4YCUA

Crystal structure of cladosporin in complex with human lysyl-trna synthetase
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
505
structure length
505
Chain Sequence
DPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPHLHFGLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Specific Inhibition of tRNA Synthetase by an ATP Competitive Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/ ligase inhibitor
molecule keywords Lysine--tRNA ligase
total genus 162
structure length 505
sequence length 505
chains with identical sequence B
ec nomenclature ec 6.1.1.6: Lysine--tRNA ligase.
pdb deposition date 2015-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00152 tRNA-synt_2 tRNA synthetases class II (D, K and N)
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ycuA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4ycuA02
1PVOA 3TREA 4DV6Q 2I4LA 1Q12A 4AQYQ 4BA1I 2B3GA 2QGQA 1YIJA 1E24A 1K8GA 2ASBA 2PMEA 3RUXA 4TQFA 3MEYA 5C4XG 4LWCA 4DR6L 2YTYA 1HZBA 1PH9A 4L5SA 5K36G 3SGIA 1YBYA 4JI5L 4P71C 3HOWH 4HWTA 2A8VA 2NVYH 2AMCA 1B7YA 2UXCQ 1VQ7A 1YEZA 3U50C 4YRCA 2DU5A 3F2CA 1JJCB 1A62A 4P73C 4NXNQ 2ZM6L 3HOVG 3PO2G 1HXDA 1P8LA 1SRUA 4GNXC 1Y1WG 3A7RA 4G85A 3CP0A 4APVA 1YFSA 4JI3Q 4NXNL 4WI1A 1L1OB 4BY1H 4RQFA 4JBWA 1WCMG 4WJ4A 3TEHA 3ERSX 3IALA 2ZNIA 4JI3L 1MJCA 1VQOA 2HNIA 3QNEA 1KAWA 2ODRD 4OO1I 1XPRA 2WB1E 2ATWA 3CPFA 2HHHQ 1VQNA 3ULPA 3CCQA 1OXUA 4YCUA 1IBKQ 5IP7G 4YRKA 3AEVA 1L0WA 3S1NH 3HXZA 2ZJQA 3HOWG 4QQBX 3GTLH 3PV0A 3HRIA 4P72C 2Z6KC 4LFAQ 2JK8A 4DV5Q 2MO0A 4DR1L 4YRQA 1SLJA 3UFGA 4FDBA 4HWRA 3F2DA 2RCNA 2NN6G 5C3EH 2BH8A 1YVCA 3J80c 4IPGA 4EO4A 3CAMA 1SROA 3UGQA 4X5OA 4A3JG 1UE1A 3RNUA 4JI1L 4YRLA 5C0XI 2ODRC 4UP7A 1OXTA 3L2PA 4A3LH 4Y52H 2NZOA 3CCEA 4JV5L 4YCWA 12ASA 4JI7L 2WB1G 3STBD 1NNHA 3ULJA 1EOVA 3CW2C 2QHTA 1EIFA 2UU9L 4HIDA 1NJ5A 2E3CA 1XMQL 4QY7A 4GKJL 2UXBQ 1H4VB 2ZTGA 3I56A 3CMAA 4GOPA 4X64L 1YJ9A 3LSQA 4A3GH 3PF4A 1TWAH 3KYHC 4GN5A 3RIRA 3EFRA 4A93H 1N8RC 4DV1L 4GNXA 4LFCL 4YRGA 1VQJA 3A31A 2UXDQ 1VQMA 4E51A 4JI8L 5H1SE 4DR3Q 1KQSA 1G5IA 4A3EH 3PCOA 2FYKA 2ZTCA 4L5RC 4OWXB 1SR3A 3S24A 4A3DH 3HOYH 1VQ4A 2P5IA 3TEHB 4LFAL 4P75A 3RKYA 3IG2A 4OONA 3G71A 5KNNA 1HNZL 3VQVA 4O0AA 3E9IA 3PF5A 2XGTA 2F4VL 4BXXG 1YGBA 4B3RQ 1RL2A 3KF8B 2VY3A 2DU7A 2GVBA 3HOUH 2R6GA 4ALPA 1I94L 3RR5A 1L1OA 1B8AA 2CWAA 2ZIOA 5C4JH 4MNOA 4NPSA 1QVFA 4RQEA 1SESA 3CC7A 4X66L 2E65A 1Q1EA 4KHPQ 4JI2Q 1PH6A 1SRYA 5ELOA 3HFZB 4YRFA 3GTMH 3J80i 4YRSA 1TXYA 2E64A 1Y1VG 2V1CC 3NEMA 2ZT6A 4JI2L 1V1QA 3PO3G 3MXNB 4IOAA 3QO8A 4IO9A 4LF5Q 4LF4L 4X62Q 2UU9Q 2IY5A 2AWNA 4YWMA 2B63G 2EAYA 3A5ZB 1YFRA 3W3SA 2D0OA 1Z47A 1N9WA 4LF4Q 4LF5L 4IFDJ 3A5ZA 3HXUA 2G4CA 2IY5B 1KIXA 1MJEA 3RN2A 4H2XA 3TUPA 2JA8G 1LUZA 1FVIA 2Q2TA 2K50A 2PI2E 1NY4A 4JI6L 1XJVA 3HOUG 3UDFA 5FLMG 2E2JH 3KOJA 1UE7A 2Q2UA 4AYBG 4JI8Q 1H4QA 3QO5A 2HIXA 1KL9A 2ZNJA 3VBBA 1N34L 4QIWE 2UUBQ 4XIGS 5M3MG 3S16H 3S2DH 4TQUS 1N34Q 3RKXA 4XU0A 2ZR2A 4AQYL 4K0KQ 5M5XH 4Y7NH 2ZT8A 4TVWA 3U4VA 4A3KH 4BA2I 1X6OA 4PG3A 2JE6I 5IWAL 4K0KL 2ALYB 5AJ3L 1NMFA 4LFBL 1G5HA 1X55A 4O2DA 3RZOH 5GAHC 2LXJA 2Q2IA 2Q7GA 2DQ3A 2ZXFA 1GVPA 3GDEA 1X9NA 1B76A 1PH7A 3CD6A 4IPHA 3PGZA 3L0OA 4DUZQ 2KBNA 3TRZA 1IYJB 5M5YH 5JJKA 4YREA 4HA8A 2DXUA 1NJ8A 4EX5A 3UDGA 3GTGH 4YDQA 3K81C 3K7UC 3UDXA 2R7FA 1YJWA 1H95A 1XNQL 2PQAB 1K0RA 1TWHH 2ZM6Q 2R92H 4AH6A 3L2ZA 1HJPA 3NENA 4A76A 3M9BA 2Y0SG 3M85A 3F8TA 4R4OA 1YNXA 4P3OA 5GAEC 3V7RA 1C0AA 3IKMB 2GVAA 3A5YA 3UDIA 4DKAC 3PO3H 4CH4A 2UUAL 4NXMQ 2PMFA 3RLFA 4DNIA 4PZ8A 1HZCA 4H2SA 1E22A 1VQ9A 4YYEA 4DR4L 4GKKQ 5IP9G 2I5MX 4XTCS 3LSSA 3HFVA 4CS3A 3AFPA 3WQZA 4JI0Q 4KI0A 1IXRA 4DV5L 1BIAA 2MNAA 1C7YA 4OWTB 5IYCH 1HC7A 1AH9A 1BBUA 2K5VA 3M3YH 2EL9A 4A93G 2NN6I 1YI2A 3E0EA 3ER0A 4A4IA 2I4MA 2E8GA 1X3EA 3HRKA 1XTDA 1J5WA 1Q46A 1HTTA 2IHEA 4A3CG 1YITA 5M3MH 1FL0A 1UEBA 3GTOH 3BFMA 5EAYA 1D8LA 1FJGQ 4DV7Q 3G4SA 2K4KA 2QHVA 2E5LL 2C35B 3BZKA 2KENA 4DR7Q 1NTGA 1YFTA 2NVTH 1JB7A 1JJCA 1U5KA 1VQLA 1FJGL 3P8TA 2UXBL 1YHBA 4MZ9A 4A3JH 3PUXA 4YWLA 4P74C 2FXQA 2JA6G 1TWFH 5LMUQ 4B3SQ 4PHCA 4H02A 2ID0A 3PUZA 1VQBA 3KF6B 1B70B 3I4MG 3OYYA 4XU2A 2CJBA 5IY0A 3HKZG 1N33L 2VUMG 5LMUL 4B3SL 2VQFL 5IYBG 1NMGA 2ES2A 3HY1A 1GKHA 2VQEQ 1TWCH 1X2GA 1PYBA 3A74A 4DR6Q 1X2HA 1N33Q 2K52A 1L2FA 1E1TA 1GGMA 5IYDH 1XMOL 1EIYB 5LMNL 3T1HL 1PH2A 4P71A 4IFDG 2R7ZH 4LF6Q 5C44G 3UH0A 1PYSB 3PZCA 1WOCA 5LMNQ 4JC0A 2JA7H 4P73A 4LF7Q 2R93H 1WPYA 4P3PA 4TVYA 3RACA 1VQCA 2ZT7A 4YHHQ 2F4VQ 3QTCA 2ZCEA 4B3TL 2WAQE 4JYAL 1N36Q 3R07A 4LF7L 2AHOB 4DPGA 5M3FH 2UUCQ 1B70A 4DV1Q 3I4MH 1KD1C 3ULLA 4JBMA 4DV0L 1QUQB 4TWAA 2VUMH 2HHHL 1VQ5A 3PSIA 4TVAA 1HR0W 3V7CA 4L5TA 2UXDL 1K9MC 2OTJA 5C0XJ 2LXKA 3CCJA 1AE2A 1Q1BA 1A8VA 1EFWA 4DV3L 4DR2L 4A3IH 1SN8A 3U4ZA 1PH3A 1NBWA 1G291 1I3QH 2DDZA 3PCOB 1CKNA 4AIMA 4GN3B 2AKWB 3GTKH 3TS0A 3M7NA 1I6HH 3J7ZC 1EVLA 4DV3Q 1VQGA 4YRPA 2E2HH 2KCMA 4POFA 4C3IH 4JI4Q 3DM3A 3JAMc 2DTHA 1CSPA 4KR3A 4DV6L 4YWKA 4RDXA 2BA1A 2I5HA 2R92G 1VQZA 3P8YA 4LNSA 1Y1VH 1NYQA 4DK3C 5M3FG 3PIPA 1XMOQ 1XPUA 4BBRG 4BW9A 4OX9L 3V7SA 4KQEA 4L87A 3S17H 3A0JA 4DUYQ 5C0XG 3EIVA 1Y1WH 1SMXA 2CQOA 1IBLL 1WQWA 2VS1A 4BY7H 1DGSA 1WI5A 5IT9c 4JI7Q 3KFUA 1LTLA 4JI5Q 2PI2A 1I5FA 4A3DG 1IBML 4Q15A 1QF6A 3NELA 4GLAC 4YHHL 4C3JH 1W2BA 4HIKA 2PNHA 1NJ6A 2JA8H 4DQ2A 1VQFA 3GTPH 4PZ7A 2DEQA 3M4QA 5IP9H 4HWSA 1QVCA 2DXTA 3I7FA 5JEAG 1HZAA 4LNQA 1QZHA 5JEAJ 4DR3L 4LFBQ 2IHFA 4NB3A 3PUYA 2MFIA 4A3MG 2F52A 2IX0A 5C4XH 1X01A 1RIPA 1NYRA 4QL5A 2A1AA 1RIQA 2JA7G 1X3FA 1VQAA 1XPOA 1Y14B 1HNXL 4IPCA 3KDFB 1G6PA 1VQHA 1S40A 3F1ZA 3H3VH 2CGHA 3RL6A 3CQZH 4XTUA 3EBEA 4H2YA 2B29A 4B3RL 4BY7G 1S3OA 4JI4L 1HNXQ 3CMEA 2XTIA 2CFMA 1VQDA 1WJJA 4K86A 3V8JA 4HJ5A 4XTXA 3KF6A 4OWWB 5IYCG 2E41A 3OTOQ 2B63H 2VZAA 5FJ8G 2DTOA 4BBSG 2JA5G 3AYHB 4HJ8A 3GD7A 3EN2A 3HXWA 4A75A 4IOCA 2EIFA 3NBHB 3G1ZA 4YRTA 4P3NA 2P0LA 5JJIA 2CJAA 3RN5A 2QHUA 3RLOA 1TWGH 1HNWL 4A3GG 2UUAQ 2JJQA 2KCTA 1IZ6A 4PMWA 4A3MH 1KMMA 2ZIMA 1OXVA 5HY6A 2RF4A 4XTYA 3CCLA 2JEBI 4DUYL 1YZ6A 2N3SA 3REUA 4YY3L 2WFWA 2R7DA 4DUZL 2ARSA 1IBMQ 1BBWA 1PH5A 1AE3A 2KHJA 4A3BG 2CWPA 2E5AA 2AMCB 4YPFA 1JJ2A 1XNQQ 1E1OA 2NZHA 2H5XA 1OTCA 1EQQA 4JI6Q 4OO1G 2C8MA 1N32Q 2MQHA 4DV2L 3A7UA 4HJ9A 2HIVA 1J5EL 3PIOA 2Q7EA 4LF8Q 4GNXB 4LF9Q 3TS2A 1CUKA 4OP0A 1LYLA 4JBKA 3K0XA 1J5EQ 4RMFA 2YTVA 3S1QH 3S1RH 4C3HH 1MIUA 3CCUA 1SERA 1PYSA 2R7ZG 2EWNA 3UGTA 1KHIA 2ZZFA 1EIYA 4BWAA 3LC0A 4DAYB 2OWOA 2WP8J 4K88A 4A3IG 2F3IA 3Q8DA 2YU9H 2R93G 2DJZA 3VQYA 3W1GA 2ZR3A 1S72A 3H3VI 4R4QA 3T1YQ 1KOGA 4GS3A 4YRNA 4A3BH 3RKWA 1QE0A 2D62A 1X56A 3I4OA 3T1YL 3S15H 3GO5A 1I94Q 1Z7MA 2YTXA 4UY8C 4MTNA 1K83H 1R9TH 4R1JA 4JV5Q 1GO3E 5C51B 1WYDA 1Q86C 3P8VA 1JJGA 4GOPC 4X66Q 2ZJRA 1VQEA 2EJGA 4A3EG 4KHPL 4IJLA 1CKOA 3HTZA 5C3EG 3RZDH 4GKJQ 4DV7L 5M5WH 4IFDI 3CXCA 2IT1A 4XTVA 4WJ3M 1EUJA 3WWVA 5DLQE 1U0LA 2DKGA 2Q5HA 1EYGA 4TVAB 3UE1A 2ZGWA 4YRJA 4C2MH 1QUQA 4DK6C 1LM0A 4A3CH 2Y0SE 4GOPB 2LSSA 1WQ7A 3FP9A 2VQEL 4L5QA 4POGA 1K73C 1PH8A 4IPDA 3H0GH 1PHJA 3L7ZC 3K7AH 4ME3A 1JT8A 4H2VA 3B6YA 4R4CA 4X6AH 5GADC 1Q8KA 4HVCA 4P72A 3D31A 3A7AA 2I4OA 1W66A 4KLKA 1HH2P 4JOIC 4X65L 3AQQA 5K1PA 1BIBA 4YRRA 1WFQA 1WCMH 5GQOA 2Q7HA 3J81i 1FYFA 1CKMA 2ZT5A 3ICEA 1USYA 1WLEA 3I55A 1SE8A 3IKLA 4HWPA 4J15A 3CCVA 2VW9A 5FLMH 4LUZA 5GAGC 1EWIA 4ZTUB 1VQPA 2ZJPA 2DVEA 2K75A 3HFZA 3FKIH 1VQIA 3HOXG 4DV0Q 2L15A 4YCVA 4OXPA 4R4TA 4JI1Q 5K1XA 4QGUA 2PMZE 1NJ1A 3TQYA 4LW1A 3RLNA 1O7IA 1YHQA 1Q7YC 3GTJH 4P74A 1OXXK 4XEMA 4DAMA 3VDYA 3KJPA 1WNLA 2EXDA 1ADYA 2N8NA 1MKHA 2ALYA 2I0QA 2EJ9A 1BVSA 4UP8A 4LFCQ 1YB3A 1CSQA 4EQ5A 2WAQG 2HQLA 1IL2A 1P16A 3D0FA 4HIMA 3W1BA 4HIOA 2ZTDA 3BJUA 2DQ0A 2BH2A 3LGJA 2DZCA 4H2TA 3HXXA 1VCIA 2VL6A 4BY1G 1ADJA 2OQ0A 1VQKA 1V43A 4OX9Q 4NXML 1PA6A 3T1HQ 4ZIBA 2KHIA 3JAMi 4JBJA 3FKIG 2YYZA 4LF6L 5E7NA 4JYAQ 1NJ2A 3MF1A 1HNZQ 3ERRA 3KJOA 1GM5A 2JQOA 4TTVA 2ZZGA 4JI0L 2I4NA 2CIMA 4JOIA 4DR5L 1X3GA 3L1AA 1WU7A 2NVXH 2MO1A 4H2XB 1KXLA 5AJ3Q 1ATIA 1Z7NA 4CH5A 2UUCL 3ICAA 2C7IA 3JC66 3OD1A 1GD7A 2ARTA 1HZ9A 5J3BA 1VQ6A 3H0GG 5C52B 2JA6H 2EJFA 2E2IH 4G84A 4CH3A 2YV5A 1K3RA 3AFQA 1V9PA 4KR2A 5E3IA 1EQRA 4YP0A 4KHZA 2OQKA 4DR2Q 2JA9A 1IBKL 1UWVA 2OCEA 2JEAI 2D0PA 1XNRQ 4YRIA 3QO7A 1E3PA 3CCRA 2RHSA 4BXXH 2K5HA 2RHQB 2NVQH 1X65A 3KLWA 2ZINA 1X54A 3S14H 5IYDG 3S2HH 4RG1A 4CS2A 2EQSA 1XNRL 1QZGA 4R4IA 1BKBA 3K8AA 2J3MA 1N32L 4QJFA 3HOXH 3STBC 3I2ZA 3OTOL 4PZ6A 1QVGA 4JCVE 2CJ9A 1IBLQ 2ARUA 4YROA 2ZZEA 3M4PA 4WF2A 2Q2HA 1K8AC 1T9HA 2N78A 5IE8A 4CH6A 1H4TA 2AKWA 3CC2A 3W5OA 4TQDA 5IP7H 3J7A5 3HOVH 2E1HA 3HXVA 1SETA 2Q5IA 3PO2H 1HR0L 3J81c 1XMQQ 2QHSA 3VQWA 4H2WA 2I5LX 4X64Q 3IRBA 2K5NA 3VQXA 1VS0A 3OW2A 1PH4A 3HOYG 3HY0A 2N49A 4HWOA 4B3TQ 1JE5A 2QEXA 1N36L 2ZTEA 4DR5Q 2Z0SA 4B3ML 2IX1A 1FGUA 2E10A 3DSQA 1YJNA 5ELNA 3CCSA 3HOZG 3I4NH 3CF5A 3A5UA 3DLLA 2OTLA 1JMCA 4IJHA 3REXA 4B3MQ 2BA0A 1YHAA 4A3LG 5IWAQ 3HXYA 2A19A 2RHSB 1Z9FA 3CMQA 1D7QA 2E5LQ 1KRSA 4UPAA 1Q82C 2VNUD 4X62L 1KRTA 3HKZE 2AWOA 3G6EA 1I50H 4XU1A 11ASA 3NETA 3K80C 4A3FG 3E9HA 3RF1A 2J3LA 4P75C 3ZJYC 2PQAA 3G48A 1SFOH 1VQ8A 1H4SA 5BR8Q 1NJIC 2VQFQ 3U58A 1HNWQ 3L4GB 1Q81C 4NCXA 1W3SA 4ZTZB 4XEOA 3H15A 4DV4L 3HKSA 5BR8L 3EFSA 2K14A 1L1OC 4K87A 3I4NG 3HOZH 4YY3Q 3J81j 4DV4Q 1PFSA 3MEFA 3FJPA 2UUBL 1E7ZA 1HR0Q 4GLVB 3CC4A 3GTQH 4UP9A 4AYBE 3BU2A 1KC8C 4H2UA 4XTWA 1EVKA 5IYBH 3CCMA 1M90C 3PUVA 1CKNB 5F5WA 4DR4Q 3S1MH 4GKKL 3F2BA 2UXCL 5GROA 1UE5A 5HGQA 4X65Q 1A0IA 4HJ7A 3UE0A 4LUVA 1USYC 5C53B 1A63A 4OLFA 5JJLA 3CPWA 4A3FH 2QA4A 3V8KA 5FLXc 4JG2A 1PV4A 3V8LA 2CCZA 1UE6A 1OXSC 5C44H 3A32A 4DV2Q 5LMNW 2HT1A 4XTZA 1C9OA 4LF8L 4LF9L 4XU3A 1G51A 3MF2A 4YRMA 2DUDA 4HJAA 2RHQA 2DGYA 3TEGA 3FHWA 4BBRH 4A3KG 2CKZB 2DZ9A 2DTIA 1NE3A 5FJ8H 1PH1A 1ASYA 3PUWA 4BBSH 1B7YB 1J6QA 3M4OH 2GN5A 2JA5H 3RGLA 1M1KC 3BZCA 4DR7L 4GLXA 4LUOA 3KDFA 4CS4A 1ASZA 2Z6KA 4DR1Q 4GN4B 1KMNA 4Q6GA 3L4GA
chains in the Genus database with same CATH superfamily
