GROA 1UE6A 4OX9Q 1FYFA 1WPYA 4DKAC 1QVFA 4B3MQ 1NYRA 2QHUA 4JBWA 3RUXA 3S1RH 2ZIMA 3FHWA 4YRPA 2CQOA 3RF1A 4CS4A 3HOWG 3RZDH 3A31A 1RIQA 2B63G 1LUZA 1NJ5A 4C3HH 4KR3A 4BBSG 1CKMA 1N36L 1B76A 4GKKL 4EX5A 2CJBA 4DV0Q 1YFSA 3HRKA 4YRSA 2DJZA 3SGIA 1GGMA 4OONA 4H2WA 3PO2G 1OXUA 2N49A 2ASBA 3F1ZA 4ME3A 1EIYB 3PF4A 3A5YA 3A0JA 3K81C 1PYSB 1S40A 2R92H 1AH9A 1A8VA 1KRTA 3I2ZA 4PMWA 1NMFA 1EIYA 4A3EH 3STBC 4HWRA 2ODRC 1PYSA 3GTKH 3S1MH 4A3IH 3H0GH 5C0XG 2ZT6A 2DU7A 3M7NA 4GOPC 1NJIC 1SETA 1IYJB 3F2DA 4PZ6A 4DAMA 5FJ8G 2E64A 1K9MC 4YYEA 4DNIA 2EJGA 2K5HA 1VQ7A 2IHFA 1KAWA 2R93H 4GNXC 1HC7A 3PV0A 4DV6L 2DTIA 2DGYA 3I7FA 1KHIA 3UE0A 1QVGA 3L2PA 1JJGA 3UDXA 3JAMc 2RHQB 3FP9A 1Q1EA 4YY3L 3MF2A 1I94Q 3CCJA 4B3SQ 2JA6H 3F8TA 1J5EL 1TXYA 2YV5A 1FGUA 4L87A 1HR0Q 4RG1A 2RHQA 11ASA 4PZ7A 3HY0A 4DK6C 1QZHA 3A7RA 4K86A 5C44H 2FYKA 4HWSA 1AE3A 3CC7A 1XPOA 2UXCQ 2PMFA 3UFGA 2DUDA 2L15A 1YB3A 1PYBA 4XTZA 2ES2A 1Y1WH 3IRBA 4DV3L 4LFAQ 2E2HH 5ELNA 4JCVE 4DPGA 2E5LL 2LXKA 1P16A 3E9IA 2VY3A 4R4OA 2CIMA 4KR2A 1NE3A 4KQEA 3CXCA 2AKWB 4RQFA 1S72A 1EUJA 4CS3A 2D0OA 3M9BA 1N8RC 2ZIOA 3RN2A 5F5WA 4A3CG 4TQFA 5AJ3Q 4NXMQ 4YWLA 3ULLA 2BA1A 4HIKA 3W5OA 2VQEL 1J5WA 1N34L 5M3FH 2N78A 2JEBI 4AYBE 4BXXH 1SN8A 3LGJA 4B3TQ 4XTWA 1E22A 3HXUA 2NN6I 4DR2Q 3HFZA 1WI5A 5FLXc 4YCWA 1O7IA 1A62A 1Y14B 1PH6A 1YNXA 4WJ4A 1B8AA 2ARSA 1SE8A 3RL6A 3MXNB 1HXDA 2QHTA 4YRFA 1HTTA 3M85A 4B3ML 3L4GA 1KIXA 4HA8A 4YRCA 4P71A 4FDBA 2E10A 3A7AA 2JA8G 4YCVA 4TQDA 1Z47A 4UP7A 3KF6B 4HWPA 3RIRA 2ZGWA 1TWCH 4X66Q 2WAQG 4LW1A 4JI7L 1QZGA 4YRRA 1X3FA 1PVOA 2HIXA 5LMNQ 4YROA 4GLXA 5K36G 1D7QA 3R07A 3LC0A 3KF6A 1QF6A 2JE6I 2RCNA 2VNUD 4IPGA 4APVA 2OQKA 4LNSA 4DV0L 5IYCH 4YP0A 1NTGA 3LSQA 2AHOB 1WCMG 1N33Q 4AQYQ 3FJPA 4DV7Q 2EJ9A 3KJPA 5LMUL 3CF5A 1YJ9A 4L5RC 4C3IH 1L1OB 5HY6A 4JI0L 1YEZA 4R4TA 4JI6Q 1Q7YC 4A3IG 3HXYA 3G4SA 4XU3A 3VQVA 1OXXK 1PH7A 4CH5A 3H3VH 2OQ0A 2WFWA 1SR3A 4XTYA 1HNZQ 2C35B 3HOWH 4YCUA 2IX1A 2K5VA 4X65Q 2B63H 3S2HH 3S17H 4NB3A 2ZTCA 4BBSH 5GAGC 1UE5A 2DTHA 4JI8Q 4C2MH 1YFRA 1UEBA 4GKJQ 4JV5Q 4QJFA 2I4OA 3HXWA 3PO2H 5C4XG 2KENA 1BVSA 3Q8DA 4BY1H 2Q2IA 3UH0A 3KYHC 5IWAQ 4JC0A 3KLWA 4A3JG 4XEOA 3CMQA 1A0IA 1YBYA 1I94L 4BBRH 4B3SL 3CP0A 3HOUG 1CSPA 2G4CA 4JI5Q 4IOAA 2WP8J 2PMZE 2DXTA 4RMFA 1WNLA 4A3BG 1VQMA 1HR0W 3GD7A 2ZJPA 3VQWA 3PUXA 2UXCL 3OYYA 5FJ8H 1NJ1A 3IG2A 4P3OA 2CFMA 4LF6Q 1BIBA 4OO1G 2UUAQ 2E2JH 2UXDQ 4DR3Q 2P5IA 3ERRA 2DKGA 4CH3A 2YTVA 1I50H 4TVYA 4YRMA 4MTNA 1XPUA 2Q5IA 4EO4A 4AIMA 1G5HA 4JOIA 2AWNA 3PIOA 3U58A 3RR5A 3CW2C 4IOCA 2A1AA 2GN5A 4LUZA 1MKHA 4DR1Q 4DV1Q 1K8AC 1H95A 4JI2Q 3CCSA 1EOVA 4NXML 1VQBA 1OTCA 2ZZFA 1PH9A 1E24A 4POGA 2J3LA 3RKXA 4X62Q 4YRLA 4B3TL 5FLMH 4BA2I 1VS0A 4A75A 4DR2L 4C3JH 1PH5A 3PIPA 2A19A 5C4JH 1YI2A 2ZTGA 4G84A 4A3LG 4P71C 1HNWL 1BKBA 1SESA 1TWFH 2K5NA 1YJNA 1B7YA 2ZTEA 3JC66 1X2GA 1WOCA 2EL9A 2WB1G 4P3NA 1IXRA 4X66L 2JA5G 3TS2A 2QHVA 3K8AA 2E5AA 2B29A 1NBWA 1DGSA 3HOVG 5LMNL 1UE7A 4A3CH 3RGLA 4R4QA 5LMNW 3TEHA 3QO5A 2N8NA 2NZHA 1V1QA 1XTDA 3J81j 2DEQA 2Z6KA 4PHCA 1VQIA 4A93G 1OXSC 1HZCA 1N33L 4AQYL 3KJOA 1E1OA 1W3SA 4DR7Q 3HXXA 3KFUA 5IE8A 2XGTA 2Q2HA 2JA7G 3REUA 4A4IA 2I4NA 3NENA 4XTUA 3V8LA 3CC2A 2CJAA 1OXVA 4NCXA 2MFIA 2JA8H 1YHQA 4HWTA 1YHAA 2ARTA 4X65L 3NELA 3NBHB 4GLVB 2ZT8A 4TTVA 4JI8L 4GKJL 4JV5L 4BY1G 1EVKA 3ER0A 2Q2UA 4LF8Q 1WCMH 3ULJA 2EAYA 2NVYH 1PH4A 3PF5A 1JB7A 1E1TA 3UDFA 4XU0A 4KI0A 5IWAL 4BBRG 3E0EA 4OXPA 2LXJA 4IFDI 2IX0A 4HIMA 4XEMA 3RKYA 2MQHA 3DM3A 1PH8A 3HXVA 4WF2A 1HZAA 1VQ9A 4JI5L 5JEAJ 2I5HA 2I0QA 1U0LA 4LF9Q 4RDXA 4GLAC 1GKHA 4JI4Q 3HY1A 4O2DA 1R9TH 1Z9FA 2JQOA 3JAMi 2QEXA 5C3EG 4DV2Q 3WWVA 4LF6L 5C4XH 3GDEA 2UUAL 3OTOQ 2UXDL 4DV5Q 3J81c 4DR3L 4JOIC 5M5XH 1BIAA 2ZCEA 4YRKA 4JYAQ 2NZOA 1FJGQ 4A3JH 1SERA 1C7YA 3RLNA 1G5IA 3S14H 2NVTH 1S3OA 5BR8Q 3ULPA 2CCZA 2WAQE 3HOUH 1H4QA 2KHIA 4UY8C 4DR1L 3RN5A 4DV1L 1XNQQ 4OWWB 2ZR2A 4A3BH 4JG2A 5FLMG 5IT9c 4UP8A 4TWAA 1VQNA 2DTOA 2HHHQ 1HZBA 1X2HA 3A7UA 2ZXFA 3RACA 1GO3E 1YHBA 3UGQA 1KRSA 4P75C 4P3PA 4K0KQ 3A74A 1NJ6A 4NXNQ 2NVQH 3EFRA 3CCRA 3F2BA 2P0LA 2I5MX 3IKMB 1LTLA 4XTCS 4X64Q 1ASZA 3REXA 4JI3Q 4QIWE 5J3BA 3OD1A 2KCMA 1HH2P 3UDIA 1PA6A 1FL0A 4PG3A 3GTOH 1Z7NA 1FVIA 2AKWA 5GADC 2K50A 3PO3G 2Z6KC 3DSQA 1SLJA 2DQ3A 4IJLA 4LFBQ 1WQWA 3CPFA 3P8YA 3TRZA 3HOYG 2QA4A 5JJLA 1VQCA 4OX9L 4JI1Q 4DR7L 5GAEC 2ZZEA 4DV4Q 2R7ZG 2AMCB 4A3LH 3AQQA 2CJ9A 3RLOA 2DZCA 3L0OA 1K73C 4E51A 3PUWA 3H15A 4YHHQ 4JBKA 2D62A 1T9HA 4PZ8A 2AMCA 2ID0A 4BA1I 5K1XA 2JA5H 1X6OA 3HOZG 5K1PA 1VQZA 3LSSA 2PI2A 1MJCA 4LWCA 5C52B 1YIJA 3HOVH 2YU9H 4RQEA 1L0WA 1ADJA 2ZNIA 3PUVA 4BW9A 1N32Q 1E3PA 3A5UA 4TVAB 4GN4B 5E3IA 3IALA 1U5KA 1BBUA 2EQSA 3IKLA 1X56A 1M1KC 1Q12A 3UE1A 4A93H 1EQQA 4QGUA 1JJ2A 1PFSA 1VQLA 3I4MG 1B70B 2K75A 2MO0A 2EXDA 3RKWA 2JA7H 2CWAA 2DVEA 4KHPQ 1EIFA 1L1OA 1NMGA 5C53B 1PH3A 1B70A 4K87A 1HJPA 1C9OA 4XIGS 3HOXG 1Q46A 4IPDA 2Q5HA 3H3VI 3HKZG 5HGQA 1D8LA 2I4LA 4LF9L 2DU5A 3M4OH 3VDYA 1XMOQ 5JJIA 3V7SA 1VQ6A 4JI4L 1N36Q 1VQGA 1K8GA 4YRIA 2R7FA 4HJ8A 3F2CA 2F52A 2I5LX 5M5YH 1WJJA 3I4NG 2ZZGA 4IFDJ 2ZR3A 3J80c 4DV5L 3M4PA 1VQEA 1I6HH 2HQLA 4YRNA 4HJ9A 4H2YA 3STBD 4G85A 1L2FA 1H4VB 3M3YH 1AE2A 2VQFQ 2HT1A 4QL5A 2DXUA 2UUCQ 4LF5Q 5JJKA 2WB1E 2PMEA 4Y52H 1X54A 1HR0L 5BR8L 1X01A 4P74A 4YRGA 3J7ZC 5ELOA 2KCTA 2KHJA 1XNQL 2EJFA 3V7CA 1NYQA 1VQ4A 2I4MA 3CC4A 4YRTA 5C0XI 2ATWA 1VQ8A 4H2TA 4LFAL 5EAYA 4OP0A 4HIDA 1X3GA 5C3EH 4DR4Q 3G6EA 4GNXB 1ASYA 2VS1A 4K0KL 2HNIA 4NXNL 2UU9Q 1JT8A 4UPAA 4JBMA 3VQXA 4L5SA 4LF7Q 3GO5A 1EYGA 4JI3L 1YITA 4GN5A 2CWPA 3GTGH 3PSIA 1KL9A 4YY3Q 2DZ9A 5AJ3L 3I56A 1VQAA 5E7NA 1SFOH 4NPSA 4LUVA 1NNHA 1IZ6A 1N9WA 1QUQB 1RL2A 4J15A 3CMEA 3A32A 3HTZA 3KF8B 3G48A 1Q1BA 2FXQA 1Z7MA 1QUQA 2DQ0A 4DQ2A 4JI1L 1HNXQ 2QHSA 2D0PA 4DV4L 4ZTZB 2C7IA 4B3RQ 4KHZA 4P75A 4L5QA 2EWNA 4QQBX 4QY7A 5IYDG 2F4VQ 3HXZA 2HIVA 3QO8A 4YHHL 1MIUA 2ZJQA 4DUYQ 4YREA 2LSSA 1X9NA 1PH2A 3CCUA 4MZ9A 1E7ZA 2ZT7A 1V9PA 2ZINA 3PO3H 1QVCA 3CCQA 1EQRA 1N34Q 3TREA 3ERSX 4DV7L 3I55A 2XTIA 3HOYH 3PGZA 2UUBQ 2R7DA 5IY0A 3E9HA 3WQZA 4HJ7A 1P8LA 2JA9A 2IHEA 1L1OC 1CKOA 2R7ZH 1A63A 4IJHA 4H2VA 4JI6L 1J6QA 4Y7NH 4ZIBA 4YWMA 3V8JA 4KHPL 1HNZL 2F3IA 1H4TA 3B6YA 3S16H 2KBNA 4R4CA 4HIOA 2B3GA 4JI7Q 3HOZH 1KMMA 5JEAG 4BWAA 3TS0A 5IP7G 1K83H 3A5ZB 1XMOL 4MNOA 2YTYA 3S1NH 1UWVA 2AWOA 3T1YQ 4H2SA 3A5ZA 4K88A 2JK8A 3CCLA 4A3FG 2R6GA 5GQOA 2ZJRA 1JJCB 4P73A 5IP9G 3I4MH 5LMUQ 4P74C 1KMNA 1BBWA 4JI0Q 1JMCA 2VQFL 1IBLQ 2UUCL 4LF5L 1JJCA 3T1HQ 3U4VA 2OTLA 3L7ZC 4HVCA 2C8MA 1HZ9A 4A76A 3HOXH 3HRIA 1LYLA 4CS2A 1Y1VG 1QE0A 1G291 3CQZH 1GD7A 4LNQA 3J81i 1V43A 1XMQQ 1ADYA 3RNUA 1Q8KA 2QGQA 2ZTDA 2RF4A 4A3GG 1VQ5A 1VQHA 3TQYA 2JJQA 1YJWA 4XTXA 4TVWA 3S2DH 3GTJH 1VQJA 4DR4L 3FKIG 3I4NH 3I4OA 1VQDA 1GVPA 2VUMH 3PUYA 1WLEA 2K4KA 2UU9L 4P72A 4A3DH 4A3MG 4LF7L 3CAMA 3UDGA 3NEMA 3ICEA 2E8GA 2IY5B 3D0FA 2CGHA 4O0AA 4YRQA 3BZKA 5IYBG 5C0XJ 4ALPA 1SRUA 4DUZQ 4JI2L 1USYA 1JE5A 4A3KG 2IY5A 2E1HA 2BH2A 2VZAA 1KD1C 3K80C 4X62L 1I3QH 4YPFA 3ZJYC 1EWIA 4X5OA 3BJUA 4AH6A 3L2ZA 3GTLH 4YWKA
chains in the Genus database with same CATH superfamily
1HNXL 5M3MG 3UGTA 1EIGA 3BFMA 2RVLA 5KIXA 4B3RL 1CQVA 2NVYB 1PHJA 4DK3C 1LM0A 4OO1I 5C51B 2IW3A 3NETA 2F4VL 2PCFB 3E6ZX 1EVLA 1YFTA 2ZM6Q 5M5WH 4R4IA 2YTXA 2E65A 1T5XD 4DUYL 1AZQA 3AYHB 3PCOB 4WFN3 1VCIA 2ALYB 2KEDA 3H94A 4RKLA 1IBMQ 4QIWB 4A3IB 3EBEA 4ABNA 4BY7G 3QTCA 4IALA 4OLFA 2L11A 2E2IH 2TSSA 1KQSA 1DOLA 1IW7D 5I6YA 4ZTUB 1X65A 3AFPA 4YIJA 3HKZE 4OWXB 4ZYSA 4YRJA 3VQYA 2Z0SA 1KXLA 3BG3A 1FNWA 1XPRA 3AU7A 4RHRA 3PCOA 2PQAB 2ALYA 3K7UC 4OWTB 2SOBA 1VQOA 3EVQA 5JOBA 2NN6H 2L9HA 3HFZB 4HTHA 4AYBB 5DM63 2OTJA 4CDCC 3G1ZA 2N3SA 3I3CA 2ICEC 2G5DA 1BXTA 2MO1A 3I72A 3HKSA 4IPCA 5I9PA 2KVMA 2UXBQ 1QNKA 2EIFA 1XNRQ 2NVXH 1OXTA 2UUBL 12ASA 3MEYA 1STAA 2PQAA 5D3DA 2DDZA 3VA5A 2E3CA 5H1SE 2VW9A 1CSQA 3U4ZA 2CH4W 3GTPH 3L4GB 2F0PA 5C4ZA 4CH4A 3J7AV 1EY0A 4LFCQ 1HNWQ 2NTTA 5C4XB 1CHQD 4EVOA 4JBJA 1SYFA 2PI2E 3QO7A 4LMQD 2F0DA 3VYUA 1IL2A 3HEJA 5IYDH 1IBKQ 4LF4Q 3BDCA 3QNEA 4X3TA 1EYAA 1X55A 4LVMA 3MEFA 3S24A 4IO9A 2B2YC 5GAHC 4DR5Q 3KDFB 1HXYD 1TWHH 3W1BA 4R1JA 4A3JB 2OWOA 4XTVA 5I9OA 3CMAA 1NJ8A 4DR6Q 1SRYA 3D6WA 5A35A 4C3HG 1WU7A 2DY7A 3S14B 3R2IA 2A68C 4CDFC 4WI1A 3DMUA 3KDFA 1I4HA 2WINB 5C44B 3EROA 4H02A 2Y0SE 1X3EA 1S5CD 4P73C 4KKUA 2K6AA 3NXWA 3T1YL 4A3BB 2KA7A 4LF8L 1KOGA 1NY4A 1EWHA 2RHSB 3LX0A 2ZT9C 2OCEA 1Y1WB 3FDTA 3QOJA 2FINB 1YVCA 2Q7GA 3L1AA 2O5IC 4TVAA 2XRSD 3R8BA 1XJVA 1B9NA 2X6GA 4NW2A 1E0BA 4EQ5A 2R92G 3PUZA 2E2HB 4IFDG 3J7AF 2VL6A 3BVMA 1U4LA 4HJ5A 2ICIA 3SXHA 3VBBA 2NUCA 2H5XA 1ATIA 1CKNB 4CJ1B 2RHSA 3TEGA 3J81L 3PQIA 1JC7A 4A3EG 3G6JB 2NVQB 4Q6GA 2A8EA 3HFVA 3CD6A 2MJ8A 1XX8A 1ZXTA 5IT9E 1IBLL 2K03A 4RH6A 1UUPA 3T1HL 3H0GG 2F0FA 1YNJD 1UE1A 3BVGA 5E1FA 1Q90A 1L0YB 3GTMH 3A7LA 4HN7A 1CKNA 1G51A 3PIO3 2QDBA 3M4QA 2LFNA 4DAYB 1FR3A 3PZCA 3J80i 3GTOB 2K1BA 5CGKA 4ZCKA 4EQNA 3OW2A 5JEAH 5CYUA 3EN2A 4GKKQ 4AYBG 4HJAA 1XMQL 5IP7H 3TUPA 1WTHA 3C2PA 3L9AX 1RIPA 5JVH3 4RGMA 3QWNA 3VYTA 5FO8B 5IGGA 4YDQA 4DV2L 4TSSA 2B2UA 3K0XA 2R93G 4DAYA 2RBMA 5IT9L 3MF1A 2I46A 2PNHA 4P72C 1PMRA 3CCVA 3J7A5 2VUMG 3OTOL 1NJ2A 3K5OA 1PV4A 1Q86C 1SMXA 4A3DG 3P8TA 4L6TB 3C46A 3KOJA 4IPHA 4A3FH 1GUSA 3KBGA 4JYAL 2ODRD 1FJGL 4H2XB 3S15H 3KLRA 4MTKA 1B1ZA 5IP9H 2WIIB 2CW0D 2Z9HA 3X3NA 1H4SA 4UAIA 3EIVA 4C56C 4XQQA 1USYC 1K0RA 2ZT5A 2MHVA 2IT1A 1KAAA 2CKZB 3MC0B 2JA6G 1M8AA 4X3KA 3DUZA 4POFA 3CRKC 4H2XA 1V1OA 3HS0C 1K8OA 1YGBA 2E41A 1C0AA 2AUKA 4UP9A 4WJ3M 3K5MA 2Z4HA 4DUZL 2MNAA 3MFYA 4F88A 4GOPB 4F7XA 1U4PA 2WB1B 1Y1VH 5C44G 1CUKA 2Y0SG 4L5TA 4HWOA 3TMEA 1GM5A 3OIPA 1VQKA 2HHHL 1W2BA 4GZYC 1VQFA 4GN3B 1FGBD 1MD2D 1B3AA 1WFQA 1K3RA 4GOPA 1Y1WG 3EFSA 1SROA 5EJWA 1OO9B 2BA0A 4A3GH 4B9XA 4RCOA 1EU4A 1WYDA 3G71A 1LT4D 2GVBA 1PH1A 2YYZA 1VQPA 3W1GA 2F3VA 2JP1A 2PW5A 4LK1C 4DV6Q 4FO2A 3FKIH 4NP5A 1RTNA 3EQLC 4X64L 4A93B 1WTXA 3ICAA 3VYRA 1S5FD 4GNXA 3KK7A 2F0TA 3K57A 5FO7B 4BS9A 5CORA 1BF4A 3AFQA 3DWAA 3CCMA 1Q81C 1EFWA 4XU2A 4I65A 3TSSA 4GS3A 1TVXA 3VYSA 4A3MH 2JEAI 1I5FA 4DA2A 2ZM6L 3V2TA 2JA7B 4ZLTF 1J5EQ 1KTKA 1EY5A 4QUFA 2Q7HA 1TWGH 2FJ2A 3QIAA 1JQYD 2PZTA 5IYBH 1IBML 2F0QA 1BCPD 3GTQH 3DLLA 3K58A 1KC8C 2NN6G 3AEVA 4A3KH 5M3FG 4Q15A 3K7AH 1WD1A 4WORA 4TQUS 4LFBL 4LVLA 3S2HB 1CT1D 3S17B 3RLFA 2K05A 2Q2TA 5KYIA 1TS2A 4BXXG 4BBSB 3BU2A 4X6AH 3RZOH 1GUWA 3BZCA 4P2CB 3TP8A 3D4RA 1M4VA 2V1CC 2ARUA 3P1HA 3CPWA 1H9JA 4DV3Q 2UXBL 3W3SA 1XNRL 2BH8A 2DNEA 2O5JC 1QB5D 1A2TA 2Q7EA 1B7YB 3D31A 4IZ8A 4BY1B 2ZNJA 2E5LQ 5M3MH 1LTRD 2RQXA 1MJEA 4XT1B 4LFCL 3U50C 3N6RA 1V1PA 3CCEA 1W66A 4LVJA 4XU1A 1WQ7A 1IBKL 4LF4L 3V7RA 1SE4A 2XNAC 3M3YB 5ELDA 4QCLA 1ONLA 4DR5L 4CH6A 4BBRB 1BCPF 3TZDA 4DR6L 5DLQE 4K2KA 1CK1A 1M90C 4BY7H 1G6PA 2H1EA 3TEHB 5KNNA 2KCNA 1Q82C 3P8VA 3TBIB 2VQEQ 2J3MA 1TWAH 1U4RA 1CTMA 4FYDA 2K14A 1N32L 2GVAA 4H2UA 5IYCG 1YZ6A 1HFNA 1JWMD 4LUOA 3S1QH 4E6IA 2K52A 3V8KA 2D5DA 1TY2A 1R4PB 4KLKA 3SK6A 3IAYA 1FD7D 2A8VA 3MQZA 3RUZA 1VMPA 5GROA 1UE6A 3VR2A 4C3IG 4OX9Q 2E2JB 1HUMA 2MGSA 2XVSA 1FYFA 1WPYA 1T5EA 3KUPA 4DKAC 5C3EB 4M1UB 1QVFA 4B3MQ 3X3MA 