4YDDB

Crystal structure of the perchlorate reductase pcrab from azospira suillum ps
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
329
structure length
329
Chain Sequence
MKAPRRQLTYVTDLNKCIGCQTCTVACKKLWTTGPGQDFMYWRNVETAPGLGYPRNWQTKGGGYKNGELQKGKIPPMIDYGIPFEFDYAGRLFEGKPGRVRPSPTPRSAPNWDEDQGAGEYPNNSFFYLPRMCNHCTKPACLEACPNEAIYKREQDGIVVIHQDKCKGAQACVQSCPYAKPYFNPLTNKANKCIGCFPRIEQGVAPACVAQCVGRAMHVGFVDDVNSSVYKLIKQYKVALPLHPEFGTEPNVFYVPPVLGPRIEMANGEPSTDPKIPLAQLEGLFGKQVRDVLAILQSEREKKMKGLASDLMDVLIGRRSTDMMISPLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DMSO reductase family type II enzyme, molybdopterin subunit
publication title Perchlorate Reductase Is Distinguished by Active Site Aromatic Gate Residues.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 85
structure length 329
sequence length 329
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2015-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13247 Fer4_11 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4yddB00
5BYQA 1XERA 4YDDB 1PC5A 4ID8A 1BWEA 1JNZB 3GYXB 2O01C 1Y5NB 1FERA 2PA8D 2ZVSA 5FD1A 4DHVA 1ROFA 4XDDA 2C42A 3OR1B 1FTCA 1R27B 1DAXA 3MM8A 2XSJB 1F5CA 3LW5C 1FDNA 1Y5IB 3EGWB 1H0HB 3MM7A 4CI0B 2C3OA 3MM5B 1DURA 1F5BA 1G3OA 3MMCA 2PMZD 2FD2A 3EXYA 3PNIA 3IR6B 1HFEL 1FEHA 4L6V3 2WSFC 2FJAB 3HKZD 5CH7B 2VPXB 1G6BA 1IQZA 2VPYB 2WB1D 6FD1A 1F2GA 1FRXA 3MMBB 7FD1A 2V4JB 3OR1A 3IR5B 2V2KA 2XSJA 1H7WA 1JB0C 1A6LA 1SJ1A 1FRKA 3MM6A 1DFDA 1C4AA 3MM5A 1FCAA 1FRLA 2C3YA 2GMHA 1FRJA 4AYBD 2C3PA 1FDDA 1FXDA 2VPWB 4KT0C 1KQFB 1FRHA 1GAOA 5BYSA 1KQGB 3MMAB 2C3UA 2Z8QA 1GTEA 1BQXA 7FDRA 5E7OB 5CHCB 1JNRB 3C8YA 2VPZB 1H98A 1VJWA 3MM9B 3MMBA 1FDAA 2VKRA 4OV1A 1FDBA 2C3MA 3EUNA 3MM8B 2IVFB 6FDRA 2WAQD 2FJDB 2PDAA 3IR7B 3OR2B 1CLFA 5L8RC 1B0VA 1Q16B 4XDCA 1GTHA 5BYRA 1Y4ZB 2FJBB 1Y5LB 1B0TA 1FF2A 3MMAA 2FGOA 1IR0A 1FRIA 1FRMA 1BD6A 3MM9A 1AXQA 1KEKA 4OMFG 2FJEB 1GT8A 2V4JA 4Y28C 1C4CA 2WSEC 1FD2A 1RGVA 1BLUA 1PC4A 4RKUC 1WTFA 2Y0SD 3MM6B 1B0PA 1K0TA 2UZAA 2GMJA 1D3WA 1BC6A 4XK8C 3MM7B 3OR2A 1SIWB 1FXRA 2WSCC 1SIZA 3MMCB 1H7XA 2FDNA