1BCPB 2B8FA 2KJXA 1PVOA 3TREA 4FYDA 2XNAC 2AQ3B 1PTOC 3O13A 4DV6Q 2I4LA 1Q12A 4AYBB 1HPCA 4AQYQ 4BA1I 3RUZA 1HXYD 1TS4A 2B3GA 2QGQA 5EPJA 3A55A 5FLXL 1YIJA 1E24A 2PZTA 1K8GA 3QO2A 3MHBA 5T1IA 3KUPA 1HHVA 2ASBA 4QCLA 2P5ZX 2PMEA 1EU3A 2F03A 1EY5A 3RUXA 5BN4A 5I9OA 4TQFA 3SK6A 3MEYA 5C4XG 1WTOA 5ELFA 1TT2A 3A8KE 4LWCA 4K5WA 4S3SA 2I46A 4DR6L 2YTYA 1HZBA 2HDMA 2EXZA 1DJRD 1PH9A 4L5SA 5K36G 1LT3D 3DMUA 1PTOD 3NTIA 3SGIA 3DWAA 2DY8A 1YBYA 3OMGA 4JI5L 4ZKCB 5C3XA 3D3RA 3R2IA 3D4RA 3MXNA 4KD4A 4P71C 3HOWH 4HWTA 2A8VA 2NVYH 2AMCA 3T16A 1FYCA 1LACA 2JA7B 3P7JA 5J39A 1B7YA 2UXCQ 1VQ7A 1YEZA 3U50C 5G3LD 4YRCA 2DU5A 5CV6A 3F2CA 3C2PA 1FNWA 1JJCB 1A62A 4M1UB 1KDCA 4P73C 4NXNQ 3HOXB 1PRTD 2ZM6L 1GOZA 3HOVG 3OWFA 3PO2G 1HXDA 1P8LA 1TR5A 1SRUA 4KHVA 1YNJD 4GNXC 1Y1WG 3A7RA 1QG7A 4G85A 3PIO3 3CP0A 4APVA 1YFSA 2JYOA 4JI3Q 4NXNL 5FK9C 4WI1A 1L1OB 2IW3A 1NSNS 1Q8IA 3KLRA 4BY1H 4RQFA 1J9OA 3NQIA 4JBWA 3TDQA 1R4PB 1WCMG 4WJ4A 3TEHA 1K28A 1SYFA 1SNOA 3ERSX 1SDFA 1H9JA 4OIKA 3IALA 2ZNIA 3BDOA 1FD7D 3GTPB 1LT5D 1Z7TA 1BOSA 1U4PA 2MUYA 2DY7A 2QDLA 4JI3L 1MJCA 2K28A 5I2YA 1VQOA 2HNIA 1CA5A 3QNEA 3MXUA 1KAWA 2ODRD 4OO1I 2G5DA 1XPRA 1STYA 3QG1A 2F0NA 4KD3A 2WB1E 2ATWA 3CPFA 3GTKB 2DNCA 2HHHQ 1VQNA 2ZXOA 3ULPA 3CCQA 1OXUA 4YCUA 1IBKQ 3FRPB 5IP7G 4H13C 3GV6A 4YRKA 3AEVA 1L0WA 4OL7A 2B2TA 3S1NH 3HXZA 2ZJQA 4DAVA 2NBFA 3HOWG 4QQBX 3OIQA 1SE4A 4LAAA 1MHWC 3DUZA 1TKWB 2CW0D 3GTLH 3PV0A 3HRIA 4P72C 2Z6KC 4LFAQ 1NAPA 2JK8A 3G6JB 4DV5Q 2MP1A 2MO0A 4DR1L 1SE3A 4YRQA 1SLJA 3UFGA 4FDBA 4HWRA 3H6MA 2FMMA 1FR3A 3F2DA 2RCNA 2NN6G 5C3EH 2BH8A 4MIUA 4K6LA 4YIJA 2L12A 1YVCA 1SYGA 4K5XA 4XQNA 4RCNA 2Z6BA 4HMJA 3J80c 4IPGA 2EPBA 4EO4A 3CAMA 1SROA 3UGQA 1IYVA 5J1ZA 4X5OA 4A3JG 1UE1A 1ICWA 4PMBA 2FHTA 3RNUA 4JI1L 2PZWA 5K5PA 4YRLA 1JR0D 5C0XI 2ODRC 4UP7A 1OXTA 2NVYB 1LTGD 3L2PA 4A3LH 1BXTA 1YNND 2CVRA 2J4XA 4DK0A 4Y52H 4HCEA 1PTOF 1MGSA 5EPLA 2NZOA 3CCEA 4JV5L 4YCWA 1HFNA 3KK7A 12ASA 1KLUD 4ODGA 4A3IB 4JI7L 2WB1G 3TP6A 3STBD 2NYZD 1NNHA 3GTMB 3ULJA 3MXGA 5CGKA 1EOVA 3CW2C 3TZUA 2QHTA 1EIFA 2UU9L 4HIDA 2PQEA 1JWSD 1NJ5A 2E3CA 1XMQL 4PMCA 3TMEA 4QY7A 3R93A 4GKJL 2UXBQ 1H4VB 4XQQA 2ZTGA 3I56A 3CMAA 4GOPA 4Z9CB 4X64L 1YJ9A 3LSQA 1EYCA 4A3GH 3PF4A 3WOEA 1TWAH 1NUCA 3KYHC 1IYUA 2F0FA 4GN5A 3HGBA 2XWJB 3RIRA 3EFRA 4M8AA 4A93H 2FFKB 1N8RC 4DV1L 1UUPA 5M5XB 2JA6B 4GNXA 2EOTA 1B50A 1U4MA 2OF1A 5CV5A 4LFCL 2RKSA 2RBMA 4YRGA 1VQJA 2F0WA 1F77A 3A31A 4XXEA 4C1NI 3K5NA 2UXDQ 1VQMA 4H0LC 4E51A 4JI8L 5H1SE 1VF5C 4DR3Q 4I65A 1KQSA 1AZQA 1D6EC 1S5ED 1G5IA 4A3EH 3PCOA 2FYKA 2ZTCA 4L5RC 4OWXB 1DD2A 1SR3A 1CK1A 5AFWA 3S24A 4A3DH 3S17B 5I6YA 4BBRB 2NS6A 3V2TA 4O1NA 2E2JB 3HOYH 1HCZA 1VQ4A 2P5IA 3TEHB 3JAME 4LFAL 4P75A 3RKYA 1B53A 3MA2B 3IG2A 2EYFA 4OONA 3MEHA 1PDQA 1AZPA 3G71A 5KNNA 1QNKA 1HNZL 3VQVA 2RDFA 4ZUJA 4O0AA 4DU9A 3E9IA 3PF5A 2XGTA 2F4VL 4BXXG 1HRJA 1YGBA 2F0HA 4CJ1B 4B3RQ 2PW5A 1RL2A 1IW7C 3KF8B 2M9VA 2VY3A 4QUCA 3NWSA 3T13A 2DU7A 1BCPF 4J6HA 5EJWA 2GVBA 3RD4A 1Y69U 3S1MB 1HFGA 4B9XA 2R6GA 4ALPA 1I94L 3RR5A 3HOUH 1L1OA 1ZEQX 2B2YC 1B8AA 5FOBB 2NB0A 1HQMC 2CWAA 4CBVA 2ZIOA 1EQVA 5C4JH 4MNOA 3NTKA 4NPSA 5C4ZA 4ZRZA 1QVFA 4RQEA 1SESA 1CA6A 2NTTA 1O7YA 5TSSA 2B2VC 3CC7A 1H9MA 4X66L 3S14B 2E65A 4TKOB 1Q1EA 4KHPQ 1STNA 1CZWA 3H91A 4JI2Q 1PH6A 1EU4A 5KNBA 4Y7NB 3HOVB 4ZAIA 1SRYA 5ELOA 3MAQA 3HFZB 4YRFA 4K2KA 3GTMH 3HOZB 3S9WA 3J80i 1JOOA 1TIID 3KBXA 1ENAA 4YRSA 3A7AB 2EYOA 1TXYA 5CR3A 2E64A 2H4OA 3J7AF 1Y1VG 2PMZB 2V1CC 1F9RA 3NEMA 2SOBA 2ZT6A 4JI2L 4DK1A 1I4RA 1V1QA 3PO3G 1BUVT 3MXNB 4IOAA 3QO8A 3NE5B 4QF4A 1GUSA 2EY6A 4HSPA 4IO9A 4LF5Q 4LF4L 5IGBA 1QE6A 5A35A 4X62Q 1O7ZA 2F1MA 4MHEA 2UU9Q 2IY5A 5C0XH 1RF2D 2AWNA 4YWMA 4JVZA 2B63G 2EAYA 4X3KA 3A5ZB 1JC7A 3SVMA 1YFRA 2K5WA 1KABA 3FEWX 4KJNA 3W3SA 2D0OA 1Z47A 5I6WA 1PMRA 1N9WA 4LF4Q 3ITPA 1PXUA 1SNDA 4LF5L 4IFDJ 3A5ZA 3HXUA 2G4CA 5BN3A 2IY5B 1QNUA 1KIXA 1MJEA 1IKMA 3RN2A 4H2XA 1G91A 3TUPA 3E5SA 4RKBA 2JA8G 1WD1A 4HCSA 1LUZA 1FVIA 2Q2TA 2K50A 2PI2E 3R8BA 1NY4A 4JI6L 5EKIA 4WORA 1XJVA 3HOUG 2QDBA 1RKNA 3UDFA 2XWBB 5FLMG 5JVH3 3KOJA 2E2JH 3W3AA 1TS2A 1UE7A 2Q2UA 2O4XA 1D2BA 2R7ZB 5IOCA 2B2UC 4AYBG 1HQRD 4JI8Q 1H4QA 3QO5A 2HIXA 1KL9A 1G8ZD 2ZNJA 3VBBA 1G6ZA 1N34L 1EYAA 3OOCA 4QIWE 2UUBQ 4XIGS 5M3MG 3S16H 2A68D 2KA7A 4R8NA 3S2DH 3ONAB 4RAUC 4TQUS 2I07B 1W6KA 1ILQA 3L9AX 1N34Q 3A56A 3RKXA 4XU0A 3U9SA 2L11A 3A54A 2ZR2A 4Q0FA 4AQYL 4K0KQ 5M5XH 4Y7NH 3CRLC 5KIXA 1LTTD 2ZT8A 4TVWA 4RGTA 2F0LA 3BVZA 3U4VA 2E74C 4A3KH 3I8ZA 1SYCA 1HTLD 4BA2I 1X6OA 4PG3A 1KTKA 2F3WA 2JE6I 1EZ8A 2KECA 3TZDA 5IWAL 3NUCA 4K0KL 2ALYB 1RDPD 3NSWA 2D2CC 3SK5A 5AJ3L 1NMFA 4I7AA 1ENFA 5ISRA 2N55A 2F0MA 4LFBL 4N9TA 1G5HA 3PQIA 4UAIA 4ZYSA 1GUWA 2XRQD 5I9PA 2NVTB 4IUPA 5M3FB 1X55A 1HTPA 1CZGA 1TS3A 1IHZA 4IZ8A 4O2DA 3RZOH 5GAHC 2LXJA 2VB3X 1VMPA 2Q2IA 4C1NK 1PFMA 4C3HG 3L3OC 2Q7GA 1NCVA 2DQ3A 1WTWA 3HEJA 1YNNC 2ZXFA 1GVPA 3NP8A 3GDEA 1X9NA 1IL8A 3NQTA 1B76A 1PH7A 3CD6A 2F0EA 2EJGC 1SYEA 1S5FD 4IPHA 3PGZA 2EYJA 3L0OA 2KBNA 2KEEA 2SNMA 1IYJB 4DUZQ 3TRZA 5M5YH 4FXGC 5JJKA 4YREA 4HA8A 2DXUA 1NJ8A 2LY7A 4EX5A 3UDGA 3HG9A 3MXPA 3GTGH 4YDQA 2A6HC 3K81C 2AUJD 3K7UC 3UDXA 2R7FA 1EYDA 1YJWA 1H95A 1XNQL 1STGA 2ZXPA 3FKIB 2PQAB 1BQQT 2KCCA 4L63B 4CKBA 1K0RA 1TWHH 2ZM6Q 2R92H 3QWNA 1SJHD 4AH6A 3L2ZA 1NNXA 2KEDA 3AMUA 2F0OA 2WKCA 1HJPA 3NENA 1RCVD 4BWGB 4QUFA 4G7OC 3I4LA 4A76A 2X6LA 3M9BA 2Y0SG 4RHRA 3M85A 3F8TA 4Q5VA 4R4OA 2IX3A 2E76C 2ZXRA 4RH6A 1YNXA 4P3OA 1WCMB 5GAEC 3V7RA 3NK9A 3C3LA 1C0AA 3IKMB 1EY7A 2GVAA 3DXJC 5DM63 3S1NB 1NR2A 4EQOA 2JA8B 4LK1C 3A5YA 3UDIA 4DKAC 3PO3H 4CH4A 2UUAL 4NXMQ 2PMFA 2F0KA 3RLFA 2B2TC 1H9SA 4DNIA 1HUNA 5CBEE 4PZ8A 4TSSA 3OPOA 1DOMA 1HZCA 4H2SA 1DOLA 1E22A 3IFDA 2C5CA 1VQ9A 3J7AV 4YYEA 3H0GB 2A6HD 4DR4L 2JXMB 4GKKQ 5IP9G 2I5MX 4XTCS 3LSSA 3HFVA 4KV6A 4HEDA 1XYIA 4K14A 4CS3A 3TP5A 1S5CD 3AFPA 1SNQA 3WQZA 4JI0Q 4KI0A 1IXRA 4DV5L 1BIAA 2MNAA 1EEID 2LFNA 1C7YA 4BY1B 1STAA 4OWTB 4FF3A 1PTOB 5IYCH 1HC7A 5FO7B 1AH9A 2BE5D 1BBUA 4DFAA 2K5VA 3M3YH 5EBCA 1C8CA 4XDXA 2Q8TA 1CI3M 5JPMC 4A93G 2EL9A 4DGZA 5IIFA 2NN6I 1YI2A 3E0EA 3H09A 1TQOA 3ER0A 4A4IA 2I4MA 5EQ0A 3T51B 4X3TA 2E8GA 1X3EA 4FP5D 3HRKA 1XTDA 4KKSA 5C3WA 5COYA 1J5WA 1Q46A 1X32A 1HTTA 2IHEA 2EE1A 5LL6S 4A3CG 2CW0C 3V96A 1YITA 1DM0B 1FNUA 2EYPA 5C3EB 3A7LA 3CKIB 1FL0A 1UEBA 3MVVA 5M3MH 1XXGA 3GTOH 3DHQA 5FLXE 3BFMA 2ICIA 5EAYA 4X3SA 4EQNA 2QW7A 1J8IA 1D8LA 1ZYRD 1FJGQ 3EJIA 4DV7Q 1ESRA 1MSHA 3G4SA 1KDAA 2V4DA 5E4XA 2K4KA 2QHVA 4H7BA 1SNCA 3GTLB 2E5LL 2C35B 2MHVA 3BZKA 2KENA 4DR7Q 1E2VA 1NTGA 1STEA 1YFTA 2NVTH 1JB7A 4A3DB 1JJCA 1U5KA 1VQLA 1FJGL 3P8TA 2UXBL 1YHBA 1EZ6A 3WOFA 1JQYD 3BVMA 5CMDA 1JB3A 4HR7B 3QB3A 4MZ9A 1QCBD 4A3JH 1S5DD 3PUXA 4YWLA 4P74C 2FXQA 2JA6G 1TWFH 3NBIA 4PV1C 4WJWA 5LMUQ 2K01A 4A3KB 4B3SQ 2QCPX 3I4MB 3DWPA 4PHCA 4H02A 3I73A 2ID0A 2OT2A 3PUZA 1VQBA 3KF6B 1XWEA 1B70B 3I4MG 1STBA 2F0DA 3OYYA 4XU2A 2CJBA 5IY0A 2AQ1B 2NZ1D 2B8GA 3HKZG 1N33L 4FF1A 1SYBA 2VUMG 4KJOA 5LMUL 2VQFL 4B3SL 2KOLA 5IYBG 1F9PA 5ELDA 5KEEA 3D6WA 1NMGA 1HA6A 3BS1A 2ES2A 3HY1A 4KY5A 1GKHA 3CU7A 4RWSC 2VQEQ 1TWCH 2R93B 3K59A 1X2GA 1TWAB 1PYBA 2R61A 1TWFB 3A74A 4DR6Q 1X2HA 3T4AC 1N33Q 1D1KA 4F88A 2K52A 1L2FA 1E1TA 5EGTA 1GGMA 4QMGA 3SE0A 1D5ZC 4R8IA 5IYDH 2HUGA 1XMOL 5LMNL 3T1HL 2CQAA 1EIYB 2MGSA 2WIIB 1PH2A 2K5QA 1V1PA 4P71A 4IFDG 2R7ZH 4LF6Q 3IFTA 1EFID 2CH4W 5C44G 1EY0A 3UH0A 1PYSB 2RVLA 3GQBA 4KN4C 3DEOA 4LVKA 2HQEA 3PZCA 1WOCA 2A73B 5LMNQ 4JC0A 1JOQA 2JA7H 1R9TB 4P73A 4LF7Q 2R93H 1F2MA 1KLGD 4DNRB 1WPYA 4P3PA 4TVYA 3RACA 1VQCA 2K32A 2ZT7A 2F4IA 4YHHQ 2F4VQ 3Q23A 3QTCA 3OWEB 2ZCEA 2Q8IB 1ICFB 4B3TL 2NWGA 2WAQE 4JYAL 1N36Q 4IALA 2IJ0A 1EQTA 3R07A 1PYWD 2F0TA 4LF7L 2AHOB 2KVMA 4DPGA 4A3BB 2BE5C 3KLSX 4IUUA 5M3FH 2PYKA 1JWMD 3KF8A 2NN6H 2UUCQ 1B70A 3VR3A 4DV1Q 3I4MH 1KD1C 2MPMA 3ULLA 4JBMA 3LX0A 4CHTB 1PFNA 4DV0L 2SDFA 4A3JB 2YU9B 1QUQB 4TWAA 1I3QB 2VUMH 2HHHL 1VQ5A 3PSIA 2EJFC 4TVAA 1HR0W 3V7CA 4L5TA 2UXDL 2E75C 1K9MC 2OTJA 3D8GA 5C0XJ 3PO2B 2LXKA 3CCJA 1TU2B 1AE2A 1Q1BA 1A8VA 1EFWA 1G2TA 4DV3L 2LKVA 4DR2L 4A3IH 1SN8A 3U4ZA 1PH3A 1I4QA 1NBWA 1G291 1I3QH 2DDZA 2WB1B 3S1QB 3PCOB 1CKNA 3HKZB 4AIMA 4GN3B 2AKWB 3GP7A 3GTKH 3TS0A 3M7NA 1F2LA 1I6HH 1CHPD 3J7ZC 5CV4A 1K8OA 4KTAA 1EVLA 4ZUIA 4DV3Q 1VQGA 4YRPA 2DN8A 2E2HH 1IW7D 2KCMA 4POFA 4C3IH 4G7HC 4JI4Q 2RA4A 4BBSB 3DM3A 2DNEA 2D9UA 5EKLA 1WD0A 3JAMc 3BG3A 3G7LA 2DTHA 1YNJC 2QF7A 1CSPA 4PQXA 4KR3A 4DV6L 3SDZA 4YWKA 4RDXA 2BA1A 2I5HA 2R92G 1VQZA 2K04A 3P8YA 1SEBD 1F2ZA 4LNSA 1GHKA 1Y8PB 2WAQB 4UDUC 1Y1VH 5CV7A 1NYQA 4DK3C 5M3FG 3PIPA 1XMOQ 1XPUA 4BBRG 5KGUA 4BW9A 4OX9L 4FF2A 3V7SA 4KQEA 4NKLA 3TP8A 4L87A 3S17H 1WTXA 1SSOA 3A0JA 4DUYQ 5C0XG 3EIVA 1Y1WH 1SMXA 2CQOA 1IBLL 1EEFD 1WQWA 5IT9L 2VS1A 4BY7H 1DGSA 1WI5A 5IT9c 4JI7Q 3IKJA 1II3A 1K83B 1LTLA 4JI5Q 3CQZB 2PI2A 3KFUA 3J81L 5M5YB 1I5FA 4A3DG 1IBML 4Q15A 1QF6A 3NELA 4GLAC 4YHHL 1LTRD 3QOJA 4C3JH 1W2BA 3K7AB 2XRSD 4HIKA 2PNHA 5IODA 5JJZA 1NJ6A 1I4HA 3SK4A 2JA8H 4DQ2A 2J0TD 1VQFA 2E2DC 3GTPH 4PZ7A 2EY5A 2DEQA 4FF4A 3M4QA 5IP9H 4HWSA 3VYSA 3VR5A 1QVCA 1CFMA 1CT1D 2X69A 2DXTA 1QJOA 3V05A 3I7FA 5JEAG 1C48A 1L0YB 1HZAA 4LNQA 1A2UA 1QZHA 5JEAJ 2B63B 4DR3L 3C1EA 2O5IC 4O42A 2BOSA 2IHFA 4NB3A 3PUYA 4LFBQ 5D14A 1F9SA 4IFDH 2EYMA 1AN8A 3Q0AA 4CDDC 2MFIA 3HOUB 1ML0D 4A3MG 2F52A 1AW7A 2IX0A 5IGCA 5C4XH 5IT9E 1X01A 1RIPA 5EBDA 5KNCA 5K36H 1NYRA 4QL5A 2RSOA 1V1PB 2A1AA 4FVMA 1RIQA 2JA7G 1B3QA 1X3FA 1VQAA 3AB9A 4NMZA 4G57A 3GTGB 4RGMA 1XPOA 1Y14B 2L5TA 5LL6X 1HNXL 2BDNA 4NDXA 3W2DA 4IPCA 3KDFB 1G6PA 1VQHA 1S40A 3VR2A 4K2LA 3F1ZA 3H3VH 2CGHA 3F2UA 2LS01 3RL6A 3GTOB 4CGYB 3CQZH 1RODA 4XTUA 3EBEA 4H2YA 1XTCD 5NUCA 2B29A 4B3RL 4BY7G 1S3OA 1PZID 1LV9A 4JI4L 4HTHA 2M00A 2XTIA 3SK8A 2CFMA 3CMEA 1HNXQ 1DOKA 2F0GA 1VQDA 3ERQA 2G9DA 1WJJA 3E0JA 3FDTA 4ULLA 5C4XB 4K86A 3V8JA 1D5XC 2CHBD 4HJ5A 4XTXA 1BNZA 3KLSA 3KF6A 4OWWB 2XN9C 3K5LA 1JWUD 5IYCG 3A8JE 3A8IE 3FPPA 3M3YB 2E41A 3OTOQ 2JSOA 2B63H 4LVJA 2VZAA 3EFXD 3WDNA 5FJ8G 1WTQA 2DTOA 2HD3A 3S2HB 4BBSG 1LABA 5FO9B 4JK1C 2JA5G 3AYHB 4HJ8A 3GD7A 1SNMA 3EN2A 2XIWA 2NVQB 3HXWA 2NUCA 4A75A 1F9QA 5ELCA 4IOCA 2EIFA 3NBHB 3G1ZA 2X6GA 2B2YA 4P3NA 4YRTA 2P0LA 5A2QL 5JJIA 2CJAA 3RN5A 2QHUA 2O5JC 4FNFA 3RLOA 4KK7A 1TWGH 1HNWL 1B3AA 4A3GG 2UUAQ 2JJQA 3M4YA 2KCTA 3Q22A 1IZ6A 4PMWA 4A3MH 1CTMA 4LVLA 1KMMA 2ZIMA 1OXVA 4TRDA 5HY6A 2RF4A 4XTYA 1EY6A 5JAVA 2RQXA 3E6ZX 4G4KA 4C3IG 3CCLA 4R9WA 2JEBI 4DUYL 1YZ6A 2N3SA 3REUA 3PO3B 3HZXA 4HSVA 5ELBA 5CBAE 3ND8A 4CDFC 4YY3L 2WFWA 4HMIA 1M4VA 2R7DA 4DUZL 5L37A 2ARSA 2CH4A 1IBMQ 2WKDA 3CHBD 1BBWA 3OMCA 4XQJA 1PH5A 1AE3A 5IGDA 2KHJA 4FXKC 4A3BG 2CWPA 1NR4A 1KDBA 3DM1A 2JN4A 4N9PA 3QJYA 5I4DA 1BR9A 2E5AA 2AMCB 3PMFA 4YPFA 1JJ2A 1XNQQ 1E1OA 1O80A 2NZHA 5C44B 2H5XA 1OTCA 2AUKA 1ONLA 2HCIA 1EQQA 1Y8OB 4JI6Q 1EY9A 1R4QB 4OO1G 2C8MA 2R92B 4N8FA 4A3FB 1N32Q 2MQHA 4DV2L 2A6ED 3TBIB 3A7UA 4HJ9A 4MN3A 2HIVA 1J5EL 3PIOA 1A3VA 2Q7EA 4LF8Q 3D4DA 4GNXB 4LF9Q 1I4GA 3TS2A 1CUKA 4OP0A 2F0JA 1LYLA 1PRTB 2JP1A 4JBKA 2WINB 3K0XA 3U9OA 1LLRD 4RCOA 4IURA 1J5EQ 1I6HB 4RMFA 4DNTB 2YTVA 3S1QH 1B9MA 4C3HH 3S1RH 3X3MA 1I50B 1MIUA 3MFYA 3CCUA 2L1BA 1RHPA 1SERA 1PYSA 1RTNA 2R7ZG 2EWNA 3MTSA 1KAAA 3UGTA 5DNFA 3FMCA 3RZDB 3RZOB 2B39A 1KHIA 2ZZFA 1TY2A 1EIYA 4BWAA 3LC0A 1BBXC 4HAEA 4LVIA 1SE2A 4DAYB 2OWOA 2WP8J 4A3EB 4A3IG 4K88A 2F3IA 3Q8DA 2YU9H 2R93G 1BDOA 3J80E 2DJZA 3HP3A 3VQYA 1LTAD 2FMCA 3W1GA 1B9NA 4CJ2C 2ZR3A 1S72A 3H3VI 4R4QA 1D1IA 1UAPA 3T1YQ 1KOGA 4GS3A 4YRNA 3I4NB 1ZXTA 2B2WA 4A3BH 4ZK9B 3RKWA 1QE0A 4LJZC 2D62A 1ET6A 4DXFA 1A3UA 1X56A 3I4OA 3MWYW 3T1YL 5JVG3 3T56B 4I7ZC 4IUVA 3S15H 1JORA 3GO5A 3URYA 3VA7A 1I94Q 1Z7MA 5CC4A 2YTXA 1Q3LA 4UY8C 4MTNA 2O2LD 3DWQA 1K83H 4RGOS 1DYQA 1R9TH 1EL0A 4R1JA 2IPKD 4L8JA 4IUQA 1JICA 4JV5Q 1GO3E 4IN3A 5E3FA 1EOTA 1WTVA 5C51B 1WYDA 1Q86C 3P8VA 1JJGA 4GOPC 4X66Q 2ZJRA 4KMUC 1VQEA 2EJGA 3HOYB 4A3EG 1GJXA 4KHPL 4IJLA 1CKOA 2A8EA 3HTZA 2KUMA 1B4OA 5C3EG 3R3OA 3RZDH 1K3BC 3Q6SA 4CKCA 4GKJQ 4DV7L 5C5MA 4JW0A 5M5WH 4IFDI 3CXCA 4B08A 2IT1A 4XT3B 4XTVA 2EYHA 3T53B 3EROA 4G7ZC 4WJ3M 1QWYA 4H44C 4V0BA 4OIJA 1EUJA 2L4NA 3WWVA 2Y0SB 4LMQD 3TP7A 5IGEA 1L0XB 5DLQE 1U0LA 3CRKC 2EY2A 2DKGA 2Q5HA 2QEJC 1SMYD 1GUTA 4A93B 1GUGA 1EYGA 4TVAB 3UE1A 1U4RA 2ENBA 2ZGWA 5HURA 4YRJA 4C2MH 1WVLA 1QUQA 2SEBD 4XYQA 2A6EC 2A74C 1O7LA 2EY1A 3BYYB 4DK6C 1LM0A 4A3CH 4UHVA 3GTQB 2Y0SE 4GOPB 2LSSA 3E3XA 3DEPA 4DAYA 1WQ7A 5HGTA 3D4WA 2QKIC 3I90A 3FP9A 2VQEL 4HT4A 3OSOA 4L5QA 1LT4D 1STHA 3SXHA 4POGA 5J22A 5DEHA 1SMYC 3GTJB 1K73C 1PH8A 1U4LA 3N52A 3K57A 2VUMB 5FKAC 4IPDA 4E6IA 1QILA 3H0GH 1PHJA 3L7ZC 1AEXA 1B44D 2EYLA 3K7AH 4ME3A 1JT8A 4H2VA 4OO1H 2Z1CA 3B6YA 1DZ1A 3NWTA 4R4CA 4ILWA 4ID6A 1CM9A 4X6AH 1Q90A 5GADC 1Q8KA 3AU7A 4HVCA 4OEMB 2E2IB 4P72A 3D31A 2JA5B 2K05A 4F7XA 3A7AA 1W66A 2I4OA 4KLKA 1HH2P 4JOIC 4X65L 1Y1WB 3AQQA 4ZLTF 1BO0A 4RHSA 2K1BA 5K1PA 1BIBA 4V190 4YRRA 1WFQA 1JOKA 1WCMH 5GQOA 2Q7HA 1RD9D 2H1EA 2OEOA 2B2WC 