1NYRA 2EY2A 2QHUA 2F3WA 1EQTA 3OHXC 4DF7A 4JBWA 2E74C 3RUXA 3S1RH 1PRTB 2ZIMA 2G9HD 2K5DA 3FHWA 1PTOD 4YRPA 2WKDA 4B08A 1HQRD 2CQOA 3RF1A 1JWUD 4HR7B 3ND8A 4CS4A 3HOWG 1DXMA 2HDMA 3RZDH 3A31A 1RIQA 5D3IB 1HQMC 2KEEA 2B63G 1LUZA 2D9UA 1NJ5A 4C3HH 1PTOB 4KKSA 1NCVA 5KEEA 2B2UC 4KR3A 2L55A 4BBSG 1CKMA 1N36L 5FOBB 1B76A 4GKKL 1LV9A 1YNJC 4EX5A 5CV5A 1HCZA 4IUTA 1AFPA 4DV0Q 2CJBA 1YFSA 1EYDA 3HRKA 4YRSA 2DJZA 1CI3M 3SGIA 1GGMA 4NDXA 4OONA 3T51B 2M2LA 4H2WA 5JVG3 1LT6D 1Q8IA 3PO2G 1X3PA 1OXUA 2N49A 3NQIA 4L63B 2ASBA 5C3XA 4H44C 1WTQA 3F1ZA 4ME3A 5ELCA 2DJGC 1EIYB 4C3JB 3PF4A 1YNND 1QG7A 5C4JB 3A5YA 4RHSA 3A0JA 3K81C 5ELBA 3SR1A 1PYSB 3Q24A 1S40A 2A69D 2R92H 1AH9A 1A8VA 4DK0A 4IFDH 1KRTA 3VR6A 1TWFB 3I2ZA 4R8NA 3P20A 4PMWA 2Q8RE 1NMFA 1EIYA 1PTOF 4A3EH 5BN3A 5EGTA 3STBC 4IURA 4HWRA 3MVVA 2ODRC 1JORA 1PYSA 4K8JA 3GTKH 5EPKA 3S1MH 1JOOA 4A3IH 3H0GH 2CW0C 4HAEA 5C0XG 2ZT6A 2DU7A 4CKCA 3M7NA 1I4RA 1LTGD 5AFWA 3NWTA 1LTSD 2XWBB 4GOPC 1NJIC 3EA6A 1SETA 1IYJB 1TS4A 3F2DA 5IGCA 3CKIB 1TT2A 4JK1C 3LWEA 4MIUA 5ELFA 2L0CA 4PZ6A 4EGVA 4DAMA 5FJ8G 2E64A 1K9MC 4YYEA 4DNIA 2EJGA 3MTSA 4FXGC 2K5HA 3D6CA 5FKAC 2D2CC 4FF4A 1VQ7A 2IHFA 3FPPA 1KAWA 2R93H 4GNXC 4XDXA 2EXZA 1FYCA 2K7VA 1HC7A 1A3VA 1RF2D 3PV0A 4X3SA 4DV6L 3HOYB 4ZUJA 2DTIA 2DGYA 2KOLA 3I7FA 1D5MC 1S5DD 1KHIA 4CGYB 1O80A 3UE0A 2OXPA 4ODGA 1QVGA 3L2PA 1JJGA 2EDGA 3UDXA 2R7ZB 3JAMc 2RHQB 3K0YA 3FP9A 1Q1EA 4YY3L 3MF2A 5BN5A 1UEAB 3OMCA 1I94Q 3CCJA 4B3SQ 2SEBD 4Y7NB 3DXJC 3F8TA 1J5EL 1TXYA 2JA6H 2YV5A 3H3VC 1PYWD 1FGUA 4L87A 2F1MA 1HR0Q 2WAQB 4RG1A 2RHQA 1ZYRC 11ASA 4PZ7A 3HY0A 1O7YA 4DK6C 2ZXRA 3LNNA 1QZHA 3A7RA 4K86A 5C44H 2FYKA 4HWSA 3HOZB 1AE3A 1EY7A 3CC7A 1XPOA 2UXCQ 2PMFA 1K83B 1PZKD 2DUDA 2L15A 1YB3A 1PYBA 4XTZA 3UFGA 2ES2A 4C3JG 1Y1WH 2F0SA 3T53B 1O78A 2QF7A 3IRBA 4DV3L 5G3LD 4LFAQ 1SJED 1WCMB 1B9MA 1SJHD 2M9VA 1DOKA 2E2HH 4KK7A 5ELNA 4JCVE 4DPGA 2E5LL 2LXKA 5A2QL 1P16A 1BDOA 3E9IA 2VY3A 1NAPA 1K0SA 3Q22A 1VDZA 4R4OA 2CIMA 1D1KA 4KR2A 3I4MB 1NE3A 4KQEA 3G7LA 1LT3D 3CXCA 5KNCA 2O2LD 2AKWB 1IHZA 4RQFA 1S72A 5KNBA 4B9WA 4ZRZA 1EUJA 4CS3A 2D0OA 3M9BA 1N8RC 1ILQA 2ZIOA 2FMMA 3MEHA 1STBA 3RN2A 2KECA 5F5WA 2PO4A 1PZJD 1GHJA 4A3CG 5AJ3Q 4TQFA 3FVQA 4NXMQ 2BCOA 4YWLA 3H09A 3ULLA 2M00A 2BA1A 5COYA 3EJIA 4HIKA 3BDOA 3W5OA 2VQEL 1J5WA 3I70A 1N34L 2QEJC 4R8IA 2N78A 3U9SA 5M3FH 2F03A 2JEBI 3MXUA 3NSWA 4AYBE 3CQZB 5CC4A 4BXXH 3HKZB 2BOSA 3QB3A 4XYQA 1R9TB 1SN8A 3BYTB 2VB2X 2SNMA 3LGJA 4IUVA 4B3TQ 4XTWA 5EPJA 1E22A 2Z8LA 3SHLA 4QB4A 3HXUA 2KHSA 2NN6I 4DR2Q 5G3LF 3HFZA 3OMGA 1WI5A 3PMFA 2R61A 5EQ0A 5FLXc 2EOTA 1CFMA 3A7AB 1O7IA 1A62A 1Y14B 4YCWA 5EKKA 1PH6A 1MSGA 1YNXA 4WJ4A 2AQ2B 1B8AA 3S2DB 4FF3A 2ARSA 4KD3A 1SE8A 5M5XB 2RA4A 3MXNB 3GTJB 1HXDA 1R4QB 2QHTA 3RL6A 4YRFA 1HTTA 3NWSA 3M85A 2L5TA 3I4NB 4B3ML 1EYCA 3NPPA 1KLUD 1D2BA 3EFXD 3L4GA 1KIXA 4RGTA 4HA8A 4YRCA 4P71A 1I4QA 5JAVA 1PRTC 4FDBA 2E10A 2JA8G 3A55A 3A7AA 4YCVA 4TQDA 1Z47A 4UP7A 3KF6B 1DCZA 4HWPA 3RIRA 1STNA 2ZGWA 1TWCH 3C1EA 4X66Q 2WAQG 3MXNA 4LW1A 2NVTB 4JI7L 4PV1C 1QZGA 4YRRA 4CKEA 1X3FA 3HOUB 1PVOA 2HIXA 5LMNQ 4YROA 1LO5D 4GLXA 4HSVA 5K36G 1D7QA 3R07A 3LC0A 4H7BA 3D3RA 1PLFA 2A73B 3KF6A 1QF6A 2JE6I 2RCNA 2VNUD 4ZQ3A 4HCSA 4IPGA 4APVA 2OQKA 4HT4A 1GUOA 4LNSA 3HRZC 4DV0L 2XRQD 2CQAA 3NUCA 5IYCH 1NTGA 4HCEA 4YP0A 3LSQA 4RFBA 2AHOB 1WTRA 1D5ZC 2PNRC 2NTSA 1WTPA 2K28A 1WCMG 1N33Q 4AQYQ 4V0BA 1I3QB 5CR3A 3FJPA 4PQXA 4DV7Q 2EJ9A 3SEBA 3JAME 2WACA 3KJPA 5LMUL 3C3LA 3CF5A 3S9WA 1YJ9A 4L5RC 1JOKA 3QJYA 4C3IH 3MZ5A 1ILPA 3T16A 2QW7A 3CU7A 1L1OB 5HY6A 4JI0L 1YEZA 4N9TA 4R4TA 2IPKD 3I4LA 4JI6Q 1Q7YC 4A3IG 1SNMA 4DAPA 3HXYA 1YNNC 2EPBA 1W6JA 3G4SA 5LHY1 1EQVA 4XU3A 4C1NK 3VQVA 1OXXK 1PH7A 4CH5A 3H3VH 2A69C 3V96A 2EY1A 2OQ0A 2WFWA 1XWEA 1SR3A 4XTYA 1HNZQ 1KLGD 2C35B 3HOWH 2Z1CA 4YCUA 5TSSA 5M5WB 2IX1A 4I7AA 2EJGC 2K5VA 3SK5A 4X65Q 2B63H 3S2HH 2B8GA 3S17H 4NB3A 1BBXC 1RD9D 2ZTCA 2E2IB 4BBSH 5GAGC 3MXPA 3SVMA 1UE5A 2DTHA 5IOCA 4JI8Q 4K6LA 4NMZA 4C2MH 3BVZA 1YFRA 1UEBA 1CA5A 5JPMC 4GKJQ 4JV5Q 1KABA 4QJFA 1VMCA 3E5SA 2I4OA 3HXWA 3OIQA 1EOTA 4X3UA 1EY6A 5JPNC 1D5XC 5C5MA 1BQQT 3PO2H 5K5PA 1WVLA 5C4XG 1MGSA 2KENA 1BVSA 1MSHA 4ULLA 3HGBA 3Q8DA 4BY1H 2Q2IA 3UH0A 5T1GA 3SDZA 3KYHC 4HEDA 1SMYC 2A6ED 5IWAQ 3L3OC 4IUQA 2J0TD 4JC0A 3KLWA 4A3JG 1FNVA 1F9RA 3TZUA 4JVZA 4XEOA 3GTPB 3CMQA 2Z6BA 4KV6A 1A0IA 1YBYA 1C4QA 1I94L 4BBRH 4CJ0B 1S5ED 1C8CA 4B3SL 1NSNS 3CP0A 3HOUG 1CSPA 2G4CA 4JI5Q 4IOAA 2JA5B 2MP1A 2WP8J 1TWHB 2PMZE 1F2LA 5J1ZA 5C0XH 1G6ZA 4RMFA 1WNLA 4A3BG 2DXTA 3MA2B 1TR5A 1VQMA 3HOVB 2YU9B 1F9SA 1HR0W 5FLXE 3MFGA 3Q23A 3GD7A 2ZJPA 4IQZA 1O7LA 3VQWA 2EJMA 3PUXA 2UXCL 3OYYA 3CHBD 3OSOA 4K6DA 5FJ8H 1NJ1A 3IG2A 4P3OA 1DZ1A 1ML0D 2FHTA 3T56B 2CFMA 4LF6Q 1BIBA 4OO1G 2UUAQ 3FPUB 4FNFA 2E2JH 2UXDQ 2OF1A 4DR3Q 2P5IA 2VB3X 2DKGA 3ERRA 1CZWA 4WRDA 4CH3A 4ZUIA 2YTVA 1I50H 4TVYA 4YRMA 1DM0B 4G7ZC 1Y69U 4MTNA 3E3XA 2HD3A 1XPUA 2Q5IA 1ICWA 4EO4A 4AIMA 3NTKA 1G5HA 2CVRA 1IYVA 3NE5B 1MBYA 4JOIA 2AWNA 3PIOA 4OIJA 3U58A 2JXMB 3AMUA 3RR5A 1F9QA 1D1IA 3CW2C 2K32A 2ZXOA 4IOCA 2A1AA 2GN5A 3FEWX 4LUZA 1MKHA 4DR1Q 2ENBA 2C5CA 4DV1Q 2F0KA 1K8AC 1SBBB 1H95A 4JI2Q 3CCSA 1ENAA 1EOVA 4NXML 2F0NA 1GOZA 1HPCA 1BCPB 2CHBD 1VQBA 1G2SA 3M4OB 4ID6A 1Z6HA 1IW7C 4IUUA 1OTCA 2FMCA 2ZZFA 1PH9A 1E24A 1I6VC 2K5WA 4POGA 2F0IA 2J3LA 4DU9A 1SNPA 3VA7A 3RKXA 1BOSA 3A54A 4X62Q 5D65A 4YRLA 4B3TL 1SEBD 2G9DA 5FLMH 5ELEA 4BA2I 1NUCA 1VS0A 4RAUC 1HA6A 4A75A 4DR2L 2L4NA 3QOLA 4C3JH 3PIPA 1PH5A 2A19A 5C4JH 1YI2A 5M5YB 1KDAA 2ZTGA 4G84A 4HMIA 4A3LG 1A3TA 4P71C 1XYIA 1HNWL 1BKBA 1PFNA 4JW0A 1SESA 1I6HB 1EZ6A 1TWFH 2K5NA 5DNFA 1BUVT 1YJNA 2E76C 1HHVA 3P75A 3DWQA 5J22A 1B7YA 2ZTEA 2I07B 3JC66 1X2GA 2DN8A 2JN4A 1WOCA 2EL9A 4CJ2C 2WB1G 3WDNA 1WTOA 5EBDA 4P3NA 1I4XA 1IXRA 4X66L 3A56A 2JA5G 3TS2A 4ZK9B 2QHVA 3K8AA 1STYA 2E5AA 3IFDA 2B29A 2DY8A 1NBWA 1DGSA 3HOVG 5LMNL 4TRDA 1ICFB 1UE7A 1RDPD 4A3CH 1RCVD 3RGLA 4R4QA 5LMNW 3TEHA 1LTAD 3QO5A 1SE3A 1Y1VB 2BDNA 2N8NA 1K28A 1NNXA 2NZHA 4DXFA 1V1QA 1XTDA 3J81j 1JWSD 3I91A 2Z6KA 2DEQA 4PHCA 2N55A 1DD2A 1VQIA 4A93G 1OXSC 1HZCA 1PDQA 1N33L 4AQYL 3KJOA 1E1OA 1W3SA 4DR7Q 3M7GA 3HXXA 2AQ3B 3HP3A 2PZWA 4XQNA 3KFUA 5IE8A 2XGTA 4ILWA 1CHPD 2Q2HA 2JA7G 3REUA 4QF4A 4OL7A 4A4IA 4FXKC 1XXGA 3NENA 2I4NA 4H13C 2RSOA 1SYBA 4XTUA 3V8LA 2K33A 3CC2A 1I4PA 2CJAA 5CV7A 1OXVA 4NCXA 2MFIA 2LMCB 2JA8H 3GTGB 2EY6A 4NKLA 1CA6A 1U4MA 3ZYYX 4A3MB 3I8ZA 1YHQA 3D4DA 1SFOB 4HWTA 1YHAA 3GQBA 3H91A 4DN4M 2ARTA 2EYMA 4X65L 3NELA 5CV4A 5K36H 3NBHB 1KDCA 4GLVB 3GTQB 2ZT8A 1LT5D 4TTVA 1QWYA 4A3KB 4JI8L 4GKJL 1QJOA 4JV5L 4K5XA 4BY1G 1SXTA 1EVKA 3ER0A 3RZOB 2L1BA 5KNDA 4OEMB 2KQ3A 3NBHA 2Q2UA 4LF8Q 1WCMH 1EEID 1HTLD 3ULJA 2EAYA 2NVYH 1PH4A 3PF5A 2AUJD 2H4OA 1JB7A 4C1NI 2LS01 1E1TA 3UDFA 1SE2A 1V8QA 4XU0A 1K3BC 4KI0A 1STGA 1SYCA 1E2WA 5IWAL 3URYA 4BBRG 3E0EA 3MAQA 5M3MB 4OXPA 2QCPX 2LXJA 4IFDI 2IX0A 4HIMA 2K01A 1VF7A 4KY5A 4PNYA 2A6EC 2NYZD 4XEMA 2NBFA 2OEOA 3RKYA 2MQHA 5LL6S 3DM3A 1PH8A 2EJFC 3HXVA 3C1FA 4WF2A 1HZAA 1VQ9A 4JI5L 5JEAJ 4RWSC 2I5HA 1PFBA 2I0QA 1U0LA 1KNAA 4LF9Q 4RDXA 4MN3A 2HQEA 4GLAC 1SNOA 3PO3B 1GKHA 4JI4Q 3HY1A 4ZKBB 4XXEA 2K5QA 4HSPA 4XYOA 4O2DA 2RSNA 1R9TH 1TWAB 1AEXA 1Z9FA 2JQOA 2MPMA 3JAMi 3KLSX 3IL8A 4J8QA 2QEXA 3DWPA 5T1IA 5C3EG 4DV2Q 1HUNA 3RD4A 3WWVA 1EZ8A 5IODA 5C4XH 4LF6L 3S1QB 3GDEA 2UUAL 1QILA 3OTOQ 2UXDL 2OT2A 5HGTA 1Y8OB 3J81c 4DV5Q 4DR3L 4JOIC 1A6XA 5M5XH 4CDDC 1S4ZA 1BIAA 2B2VC 3U9OA 2ZCEA 4YRKA 4JYAQ 1STEA 2NZOA 1FJGQ 4A3JH 1UNSA 1SERA 3UI2A 4FF2A 1TS5A 1C7YA 3TN2A 3RLNA 1AZPA 1G5IA 3S14H 1B3QA 1Q3LA 1F77A 2NVTH 2EYFA 1S3OA 3R2TA 5BR8Q 3ULPA 2CCZA 1JOQA 2O4XA 4LAAA 2WAQE 4DNTB 3HOUH 2RDGA 3S16B 1H4QA 2KHIA 4UY8C 4DR1L 3RN5A 3QO2A 4DV1L 1XNQQ 4OWWB 2F0UA 1E2ZA 4RA8A 1BCPC 2AQ1B 2ZR2A 4A3BH 3V05A 4JG2A 4C3HB 5FLMG 1LACA 5IT9c 3S1NB 4UP8A 3NK9A 4TWAA 1VQNA 2DTOA 2HHHQ 1DOMA 1HZBA 1TS3A 2B39A 2F0VA 1X2HA 2K04A 5EBCA 3A7UA 2ZXFA 3RACA 1H9RA 1GO3E 1YHBA 1GJXA 3UGQA 1ZKOA 3R3OA 1KRSA 2QDLA 2WV6D 5JJZA 2PPBC 4P75C 4P3PA 5LL6X 3ONAB 4K0KQ 3GV3A 4OO1H 1RTOA 3A74A 1CQFA 4DAVA 4NXNQ 1NJ6A 2NVQH 3EFRA 2RDFA 3CCRA 4IN3A 3F2BA 4H0LC 2I5MX 2P0LA 3IKMB 1LTLA 4XTCS 4X64Q 1ASZA 3REXA 4JI3Q 2R92B 3T13A 4QIWE 5J3BA 3OD1A 2KCMA 1B53A 1HH2P 3H6MA 3UDIA 1PA6A 4MHEA 1JICA 1FL0A 2DJFC 4PG3A 4A3EB 1TIID 3GTOH 1DONA 4G7OC 1Z7NA 1FVIA 1LLRD 3HOXB 2AKWA 3GTKB 5GADC 3S1MB 1CZGA 2K50A 3PO3G 2F0WA 2F0HA 2Z6KC 3H0GB 4OGQC 5DAUA 5NUCA 3HZXA 3DSQA 1IYUA 1SLJA 2DQ3A 4QUCA 4IJLA 4LFBQ 4KHVA 2CH4A 1WQWA 1L0XB 3CPFA 3P8YA 2V4DA 3TRZA 3VR3A 3HOYG 2QA4A 2HCCA 5JJLA 1VQCA 5CV8A 4OX9L 2EYOA 1JR0D 2EYPA 4JI1Q 4DR7L 5CV9A 3SE0A 5I2YA 4K8IA 5GAEC 2IJ0A 2ZZEA 2X69A 1A15A 4DV4Q 2R7ZG 2R93B 2AMCB 4A3LH 3AQQA 2CJ9A 3RLOA 2DZCA 1WD0A 2VUMB 3L0OA 1K73C 4EQPA 5HURA 3WOEA 4A3DB 1A3UA 2XWJB 4E51A 3PUWA 3H15A 4YHHQ 4JBKA 1WTWA 2D62A 1T9HA 4PZ8A 4U68A 4LVKA 2AMCA 2ID0A 4BA1I 1HTPA 5K1XA 1GHKA 4K5VA 1PTOC 2N88A 1KNEA 2JA5H 1X6OA 4CKBA 3HOZG 5I2XA 4RGOS 1VQZA 3LSSA 5K1PA 4CBVA 2PI2A 1HFGA 2JA6B 1MJCA 3ITPA 4LWCA 5C52B 1YIJA 2BE5D 1IKMA 3HOVH 4FVMA 2YU9H 4RQEA 1J8IA 1L0WA 1ADJA 1RKNA 2ZNIA 3BZDB 3A8KE 1DJRD 3PUVA 1LTBD 1B50A 4BW9A 2LY7A 2FFKB 1N32Q 1EIHA 4PMBA 1FNUA 1E3PA 3J81E 3A5UA 4TVAB 2EZVA 4GN4B 1F2MA 2Y0SB 1II3A 4RKBA 5E3IA 5EKLA 3IALA 1U5KA 1BBUA 4KD4A 2EQSA 3IKLA 1X56A 4Q5VA 1M1KC 1Q12A 1QCBD 3UE1A 4A93H 1EQQA 4KKTA 4QGUA 4RGNA 4WJWA 1G8ZD 3WOFA 3NQTA 3ERQA 3GTLB 1JJ2A 1PFSA 1VQLA 3I4MG 1B70B 2K75A 3HG9A 2MO0A 2EXDA 1GXDC 3GP7A 3RKWA 4K14A 3MWYW 5CBEE 4LJZC 4KJOA 2JA7H 2EYHA 2CWAA 2B2WA 2DVEA 1X3QA 2XIWA 1LABA 1EIFA 4KHPQ 1L1OA 1NMGA 5C53B 1PH3A 1TQOA 1B70A 4KN7C 4K87A 4J6HA 3JAML 1HJPA 1C9OA 1PXUA 4DXGA 4XIGS 4RCNA 5I6WA 3HOXG 1Q46A 4IPDA 1UAPA 2Q5HA 1PZID 4CDEC 3H3VI 4XT3B 1EL0A 3HKZG 4KTAA 1C48A 5HGQA 1D8LA 1PFMA 3I73A 1DYQA 2I4LA 4LF9L 2DU5A 3M4OH 3VDYA 1XMOQ 1S5BD 1VF5C 5JJIA 1H9SB 3V7SA 3T4AC 4JI4L 1VQ6A 1N36Q 1VQGA 2E2DC 1K8GA 3AB9A 4YRIA 2R7FA 1B2TA 4CHTB 5M3FB 2BDOA 5IIFA 4HJ8A 3F2CA 2RCFA 2F52A 1BO0A 2I5LX 4OHJA 1H9SA 5M5YH 3A8JE 4TKOB 1SNDA 1WJJA 3I4NG 2NVXB 2HUGA 3DM1A 2ZZGA 4IFDJ 2ZR3A 3J80c 3K6OA 2B2TA 3NHHA 1NR4A 4OELB 1A2UA 5DEHA 4DV5L 3M4PA 1VQEA 1I6HH 2HQLA 1EWCA 4YRNA 4HJ9A 2A6HD 4H2YA 3STBD 5J39A 1L2FA 4G85A 3TP5A 1H4VB 3M3YH 2X6LA 3PIP3 2QILA 1AE2A 2VQFQ 2HT1A 4QL5A 2DXUA 2UUCQ 4LF5Q 4G4KA 2P5ZX 5JJKA 2WB1E 2PMEA 1BNZA 4Y52H 1X54A 1HR0L 5BR8L 2PYKA 1X01A 3OWEB 4P74A 4XQJA 4YRGA 1EY9A 3FMCA 5C4HA 5ELOA 3J7ZC 2KCTA 3NTIA 1TWCB 5IGDA 2KHJA 1XNQL 2IWHA 2EJFA 1LTTD 3V7CA 2IL8A 2L12A 3VR5A 1NYQA 1VQ4A 2I4MA 4N9PA 5F2DA 3CC4A 4S3SA 4YRTA 1ENFA 2J4XA 3D8GA 5C0XI 2PMZB 2RKSA 4DFAA 2ATWA 5D14A 1VQ8A 4H2TA 5E3FA 2EYJA 1NR2A 4LFAL 5EAYA 4OP0A 1Y8PB 2E75C 4HIDA 1X3GA 5C3EH 2PQEA 4DR4Q 4G7HC 3G6EA 2F0OA 4GNXB 2SDFA 2XSCA 1BR9A 1ASYA 2VS1A 3A8IE 4K0KL 1QOHA 2HNIA 4NXNL 1EY4A 3R93A 5FLXL 2UU9Q 4DNRB 4QMGA 1JT8A 4UPAA 1B4OA 2F0EA 4JBMA 3VQXA 1Z7TA 1QE6A 4C3IB 4L5SA 3GO5A 1EYGA 4LF7Q 4JI3L 2B2VA 1YITA 1JCKB 1HRJA 2NWGA 4GN5A 2CWPA 4DK1A 3GTGH 3PSIA 1KL9A 5KRUA 4YY3Q 1PTOH 1ZYRD 5CV6A 4KMUC 5ISRA 2DZ9A 5AJ3L 2XN9C 1VQAA 