chains in the Genus database with same CATH superfamily
4DPUA 2LLZA 2IYIA 1CULB 4TNOA 1KLMB 5J1EB 1I94J 2H5EA 4XIUA 1G6BA 3D6TB 4OI4A 2GZOA 1RK8A 2UUAJ 3DOKB 4M5MA 2BJEA 1NDPA 1RTDA 4DZDA 4NXNF 1Q78A 4OHYA 2HVEA 1PIEA 2EKNA 3MMJA 4I6WA 1KQFB 1AZSA 3P96A 3KJVA 2CPEA 1S0OA 2HFVA 4YY3F 1TK8A 1QY7A 2YY3A 3A8IA 4RUAA 1RABB 4K5RA 4QJVA 3GYNA 5IT4A 1DARA 5ETTA 2MYFA 1F2HA 5EHHA 3KLGB 4FXDA 1NKCA 4WKRA 1X5TA 1FX2A 4BCAA 3DMJB 2HZAA 2YNGA 5ETOA 2P6SA 1F6TA 2UZAA 3KLFB 3V5RA 2CJ9A 2VG7A 2UXCJ 2BUNA 2E9RX 1IKVA 3Q83A 2A2CA 1VQ4S 2VZ9A 3RB4A 4MIBA 5EWFA 3EGWB 4YDXA 3CCVS 3EXYA 2NPFA 1JMTA 4IDKA 3M9MB 1QDUB 3UDVA 2VPYB 2W4PA 2E9TA 2EW9A 3ONQA 3UDCA 3DFEA 4EYIB 2IJFA 3LPEA 4OI3A 2F4FA 3NOGA 2KRBA 2CWKA 3BSOA 2BJ9A 1YLXA 3T9ZA 2VKRA 3JQJA 4IH5A 1QAYA 2CJXB 4Y00A 1Q16B 2BRLA 1KVJA 1TP7A 4MKBA 4LF6J 3CGIA 4LRBA 5E3CA 1G7CB 2AT1B 3HDSA 3HF5A 1BLUA 4TQSA 4RKUC 2BE2A 4E8UA 3GE9A 1X4HA 2AYGA 1OY6A 4MH8A 1XNQJ 1WKKA 4OZ3A 4WYLA 3MD3A 4CH7A 4KTQA 2C1EB 1WC6A 2VG6A 3G8SA 1U1LA 4C9DA 1R31A 2ZHAA 5KG5A 1JLFA 4TU7A 3D3CJ 3DKDA 1WI6A 3HKZD 4OLPA 2ZEJA 5FDLA 1NDLA 3AD9C 3UVJA 1RLDA 3TUJC 4E2FB 1ICEB 4FS1A 5D0GA 1VBKA 3FFIB 4WXOA 4WZQA 1S4FA 2ROGA 4U95A 4DS4A 2BQRA 4NXNJ 1YDLA 3CCLS 4FKYA 3VAIA 3L9ZA 1NAQA 3EGNA 4YY3J 3OSNA 1B0VA 2CA9A 3TZYA 4TLRA 2K7JA 3SCKE 3A3OB 3UD4P 2MY7A 4TVAB 3MPUB 1S6UA 1RHUB 4LF7F 5E0OA 2XLIA 1NK7A 5A2QY 1IBKJ 3NXZA 2NXNA 3LH2S 4UW2A 1D9AA 3G71S 3W66A 4UQGA 4USIA 3HLUA 4KE5A 3TANA 3DOLB 3TEGA 4PWWA 1HNIB 4CT9A 1JJ2R 1P27B 2LEAA 2HS3A 3EWGA 4A8XA 1QVGR 2BVZA 5FLXU 2GVZA 1JLQA 1MU2B 1UL3A 2G2OA 1VRUA 1NK6A 4CLSA 1K73T 2E1RA 2W2OP 4Y34A 3BJYA 1FVSA 4CTAB 2R7OA 5A8RB 3IMQJ 3B8HA 1X4FA 3HD1A 1Q5VA 2Q3PA 3AJ1A 4KYZA 4RW6B 3W9HA 3OL6A 1HNVB 4DU8A 5LJ5Y 1BMQB 2E5JA 4DUYJ 4OJ1A 2DPJA 3AXMA 2R7VA 