3J81i 1FYFA 4J8QA 1CKMA 2EJMA 2ZT5A 4BS9A 3VR4A 3ICEA 1USYA 1WLEA 1A2TA 3I55A 1H9KA 1SE8A 5I2XA 3IKLA 4HWPA 4J15A 2PCFB 1LT6D 2K33A 3CCVA 2VW9A 5M5WB 5DAUA 4LUZA 5GAGC 5FLMH 3SEBA 1EWIA 4ZTUB 1VQPA 3OHXC 2ZJPA 2DVEA 2K75A 3HFZA 3FKIH 1VQIA 3HOXG 1JE4A 4DV0Q 2L15A 4YCVA 2K6AA 4OXPA 4R4TA 3P75A 4JI1Q 5K1XA 1H9RA 2C9OA 2E2HB 3VYUA 4QGUA 2PMZE 1AFPA 4X3UA 4XYOA 1NJ1A 5EKKA 1TWCB 3HOWB 4NW2A 3TQYA 4F87A 1VDZA 4LW1A 1FGBD 3RLNA 2GA4B 1O7IA 1YHQA 2RDGA 2QILA 3MC0B 3GTJH 1Q7YC 4P74A 1KNEA 1OXXK 5CYUA 4XEMA 4DAMA 2A5HA 3VDYA 4JPBW 4DA2A 3KJPA 1WNLA 4ZCKA 2EXDA 1EWCA 3C1FA 1ADYA 1SXTA 2N8NA 1MKHA 2ALYA 2I0QA 2EJ9A 1BVSA 1VMCA 3OW7A 2EZVA 3I70A 1QOHA 3NTHA 2NVXB 2B2UA 4UP8A 1LTSD 3HRZC 4LFCQ 1YB3A 1CSQA 4EQ5A 2WAQG 2HQLA 5C4JB 1IL2A 3P20A 4C2MB 1P16A 3ZYYX 1Y8NB 3VYRA 4CDEC 1PFBA 2A69D 1TWHB 3D0FA 4HIMA 3W1BA 4HIOA 1T5EA 2ZTDA 3BJUA 2DQ0A 2BH2A 3LGJA 2DZCA 4H2TA 2J7ZA 1EIGA 3HXXA 1SNPA 3LWEA 1VCIA 3LNNA 1O78A 2VL6A 4BY1G 3QOLA 1ADJA 2OQ0A 1VQKA 1V43A 4OX9Q 2SNSA 1PA6A 4NXML 3T1HQ 4ZIBA 3S16B 4C3JB 1SJED 4FXDA 2KHIA 3JAMi 4JBJA 3FKIG 5E1FA 2YYZA 3JAML 4LF6L 3BDCA 4RGNA 5E7NA 1QB5D 4K5VA 4RA8A 3RMHA 4JYAQ 3M4OB 1NJ2A 4BY7B 3MF1A 1MSGA 3UI2A 1EWHA 2WACA 2Z9HA 1HNZQ 3ERRA 3KJOA 3TSSA 4ZKBB 2IWHA 1MD2D 1GM5A 1LTBD 2JQOA 4FO2A 5D3IB 1Z6HA 4TTVA 3PIP3 3OIPA 3K58A 2ZZGA 1DCZA 1RTOA 5ELEA 4JI0L 4HN7A 1G2SA 2I4NA 1I4PA 2CIMA 2TSSA 4JOIA 4DR5L 1X3GA 3I3CA 3L1AA 2Z8LA 1TY0A 1WU7A 2NVXH 2MO1A 4H2XB 1KXLA 5AJ3Q 1ATIA 1Z7NA 4CH5A 2OXPA 2PZUA 4OHJA 3ND9A 2UUCL 3ICAA 2C7IA 3JC66 1KNAA 3OD1A 1GD7A 2ARTA 3VR6A 1HZ9A 4ME5A 3IAYA 4B9WA 5J3BA 1VQ6A 4C56C 4GZYC 3H0GG 5C52B 2EVBA 2JA6H 2B2VA 2EJFA 2RDHA 3S2DB 2E2IH 4U673 4G84A 4CH3A 2YV5A 3BZDB 1OO9B 1K3RA 5E4WC 3AFQA 3D6CA 1V9PA 2IL8A 4KR2A 2K7VA 2XSCA 4A3MB 5E3IA 1EQRA 4MTKA 4YP0A 4KHZA 2OQKA 4DR2Q 1ET9A 4LVMA 2PNRC 4KY7A 2JA9A 1E0BA 1SAPA 1TWGB 1IBKL 1UWVA 5KNDA 2OCEA 2JEAI 2A68C 2D0PA 1XNRQ 4YRIA 4L6TB 3QO7A 1LO5D 3EQLC 1E3PA 2FINB 1CHQD 2F0VA 3CCRA 2RHSA 4BXXH 2K5HA 2RSNA 2RHQB 2NVQH 1X65A 2BDOA 3KLWA 2ZINA 2AQ2B 1BF4A 1X54A 3S14H 1SYDA 1TS5A 2DJFC 5IYDG 3S2HH 4RG1A 4CS2A 2EQSA 1A6XA 1XNRL 2PPBC 1QZGA 4R4IA 1BKBA 3K8AA 2J3MA 3GV3A 1N32L 4QJFA 3HOXH 1DXMA 3STBC 2EDGA 3I2ZA 3OTOL 4PZ6A 1S4ZA 3P1HA 1QVGA 4JCVE 1SBBB 2KQ3A 1D5MC 2CJ9A 4DF7A 1IBLQ 1SFOB 1RJTA 2ARUA 4YROA 2NTSA 2ZZEA 1PZKD 3M4PA 4IUNA 4WF2A 3K0YA 3K6OA 2Q2HA 4EGVA 1K8AC 1T9HA 5D65A 2N78A 5IE8A 2D5DA 4CH6A 1H4TA 5LHY1 1GHJA 5IGFA 2AKWA 3CC2A 3C46A 2Z4HA 3VA5A 1PRTF 2FJ2A 3W5OA 4TQDA 5IP7H 1LTID 3J7A5 5D3DA 1WTHA 3HOVH 2E1HA 3HXVA 2DJGC 1SETA 2Q5IA 3PO2H 3MQZA 1HR0L 3K5MA 3J81c 1IKLA 1T5XD 3NBHA 5G3LF 1U9RA 1V8QA 4QIWB 4CKEA 1XMQQ 2QHSA 3VQWA 4H2WA 1F2YA 2I5LX 4X64Q 3IRBA 1ESFA 3BYTB 2K5NA 3VQXA 1GUNA 1VS0A 4EVOA 3OW2A 3FVQA 3I91A 4RFBA 1PH4A 4WRDA 4NP5A 2F0QA 4K6DA 4ABNA 1C4QA 3HOYG 3HY0A 2N49A 3EA6A 4HWOA 4ZQ3A 4B3TQ 1EIHA 1JE5A 1A15A 1A3TA 3J7YW 1V1OA 2QEXA 1N36L 2ZTEA 4DR5Q 1EY8A 2Z0SA 3X3NA 5T1GA 4EQPA 4B3ML 2IX1A 1FGUA 1FNVA 2E10A 4KY6A 2R3ZA 3DSQA 1YJNA 5ELNA 3CCSA 1PRTC 3I72A 3HOZG 3CF5A 3I4NH 3A5UA 3DLLA 1ZKOA 2Z4IA 2OTLA 1JMCA 4IJHA 3REXA 3LWUA 5KYIA 5DM73 4B3MQ 2BA0A 1YHAA 5IGGA 4A3LG 5IWAQ 1K0SA 3TN2A 3HXYA 2A19A 3J81E 1I6VC 2G9HD 2N88A 2RHSB 1Z9FA 3CMQA 1CQVA 1D7QA 2E5LQ 1KRSA 4UPAA 1Q82C 2F3VA 3H3VC 2K03A 2VNUD 4KKTA 1ENCA 1UEAB 4CDCC 2Q8RE 4X62L 1KRTA 1VF7A 5C6AA 3HKZE 3NPPA 2L55A 2AWOA 3G6EA 1Y1VB 3BDLA 1I50H 2ZT9C 4DAPA 4XU1A 2RCFA 5F2DA 3KBGA 11ASA 1XX8A 5C4HA 3NETA 3K80C 4DN4M 1H9SB 3K5OA 2KHSA 4K8JA 4A3FG 4J1MA 2ICEC 3E9HA 2A69C 4OGQC 3RF1A 2WV6D 2J3LA 4P75C 3BVGA 3ZJYC 3H94A 2PQAA 3G48A 4XT1B 1SFOH 1VQ8A 2HDLA 1H4SA 5BR8Q 1NJIC 2VQFQ 1WTPA 3U58A 1HNWQ 3L4GB 4IUTA 1Q81C 4IQZA 5CV8A 4NCXA 4K8IA 1W3SA 4ZTZB 1MBYA 4XEOA 4P2CB 4F8MA 4RKLA 3H15A 4DV4L 4A3GB 3HKSA 5EPKA 1S5BD 5JOBA 5KYLA 5BR8L 2TMPA 2L9HA 1PTOH 2HCCA 2K14A 3EFSA 1E2ZA 4N8X1 1HA5A 1L1OC 1PZJD 3I4NG 1GUOA 2M2LA 4YY3Q 3HOZH 4K87A 1K8MA 3J81j 4DV4Q 1PFSA 1PLFA 3MEFA 3FJPA 2UUBL 5JEAH 1E7ZA 1HR0Q 5FO8B 4GLVB 3CC4A 5CORA 3GTQH 4UP9A 4C3HB 3S1RB 4AYBE 3BU2A 4KN7C 3Q24A 1KC8C 4H2UA 4XTWA 1EVKA 5IYBH 3CCMA 3FPUB 1WTRA 1M8AA 3R2TA 1M90C 5M3MB 2F0PA 3M7GA 3PUVA 1CKNB 1X3PA 2F0IA 3J80L 1AP0A 1BCPD 5F5WA 4DR4Q 3S1MH 4GKKL 3HS0C 3F2BA 1GXDC 2UXCL 5A2QE 3VYTA 5GROA 1UE5A 5HGQA 4X65Q 1A0IA 4HJ7A 2VB2X 4LUVA 3UE0A 1USYC 5C53B 1ILPA 1HUMA 2K5DA 1ZYRC 4U68A 2XVSA 1JCKB 1A63A 1EY4A 4OLFA 5JJLA 3CPWA 3IL8A 4A3FH 2QA4A 5JPNC 3V8KA 5FLXc 1B1ZA 5KRUA 4JG2A 1PV4A 3V8LA 2CCZA 1UE6A 1OXSC 3QR8A 5C44H 1CQFA 3A32A 1UNSA 3NHHA 3EVQA 4DV2Q 3QIAA 4KKUA 5LMNW 3SR1A 2HT1A 4XTZA 1C9OA 3MZ5A 4LF8L 4LF9L 4XU3A 1G51A 3MF2A 4YRMA 1W6JA 3SHLA 4CJ0B 2DUDA 4HJAA 2RHQA 4OELB 2DGYA 3FHWA 4BBRH 3TEGA 4A3KG 2PW7A 2CKZB 2DZ9A 2F0SA 5FJ8H 1NE3A 1PH1A 2PO4A 2DTIA 1ASYA 3PUWA 5CV9A 5BN5A 4BBSH 1B7YB 2BCOA 1J6QA 3M4OH 2GN5A 4C3IB 2JA5H 4PNYA 4DXGA 3RGLA 3N6RA 3BZCA 3NXWA 4GLXA 1M1KC 4DR7L 1X3QA 4LUOA 2LMCB 4QB4A 3KDFA 2F0UA 5M9OA 1B2TA 1MI2A 1BCPC 2VXWA 1TVXA 4CS4A 3S15B 1E2WA 1ASZA 5C5LA 2L0CA 4C3JG 4WFN3 2MJ8A 2Z6KA 1DONA 4DR1Q 4GN4B 1KMNA 4Q6GA 2KCNA 3MFGA 1I4XA 3L4GA
chains in the Genus database with same CATH topology
1PVOA 3TREA 4DV6Q 2I4LA 1Q12A 4AQYQ 4BA1I 2B3GA 2QGQA 1YIJA 1E24A 1K8GA 2ASBA 2PMEA 3RUXA 4TQFA 3MEYA 5C4XG 4LWCA 4DR6L 2YTYA 1HZBA 1PH9A 4L5SA 5K36G 3SGIA 1YBYA 4JI5L 4P71C 3HOWH 4HWTA 2A8VA 2NVYH 2AMCA 1B7YA 2UXCQ 1VQ7A 1YEZA 3U50C 4YRCA 2DU5A 3F2CA 1JJCB 1A62A 4P73C 4NXNQ 2ZM6L 3HOVG 3PO2G 1HXDA 1P8LA 1SRUA 4GNXC 1Y1WG 3A7RA 4G85A 3CP0A 4APVA 1YFSA 4JI3Q 4NXNL 4WI1A 1L1OB 4BY1H 4RQFA 4JBWA 1WCMG 4WJ4A 3TEHA 3ERSX 3IALA 2ZNIA 4JI3L 1MJCA 1VQOA 2HNIA 3QNEA 1KAWA 2ODRD 4OO1I 1XPRA 2WB1E 2ATWA 3CPFA 2HHHQ 1VQNA 3ULPA 3CCQA 1OXUA 4YCUA 1IBKQ 5IP7G 4YRKA 3AEVA 1L0WA 3S1NH 3HXZA 2ZJQA 3HOWG 4QQBX 3GTLH 3PV0A 3HRIA 4P72C 2Z6KC 4LFAQ 2JK8A 4DV5Q 2MO0A 4DR1L 4YRQA 1SLJA 3UFGA 4FDBA 4HWRA 3F2DA 2RCNA 2NN6G 5C3EH 2BH8A 1YVCA 3J80c 4IPGA 4EO4A 3CAMA 1SROA 3UGQA 4X5OA 4A3JG 1UE1A 3RNUA 4JI1L 4YRLA 5C0XI 2ODRC 4UP7A 1OXTA 3L2PA 4A3LH 4Y52H 2NZOA 3CCEA 4JV5L 4YCWA 12ASA 4JI7L 2WB1G 3STBD 1NNHA 3ULJA 1EOVA 3CW2C 2QHTA 1EIFA 2UU9L 4HIDA 1NJ5A 2E3CA 1XMQL 4QY7A 4GKJL 2UXBQ 1H4VB 2ZTGA 3I56A 3CMAA 4GOPA 4X64L 1YJ9A 3LSQA 4A3GH 3PF4A 1TWAH 3KYHC 4GN5A 3RIRA 3EFRA 4A93H 1N8RC 4DV1L 4GNXA 4LFCL 4YRGA 1VQJA 3A31A 2UXDQ 1VQMA 4E51A 4JI8L 5H1SE 4DR3Q 1KQSA 1G5IA 4A3EH 3PCOA 2FYKA 2ZTCA 4L5RC 4OWXB 1SR3A 3S24A 4A3DH 2NS6A 3HOYH 1VQ4A 2P5IA 3TEHB 4LFAL 4P75A 3RKYA 3IG2A 4OONA 3G71A 5KNNA 1HNZL 3VQVA 4O0AA 3E9IA 3PF5A 2XGTA 2F4VL 4BXXG 1YGBA 4B3RQ 1RL2A 3KF8B 2VY3A 2DU7A 2GVBA 3HOUH 2R6GA 4ALPA 1I94L 3RR5A 1L1OA 1B8AA 2CWAA 2ZIOA 5C4JH 4MNOA 4NPSA 1QVFA 4RQEA 1SESA 3CC7A 4X66L 2E65A 1Q1EA 4KHPQ 4JI2Q 1PH6A 1SRYA 5ELOA 3HFZB 4YRFA 3GTMH 3J80i 4YRSA 1TXYA 2E64A 1Y1VG 2V1CC 3NEMA 2ZT6A 4JI2L 1V1QA 3PO3G 3MXNB 4IOAA 3QO8A 4IO9A 4LF5Q 4LF4L 4X62Q 2UU9Q 2IY5A 2AWNA 4YWMA 2B63G 2EAYA 3A5ZB 1YFRA 3W3SA 2D0OA 1Z47A 1N9WA 4LF4Q 4LF5L 4IFDJ 3A5ZA 3HXUA 2G4CA 2IY5B 1KIXA 1MJEA 3RN2A 4H2XA 3TUPA 2JA8G 1LUZA 1FVIA 2Q2TA 2K50A 2PI2E 1NY4A 4JI6L 1XJVA 3HOUG 3UDFA 5FLMG 2E2JH 3KOJA 1UE7A 2Q2UA 4AYBG 4JI8Q 1H4QA 3QO5A 2HIXA 1KL9A 2ZNJA 3VBBA 1N34L 4QIWE 2UUBQ 4XIGS 5M3MG 3S16H 3S2DH 4TQUS 1N34Q 3RKXA 4XU0A 2ZR2A 4AQYL 4K0KQ 5M5XH 4Y7NH 2ZT8A 4TVWA 3U4VA 4A3KH 4BA2I 1X6OA 4PG3A 2JE6I 5IWAL 4K0KL 2ALYB 5AJ3L 1NMFA 4LFBL 1G5HA 1X55A 4O2DA 3RZOH 5GAHC 2LXJA 2Q2IA 2Q7GA 2DQ3A 2ZXFA 1GVPA 3GDEA 1X9NA 1B76A 1PH7A 3CD6A 4IPHA 3PGZA 3L0OA 4DUZQ 2KBNA 3TRZA 1IYJB 5M5YH 5JJKA 4YREA 4HA8A 2DXUA 1NJ8A 4EX5A 3UDGA 3GTGH 4YDQA 3K81C 3K7UC 3UDXA 2R7FA 1YJWA 1H95A 1XNQL 2PQAB 1K0RA 1TWHH 2ZM6Q 2R92H 4AH6A 3L2ZA 1HJPA 3NENA 4A76A 3M9BA 2Y0SG 3M85A 3F8TA 4R4OA 1YNXA 4P3OA 5GAEC 3V7RA 1C0AA 3IKMB 2GVAA 3A5YA 3UDIA 4DKAC 3PO3H 4CH4A 2UUAL 4NXMQ 2PMFA 3RLFA 4DNIA 4PZ8A 1HZCA 4H2SA 1E22A 1VQ9A 4YYEA 4DR4L 4GKKQ 5IP9G 2I5MX 4XTCS 3LSSA 3HFVA 4CS3A 3AFPA 3WQZA 4JI0Q 4KI0A 1IXRA 4DV5L 1BIAA 2MNAA 1C7YA 4OWTB 5IYCH 1HC7A 1AH9A 1BBUA 2K5VA 3M3YH 2EL9A 4A93G 2NN6I 1YI2A 3E0EA 3ER0A 4A4IA 2I4MA 2E8GA 1X3EA 3HRKA 1XTDA 1J5WA 1Q46A 1HTTA 2IHEA 4A3CG 1YITA 5M3MH 1FL0A 1UEBA 3GTOH 3BFMA 5EAYA 1D8LA 1FJGQ 4DV7Q 3G4SA 2K4KA 2QHVA 2E5LL 2C35B 3BZKA 2KENA 4DR7Q 1NTGA 1YFTA 2NVTH 1JB7A 1JJCA 1U5KA 1VQLA 1FJGL 3P8TA 2UXBL 1YHBA 4MZ9A 4A3JH 3PUXA 4YWLA 4P74C 2FXQA 2JA6G 1TWFH 5LMUQ 4B3SQ 4PHCA 4H02A 2ID0A 3PUZA 1VQBA 3KF6B 1B70B 3I4MG 3OYYA 4XU2A 2CJBA 5IY0A 3HKZG 1N33L 2VUMG 5LMUL 4B3SL 2VQFL 5IYBG 1NMGA 2ES2A 3HY1A 1GKHA 2VQEQ 1TWCH 1X2GA 1PYBA 3A74A 4DR6Q 1X2HA 1N33Q 2K52A 1L2FA 1E1TA 1GGMA 5IYDH 1XMOL 1EIYB 5LMNL 3T1HL 1PH2A 4P71A 4IFDG 2R7ZH 4LF6Q 5C44G 3UH0A 1PYSB 4LVKA 3PZCA 1WOCA 5LMNQ 4JC0A 2JA7H 4P73A 4LF7Q 2R93H 1WPYA 4P3PA 4TVYA 3RACA 1VQCA 2ZT7A 4YHHQ 2F4VQ 3QTCA 2ZCEA 4B3TL 2WAQE 4JYAL 1N36Q 3R07A 4LF7L 2AHOB 4DPGA 5M3FH 2UUCQ 1B70A 4DV1Q 3I4MH 1KD1C 3ULLA 4JBMA 4DV0L 1QUQB 4TWAA 2VUMH 2HHHL 1VQ5A 3PSIA 4TVAA 1HR0W 3V7CA 4L5TA 2UXDL 1K9MC 2OTJA 5C0XJ 2LXKA 3CCJA 1AE2A 1Q1BA 1A8VA 1EFWA 4DV3L 4DR2L 4A3IH 1SN8A 3U4ZA 1PH3A 1NBWA 1G291 1I3QH 2DDZA 3PCOB 1CKNA 4AIMA 4GN3B 2AKWB 3GTKH 3TS0A 3M7NA 1I6HH 3J7ZC 1EVLA 4DV3Q 1VQGA 4YRPA 2E2HH 2KCMA 4POFA 4C3IH 4JI4Q 3DM3A 3JAMc 2DTHA 1CSPA 4KR3A 4DV6L 4YWKA 4RDXA 2BA1A 2I5HA 2R92G 1VQZA 3P8YA 4LNSA 1Y1VH 1NYQA 4DK3C 5M3FG 3PIPA 1XMOQ 1XPUA 4BBRG 4BW9A 4OX9L 3V7SA 4KQEA 4L87A 3S17H 3A0JA 4DUYQ 5C0XG 3EIVA 1Y1WH 1SMXA 2CQOA 1IBLL 1WQWA 2VS1A 4BY7H 1DGSA 1WI5A 5IT9c 4JI7Q 3KFUA 1LTLA 4JI5Q 2PI2A 1I5FA 4A3DG 1IBML 4Q15A 1QF6A 3NELA 4GLAC 4YHHL 4C3JH 1W2BA 4HIKA 2PNHA 1NJ6A 2JA8H 4DQ2A 1VQFA 3GTPH 4PZ7A 2DEQA 3M4QA 5IP9H 4HWSA 1QVCA 2DXTA 3I7FA 5JEAG 1HZAA 4LNQA 1QZHA 5JEAJ 4DR3L 4LFBQ 2IHFA 4NB3A 3PUYA 2MFIA 4A3MG 2F52A 2IX0A 5C4XH 1X01A 1RIPA 1NYRA 4QL5A 2A1AA 1RIQA 2JA7G 1X3FA 1VQAA 1XPOA 1Y14B 1HNXL 4IPCA 3KDFB 1G6PA 1VQHA 1S40A 3F1ZA 3H3VH 2CGHA 3RL6A 3CQZH 4XTUA 3EBEA 4H2YA 2B29A 4B3RL 4BY7G 1S3OA 4JI4L 1HNXQ 3CMEA 2XTIA 2CFMA 1VQDA 1WJJA 4K86A 3V8JA 4HJ5A 4XTXA 3KF6A 4OWWB 5IYCG 2E41A 3OTOQ 2B63H 4LVJA 2VZAA 5FJ8G 2DTOA 4BBSG 2JA5G 3AYHB 4HJ8A 3GD7A 3EN2A 3HXWA 4A75A 4IOCA 2EIFA 3NBHB 3G1ZA 4YRTA 4P3NA 2P0LA 5JJIA 2CJAA 3RN5A 2QHUA 3RLOA 1TWGH 1HNWL 4A3GG 2UUAQ 2JJQA 2KCTA 1IZ6A 4PMWA 4A3MH 4LVLA 1KMMA 2ZIMA 1OXVA 5HY6A 2RF4A 4XTYA 3CCLA 2JEBI 4DUYL 1YZ6A 2N3SA 3REUA 4YY3L 2WFWA 2R7DA 4DUZL 2ARSA 1IBMQ 1BBWA 1PH5A 1AE3A 2KHJA 4A3BG 2CWPA 2E5AA 2AMCB 4YPFA 1JJ2A 1XNQQ 1E1OA 2NZHA 2H5XA 1OTCA 1EQQA 4JI6Q 4OO1G 2C8MA 1N32Q 2MQHA 4DV2L 3A7UA 4HJ9A 2HIVA 1J5EL 3PIOA 2Q7EA 4LF8Q 4GNXB 4LF9Q 3TS2A 1CUKA 4OP0A 1LYLA 4JBKA 3K0XA 1J5EQ 4RMFA 2YTVA 3S1QH 3S1RH 4C3HH 1MIUA 3CCUA 1SERA 1PYSA 2R7ZG 2EWNA 3UGTA 1KHIA 2ZZFA 1EIYA 4BWAA 3LC0A 4LVIA 4DAYB 2OWOA 2WP8J 4K88A 4A3IG 2F3IA 3Q8DA 2YU9H 2R93G 2DJZA 3VQYA 3W1GA 2ZR3A 1S72A 3H3VI 4R4QA 3T1YQ 1KOGA 4GS3A 4YRNA 4A3BH 3RKWA 1QE0A 2D62A 1X56A 3I4OA 3T1YL 3S15H 3GO5A 1I94Q 1Z7MA 2YTXA 4UY8C 4MTNA 1K83H 1R9TH 4R1JA 4JV5Q 1GO3E 5C51B 1WYDA 1Q86C 3P8VA 1JJGA 4GOPC 4X66Q 2ZJRA 1VQEA 2EJGA 4A3EG 4KHPL 4IJLA 1CKOA 2A8EA 3HTZA 5C3EG 3RZDH 4GKJQ 4DV7L 5M5WH 4IFDI 3CXCA 2IT1A 4XTVA 4WJ3M 1EUJA 3WWVA 5DLQE 1U0LA 2DKGA 2Q5HA 1EYGA 4TVAB 3UE1A 2ZGWA 4YRJA 4C2MH 1QUQA 4DK6C 1LM0A 4A3CH 2Y0SE 4GOPB 2LSSA 1WQ7A 3FP9A 2VQEL 4HT4A 4L5QA 4POGA 1K73C 1PH8A 4IPDA 3H0GH 1PHJA 3L7ZC 3K7AH 4ME3A 1JT8A 4H2VA 3B6YA 4R4CA 4X6AH 5GADC 1Q8KA 