5E7NA 3I56A 1TY0A 1SFOH 4FF1A 3GTMB 4ZAIA 3TP6A 4NPSA 5IGBA 2F0LA 4LUVA 1NNHA 3HOWB 4JPBW 3FRPB 1IZ6A 1N9WA 1ET9A 1GUGA 1AW7A 4FXDA 4KY6A 1QUQB 1RL2A 2J7ZA 2B63B 4J15A 1EU3A 4EQOA 3CMEA 3GV6A 3A32A 3HTZA 1JB3A 2Z4IA 1MHWC 3KF8B 3G48A 4C2MB 1Q1BA 3CRLC 3BDLA 4I7ZC 4OIKA 2FXQA 1Z7MA 1QUQA 2DQ0A 1D6EC 4DQ2A 1SNCA 3SK8A 4JI1L 1HNXQ 1V1PB 2C9OA 1EFID 2QHSA 2D0PA 4DV4L 4ZTZB 2C7IA 3K5NA 1ENCA 3PO2B 4A3FB 4B3RQ 4KHZA 4P75A 2JSOA 2EVBA 4L5QA 5I4DA 2EWNA 4QQBX 3KF8A 3S15B 3QR8A 4ME5A 4QY7A 5IYDG 4LVIA 1F2YA 1KDBA 2F4VQ 1TKWB 3HXZA 2HIVA 3QO8A 4YHHL 1MIUA 3K59A 3W3AA 1O7ZA 2ZJQA 4G57A 4DUYQ 2F4IA 4IUNA 4R9WA 4V190 4YREA 2LSSA 1HA5A 1X9NA 1PH2A 1X32A 3CCUA 1MI2A 4MZ9A 1SAPA 1E7ZA 2ZT7A 1GUNA 1V9PA 2ZINA 3PO3H 3OOCA 1RHPA 2F0MA 1QVCA 1TU2B 5C6AA 3CCQA 3DHQA 5EKIA 3MHBA 1EQRA 3MXGA 3J80E 1N34Q 3TREA 1SDFA 3ERSX 5C5LA 3SK4A 3LWUA 1RODA 2BE5C 4DV7L 2B8FA 3I55A 1SYGA 2XTIA 3HOYH 3PGZA 4PMCA 2UUBQ 2R7DA 5IY0A 4A3GB 3E9HA 3WQZA 4HJ7A 1P8LA 2JA9A 2B2WC 2IHEA 1L1OC 1CKOA 4K5WA 3FKIB 2R7ZH 1A63A 4IJHA 5E4XA 4H2VA 4JI6L 2KUMA 1SYEA 1ET6A 2HDLA 1PRTD 3BYYB 4KJNA 1F2ZA 1J6QA 4Y7NH 2F0GA 1SYDA 5CBAE 2A68D 2Q8IB 3J80L 2VXWA 1I50B 4YWMA 4ZIBA 4HMJA 3V8JA 3NBIA 4KHPL 3NP8A 1HNZL 2F3IA 1H4TA 3B6YA 3W2DA 1H9KA 1SNQA 4O42A 1TWGB 2KBNA 4K2LA 5IGFA 3S16H 2QKIC 4R4CA 4HIOA 5C3WA 4N8FA 2B3GA 1SSOA 4JI7Q 3HOZH 1KMMA 5JEAG 4BWAA 4J1MA 3KBXA 3TS0A 2B2YA 1K8MA 5IP7G 1K83H 3A5ZB 1IL8A 3K7AB 4FP5D 3TDQA 1XMOL 4MNOA 2YTYA 2A5HA 3S1NH 2Q8TA 2WKCA 1UWVA 2LKVA 3F2UA 5DM73 4F87A 2AWOA 2B2TC 2GA4B 3T1YQ 4H2SA 2EE1A 3O13A 5EPLA 1LTID 4IUPA 1ESRA 2NB0A 3A5ZA 3I90A 2NS6A 1QNUA 4K88A 4KY7A 2JK8A 3CCLA 1STHA 2NZ1D 4A3FG 2R6GA 3K5LA 1WTVA 5GQOA 3RMHA 5FK9C 2ZJRA 1JJCB 4Q0FA 4P73A 1G2TA 5IP9G 1PRTF 5LMUQ 3I4MH 1RJTA 4UDUC 4O1NA 5KGUA 4P74C 1J9OA 4F8MA 1AP0A 1KMNA 1BBWA 3Q6SA 2KCCA 1H9MA 1CM9A 4JI0Q 4KN4C 2EYLA 1JMCA 2VQFL 1IBLQ 2R3ZA 2UUCL 4LF5L 1JJCA 3T1HQ 5KYLA 3U4VA 1ESFA 1EY8A 2A6HC 2OTLA 3L7ZC 4HVCA 2C8MA 2DNCA 1HZ9A 4ZKCB 2IX3A 4A76A 4DGZA 3HOXH 3HRIA 1LYLA 4CS2A 1Y1VG 3IFTA 1QE0A 1G291 4BY7B 3Q0AA 3CQZH 1GD7A 3E0JA 4LNQA 3J81i 2RDHA 1V43A 1XMQQ 1ADYA 4N8X1 3RNUA 1Q8KA 3VR4A 2QGQA 3OPOA 2ZTDA 2RF4A 3TP7A 3IKJA 5E4WC 4A3GG 1VQ5A 5M9OA 1VQHA 3D4WA 3N52A 2HCIA 3TQYA 2JJQA 1YJWA 4BWGB 4XTXA 3J7YW 4TVWA 4UHVA 1SMYD 1GUTA 3S2DH 3GTJH 1VQJA 4DR4L 4L8JA 3FKIG 1G91A 5CMDA 5BN4A 3I4NH 3M4YA 3I4OA 1VQDA 1I4GA 1GVPA 2VUMH 2EY5A 3ND9A 3PUYA 1WLEA 2K4KA 2UU9L 2PZUA 4P72A 4A3DH 2SNSA 2ZXPA 2KJXA 2JYOA 4A3MG 4LF7L 3CAMA 3UDGA 2A74C 3NEMA 3ICEA 2E8GA 2IY5B 2PW7A 3D0FA 3S1RB 1EEFD 1XTCD 2CGHA 4O0AA 1JE4A 4YRQA 3BZKA 4M8AA 1W6KA 5IYBG 5C0XJ 4ALPA 3DEOA 1SRUA 4Z9CB 4DUZQ 3RZDB 4JI2L 1E2VA 1Y8NB 1USYA 1AN8A 3NTHA 1JE5A 5FO9B 4A3KG 2JA8B 2IY5A 3OW7A 2E1HA 1IKLA 2BH2A 3P7JA 4U673 3QG1A 3BS1A 2VZAA 3OWFA 1KD1C 5A2QE 3K80C 4X62L 1I3QH 5L37A 1F9PA 4YPFA 2MUYA 3KLSA 3ZJYC 5IGEA 1EWIA 1U9RA 1B44D 4X5OA 1ZEQX 3DEPA 3BJUA 4AH6A 2F0JA 3L2ZA 3GTLH 2TMPA 4YWKA
chains in the Genus database with same CATH topology
1HNXL 5M3MG 3UGTA 3BFMA 4B3RL 1PHJA 4DK3C 1LM0A 4OO1I 5C51B 3NETA 2F4VL 1EVLA 1YFTA 2ZM6Q 5M5WH 4R4IA 2YTXA 2E65A 4DUYL 3AYHB 3PCOB 1VCIA 2ALYB 1IBMQ 3EBEA 3QTCA 4BY7G 4OLFA 2E2IH 1KQSA 4ZTUB 1X65A 3AFPA 3HKZE 4OWXB 4YRJA 3VQYA 2Z0SA 1KXLA 1XPRA 3PCOA 2PQAB 2ALYA 3K7UC 4OWTB 1VQOA 3HFZB 2OTJA 3G1ZA 2N3SA 2MO1A 3HKSA 4IPCA 2UXBQ 2EIFA 1XNRQ 2NVXH 1OXTA 2UUBL 12ASA 3MEYA 2PQAA 2DDZA 2E3CA 5H1SE 2VW9A 1CSQA 3U4ZA 3L4GB 3GTPH 4CH4A 4LFCQ 1HNWQ 4JBJA 2PI2E 3QO7A 1IL2A 5IYDH 1IBKQ 4LF4Q 3QNEA 1X55A 4LVMA 3MEFA 3S24A 4IO9A 5GAHC 4DR5Q 3KDFB 3W1BA 1TWHH 4R1JA 2OWOA 4XTVA 3CMAA 1NJ8A 4DR6Q 1SRYA 1WU7A 4WI1A 3KDFA 4H02A 2Y0SE 1X3EA 4P73C 3T1YL 4LF8L 1KOGA 1NY4A 2RHSB 2OCEA 2Q7GA 1YVCA 3L1AA 4TVAA 1XJVA 4EQ5A 2R92G 3PUZA 4IFDG 2VL6A 4HJ5A 3VBBA 2H5XA 1ATIA 1CKNB 2RHSA 3TEGA 4A3EG 4Q6GA 2A8EA 3HFVA 3CD6A 1IBLL 3T1HL 3H0GG 1UE1A 3GTMH 1CKNA 1G51A 3M4QA 4DAYB 3PZCA 3J80i 3OW2A 3EN2A 4GKKQ 4AYBG 4HJAA 1XMQL 5IP7H 3TUPA 1RIPA 4YDQA 4DV2L 3K0XA 2R93G 3MF1A 2PNHA 4P72C 3CCVA 3J7A5 2VUMG 3OTOL 1NJ2A 1PV4A 1Q86C 1SMXA 4A3DG 3P8TA 3KOJA 4IPHA 4A3FH 4JYAL 2ODRD 1FJGL 4H2XB 3S15H 5IP9H 1H4SA 3EIVA 1USYC 1K0RA 2ZT5A 2IT1A 2CKZB 2JA6G 4POFA 4H2XA 1YGBA 2E41A 1C0AA 4UP9A 4WJ3M 4DUZL 2MNAA 4GOPB 1Y1VH 5C44G 1CUKA 2Y0SG 4L5TA 4HWOA 1GM5A 1VQKA 2HHHL 1W2BA 1VQFA 4GN3B 1WFQA 1K3RA 4GOPA 1Y1WG 3EFSA 1SROA 2BA0A 4A3GH 1WYDA 3G71A 2GVBA 1PH1A 2YYZA 1VQPA 3W1GA 4DV6Q 3FKIH 4X64L 3ICAA 4GNXA 3AFQA 3CCMA 1Q81C 1EFWA 4XU2A 4GS3A 4A3MH 2JEAI 1I5FA 2ZM6L 1J5EQ 2Q7HA 1TWGH 5IYBH 1IBML 3GTQH 3DLLA 1KC8C 2NN6G 3AEVA 4A3KH 5M3FG 4Q15A 3K7AH 4LVLA 4TQUS 4LFBL 3RLFA 2Q2TA 4BXXG 3BU2A 4X6AH 3RZOH 3BZCA 2V1CC 2ARUA 3CPWA 4DV3Q 2UXBL 3W3SA 1XNRL 2BH8A 2Q7EA 1B7YB 3D31A 2ZNJA 2E5LQ 5M3MH 1MJEA 4LFCL 3U50C 3CCEA 1W66A 4LVJA 4XU1A 1WQ7A 1IBKL 4LF4L 3V7RA 4DR5L 4CH6A 4DR6L 5DLQE 1M90C 4BY7H 1G6PA 5KNNA 3TEHB 1Q82C 3P8VA 2VQEQ 2J3MA 1TWAH 2K14A 1N32L 2GVAA 4H2UA 5IYCG 1YZ6A 4LUOA 3S1QH 2K52A 3V8KA 4KLKA 3MQZA 2A8VA 5GROA 1UE6A 4OX9Q 1FYFA 1WPYA 4DKAC 1QVFA 4B3MQ 1NYRA 2QHUA 4JBWA 3RUXA 3S1RH 2ZIMA 3FHWA 4YRPA 2CQOA 3RF1A 4CS4A 3HOWG 3RZDH 3A31A 1RIQA 2B63G 1LUZA 1NJ5A 4C3HH 4KR3A 4BBSG 1CKMA 1N36L 1B76A 4GKKL 4EX5A 2CJBA 4DV0Q 1YFSA 3HRKA 4YRSA 2DJZA 3SGIA 1GGMA 4OONA 4H2WA 3PO2G 1OXUA 2N49A 2ASBA 3F1ZA 4ME3A 1EIYB 3PF4A 3A5YA 3A0JA 3K81C 1PYSB 1S40A 2R92H 1AH9A 1A8VA 1KRTA 3I2ZA 4PMWA 1NMFA 1EIYA 4A3EH 3STBC 4HWRA 2ODRC 1PYSA 3GTKH 3S1MH 4A3IH 3H0GH 5C0XG 2ZT6A 2DU7A 3M7NA 4GOPC 1NJIC 1SETA 1IYJB 3F2DA 4PZ6A 4DAMA 5FJ8G 2E64A 1K9MC 4YYEA 4DNIA 2EJGA 2K5HA 1VQ7A 2IHFA 1KAWA 2R93H 4GNXC 1HC7A 3PV0A 4DV6L 2DTIA 2DGYA 3I7FA 1KHIA 3UE0A 1QVGA 3L2PA 1JJGA 3UDXA 3JAMc 2RHQB 3FP9A 1Q1EA 4YY3L 3MF2A 1I94Q 3CCJA 4B3SQ 2JA6H 3F8TA 1J5EL 1TXYA 2YV5A 1FGUA 4L87A 1HR0Q 4RG1A 2RHQA 11ASA 4PZ7A 3HY0A 4DK6C 1QZHA 3A7RA 4K86A 5C44H 2FYKA 4HWSA 1AE3A 3CC7A 1XPOA 2UXCQ 2PMFA 3UFGA 2DUDA 2L15A 1YB3A 1PYBA 4XTZA 2ES2A 1Y1WH 3IRBA 4DV3L 4LFAQ 2E2HH 5ELNA 4JCVE 4DPGA 2E5LL 2LXKA 1P16A 3E9IA 2VY3A 4R4OA 2CIMA 4KR2A 1NE3A 4KQEA 3CXCA 2AKWB 4RQFA 1S72A 1EUJA 4CS3A 2D0OA 3M9BA 1N8RC 2ZIOA 3RN2A 5F5WA 4A3CG 4TQFA 5AJ3Q 4NXMQ 4YWLA 3ULLA 2BA1A 4HIKA 3W5OA 2VQEL 1J5WA 1N34L 5M3FH 2N78A 2JEBI 4AYBE 4BXXH 1SN8A 3LGJA 4B3TQ 4XTWA 1E22A 3HXUA 2NN6I 4DR2Q 3HFZA 1WI5A 5FLXc 4YCWA 1O7IA 1A62A 1Y14B 1PH6A 1YNXA 4WJ4A 1B8AA 2ARSA 1SE8A 3RL6A 3MXNB 1HXDA 2QHTA 4YRFA 1HTTA 3M85A 4B3ML 3L4GA 1KIXA 4HA8A 4YRCA 4P71A 4FDBA 2E10A 3A7AA 2JA8G 4YCVA 4TQDA 1Z47A 4UP7A 3KF6B 4HWPA 3RIRA 2ZGWA 1TWCH 4X66Q 2WAQG 4LW1A 4JI7L 1QZGA 4YRRA 1X3FA 1PVOA 2HIXA 5LMNQ 4YROA 4GLXA 5K36G 1D7QA 3R07A 3LC0A 3KF6A 1QF6A 2JE6I 2RCNA 2VNUD 4HT4A 4IPGA 4APVA 2OQKA 4LNSA 4DV0L 5IYCH 4YP0A 1NTGA 3LSQA 2AHOB 1WCMG 1N33Q 4AQYQ 3FJPA 4DV7Q 2EJ9A 3KJPA 5LMUL 3CF5A 1YJ9A 4L5RC 4C3IH 1L1OB 5HY6A 4JI0L 1YEZA 4R4TA 4JI6Q 1Q7YC 4A3IG 3HXYA 3G4SA 4XU3A 3VQVA 1OXXK 1PH7A 4CH5A 3H3VH 2OQ0A 2WFWA 1SR3A 4XTYA 1HNZQ 2C35B 3HOWH 4YCUA 2IX1A 2K5VA 4X65Q 2B63H 3S2HH 3S17H 4NB3A 2ZTCA 4BBSH 5GAGC 1UE5A 2DTHA 4JI8Q 4C2MH 1YFRA 1UEBA 4GKJQ 4JV5Q 4QJFA 2I4OA 3HXWA 3PO2H 5C4XG 2KENA 1BVSA 3Q8DA 4BY1H 2Q2IA 3UH0A 3KYHC 5IWAQ 4JC0A 3KLWA 4A3JG 4XEOA 3CMQA 1A0IA 1YBYA 1I94L 4BBRH 4B3SL 3CP0A 3HOUG 1CSPA 2G4CA 4JI5Q 4IOAA 2WP8J 2PMZE 2DXTA 4RMFA 1WNLA 4A3BG 1VQMA 1HR0W 3GD7A 2ZJPA 3VQWA 3PUXA 2UXCL 3OYYA 5FJ8H 1NJ1A 3IG2A 4P3OA 2CFMA 4LF6Q 1BIBA 4OO1G 2UUAQ 2E2JH 2UXDQ 4DR3Q 2P5IA 3ERRA 2DKGA 4CH3A 2YTVA 1I50H 4TVYA 4YRMA 4MTNA 1XPUA 2Q5IA 4EO4A 4AIMA 1G5HA 4JOIA 2AWNA 3PIOA 3U58A 3RR5A 3CW2C 4IOCA 2A1AA 2GN5A 4LUZA 1MKHA 4DR1Q 4DV1Q 1K8AC 1H95A 4JI2Q 3CCSA 1EOVA 4NXML 1VQBA 1OTCA 2ZZFA 1PH9A 1E24A 4POGA 2J3LA 3RKXA 4X62Q 4YRLA 4B3TL 5FLMH 4BA2I 1VS0A 4A75A 4DR2L 4C3JH 1PH5A 3PIPA 2A19A 5C4JH 1YI2A 2ZTGA 4G84A 4A3LG 4P71C 1HNWL 1BKBA 1SESA 1TWFH 2K5NA 1YJNA 1B7YA 2ZTEA 3JC66 1X2GA 1WOCA 2EL9A 2WB1G 4P3NA 1IXRA 4X66L 2JA5G 3TS2A 2QHVA 3K8AA 2E5AA 2B29A 1NBWA 1DGSA 3HOVG 5LMNL 1UE7A 4A3CH 3RGLA 4R4QA 5LMNW 3TEHA 3QO5A 2N8NA 2NZHA 1V1QA 1XTDA 3J81j 2DEQA 2Z6KA 4PHCA 1VQIA 4A93G 1OXSC 1HZCA 1N33L 4AQYL 3KJOA 1E1OA 1W3SA 4DR7Q 3HXXA 3KFUA 5IE8A 2XGTA 2Q2HA 2JA7G 3REUA 4A4IA 2I4NA 3NENA 4XTUA 3V8LA 3CC2A 2CJAA 1OXVA 4NCXA 2MFIA 2JA8H 1YHQA 4HWTA 1YHAA 2ARTA 4X65L 3NELA 3NBHB 4GLVB 2ZT8A 4TTVA 4JI8L 4GKJL 4JV5L 4BY1G 1EVKA 3ER0A 2Q2UA 4LF8Q 1WCMH 3ULJA 2EAYA 2NVYH 1PH4A 3PF5A 1JB7A 1E1TA 3UDFA 4XU0A 4KI0A 5IWAL 4BBRG 3E0EA 4OXPA 2LXJA 4IFDI 2IX0A 4HIMA 4XEMA 3RKYA 2MQHA 3DM3A 1PH8A 3HXVA 4WF2A 1HZAA 1VQ9A 4JI5L 5JEAJ 2I5HA 2I0QA 1U0LA 4LF9Q 4RDXA 4GLAC 1GKHA 4JI4Q 3HY1A 4O2DA 1R9TH 1Z9FA 2JQOA 3JAMi 2QEXA 5C3EG 4DV2Q 3WWVA 4LF6L 5C4XH 3GDEA 2UUAL 3OTOQ 2UXDL 4DV5Q 3J81c 4DR3L 4JOIC 5M5XH 1BIAA 2ZCEA 4YRKA 4JYAQ 2NZOA 1FJGQ 4A3JH 1SERA 1C7YA 3RLNA 1G5IA 3S14H 2NVTH 1S3OA 5BR8Q 3ULPA 2CCZA 2WAQE 3HOUH 1H4QA 2KHIA 4UY8C 4DR1L 3RN5A 4DV1L 1XNQQ 4OWWB 2ZR2A 4A3BH 4JG2A 5FLMG 5IT9c 4UP8A 4TWAA 1VQNA 2DTOA 2HHHQ 1HZBA 1X2HA 3A7UA 2ZXFA 3RACA 1GO3E 1YHBA 3UGQA 1KRSA 4P75C 4P3PA 4K0KQ 3A74A 1NJ6A 4NXNQ 2NVQH 3EFRA 3CCRA 3F2BA 2P0LA 2I5MX 3IKMB 1LTLA 4XTCS 4X64Q 1ASZA 3REXA 4JI3Q 4QIWE 5J3BA 3OD1A 2KCMA 1HH2P 3UDIA 1PA6A 1FL0A 4PG3A 3GTOH 1Z7NA 1FVIA 2AKWA 5GADC 2K50A 3PO3G 2Z6KC 3DSQA 1SLJA 2DQ3A 4IJLA 4LFBQ 1WQWA 3CPFA 3P8YA 3TRZA 3HOYG 2QA4A 5JJLA 1VQCA 4OX9L 4JI1Q 4DR7L 5GAEC 2ZZEA 4DV4Q 2R7ZG 2AMCB 4A3LH 3AQQA 2CJ9A 3RLOA 2DZCA 3L0OA 1K73C 4E51A 3PUWA 3H15A 4YHHQ 4JBKA 2D62A 1T9HA 4PZ8A 4LVKA 2AMCA 2ID0A 4BA1I 5K1XA 2JA5H 1X6OA 3HOZG 5K1PA 1VQZA 3LSSA 2PI2A 1MJCA 4LWCA 5C52B 1YIJA 3HOVH 2YU9H 4RQEA 1L0WA 1ADJA 2ZNIA 3PUVA 4BW9A 1N32Q 1E3PA 3A5UA 4TVAB 4GN4B 5E3IA 3IALA 1U5KA 1BBUA 2EQSA 3IKLA 1X56A 1M1KC 1Q12A 3UE1A 4A93H 1EQQA 4QGUA 1JJ2A 1PFSA 1VQLA 3I4MG 1B70B 2K75A 2MO0A 2EXDA 3RKWA 2JA7H 2CWAA 2DVEA 4KHPQ 1EIFA 1L1OA 1NMGA 5C53B 1PH3A 1B70A 4K87A 1HJPA 1C9OA 4XIGS 3HOXG 1Q46A 4IPDA 2Q5HA 3H3VI 3HKZG 5HGQA 1D8LA 2I4LA 4LF9L 2DU5A 3M4OH 3VDYA 1XMOQ 5JJIA 3V7SA 1VQ6A 4JI4L 1N36Q 1VQGA 1K8GA 4YRIA 2R7FA 4HJ8A 3F2CA 2F52A 2I5LX 5M5YH 1WJJA 3I4NG 2ZZGA 4IFDJ 2ZR3A 3J80c 4DV5L 3M4PA 1VQEA 1I6HH 2HQLA 4YRNA 4HJ9A 4H2YA 3STBD 4G85A 1L2FA 1H4VB 3M3YH 1AE2A 2VQFQ 2HT1A 4QL5A 2DXUA 2UUCQ 4LF5Q 5JJKA 2WB1E 2PMEA 4Y52H 1X54A 1HR0L 5BR8L 1X01A 4P74A 4YRGA 3J7ZC 5ELOA 2KCTA 2KHJA 1XNQL 2EJFA 3V7CA 1NYQA 1VQ4A 2I4MA 3CC4A 4YRTA 5C0XI 2ATWA 1VQ8A 4H2TA 4LFAL 5EAYA 4OP0A 4HIDA 1X3GA 5C3EH 4DR4Q 3G6EA 4GNXB 1ASYA 2VS1A 4K0KL 2HNIA 4NXNL 2UU9Q 1JT8A 4UPAA 4JBMA 3VQXA 4L5SA 4LF7Q 3GO5A 1EYGA 4JI3L 1YITA 4GN5A 2CWPA 3GTGH 3PSIA 1KL9A 4YY3Q 2DZ9A 5AJ3L 3I56A 1VQAA 5E7NA 1SFOH 4NPSA 4LUVA 1NNHA 1IZ6A 1N9WA 1QUQB 1RL2A 4J15A 3CMEA 3A32A 3HTZA 3KF8B 3G48A 1Q1BA 2FXQA 1Z7MA 1QUQA 2DQ0A 4DQ2A 4JI1L 1HNXQ 2QHSA 2D0PA 4DV4L 4ZTZB 2C7IA 4B3RQ 4KHZA 4P75A 4L5QA 2EWNA 4QQBX 4QY7A 5IYDG 4LVIA 2F4VQ 3HXZA 2HIVA 3QO8A 4YHHL 1MIUA 2ZJQA 4DUYQ 4YREA 2LSSA 1X9NA 1PH2A 3CCUA 4MZ9A 1E7ZA 2ZT7A 1V9PA 2ZINA 3PO3H 1QVCA 3CCQA 1EQRA 1N34Q 3TREA 3ERSX 4DV7L 3I55A 2XTIA 3HOYH 3PGZA 2UUBQ 