2XY6A 1URNA 1KFSA 5A8WB 2VBXA 1NPKA 2A0FB 1OSCA 5C24A 4LSZB 3ELHA 5KFIA 4DG1A 2FY8A 3EZOA 1WHYA 4P9SA 3X1LB 1U1PA 3CCJS 3HM9A 2W7PA 2C2NA 4KGMA 1VK8A 3G6YA 3CDBA 1ZZNA 3HI9A 3MR3A 4C2MA 2CXEA 2HFOA 3CCUS 2XC9A 1VLYA 3W2VA 3VZHA 3KJFB 4NMLA 3BDEA 4ID5A 2IDLA 8AT1B 5F9NA 3MEEA 1GTEA 3D9BA 4LFAF 4Y0FA 2AX0A 2IYGA 1FDAA 5J2MB 3BPDA 1WC5A 4R0JA 4CH1A 3HCXA 4DCJB 2QC3A 2BACA 3KUHA 3SV4A 4FZVA 3M6XA 4R8UB 4DV2F 1IR0A 3IA0A 4UY8T 3OFGA 4WBFA 2GCFA 2LXIA 5AXKA 5HO4A 3W5YA 3DCAA 1W7WA 2Q79A 3BQ1A 2AHOB 3KKFA 3SSSA 2HNDB 4LF7J 3NNCA 2UUTA 2AQ4A 2J9DE 2B9WA 1F9EB 4ZVQB 2OPSB 5GMEA 2P6TA 4DFKA 1JLAB 4BWJA 1SCJB 2ZH4A 1HFEL 2YNFB 4WFYA 3AT1B 1B7YB 5CH7B 4NA2A 1LXNA 5HBMB 3EMTA 3VAHA 2ASDA 1OS5A 1W2IA 4K50A 3MCSA 2CZ4A 1TVRB 3UCGA 4A8FA 2EC0A 2BV3A 5B0BA 1BQMB 4CIOA 2GAHC 4LFCJ 2UUBF 3IC1A 1VQKS 2HHXA 4X66F 3RUBL 4PWDA 2U2FA 3V4MA 2FIUA 2OPPA 5IT9Y 2BEFA 4OYIA 4Y3CA 5D78A 1Y4ZB 2CPJA 1VCTA 1S6OA 1KONA 4JI2F 1V3SA 4RNNA 4K0KF 2ZH6A 1SL2A 3LAMA 3RBZA 2G0JA 2APOA 1RGVA 3US5A 4HACA 1SUQB 3HX9A 3RW6A 1SJRA 2KHDA 4DHVA 2CQHA 3NLCA 2JFKA 2UP1A 1RHJB 4ZPDA 4U8VA 5K20B 5L9XA 1CJKA 1MSWD 2RRBA 4FVCA 4DX8H 1FX4A 1F60B 2RDIA 3ZZZA 2K3KA 2VG7B 2HFSA 3I0RA 3DLGA 2DR5A 1T3OA 1X7VA 4BS2A 1NKEA 1Q8IA 4O23A 3BR9A 1KWMA 2ZH2A 3M2UA 3L7OA 1CS4A 3DU5A 2FHJA 1JXEA 2MPUA 2YNHB 3H5SA 5F8IA 2IM3A 3UN5A 4LFAJ 1MMDA 4NLDA 1NHVA 3CJRA 3DLEA 1LV5A 2HGMA 4EBCA 4ZVGA 1SL1A 4IKAA 1MLAA 1NUEA 1Q82T 3SBMA 1VGYA 4DV2J 3FCHA 4WTYA 1NK5A 2M88A 2RHQB 2HHTA 3P5TL 4NRTA 2R8HA 3CF5Q 1MMNA 1QUPA 3CC4S 2RDDA 4J91A 2DNOA 2FC8A 4DV1F 2ATCB 2I5JA 4LBPA 4MYTA 3W1YC 3PNIA 1EKSA 4P52A 2YKQA 2PEHA 3CO9A 3QLHA 4DV7F 2JOQA 4OZ5A 3SSRA 1RYSA 7FD1A 3F44A 4USUA 4MKYA 4N8OA 2BE2B 4QWDA 2BA9A 2QGFB 3UR3C 2W7OA 1KHWA 4RW9B 3BQ0A 1VLOA 5C2CA 3E3XA 4KJIA 3C8YA 2KT2A 4NZ7A 4NX9A 2UUBJ 3OTEA 3NAHA 3O1LA 1UFLA 5DZ6A 2DR9A 4ZVEA 1IBMJ 2ZKUA 2ZJRQ 2Y1RI 4ES1A 3T41A 3PR5B 1N0UA 4JI2J 5KFRA 3THTA 3E8OA 4RU2A 4USKA 