4HVCA 4P72A 3D31A 3A7AA 2I4OA 1W66A 4KLKA 1HH2P 4JOIC 4X65L 3AQQA 5K1PA 1BIBA 4YRRA 1WFQA 1WCMH 5GQOA 2Q7HA 3J81i 1FYFA 1CKMA 2ZT5A 3ICEA 1USYA 1WLEA 3I55A 1SE8A 3IKLA 4HWPA 4J15A 3CCVA 2VW9A 5FLMH 4LUZA 5GAGC 1EWIA 4ZTUB 1VQPA 2ZJPA 2DVEA 2K75A 3HFZA 3FKIH 1VQIA 3HOXG 4DV0Q 2L15A 4YCVA 4OXPA 4R4TA 4JI1Q 5K1XA 4QGUA 2PMZE 1NJ1A 3TQYA 4LW1A 3RLNA 1O7IA 1YHQA 1Q7YC 3GTJH 4P74A 1OXXK 4XEMA 4DAMA 3VDYA 3KJPA 1WNLA 2EXDA 1ADYA 2N8NA 1MKHA 2ALYA 2I0QA 2EJ9A 1BVSA 4UP8A 4LFCQ 1YB3A 1CSQA 4EQ5A 2WAQG 2HQLA 1IL2A 1P16A 3D0FA 4HIMA 3W1BA 4HIOA 2ZTDA 3BJUA 2DQ0A 2BH2A 3LGJA 2DZCA 4H2TA 3HXXA 1VCIA 2VL6A 4BY1G 1ADJA 2OQ0A 1VQKA 1V43A 4OX9Q 4NXML 1PA6A 3T1HQ 4ZIBA 2KHIA 3JAMi 4JBJA 3FKIG 2YYZA 4LF6L 5E7NA 4JYAQ 1NJ2A 3MF1A 1HNZQ 3ERRA 3KJOA 1GM5A 2JQOA 4TTVA 2ZZGA 4JI0L 2I4NA 2CIMA 4JOIA 4DR5L 1X3GA 3L1AA 1WU7A 2NVXH 2MO1A 4H2XB 1KXLA 5AJ3Q 1ATIA 1Z7NA 4CH5A 2UUCL 3ICAA 2C7IA 3JC66 3OD1A 1GD7A 2ARTA 1HZ9A 5J3BA 1VQ6A 3H0GG 5C52B 2JA6H 2EJFA 2E2IH 4G84A 4CH3A 2YV5A 1K3RA 3AFQA 1V9PA 4KR2A 5E3IA 1EQRA 4YP0A 4KHZA 2OQKA 4DR2Q 4LVMA 2JA9A 1IBKL 1UWVA 2OCEA 2JEAI 2D0PA 1XNRQ 4YRIA 3QO7A 1E3PA 3CCRA 2RHSA 4BXXH 2K5HA 2RHQB 2NVQH 1X65A 3KLWA 2ZINA 1X54A 3S14H 5IYDG 3S2HH 4RG1A 4CS2A 2EQSA 1XNRL 1QZGA 4R4IA 1BKBA 3K8AA 2J3MA 1N32L 4QJFA 3HOXH 3STBC 3I2ZA 3OTOL 4PZ6A 1QVGA 4JCVE 2CJ9A 1IBLQ 2ARUA 4YROA 2ZZEA 3M4PA 4WF2A 2Q2HA 1K8AC 1T9HA 2N78A 5IE8A 4CH6A 1H4TA 2AKWA 3CC2A 3W5OA 4TQDA 5IP7H 3J7A5 3HOVH 2E1HA 3HXVA 1SETA 2Q5IA 3PO2H 3MQZA 1HR0L 3J81c 1XMQQ 2QHSA 3VQWA 4H2WA 2I5LX 4X64Q 3IRBA 2K5NA 3VQXA 1VS0A 3OW2A 1PH4A 3HOYG 3HY0A 2N49A 4HWOA 4B3TQ 1JE5A 2QEXA 1N36L 2ZTEA 4DR5Q 2Z0SA 4B3ML 2IX1A 1FGUA 2E10A 3DSQA 1YJNA 5ELNA 3CCSA 3HOZG 3I4NH 3CF5A 3A5UA 3DLLA 2OTLA 1JMCA 4IJHA 3REXA 4B3MQ 2BA0A 1YHAA 4A3LG 5IWAQ 3HXYA 2A19A 2RHSB 1Z9FA 3CMQA 1D7QA 2E5LQ 1KRSA 4UPAA 1Q82C 2VNUD 4X62L 1KRTA 3HKZE 2AWOA 3G6EA 1I50H 4XU1A 11ASA 3NETA 3K80C 4A3FG 3E9HA 3RF1A 2J3LA 4P75C 3ZJYC 2PQAA 3G48A 1SFOH 1VQ8A 1H4SA 5BR8Q 1NJIC 2VQFQ 3U58A 1HNWQ 3L4GB 1Q81C 4NCXA 1W3SA 4ZTZB 4XEOA 3H15A 4DV4L 3HKSA 5BR8L 3EFSA 2K14A 1L1OC 4K87A 3I4NG 3HOZH 4YY3Q 3J81j 4DV4Q 1PFSA 3MEFA 3FJPA 2UUBL 1E7ZA 1HR0Q 4GLVB 3CC4A 3GTQH 4UP9A 4AYBE 3BU2A 1KC8C 4H2UA 4XTWA 1EVKA 5IYBH 3CCMA 1M90C 3PUVA 1CKNB 5F5WA 4DR4Q 3S1MH 4GKKL 3F2BA 2UXCL 5GROA 1UE5A 5HGQA 4X65Q 1A0IA 4HJ7A 3UE0A 4LUVA 1USYC 5C53B 1A63A 4OLFA 5JJLA 3CPWA 4A3FH 2QA4A 3V8KA 5FLXc 4JG2A 1PV4A 3V8LA 2CCZA 1UE6A 1OXSC 5C44H 3A32A 4DV2Q 5LMNW 2HT1A 4XTZA 1C9OA 4LF8L 4LF9L 4XU3A 1G51A 3MF2A 4YRMA 2DUDA 4HJAA 2RHQA 2DGYA 3TEGA 3FHWA 4BBRH 4A3KG 2CKZB 2DZ9A 2DTIA 1NE3A 5FJ8H 1PH1A 1ASYA 3PUWA 4BBSH 1B7YB 1J6QA 3M4OH 2GN5A 2JA5H 3RGLA 1M1KC 3BZCA 4DR7L 4GLXA 4LUOA 3KDFA 4CS4A 1ASZA 2Z6KA 4DR1Q 4GN4B 1KMNA 4Q6GA 3L4GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PVO A;  3TRE A;  4DV6 Q;  2I4L A;  1Q12 A;  4AQY Q;  4BA1 I;  2B3G A;  2QGQ A;  1YIJ A;  1E24 A;  1K8G A;  2ASB A;  2PME A;  3RUX A;  4TQF A;  3MEY A;  5C4X G;  4LWC A;  4DR6 L;  2YTY A;  1HZB A;  1PH9 A;  4L5S A;  5K36 G;  3SGI A;  1YBY A;  4JI5 L;  4P71 C;  3HOW H;  4HWT A;  2A8V A;  2NVY H;  2AMC A;  1B7Y A;  2UXC Q;  1VQ7 A;  1YEZ A;  3U50 C;  4YRC A;  2DU5 A;  3F2C A;  1JJC B;  1A62 A;  4P73 C;  4NXN Q;  2ZM6 L;  3HOV G;  3PO2 G;  1HXD A;  1P8L A;  1SRU A;  4GNX C;  1Y1W G;  3A7R A;  4G85 A;  3CP0 A;  4APV A;  1YFS A;  4JI3 Q;  4NXN L;  4WI1 A;  1L1O B;  4BY1 H;  4RQF A;  4JBW A;  1WCM G;  4WJ4 A;  3TEH A;  3ERS X;  3IAL A;  2ZNI A;  4JI3 L;  1MJC A;  1VQO A;  2HNI A;  3QNE A;  1KAW A;  2ODR D;  4OO1 I;  1XPR A;  2WB1 E;  2ATW A;  3CPF A;  2HHH Q;  1VQN A;  3ULP A;  3CCQ A;  1OXU A;  4YCU A;  1IBK Q;  5IP7 G;  4YRK A;  3AEV A;  1L0W A;  3S1N H;  3HXZ A;  2ZJQ A;  3HOW G;  4QQB X;  3GTL H;  3PV0 A;  3HRI A;  4P72 C;  2Z6K C;  4LFA Q;  2JK8 A;  4DV5 Q;  2MO0 A;  4DR1 L;  4YRQ A;  1SLJ A;  3UFG A;  4FDB A;  4HWR A;  3F2D A;  2RCN A;  2NN6 G;  5C3E H;  2BH8 A;  1YVC A;  3J80 c;  4IPG A;  4EO4 A;  3CAM A;  1SRO A;  3UGQ A;  4X5O A;  4A3J G;  1UE1 A;  3RNU A;  4JI1 L;  4YRL A;  5C0X I;  2ODR C;  4UP7 A;  1OXT A;  3L2P A;  4A3L H;  4Y52 H;  2NZO A;  3CCE A;  4JV5 L;  4YCW A;  12AS A;  4JI7 L;  2WB1 G;  3STB D;  1NNH A;  3ULJ A;  1EOV A;  3CW2 C;  2QHT A;  1EIF A;  2UU9 L;  4HID A;  1NJ5 A;  2E3C A;  1XMQ L;  4QY7 A;  4GKJ L;  2UXB Q;  1H4V B;  2ZTG A;  3I56 A;  3CMA A;  4GOP A;  4X64 L;  1YJ9 A;  3LSQ A;  4A3G H;  3PF4 A;  1TWA H;  3KYH C;  4GN5 A;  3RIR A;  3EFR A;  4A93 H;  1N8R C;  4DV1 L;  4GNX A;  4LFC L;  4YRG A;  1VQJ A;  3A31 A;  2UXD Q;  1VQM A;  4E51 A;  4JI8 L;  5H1S E;  4DR3 Q;  1KQS A;  1G5I A;  4A3E H;  3PCO A;  2FYK A;  2ZTC A;  4L5R C;  4OWX B;  1SR3 A;  3S24 A;  4A3D H;  3HOY H;  1VQ4 A;  2P5I A;  3TEH B;  4LFA L;  4P75 A;  3RKY A;  3IG2 A;  4OON A;  3G71 A;  5KNN A;  1HNZ L;  3VQV A;  4O0A A;  3E9I A;  3PF5 A;  2XGT A;  2F4V L;  4BXX G;  1YGB A;  4B3R Q;  1RL2 A;  3KF8 B;  2VY3 A;  2DU7 A;  2GVB A;  3HOU H;  2R6G A;  4ALP A;  1I94 L;  3RR5 A;  1L1O A;  1B8A A;  2CWA A;  2ZIO A;  5C4J H;  4MNO A;  4NPS A;  1QVF A;  4RQE A;  1SES A;  3CC7 A;  4X66 L;  2E65 A;  1Q1E A;  4KHP Q;  4JI2 Q;  1PH6 A;  1SRY A;  5ELO A;  3HFZ B;  4YRF A;  3GTM H;  3J80 i;  4YRS A;  1TXY A;  2E64 A;  1Y1V G;  2V1C C;  3NEM A;  2ZT6 A;  4JI2 L;  1V1Q A;  3PO3 G;  3MXN B;  4IOA A;  3QO8 A;  4IO9 A;  4LF5 Q;  4LF4 L;  4X62 Q;  2UU9 Q;  2IY5 A;  2AWN A;  4YWM A;  2B63 G;  2EAY A;  3A5Z B;  1YFR A;  3W3S A;  2D0O A;  1Z47 A;  1N9W A;  4LF4 Q;  4LF5 L;  4IFD J;  3A5Z A;  3HXU A;  2G4C A;  2IY5 B;  1KIX A;  1MJE A;  3RN2 A;  4H2X A;  3TUP A;  2JA8 G;  1LUZ A;  1FVI A;  2Q2T A;  2K50 A;  2PI2 E;  1NY4 A;  4JI6 L;  1XJV A;  3HOU G;  3UDF A;  5FLM G;  2E2J H;  3KOJ A;  1UE7 A;  2Q2U A;  4AYB G;  4JI8 Q;  1H4Q A;  3QO5 A;  2HIX A;  1KL9 A;  2ZNJ A;  3VBB A;  1N34 L;  4QIW E;  2UUB Q;  4XIG S;  5M3M G;  3S16 H;  3S2D H;  4TQU S;  1N34 Q;  3RKX A;  4XU0 A;  2ZR2 A;  4AQY L;  4K0K Q;  5M5X H;  4Y7N H;  2ZT8 A;  4TVW A;  3U4V A;  4A3K H;  4BA2 I;  1X6O A;  4PG3 A;  2JE6 I;  5IWA L;  4K0K L;  2ALY B;  5AJ3 L;  1NMF A;  4LFB L;  1G5H A;  1X55 A;  4O2D A;  3RZO H;  5GAH C;  2LXJ A;  2Q2I A;  2Q7G A;  2DQ3 A;  2ZXF A;  1GVP A;  3GDE A;  1X9N A;  1B76 A;  1PH7 A;  3CD6 A;  4IPH A;  3PGZ A;  3L0O A;  4DUZ Q;  2KBN A;  3TRZ A;  1IYJ B;  5M5Y H;  5JJK A;  4YRE A;  4HA8 A;  2DXU A;  1NJ8 A;  4EX5 A;  3UDG A;  3GTG H;  4YDQ A;  3K81 C;  3K7U C;  3UDX A;  2R7F A;  1YJW A;  1H95 A;  1XNQ L;  2PQA B;  1K0R A;  1TWH H;  2ZM6 Q;  2R92 H;  4AH6 A;  3L2Z A;  1HJP A;  3NEN A;  4A76 A;  3M9B A;  2Y0S G;  3M85 A;  3F8T A;  4R4O A;  1YNX A;  4P3O A;  5GAE C;  3V7R A;  1C0A A;  3IKM B;  2GVA A;  3A5Y A;  3UDI A;  4DKA C;  3PO3 H;  4CH4 A;  2UUA L;  4NXM Q;  2PMF A;  3RLF A;  4DNI A;  4PZ8 A;  1HZC A;  4H2S A;  1E22 A;  1VQ9 A;  4YYE A;  4DR4 L;  4GKK Q;  5IP9 G;  2I5M X;  4XTC S;  3LSS A;  3HFV A;  4CS3 A;  3AFP A;  3WQZ A;  4JI0 Q;  4KI0 A;  1IXR A;  4DV5 L;  1BIA A;  2MNA A;  1C7Y A;  4OWT B;  5IYC H;  1HC7 A;  1AH9 A;  1BBU A;  2K5V A;  3M3Y H;  2EL9 A;  4A93 G;  2NN6 I;  1YI2 A;  3E0E A;  3ER0 A;  4A4I A;  2I4M A;  2E8G A;  1X3E A;  3HRK A;  1XTD A;  1J5W A;  1Q46 A;  1HTT A;  2IHE A;  4A3C G;  1YIT A;  5M3M H;  1FL0 A;  1UEB A;  3GTO H;  3BFM A;  5EAY A;  1D8L A;  1FJG Q;  4DV7 Q;  3G4S A;  2K4K A;  2QHV A;  2E5L L;  2C35 B;  3BZK A;  2KEN A;  4DR7 Q;  1NTG A;  1YFT A;  2NVT H;  1JB7 A;  1JJC A;  1U5K A;  1VQL A;  1FJG L;  3P8T A;  2UXB L;  1YHB A;  4MZ9 A;  4A3J H;  3PUX A;  4YWL A;  4P74 C;  2FXQ A;  2JA6 G;  1TWF H;  5LMU Q;  4B3S Q;  4PHC A;  4H02 A;  2ID0 A;  3PUZ A;  1VQB A;  3KF6 B;  1B70 B;  3I4M G;  3OYY A;  4XU2 A;  2CJB A;  5IY0 A;  3HKZ G;  1N33 L;  2VUM G;  5LMU L;  4B3S L;  2VQF L;  5IYB G;  1NMG A;  2ES2 A;  3HY1 A;  1GKH A;  2VQE Q;  1TWC H;  1X2G A;  1PYB A;  3A74 A;  4DR6 Q;  1X2H A;  1N33 Q;  2K52 A;  1L2F A;  1E1T A;  1GGM A;  5IYD H;  1XMO L;  1EIY B;  5LMN L;  3T1H L;  1PH2 A;  4P71 A;  4IFD G;  2R7Z H;  4LF6 Q;  5C44 G;  3UH0 A;  1PYS B;  3PZC A;  1WOC A;  5LMN Q;  4JC0 A;  2JA7 H;  4P73 A;  4LF7 Q;  2R93 H;  1WPY A;  4P3P A;  4TVY A;  3RAC A;  1VQC A;  2ZT7 A;  4YHH Q;  2F4V Q;  3QTC A;  2ZCE A;  4B3T L;  2WAQ E;  4JYA L;  1N36 Q;  3R07 A;  4LF7 L;  2AHO B;  4DPG A;  5M3F H;  2UUC Q;  1B70 A;  4DV1 Q;  3I4M H;  1KD1 C;  3ULL A;  4JBM A;  4DV0 L;  1QUQ B;  4TWA A;  2VUM H;  2HHH L;  1VQ5 A;  3PSI A;  4TVA A;  1HR0 W;  3V7C A;  4L5T A;  2UXD L;  1K9M C;  2OTJ A;  5C0X J;  2LXK A;  3CCJ A;  1AE2 A;  1Q1B A;  1A8V A;  1EFW A;  4DV3 L;  4DR2 L;  4A3I H;  1SN8 A;  3U4Z A;  1PH3 A;  1NBW A;  1G29 1;  1I3Q H;  2DDZ A;  3PCO B;  1CKN A;  4AIM A;  4GN3 B;  2AKW B;  3GTK H;  3TS0 A;  3M7N A;  1I6H H;  3J7Z C;  1EVL A;  4DV3 Q;  1VQG A;  4YRP A;  2E2H H;  2KCM A;  4POF A;  4C3I H;  4JI4 Q;  3DM3 A;  3JAM c;  2DTH A;  1CSP A;  4KR3 A;  4DV6 L;  4YWK A;  4RDX A;  2BA1 A;  2I5H A;  2R92 G;  1VQZ A;  3P8Y A;  4LNS A;  1Y1V H;  1NYQ A;  4DK3 C;  5M3F G;  3PIP A;  1XMO Q;  1XPU A;  4BBR G;  4BW9 A;  4OX9 L;  3V7S A;  4KQE A;  4L87 A;  3S17 H;  3A0J A;  4DUY Q;  5C0X G;  3EIV A;  1Y1W H;  1SMX A;  2CQO A;  1IBL L;  1WQW A;  2VS1 A;  4BY7 H;  1DGS A;  1WI5 A;  5IT9 c;  4JI7 Q;  3KFU A;  1LTL A;  4JI5 Q;  2PI2 A;  1I5F A;  4A3D G;  1IBM L;  4Q15 A;  1QF6 A;  3NEL A;  4GLA C;  4YHH L;  4C3J H;  1W2B A;  4HIK A;  2PNH A;  1NJ6 A;  2JA8 H;  4DQ2 A;  1VQF A;  3GTP H;  4PZ7 A;  2DEQ A;  3M4Q A;  5IP9 H;  4HWS A;  1QVC A;  2DXT A;  3I7F A;  5JEA G;  1HZA A;  4LNQ A;  1QZH A;  5JEA J;  4DR3 L;  4LFB Q;  2IHF A;  4NB3 A;  3PUY A;  2MFI A;  4A3M G;  2F52 A;  2IX0 A;  5C4X H;  1X01 A;  1RIP A;  1NYR A;  4QL5 A;  2A1A A;  1RIQ A;  2JA7 G;  1X3F A;  1VQA A;  1XPO A;  1Y14 B;  1HNX L;  4IPC A;  3KDF B;  1G6P A;  1VQH A;  1S40 A;  3F1Z A;  3H3V H;  2CGH A;  3RL6 A;  3CQZ H;  4XTU A;  3EBE A;  4H2Y A;  2B29 A;  4B3R L;  4BY7 G;  1S3O A;  4JI4 L;  1HNX Q;  3CME A;  2XTI A;  2CFM A;  1VQD A;  1WJJ A;  4K86 A;  3V8J A;  4HJ5 A;  4XTX A;  3KF6 A;  4OWW B;  5IYC G;  2E41 A;  3OTO Q;  2B63 H;  2VZA A;  5FJ8 G;  2DTO A;  4BBS G;  2JA5 G;  3AYH B;  4HJ8 A;  3GD7 A;  3EN2 A;  3HXW A;  4A75 A;  4IOC A;  2EIF A;  3NBH B;  3G1Z A;  4YRT A;  4P3N A;  2P0L A;  5JJI A;  2CJA A;  3RN5 A;  2QHU A;  3RLO A;  1TWG H;  1HNW L;  4A3G G;  2UUA Q;  2JJQ A;  2KCT A;  1IZ6 A;  4PMW A;  4A3M H;  1KMM A;  2ZIM A;  1OXV A;  5HY6 A;  2RF4 A;  4XTY A;  3CCL A;  2JEB I;  4DUY L;  1YZ6 A;  2N3S A;  3REU A;  4YY3 L;  2WFW A;  2R7D A;  4DUZ L;  2ARS A;  1IBM Q;  1BBW A;  1PH5 A;  1AE3 A;  2KHJ A;  4A3B G;  2CWP A;  2E5A A;  2AMC B;  4YPF A;  1JJ2 A;  1XNQ Q;  1E1O A;  2NZH A;  2H5X A;  1OTC A;  1EQQ A;  4JI6 Q;  4OO1 G;  2C8M A;  1N32 Q;  2MQH A;  4DV2 L;  3A7U A;  4HJ9 A;  2HIV A;  1J5E L;  3PIO A;  2Q7E A;  4LF8 Q;  4GNX B;  4LF9 Q;  3TS2 A;  1CUK A;  4OP0 A;  1LYL A;  4JBK A;  3K0X A;  1J5E Q;  4RMF A;  2YTV A;  3S1Q H;  3S1R H;  4C3H H;  1MIU A;  3CCU A;  1SER A;  1PYS A;  2R7Z G;  2EWN A;  3UGT A;  1KHI A;  2ZZF A;  1EIY A;  4BWA A;  3LC0 A;  4DAY B;  2OWO A;  2WP8 J;  4K88 A;  4A3I G;  2F3I A;  3Q8D A;  2YU9 H;  2R93 G;  2DJZ A;  3VQY A;  3W1G A;  2ZR3 A;  1S72 A;  3H3V I;  4R4Q A;  3T1Y Q;  1KOG A;  4GS3 A;  4YRN A;  4A3B H;  3RKW A;  1QE0 A;  2D62 A;  1X56 A;  3I4O