2R7DA 5IY0A 3E9HA 3WQZA 4HJ7A 1P8LA 2JA9A 2IHEA 1L1OC 1CKOA 2R7ZH 1A63A 4IJHA 4H2VA 4JI6L 1J6QA 4Y7NH 4ZIBA 4YWMA 3V8JA 4KHPL 1HNZL 2F3IA 1H4TA 3B6YA 3S16H 2KBNA 4R4CA 4HIOA 2B3GA 4JI7Q 3HOZH 1KMMA 5JEAG 4BWAA 3TS0A 5IP7G 1K83H 3A5ZB 1XMOL 4MNOA 2YTYA 3S1NH 1UWVA 2AWOA 3T1YQ 4H2SA 3A5ZA 4K88A 2NS6A 2JK8A 3CCLA 4A3FG 2R6GA 5GQOA 2ZJRA 1JJCB 4P73A 5IP9G 3I4MH 5LMUQ 4P74C 1KMNA 1BBWA 4JI0Q 1JMCA 2VQFL 1IBLQ 2UUCL 4LF5L 1JJCA 3T1HQ 3U4VA 2OTLA 3L7ZC 4HVCA 2C8MA 1HZ9A 4A76A 3HOXH 3HRIA 1LYLA 4CS2A 1Y1VG 1QE0A 1G291 3CQZH 1GD7A 4LNQA 3J81i 1V43A 1XMQQ 1ADYA 3RNUA 1Q8KA 2QGQA 2ZTDA 2RF4A 4A3GG 1VQ5A 1VQHA 3TQYA 2JJQA 1YJWA 4XTXA 4TVWA 3S2DH 3GTJH 1VQJA 4DR4L 3FKIG 3I4NH 3I4OA 1VQDA 1GVPA 2VUMH 3PUYA 1WLEA 2K4KA 2UU9L 4P72A 4A3DH 4A3MG 4LF7L 3CAMA 3UDGA 3NEMA 3ICEA 2E8GA 2IY5B 3D0FA 2CGHA 4O0AA 4YRQA 3BZKA 5IYBG 5C0XJ 4ALPA 1SRUA 4DUZQ 4JI2L 1USYA 1JE5A 4A3KG 2IY5A 2E1HA 2BH2A 2VZAA 1KD1C 3K80C 4X62L 1I3QH 4YPFA 3ZJYC 1EWIA 4X5OA 3BJUA 4AH6A 3L2ZA 3GTLH 4YWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNX L;  5M3M G;  3UGT A;  3BFM A;  4B3R L;  1PHJ A;  4DK3 C;  1LM0 A;  4OO1 I;  5C51 B;  3NET A;  2F4V L;  1EVL A;  1YFT A;  2ZM6 Q;  5M5W H;  4R4I A;  2YTX A;  2E65 A;  4DUY L;  3AYH B;  3PCO B;  1VCI A;  2ALY B;  1IBM Q;  3EBE A;  3QTC A;  4BY7 G;  4OLF A;  2E2I H;  1KQS A;  4ZTU B;  1X65 A;  3AFP A;  3HKZ E;  4OWX B;  4YRJ A;  3VQY A;  2Z0S A;  1KXL A;  1XPR A;  3PCO A;  2PQA B;  2ALY A;  3K7U C;  4OWT B;  1VQO A;  3HFZ B;  2OTJ A;  3G1Z A;  2N3S A;  2MO1 A;  3HKS A;  4IPC A;  2UXB Q;  2EIF A;  1XNR Q;  2NVX H;  1OXT A;  2UUB L;  12AS A;  3MEY A;  2PQA A;  2DDZ A;  2E3C A;  5H1S E;  2VW9 A;  1CSQ A;  3U4Z A;  3L4G B;  3GTP H;  4CH4 A;  4LFC Q;  1HNW Q;  4JBJ A;  2PI2 E;  3QO7 A;  1IL2 A;  5IYD H;  1IBK Q;  4LF4 Q;  3QNE A;  1X55 A;  3MEF A;  3S24 A;  4IO9 A;  5GAH C;  4DR5 Q;  3KDF B;  3W1B A;  1TWH H;  4R1J A;  2OWO A;  4XTV A;  3CMA A;  1NJ8 A;  4DR6 Q;  1SRY A;  1WU7 A;  4WI1 A;  3KDF A;  4H02 A;  2Y0S E;  1X3E A;  4P73 C;  3T1Y L;  4LF8 L;  1KOG A;  1NY4 A;  2RHS B;  2OCE A;  2Q7G A;  1YVC A;  3L1A A;  4TVA A;  1XJV A;  4EQ5 A;  2R92 G;  3PUZ A;  4IFD G;  2VL6 A;  4HJ5 A;  3VBB A;  2H5X A;  1ATI A;  1CKN B;  2RHS A;  3TEG A;  4A3E G;  4Q6G A;  3HFV A;  3CD6 A;  1IBL L;  3T1H L;  3H0G G;  1UE1 A;  3GTM H;  1CKN A;  1G51 A;  3M4Q A;  4DAY B;  3PZC A;  3J80 i;  3OW2 A;  3EN2 A;  4GKK Q;  4AYB G;  4HJA A;  1XMQ L;  5IP7 H;  3TUP A;  1RIP A;  4YDQ A;  4DV2 L;  3K0X A;  2R93 G;  3MF1 A;  2PNH A;  4P72 C;  3CCV A;  3J7A 5;  2VUM G;  3OTO L;  1NJ2 A;  1PV4 A;  1Q86 C;  1SMX A;  4A3D G;  3P8T A;  3KOJ A;  4IPH A;  4A3F H;  4JYA L;  2ODR D;  1FJG L;  4H2X B;  3S15 H;  5IP9 H;  1H4S A;  3EIV A;  1USY C;  1K0R A;  2ZT5 A;  2IT1 A;  2CKZ B;  2JA6 G;  4POF A;  4H2X A;  1YGB A;  2E41 A;  1C0A A;  4UP9 A;  4WJ3 M;  4DUZ L;  2MNA A;  4GOP B;  1Y1V H;  5C44 G;  1CUK A;  2Y0S G;  4L5T A;  4HWO A;  1GM5 A;  1VQK A;  2HHH L;  1W2B A;  1VQF A;  4GN3 B;  1WFQ A;  1K3R A;  4GOP A;  1Y1W G;  3EFS A;  1SRO A;  2BA0 A;  4A3G H;  1WYD A;  3G71 A;  2GVB A;  1PH1 A;  2YYZ A;  1VQP A;  3W1G A;  4DV6 Q;  3FKI H;  4X64 L;  3ICA A;  4GNX A;  3AFQ A;  3CCM A;  1Q81 C;  1EFW A;  4XU2 A;  4GS3 A;  4A3M H;  2JEA I;  1I5F A;  2ZM6 L;  1J5E Q;  2Q7H A;  1TWG H;  5IYB H;  1IBM L;  3GTQ H;  3DLL A;  1KC8 C;  2NN6 G;  3AEV A;  4A3K H;  5M3F G;  4Q15 A;  3K7A H;  4TQU S;  4LFB L;  3RLF A;  2Q2T A;  4BXX G;  3BU2 A;  4X6A H;  3RZO H;  3BZC A;  2V1C C;  2ARU A;  3CPW A;  4DV3 Q;  2UXB L;  3W3S A;  1XNR L;  2BH8 A;  2Q7E A;  1B7Y B;  3D31 A;  2ZNJ A;  2E5L Q;  5M3M H;  1MJE A;  4LFC L;  3U50 C;  3CCE A;  1W66 A;  4XU1 A;  1WQ7 A;  1IBK L;  4LF4 L;  3V7R A;  4DR5 L;  4CH6 A;  4DR6 L;  5DLQ E;  1M90 C;  4BY7 H;  1G6P A;  5KNN A;  3TEH B;  1Q82 C;  3P8V A;  2VQE Q;  2J3M A;  1TWA H;  2K14 A;  1N32 L;  2GVA A;  4H2U A;  5IYC G;  1YZ6 A;  4LUO A;  3S1Q H;  2K52 A;  3V8K A;  4KLK A;  2A8V A;  5GRO A;  1UE6 A;  4OX9 Q;  1FYF A;  1WPY A;  4DKA C;  1QVF A;  4B3M Q;  1NYR A;  2QHU A;  4JBW A;  3RUX A;  3S1R H;  2ZIM A;  3FHW A;  4YRP A;  2CQO A;  3RF1 A;  4CS4 A;  3HOW G;  3RZD H;  3A31 A;  1RIQ A;  2B63 G;  1LUZ A;  1NJ5 A;  4C3H H;  4KR3 A;  4BBS G;  1CKM A;  1N36 L;  1B76 A;  4GKK L;  4EX5 A;  2CJB A;  4DV0 Q;  1YFS A;  3HRK A;  4YRS A;  2DJZ A;  3SGI A;  1GGM A;  4OON A;  4H2W A;  3PO2 G;  1OXU A;  2N49 A;  2ASB A;  3F1Z A;  4ME3 A;  1EIY B;  3PF4 A;  3A5Y A;  3A0J A;  3K81 C;  1PYS B;  1S40 A;  2R92 H;  1AH9 A;  1A8V A;  1KRT A;  3I2Z A;  4PMW A;  1NMF A;  1EIY A;  4A3E H;  3STB C;  4HWR A;  2ODR C;  1PYS A;  3GTK H;  3S1M H;  4A3I H;  3H0G H;  5C0X G;  2ZT6 A;  2DU7 A;  3M7N A;  4GOP C;  1NJI C;  1SET A;  1IYJ B;  3F2D A;  4PZ6 A;  4DAM A;  5FJ8 G;  2E64 A;  1K9M C;  4YYE A;  4DNI A;  2EJG A;  2K5H A;  1VQ7 A;  2IHF A;  1KAW A;  2R93 H;  4GNX C;  1HC7 A;  3PV0 A;  4DV6 L;  2DTI A;  2DGY A;  3I7F A;  1KHI A;  3UE0 A;  1QVG A;  3L2P A;  1JJG A;  3UDX A;  3JAM c;  2RHQ B;  3FP9 A;  1Q1E A;  4YY3 L;  3MF2 A;  1I94 Q;  3CCJ A;  4B3S Q;  2JA6 H;  3F8T A;  1J5E L;  1TXY A;  2YV5 A;  1FGU A;  4L87 A;  1HR0 Q;  4RG1 A;  2RHQ A;  11AS A;  4PZ7 A;  3HY0 A;  4DK6 C;  1QZH A;  3A7R A;  4K86 A;  5C44 H;  2FYK A;  4HWS A;  1AE3 A;  3CC7 A;  1XPO A;  2UXC Q;  2PMF A;  3UFG A;  2DUD A;  2L15 A;  1YB3 A;  1PYB A;  4XTZ A;  2ES2 A;  1Y1W H;  3IRB A;  4DV3 L;  4LFA Q;  2E2H H;  5ELN A;  4JCV E;  4DPG A;  2E5L L;  2LXK A;  1P16 A;  3E9I A;  2VY3 A;  4R4O A;  2CIM A;  4KR2 A;  1NE3 A;  4KQE A;  3CXC A;  2AKW B;  4RQF A;  1S72 A;  1EUJ A;  4CS3 A;  2D0O A;  3M9B A;  1N8R C;  2ZIO A;  3RN2 A;  5F5W A;  4A3C G;  4TQF A;  5AJ3 Q;  4NXM Q;  4YWL A;  3ULL A;  2BA1 A;  4HIK A;  3W5O A;  2VQE L;  1J5W A;  1N34 L;  5M3F H;  2N78 A;  2JEB I;  4AYB E;  4BXX H;  1SN8 A;  3LGJ A;  4B3T Q;  4XTW A;  1E22 A;  3HXU A;  2NN6 I;  4DR2 Q;  3HFZ A;  1WI5 A;  5FLX c;  4YCW A;  1O7I A;  1A62 A;  1Y14 B;  1PH6 A;  1YNX A;  4WJ4 A;  1B8A A;  2ARS A;  1SE8 A;  3RL6 A;  3MXN B;  1HXD A;  2QHT A;  4YRF A;  1HTT A;  3M85 A;  4B3M L;  3L4G A;  1KIX A;  4HA8 A;  4YRC A;  4P71 A;  4FDB A;  2E10 A;  3A7A A;  2JA8 G;  4YCV A;  4TQD A;  1Z47 A;  4UP7 A;  3KF6 B;  4HWP A;  3RIR A;  2ZGW A;  1TWC H;  4X66 Q;  2WAQ G;  4LW1 A;  4JI7 L;  1QZG A;  4YRR A;  1X3F A;  1PVO A;  2HIX A;  5LMN Q;  4YRO A;  4GLX A;  5K36 G;  1D7Q A;  3R07 A;  3LC0 A;  3KF6 A;  1QF6 A;  2JE6 I;  2RCN A;  2VNU D;  4IPG A;  4APV A;  2OQK A;  4LNS A;  4DV0 L;  5IYC H;  4YP0 A;  1NTG A;  3LSQ A;  2AHO B;  1WCM G;  1N33 Q;  4AQY Q;  3FJP A;  4DV7 Q;  2EJ9 A;  3KJP A;  5LMU L;  3CF5 A;  1YJ9 A;  4L5R C;  4C3I H;  1L1O B;  5HY6 A;  4JI0 L;  1YEZ A;  4R4T A;  4JI6 Q;  1Q7Y C;  4A3I G;  3HXY A;  3G4S A;  4XU3 A;  3VQV A;  1OXX K;  1PH7 A;  4CH5 A;  3H3V H;  2OQ0 A;  2WFW A;  1SR3 A;  4XTY A;  1HNZ Q;  2C35 B;  3HOW H;  4YCU A;  2IX1 A;  2K5V A;  4X65 Q;  2B63 H;  3S2H H;  3S17 H;  4NB3 A;  2ZTC A;  4BBS H;  5GAG C;  1UE5 A;  2DTH A;  4JI8 Q;  4C2M H;  1YFR A;  1UEB A;  4GKJ Q;  4JV5 Q;  4QJF A;  2I4O A;  3HXW A;  3PO2 H;  5C4X G;  2KEN A;  1BVS A;  3Q8D A;  4BY1 H;  2Q2I A;  3UH0 A;  3KYH C;  5IWA Q;  4JC0 A;  3KLW A;  4A3J G;  4XEO A;  3CMQ A;  1A0I A;  1YBY A;  1I94 L;  4BBR H;  4B3S L;  3CP0 A;  3HOU G;  1CSP A;  2G4C A;  4JI5 Q;  4IOA A;  2WP8 J;  2PMZ E;  2DXT A;  4RMF A;  1WNL A;  4A3B G;  1VQM A;  1HR0 W;  3GD7 A;  2ZJP A;  3VQW A;  3PUX A;  2UXC L;  3OYY A;  5FJ8 H;  1NJ1 A;  3IG2 A;  4P3O A;  2CFM A;  4LF6 Q;  1BIB A;  4OO1 G;  2UUA Q;  2E2J H;  2UXD Q;  4DR3 Q;  2P5I A;  3ERR A;  2DKG A;  4CH3 A;  2YTV A;  1I50 H;  4TVY A;  4YRM A;  4MTN A;  1XPU A;  2Q5I A;  4EO4 A;  4AIM A;  1G5H A;  4JOI A;  2AWN A;  3PIO A;  3U58 A;  3RR5 A;  3CW2 C;  4IOC A;  2A1A A;  2GN5 A;  4LUZ A;  1MKH A;  4DR1 Q;  4DV1 Q;  1K8A C;  1H95 A;  4JI2 Q;  3CCS A;  1EOV A;  4NXM L;  1VQB A;  1OTC A;  2ZZF A;  1PH9 A;  1E24 A;  4POG A;  2J3L A;  3RKX A;  4X62 Q;  4YRL A;  4B3T L;  5FLM H;  4BA2 I;  1VS0 A;  4A75 A;  4DR2 L;  4C3J H;  1PH5 A;  3PIP A;  2A19 A;  5C4J H;  1YI2 A;  2ZTG A;  4G84 A;  4A3L G;  4P71 C;  1HNW L;  1BKB A;  1SES A;  1TWF H;  2K5N A;  1YJN A;  1B7Y A;  2ZTE A;  3JC6 6;  1X2G A;  1WOC A;  2EL9 A;  2WB1 G;  4P3N A;  1IXR A;  4X66 L;  2JA5 G;  3TS2 A;  2QHV A;  3K8A A;  2E5A A;  2B29 A;  1NBW A;  1DGS A;  3HOV G;  5LMN L;  1UE7 A;  4A3C H;  3RGL A;  4R4Q A;  5LMN W;  3TEH A;  3QO5 A;  2N8N A;  2NZH A;  1V1Q A;  1XTD A;  3J81 j;  2DEQ A;  2Z6K A;  4PHC A;  1VQI A;  4A93 G;  1OXS C;  1HZC A;  1N33 L;  4AQY L;  3KJO A;  1E1O A;  1W3S A;  4DR7 Q;  3HXX A;  3KFU A;  5IE8 A;  2XGT A;  2Q2H A;  2JA7 G;  3REU A;  4A4I A;  2I4N A;  3NEN A;  4XTU A;  3V8L A;  3CC2 A;  2CJA A;  1OXV A;  4NCX A;  2MFI A;  2JA8 H;  1YHQ A;  4HWT A;  1YHA A;  2ART A;  4X65 L;  3NEL A;  3NBH B;  4GLV B;  2ZT8 A;  4TTV A;  4JI8 L;  4GKJ L;  4JV5 L;  4BY1 G;  1EVK A;  3ER0 A;  2Q2U A;  4LF8 Q;  1WCM H;  3ULJ A;  2EAY A;  2NVY H;  1PH4 A;  3PF5 A;  1JB7 A;  1E1T A;  3UDF A;  4XU0 A;  4KI0 A;  5IWA L;  4BBR G;  3E0E A;  4OXP A;  2LXJ A;  4IFD I;  2IX0 A;  4HIM A;  4XEM A;  3RKY A;  2MQH A;  3DM3 A;  1PH8 A;  3HXV A;  4WF2 A;  1HZA A;  1VQ9 A;  4JI5 L;  5JEA J;  2I5H A;  2I0Q A;  1U0L A;  4LF9 Q;  4RDX A;  4GLA C;  1GKH A;  4JI4 Q;  3HY1 A;  4O2D A;  1R9T H;  1Z9F A;  2JQO A;  3JAM i;  2QEX A;  5C3E G;  4DV2 Q;  3WWV A;  4LF6 L;  5C4X H;  3GDE A;  2UUA L;  3OTO Q;  2UXD L;  4DV5 Q;  3J81 c;  4DR3 L;  4JOI C;  5M5X H;  1BIA A;  2ZCE A;  4YRK A;  4JYA Q;  2NZO A;  1FJG Q;  4A3J H;  1SER A;  1C7Y A;  3RLN A;  1G5I A;  3S14 H;  2NVT H;  1S3O A;  5BR8 Q;  3ULP A;  2CCZ A;  2WAQ E;  3HOU H;  1H4Q A;  2KHI A;  4UY8 C;  4DR1 L;  3RN5 A;  4DV1 L;  1XNQ Q;  4OWW B;  2ZR2 A;  4A3B H;  4JG2 A;  5FLM G;  5IT9 c;  4UP8 A;  4TWA A;  1VQN A;  2DTO A;  2HHH Q;  1HZB A;  1X2H A;  3A7U A;  2ZXF A;  3RAC A;  1GO3 E;  1YHB A;  3UGQ A;  1KRS A;  4P75 C;  4P3P A;  4K0K Q;  3A74 A;  1NJ6 A;  4NXN Q;  2NVQ H;  3EFR A;  3CCR A;  3F2B A;  2P0L A;  2I5M X;  3IKM B;  1LTL A;  4XTC S;  4X64 Q;  1ASZ A;  3REX A;  4JI3 Q;  4QIW E;  5J3B A;  3OD1 A;  2KCM A;  1HH2 P;  3UDI A;  1PA6 A;  1FL0 A;  4PG3 A;  3GTO H;  1Z7N A;  1FVI A;  2AKW A;  5GAD C;  2K50 A;  3PO3 G;  2Z6K C;  3DSQ A;  1SLJ A;  2DQ3 A;  4IJL A;  4LFB Q;  1WQW A;  3CPF A;  3P8Y A;  3TRZ A;  3HOY G;  2QA4 A;  5JJL A;  1VQC A;  4OX9 L;  4JI1 Q;  4DR7 L;  5GAE C;  2ZZE A;  4DV4 Q;  2R7Z G;  2AMC B;  4A3L H;  3AQQ A;  2CJ9 A;  3RLO A;  2DZC A;  3L0O A;  1K73 C;  4E51 A;  3PUW A;  3H15 A;  4YHH Q;  4JBK A;  2D62 A;  1T9H A;  4PZ8 A;  2AMC A;  2ID0 A;  4BA1 I;  5K1X A;  2JA5 H;  1X6O A;  3HOZ G;  5K1P A;  1VQZ A;  3LSS A;  2PI2 A;  1MJC A;  4LWC A;  5C52 B;  1YIJ A;  3HOV H;  2YU9 H;  4RQE A;  1L0W A;  1ADJ A;  2ZNI A;  3PUV A;  4BW9 A;  1N32 Q;  1E3P A;  3A5U A;  4TVA B;  4GN4 B;  5E3I A;  3IAL A;  1U5K A;  1BBU A;  2EQS A;  3IKL A;  1X56 A;  1M1K C;  1Q12 A;  3UE1 A;  