4F4ZA 4F50A 1Q86T 1RTHB 4KPYA 4HDGA 4ED6A 1RAIB 2V8VA 3RBXA 2XSJB 4NCAA 1VOMA 3MMCA 2AEFA 1CJUB 1P1TA 3T1HF 4I68A 1HWLA 3IGNA 5K14A 4CP5A 5A8KA 1UFWA 3IG1B 3F56A 4HT5A 4QWCA 5ITHA 3IBFB 5KFSA 2W2QP 5LOQA 4GKKF 2LECA 4LVNP 1FJ7A 4I6AA 2YH0A 3QGGA 4HTJA 4LF4F 3OTOF 1WC4A 1EQMA 3FQLA 3RBEA 2ILYA 3VGSA 4J9QA 1Z4UA 2HRUA 4LR7A 1QVFR 1VQ5S 3BGFA 5GAHI 1IQTA 1VRUB 3V81B 2I6WA 3H25A 1FD2A 3J7YI 4UOFA 1QAIA 2RQCA 5IXUA 2ZDOA 2CPHA 2UVRA 1CQMA 2HLTA 3D2WA 1JIHA 4B9MA 1Q5YA 2XHCA 2ZOMA 1RAHB 2HHUA 2RAQA 1Q8KA 2XMWA 2GVDA 1YZ7A 3MCOA 4TN2A 5L1KA 1NZAA 4DV1J 4ER8A 3H5XA 2DIVA 4JI4F 3M8QA 3MMBB 2OSRA 3CJSA 3IR5B 3TJ9A 4HI1A 2W24A 3B4MA 4EYHB 3MEDA 4CT8A 4J37A 4L3KA 3RZAA 3D1OA 5CXTA 2FHJD 1R8HA 8RUCA 3QJPA 2OLWA 1UAWA 3BKTA 1YX2A 3J7A1 4WFBQ 2HBQB 1FE0A 2OKQA 2DRAA 3FJ2A 4OHWA 1WHVA 2PIIA 1NCLA 5ETSA 1TL3B 5DO2A 2YNIA 2GNKA 4RUBA 4C4WA 1F0XA 3PJ9A 4J9NA 3QRRA 3GR0A 3TAMA 2CQ4A 1NSQA 5HI7A 1T9XA 1HQ2A 4X4UA 1U7LA 2ZBIA 3QNWB 3RB6A 1CSJA 3PR4A 2HAIA 1LFPA 3OL9A 5K8MA 4F0HA 4I4BA 2WOMA 4DZ6A 4KPCA 3GFYA 2DGXA 2QMWA 4Z37A 3L7PA 3UN2A 3FCWA 3OD2A 2HIQA 3T1HJ 4DR7F 1FA0A 2HQGA 4OYMA 3IRXA 3PEHA 3M6UA 1B7FA 4NASA 2DGTA 4GKKJ 2DGUA 3IGVA 3NS7B 4F36A 1JLGA 2W2PP 2JLEA 3TP2A 1XNRJ 1EARA 1UJ4A 1M5KC 1O5JA 2AJ1A 3OXLA 4CO1A 4HYKA 4LF4J 2CJKA 5L8RC 3DLKA 5KFLA 3UPFA 2XYHB 4ZLNA 4DV4F 4V1Ak 4Q8FA 1IM4A 2IDEA 1FRIA 4TY9A 3MFIA 1O6XA 3HVAA 4Y28C 3TJ8A 1K47A 5EX0A 1MNEA 1M90T 4MKAA 3JQKA 5CYJA 3A3NB 3CC7S 4PG8A 3PXGa 1EP4A 2EBGA 3DM2B 2PT0A 2C2ZB 4ZVOB 3OR1B 2BXJA 3MM8A 4MK7A 2CQ3A 3N5FA 2V8DA 3WX4A 3CC2S 1OYDA 1VR6A 4U8YA 2H4WB 3NNHA 2DT9A 3JTNA 2U1AA 4QWBA 4RL1A 4KB7A 2CRLA 1KBRA 1N88A 2M8HA 5KG7A 4JI4J 2J0WA 3FQKA 3KK3A 3EPGA 4KT0C 4XO0A 5KFAA 5AJ3F 4LRCA 2R7WA 1NHUA 1YITS 2IM1A 4PYDA 3SQGA 3NWRA 3RAQA 4EUVA 3C66A 2C28A 3P6YC 1X9MA 2V4JA 2FLNA 4HVZA 4J5OA 4URSA 4KO0B 1HI1A 2BKPA 3OW2R 2L3MA 4UT4A 2CPZA 2Z2MA 4M1KA 2OPQB 4I56A 2HNYA 3PYGA 4HHHA 1QE1A 5C42A 1U24A 4J9SA 