A;  3T1Y L;  3S15 H;  3GO5 A;  1I94 Q;  1Z7M A;  2YTX A;  4UY8 C;  4MTN A;  1K83 H;  1R9T H;  4R1J A;  4JV5 Q;  1GO3 E;  5C51 B;  1WYD A;  1Q86 C;  3P8V A;  1JJG A;  4GOP C;  4X66 Q;  2ZJR A;  1VQE A;  2EJG A;  4A3E G;  4KHP L;  4IJL A;  1CKO A;  3HTZ A;  5C3E G;  3RZD H;  4GKJ Q;  4DV7 L;  5M5W H;  4IFD I;  3CXC A;  2IT1 A;  4XTV A;  4WJ3 M;  1EUJ A;  3WWV A;  5DLQ E;  1U0L A;  2DKG A;  2Q5H A;  1EYG A;  4TVA B;  3UE1 A;  2ZGW A;  4YRJ A;  4C2M H;  1QUQ A;  4DK6 C;  1LM0 A;  4A3C H;  2Y0S E;  4GOP B;  2LSS A;  1WQ7 A;  3FP9 A;  2VQE L;  4L5Q A;  4POG A;  1K73 C;  1PH8 A;  4IPD A;  3H0G H;  1PHJ A;  3L7Z C;  3K7A H;  4ME3 A;  1JT8 A;  4H2V A;  3B6Y A;  4R4C A;  4X6A H;  5GAD C;  1Q8K A;  4HVC A;  4P72 A;  3D31 A;  3A7A A;  2I4O A;  1W66 A;  4KLK A;  1HH2 P;  4JOI C;  4X65 L;  3AQQ A;  5K1P A;  1BIB A;  4YRR A;  1WFQ A;  1WCM H;  5GQO A;  2Q7H A;  3J81 i;  1FYF A;  1CKM A;  2ZT5 A;  3ICE A;  1USY A;  1WLE A;  3I55 A;  1SE8 A;  3IKL A;  4HWP A;  4J15 A;  3CCV A;  2VW9 A;  5FLM H;  4LUZ A;  5GAG C;  1EWI A;  4ZTU B;  1VQP A;  2ZJP A;  2DVE A;  2K75 A;  3HFZ A;  3FKI H;  1VQI A;  3HOX G;  4DV0 Q;  2L15 A;  4YCV A;  4OXP A;  4R4T A;  4JI1 Q;  5K1X A;  4QGU A;  2PMZ E;  1NJ1 A;  3TQY A;  4LW1 A;  3RLN A;  1O7I A;  1YHQ A;  1Q7Y C;  3GTJ H;  4P74 A;  1OXX K;  4XEM A;  4DAM A;  3VDY A;  3KJP A;  1WNL A;  2EXD A;  1ADY A;  2N8N A;  1MKH A;  2ALY A;  2I0Q A;  2EJ9 A;  1BVS A;  4UP8 A;  4LFC Q;  1YB3 A;  1CSQ A;  4EQ5 A;  2WAQ G;  2HQL A;  1IL2 A;  1P16 A;  3D0F A;  4HIM A;  3W1B A;  4HIO A;  2ZTD A;  3BJU A;  2DQ0 A;  2BH2 A;  3LGJ A;  2DZC A;  4H2T A;  3HXX A;  1VCI A;  2VL6 A;  4BY1 G;  1ADJ A;  2OQ0 A;  1VQK A;  1V43 A;  4OX9 Q;  4NXM L;  1PA6 A;  3T1H Q;  4ZIB A;  2KHI A;  3JAM i;  4JBJ A;  3FKI G;  2YYZ A;  4LF6 L;  5E7N A;  4JYA Q;  1NJ2 A;  3MF1 A;  1HNZ Q;  3ERR A;  3KJO A;  1GM5 A;  2JQO A;  4TTV A;  2ZZG A;  4JI0 L;  2I4N A;  2CIM A;  4JOI A;  4DR5 L;  1X3G A;  3L1A A;  1WU7 A;  2NVX H;  2MO1 A;  4H2X B;  1KXL A;  5AJ3 Q;  1ATI A;  1Z7N A;  4CH5 A;  2UUC L;  3ICA A;  2C7I A;  3JC6 6;  3OD1 A;  1GD7 A;  2ART A;  1HZ9 A;  5J3B A;  1VQ6 A;  3H0G G;  5C52 B;  2JA6 H;  2EJF A;  2E2I H;  4G84 A;  4CH3 A;  2YV5 A;  1K3R A;  3AFQ A;  1V9P A;  4KR2 A;  5E3I A;  1EQR A;  4YP0 A;  4KHZ A;  2OQK A;  4DR2 Q;  2JA9 A;  1IBK L;  1UWV A;  2OCE A;  2JEA I;  2D0P A;  1XNR Q;  4YRI A;  3QO7 A;  1E3P A;  3CCR A;  2RHS A;  4BXX H;  2K5H A;  2RHQ B;  2NVQ H;  1X65 A;  3KLW A;  2ZIN A;  1X54 A;  3S14 H;  5IYD G;  3S2H H;  4RG1 A;  4CS2 A;  2EQS A;  1XNR L;  1QZG A;  4R4I A;  1BKB A;  3K8A A;  2J3M A;  1N32 L;  4QJF A;  3HOX H;  3STB C;  3I2Z A;  3OTO L;  4PZ6 A;  1QVG A;  4JCV E;  2CJ9 A;  1IBL Q;  2ARU A;  4YRO A;  2ZZE A;  3M4P A;  4WF2 A;  2Q2H A;  1K8A C;  1T9H A;  2N78 A;  5IE8 A;  4CH6 A;  1H4T A;  2AKW A;  3CC2 A;  3W5O A;  4TQD A;  5IP7 H;  3J7A 5;  3HOV H;  2E1H A;  3HXV A;  1SET A;  2Q5I A;  3PO2 H;  1HR0 L;  3J81 c;  1XMQ Q;  2QHS A;  3VQW A;  4H2W A;  2I5L X;  4X64 Q;  3IRB A;  2K5N A;  3VQX A;  1VS0 A;  3OW2 A;  1PH4 A;  3HOY G;  3HY0 A;  2N49 A;  4HWO A;  4B3T Q;  1JE5 A;  2QEX A;  1N36 L;  2ZTE A;  4DR5 Q;  2Z0S A;  4B3M L;  2IX1 A;  1FGU A;  2E10 A;  3DSQ A;  1YJN A;  5ELN A;  3CCS A;  3HOZ G;  3I4N H;  3CF5 A;  3A5U A;  3DLL A;  2OTL A;  1JMC A;  4IJH A;  3REX A;  4B3M Q;  2BA0 A;  1YHA A;  4A3L G;  5IWA Q;  3HXY A;  2A19 A;  2RHS B;  1Z9F A;  3CMQ A;  1D7Q A;  2E5L Q;  1KRS A;  4UPA A;  1Q82 C;  2VNU D;  4X62 L;  1KRT A;  3HKZ E;  2AWO A;  3G6E A;  1I50 H;  4XU1 A;  11AS A;  3NET A;  3K80 C;  4A3F G;  3E9H A;  3RF1 A;  2J3L A;  4P75 C;  3ZJY C;  2PQA A;  3G48 A;  1SFO H;  1VQ8 A;  1H4S A;  5BR8 Q;  1NJI C;  2VQF Q;  3U58 A;  1HNW Q;  3L4G B;  1Q81 C;  4NCX A;  1W3S A;  4ZTZ B;  4XEO A;  3H15 A;  4DV4 L;  3HKS A;  5BR8 L;  3EFS A;  2K14 A;  1L1O C;  4K87 A;  3I4N G;  3HOZ H;  4YY3 Q;  3J81 j;  4DV4 Q;  1PFS A;  3MEF A;  3FJP A;  2UUB L;  1E7Z A;  1HR0 Q;  4GLV B;  3CC4 A;  3GTQ H;  4UP9 A;  4AYB E;  3BU2 A;  1KC8 C;  4H2U A;  4XTW A;  1EVK A;  5IYB H;  3CCM A;  1M90 C;  3PUV A;  1CKN B;  5F5W A;  4DR4 Q;  3S1M H;  4GKK L;  3F2B A;  2UXC L;  5GRO A;  1UE5 A;  5HGQ A;  4X65 Q;  1A0I A;  4HJ7 A;  3UE0 A;  4LUV A;  1USY C;  5C53 B;  1A63 A;  4OLF A;  5JJL A;  3CPW A;  4A3F H;  2QA4 A;  3V8K A;  5FLX c;  4JG2 A;  1PV4 A;  3V8L A;  2CCZ A;  1UE6 A;  1OXS C;  5C44 H;  3A32 A;  4DV2 Q;  5LMN W;  2HT1 A;  4XTZ A;  1C9O A;  4LF8 L;  4LF9 L;  4XU3 A;  1G51 A;  3MF2 A;  4YRM A;  2DUD A;  4HJA A;  2RHQ A;  2DGY A;  3TEG A;  3FHW A;  4BBR H;  4A3K G;  2CKZ B;  2DZ9 A;  2DTI A;  1NE3 A;  5FJ8 H;  1PH1 A;  1ASY A;  3PUW A;  4BBS H;  1B7Y B;  1J6Q A;  3M4O H;  2GN5 A;  2JA5 H;  3RGL A;  1M1K C;  3BZC A;  4DR7 L;  4GLX A;  4LUO A;  3KDF A;  4CS4 A;  1ASZ A;  2Z6K A;  4DR1 Q;  4GN4 B;  1KMN A;  4Q6G A;  3L4G A; 
#chains in the Genus database with same CATH topology
 1BCP B;  2B8F A;  2KJX A;  1PVO A;  3TRE A;  4FYD A;  2XNA C;  2AQ3 B;  1PTO C;  3O13 A;  4DV6 Q;  2I4L A;  1Q12 A;  4AYB B;  1HPC A;  4AQY Q;  4BA1 I;  3RUZ A;  1HXY D;  1TS4 A;  2B3G A;  2QGQ A;  5EPJ A;  3A55 A;  5FLX L;  1YIJ A;  1E24 A;  2PZT A;  1K8G A;  3QO2 A;  3MHB A;  5T1I A;  3KUP A;  1HHV A;  2ASB A;  4QCL A;  2P5Z X;  2PME A;  1EU3 A;  2F03 A;  1EY5 A;  3RUX A;  5BN4 A;  5I9O A;  4TQF A;  3SK6 A;  3MEY A;  5C4X G;  1WTO A;  5ELF A;  1TT2 A;  3A8K E;  4LWC A;  4K5W A;  4S3S A;  2I46 A;  4DR6 L;  2YTY A;  1HZB A;  2HDM A;  2EXZ A;  1DJR D;  1PH9 A;  4L5S A;  5K36 G;  1LT3 D;  3DMU A;  1PTO D;  3NTI A;  3SGI A;  3DWA A;  2DY8 A;  1YBY A;  3OMG A;  4JI5 L;  4ZKC B;  5C3X A;  3D3R A;  3R2I A;  3D4R A;  3MXN A;  4KD4 A;  4P71 C;  3HOW H;  4HWT A;  2A8V A;  2NVY H;  2AMC A;  3T16 A;  1FYC A;  1LAC A;  2JA7 B;  3P7J A;  5J39 A;  1B7Y A;  2UXC Q;  1VQ7 A;  1YEZ A;  3U50 C;  5G3L D;  4YRC A;  2DU5 A;  5CV6 A;  3F2C A;  3C2P A;  1FNW A;  1JJC B;  1A62 A;  4M1U B;  1KDC A;  4P73 C;  4NXN Q;  3HOX B;  1PRT D;  2ZM6 L;  1GOZ A;  3HOV G;  3OWF A;  3PO2 G;  1HXD A;  1P8L A;  1TR5 A;  1SRU A;  4KHV A;  1YNJ D;  4GNX C;  1Y1W G;  3A7R A;  1QG7 A;  4G85 A;  3PIO 3;  3CP0 A;  4APV A;  1YFS A;  2JYO A;  4JI3 Q;  4NXN L;  5FK9 C;  4WI1 A;  1L1O B;  2IW3 A;  1NSN S;  1Q8I A;  3KLR A;  4BY1 H;  4RQF A;  1J9O A;  3NQI A;  4JBW A;  3TDQ A;  1R4P B;  1WCM G;  4WJ4 A;  3TEH A;  1K28 A;  1SYF A;  1SNO A;  3ERS X;  1SDF A;  1H9J A;  4OIK A;  3IAL A;  2ZNI A;  3BDO A;  1FD7 D;  3GTP B;  1LT5 D;  1Z7T A;  1BOS A;  1U4P A;  2MUY A;  2DY7 A;  2QDL A;  4JI3 L;  1MJC A;  2K28 A;  5I2Y A;  1VQO A;  2HNI A;  1CA5 A;  3QNE A;  3MXU A;  1KAW A;  2ODR D;  4OO1 I;  2G5D A;  1XPR A;  1STY A;  3QG1 A;  2F0N A;  4KD3 A;  2WB1 E;  2ATW A;  3CPF A;  3GTK B;  2DNC A;  2HHH Q;  1VQN A;  2ZXO A;  3ULP A;  3CCQ A;  1OXU A;  4YCU A;  1IBK Q;  3FRP B;  5IP7 G;  4H13 C;  3GV6 A;  4YRK A;  3AEV A;  1L0W A;  4OL7 A;  2B2T A;  3S1N H;  3HXZ A;  2ZJQ A;  4DAV A;  2NBF A;  3HOW G;  4QQB X;  3OIQ A;  1SE4 A;  4LAA A;  1MHW C;  3DUZ A;  1TKW B;  2CW0 D;  3GTL H;  3PV0 A;  3HRI A;  4P72 C;  2Z6K C;  4LFA Q;  1NAP A;  2JK8 A;  3G6J B;  4DV5 Q;  2MP1 A;  2MO0 A;  4DR1 L;  1SE3 A;  4YRQ A;  1SLJ A;  3UFG A;  4FDB A;  4HWR A;  3H6M A;  2FMM A;  1FR3 A;  3F2D A;  2RCN A;  2NN6 G;  5C3E H;  2BH8 A;  4MIU A;  4K6L A;  4YIJ A;  2L12 A;  1YVC A;  1SYG A;  4K5X A;  4XQN A;  4RCN A;  2Z6B A;  4HMJ A;  3J80 c;  4IPG A;  2EPB A;  4EO4 A;  3CAM A;  1SRO A;  3UGQ A;  1IYV A;  5J1Z A;  4X5O A;  4A3J G;  1UE1 A;  1ICW A;  4PMB A;  2FHT A;  3RNU A;  4JI1 L;  2PZW A;  5K5P A;  4YRL A;  1JR0 D;  5C0X I;  2ODR C;  4UP7 A;  1OXT A;  2NVY B;  1LTG D;  3L2P A;  4A3L H;  1BXT A;  1YNN D;  2CVR A;  2J4X A;  4DK0 A;  4Y52 H;  4HCE A;  1PTO F;  1MGS A;  5EPL A;  2NZO A;  3CCE A;  4JV5 L;  4YCW A;  1HFN A;  3KK7 A;  12AS A;  1KLU D;  4ODG A;  4A3I B;  4JI7 L;  2WB1 G;  3TP6 A;  3STB D;  2NYZ D;  1NNH A;  3GTM B;  3ULJ A;  3MXG A;  5CGK A;  1EOV A;  3CW2 C;  3TZU A;  2QHT A;  1EIF A;  2UU9 L;  4HID A;  2PQE A;  1JWS D;  1NJ5 A;  2E3C A;  1XMQ L;  4PMC A;  3TME A;  4QY7 A;  3R93 A;  4GKJ L;  2UXB Q;  1H4V B;  4XQQ A;  2ZTG A;  3I56 A;  3CMA A;  4GOP A;  4Z9C B;  4X64 L;  1YJ9 A;  3LSQ A;  1EYC A;  4A3G H;  3PF4 A;  3WOE A;  1TWA H;  1NUC A;  3KYH C;  1IYU A;  2F0F A;  4GN5 A;  3HGB A;  2XWJ B;  3RIR A;  3EFR A;  4M8A A;  4A93 H;  2FFK B;  1N8R C;  4DV1 L;  1UUP A;  5M5X B;  2JA6 B;  4GNX A;  2EOT A;  1B50 A;  1U4M A;  2OF1 A;  5CV5 A;  4LFC L;  2RKS A;  2RBM A;  4YRG A;  1VQJ A;  2F0W A;  1F77 A;  3A31 A;  4XXE A;  4C1N I;  3K5N A;  2UXD Q;  1VQM A;  4H0L C;  4E51 A;  4JI8 L;  5H1S E;  1VF5 C;  4DR3 Q;  4I65 A;  1KQS A;  1AZQ A;  1D6E C;  1S5E D;  1G5I A;  4A3E H;  3PCO A;  2FYK A;  2ZTC A;  4L5R C;  4OWX B;  1DD2 A;  1SR3 A;  1CK1 A;  5AFW A;  3S24 A;  4A3D H;  3S17 B;  5I6Y A;  4BBR B;  2NS6 A;  3V2T A;  4O1N A;  2E2J B;  3HOY H;  1HCZ A;  1VQ4 A;  2P5I A;  3TEH B;  3JAM E;  4LFA L;  4P75 A;  3RKY A;  1B53 A;  3MA2 B;  3IG2 A;  2EYF A;  4OON A;  3MEH A;  1PDQ A;  1AZP A;  3G71 A;  5KNN A;  1QNK A;  1HNZ L;  3VQV A;  2RDF A;  4ZUJ A;  4O0A A;  4DU9 A;  3E9I A;  3PF5 A;  2XGT A;  2F4V L;  4BXX G;  1HRJ A;  1YGB A;  2F0H A;  4CJ1 B;  4B3R Q;  2PW5 A;  1RL2 A;  1IW7 C;  3KF8 B;  2M9V A;  2VY3 A;  4QUC A;  3NWS A;  3T13 A;  2DU7 A;  1BCP F;  4J6H A;  5EJW A;  2GVB A;  3RD4 A;  1Y69 U;  3S1M B;  1HFG A;  4B9X A;  2R6G A;  4ALP A;  1I94 L;  3RR5 A;  3HOU H;  1L1O A;  1ZEQ X;  2B2Y C;  1B8A A;  5FOB B;  2NB0 A;  1HQM C;  2CWA A;  4CBV A;  2ZIO A;  1EQV A;  5C4J H;  4MNO A;  3NTK A;  4NPS A;  5C4Z A;  4ZRZ A;  1QVF A;  4RQE A;  1SES A;  1CA6 A;  2NTT A;  1O7Y A;  5TSS A;  2B2V C;  3CC7 A;  1H9M A;  4X66 L;  3S14 B;  2E65 A;  4TKO B;  1Q1E A;  4KHP Q;  1STN A;  1CZW A;  3H91 A;  4JI2 Q;  1PH6 A;  1EU4 A;  5KNB A;  4Y7N B;  3HOV B;  4ZAI A;  1SRY A;  5ELO A;  3MAQ A;  3HFZ B;  4YRF A;  4K2K A;  3GTM H;  3HOZ B;  3S9W A;  3J80 i;  1JOO A;  1TII D;  3KBX A;  1ENA A;  4YRS A;  3A7A B;  2EYO A;  1TXY A;  5CR3 A;  2E64 A;  2H4O A;  3J7A F;  1Y1V G;  2PMZ B;  2V1C C;  1F9R A;  3NEM A;  2SOB A;  2ZT6 A;  4JI2 L;  4DK1 A;  1I4R A;  1V1Q A;  3PO3 G;  1BUV T;  3MXN B;  4IOA A;  3QO8 A;  3NE5 B;  4QF4 A;  1GUS A;  2EY6 A;  4HSP A;  4IO9 A;  4LF5 Q;  4LF4 L;  5IGB A;  1QE6 A;  5A35 A;  4X62 Q;  1O7Z A;  2F1M A;  4MHE A;  2UU9 Q;  2IY5 A;  5C0X H;  1RF2 D;  2AWN A;  4YWM A;  4JVZ A;  2B63 G;  2EAY A;  4X3K A;  3A5Z B;  1JC7 A;  3SVM A;  1YFR A;  2K5W A;  1KAB A;  3FEW X;  4KJN A;  3W3S A;  2D0O A;  1Z47 A;  5I6W A;  1PMR A;  1N9W A;  4LF4 Q;  3ITP A;  1PXU A;  1SND A;  4LF5 L;  4IFD J;  3A5Z A;  3HXU A;  2G4C A;  5BN3 A;  2IY5 B;  1QNU A;  1KIX A;  1MJE A;  1IKM A;  3RN2 A;  4H2X A;  1G91 A;  3TUP A;  3E5S A;  4RKB A;  2JA8 G;  1WD1 A;  4HCS A;  1LUZ A;  1FVI A;  2Q2T A;  2K50 A;  2PI2 E;  3R8B A;  1NY4 A;  4JI6 L;  5EKI A;  4WOR A;  1XJV A;  3HOU G;  2QDB A;  1RKN A;  3UDF A;  2XWB B;  5FLM G;  5JVH 3;  3KOJ A;  2E2J H;  3W3A A;  1TS2 A;  1UE7 A;  2Q2U A;  2O4X A;  1D2B A;  2R7Z B;  5IOC A;  2B2U C;  4AYB G;  1HQR D;  4JI8 Q;  1H4Q A;  3QO5 A;  2HIX A;  1KL9 A;  1G8Z D;  2ZNJ A;  3VBB A;  1G6Z A;  1N34 L;  1EYA A;  3OOC A;  4QIW E;  2UUB Q;  4XIG S;  5M3M G;  3S16 H;  2A68 D;  2KA7 A;  4R8N A;  3S2D H;  3ONA B;  