4A93 H;  1EQQ A;  4QGU A;  1JJ2 A;  1PFS A;  1VQL A;  3I4M G;  1B70 B;  2K75 A;  2MO0 A;  2EXD A;  3RKW A;  2JA7 H;  2CWA A;  2DVE A;  4KHP Q;  1EIF A;  1L1O A;  1NMG A;  5C53 B;  1PH3 A;  1B70 A;  4K87 A;  1HJP A;  1C9O A;  4XIG S;  3HOX G;  1Q46 A;  4IPD A;  2Q5H A;  3H3V I;  3HKZ G;  5HGQ A;  1D8L A;  2I4L A;  4LF9 L;  2DU5 A;  3M4O H;  3VDY A;  1XMO Q;  5JJI A;  3V7S A;  1VQ6 A;  4JI4 L;  1N36 Q;  1VQG A;  1K8G A;  4YRI A;  2R7F A;  4HJ8 A;  3F2C A;  2F52 A;  2I5L X;  5M5Y H;  1WJJ A;  3I4N G;  2ZZG A;  4IFD J;  2ZR3 A;  3J80 c;  4DV5 L;  3M4P A;  1VQE A;  1I6H H;  2HQL A;  4YRN A;  4HJ9 A;  4H2Y A;  3STB D;  4G85 A;  1L2F A;  1H4V B;  3M3Y H;  1AE2 A;  2VQF Q;  2HT1 A;  4QL5 A;  2DXU A;  2UUC Q;  4LF5 Q;  5JJK A;  2WB1 E;  2PME A;  4Y52 H;  1X54 A;  1HR0 L;  5BR8 L;  1X01 A;  4P74 A;  4YRG A;  3J7Z C;  5ELO A;  2KCT A;  2KHJ A;  1XNQ L;  2EJF A;  3V7C A;  1NYQ A;  1VQ4 A;  2I4M A;  3CC4 A;  4YRT A;  5C0X I;  2ATW A;  1VQ8 A;  4H2T A;  4LFA L;  5EAY A;  4OP0 A;  4HID A;  1X3G A;  5C3E H;  4DR4 Q;  3G6E A;  4GNX B;  1ASY A;  2VS1 A;  4K0K L;  2HNI A;  4NXN L;  2UU9 Q;  1JT8 A;  4UPA A;  4JBM A;  3VQX A;  4L5S A;  4LF7 Q;  3GO5 A;  1EYG A;  4JI3 L;  1YIT A;  4GN5 A;  2CWP A;  3GTG H;  3PSI A;  1KL9 A;  4YY3 Q;  2DZ9 A;  5AJ3 L;  3I56 A;  1VQA A;  5E7N A;  1SFO H;  4NPS A;  4LUV A;  1NNH A;  1IZ6 A;  1N9W A;  1QUQ B;  1RL2 A;  4J15 A;  3CME A;  3A32 A;  3HTZ A;  3KF8 B;  3G48 A;  1Q1B A;  2FXQ A;  1Z7M A;  1QUQ A;  2DQ0 A;  4DQ2 A;  4JI1 L;  1HNX Q;  2QHS A;  2D0P A;  4DV4 L;  4ZTZ B;  2C7I A;  4B3R Q;  4KHZ A;  4P75 A;  4L5Q A;  2EWN A;  4QQB X;  4QY7 A;  5IYD G;  2F4V Q;  3HXZ A;  2HIV A;  3QO8 A;  4YHH L;  1MIU A;  2ZJQ A;  4DUY Q;  4YRE A;  2LSS A;  1X9N A;  1PH2 A;  3CCU A;  4MZ9 A;  1E7Z A;  2ZT7 A;  1V9P A;  2ZIN A;  3PO3 H;  1QVC A;  3CCQ A;  1EQR A;  1N34 Q;  3TRE A;  3ERS X;  4DV7 L;  3I55 A;  2XTI A;  3HOY H;  3PGZ A;  2UUB Q;  2R7D A;  5IY0 A;  3E9H A;  3WQZ A;  4HJ7 A;  1P8L A;  2JA9 A;  2IHE A;  1L1O C;  1CKO A;  2R7Z H;  1A63 A;  4IJH A;  4H2V A;  4JI6 L;  1J6Q A;  4Y7N H;  4ZIB A;  4YWM A;  3V8J A;  4KHP L;  1HNZ L;  2F3I A;  1H4T A;  3B6Y A;  3S16 H;  2KBN A;  4R4C A;  4HIO A;  2B3G A;  4JI7 Q;  3HOZ H;  1KMM A;  5JEA G;  4BWA A;  3TS0 A;  5IP7 G;  1K83 H;  3A5Z B;  1XMO L;  4MNO A;  2YTY A;  3S1N H;  1UWV A;  2AWO A;  3T1Y Q;  4H2S A;  3A5Z A;  4K88 A;  2JK8 A;  3CCL A;  4A3F G;  2R6G A;  5GQO A;  2ZJR A;  1JJC B;  4P73 A;  5IP9 G;  3I4M H;  5LMU Q;  4P74 C;  1KMN A;  1BBW A;  4JI0 Q;  1JMC A;  2VQF L;  1IBL Q;  2UUC L;  4LF5 L;  1JJC A;  3T1H Q;  3U4V A;  2OTL A;  3L7Z C;  4HVC A;  2C8M A;  1HZ9 A;  4A76 A;  3HOX H;  3HRI A;  1LYL A;  4CS2 A;  1Y1V G;  1QE0 A;  1G29 1;  3CQZ H;  1GD7 A;  4LNQ A;  3J81 i;  1V43 A;  1XMQ Q;  1ADY A;  3RNU A;  1Q8K A;  2QGQ A;  2ZTD A;  2RF4 A;  4A3G G;  1VQ5 A;  1VQH A;  3TQY A;  2JJQ A;  1YJW A;  4XTX A;  4TVW A;  3S2D H;  3GTJ H;  1VQJ A;  4DR4 L;  3FKI G;  3I4N H;  3I4O A;  1VQD A;  1GVP A;  2VUM H;  3PUY A;  1WLE A;  2K4K A;  2UU9 L;  4P72 A;  4A3D H;  4A3M G;  4LF7 L;  3CAM A;  3UDG A;  3NEM A;  3ICE A;  2E8G A;  2IY5 B;  3D0F A;  2CGH A;  4O0A A;  4YRQ A;  3BZK A;  5IYB G;  5C0X J;  4ALP A;  1SRU A;  4DUZ Q;  4JI2 L;  1USY A;  1JE5 A;  4A3K G;  2IY5 A;  2E1H A;  2BH2 A;  2VZA A;  1KD1 C;  3K80 C;  4X62 L;  1I3Q H;  4YPF A;  3ZJY C;  1EWI A;  4X5O A;  3BJU A;  4AH6 A;  3L2Z A;  3GTL H;  4YWK A; 
#chains in the Genus database with same CATH topology
 1HNX L;  5M3M G;  3UGT A;  1EIG A;  3BFM A;  2RVL A;  5KIX A;  4B3R L;  1CQV A;  2NVY B;  1PHJ A;  4DK3 C;  1LM0 A;  4OO1 I;  5C51 B;  2IW3 A;  3NET A;  2F4V L;  2PCF B;  3E6Z X;  1EVL A;  1YFT A;  2ZM6 Q;  5M5W H;  4R4I A;  2YTX A;  2E65 A;  1T5X D;  4DUY L;  1AZQ A;  3AYH B;  3PCO B;  4WFN 3;  1VCI A;  2ALY B;  2KED A;  3H94 A;  4RKL A;  1IBM Q;  4QIW B;  4A3I B;  3EBE A;  4ABN A;  4BY7 G;  3QTC A;  4IAL A;  4OLF A;  2L11 A;  2E2I H;  2TSS A;  1KQS A;  1DOL A;  1IW7 D;  5I6Y A;  4ZTU B;  1X65 A;  3AFP A;  4YIJ A;  3HKZ E;  4OWX B;  4ZYS A;  4YRJ A;  3VQY A;  2Z0S A;  1KXL A;  3BG3 A;  1FNW A;  1XPR A;  3AU7 A;  4RHR A;  3PCO A;  2PQA B;  2ALY A;  3K7U C;  4OWT B;  2SOB A;  1VQO A;  3EVQ A;  5JOB A;  2NN6 H;  2L9H A;  3HFZ B;  4HTH A;  4AYB B;  5DM6 3;  2OTJ A;  4CDC C;  3G1Z A;  2N3S A;  3I3C A;  2ICE C;  2G5D A;  1BXT A;  2MO1 A;  3I72 A;  3HKS A;  4IPC A;  5I9P A;  2KVM A;  2UXB Q;  1QNK A;  2EIF A;  1XNR Q;  2NVX H;  1OXT A;  2UUB L;  12AS A;  3MEY A;  1STA A;  2PQA A;  5D3D A;  2DDZ A;  3VA5 A;  2E3C A;  5H1S E;  2VW9 A;  1CSQ A;  3U4Z A;  2CH4 W;  3GTP H;  3L4G B;  2F0P A;  5C4Z A;  4CH4 A;  3J7A V;  1EY0 A;  4LFC Q;  1HNW Q;  2NTT A;  5C4X B;  1CHQ D;  4EVO A;  4JBJ A;  1SYF A;  2PI2 E;  3QO7 A;  4LMQ D;  2F0D A;  3VYU A;  1IL2 A;  3HEJ A;  5IYD H;  1IBK Q;  4LF4 Q;  3BDC A;  3QNE A;  4X3T A;  1EYA A;  1X55 A;  4LVM A;  3MEF A;  3S24 A;  4IO9 A;  2B2Y C;  5GAH C;  4DR5 Q;  3KDF B;  1HXY D;  1TWH H;  3W1B A;  4R1J A;  4A3J B;  2OWO A;  4XTV A;  5I9O A;  3CMA A;  1NJ8 A;  4DR6 Q;  1SRY A;  3D6W A;  5A35 A;  4C3H G;  1WU7 A;  2DY7 A;  3S14 B;  3R2I A;  2A68 C;  4CDF C;  4WI1 A;  3DMU A;  3KDF A;  1I4H A;  2WIN B;  5C44 B;  3ERO A;  4H02 A;  2Y0S E;  1X3E A;  1S5C D;  4P73 C;  4KKU A;  2K6A A;  3NXW A;  3T1Y L;  4A3B B;  2KA7 A;  4LF8 L;  1KOG A;  1NY4 A;  1EWH A;  2RHS B;  3LX0 A;  2ZT9 C;  2OCE A;  1Y1W B;  3FDT A;  3QOJ A;  2FIN B;  1YVC A;  2Q7G A;  3L1A A;  2O5I C;  4TVA A;  2XRS D;  3R8B A;  1XJV A;  1B9N A;  2X6G A;  4NW2 A;  1E0B A;  4EQ5 A;  2R92 G;  3PUZ A;  2E2H B;  4IFD G;  3J7A F;  2VL6 A;  3BVM A;  1U4L A;  4HJ5 A;  2ICI A;  3SXH A;  3VBB A;  2NUC A;  2H5X A;  1ATI A;  1CKN B;  4CJ1 B;  2RHS A;  3TEG A;  3J81 L;  3PQI A;  1JC7 A;  4A3E G;  3G6J B;  2NVQ B;  4Q6G A;  2A8E A;  3HFV A;  3CD6 A;  2MJ8 A;  1XX8 A;  1ZXT A;  5IT9 E;  1IBL L;  2K03 A;  4RH6 A;  1UUP A;  3T1H L;  3H0G G;  2F0F A;  1YNJ D;  1UE1 A;  3BVG A;  5E1F A;  1Q90 A;  1L0Y B;  3GTM H;  3A7L A;  4HN7 A;  1CKN A;  1G51 A;  3PIO 3;  2QDB A;  3M4Q A;  2LFN A;  4DAY B;  1FR3 A;  3PZC A;  3J80 i;  3GTO B;  2K1B A;  5CGK A;  4ZCK A;  4EQN A;  3OW2 A;  5JEA H;  5CYU A;  3EN2 A;  4GKK Q;  4AYB G;  4HJA A;  1XMQ L;  5IP7 H;  3TUP A;  1WTH A;  3C2P A;  3L9A X;  1RIP A;  5JVH 3;  4RGM A;  3QWN A;  3VYT A;  5FO8 B;  5IGG A;  4YDQ A;  4DV2 L;  4TSS A;  2B2U A;  3K0X A;  2R93 G;  4DAY A;  2RBM A;  5IT9 L;  3MF1 A;  2I46 A;  2PNH A;  4P72 C;  1PMR A;  3CCV A;  3J7A 5;  2VUM G;  3OTO L;  1NJ2 A;  3K5O A;  1PV4 A;  1Q86 C;  1SMX A;  4A3D G;  3P8T A;  4L6T B;  3C46 A;  3KOJ A;  4IPH A;  4A3F H;  1GUS A;  3KBG A;  4JYA L;  2ODR D;  1FJG L;  4H2X B;  3S15 H;  3KLR A;  4MTK A;  1B1Z A;  5IP9 H;  2WII B;  2CW0 D;  2Z9H A;  3X3N A;  1H4S A;  4UAI A;  3EIV A;  4C56 C;  4XQQ A;  1USY C;  1K0R A;  2ZT5 A;  2MHV A;  2IT1 A;  1KAA A;  2CKZ B;  3MC0 B;  2JA6 G;  1M8A A;  4X3K A;  3DUZ A;  4POF A;  3CRK C;  4H2X A;  1V1O A;  3HS0 C;  1K8O A;  1YGB A;  2E41 A;  1C0A A;  2AUK A;  4UP9 A;  4WJ3 M;  3K5M A;  2Z4H A;  4DUZ L;  2MNA A;  3MFY A;  4F88 A;  4GOP B;  4F7X A;  1U4P A;  2WB1 B;  1Y1V H;  5C44 G;  1CUK A;  2Y0S G;  4L5T A;  4HWO A;  3TME A;  1GM5 A;  3OIP A;  1VQK A;  2HHH L;  1W2B A;  4GZY C;  1VQF A;  4GN3 B;  1FGB D;  1MD2 D;  1B3A A;  1WFQ A;  1K3R A;  4GOP A;  1Y1W G;  3EFS A;  1SRO A;  5EJW A;  1OO9 B;  2BA0 A;  4A3G H;  4B9X A;  4RCO A;  1EU4 A;  1WYD A;  3G71 A;  1LT4 D;  2GVB A;  1PH1 A;  2YYZ A;  1VQP A;  3W1G A;  2F3V A;  2JP1 A;  2PW5 A;  4LK1 C;  4DV6 Q;  4FO2 A;  3FKI H;  4NP5 A;  1RTN A;  3EQL C;  4X64 L;  4A93 B;  1WTX A;  3ICA A;  3VYR A;  1S5F D;  4GNX A;  3KK7 A;  2F0T A;  3K57 A;  5FO7 B;  4BS9 A;  5COR A;  1BF4 A;  3AFQ A;  3DWA A;  3CCM A;  1Q81 C;  1EFW A;  4XU2 A;  4I65 A;  3TSS A;  4GS3 A;  1TVX A;  3VYS A;  4A3M H;  2JEA I;  1I5F A;  4DA2 A;  2ZM6 L;  3V2T A;  2JA7 B;  4ZLT F;  1J5E Q;  1KTK A;  1EY5 A;  4QUF A;  2Q7H A;  1TWG H;  2FJ2 A;  3QIA A;  1JQY D;  2PZT A;  5IYB H;  1IBM L;  2F0Q A;  1BCP D;  3GTQ H;  3DLL A;  3K58 A;  1KC8 C;  2NN6 G;  3AEV A;  4A3K H;  5M3F G;  4Q15 A;  3K7A H;  1WD1 A;  4WOR A;  4TQU S;  4LFB L;  4LVL A;  3S2H B;  1CT1 D;  3S17 B;  3RLF A;  2K05 A;  2Q2T A;  5KYI A;  1TS2 A;  4BXX G;  4BBS B;  3BU2 A;  4X6A H;  3RZO H;  1GUW A;  3BZC A;  4P2C B;  3TP8 A;  3D4R A;  1M4V A;  2V1C C;  2ARU A;  3P1H A;  3CPW A;  1H9J A;  4DV3 Q;  2UXB L;  3W3S A;  1XNR L;  2BH8 A;  2DNE A;  2O5J C;  1QB5 D;  1A2T A;  2Q7E A;  1B7Y B;  3D31 A;  4IZ8 A;  4BY1 B;  2ZNJ A;  2E5L Q;  5M3M H;  1LTR D;  2RQX A;  1MJE A;  4XT1 B;  4LFC L;  3U50 C;  3N6R A;  1V1P A;  3CCE A;  1W66 A;  4LVJ A;  4XU1 A;  1WQ7 A;  1IBK L;  4LF4 L;  3V7R A;  1SE4 A;  2XNA C;  3M3Y B;  5ELD A;  4QCL A;  1ONL A;  4DR5 L;  4CH6 A;  4BBR B;  1BCP F;  3TZD A;  4DR6 L;  5DLQ E;  4K2K A;  1CK1 A;  1M90 C;  4BY7 H;  1G6P A;  2H1E A;  3TEH B;  5KNN A;  2KCN A;  1Q82 C;  3P8V A;  3TBI B;  2VQE Q;  2J3M A;  1TWA H;  1U4R A;  1CTM A;  4FYD A;  2K14 A;  1N32 L;  2GVA A;  4H2U A;  5IYC G;  1YZ6 A;  1HFN A;  1JWM D;  4LUO A;  3S1Q H;  4E6I A;  2K52 A;  3V8K A;  2D5D A;  1TY2 A;  1R4P B;  4KLK A;  3SK6 A;  3IAY A;  1FD7 D;  2A8V A;  3MQZ A;  3RUZ A;  1VMP A;  5GRO A;  1UE6 A;  3VR2 A;  4C3I G;  4OX9 Q;  2E2J B;  1HUM A;  2MGS A;  2XVS A;  1FYF A;  1WPY A;  1T5E A;  3KUP A;  4DKA C;  5C3E B;  4M1U B;  1QVF A;  4B3M Q;  3X3M A;  1NYR A;  2EY2 A;  2QHU A;  2F3W A;  1EQT A;  3OHX C;  4DF7 A;  4JBW A;  2E74 C;  3RUX A;  3S1R H;  1PRT B;  2ZIM A;  2G9H D;  2K5D A;  3FHW A;  1PTO D;  4YRP A;  2WKD A;  4B08 A;  1HQR D;  2CQO A;  3RF1 A;  1JWU D;  4HR7 B;  3ND8 A;  4CS4 A;  3HOW G;  1DXM A;  2HDM A;  3RZD H;  3A31 A;  1RIQ A;  5D3I B;  1HQM C;  2KEE A;  2B63 G;  1LUZ A;  2D9U A;  1NJ5 A;  4C3H H;  1PTO B;  4KKS A;  1NCV A;  5KEE A;  2B2U C;  4KR3 A;  2L55 A;  4BBS G;  1CKM A;  1N36 L;  5FOB B;  1B76 A;  4GKK L;  1LV9 A;  1YNJ C;  4EX5 A;  5CV5 A;  1HCZ A;  4IUT A;  1AFP A;  4DV0 Q;  2CJB A;  1YFS A;  1EYD A;  3HRK A;  4YRS A;  2DJZ A;  1CI3 M;  3SGI A;  1GGM A;  4NDX A;  4OON A;  3T51 B;  2M2L A;  4H2W A;  5JVG 3;  1LT6 D;  1Q8I A;  3PO2 G;  1X3P A;  1OXU A;  2N49 A;  3NQI A;  4L63 B;  2ASB A;  5C3X A;  4H44 C;  1WTQ A;  3F1Z A;  4ME3 A;  5ELC A;  2DJG C;  1EIY B;  4C3J B;  3PF4 A;  1YNN D;  1QG7 A;  5C4J B;  3A5Y A;  4RHS A;  3A0J A;  3K81 C;  5ELB A;  3SR1 A;  1PYS B;  3Q24 A;  1S40 A;  2A69 D;  2R92 H;  1AH9 A;  1A8V A;  4DK0 A;  4IFD H;  1KRT A;  3VR6 A;  1TWF B;  3I2Z A;  4R8N A;  3P20 A;  4PMW A;  2Q8R E;  1NMF A;  1EIY A;  1PTO F;  4A3E H;  5BN3 A;  5EGT A;  3STB C;  4IUR A;  4HWR A;  3MVV A;  2ODR C;  1JOR A;  1PYS A;  4K8J A;  3GTK H;  5EPK A;  3S1M H;  1JOO A;  4A3I H;  3H0G H;  2CW0 C;  4HAE A;  5C0X G;  2ZT6 A;  2DU7 A;  4CKC A;  3M7N A;  1I4R A;  1LTG D;  5AFW A;  3NWT A;  1LTS D;  2XWB B;  4GOP C;  1NJI C;  3EA6 A;  1SET A;  1IYJ B;  1TS4 A;  3F2D A;  5IGC A;  3CKI