1FK9A 4KFBA 4C0BA 2YWFA 4X4PA 2YXLA 1VBYA 3D66A 3NCPA 3K7RA 2W9BB 5EX3A 2AGOA 1RBOB 2N7YA 2J0QD 3PRBA 5DQGA 2MKCA 3N6LA 3K8WA 5FLXY 3C6TA 3W60A 1OO0B 2UUWA 1KRPA 1RAEB 4TY8B 3WQPA 3QLHB 4I7FA 5J2QA 3H7HB 2KJVA 2LQJA 4AT1B 4BBYA 3PW5A 1C0UA 4AUKA 2AU0A 2ILZA 1CG2A 1FXLA 2UV8A 4DV4J 2DVIA 2V50A 4F4YA 2HMIB 4L3NA 1RCXB 2EVZA 1HPZA 2E1MC 3LP0B 1TFYA 2UV8G 3I6PA 2MLZA 3T1YJ 3GONA 2V9KA 1CPZA 1CC8A 1X9WA 1LQ9A 4IRCA 4P74A 1M5SA 1F3FA 1V5IB 3K17A 4K4UA 4QCLA 1RACB 1RAGB 1WC0A 4YQWA 2VFVA 5IOLA 4O0NA 1T11A 1YK9A 3RG6A 1VC5A 4O0IA 3H2VE 2DXEA 4JI1F 3G82A 4DLEA 5K14B 2WB4A 4O4RA 1REVA 4J9MA 4DL7A 1VIOA 3A8JA 2E7VA 2QA4S 1C1CA 1VI7A 5EUHA 1TAQA 2ZJQQ 4DCPB 3BGOP 5HP1A 2VG5B 2VFTA 3FSYA 3KXDA 2VQFJ 3L09A 2R42A 1IKWA 1SKSA 5THWA 1Q53A 1L5UA 1XMOF 5IC4B 3GV7B 4OX6A 1R0AB 5DG7A 3ILOA 1UA0A 1RWUA 2DR6A 1HI0P 3MM5A 1FRJA 1S4EA 2VD3A 4J9LA 1NJXA 3PKYA 4NOHA 2MJNA 4ECWA 3D3BJ 5CCMA 3KYLA 5IS2A 1YJTA 4J9KA 3RAMA 2YWHA 3NOCA 4C48A 1WD6A 5C25A 4ZPWR 2GVDB 4LFBF 5CD4H 2E29A 4KV8B 4TQRA 1F5AA 2AWZA 2M8DB 3D6MB 2KHCA 1E6YA 1L3TA 1D8ZA 1U8SA 1Z2LA 1GH8A 1KFDA 1PC4A 4I2QA 2R2UA 1TKTA 2LYVA 2CNNB 4USHA 2E1CA 5IFMA 2M5YA 1SQEA 3ZFVA 1KNZA 1TZ0A 4V19X 1S7IA 1Y3KA 3DHWC 4K7QA 5D8HB 5A6WA 2OEJA 3AAWB 2KYZA 3LWLA 1EZZB 2DHXA 1FEHA 1GX5A 2XBPA 3M30A 5SUHA 1N5YA 2O3DA 1C1BA 3UQSA 3R1HA 1AT1B 4C0OC 2VJVA 4PYAA 3GIMA 2V94A 4KGKA 2KKHA 1HYSA 4DPTA 2QIFA 3C14B 1S9EA 2F65A 4HH0A 2EFVA 1RB0A 1RTJA 1VQOS 3ZTSA 4CZCA 1R89A 2EFPA 2QT7A 3D6HB 1ZAVA 5KFJA 2Q43A 3SCLE 4N7TA 2CADA 1RWXB 3IP0A 3BBCA 4H4OB 3JTOA 2VDHA 4JI1J 2XMKA 1W2BR 4WZMA 2HHQA 4WU3A 1WACA 2VFUA 3BDPA 2RQKA 3KDNA 1YRTA 1JLGB 4CO2A 4DF8A 2J9EA 1H6KX 2EFOA 1VIXA 4Q7AA 3DLKB 1MROA 4ANEA 4F3QA 2RJZA 2HBRB 1IR2A 2HHPA 4ICLA 5KG2A 4H4MA 1XR6A 2E44A 2I1RA 1S97A 2ZZNA 1VS3A 1XMOJ 1DQAA 4A46A 4LSLA 2J7WA 2JVOA 3LAKA 1EP4B 4U67Q 4C3LA 1G4CA 1K1SA 1AA1B 2FZGB 4EZ9A 3MM8B 1U47A 4FF3A 1N5SA 2F8HA 2MQLA 2HW3A 1YI2S 2KU7A 3MXHP 