4RAU C;  4TQU S;  2I07 B;  1W6K A;  1ILQ A;  3L9A X;  1N34 Q;  3A56 A;  3RKX A;  4XU0 A;  3U9S A;  2L11 A;  3A54 A;  2ZR2 A;  4Q0F A;  4AQY L;  4K0K Q;  5M5X H;  4Y7N H;  3CRL C;  5KIX A;  1LTT D;  2ZT8 A;  4TVW A;  4RGT A;  2F0L A;  3BVZ A;  3U4V A;  2E74 C;  4A3K H;  3I8Z A;  1SYC A;  1HTL D;  4BA2 I;  1X6O A;  4PG3 A;  1KTK A;  2F3W A;  2JE6 I;  1EZ8 A;  2KEC A;  3TZD A;  5IWA L;  3NUC A;  4K0K L;  2ALY B;  1RDP D;  3NSW A;  2D2C C;  3SK5 A;  5AJ3 L;  1NMF A;  4I7A A;  1ENF A;  5ISR A;  2N55 A;  2F0M A;  4LFB L;  4N9T A;  1G5H A;  3PQI A;  4UAI A;  4ZYS A;  1GUW A;  2XRQ D;  5I9P A;  2NVT B;  4IUP A;  5M3F B;  1X55 A;  1HTP A;  1CZG A;  1TS3 A;  1IHZ A;  4IZ8 A;  4O2D A;  3RZO H;  5GAH C;  2LXJ A;  2VB3 X;  1VMP A;  2Q2I A;  4C1N K;  1PFM A;  4C3H G;  3L3O C;  2Q7G A;  1NCV A;  2DQ3 A;  1WTW A;  3HEJ A;  1YNN C;  2ZXF A;  1GVP A;  3NP8 A;  3GDE A;  1X9N A;  1IL8 A;  3NQT A;  1B76 A;  1PH7 A;  3CD6 A;  2F0E A;  2EJG C;  1SYE A;  1S5F D;  4IPH A;  3PGZ A;  2EYJ A;  3L0O A;  2KBN A;  2KEE A;  2SNM A;  1IYJ B;  4DUZ Q;  3TRZ A;  5M5Y H;  4FXG C;  5JJK A;  4YRE A;  4HA8 A;  2DXU A;  1NJ8 A;  2LY7 A;  4EX5 A;  3UDG A;  3HG9 A;  3MXP A;  3GTG H;  4YDQ A;  2A6H C;  3K81 C;  2AUJ D;  3K7U C;  3UDX A;  2R7F A;  1EYD A;  1YJW A;  1H95 A;  1XNQ L;  1STG A;  2ZXP A;  3FKI B;  2PQA B;  1BQQ T;  2KCC A;  4L63 B;  4CKB A;  1K0R A;  1TWH H;  2ZM6 Q;  2R92 H;  3QWN A;  1SJH D;  4AH6 A;  3L2Z A;  1NNX A;  2KED A;  3AMU A;  2F0O A;  2WKC A;  1HJP A;  3NEN A;  1RCV D;  4BWG B;  4QUF A;  4G7O C;  3I4L A;  4A76 A;  2X6L A;  3M9B A;  2Y0S G;  4RHR A;  3M85 A;  3F8T A;  4Q5V A;  4R4O A;  2IX3 A;  2E76 C;  2ZXR A;  4RH6 A;  1YNX A;  4P3O A;  1WCM B;  5GAE C;  3V7R A;  3NK9 A;  3C3L A;  1C0A A;  3IKM B;  1EY7 A;  2GVA A;  3DXJ C;  5DM6 3;  3S1N B;  1NR2 A;  4EQO A;  2JA8 B;  4LK1 C;  3A5Y A;  3UDI A;  4DKA C;  3PO3 H;  4CH4 A;  2UUA L;  4NXM Q;  2PMF A;  2F0K A;  3RLF A;  2B2T C;  1H9S A;  4DNI A;  1HUN A;  5CBE E;  4PZ8 A;  4TSS A;  3OPO A;  1DOM A;  1HZC A;  4H2S A;  1DOL A;  1E22 A;  3IFD A;  2C5C A;  1VQ9 A;  3J7A V;  4YYE A;  3H0G B;  2A6H D;  4DR4 L;  2JXM B;  4GKK Q;  5IP9 G;  2I5M X;  4XTC S;  3LSS A;  3HFV A;  4KV6 A;  4HED A;  1XYI A;  4K14 A;  4CS3 A;  3TP5 A;  1S5C D;  3AFP A;  1SNQ A;  3WQZ A;  4JI0 Q;  4KI0 A;  1IXR A;  4DV5 L;  1BIA A;  2MNA A;  1EEI D;  2LFN A;  1C7Y A;  4BY1 B;  1STA A;  4OWT B;  4FF3 A;  1PTO B;  5IYC H;  1HC7 A;  5FO7 B;  1AH9 A;  2BE5 D;  1BBU A;  4DFA A;  2K5V A;  3M3Y H;  5EBC A;  1C8C A;  4XDX A;  2Q8T A;  1CI3 M;  5JPM C;  4A93 G;  2EL9 A;  4DGZ A;  5IIF A;  2NN6 I;  1YI2 A;  3E0E A;  3H09 A;  1TQO A;  3ER0 A;  4A4I A;  2I4M A;  5EQ0 A;  3T51 B;  4X3T A;  2E8G A;  1X3E A;  4FP5 D;  3HRK A;  1XTD A;  4KKS A;  5C3W A;  5COY A;  1J5W A;  1Q46 A;  1X32 A;  1HTT A;  2IHE A;  2EE1 A;  5LL6 S;  4A3C G;  2CW0 C;  3V96 A;  1YIT A;  1DM0 B;  1FNU A;  2EYP A;  5C3E B;  3A7L A;  3CKI B;  1FL0 A;  1UEB A;  3MVV A;  5M3M H;  1XXG A;  3GTO H;  3DHQ A;  5FLX E;  3BFM A;  2ICI A;  5EAY A;  4X3S A;  4EQN A;  2QW7 A;  1J8I A;  1D8L A;  1ZYR D;  1FJG Q;  3EJI A;  4DV7 Q;  1ESR A;  1MSH A;  3G4S A;  1KDA A;  2V4D A;  5E4X A;  2K4K A;  2QHV A;  4H7B A;  1SNC A;  3GTL B;  2E5L L;  2C35 B;  2MHV A;  3BZK A;  2KEN A;  4DR7 Q;  1E2V A;  1NTG A;  1STE A;  1YFT A;  2NVT H;  1JB7 A;  4A3D B;  1JJC A;  1U5K A;  1VQL A;  1FJG L;  3P8T A;  2UXB L;  1YHB A;  1EZ6 A;  3WOF A;  1JQY D;  3BVM A;  5CMD A;  1JB3 A;  4HR7 B;  3QB3 A;  4MZ9 A;  1QCB D;  4A3J H;  1S5D D;  3PUX A;  4YWL A;  4P74 C;  2FXQ A;  2JA6 G;  1TWF H;  3NBI A;  4PV1 C;  4WJW A;  5LMU Q;  2K01 A;  4A3K B;  4B3S Q;  2QCP X;  3I4M B;  3DWP A;  4PHC A;  4H02 A;  3I73 A;  2ID0 A;  2OT2 A;  3PUZ A;  1VQB A;  3KF6 B;  1XWE A;  1B70 B;  3I4M G;  1STB A;  2F0D A;  3OYY A;  4XU2 A;  2CJB A;  5IY0 A;  2AQ1 B;  2NZ1 D;  2B8G A;  3HKZ G;  1N33 L;  4FF1 A;  1SYB A;  2VUM G;  4KJO A;  5LMU L;  2VQF L;  4B3S L;  2KOL A;  5IYB G;  1F9P A;  5ELD A;  5KEE A;  3D6W A;  1NMG A;  1HA6 A;  3BS1 A;  2ES2 A;  3HY1 A;  4KY5 A;  1GKH A;  3CU7 A;  4RWS C;  2VQE Q;  1TWC H;  2R93 B;  3K59 A;  1X2G A;  1TWA B;  1PYB A;  2R61 A;  1TWF B;  3A74 A;  4DR6 Q;  1X2H A;  3T4A C;  1N33 Q;  1D1K A;  4F88 A;  2K52 A;  1L2F A;  1E1T A;  5EGT A;  1GGM A;  4QMG A;  3SE0 A;  1D5Z C;  4R8I A;  5IYD H;  2HUG A;  1XMO L;  5LMN L;  3T1H L;  2CQA A;  1EIY B;  2MGS A;  2WII B;  1PH2 A;  2K5Q A;  1V1P A;  4P71 A;  4IFD G;  2R7Z H;  4LF6 Q;  3IFT A;  1EFI D;  2CH4 W;  5C44 G;  1EY0 A;  3UH0 A;  1PYS B;  2RVL A;  3GQB A;  4KN4 C;  3DEO A;  4LVK A;  2HQE A;  3PZC A;  1WOC A;  2A73 B;  5LMN Q;  4JC0 A;  1JOQ A;  2JA7 H;  1R9T B;  4P73 A;  4LF7 Q;  2R93 H;  1F2M A;  1KLG D;  4DNR B;  1WPY A;  4P3P A;  4TVY A;  3RAC A;  1VQC A;  2K32 A;  2ZT7 A;  2F4I A;  4YHH Q;  2F4V Q;  3Q23 A;  3QTC A;  3OWE B;  2ZCE A;  2Q8I B;  1ICF B;  4B3T L;  2NWG A;  2WAQ E;  4JYA L;  1N36 Q;  4IAL A;  2IJ0 A;  1EQT A;  3R07 A;  1PYW D;  2F0T A;  4LF7 L;  2AHO B;  2KVM A;  4DPG A;  4A3B B;  2BE5 C;  3KLS X;  4IUU A;  5M3F H;  2PYK A;  1JWM D;  3KF8 A;  2NN6 H;  2UUC Q;  1B70 A;  3VR3 A;  4DV1 Q;  3I4M H;  1KD1 C;  2MPM A;  3ULL A;  4JBM A;  3LX0 A;  4CHT B;  1PFN A;  4DV0 L;  2SDF A;  4A3J B;  2YU9 B;  1QUQ B;  4TWA A;  1I3Q B;  2VUM H;  2HHH L;  1VQ5 A;  3PSI A;  2EJF C;  4TVA A;  1HR0 W;  3V7C A;  4L5T A;  2UXD L;  2E75 C;  1K9M C;  2OTJ A;  3D8G A;  5C0X J;  3PO2 B;  2LXK A;  3CCJ A;  1TU2 B;  1AE2 A;  1Q1B A;  1A8V A;  1EFW A;  1G2T A;  4DV3 L;  2LKV A;  4DR2 L;  4A3I H;  1SN8 A;  3U4Z A;  1PH3 A;  1I4Q A;  1NBW A;  1G29 1;  1I3Q H;  2DDZ A;  2WB1 B;  3S1Q B;  3PCO B;  1CKN A;  3HKZ B;  4AIM A;  4GN3 B;  2AKW B;  3GP7 A;  3GTK H;  3TS0 A;  3M7N A;  1F2L A;  1I6H H;  1CHP D;  3J7Z C;  5CV4 A;  1K8O A;  4KTA A;  1EVL A;  4ZUI A;  4DV3 Q;  1VQG A;  4YRP A;  2DN8 A;  2E2H H;  1IW7 D;  2KCM A;  4POF A;  4C3I H;  4G7H C;  4JI4 Q;  2RA4 A;  4BBS B;  3DM3 A;  2DNE A;  2D9U A;  5EKL A;  1WD0 A;  3JAM c;  3BG3 A;  3G7L A;  2DTH A;  1YNJ C;  2QF7 A;  1CSP A;  4PQX A;  4KR3 A;  4DV6 L;  3SDZ A;  4YWK A;  4RDX A;  2BA1 A;  2I5H A;  2R92 G;  1VQZ A;  2K04 A;  3P8Y A;  1SEB D;  1F2Z A;  4LNS A;  1GHK A;  1Y8P B;  2WAQ B;  4UDU C;  1Y1V H;  5CV7 A;  1NYQ A;  4DK3 C;  5M3F G;  3PIP A;  1XMO Q;  1XPU A;  4BBR G;  5KGU A;  4BW9 A;  4OX9 L;  4FF2 A;  3V7S A;  4KQE A;  4NKL A;  3TP8 A;  4L87 A;  3S17 H;  1WTX A;  1SSO A;  3A0J A;  4DUY Q;  5C0X G;  3EIV A;  1Y1W H;  1SMX A;  2CQO A;  1IBL L;  1EEF D;  1WQW A;  5IT9 L;  2VS1 A;  4BY7 H;  1DGS A;  1WI5 A;  5IT9 c;  4JI7 Q;  3IKJ A;  1II3 A;  1K83 B;  1LTL A;  4JI5 Q;  3CQZ B;  2PI2 A;  3KFU A;  3J81 L;  5M5Y B;  1I5F A;  4A3D G;  1IBM L;  4Q15 A;  1QF6 A;  3NEL A;  4GLA C;  4YHH L;  1LTR D;  3QOJ A;  4C3J H;  1W2B A;  3K7A B;  2XRS D;  4HIK A;  2PNH A;  5IOD A;  5JJZ A;  1NJ6 A;  1I4H A;  3SK4 A;  2JA8 H;  4DQ2 A;  2J0T D;  1VQF A;  2E2D C;  3GTP H;  4PZ7 A;  2EY5 A;  2DEQ A;  4FF4 A;  3M4Q A;  5IP9 H;  4HWS A;  3VYS A;  3VR5 A;  1QVC A;  1CFM A;  1CT1 D;  2X69 A;  2DXT A;  1QJO A;  3V05 A;  3I7F A;  5JEA G;  1C48 A;  1L0Y B;  1HZA A;  4LNQ A;  1A2U A;  1QZH A;  5JEA J;  2B63 B;  4DR3 L;  3C1E A;  2O5I C;  4O42 A;  2BOS A;  2IHF A;  4NB3 A;  3PUY A;  4LFB Q;  5D14 A;  1F9S A;  4IFD H;  2EYM A;  1AN8 A;  3Q0A A;  4CDD C;  2MFI A;  3HOU B;  1ML0 D;  4A3M G;  2F52 A;  1AW7 A;  2IX0 A;  5IGC A;  5C4X H;  5IT9 E;  1X01 A;  1RIP A;  5EBD A;  5KNC A;  5K36 H;  1NYR A;  4QL5 A;  2RSO A;  1V1P B;  2A1A A;  4FVM A;  1RIQ A;  2JA7 G;  1B3Q A;  1X3F A;  1VQA A;  3AB9 A;  4NMZ A;  4G57 A;  3GTG B;  4RGM A;  1XPO A;  1Y14 B;  2L5T A;  5LL6 X;  1HNX L;  2BDN A;  4NDX A;  3W2D A;  4IPC A;  3KDF B;  1G6P A;  1VQH A;  1S40 A;  3VR2 A;  4K2L A;  3F1Z A;  3H3V H;  2CGH A;  3F2U A;  2LS0 1;  3RL6 A;  3GTO B;  4CGY B;  3CQZ H;  1ROD A;  4XTU A;  3EBE A;  4H2Y A;  1XTC D;  5NUC A;  2B29 A;  4B3R L;  4BY7 G;  1S3O A;  1PZI D;  1LV9 A;  4JI4 L;  4HTH A;  2M00 A;  2XTI A;  3SK8 A;  2CFM A;  3CME A;  1HNX Q;  1DOK A;  2F0G A;  1VQD A;  3ERQ A;  2G9D A;  1WJJ A;  3E0J A;  3FDT A;  4ULL A;  5C4X B;  4K86 A;  3V8J A;  1D5X C;  2CHB D;  4HJ5 A;  4XTX A;  1BNZ A;  3KLS A;  3KF6 A;  4OWW B;  2XN9 C;  3K5L A;  1JWU D;  5IYC G;  3A8J E;  3A8I E;  3FPP A;  3M3Y B;  2E41 A;  3OTO Q;  2JSO A;  2B63 H;  4LVJ A;  2VZA A;  3EFX D;  3WDN A;  5FJ8 G;  1WTQ A;  2DTO A;  2HD3 A;  3S2H B;  4BBS G;  1LAB A;  5FO9 B;  4JK1 C;  2JA5 G;  3AYH B;  4HJ8 A;  3GD7 A;  1SNM A;  3EN2 A;  2XIW A;  2NVQ B;  3HXW A;  2NUC A;  4A75 A;  1F9Q A;  5ELC A;  4IOC A;  2EIF A;  3NBH B;  3G1Z A;  2X6G A;  2B2Y A;  4P3N A;  4YRT A;  2P0L A;  5A2Q L;  5JJI A;  2CJA A;  3RN5 A;  2QHU A;  2O5J C;  4FNF A;  3RLO A;  4KK7 A;  1TWG H;  1HNW L;  1B3A A;  4A3G G;  2UUA Q;  2JJQ A;  3M4Y A;  2KCT A;  3Q22 A;  1IZ6 A;  4PMW A;  4A3M H;  1CTM A;  4LVL A;  1KMM A;  2ZIM A;  1OXV A;  4TRD A;  5HY6 A;  2RF4 A;  4XTY A;  1EY6 A;  5JAV A;  2RQX A;  3E6Z X;  4G4K A;  4C3I G;  3CCL A;  4R9W A;  2JEB I;  4DUY L;  1YZ6 A;  2N3S A;  3REU A;  3PO3 B;  3HZX A;  4HSV A;  5ELB A;  5CBA E;  3ND8 A;  4CDF C;  4YY3 L;  2WFW A;  4HMI A;  1M4V A;  2R7D A;  4DUZ L;  5L37 A;  2ARS A;  2CH4 A;  1IBM Q;  2WKD A;  3CHB D;  1BBW A;  3OMC A;  4XQJ A;  1PH5 A;  1AE3 A;  5IGD A;  2KHJ A;  4FXK C;  4A3B G;  2CWP A;  1NR4 A;  1KDB A;  3DM1 A;  2JN4 A;  4N9P A;  3QJY A;  5I4D A;  1BR9 A;  2E5A A;  2AMC B;  3PMF A;  4YPF A;  1JJ2 A;  1XNQ Q;  1E1O A;  1O80 A;  2NZH A;  5C44 B;  2H5X A;  1OTC A;  2AUK A;  1ONL A;  2HCI A;  1EQQ A;  1Y8O B;  4JI6 Q;  1EY9 A;  1R4Q B;  4OO1 G;  2C8M A;  2R92 B;  4N8F A;  4A3F B;  1N32 Q;  2MQH A;  4DV2 L;  2A6E D;  3TBI B;  3A7U A;  4HJ9 A;  4MN3 A;  2HIV A;  1J5E L;  3PIO A;  1A3V A;  2Q7E A;  4LF8 Q;  3D4D A;  4GNX B;  4LF9 Q;  1I4G A;  3TS2 A;  1CUK A;  4OP0 A;  2F0J A;  1LYL A;  1PRT B;  2JP1 A;  4JBK A;  2WIN B;  3K0X A;  3U9O A;  1LLR D;  4RCO A;  4IUR A;  1J5E Q;  1I6H B;  4RMF A;  4DNT B;  2YTV A;  3S1Q H;  1B9M A;  4C3H H;  3S1R H;  3X3M A;  1I50 B;  1MIU A;  3MFY A;  3CCU A;  2L1B A;  1RHP A;  1SER A;  1PYS A;  1RTN A;  2R7Z G;  2EWN A;  3MTS A;  1KAA A;  3UGT A;  5DNF A;  3FMC A;  3RZD B;  3RZO B;  2B39 A;  1KHI A;  2ZZF A;  1TY2 A;  1EIY A;  4BWA A;  3LC0 A;  1BBX C;  4HAE A;  4LVI A;  1SE2 A;  4DAY B;  2OWO A;  2WP8 J;  4A3E B;  4A3I G;  4K88 A;  2F3I A;  3Q8D A;  2YU9 H;  2R93 G;  1BDO A;  3J80 E;  2DJZ A;  3HP3 A;  3VQY A;  1LTA D;  2FMC A;  3W1G A;  1B9N A;  4CJ2 C;  2ZR3 A;  1S72 A;  3H3V I;  4R4Q A;  1D1I A;  1UAP A;  3T1Y Q;  1KOG A;  4GS3 A;  4YRN A;  3I4N B;  1ZXT A;  2B2W A;  4A3B H;  4ZK9 B;  3RKW A;  1QE0 A;  4LJZ C;  2D62 A;  1ET6 A;  4DXF A;  1A3U A;  1X56 A;  3I4O A;  3MWY W;  3T1Y L;  5JVG 3;  3T56 B;  4I7Z C;  4IUV A;  3S15 H;  1JOR A;  3GO5 A;  3URY A;  3VA7 A;  1I94 Q;  1Z7M A;  5CC4 A;  2YTX A;  1Q3L A;  4UY8 C;  4MTN A;  2O2L D;  3DWQ A;  1K83 H;  4RGO S;  1DYQ A;  1R9T H;  1EL0 A;  4R1J A;  2IPK D;  4L8J A;  4IUQ A;  1JIC A;  4JV5 Q;  1GO3 E;  4IN3 A;  5E3F A;  1EOT A;  1WTV A;  5C51 B;  1WYD A;  1Q86 C;  3P8V A;  1JJG A;  4GOP C;  4X66 Q;  2ZJR A;  4KMU C;  1VQE A;  2EJG A;  3HOY B;  4A3E G;  1GJX A;  4KHP L;  4IJL A;  1CKO A;  2A8E A;  3HTZ A;  2KUM A;  1B4O A;  5C3E G;  3R3O A;  3RZD H;  1K3B