B;  1TT2 A;  4JK1 C;  3LWE A;  4MIU A;  5ELF A;  2L0C A;  4PZ6 A;  4EGV A;  4DAM A;  5FJ8 G;  2E64 A;  1K9M C;  4YYE A;  4DNI A;  2EJG A;  3MTS A;  4FXG C;  2K5H A;  3D6C A;  5FKA C;  2D2C C;  4FF4 A;  1VQ7 A;  2IHF A;  3FPP A;  1KAW A;  2R93 H;  4GNX C;  4XDX A;  2EXZ A;  1FYC A;  2K7V A;  1HC7 A;  1A3V A;  1RF2 D;  3PV0 A;  4X3S A;  4DV6 L;  3HOY B;  4ZUJ A;  2DTI A;  2DGY A;  2KOL A;  3I7F A;  1D5M C;  1S5D D;  1KHI A;  4CGY B;  1O80 A;  3UE0 A;  2OXP A;  4ODG A;  1QVG A;  3L2P A;  1JJG A;  2EDG A;  3UDX A;  2R7Z B;  3JAM c;  2RHQ B;  3K0Y A;  3FP9 A;  1Q1E A;  4YY3 L;  3MF2 A;  5BN5 A;  1UEA B;  3OMC A;  1I94 Q;  3CCJ A;  4B3S Q;  2SEB D;  4Y7N B;  3DXJ C;  3F8T A;  1J5E L;  1TXY A;  2JA6 H;  2YV5 A;  3H3V C;  1PYW D;  1FGU A;  4L87 A;  2F1M A;  1HR0 Q;  2WAQ B;  4RG1 A;  2RHQ A;  1ZYR C;  11AS A;  4PZ7 A;  3HY0 A;  1O7Y A;  4DK6 C;  2ZXR A;  3LNN A;  1QZH A;  3A7R A;  4K86 A;  5C44 H;  2FYK A;  4HWS A;  3HOZ B;  1AE3 A;  1EY7 A;  3CC7 A;  1XPO A;  2UXC Q;  2PMF A;  1K83 B;  1PZK D;  2DUD A;  2L15 A;  1YB3 A;  1PYB A;  4XTZ A;  3UFG A;  2ES2 A;  4C3J G;  1Y1W H;  2F0S A;  3T53 B;  1O78 A;  2QF7 A;  3IRB A;  4DV3 L;  5G3L D;  4LFA Q;  1SJE D;  1WCM B;  1B9M A;  1SJH D;  2M9V A;  1DOK A;  2E2H H;  4KK7 A;  5ELN A;  4JCV E;  4DPG A;  2E5L L;  2LXK A;  5A2Q L;  1P16 A;  1BDO A;  3E9I A;  2VY3 A;  1NAP A;  1K0S A;  3Q22 A;  1VDZ A;  4R4O A;  2CIM A;  1D1K A;  4KR2 A;  3I4M B;  1NE3 A;  4KQE A;  3G7L A;  1LT3 D;  3CXC A;  5KNC A;  2O2L D;  2AKW B;  1IHZ A;  4RQF A;  1S72 A;  5KNB A;  4B9W A;  4ZRZ A;  1EUJ A;  4CS3 A;  2D0O A;  3M9B A;  1N8R C;  1ILQ A;  2ZIO A;  2FMM A;  3MEH A;  1STB A;  3RN2 A;  2KEC A;  5F5W A;  2PO4 A;  1PZJ D;  1GHJ A;  4A3C G;  5AJ3 Q;  4TQF A;  3FVQ A;  4NXM Q;  2BCO A;  4YWL A;  3H09 A;  3ULL A;  2M00 A;  2BA1 A;  5COY A;  3EJI A;  4HIK A;  3BDO A;  3W5O A;  2VQE L;  1J5W A;  3I70 A;  1N34 L;  2QEJ C;  4R8I A;  2N78 A;  3U9S A;  5M3F H;  2F03 A;  2JEB I;  3MXU A;  3NSW A;  4AYB E;  3CQZ B;  5CC4 A;  4BXX H;  3HKZ B;  2BOS A;  3QB3 A;  4XYQ A;  1R9T B;  1SN8 A;  3BYT B;  2VB2 X;  2SNM A;  3LGJ A;  4IUV A;  4B3T Q;  4XTW A;  5EPJ A;  1E22 A;  2Z8L A;  3SHL A;  4QB4 A;  3HXU A;  2KHS A;  2NN6 I;  4DR2 Q;  5G3L F;  3HFZ A;  3OMG A;  1WI5 A;  3PMF A;  2R61 A;  5EQ0 A;  5FLX c;  2EOT A;  1CFM A;  3A7A B;  1O7I A;  1A62 A;  1Y14 B;  4YCW A;  5EKK A;  1PH6 A;  1MSG A;  1YNX A;  4WJ4 A;  2AQ2 B;  1B8A A;  3S2D B;  4FF3 A;  2ARS A;  4KD3 A;  1SE8 A;  5M5X B;  2RA4 A;  3MXN B;  3GTJ B;  1HXD A;  1R4Q B;  2QHT A;  3RL6 A;  4YRF A;  1HTT A;  3NWS A;  3M85 A;  2L5T A;  3I4N B;  4B3M L;  1EYC A;  3NPP A;  1KLU D;  1D2B A;  3EFX D;  3L4G A;  1KIX A;  4RGT A;  4HA8 A;  4YRC A;  4P71 A;  1I4Q A;  5JAV A;  1PRT C;  4FDB A;  2E10 A;  2JA8 G;  3A55 A;  3A7A A;  4YCV A;  4TQD A;  1Z47 A;  4UP7 A;  3KF6 B;  1DCZ A;  4HWP A;  3RIR A;  1STN A;  2ZGW A;  1TWC H;  3C1E A;  4X66 Q;  2WAQ G;  3MXN A;  4LW1 A;  2NVT B;  4JI7 L;  4PV1 C;  1QZG A;  4YRR A;  4CKE A;  1X3F A;  3HOU B;  1PVO A;  2HIX A;  5LMN Q;  4YRO A;  1LO5 D;  4GLX A;  4HSV A;  5K36 G;  1D7Q A;  3R07 A;  3LC0 A;  4H7B A;  3D3R A;  1PLF A;  2A73 B;  3KF6 A;  1QF6 A;  2JE6 I;  2RCN A;  2VNU D;  4ZQ3 A;  4HCS A;  4IPG A;  4APV A;  2OQK A;  4HT4 A;  1GUO A;  4LNS A;  3HRZ C;  4DV0 L;  2XRQ D;  2CQA A;  3NUC A;  5IYC H;  1NTG A;  4HCE A;  4YP0 A;  3LSQ A;  4RFB A;  2AHO B;  1WTR A;  1D5Z C;  2PNR C;  2NTS A;  1WTP A;  2K28 A;  1WCM G;  1N33 Q;  4AQY Q;  4V0B A;  1I3Q B;  5CR3 A;  3FJP A;  4PQX A;  4DV7 Q;  2EJ9 A;  3SEB A;  3JAM E;  2WAC A;  3KJP A;  5LMU L;  3C3L A;  3CF5 A;  3S9W A;  1YJ9 A;  4L5R C;  1JOK A;  3QJY A;  4C3I H;  3MZ5 A;  1ILP A;  3T16 A;  2QW7 A;  3CU7 A;  1L1O B;  5HY6 A;  4JI0 L;  1YEZ A;  4N9T A;  4R4T A;  2IPK D;  3I4L A;  4JI6 Q;  1Q7Y C;  4A3I G;  1SNM A;  4DAP A;  3HXY A;  1YNN C;  2EPB A;  1W6J A;  3G4S A;  5LHY 1;  1EQV A;  4XU3 A;  4C1N K;  3VQV A;  1OXX K;  1PH7 A;  4CH5 A;  3H3V H;  2A69 C;  3V96 A;  2EY1 A;  2OQ0 A;  2WFW A;  1XWE A;  1SR3 A;  4XTY A;  1HNZ Q;  1KLG D;  2C35 B;  3HOW H;  2Z1C A;  4YCU A;  5TSS A;  5M5W B;  2IX1 A;  4I7A A;  2EJG C;  2K5V A;  3SK5 A;  4X65 Q;  2B63 H;  3S2H H;  2B8G A;  3S17 H;  4NB3 A;  1BBX C;  1RD9 D;  2ZTC A;  2E2I B;  4BBS H;  5GAG C;  3MXP A;  3SVM A;  1UE5 A;  2DTH A;  5IOC A;  4JI8 Q;  4K6L A;  4NMZ A;  4C2M H;  3BVZ A;  1YFR A;  1UEB A;  1CA5 A;  5JPM C;  4GKJ Q;  4JV5 Q;  1KAB A;  4QJF A;  1VMC A;  3E5S A;  2I4O A;  3HXW A;  3OIQ A;  1EOT A;  4X3U A;  1EY6 A;  5JPN C;  1D5X C;  5C5M A;  1BQQ T;  3PO2 H;  5K5P A;  1WVL A;  5C4X G;  1MGS A;  2KEN A;  1BVS A;  1MSH A;  4ULL A;  3HGB A;  3Q8D A;  4BY1 H;  2Q2I A;  3UH0 A;  5T1G A;  3SDZ A;  3KYH C;  4HED A;  1SMY C;  2A6E D;  5IWA Q;  3L3O C;  4IUQ A;  2J0T D;  4JC0 A;  3KLW A;  4A3J G;  1FNV A;  1F9R A;  3TZU A;  4JVZ A;  4XEO A;  3GTP B;  3CMQ A;  2Z6B A;  4KV6 A;  1A0I A;  1YBY A;  1C4Q A;  1I94 L;  4BBR H;  4CJ0 B;  1S5E D;  1C8C A;  4B3S L;  1NSN S;  3CP0 A;  3HOU G;  1CSP A;  2G4C A;  4JI5 Q;  4IOA A;  2JA5 B;  2MP1 A;  2WP8 J;  1TWH B;  2PMZ E;  1F2L A;  5J1Z A;  5C0X H;  1G6Z A;  4RMF A;  1WNL A;  4A3B G;  2DXT A;  3MA2 B;  1TR5 A;  1VQM A;  3HOV B;  2YU9 B;  1F9S A;  1HR0 W;  5FLX E;  3MFG A;  3Q23 A;  3GD7 A;  2ZJP A;  4IQZ A;  1O7L A;  3VQW A;  2EJM A;  3PUX A;  2UXC L;  3OYY A;  3CHB D;  3OSO A;  4K6D A;  5FJ8 H;  1NJ1 A;  3IG2 A;  4P3O A;  1DZ1 A;  1ML0 D;  2FHT A;  3T56 B;  2CFM A;  4LF6 Q;  1BIB A;  4OO1 G;  2UUA Q;  3FPU B;  4FNF A;  2E2J H;  2UXD Q;  2OF1 A;  4DR3 Q;  2P5I A;  2VB3 X;  2DKG A;  3ERR A;  1CZW A;  4WRD A;  4CH3 A;  4ZUI A;  2YTV A;  1I50 H;  4TVY A;  4YRM A;  1DM0 B;  4G7Z C;  1Y69 U;  4MTN A;  3E3X A;  2HD3 A;  1XPU A;  2Q5I A;  1ICW A;  4EO4 A;  4AIM A;  3NTK A;  1G5H A;  2CVR A;  1IYV A;  3NE5 B;  1MBY A;  4JOI A;  2AWN A;  3PIO A;  4OIJ A;  3U58 A;  2JXM B;  3AMU A;  3RR5 A;  1F9Q A;  1D1I A;  3CW2 C;  2K32 A;  2ZXO A;  4IOC A;  2A1A A;  2GN5 A;  3FEW X;  4LUZ A;  1MKH A;  4DR1 Q;  2ENB A;  2C5C A;  4DV1 Q;  2F0K A;  1K8A C;  1SBB B;  1H95 A;  4JI2 Q;  3CCS A;  1ENA A;  1EOV A;  4NXM L;  2F0N A;  1GOZ A;  1HPC A;  1BCP B;  2CHB D;  1VQB A;  1G2S A;  3M4O B;  4ID6 A;  1Z6H A;  1IW7 C;  4IUU A;  1OTC A;  2FMC A;  2ZZF A;  1PH9 A;  1E24 A;  1I6V C;  2K5W A;  4POG A;  2F0I A;  2J3L A;  4DU9 A;  1SNP A;  3VA7 A;  3RKX A;  1BOS A;  3A54 A;  4X62 Q;  5D65 A;  4YRL A;  4B3T L;  1SEB D;  2G9D A;  5FLM H;  5ELE A;  4BA2 I;  1NUC A;  1VS0 A;  4RAU C;  1HA6 A;  4A75 A;  4DR2 L;  2L4N A;  3QOL A;  4C3J H;  3PIP A;  1PH5 A;  2A19 A;  5C4J H;  1YI2 A;  5M5Y B;  1KDA A;  2ZTG A;  4G84 A;  4HMI A;  4A3L G;  1A3T A;  4P71 C;  1XYI A;  1HNW L;  1BKB A;  1PFN A;  4JW0 A;  1SES A;  1I6H B;  1EZ6 A;  1TWF H;  2K5N A;  5DNF A;  1BUV T;  1YJN A;  2E76 C;  1HHV A;  3P75 A;  3DWQ A;  5J22 A;  1B7Y A;  2ZTE A;  2I07 B;  3JC6 6;  1X2G A;  2DN8 A;  2JN4 A;  1WOC A;  2EL9 A;  4CJ2 C;  2WB1 G;  3WDN A;  1WTO A;  5EBD A;  4P3N A;  1I4X A;  1IXR A;  4X66 L;  3A56 A;  2JA5 G;  3TS2 A;  4ZK9 B;  2QHV A;  3K8A A;  1STY A;  2E5A A;  3IFD A;  2B29 A;  2DY8 A;  1NBW A;  1DGS A;  3HOV G;  5LMN L;  4TRD A;  1ICF B;  1UE7 A;  1RDP D;  4A3C H;  1RCV D;  3RGL A;  4R4Q A;  5LMN W;  3TEH A;  1LTA D;  3QO5 A;  1SE3 A;  1Y1V B;  2BDN A;  2N8N A;  1K28 A;  1NNX A;  2NZH A;  4DXF A;  1V1Q A;  1XTD A;  3J81 j;  1JWS D;  3I91 A;  2Z6K A;  2DEQ A;  4PHC A;  2N55 A;  1DD2 A;  1VQI A;  4A93 G;  1OXS C;  1HZC A;  1PDQ A;  1N33 L;  4AQY L;  3KJO A;  1E1O A;  1W3S A;  4DR7 Q;  3M7G A;  3HXX A;  2AQ3 B;  3HP3 A;  2PZW A;  4XQN A;  3KFU A;  5IE8 A;  2XGT A;  4ILW A;  1CHP D;  2Q2H A;  2JA7 G;  3REU A;  4QF4 A;  4OL7 A;  4A4I A;  4FXK C;  1XXG A;  3NEN A;  2I4N A;  4H13 C;  2RSO A;  1SYB A;  4XTU A;  3V8L A;  2K33 A;  3CC2 A;  1I4P A;  2CJA A;  5CV7 A;  1OXV A;  4NCX A;  2MFI A;  2LMC B;  2JA8 H;  3GTG B;  2EY6 A;  4NKL A;  1CA6 A;  1U4M A;  3ZYY X;  4A3M B;  3I8Z A;  1YHQ A;  3D4D A;  1SFO B;  4HWT A;  1YHA A;  3GQB A;  3H91 A;  4DN4 M;  2ART A;  2EYM A;  4X65 L;  3NEL A;  5CV4 A;  5K36 H;  3NBH B;  1KDC A;  4GLV B;  3GTQ B;  2ZT8 A;  1LT5 D;  4TTV A;  1QWY A;  4A3K B;  4JI8 L;  4GKJ L;  1QJO A;  4JV5 L;  4K5X A;  4BY1 G;  1SXT A;  1EVK A;  3ER0 A;  3RZO B;  2L1B A;  5KND A;  4OEM B;  2KQ3 A;  3NBH A;  2Q2U A;  4LF8 Q;  1WCM H;  1EEI D;  1HTL D;  3ULJ A;  2EAY A;  2NVY H;  1PH4 A;  3PF5 A;  2AUJ D;  2H4O A;  1JB7 A;  4C1N I;  2LS0 1;  1E1T A;  3UDF A;  1SE2 A;  1V8Q A;  4XU0 A;  1K3B C;  4KI0 A;  1STG A;  1SYC A;  1E2W A;  5IWA L;  3URY A;  4BBR G;  3E0E A;  3MAQ A;  5M3M B;  4OXP A;  2QCP X;  2LXJ A;  4IFD I;  2IX0 A;  4HIM A;  2K01 A;  1VF7 A;  4KY5 A;  4PNY A;  2A6E C;  2NYZ D;  4XEM A;  2NBF A;  2OEO A;  3RKY A;  2MQH A;  5LL6 S;  3DM3 A;  1PH8 A;  2EJF C;  3HXV A;  3C1F A;  4WF2 A;  1HZA A;  1VQ9 A;  4JI5 L;  5JEA J;  4RWS C;  2I5H A;  1PFB A;  2I0Q A;  1U0L A;  1KNA A;  4LF9 Q;  4RDX A;  4MN3 A;  2HQE A;  4GLA C;  1SNO A;  3PO3 B;  1GKH A;  4JI4 Q;  3HY1 A;  4ZKB B;  4XXE A;  2K5Q A;  4HSP A;  4XYO A;  4O2D A;  2RSN A;  1R9T H;  1TWA B;  1AEX A;  1Z9F A;  2JQO A;  2MPM A;  3JAM i;  3KLS X;  3IL8 A;  4J8Q A;  2QEX A;  3DWP A;  5T1I A;  5C3E G;  4DV2 Q;  1HUN A;  3RD4 A;  3WWV A;  1EZ8 A;  5IOD A;  5C4X H;  4LF6 L;  3S1Q B;  3GDE A;  2UUA L;  1QIL A;  3OTO Q;  2UXD L;  2OT2 A;  5HGT A;  1Y8O B;  3J81 c;  4DV5 Q;  4DR3 L;  4JOI C;  1A6X A;  5M5X H;  4CDD C;  1S4Z A;  1BIA A;  2B2V C;  3U9O A;  2ZCE A;  4YRK A;  4JYA Q;  1STE A;  2NZO A;  1FJG Q;  4A3J H;  1UNS A;  1SER A;  3UI2 A;  4FF2 A;  1TS5 A;  1C7Y A;  3TN2 A;  3RLN A;  1AZP A;  1G5I A;  3S14 H;  1B3Q A;  1Q3L A;  1F77 A;  2NVT H;  2EYF A;  1S3O A;  3R2T A;  5BR8 Q;  3ULP A;  2CCZ A;  1JOQ A;  2O4X A;  4LAA A;  2WAQ E;  4DNT B;  3HOU H;  2RDG A;  3S16 B;  1H4Q A;  2KHI A;  4UY8 C;  4DR1 L;  3RN5 A;  3QO2 A;  4DV1 L;  1XNQ Q;  4OWW B;  2F0U A;  1E2Z A;  4RA8 A;  1BCP C;  2AQ1 B;  2ZR2 A;  4A3B H;  3V05 A;  4JG2 A;  4C3H B;  5FLM G;  1LAC A;  5IT9 c;  3S1N B;  4UP8 A;  3NK9 A;  4TWA A;  1VQN A;  2DTO A;  2HHH Q;  1DOM A;  1HZB A;  1TS3 A;  2B39 A;  2F0V A;  1X2H A;  2K04 A;  5EBC A;  3A7U A;  2ZXF A;  3RAC A;  1H9R A;  1GO3 E;  1YHB A;  1GJX A;  3UGQ A;  1ZKO A;  3R3O A;  1KRS A;  2QDL A;  2WV6 D;  5JJZ A;  2PPB C;  4P75 C;  4P3P A;  5LL6 X;  3ONA B;  4K0K Q;  3GV3 A;  4OO1 H;  1RTO A;  3A74 A;  1CQF A;  4DAV A;  4NXN Q;  1NJ6 A;  2NVQ H;  3EFR A;  2RDF A;  3CCR A;  4IN3 A;  3F2B A;  4H0L C;  2I5M X;  2P0L A;  3IKM B;  1LTL A;  4XTC S;  4X64 Q;  1ASZ A;  3REX A;  4JI3 Q;  2R92 B;  3T13 A;  4QIW E;  5J3B A;  3OD1 A;  2KCM A;  1B53 A;  1HH2 P;  3H6M A;  3UDI A;  1PA6 A;  4MHE A;  1JIC A;  1FL0 A;  2DJF C;  4PG3 A;  4A3E B;  1TII D;  3GTO H;  1DON A;  4G7O C;  1Z7N A;  1FVI A;  1LLR D;  3HOX B;  2AKW A;  3GTK B;  5GAD C;  3S1M B;  1CZG A;  2K50 A;  3PO3 G;  2F0W A;  2F0H A;  2Z6K C;  3H0G B;  4OGQ C;  5DAU A;  5NUC