4Y6IA 2HS4A 4UY85 2VBYA 4O3OA 4LFBJ 2WSEC 4IYQA 2XLKA 1D3WA 2DCLA 4DPYA 1H7XA 4MYUA 3KK3B 2FJXA 4X4VA 2CZVC 2BOPA 5LMUJ 4FPRA 4GVBB 4RNOA 5KFXA 3BGLA 1D9DA 4CH0S 3LP1A 1H3DA 5DDRC 1REGX 3HULA 1S10A 3C46A 3H5UA 1U1QA 4F25A 2W8KA 2ZWOA 3V2UC 1PYSB 3S6EA 4QIEA 2ZC3A 4QPTA 4EMDA 4LRFA 3HHLC 3FBCA 4FBTA 1N6QB 2V4JB 2AJ0A 4ECRA 1LK5A 2C3YA 3Q8PB 3GIIA 2HNZB 3Q8SB 3DC2A 3DXBA 2E5IA 3K2YA 5E7OB 1IM6A 4F8RA 2ASJA 1KHVA 2HNYB 2HQIA 2J9DA 3IN5A 4ZCIA 4IO1A 2R8JA 3OR2B 3ITHB 3DGVA 2GIQA 5D4PA 2CJQA 5C42B 4ANCA 2Z58B 4KSEB 9ATCB 2CQDA 5F0UA 2YTCA 2ZM6F 2FJEB 1Q8LA 5KG1A 4IUFA 1VQNS 1YHQS 3W61A 5IM0A 1WOOA 3RB3A 1HI8A 3VGUA 1RT1A 3H40A 4JYAF 2MHNA 1FE4A 1QD1A 4USTA 3BQ2A 2E1AA 2W4CA 3GJQB 2FJWA 2Z2YB 2CDRB 3CMAS 3CDAA 1S1VA 2NYHA 4JI6F 2EPIA 3PJWA 1NK4A 4AL6A 3V4IB 4X4NA 4ENOA 3KK1B 1F5BA 1IBLJ 2AZ1A 1ACMB 2XY5A 4K4VA 2B3TB 2FVRA 2FJAB 5J2QB 4I7FB 1BWVA 2XQCA 2H9ZA 4ZCLA 2NZCA 3TQ1A 4PXBA 1WORA 3RRHA 2FVQA 1WNEA 2HVDA 2EC2A 2PMHA 1LW0A 3MDFA 3NEKA 1N52B 3QT7A 5MAOA 5D4OA 5KT6A 1X4CA 1H2TZ 3BGRA 1S1XA 2HHWA 3MCMA 4QW8A 5FJ4A 3VAFA 4G1QB 3PIOQ 3N4WA 1UKUA 2B4OA 1LWFA 3W63A 2H54B 5LXRA 1RSCA 2DNLA 4Y2MA 3K5MA 4R5PA 1O0PA 3OQ2A 3PTWA 3CD0A 2PE8A 2BJ3A 4PG5A 4DSLA 2ZVSA 3TUPA 5KTQA 3MR6A 3MR2A 1VQMS 5IQQA 3MOZA 1A0OB 5J2PA 2H1YA 1RDRA 2YQ0A 1JLCB 2VF3A 2YX7A 5ETRA 1SV5B 4B3MF 2CNKB 2FLLA 2OHDA 3KLHA 2MGZB 3HHKA 2R7SA 4ZLPA 2OJ3A 2K1RA 2P2CB 1NDCA 5IV4A 3JSYA 3I55S 4HL9A 3RAXA 2GO9A 1WOPA 2L08A 5G4DA 3PHEA 4QR0A 2V68A 1UW9A 5E2QA 3PM9A 5HQ8A 5LSOA 3NY0A 3FEYB 4PEOA 1NM2A 2MKSA 5LXYA 2BDPA 1TKXA 5I42A 1IKWB 3H90A 2JEIA 3LOUA 4Y2IA 4M94A 2OO4A 3HFVA 1FF2A 3ET6B 2FGOA 2ZUGA 3PCOB 1U2FA 4JI0F 4ETZA 5HVFA 1FWPA 3KLIA 3GIJA 3PX4A 4MFBB 4NRUA 1ZZFA 4U7UD 5ETQA 3J81j 2ZM6J 3DRSA 5GADI 1X5PA 4JP8A 2DB1A 1TL7A 5KFYA 2K06A 4M5KA 4JYAJ 3UD5A 1HR0F 2GJIA 4B3RF 2GC8A 4CM2A 2RF2A 1F5CA 1CQNA 4NYPA 5C25B 5ETKA 3H5YA 4I6YA 2C2RA 3LPYA 4JI6J 2VPXB 8ATCB 3EZUA 3TEHB 2DXFA 