C;  3Q6S A;  4CKC A;  4GKJ Q;  4DV7 L;  5C5M A;  4JW0 A;  5M5W H;  4IFD I;  3CXC A;  4B08 A;  2IT1 A;  4XT3 B;  4XTV A;  2EYH A;  3T53 B;  3ERO A;  4G7Z C;  4WJ3 M;  1QWY A;  4H44 C;  4V0B A;  4OIJ A;  1EUJ A;  2L4N A;  3WWV A;  2Y0S B;  4LMQ D;  3TP7 A;  5IGE A;  1L0X B;  5DLQ E;  1U0L A;  3CRK C;  2EY2 A;  2DKG A;  2Q5H A;  2QEJ C;  1SMY D;  1GUT A;  4A93 B;  1GUG A;  1EYG A;  4TVA B;  3UE1 A;  1U4R A;  2ENB A;  2ZGW A;  5HUR A;  4YRJ A;  4C2M H;  1WVL A;  1QUQ A;  2SEB D;  4XYQ A;  2A6E C;  2A74 C;  1O7L A;  2EY1 A;  3BYY B;  4DK6 C;  1LM0 A;  4A3C H;  4UHV A;  3GTQ B;  2Y0S E;  4GOP B;  2LSS A;  3E3X A;  3DEP A;  4DAY A;  1WQ7 A;  5HGT A;  3D4W A;  2QKI C;  3I90 A;  3FP9 A;  2VQE L;  4HT4 A;  3OSO A;  4L5Q A;  1LT4 D;  1STH A;  3SXH A;  4POG A;  5J22 A;  5DEH A;  1SMY C;  3GTJ B;  1K73 C;  1PH8 A;  1U4L A;  3N52 A;  3K57 A;  2VUM B;  5FKA C;  4IPD A;  4E6I A;  1QIL A;  3H0G H;  1PHJ A;  3L7Z C;  1AEX A;  1B44 D;  2EYL A;  3K7A H;  4ME3 A;  1JT8 A;  4H2V A;  4OO1 H;  2Z1C A;  3B6Y A;  1DZ1 A;  3NWT A;  4R4C A;  4ILW A;  4ID6 A;  1CM9 A;  4X6A H;  1Q90 A;  5GAD C;  1Q8K A;  3AU7 A;  4HVC A;  4OEM B;  2E2I B;  4P72 A;  3D31 A;  2JA5 B;  2K05 A;  4F7X A;  3A7A A;  1W66 A;  2I4O A;  4KLK A;  1HH2 P;  4JOI C;  4X65 L;  1Y1W B;  3AQQ A;  4ZLT F;  1BO0 A;  4RHS A;  2K1B A;  5K1P A;  1BIB A;  4V19 0;  4YRR A;  1WFQ A;  1JOK A;  1WCM H;  5GQO A;  2Q7H A;  1RD9 D;  2H1E A;  2OEO A;  2B2W C;  3J81 i;  1FYF A;  4J8Q A;  1CKM A;  2EJM A;  2ZT5 A;  4BS9 A;  3VR4 A;  3ICE A;  1USY A;  1WLE A;  1A2T A;  3I55 A;  1H9K A;  1SE8 A;  5I2X A;  3IKL A;  4HWP A;  4J15 A;  2PCF B;  1LT6 D;  2K33 A;  3CCV A;  2VW9 A;  5M5W B;  5DAU A;  4LUZ A;  5GAG C;  5FLM H;  3SEB A;  1EWI A;  4ZTU B;  1VQP A;  3OHX C;  2ZJP A;  2DVE A;  2K75 A;  3HFZ A;  3FKI H;  1VQI A;  3HOX G;  1JE4 A;  4DV0 Q;  2L15 A;  4YCV A;  2K6A A;  4OXP A;  4R4T A;  3P75 A;  4JI1 Q;  5K1X A;  1H9R A;  2C9O A;  2E2H B;  3VYU A;  4QGU A;  2PMZ E;  1AFP A;  4X3U A;  4XYO A;  1NJ1 A;  5EKK A;  1TWC B;  3HOW B;  4NW2 A;  3TQY A;  4F87 A;  1VDZ A;  4LW1 A;  1FGB D;  3RLN A;  2GA4 B;  1O7I A;  1YHQ A;  2RDG A;  2QIL A;  3MC0 B;  3GTJ H;  1Q7Y C;  4P74 A;  1KNE A;  1OXX K;  5CYU A;  4XEM A;  4DAM A;  2A5H A;  3VDY A;  4JPB W;  4DA2 A;  3KJP A;  1WNL A;  4ZCK A;  2EXD A;  1EWC A;  3C1F A;  1ADY A;  1SXT A;  2N8N A;  1MKH A;  2ALY A;  2I0Q A;  2EJ9 A;  1BVS A;  1VMC A;  3OW7 A;  2EZV A;  3I70 A;  1QOH A;  3NTH A;  2NVX B;  2B2U A;  4UP8 A;  1LTS D;  3HRZ C;  4LFC Q;  1YB3 A;  1CSQ A;  4EQ5 A;  2WAQ G;  2HQL A;  5C4J B;  1IL2 A;  3P20 A;  4C2M B;  1P16 A;  3ZYY X;  1Y8N B;  3VYR A;  4CDE C;  1PFB A;  2A69 D;  1TWH B;  3D0F A;  4HIM A;  3W1B A;  4HIO A;  1T5E A;  2ZTD A;  3BJU A;  2DQ0 A;  2BH2 A;  3LGJ A;  2DZC A;  4H2T A;  2J7Z A;  1EIG A;  3HXX A;  1SNP A;  3LWE A;  1VCI A;  3LNN A;  1O78 A;  2VL6 A;  4BY1 G;  3QOL A;  1ADJ A;  2OQ0 A;  1VQK A;  1V43 A;  4OX9 Q;  2SNS A;  1PA6 A;  4NXM L;  3T1H Q;  4ZIB A;  3S16 B;  4C3J B;  1SJE D;  4FXD A;  2KHI A;  3JAM i;  4JBJ A;  3FKI G;  5E1F A;  2YYZ A;  3JAM L;  4LF6 L;  3BDC A;  4RGN A;  5E7N A;  1QB5 D;  4K5V A;  4RA8 A;  3RMH A;  4JYA Q;  3M4O B;  1NJ2 A;  4BY7 B;  3MF1 A;  1MSG A;  3UI2 A;  1EWH A;  2WAC A;  2Z9H A;  1HNZ Q;  3ERR A;  3KJO A;  3TSS A;  4ZKB B;  2IWH A;  1MD2 D;  1GM5 A;  1LTB D;  2JQO A;  4FO2 A;  5D3I B;  1Z6H A;  4TTV A;  3PIP 3;  3OIP A;  3K58 A;  2ZZG A;  1DCZ A;  1RTO A;  5ELE A;  4JI0 L;  4HN7 A;  1G2S A;  2I4N A;  1I4P A;  2CIM A;  2TSS A;  4JOI A;  4DR5 L;  1X3G A;  3I3C A;  3L1A A;  2Z8L A;  1TY0 A;  1WU7 A;  2NVX H;  2MO1 A;  4H2X B;  1KXL A;  5AJ3 Q;  1ATI A;  1Z7N A;  4CH5 A;  2OXP A;  2PZU A;  4OHJ A;  3ND9 A;  2UUC L;  3ICA A;  2C7I A;  3JC6 6;  1KNA A;  3OD1 A;  1GD7 A;  2ART A;  3VR6 A;  1HZ9 A;  4ME5 A;  3IAY A;  4B9W A;  5J3B A;  1VQ6 A;  4C56 C;  4GZY C;  3H0G G;  5C52 B;  2EVB A;  2JA6 H;  2B2V A;  2EJF A;  2RDH A;  3S2D B;  2E2I H;  4U67 3;  4G84 A;  4CH3 A;  2YV5 A;  3BZD B;  1OO9 B;  1K3R A;  5E4W C;  3AFQ A;  3D6C A;  1V9P A;  2IL8 A;  4KR2 A;  2K7V A;  2XSC A;  4A3M B;  5E3I A;  1EQR A;  4MTK A;  4YP0 A;  4KHZ A;  2OQK A;  4DR2 Q;  1ET9 A;  4LVM A;  2PNR C;  4KY7 A;  2JA9 A;  1E0B A;  1SAP A;  1TWG B;  1IBK L;  1UWV A;  5KND A;  2OCE A;  2JEA I;  2A68 C;  2D0P A;  1XNR Q;  4YRI A;  4L6T B;  3QO7 A;  1LO5 D;  3EQL C;  1E3P A;  2FIN B;  1CHQ D;  2F0V A;  3CCR A;  2RHS A;  4BXX H;  2K5H A;  2RSN A;  2RHQ B;  2NVQ H;  1X65 A;  2BDO A;  3KLW A;  2ZIN A;  2AQ2 B;  1BF4 A;  1X54 A;  3S14 H;  1SYD A;  1TS5 A;  2DJF C;  5IYD G;  3S2H H;  4RG1 A;  4CS2 A;  2EQS A;  1A6X A;  1XNR L;  2PPB C;  1QZG A;  4R4I A;  1BKB A;  3K8A A;  2J3M A;  3GV3 A;  1N32 L;  4QJF A;  3HOX H;  1DXM A;  3STB C;  2EDG A;  3I2Z A;  3OTO L;  4PZ6 A;  1S4Z A;  3P1H A;  1QVG A;  4JCV E;  1SBB B;  2KQ3 A;  1D5M C;  2CJ9 A;  4DF7 A;  1IBL Q;  1SFO B;  1RJT A;  2ARU A;  4YRO A;  2NTS A;  2ZZE A;  1PZK D;  3M4P A;  4IUN A;  4WF2 A;  3K0Y A;  3K6O A;  2Q2H A;  4EGV A;  1K8A C;  1T9H A;  5D65 A;  2N78 A;  5IE8 A;  2D5D A;  4CH6 A;  1H4T A;  5LHY 1;  1GHJ A;  5IGF A;  2AKW A;  3CC2 A;  3C46 A;  2Z4H A;  3VA5 A;  1PRT F;  2FJ2 A;  3W5O A;  4TQD A;  5IP7 H;  1LTI D;  3J7A 5;  5D3D A;  1WTH A;  3HOV H;  2E1H A;  3HXV A;  2DJG C;  1SET A;  2Q5I A;  3PO2 H;  3MQZ A;  1HR0 L;  3K5M A;  3J81 c;  1IKL A;  1T5X D;  3NBH A;  5G3L F;  1U9R A;  1V8Q A;  4QIW B;  4CKE A;  1XMQ Q;  2QHS A;  3VQW A;  4H2W A;  1F2Y A;  2I5L X;  4X64 Q;  3IRB A;  1ESF A;  3BYT B;  2K5N A;  3VQX A;  1GUN A;  1VS0 A;  4EVO A;  3OW2 A;  3FVQ A;  3I91 A;  4RFB A;  1PH4 A;  4WRD A;  4NP5 A;  2F0Q A;  4K6D A;  4ABN A;  1C4Q A;  3HOY G;  3HY0 A;  2N49 A;  3EA6 A;  4HWO A;  4ZQ3 A;  4B3T Q;  1EIH A;  1JE5 A;  1A15 A;  1A3T A;  3J7Y W;  1V1O A;  2QEX A;  1N36 L;  2ZTE A;  4DR5 Q;  1EY8 A;  2Z0S A;  3X3N A;  5T1G A;  4EQP A;  4B3M L;  2IX1 A;  1FGU A;  1FNV A;  2E10 A;  4KY6 A;  2R3Z A;  3DSQ A;  1YJN A;  5ELN A;  3CCS A;  1PRT C;  3I72 A;  3HOZ G;  3CF5 A;  3I4N H;  3A5U A;  3DLL A;  1ZKO A;  2Z4I A;  2OTL A;  1JMC A;  4IJH A;  3REX A;  3LWU A;  5KYI A;  5DM7 3;  4B3M Q;  2BA0 A;  1YHA A;  5IGG A;  4A3L G;  5IWA Q;  1K0S A;  3TN2 A;  3HXY A;  2A19 A;  3J81 E;  1I6V C;  2G9H D;  2N88 A;  2RHS B;  1Z9F A;  3CMQ A;  1CQV A;  1D7Q A;  2E5L Q;  1KRS A;  4UPA A;  1Q82 C;  2F3V A;  3H3V C;  2K03 A;  2VNU D;  4KKT A;  1ENC A;  1UEA B;  4CDC C;  2Q8R E;  4X62 L;  1KRT A;  1VF7 A;  5C6A A;  3HKZ E;  3NPP A;  2L55 A;  2AWO A;  3G6E A;  1Y1V B;  3BDL A;  1I50 H;  2ZT9 C;  4DAP A;  4XU1 A;  2RCF A;  5F2D A;  3KBG A;  11AS A;  1XX8 A;  5C4H A;  3NET A;  3K80 C;  4DN4 M;  1H9S B;  3K5O A;  2KHS A;  4K8J A;  4A3F G;  4J1M A;  2ICE C;  3E9H A;  2A69 C;  4OGQ C;  3RF1 A;  2WV6 D;  2J3L A;  4P75 C;  3BVG A;  3ZJY C;  3H94 A;  2PQA A;  3G48 A;  4XT1 B;  1SFO H;  1VQ8 A;  2HDL A;  1H4S A;  5BR8 Q;  1NJI C;  2VQF Q;  1WTP A;  3U58 A;  1HNW Q;  3L4G B;  4IUT A;  1Q81 C;  4IQZ A;  5CV8 A;  4NCX A;  4K8I A;  1W3S A;  4ZTZ B;  1MBY A;  4XEO A;  4P2C B;  4F8M A;  4RKL A;  3H15 A;  4DV4 L;  4A3G B;  3HKS A;  5EPK A;  1S5B D;  5JOB A;  5KYL A;  5BR8 L;  2TMP A;  2L9H A;  1PTO H;  2HCC A;  2K14 A;  3EFS A;  1E2Z A;  4N8X 1;  1HA5 A;  1L1O C;  1PZJ D;  3I4N G;  1GUO A;  2M2L A;  4YY3 Q;  3HOZ H;  4K87 A;  1K8M A;  3J81 j;  4DV4 Q;  1PFS A;  1PLF A;  3MEF A;  3FJP A;  2UUB L;  5JEA H;  1E7Z A;  1HR0 Q;  5FO8 B;  4GLV B;  3CC4 A;  5COR A;  3GTQ H;  4UP9 A;  4C3H B;  3S1R B;  4AYB E;  3BU2 A;  4KN7 C;  3Q24 A;  1KC8 C;  4H2U A;  4XTW A;  1EVK A;  5IYB H;  3CCM A;  3FPU B;  1WTR A;  1M8A A;  3R2T A;  1M90 C;  5M3M B;  2F0P A;  3M7G A;  3PUV A;  1CKN B;  1X3P A;  2F0I A;  3J80 L;  1AP0 A;  1BCP D;  5F5W A;  4DR4 Q;  3S1M H;  4GKK L;  3HS0 C;  3F2B A;  1GXD C;  2UXC L;  5A2Q E;  3VYT A;  5GRO A;  1UE5 A;  5HGQ A;  4X65 Q;  1A0I A;  4HJ7 A;  2VB2 X;  4LUV A;  3UE0 A;  1USY C;  5C53 B;  1ILP A;  1HUM A;  2K5D A;  1ZYR C;  4U68 A;  2XVS A;  1JCK B;  1A63 A;  1EY4 A;  4OLF A;  5JJL A;  3CPW A;  3IL8 A;  4A3F H;  2QA4 A;  5JPN C;  3V8K A;  5FLX c;  1B1Z A;  5KRU A;  4JG2 A;  1PV4 A;  3V8L A;  2CCZ A;  1UE6 A;  1OXS C;  3QR8 A;  5C44 H;  1CQF A;  3A32 A;  1UNS A;  3NHH A;  3EVQ A;  4DV2 Q;  3QIA A;  4KKU A;  5LMN W;  3SR1 A;  2HT1 A;  4XTZ A;  1C9O A;  3MZ5 A;  4LF8 L;  4LF9 L;  4XU3 A;  1G51 A;  3MF2 A;  4YRM A;  1W6J A;  3SHL A;  4CJ0 B;  2DUD A;  4HJA A;  2RHQ A;  4OEL B;  2DGY A;  3FHW A;  4BBR H;  3TEG A;  4A3K G;  2PW7 A;  2CKZ B;  2DZ9 A;  2F0S A;  5FJ8 H;  1NE3 A;  1PH1 A;  2PO4 A;  2DTI A;  1ASY A;  3PUW A;  5CV9 A;  5BN5 A;  4BBS H;  1B7Y B;  2BCO A;  1J6Q A;  3M4O H;  2GN5 A;  4C3I B;  2JA5 H;  4PNY A;  4DXG A;  3RGL A;  3N6R A;  3BZC A;  3NXW A;  4GLX A;  1M1K C;  4DR7 L;  1X3Q A;  4LUO A;  2LMC B;  4QB4 A;  3KDF A;  2F0U A;  5M9O A;  1B2T A;  1MI2 A;  1BCP C;  2VXW A;  1TVX A;  4CS4 A;  3S15 B;  1E2W A;  1ASZ A;  5C5L A;  2L0C A;  4C3J G;  4WFN 3;  2MJ8 A;  2Z6K A;  1DON A;  4DR1 Q;  4GN4 B;  1KMN A;  4Q6G A;  2KCN A;  3MFG A;  1I4X A;  3L4G A; 
#chains in the Genus database with same CATH homology
 1PVO A;  3TRE A;  4DV6 Q;  2I4L A;  1Q12 A;  4AQY Q;  4BA1 I;  2B3G A;  2QGQ A;  1YIJ A;  1E24 A;  1K8G A;  2ASB A;  2PME A;  3RUX A;  4TQF A;  3MEY A;  5C4X G;  4LWC A;  4DR6 L;  2YTY A;  1HZB A;  1PH9 A;  4L5S A;  5K36 G;  3SGI A;  1YBY A;  4JI5 L;  4P71 C;  3HOW H;  4HWT A;  2A8V A;  2NVY H;  2AMC A;  1B7Y A;  2UXC Q;  1VQ7 A;  1YEZ A;  3U50 C;  4YRC A;  2DU5 A;  3F2C A;  1JJC B;  1A62 A;  4P73 C;  4NXN Q;  2ZM6 L;  3HOV G;  3PO2 G;  1HXD A;  1P8L A;  1SRU A;  4GNX C;  1Y1W G;  3A7R A;  4G85 A;  3CP0 A;  4APV A;  1YFS A;  4JI3 Q;  4NXN L;  4WI1 A;  1L1O B;  4BY1 H;  4RQF A;  4JBW A;  1WCM G;  4WJ4 A;  3TEH A;  3ERS X;  3IAL A;  2ZNI A;  4JI3 L;  1MJC A;  1VQO A;  2HNI A;  3QNE A;  1KAW A;  2ODR D;  4OO1 I;  1XPR A;  2WB1 E;  2ATW A;  3CPF A;  2HHH Q;  1VQN A;  3ULP A;  3CCQ A;  1OXU A;  4YCU A;  1IBK Q;  5IP7 G;  4YRK A;  3AEV A;  1L0W A;  3S1N H;  3HXZ A;  2ZJQ A;  3HOW G;  4QQB X;  3GTL H;  3PV0 A;  3HRI A;  4P72 C;  2Z6K C;  4LFA Q;  2JK8 A;  4DV5 Q;  2MO0 A;  4DR1 L;  4YRQ A;  1SLJ A;  3UFG A;  4FDB A;  4HWR A;  3F2D A;  2RCN A;  2NN6 G;  5C3E H;  2BH8 A;  1YVC A;  3J80 c;  4IPG A;  4EO4 A;  3CAM A;  1SRO A;  3UGQ A;  4X5O A;  4A3J G;  1UE1 A;  3RNU A;  4JI1 L;  4YRL A;  5C0X I;  2ODR C;  4UP7 A;  1OXT A;  3L2P A;  4A3L H;  4Y52 H;  2NZO A;  3CCE A;  4JV5 L;  4YCW A;  12AS A;  4JI7 L;  2WB1 G;  3STB D;  1NNH A;  3ULJ A;  1EOV A;  3CW2 C;  2QHT A;  1EIF A;  2UU9 L;  4HID A;  1NJ5 A;  2E3C A;  1XMQ L;  4QY7 A;  4GKJ L;  2UXB Q;  1H4V B;  2ZTG A;  3I56 A;  3CMA A;  4GOP A;  4X64 L;  1YJ9 A;  3LSQ A;  4A3G H;  3PF4 A;  1TWA H;  3KYH C;  4GN5 A;  3RIR A;  3EFR A;  4A93 H;  1N8R C;  4DV1 L;  4GNX A;  4LFC L;  4YRG A;  1VQJ A;  3A31 A;  2UXD Q;  1VQM A;  4E51 A;  4JI8 L;  5H1S E;  4DR3 Q;  1KQS A;  1G5I A;  4A3E H;  3PCO A;  2FYK A;  2ZTC A;  4L5R C;  4OWX B;  1SR3 A;  3S24 A;  4A3D H;  2NS6 A;  3HOY H;  1VQ4 A;  2P5I A;  3TEH B;  4LFA L;  4P75 A;  3RKY A;  3IG2 A;  4OON A;  3G71 A;  5KNN A;  1HNZ L;  3VQV A;  4O0A A;  3E9I A;  3PF5 A;  2XGT A;  2F4V L;  4BXX G;  1YGB A;  4B3R Q;  1RL2 A;  3KF8 B;  2VY3 A;  2DU7 A;  2GVB A;  3HOU H;  2R6G A;  4ALP A;  