A;  3HZX A;  3DSQ A;  1IYU A;  1SLJ A;  2DQ3 A;  4QUC A;  4IJL A;  4LFB Q;  4KHV A;  2CH4 A;  1WQW A;  1L0X B;  3CPF A;  3P8Y A;  2V4D A;  3TRZ A;  3VR3 A;  3HOY G;  2QA4 A;  2HCC A;  5JJL A;  1VQC A;  5CV8 A;  4OX9 L;  2EYO A;  1JR0 D;  2EYP A;  4JI1 Q;  4DR7 L;  5CV9 A;  3SE0 A;  5I2Y A;  4K8I A;  5GAE C;  2IJ0 A;  2ZZE A;  2X69 A;  1A15 A;  4DV4 Q;  2R7Z G;  2R93 B;  2AMC B;  4A3L H;  3AQQ A;  2CJ9 A;  3RLO A;  2DZC A;  1WD0 A;  2VUM B;  3L0O A;  1K73 C;  4EQP A;  5HUR A;  3WOE A;  4A3D B;  1A3U A;  2XWJ B;  4E51 A;  3PUW A;  3H15 A;  4YHH Q;  4JBK A;  1WTW A;  2D62 A;  1T9H A;  4PZ8 A;  4U68 A;  4LVK A;  2AMC A;  2ID0 A;  4BA1 I;  1HTP A;  5K1X A;  1GHK A;  4K5V A;  1PTO C;  2N88 A;  1KNE A;  2JA5 H;  1X6O A;  4CKB A;  3HOZ G;  5I2X A;  4RGO S;  1VQZ A;  3LSS A;  5K1P A;  4CBV A;  2PI2 A;  1HFG A;  2JA6 B;  1MJC A;  3ITP A;  4LWC A;  5C52 B;  1YIJ A;  2BE5 D;  1IKM A;  3HOV H;  4FVM A;  2YU9 H;  4RQE A;  1J8I A;  1L0W A;  1ADJ A;  1RKN A;  2ZNI A;  3BZD B;  3A8K E;  1DJR D;  3PUV A;  1LTB D;  1B50 A;  4BW9 A;  2LY7 A;  2FFK B;  1N32 Q;  1EIH A;  4PMB A;  1FNU A;  1E3P A;  3J81 E;  3A5U A;  4TVA B;  2EZV A;  4GN4 B;  1F2M A;  2Y0S B;  1II3 A;  4RKB A;  5E3I A;  5EKL A;  3IAL A;  1U5K A;  1BBU A;  4KD4 A;  2EQS A;  3IKL A;  1X56 A;  4Q5V A;  1M1K C;  1Q12 A;  1QCB D;  3UE1 A;  4A93 H;  1EQQ A;  4KKT A;  4QGU A;  4RGN A;  4WJW A;  1G8Z D;  3WOF A;  3NQT A;  3ERQ A;  3GTL B;  1JJ2 A;  1PFS A;  1VQL A;  3I4M G;  1B70 B;  2K75 A;  3HG9 A;  2MO0 A;  2EXD A;  1GXD C;  3GP7 A;  3RKW A;  4K14 A;  3MWY W;  5CBE E;  4LJZ C;  4KJO A;  2JA7 H;  2EYH A;  2CWA A;  2B2W A;  2DVE A;  1X3Q A;  2XIW A;  1LAB A;  1EIF A;  4KHP Q;  1L1O A;  1NMG A;  5C53 B;  1PH3 A;  1TQO A;  1B70 A;  4KN7 C;  4K87 A;  4J6H A;  3JAM L;  1HJP A;  1C9O A;  1PXU A;  4DXG A;  4XIG S;  4RCN A;  5I6W A;  3HOX G;  1Q46 A;  4IPD A;  1UAP A;  2Q5H A;  1PZI D;  4CDE C;  3H3V I;  4XT3 B;  1EL0 A;  3HKZ G;  4KTA A;  1C48 A;  5HGQ A;  1D8L A;  1PFM A;  3I73 A;  1DYQ A;  2I4L A;  4LF9 L;  2DU5 A;  3M4O H;  3VDY A;  1XMO Q;  1S5B D;  1VF5 C;  5JJI A;  1H9S B;  3V7S A;  3T4A C;  4JI4 L;  1VQ6 A;  1N36 Q;  1VQG A;  2E2D C;  1K8G A;  3AB9 A;  4YRI A;  2R7F A;  1B2T A;  4CHT B;  5M3F B;  2BDO A;  5IIF A;  4HJ8 A;  3F2C A;  2RCF A;  2F52 A;  1BO0 A;  2I5L X;  4OHJ A;  1H9S A;  5M5Y H;  3A8J E;  4TKO B;  1SND A;  1WJJ A;  3I4N G;  2NVX B;  2HUG A;  3DM1 A;  2ZZG A;  4IFD J;  2ZR3 A;  3J80 c;  3K6O A;  2B2T A;  3NHH A;  1NR4 A;  4OEL B;  1A2U A;  5DEH A;  4DV5 L;  3M4P A;  1VQE A;  1I6H H;  2HQL A;  1EWC A;  4YRN A;  4HJ9 A;  2A6H D;  4H2Y A;  3STB D;  5J39 A;  1L2F A;  4G85 A;  3TP5 A;  1H4V B;  3M3Y H;  2X6L A;  3PIP 3;  2QIL A;  1AE2 A;  2VQF Q;  2HT1 A;  4QL5 A;  2DXU A;  2UUC Q;  4LF5 Q;  4G4K A;  2P5Z X;  5JJK A;  2WB1 E;  2PME A;  1BNZ A;  4Y52 H;  1X54 A;  1HR0 L;  5BR8 L;  2PYK A;  1X01 A;  3OWE B;  4P74 A;  4XQJ A;  4YRG A;  1EY9 A;  3FMC A;  5C4H A;  5ELO A;  3J7Z C;  2KCT A;  3NTI A;  1TWC B;  5IGD A;  2KHJ A;  1XNQ L;  2IWH A;  2EJF A;  1LTT D;  3V7C A;  2IL8 A;  2L12 A;  3VR5 A;  1NYQ A;  1VQ4 A;  2I4M A;  4N9P A;  5F2D A;  3CC4 A;  4S3S A;  4YRT A;  1ENF A;  2J4X A;  3D8G A;  5C0X I;  2PMZ B;  2RKS A;  4DFA A;  2ATW A;  5D14 A;  1VQ8 A;  4H2T A;  5E3F A;  2EYJ A;  1NR2 A;  4LFA L;  5EAY A;  4OP0 A;  1Y8P B;  2E75 C;  4HID A;  1X3G A;  5C3E H;  2PQE A;  4DR4 Q;  4G7H C;  3G6E A;  2F0O A;  4GNX B;  2SDF A;  2XSC A;  1BR9 A;  1ASY A;  2VS1 A;  3A8I E;  4K0K L;  1QOH A;  2HNI A;  4NXN L;  1EY4 A;  3R93 A;  5FLX L;  2UU9 Q;  4DNR B;  4QMG A;  1JT8 A;  4UPA A;  1B4O A;  2F0E A;  4JBM A;  3VQX A;  1Z7T A;  1QE6 A;  4C3I B;  4L5S A;  3GO5 A;  1EYG A;  4LF7 Q;  4JI3 L;  2B2V A;  1YIT A;  1JCK B;  1HRJ A;  2NWG A;  4GN5 A;  2CWP A;  4DK1 A;  3GTG H;  3PSI A;  1KL9 A;  5KRU A;  4YY3 Q;  1PTO H;  1ZYR D;  5CV6 A;  4KMU C;  5ISR A;  2DZ9 A;  5AJ3 L;  2XN9 C;  1VQA A;  5E7N A;  3I56 A;  1TY0 A;  1SFO H;  4FF1 A;  3GTM B;  4ZAI A;  3TP6 A;  4NPS A;  5IGB A;  2F0L A;  4LUV A;  1NNH A;  3HOW B;  4JPB W;  3FRP B;  1IZ6 A;  1N9W A;  1ET9 A;  1GUG A;  1AW7 A;  4FXD A;  4KY6 A;  1QUQ B;  1RL2 A;  2J7Z A;  2B63 B;  4J15 A;  1EU3 A;  4EQO A;  3CME A;  3GV6 A;  3A32 A;  3HTZ A;  1JB3 A;  2Z4I A;  1MHW C;  3KF8 B;  3G48 A;  4C2M B;  1Q1B A;  3CRL C;  3BDL A;  4I7Z C;  4OIK A;  2FXQ A;  1Z7M A;  1QUQ A;  2DQ0 A;  1D6E C;  4DQ2 A;  1SNC A;  3SK8 A;  4JI1 L;  1HNX Q;  1V1P B;  2C9O A;  1EFI D;  2QHS A;  2D0P A;  4DV4 L;  4ZTZ B;  2C7I A;  3K5N A;  1ENC A;  3PO2 B;  4A3F B;  4B3R Q;  4KHZ A;  4P75 A;  2JSO A;  2EVB A;  4L5Q A;  5I4D A;  2EWN A;  4QQB X;  3KF8 A;  3S15 B;  3QR8 A;  4ME5 A;  4QY7 A;  5IYD G;  4LVI A;  1F2Y A;  1KDB A;  2F4V Q;  1TKW B;  3HXZ A;  2HIV A;  3QO8 A;  4YHH L;  1MIU A;  3K59 A;  3W3A A;  1O7Z A;  2ZJQ A;  4G57 A;  4DUY Q;  2F4I A;  4IUN A;  4R9W A;  4V19 0;  4YRE A;  2LSS A;  1HA5 A;  1X9N A;  1PH2 A;  1X32 A;  3CCU A;  1MI2 A;  4MZ9 A;  1SAP A;  1E7Z A;  2ZT7 A;  1GUN A;  1V9P A;  2ZIN A;  3PO3 H;  3OOC A;  1RHP A;  2F0M A;  1QVC A;  1TU2 B;  5C6A A;  3CCQ A;  3DHQ A;  5EKI A;  3MHB A;  1EQR A;  3MXG A;  3J80 E;  1N34 Q;  3TRE A;  1SDF A;  3ERS X;  5C5L A;  3SK4 A;  3LWU A;  1ROD A;  2BE5 C;  4DV7 L;  2B8F A;  3I55 A;  1SYG A;  2XTI A;  3HOY H;  3PGZ A;  4PMC A;  2UUB Q;  2R7D A;  5IY0 A;  4A3G B;  3E9H A;  3WQZ A;  4HJ7 A;  1P8L A;  2JA9 A;  2B2W C;  2IHE A;  1L1O C;  1CKO A;  4K5W A;  3FKI B;  2R7Z H;  1A63 A;  4IJH A;  5E4X A;  4H2V A;  4JI6 L;  2KUM A;  1SYE A;  1ET6 A;  2HDL A;  1PRT D;  3BYY B;  4KJN A;  1F2Z A;  1J6Q A;  4Y7N H;  2F0G A;  1SYD A;  5CBA E;  2A68 D;  2Q8I B;  3J80 L;  2VXW A;  1I50 B;  4YWM A;  4ZIB A;  4HMJ A;  3V8J A;  3NBI A;  4KHP L;  3NP8 A;  1HNZ L;  2F3I A;  1H4T A;  3B6Y A;  3W2D A;  1H9K A;  1SNQ A;  4O42 A;  1TWG B;  2KBN A;  4K2L A;  5IGF A;  3S16 H;  2QKI C;  4R4C A;  4HIO A;  5C3W A;  4N8F A;  2B3G A;  1SSO A;  4JI7 Q;  3HOZ H;  1KMM A;  5JEA G;  4BWA A;  4J1M A;  3KBX A;  3TS0 A;  2B2Y A;  1K8M A;  5IP7 G;  1K83 H;  3A5Z B;  1IL8 A;  3K7A B;  4FP5 D;  3TDQ A;  1XMO L;  4MNO A;  2YTY A;  2A5H A;  3S1N H;  2Q8T A;  2WKC A;  1UWV A;  2LKV A;  3F2U A;  5DM7 3;  4F87 A;  2AWO A;  2B2T C;  2GA4 B;  3T1Y Q;  4H2S A;  2EE1 A;  3O13 A;  5EPL A;  1LTI D;  4IUP A;  1ESR A;  2NB0 A;  3A5Z A;  3I90 A;  2NS6 A;  1QNU A;  4K88 A;  4KY7 A;  2JK8 A;  3CCL A;  1STH A;  2NZ1 D;  4A3F G;  2R6G A;  3K5L A;  1WTV A;  5GQO A;  3RMH A;  5FK9 C;  2ZJR A;  1JJC B;  4Q0F A;  4P73 A;  1G2T A;  5IP9 G;  1PRT F;  5LMU Q;  3I4M H;  1RJT A;  4UDU C;  4O1N A;  5KGU A;  4P74 C;  1J9O A;  4F8M A;  1AP0 A;  1KMN A;  1BBW A;  3Q6S A;  2KCC A;  1H9M A;  1CM9 A;  4JI0 Q;  4KN4 C;  2EYL A;  1JMC A;  2VQF L;  1IBL Q;  2R3Z A;  2UUC L;  4LF5 L;  1JJC A;  3T1H Q;  5KYL A;  3U4V A;  1ESF A;  1EY8 A;  2A6H C;  2OTL A;  3L7Z C;  4HVC A;  2C8M A;  2DNC A;  1HZ9 A;  4ZKC B;  2IX3 A;  4A76 A;  4DGZ A;  3HOX H;  3HRI A;  1LYL A;  4CS2 A;  1Y1V G;  3IFT A;  1QE0 A;  1G29 1;  4BY7 B;  3Q0A A;  3CQZ H;  1GD7 A;  3E0J A;  4LNQ A;  3J81 i;  2RDH A;  1V43 A;  1XMQ Q;  1ADY A;  4N8X 1;  3RNU A;  1Q8K A;  3VR4 A;  2QGQ A;  3OPO A;  2ZTD A;  2RF4 A;  3TP7 A;  3IKJ A;  5E4W C;  4A3G G;  1VQ5 A;  5M9O A;  1VQH A;  3D4W A;  3N52 A;  2HCI A;  3TQY A;  2JJQ A;  1YJW A;  4BWG B;  4XTX A;  3J7Y W;  4TVW A;  4UHV A;  1SMY D;  1GUT A;  3S2D H;  3GTJ H;  1VQJ A;  4DR4 L;  4L8J A;  3FKI G;  1G91 A;  5CMD A;  5BN4 A;  3I4N H;  3M4Y A;  3I4O A;  1VQD A;  1I4G A;  1GVP A;  2VUM H;  2EY5 A;  3ND9 A;  3PUY A;  1WLE A;  2K4K A;  2UU9 L;  2PZU A;  4P72 A;  4A3D H;  2SNS A;  2ZXP A;  2KJX A;  2JYO A;  4A3M G;  4LF7 L;  3CAM A;  3UDG A;  2A74 C;  3NEM A;  3ICE A;  2E8G A;  2IY5 B;  2PW7 A;  3D0F A;  3S1R B;  1EEF D;  1XTC D;  2CGH A;  4O0A A;  1JE4 A;  4YRQ A;  3BZK A;  4M8A A;  1W6K A;  5IYB G;  5C0X J;  4ALP A;  3DEO A;  1SRU A;  4Z9C B;  4DUZ Q;  3RZD B;  4JI2 L;  1E2V A;  1Y8N B;  1USY A;  1AN8 A;  3NTH A;  1JE5 A;  5FO9 B;  4A3K G;  2JA8 B;  2IY5 A;  3OW7 A;  2E1H A;  1IKL A;  2BH2 A;  3P7J A;  4U67 3;  3QG1 A;  3BS1 A;  2VZA A;  3OWF A;  1KD1 C;  5A2Q E;  3K80 C;  4X62 L;  1I3Q H;  5L37 A;  1F9P A;  4YPF A;  2MUY A;  3KLS A;  3ZJY C;  5IGE A;  1EWI A;  1U9R A;  1B44 D;  4X5O A;  1ZEQ X;  3DEP A;  3BJU A;  4AH6 A;  2F0J A;  3L2Z A;  3GTL H;  2TMP A;  4YWK A; 
#chains in the Genus database with same CATH homology
 1HNX L;  5M3M G;  3UGT A;  3BFM A;  4B3R L;  1PHJ A;  4DK3 C;  1LM0 A;  4OO1 I;  5C51 B;  3NET A;  2F4V L;  1EVL A;  1YFT A;  2ZM6 Q;  5M5W H;  4R4I A;  2YTX A;  2E65 A;  4DUY L;  3AYH B;  3PCO B;  1VCI A;  2ALY B;  1IBM Q;  3EBE A;  3QTC A;  4BY7 G;  4OLF A;  2E2I H;  1KQS A;  4ZTU B;  1X65 A;  3AFP A;  3HKZ E;  4OWX B;  4YRJ A;  3VQY A;  2Z0S A;  1KXL A;  1XPR A;  3PCO A;  2PQA B;  2ALY A;  3K7U C;  4OWT B;  1VQO A;  3HFZ B;  2OTJ A;  3G1Z A;  2N3S A;  2MO1 A;  3HKS A;  4IPC A;  2UXB Q;  2EIF A;  1XNR Q;  2NVX H;  1OXT A;  2UUB L;  12AS A;  3MEY A;  2PQA A;  2DDZ A;  2E3C A;  5H1S E;  2VW9 A;  1CSQ A;  3U4Z A;  3L4G B;  3GTP H;  4CH4 A;  4LFC Q;  1HNW Q;  4JBJ A;  2PI2 E;  3QO7 A;  1IL2 A;  5IYD H;  1IBK Q;  4LF4 Q;  3QNE A;  1X55 A;  4LVM A;  3MEF A;  3S24 A;  4IO9 A;  5GAH C;  4DR5 Q;  3KDF B;  3W1B A;  1TWH H;  4R1J A;  2OWO A;  4XTV A;  3CMA A;  1NJ8 A;  4DR6 Q;  1SRY A;  1WU7 A;  4WI1 A;  3KDF A;  4H02 A;  2Y0S E;  1X3E A;  4P73 C;  3T1Y L;  4LF8 L;  1KOG A;  1NY4 A;  2RHS B;  2OCE A;  2Q7G A;  1YVC A;  3L1A A;  4TVA A;  1XJV A;  4EQ5 A;  2R92 G;  3PUZ A;  4IFD G;  2VL6 A;  4HJ5 A;  3VBB A;  2H5X A;  1ATI A;  1CKN B;  2RHS A;  3TEG A;  4A3E G;  4Q6G A;  2A8E A;  3HFV A;  3CD6 A;  1IBL L;  3T1H L;  3H0G G;  1UE1 A;  3GTM H;  1CKN A;  1G51 A;  3M4Q A;  4DAY B;  3PZC A;  3J80 i;  3OW2 A;  3EN2 A;  4GKK Q;  4AYB G;  4HJA A;  1XMQ L;  5IP7 H;  3TUP A;  1RIP A;  4YDQ A;  4DV2 L;  3K0X A;  2R93 G;  3MF1 A;  2PNH A;  4P72 C;  3CCV A;  3J7A 5;  2VUM G;  3OTO L;  1NJ2 A;  1PV4 A;  1Q86 C;  1SMX A;  4A3D G;  3P8T A;  3KOJ A;  4IPH A;  4A3F H;  4JYA L;  2ODR D;  1FJG L;  4H2X B;  3S15 H;  5IP9 H;  1H4S A;  3EIV A;  1USY C;  1K0R A;  2ZT5 A;  2IT1 A;  2CKZ B;  2JA6 G;  4POF A;  4H2X A;  1YGB A;  2E41 A;  1C0A A;  4UP9 A;  4WJ3 M;  4DUZ L;  2MNA A;  4GOP B;  1Y1V H;  5C44 G;  1CUK A;  2Y0S G;  4L5T A;  4HWO A;  1GM5 A;  1VQK A;  2HHH L;  1W2B A;  1VQF A;  4GN3 B;  1WFQ A;  1K3R A;  4GOP A;  1Y1W G;  3EFS A;  1SRO A;  2BA0 A;  4A3G H;  1WYD A;  3G71 A;  2GVB A;  1PH1 A;  2YYZ A;  1VQP A;  3W1G A;  4DV6 Q;  3FKI H;  4X64 L;  3ICA A;  4GNX A;  3AFQ A;  3CCM A;  1Q81 C;  1EFW A;  4XU2 A;  4GS3 A;  4A3M H;  2JEA I;  1I5F A;  2ZM6 L;  1J5E Q;  2Q7H A;  1TWG H;  5IYB H;  1IBM L;  3GTQ H;  3DLL A;  1KC8 C;  2NN6 G;  3AEV A;  4A3K H;  5M3F G;  4Q15 A;  3K7A H;  4LVL A;  4TQU S;  4LFB L;  3RLF A;  2Q2T A;  4BXX G;  3BU2 A;  4X6A H;  3RZO H;  3BZC A;  2V1C C;  2ARU A;  3CPW A;  4DV3 Q;  2UXB L;  3W3S A;  