4FVMA 4DR2F 1RISA 1UEVA 4IG0A 2IY5B 4DF4A 3NP5A 2A1BA 2HRTA 4ELUA 1UW4A 1TL4A 4P2MA 1E6VA 4Q0BB 4N76A 4IOAQ 3NCRA 2QLFB 4F04B 5HATA 4LVOP 3UD3P 1VJWA 2IPOB 3MM9B 2POKA 3K8VA 2R2RA 2Z57B 3W65A 2CQCA 2F9DA 1QAJA 1IUJA 5HSPA 2LKZA 1Y10A 3GWCA 5D4NA 2MQQA 3EVOA 1N5YB 3MPWA 1RUSA 3VF0B 1C1BB 2FHMA 4QOTA 1IBCB 1U09A 1WTFA 4TU9A 2LU1A 4DV5F 4C7QA 3MM7B 1UMJA 3AA9A 3SEOA 1WG5A 4PZVA 1HYSB 4DBQA 4MMOA 1S9EB 1VBXA 2QSWA 4RW4A 1T7PA 3QIDA 4P6QA 4HHJA 4EFAC 4RU9A 5DG8A 2L48A 4RBUA 3H8YA 4IFYB 1OY8A 1UZDA 2HWIA 3DRYA 3PEJA 1S9GB 3G2XA 5B0AA 2KFZA 4K2XA 5M2UA 5L1JA 4B3MJ 1CULA 1FJGF 1YZ6A 1X4GA 2KJWA 1KLMA 5J1EA 2BJ1A 3UCUP 2KTQA 3U1LA 4M5DB 2VOPA 4DQRA 3U1MA 3FNNA 2CPIA 2WTFA 2ZH5A 1KLNA 3DOKA 5DS7A 4AE5A 3NAIA 4WP3A 3GIRA 3OHAA 1S6PA 1MROB 2GHVC 3MF5A 3E2EA 3P3DA 4G6VB 4PKDB 1EX8A 2AF6A 2V63A 3UR0A 3K57A 3M8PA 2QYGA 3TUIC 3ETOA 4JI0J 4F3MA 4P2SA 5BYQA 3SCJE 4LSLB 2MZ1A 1R3NA 2KM8C 2AD9A 1NK9A 3KLVA 2R7TA 2C42A 3DMJA 2EFNA 1R27B 2F1FA 3NGSA 1RWNB 1PO6A 1WEZA 3EX7B 3KHRA 2FD2A 1HR0J 2YVSA 1V5VA 2AJ4A 2DNRA 2B4PA 3LWMA 2QA2A 1R8PA 5H1SV 2J9CA 2F3JA 3H2UB 4Q2LA 5IC6B 4MT1A 2X51A 3M2RA 2RDJA 2HVZA 4AFFA 2VFRA 4DR2J 2VH7A 2B7BB 3V6JA 3KDOA 2BX6A 2FVCA 1XR5A 1VK3A 3M8ZA 3QGIA 3L3CA 2MXYA 2EFQA 1RT5B 1N33J 2ZKTA 3CJ4A 3MEKA 1X0FA 4NL5A 2YKPA 2R9LA 1JKHB 2XEXA 1BQNA 5BXIA 3LUYA 1NSAA 1SC6A 2ZNZA 3QGPA 3S01A 2M9KA 4ZVRB 2GJFA 2XCAA 5KG0A 5L1LA 4F4KA 1FKOB 4XK8C 5DQHA 4MAKA 4OX7A 2HVIA 4CYUB 1PC5A 1UZHA 2DBBA 4A8KA 2JX2A 4DV5J 5ETNA 1ROFA 5KT5A 3JTPA 4IR9A 2JFDA 1JLEB 1V6HA 4DX6A 4YB7A 3RU0A 4AD6A 1JWWA 1N34F 1N0VC 2QL5B 1S99A 3C19A 1WF0A 4YR0A 3U27A 4JV5F 1S49A 5CQGA 2OD4A 4M5LA 3B4DA 3GCWP 1JB0C 1F3VA 5HJYA 1DFDA 4OI1A 5IM0B 1FRLA 3JQMA 2HK3A 3KTQA 2RMLA 2E5LF 3OXFA 3CW2C 1H38A 2AYEA 3MFHA 1LKZA 3MPVA 3BPSP 1S1WB 4A8OA 4KHMA 1TK0A 3T5LA 3FFIA 2W2MP 4ITSA 1FVQA 3QZ7A 1L3UA 2BYCA 2GQQA 3ENVA 2J0XA 1HIYA 1LW0B 3ZZPA 5AE2A 4KGZB 5EN1A 5MLCV 2B9EA 3UI3A 1V3ZA 1JJ4A 