1I94 L;  3RR5 A;  1L1O A;  1B8A A;  2CWA A;  2ZIO A;  5C4J H;  4MNO A;  4NPS A;  1QVF A;  4RQE A;  1SES A;  3CC7 A;  4X66 L;  2E65 A;  1Q1E A;  4KHP Q;  4JI2 Q;  1PH6 A;  1SRY A;  5ELO A;  3HFZ B;  4YRF A;  3GTM H;  3J80 i;  4YRS A;  1TXY A;  2E64 A;  1Y1V G;  2V1C C;  3NEM A;  2ZT6 A;  4JI2 L;  1V1Q A;  3PO3 G;  3MXN B;  4IOA A;  3QO8 A;  4IO9 A;  4LF5 Q;  4LF4 L;  4X62 Q;  2UU9 Q;  2IY5 A;  2AWN A;  4YWM A;  2B63 G;  2EAY A;  3A5Z B;  1YFR A;  3W3S A;  2D0O A;  1Z47 A;  1N9W A;  4LF4 Q;  4LF5 L;  4IFD J;  3A5Z A;  3HXU A;  2G4C A;  2IY5 B;  1KIX A;  1MJE A;  3RN2 A;  4H2X A;  3TUP A;  2JA8 G;  1LUZ A;  1FVI A;  2Q2T A;  2K50 A;  2PI2 E;  1NY4 A;  4JI6 L;  1XJV A;  3HOU G;  3UDF A;  5FLM G;  2E2J H;  3KOJ A;  1UE7 A;  2Q2U A;  4AYB G;  4JI8 Q;  1H4Q A;  3QO5 A;  2HIX A;  1KL9 A;  2ZNJ A;  3VBB A;  1N34 L;  4QIW E;  2UUB Q;  4XIG S;  5M3M G;  3S16 H;  3S2D H;  4TQU S;  1N34 Q;  3RKX A;  4XU0 A;  2ZR2 A;  4AQY L;  4K0K Q;  5M5X H;  4Y7N H;  2ZT8 A;  4TVW A;  3U4V A;  4A3K H;  4BA2 I;  1X6O A;  4PG3 A;  2JE6 I;  5IWA L;  4K0K L;  2ALY B;  5AJ3 L;  1NMF A;  4LFB L;  1G5H A;  1X55 A;  4O2D A;  3RZO H;  5GAH C;  2LXJ A;  2Q2I A;  2Q7G A;  2DQ3 A;  2ZXF A;  1GVP A;  3GDE A;  1X9N A;  1B76 A;  1PH7 A;  3CD6 A;  4IPH A;  3PGZ A;  3L0O A;  4DUZ Q;  2KBN A;  3TRZ A;  1IYJ B;  5M5Y H;  5JJK A;  4YRE A;  4HA8 A;  2DXU A;  1NJ8 A;  4EX5 A;  3UDG A;  3GTG H;  4YDQ A;  3K81 C;  3K7U C;  3UDX A;  2R7F A;  1YJW A;  1H95 A;  1XNQ L;  2PQA B;  1K0R A;  1TWH H;  2ZM6 Q;  2R92 H;  4AH6 A;  3L2Z A;  1HJP A;  3NEN A;  4A76 A;  3M9B A;  2Y0S G;  3M85 A;  3F8T A;  4R4O A;  1YNX A;  4P3O A;  5GAE C;  3V7R A;  1C0A A;  3IKM B;  2GVA A;  3A5Y A;  3UDI A;  4DKA C;  3PO3 H;  4CH4 A;  2UUA L;  4NXM Q;  2PMF A;  3RLF A;  4DNI A;  4PZ8 A;  1HZC A;  4H2S A;  1E22 A;  1VQ9 A;  4YYE A;  4DR4 L;  4GKK Q;  5IP9 G;  2I5M X;  4XTC S;  3LSS A;  3HFV A;  4CS3 A;  3AFP A;  3WQZ A;  4JI0 Q;  4KI0 A;  1IXR A;  4DV5 L;  1BIA A;  2MNA A;  1C7Y A;  4OWT B;  5IYC H;  1HC7 A;  1AH9 A;  1BBU A;  2K5V A;  3M3Y H;  2EL9 A;  4A93 G;  2NN6 I;  1YI2 A;  3E0E A;  3ER0 A;  4A4I A;  2I4M A;  2E8G A;  1X3E A;  3HRK A;  1XTD A;  1J5W A;  1Q46 A;  1HTT A;  2IHE A;  4A3C G;  1YIT A;  5M3M H;  1FL0 A;  1UEB A;  3GTO H;  3BFM A;  5EAY A;  1D8L A;  1FJG Q;  4DV7 Q;  3G4S A;  2K4K A;  2QHV A;  2E5L L;  2C35 B;  3BZK A;  2KEN A;  4DR7 Q;  1NTG A;  1YFT A;  2NVT H;  1JB7 A;  1JJC A;  1U5K A;  1VQL A;  1FJG L;  3P8T A;  2UXB L;  1YHB A;  4MZ9 A;  4A3J H;  3PUX A;  4YWL A;  4P74 C;  2FXQ A;  2JA6 G;  1TWF H;  5LMU Q;  4B3S Q;  4PHC A;  4H02 A;  2ID0 A;  3PUZ A;  1VQB A;  3KF6 B;  1B70 B;  3I4M G;  3OYY A;  4XU2 A;  2CJB A;  5IY0 A;  3HKZ G;  1N33 L;  2VUM G;  5LMU L;  4B3S L;  2VQF L;  5IYB G;  1NMG A;  2ES2 A;  3HY1 A;  1GKH A;  2VQE Q;  1TWC H;  1X2G A;  1PYB A;  3A74 A;  4DR6 Q;  1X2H A;  1N33 Q;  2K52 A;  1L2F A;  1E1T A;  1GGM A;  5IYD H;  1XMO L;  1EIY B;  5LMN L;  3T1H L;  1PH2 A;  4P71 A;  4IFD G;  2R7Z H;  4LF6 Q;  5C44 G;  3UH0 A;  1PYS B;  4LVK A;  3PZC A;  1WOC A;  5LMN Q;  4JC0 A;  2JA7 H;  4P73 A;  4LF7 Q;  2R93 H;  1WPY A;  4P3P A;  4TVY A;  3RAC A;  1VQC A;  2ZT7 A;  4YHH Q;  2F4V Q;  3QTC A;  2ZCE A;  4B3T L;  2WAQ E;  4JYA L;  1N36 Q;  3R07 A;  4LF7 L;  2AHO B;  4DPG A;  5M3F H;  2UUC Q;  1B70 A;  4DV1 Q;  3I4M H;  1KD1 C;  3ULL A;  4JBM A;  4DV0 L;  1QUQ B;  4TWA A;  2VUM H;  2HHH L;  1VQ5 A;  3PSI A;  4TVA A;  1HR0 W;  3V7C A;  4L5T A;  2UXD L;  1K9M C;  2OTJ A;  5C0X J;  2LXK A;  3CCJ A;  1AE2 A;  1Q1B A;  1A8V A;  1EFW A;  4DV3 L;  4DR2 L;  4A3I H;  1SN8 A;  3U4Z A;  1PH3 A;  1NBW A;  1G29 1;  1I3Q H;  2DDZ A;  3PCO B;  1CKN A;  4AIM A;  4GN3 B;  2AKW B;  3GTK H;  3TS0 A;  3M7N A;  1I6H H;  3J7Z C;  1EVL A;  4DV3 Q;  1VQG A;  4YRP A;  2E2H H;  2KCM A;  4POF A;  4C3I H;  4JI4 Q;  3DM3 A;  3JAM c;  2DTH A;  1CSP A;  4KR3 A;  4DV6 L;  4YWK A;  4RDX A;  2BA1 A;  2I5H A;  2R92 G;  1VQZ A;  3P8Y A;  4LNS A;  1Y1V H;  1NYQ A;  4DK3 C;  5M3F G;  3PIP A;  1XMO Q;  1XPU A;  4BBR G;  4BW9 A;  4OX9 L;  3V7S A;  4KQE A;  4L87 A;  3S17 H;  3A0J A;  4DUY Q;  5C0X G;  3EIV A;  1Y1W H;  1SMX A;  2CQO A;  1IBL L;  1WQW A;  2VS1 A;  4BY7 H;  1DGS A;  1WI5 A;  5IT9 c;  4JI7 Q;  3KFU A;  1LTL A;  4JI5 Q;  2PI2 A;  1I5F A;  4A3D G;  1IBM L;  4Q15 A;  1QF6 A;  3NEL A;  4GLA C;  4YHH L;  4C3J H;  1W2B A;  4HIK A;  2PNH A;  1NJ6 A;  2JA8 H;  4DQ2 A;  1VQF A;  3GTP H;  4PZ7 A;  2DEQ A;  3M4Q A;  5IP9 H;  4HWS A;  1QVC A;  2DXT A;  3I7F A;  5JEA G;  1HZA A;  4LNQ A;  1QZH A;  5JEA J;  4DR3 L;  4LFB Q;  2IHF A;  4NB3 A;  3PUY A;  2MFI A;  4A3M G;  2F52 A;  2IX0 A;  5C4X H;  1X01 A;  1RIP A;  1NYR A;  4QL5 A;  2A1A A;  1RIQ A;  2JA7 G;  1X3F A;  1VQA A;  1XPO A;  1Y14 B;  1HNX L;  4IPC A;  3KDF B;  1G6P A;  1VQH A;  1S40 A;  3F1Z A;  3H3V H;  2CGH A;  3RL6 A;  3CQZ H;  4XTU A;  3EBE A;  4H2Y A;  2B29 A;  4B3R L;  4BY7 G;  1S3O A;  4JI4 L;  1HNX Q;  3CME A;  2XTI A;  2CFM A;  1VQD A;  1WJJ A;  4K86 A;  3V8J A;  4HJ5 A;  4XTX A;  3KF6 A;  4OWW B;  5IYC G;  2E41 A;  3OTO Q;  2B63 H;  4LVJ A;  2VZA A;  5FJ8 G;  2DTO A;  4BBS G;  2JA5 G;  3AYH B;  4HJ8 A;  3GD7 A;  3EN2 A;  3HXW A;  4A75 A;  4IOC A;  2EIF A;  3NBH B;  3G1Z A;  4YRT A;  4P3N A;  2P0L A;  5JJI A;  2CJA A;  3RN5 A;  2QHU A;  3RLO A;  1TWG H;  1HNW L;  4A3G G;  2UUA Q;  2JJQ A;  2KCT A;  1IZ6 A;  4PMW A;  4A3M H;  4LVL A;  1KMM A;  2ZIM A;  1OXV A;  5HY6 A;  2RF4 A;  4XTY A;  3CCL A;  2JEB I;  4DUY L;  1YZ6 A;  2N3S A;  3REU A;  4YY3 L;  2WFW A;  2R7D A;  4DUZ L;  2ARS A;  1IBM Q;  1BBW A;  1PH5 A;  1AE3 A;  2KHJ A;  4A3B G;  2CWP A;  2E5A A;  2AMC B;  4YPF A;  1JJ2 A;  1XNQ Q;  1E1O A;  2NZH A;  2H5X A;  1OTC A;  1EQQ A;  4JI6 Q;  4OO1 G;  2C8M A;  1N32 Q;  2MQH A;  4DV2 L;  3A7U A;  4HJ9 A;  2HIV A;  1J5E L;  3PIO A;  2Q7E A;  4LF8 Q;  4GNX B;  4LF9 Q;  3TS2 A;  1CUK A;  4OP0 A;  1LYL A;  4JBK A;  3K0X A;  1J5E Q;  4RMF A;  2YTV A;  3S1Q H;  3S1R H;  4C3H H;  1MIU A;  3CCU A;  1SER A;  1PYS A;  2R7Z G;  2EWN A;  3UGT A;  1KHI A;  2ZZF A;  1EIY A;  4BWA A;  3LC0 A;  4LVI A;  4DAY B;  2OWO A;  2WP8 J;  4K88 A;  4A3I G;  2F3I A;  3Q8D A;  2YU9 H;  2R93 G;  2DJZ A;  3VQY A;  3W1G A;  2ZR3 A;  1S72 A;  3H3V I;  4R4Q A;  3T1Y Q;  1KOG A;  4GS3 A;  4YRN A;  4A3B H;  3RKW A;  1QE0 A;  2D62 A;  1X56 A;  3I4O A;  3T1Y L;  3S15 H;  3GO5 A;  1I94 Q;  1Z7M A;  2YTX A;  4UY8 C;  4MTN A;  1K83 H;  1R9T H;  4R1J A;  4JV5 Q;  1GO3 E;  5C51 B;  1WYD A;  1Q86 C;  3P8V A;  1JJG A;  4GOP C;  4X66 Q;  2ZJR A;  1VQE A;  2EJG A;  4A3E G;  4KHP L;  4IJL A;  1CKO A;  2A8E A;  3HTZ A;  5C3E G;  3RZD H;  4GKJ Q;  4DV7 L;  5M5W H;  4IFD I;  3CXC A;  2IT1 A;  4XTV A;  4WJ3 M;  1EUJ A;  3WWV A;  5DLQ E;  1U0L A;  2DKG A;  2Q5H A;  1EYG A;  4TVA B;  3UE1 A;  2ZGW A;  4YRJ A;  4C2M H;  1QUQ A;  4DK6 C;  1LM0 A;  4A3C H;  2Y0S E;  4GOP B;  2LSS A;  1WQ7 A;  3FP9 A;  2VQE L;  4HT4 A;  4L5Q A;  4POG A;  1K73 C;  1PH8 A;  4IPD A;  3H0G H;  1PHJ A;  3L7Z C;  3K7A H;  4ME3 A;  1JT8 A;  4H2V A;  3B6Y A;  4R4C A;  4X6A H;  5GAD C;  1Q8K A;  4HVC A;  4P72 A;  3D31 A;  3A7A A;  2I4O A;  1W66 A;  4KLK A;  1HH2 P;  4JOI C;  4X65 L;  3AQQ A;  5K1P A;  1BIB A;  4YRR A;  1WFQ A;  1WCM H;  5GQO A;  2Q7H A;  3J81 i;  1FYF A;  1CKM A;  2ZT5 A;  3ICE A;  1USY A;  1WLE A;  3I55 A;  1SE8 A;  3IKL A;  4HWP A;  4J15 A;  3CCV A;  2VW9 A;  5FLM H;  4LUZ A;  5GAG C;  1EWI A;  4ZTU B;  1VQP A;  2ZJP A;  2DVE A;  2K75 A;  3HFZ A;  3FKI H;  1VQI A;  3HOX G;  4DV0 Q;  2L15 A;  4YCV A;  4OXP A;  4R4T A;  4JI1 Q;  5K1X A;  4QGU A;  2PMZ E;  1NJ1 A;  3TQY A;  4LW1 A;  3RLN A;  1O7I A;  1YHQ A;  1Q7Y C;  3GTJ H;  4P74 A;  1OXX K;  4XEM A;  4DAM A;  3VDY A;  3KJP A;  1WNL A;  2EXD A;  1ADY A;  2N8N A;  1MKH A;  2ALY A;  2I0Q A;  2EJ9 A;  1BVS A;  4UP8 A;  4LFC Q;  1YB3 A;  1CSQ A;  4EQ5 A;  2WAQ G;  2HQL A;  1IL2 A;  1P16 A;  3D0F A;  4HIM A;  3W1B A;  4HIO A;  2ZTD A;  3BJU A;  2DQ0 A;  2BH2 A;  3LGJ A;  2DZC A;  4H2T A;  3HXX A;  1VCI A;  2VL6 A;  4BY1 G;  1ADJ A;  2OQ0 A;  1VQK A;  1V43 A;  4OX9 Q;  4NXM L;  1PA6 A;  3T1H Q;  4ZIB A;  2KHI A;  3JAM i;  4JBJ A;  3FKI G;  2YYZ A;  4LF6 L;  5E7N A;  4JYA Q;  1NJ2 A;  3MF1 A;  1HNZ Q;  3ERR A;  3KJO A;  1GM5 A;  2JQO A;  4TTV A;  2ZZG A;  4JI0 L;  2I4N A;  2CIM A;  4JOI A;  4DR5 L;  1X3G A;  3L1A A;  1WU7 A;  2NVX H;  2MO1 A;  4H2X B;  1KXL A;  5AJ3 Q;  1ATI A;  1Z7N A;  4CH5 A;  2UUC L;  3ICA A;  2C7I A;  3JC6 6;  3OD1 A;  1GD7 A;  2ART A;  1HZ9 A;  5J3B A;  1VQ6 A;  3H0G G;  5C52 B;  2JA6 H;  2EJF A;  2E2I H;  4G84 A;  4CH3 A;  2YV5 A;  1K3R A;  3AFQ A;  1V9P A;  4KR2 A;  5E3I A;  1EQR A;  4YP0 A;  4KHZ A;  2OQK A;  4DR2 Q;  4LVM A;  2JA9 A;  1IBK L;  1UWV A;  2OCE A;  2JEA I;  2D0P A;  1XNR Q;  4YRI A;  3QO7 A;  1E3P A;  3CCR A;  2RHS A;  4BXX H;  2K5H A;  2RHQ B;  2NVQ H;  1X65 A;  3KLW A;  2ZIN A;  1X54 A;  3S14 H;  5IYD G;  3S2H H;  4RG1 A;  4CS2 A;  2EQS A;  1XNR L;  1QZG A;  4R4I A;  1BKB A;  3K8A A;  2J3M A;  1N32 L;  4QJF A;  3HOX H;  3STB C;  3I2Z A;  3OTO L;  4PZ6 A;  1QVG A;  4JCV E;  2CJ9 A;  1IBL Q;  2ARU A;  4YRO A;  2ZZE A;  3M4P A;  4WF2 A;  2Q2H A;  1K8A C;  1T9H A;  2N78 A;  5IE8 A;  4CH6 A;  1H4T A;  2AKW A;  3CC2 A;  3W5O A;  4TQD A;  5IP7 H;  3J7A 5;  3HOV H;  2E1H A;  3HXV A;  1SET A;  2Q5I A;  3PO2 H;  3MQZ A;  1HR0 L;  3J81 c;  1XMQ Q;  2QHS A;  3VQW A;  4H2W A;  2I5L X;  4X64 Q;  3IRB A;  2K5N A;  3VQX A;  1VS0 A;  3OW2 A;  1PH4 A;  3HOY G;  3HY0 A;  2N49 A;  4HWO A;  4B3T Q;  1JE5 A;  2QEX A;  1N36 L;  2ZTE A;  4DR5 Q;  2Z0S A;  4B3M L;  2IX1 A;  1FGU A;  2E10 A;  3DSQ A;  1YJN A;  5ELN A;  3CCS A;  3HOZ G;  3I4N H;  3CF5 A;  3A5U A;  3DLL A;  2OTL A;  1JMC A;  4IJH A;  3REX A;  4B3M Q;  2BA0 A;  1YHA A;  4A3L G;  5IWA Q;  3HXY A;  2A19 A;  2RHS B;  1Z9F A;  3CMQ A;  1D7Q A;  2E5L Q;  1KRS A;  4UPA A;  1Q82 C;  2VNU D;  4X62 L;  1KRT A;  3HKZ E;  2AWO A;  3G6E A;  1I50 H;  4XU1 A;  11AS A;  3NET A;  3K80 C;  4A3F G;  3E9H A;  3RF1 A;  2J3L A;  4P75 C;  3ZJY C;  2PQA A;  3G48 A;  1SFO H;  1VQ8 A;  1H4S A;  5BR8 Q;  1NJI C;  2VQF Q;  3U58 A;  1HNW Q;  3L4G B;  1Q81 C;  4NCX A;  1W3S A;  4ZTZ B;  4XEO A;  3H15 A;  4DV4 L;  3HKS A;  5BR8 L;  3EFS A;  2K14 A;  1L1O C;  4K87 A;  3I4N G;  3HOZ H;  4YY3 Q;  3J81 j;  4DV4 Q;  1PFS A;  3MEF A;  3FJP A;  2UUB L;  1E7Z A;  1HR0 Q;  4GLV B;  3CC4 A;  3GTQ H;  4UP9 A;  4AYB E;  3BU2 A;  1KC8 C;  4H2U A;  4XTW A;  1EVK A;  5IYB H;  3CCM A;  1M90 C;  3PUV A;  1CKN B;  5F5W A;  4DR4 Q;  3S1M H;  4GKK L;  3F2B A;  2UXC L;  5GRO A;  1UE5 A;  5HGQ A;  4X65 Q;  1A0I A;  4HJ7 A;  3UE0 A;  4LUV A;  1USY C;  5C53 B;  1A63 A;  4OLF A;  5JJL A;  3CPW A;  4A3F H;  2QA4 A;  3V8K A;  5FLX c;  4JG2 A;  1PV4 A;  3V8L A;  2CCZ A;  1UE6 A;  1OXS C;  5C44 H;  3A32 A;  4DV2 Q;  5LMN W;  2HT1 A;  4XTZ A;  1C9O A;  4LF8 L;  4LF9 L;  4XU3 A;  1G51 A;  3MF2 A;  4YRM A;  2DUD A;  4HJA A;  2RHQ A;  2DGY A;  3TEG A;  3FHW A;  4BBR H;  4A3K G;  2CKZ B;  2DZ9 A;  2DTI A;  1NE3 A;  5FJ8 H;  1PH1 A;  1ASY A;  3PUW A;  4BBS H;  1B7Y B;  1J6Q A;  3M4O H;  2GN5 A;  2JA5 H;  3RGL A;  1M1K C;  3BZC A;  4DR7 L;  4GLX A;  4LUO A;  3KDF A;  4CS4 A;  1ASZ A;  2Z6K A;  4DR1 Q;  4GN4 B;  1KMN A;  4Q6G A;  3L4G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...