1XNR L;  2BH8 A;  2Q7E A;  1B7Y B;  3D31 A;  2ZNJ A;  2E5L Q;  5M3M H;  1MJE A;  4LFC L;  3U50 C;  3CCE A;  1W66 A;  4LVJ A;  4XU1 A;  1WQ7 A;  1IBK L;  4LF4 L;  3V7R A;  4DR5 L;  4CH6 A;  4DR6 L;  5DLQ E;  1M90 C;  4BY7 H;  1G6P A;  5KNN A;  3TEH B;  1Q82 C;  3P8V A;  2VQE Q;  2J3M A;  1TWA H;  2K14 A;  1N32 L;  2GVA A;  4H2U A;  5IYC G;  1YZ6 A;  4LUO A;  3S1Q H;  2K52 A;  3V8K A;  4KLK A;  3MQZ A;  2A8V A;  5GRO A;  1UE6 A;  4OX9 Q;  1FYF A;  1WPY A;  4DKA C;  1QVF A;  4B3M Q;  1NYR A;  2QHU A;  4JBW A;  3RUX A;  3S1R H;  2ZIM A;  3FHW A;  4YRP A;  2CQO A;  3RF1 A;  4CS4 A;  3HOW G;  3RZD H;  3A31 A;  1RIQ A;  2B63 G;  1LUZ A;  1NJ5 A;  4C3H H;  4KR3 A;  4BBS G;  1CKM A;  1N36 L;  1B76 A;  4GKK L;  4EX5 A;  2CJB A;  4DV0 Q;  1YFS A;  3HRK A;  4YRS A;  2DJZ A;  3SGI A;  1GGM A;  4OON A;  4H2W A;  3PO2 G;  1OXU A;  2N49 A;  2ASB A;  3F1Z A;  4ME3 A;  1EIY B;  3PF4 A;  3A5Y A;  3A0J A;  3K81 C;  1PYS B;  1S40 A;  2R92 H;  1AH9 A;  1A8V A;  1KRT A;  3I2Z A;  4PMW A;  1NMF A;  1EIY A;  4A3E H;  3STB C;  4HWR A;  2ODR C;  1PYS A;  3GTK H;  3S1M H;  4A3I H;  3H0G H;  5C0X G;  2ZT6 A;  2DU7 A;  3M7N A;  4GOP C;  1NJI C;  1SET A;  1IYJ B;  3F2D A;  4PZ6 A;  4DAM A;  5FJ8 G;  2E64 A;  1K9M C;  4YYE A;  4DNI A;  2EJG A;  2K5H A;  1VQ7 A;  2IHF A;  1KAW A;  2R93 H;  4GNX C;  1HC7 A;  3PV0 A;  4DV6 L;  2DTI A;  2DGY A;  3I7F A;  1KHI A;  3UE0 A;  1QVG A;  3L2P A;  1JJG A;  3UDX A;  3JAM c;  2RHQ B;  3FP9 A;  1Q1E A;  4YY3 L;  3MF2 A;  1I94 Q;  3CCJ A;  4B3S Q;  2JA6 H;  3F8T A;  1J5E L;  1TXY A;  2YV5 A;  1FGU A;  4L87 A;  1HR0 Q;  4RG1 A;  2RHQ A;  11AS A;  4PZ7 A;  3HY0 A;  4DK6 C;  1QZH A;  3A7R A;  4K86 A;  5C44 H;  2FYK A;  4HWS A;  1AE3 A;  3CC7 A;  1XPO A;  2UXC Q;  2PMF A;  3UFG A;  2DUD A;  2L15 A;  1YB3 A;  1PYB A;  4XTZ A;  2ES2 A;  1Y1W H;  3IRB A;  4DV3 L;  4LFA Q;  2E2H H;  5ELN A;  4JCV E;  4DPG A;  2E5L L;  2LXK A;  1P16 A;  3E9I A;  2VY3 A;  4R4O A;  2CIM A;  4KR2 A;  1NE3 A;  4KQE A;  3CXC A;  2AKW B;  4RQF A;  1S72 A;  1EUJ A;  4CS3 A;  2D0O A;  3M9B A;  1N8R C;  2ZIO A;  3RN2 A;  5F5W A;  4A3C G;  4TQF A;  5AJ3 Q;  4NXM Q;  4YWL A;  3ULL A;  2BA1 A;  4HIK A;  3W5O A;  2VQE L;  1J5W A;  1N34 L;  5M3F H;  2N78 A;  2JEB I;  4AYB E;  4BXX H;  1SN8 A;  3LGJ A;  4B3T Q;  4XTW A;  1E22 A;  3HXU A;  2NN6 I;  4DR2 Q;  3HFZ A;  1WI5 A;  5FLX c;  4YCW A;  1O7I A;  1A62 A;  1Y14 B;  1PH6 A;  1YNX A;  4WJ4 A;  1B8A A;  2ARS A;  1SE8 A;  3RL6 A;  3MXN B;  1HXD A;  2QHT A;  4YRF A;  1HTT A;  3M85 A;  4B3M L;  3L4G A;  1KIX A;  4HA8 A;  4YRC A;  4P71 A;  4FDB A;  2E10 A;  3A7A A;  2JA8 G;  4YCV A;  4TQD A;  1Z47 A;  4UP7 A;  3KF6 B;  4HWP A;  3RIR A;  2ZGW A;  1TWC H;  4X66 Q;  2WAQ G;  4LW1 A;  4JI7 L;  1QZG A;  4YRR A;  1X3F A;  1PVO A;  2HIX A;  5LMN Q;  4YRO A;  4GLX A;  5K36 G;  1D7Q A;  3R07 A;  3LC0 A;  3KF6 A;  1QF6 A;  2JE6 I;  2RCN A;  2VNU D;  4HT4 A;  4IPG A;  4APV A;  2OQK A;  4LNS A;  4DV0 L;  5IYC H;  4YP0 A;  1NTG A;  3LSQ A;  2AHO B;  1WCM G;  1N33 Q;  4AQY Q;  3FJP A;  4DV7 Q;  2EJ9 A;  3KJP A;  5LMU L;  3CF5 A;  1YJ9 A;  4L5R C;  4C3I H;  1L1O B;  5HY6 A;  4JI0 L;  1YEZ A;  4R4T A;  4JI6 Q;  1Q7Y C;  4A3I G;  3HXY A;  3G4S A;  4XU3 A;  3VQV A;  1OXX K;  1PH7 A;  4CH5 A;  3H3V H;  2OQ0 A;  2WFW A;  1SR3 A;  4XTY A;  1HNZ Q;  2C35 B;  3HOW H;  4YCU A;  2IX1 A;  2K5V A;  4X65 Q;  2B63 H;  3S2H H;  3S17 H;  4NB3 A;  2ZTC A;  4BBS H;  5GAG C;  1UE5 A;  2DTH A;  4JI8 Q;  4C2M H;  1YFR A;  1UEB A;  4GKJ Q;  4JV5 Q;  4QJF A;  2I4O A;  3HXW A;  3PO2 H;  5C4X G;  2KEN A;  1BVS A;  3Q8D A;  4BY1 H;  2Q2I A;  3UH0 A;  3KYH C;  5IWA Q;  4JC0 A;  3KLW A;  4A3J G;  4XEO A;  3CMQ A;  1A0I A;  1YBY A;  1I94 L;  4BBR H;  4B3S L;  3CP0 A;  3HOU G;  1CSP A;  2G4C A;  4JI5 Q;  4IOA A;  2WP8 J;  2PMZ E;  2DXT A;  4RMF A;  1WNL A;  4A3B G;  1VQM A;  1HR0 W;  3GD7 A;  2ZJP A;  3VQW A;  3PUX A;  2UXC L;  3OYY A;  5FJ8 H;  1NJ1 A;  3IG2 A;  4P3O A;  2CFM A;  4LF6 Q;  1BIB A;  4OO1 G;  2UUA Q;  2E2J H;  2UXD Q;  4DR3 Q;  2P5I A;  3ERR A;  2DKG A;  4CH3 A;  2YTV A;  1I50 H;  4TVY A;  4YRM A;  4MTN A;  1XPU A;  2Q5I A;  4EO4 A;  4AIM A;  1G5H A;  4JOI A;  2AWN A;  3PIO A;  3U58 A;  3RR5 A;  3CW2 C;  4IOC A;  2A1A A;  2GN5 A;  4LUZ A;  1MKH A;  4DR1 Q;  4DV1 Q;  1K8A C;  1H95 A;  4JI2 Q;  3CCS A;  1EOV A;  4NXM L;  1VQB A;  1OTC A;  2ZZF A;  1PH9 A;  1E24 A;  4POG A;  2J3L A;  3RKX A;  4X62 Q;  4YRL A;  4B3T L;  5FLM H;  4BA2 I;  1VS0 A;  4A75 A;  4DR2 L;  4C3J H;  1PH5 A;  3PIP A;  2A19 A;  5C4J H;  1YI2 A;  2ZTG A;  4G84 A;  4A3L G;  4P71 C;  1HNW L;  1BKB A;  1SES A;  1TWF H;  2K5N A;  1YJN A;  1B7Y A;  2ZTE A;  3JC6 6;  1X2G A;  1WOC A;  2EL9 A;  2WB1 G;  4P3N A;  1IXR A;  4X66 L;  2JA5 G;  3TS2 A;  2QHV A;  3K8A A;  2E5A A;  2B29 A;  1NBW A;  1DGS A;  3HOV G;  5LMN L;  1UE7 A;  4A3C H;  3RGL A;  4R4Q A;  5LMN W;  3TEH A;  3QO5 A;  2N8N A;  2NZH A;  1V1Q A;  1XTD A;  3J81 j;  2DEQ A;  2Z6K A;  4PHC A;  1VQI A;  4A93 G;  1OXS C;  1HZC A;  1N33 L;  4AQY L;  3KJO A;  1E1O A;  1W3S A;  4DR7 Q;  3HXX A;  3KFU A;  5IE8 A;  2XGT A;  2Q2H A;  2JA7 G;  3REU A;  4A4I A;  2I4N A;  3NEN A;  4XTU A;  3V8L A;  3CC2 A;  2CJA A;  1OXV A;  4NCX A;  2MFI A;  2JA8 H;  1YHQ A;  4HWT A;  1YHA A;  2ART A;  4X65 L;  3NEL A;  3NBH B;  4GLV B;  2ZT8 A;  4TTV A;  4JI8 L;  4GKJ L;  4JV5 L;  4BY1 G;  1EVK A;  3ER0 A;  2Q2U A;  4LF8 Q;  1WCM H;  3ULJ A;  2EAY A;  2NVY H;  1PH4 A;  3PF5 A;  1JB7 A;  1E1T A;  3UDF A;  4XU0 A;  4KI0 A;  5IWA L;  4BBR G;  3E0E A;  4OXP A;  2LXJ A;  4IFD I;  2IX0 A;  4HIM A;  4XEM A;  3RKY A;  2MQH A;  3DM3 A;  1PH8 A;  3HXV A;  4WF2 A;  1HZA A;  1VQ9 A;  4JI5 L;  5JEA J;  2I5H A;  2I0Q A;  1U0L A;  4LF9 Q;  4RDX A;  4GLA C;  1GKH A;  4JI4 Q;  3HY1 A;  4O2D A;  1R9T H;  1Z9F A;  2JQO A;  3JAM i;  2QEX A;  5C3E G;  4DV2 Q;  3WWV A;  4LF6 L;  5C4X H;  3GDE A;  2UUA L;  3OTO Q;  2UXD L;  4DV5 Q;  3J81 c;  4DR3 L;  4JOI C;  5M5X H;  1BIA A;  2ZCE A;  4YRK A;  4JYA Q;  2NZO A;  1FJG Q;  4A3J H;  1SER A;  1C7Y A;  3RLN A;  1G5I A;  3S14 H;  2NVT H;  1S3O A;  5BR8 Q;  3ULP A;  2CCZ A;  2WAQ E;  3HOU H;  1H4Q A;  2KHI A;  4UY8 C;  4DR1 L;  3RN5 A;  4DV1 L;  1XNQ Q;  4OWW B;  2ZR2 A;  4A3B H;  4JG2 A;  5FLM G;  5IT9 c;  4UP8 A;  4TWA A;  1VQN A;  2DTO A;  2HHH Q;  1HZB A;  1X2H A;  3A7U A;  2ZXF A;  3RAC A;  1GO3 E;  1YHB A;  3UGQ A;  1KRS A;  4P75 C;  4P3P A;  4K0K Q;  3A74 A;  1NJ6 A;  4NXN Q;  2NVQ H;  3EFR A;  3CCR A;  3F2B A;  2P0L A;  2I5M X;  3IKM B;  1LTL A;  4XTC S;  4X64 Q;  1ASZ A;  3REX A;  4JI3 Q;  4QIW E;  5J3B A;  3OD1 A;  2KCM A;  1HH2 P;  3UDI A;  1PA6 A;  1FL0 A;  4PG3 A;  3GTO H;  1Z7N A;  1FVI A;  2AKW A;  5GAD C;  2K50 A;  3PO3 G;  2Z6K C;  3DSQ A;  1SLJ A;  2DQ3 A;  4IJL A;  4LFB Q;  1WQW A;  3CPF A;  3P8Y A;  3TRZ A;  3HOY G;  2QA4 A;  5JJL A;  1VQC A;  4OX9 L;  4JI1 Q;  4DR7 L;  5GAE C;  2ZZE A;  4DV4 Q;  2R7Z G;  2AMC B;  4A3L H;  3AQQ A;  2CJ9 A;  3RLO A;  2DZC A;  3L0O A;  1K73 C;  4E51 A;  3PUW A;  3H15 A;  4YHH Q;  4JBK A;  2D62 A;  1T9H A;  4PZ8 A;  4LVK A;  2AMC A;  2ID0 A;  4BA1 I;  5K1X A;  2JA5 H;  1X6O A;  3HOZ G;  5K1P A;  1VQZ A;  3LSS A;  2PI2 A;  1MJC A;  4LWC A;  5C52 B;  1YIJ A;  3HOV H;  2YU9 H;  4RQE A;  1L0W A;  1ADJ A;  2ZNI A;  3PUV A;  4BW9 A;  1N32 Q;  1E3P A;  3A5U A;  4TVA B;  4GN4 B;  5E3I A;  3IAL A;  1U5K A;  1BBU A;  2EQS A;  3IKL A;  1X56 A;  1M1K C;  1Q12 A;  3UE1 A;  4A93 H;  1EQQ A;  4QGU A;  1JJ2 A;  1PFS A;  1VQL A;  3I4M G;  1B70 B;  2K75 A;  2MO0 A;  2EXD A;  3RKW A;  2JA7 H;  2CWA A;  2DVE A;  4KHP Q;  1EIF A;  1L1O A;  1NMG A;  5C53 B;  1PH3 A;  1B70 A;  4K87 A;  1HJP A;  1C9O A;  4XIG S;  3HOX G;  1Q46 A;  4IPD A;  2Q5H A;  3H3V I;  3HKZ G;  5HGQ A;  1D8L A;  2I4L A;  4LF9 L;  2DU5 A;  3M4O H;  3VDY A;  1XMO Q;  5JJI A;  3V7S A;  1VQ6 A;  4JI4 L;  1N36 Q;  1VQG A;  1K8G A;  4YRI A;  2R7F A;  4HJ8 A;  3F2C A;  2F52 A;  2I5L X;  5M5Y H;  1WJJ A;  3I4N G;  2ZZG A;  4IFD J;  2ZR3 A;  3J80 c;  4DV5 L;  3M4P A;  1VQE A;  1I6H H;  2HQL A;  4YRN A;  4HJ9 A;  4H2Y A;  3STB D;  4G85 A;  1L2F A;  1H4V B;  3M3Y H;  1AE2 A;  2VQF Q;  2HT1 A;  4QL5 A;  2DXU A;  2UUC Q;  4LF5 Q;  5JJK A;  2WB1 E;  2PME A;  4Y52 H;  1X54 A;  1HR0 L;  5BR8 L;  1X01 A;  4P74 A;  4YRG A;  3J7Z C;  5ELO A;  2KCT A;  2KHJ A;  1XNQ L;  2EJF A;  3V7C A;  1NYQ A;  1VQ4 A;  2I4M A;  3CC4 A;  4YRT A;  5C0X I;  2ATW A;  1VQ8 A;  4H2T A;  4LFA L;  5EAY A;  4OP0 A;  4HID A;  1X3G A;  5C3E H;  4DR4 Q;  3G6E A;  4GNX B;  1ASY A;  2VS1 A;  4K0K L;  2HNI A;  4NXN L;  2UU9 Q;  1JT8 A;  4UPA A;  4JBM A;  3VQX A;  4L5S A;  4LF7 Q;  3GO5 A;  1EYG A;  4JI3 L;  1YIT A;  4GN5 A;  2CWP A;  3GTG H;  3PSI A;  1KL9 A;  4YY3 Q;  2DZ9 A;  5AJ3 L;  3I56 A;  1VQA A;  5E7N A;  1SFO H;  4NPS A;  4LUV A;  1NNH A;  1IZ6 A;  1N9W A;  1QUQ B;  1RL2 A;  4J15 A;  3CME A;  3A32 A;  3HTZ A;  3KF8 B;  3G48 A;  1Q1B A;  2FXQ A;  1Z7M A;  1QUQ A;  2DQ0 A;  4DQ2 A;  4JI1 L;  1HNX Q;  2QHS A;  2D0P A;  4DV4 L;  4ZTZ B;  2C7I A;  4B3R Q;  4KHZ A;  4P75 A;  4L5Q A;  2EWN A;  4QQB X;  4QY7 A;  5IYD G;  4LVI A;  2F4V Q;  3HXZ A;  2HIV A;  3QO8 A;  4YHH L;  1MIU A;  2ZJQ A;  4DUY Q;  4YRE A;  2LSS A;  1X9N A;  1PH2 A;  3CCU A;  4MZ9 A;  1E7Z A;  2ZT7 A;  1V9P A;  2ZIN A;  3PO3 H;  1QVC A;  3CCQ A;  1EQR A;  1N34 Q;  3TRE A;  3ERS X;  4DV7 L;  3I55 A;  2XTI A;  3HOY H;  3PGZ A;  2UUB Q;  2R7D A;  5IY0 A;  3E9H A;  3WQZ A;  4HJ7 A;  1P8L A;  2JA9 A;  2IHE A;  1L1O C;  1CKO A;  2R7Z H;  1A63 A;  4IJH A;  4H2V A;  4JI6 L;  1J6Q A;  4Y7N H;  4ZIB A;  4YWM A;  3V8J A;  4KHP L;  1HNZ L;  2F3I A;  1H4T A;  3B6Y A;  3S16 H;  2KBN A;  4R4C A;  4HIO A;  2B3G A;  4JI7 Q;  3HOZ H;  1KMM A;  5JEA G;  4BWA A;  3TS0 A;  5IP7 G;  1K83 H;  3A5Z B;  1XMO L;  4MNO A;  2YTY A;  3S1N H;  1UWV A;  2AWO A;  3T1Y Q;  4H2S A;  3A5Z A;  4K88 A;  2NS6 A;  2JK8 A;  3CCL A;  4A3F G;  2R6G A;  5GQO A;  2ZJR A;  1JJC B;  4P73 A;  5IP9 G;  3I4M H;  5LMU Q;  4P74 C;  1KMN A;  1BBW A;  4JI0 Q;  1JMC A;  2VQF L;  1IBL Q;  2UUC L;  4LF5 L;  1JJC A;  3T1H Q;  3U4V A;  2OTL A;  3L7Z C;  4HVC A;  2C8M A;  1HZ9 A;  4A76 A;  3HOX H;  3HRI A;  1LYL A;  4CS2 A;  1Y1V G;  1QE0 A;  1G29 1;  3CQZ H;  1GD7 A;  4LNQ A;  3J81 i;  1V43 A;  1XMQ Q;  1ADY A;  3RNU A;  1Q8K A;  2QGQ A;  2ZTD A;  2RF4 A;  4A3G G;  1VQ5 A;  1VQH A;  3TQY A;  2JJQ A;  1YJW A;  4XTX A;  4TVW A;  3S2D H;  3GTJ H;  1VQJ A;  4DR4 L;  3FKI G;  3I4N H;  3I4O A;  1VQD A;  1GVP A;  2VUM H;  3PUY A;  1WLE A;  2K4K A;  2UU9 L;  4P72 A;  4A3D H;  4A3M G;  4LF7 L;  3CAM A;  3UDG A;  3NEM A;  3ICE A;  2E8G A;  2IY5 B;  3D0F A;  2CGH A;  4O0A A;  4YRQ A;  3BZK A;  5IYB G;  5C0X J;  4ALP A;  1SRU A;  4DUZ Q;  4JI2 L;  1USY A;  1JE5 A;  4A3K G;  2IY5 A;  2E1H A;  2BH2 A;  2VZA A;  1KD1 C;  3K80 C;  4X62 L;  1I3Q H;  4YPF A;  3ZJY C;  1EWI A;  4X5O A;  3BJU A;  4AH6 A;  3L2Z A;  3GTL H;  4YWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...