4M5IA 3ZZUA 3VAGA 2CG8A 1SBRA 1HBUB 3BGRB 4IH7A 4M8LA 3PW2A 4ZPVR 2IIHA 1P1LA 1TL5A 3ZTQA 2AKWB 3QRPA 3FC9A 3MCNA 3T3FA 4HDHA 1NDKA 3G86A 4Z7YA 4HKQA 4HLBA 3D0IE 2DISA 4DEZA 3QYYA 4P2FA 3DLLQ 2MKIA 1R0BG 4R5PB 3HMJG 3V6DA 4FN5A 3HT3A 1WF1A 3BBBA 2WBMA 4LJMA 4D3GA 1MU2A 1RT6B 5GAGU 2WW8A 2P9CA 2LMIA 4H4KC 2XMVA 5J2PB 3VGVA 1S9FA 2HYIB 3G4SS 2DKOB 4E0DA 3IBCB 3TVYA 4LF2A 5A8RA 3OL8A 1SKUB 2BABA 2K1RB 4ED4A 3R2CJ 4GRSA 2I8EA 2Z2LA 4NLYA 1YJVA 1JX4A 2G13A 3NWGA 5KFCA 1PILA 3KHGA 3BH7B 2Q66A 4RW6A 3H4BA 3R5BA 4LIWA 1U1OA 2F4VJ 4DL5A 1R8CA 2QFIA 4XDDA 2IM0A 3M32A 1YJRA 3K5OA 2DHAA 5A8WA 1X9SA 1TKXB 1B64A 1MG7A 2IRYA 2YBVA 1FKPA 2VA2A 1WDTA 2CQ0A 1I3OB 4QPXA 4FYXB 5I3QA 1N34J 1UCNA 2GQ2A 4NLSA 2CVEA 4CLZA 4JV5J 3W64A 1HHQA 3OVAA 3P49B 4OLOA 3OUYB 1LNQA 4K4WA 2N4CA 1Q8BA 2E5LJ 4X65F 2LA6A 2RF2B 1UFKA 2BANB 3VAKA 1D0EA 2AYMA 3S8SA 2YKNA 3GJSB 1NEEA 1U1NA 3SXLA 1ZM9A 4ZP9A 1DTTA 4ELVA 5J2MA 4W98A 3AB2B 1HNZF 2I2YA 2C22A 1MWYA 3LANA 1E6VB 3SCIE 3NKYA 4NI2B 4N47A 1KVKA 2XWYA 3IS9B 3HD2A 1ZM4A 3IXQA 1X4EA 2C2DA 3FEXB 1TFWA 4RUCA 1UEUA 2B56A 2HNDA 3TJAA 1GXLA 4QIGA 2KH9A 1ZS6A 1RWPB 3KMQA 4ZVHA 4HEA9 2VUGA 4EO6A 4OZ2A 2VQEF 1B99A 1N5QA 1JLAA 1TKZB 4FYYB 3R5AA 4WCEQ 2YNFA 2N3LA 1HNXJ 5HBMA 7FDRA 2VPZB 1SJQA 1XC9A 2FJDB 1TVRA 4M63A 2O1PA 3TX0A 3TZZA 1BQMA 2XO6A 3LP2B 4G1IA 4URQU 2MLYA 2MZRA 4CLWA 1HWJA 1C0TB 3A12A 1UWAA 5E3AA 1DLOA 2JC1A 2LDYA 2D9PA 2K8GA 1X0PA 1MN7A 4PWUA 3D6FB 4ED2A 5KFKA 1FDNA 1SUQA 4LBHA 3J7ZT 2NXCA 1S6PB 2ACYA 4NWBA 1TU0B 3HHLA 4C8MA 2LQ8A 1K44A 4F02A 1WI8A 1TUVA 1JK9B 4B9TA 3DOMA 2NREA 3HP6A 3MECB 1FRXA 3N0VA 1LW2B 3M8PB 3DYAB 2OPRB 3HFKA 1FDDA 2XWXA 1S0MA 4WK3A 3KUGA 3TZXA 4ZPAA 3G9CA 3QBCA 4DR3F 4BDPA 4WYWA 5F8JA 5H9EK 1DTQA 3N79A 1NSPA 2L9WA 4C8YA 2PC6A 2OAUA 4ATNA 4DPXA 1HKAA 4X65J 1EKRA 3MTJA 1M1HA 4YUDA 4Y2AA 2RB7A 3R9LA 4ED7A 2K2PA 3Q8VA 3P45B 4Q8EA 3L4BC 1GT8A 5M2RA 3M2RB 5T41A 2YNHA 3AJ2A 1OQ3A 1P8GA 2QFJA 2D3OR 2AZ3A 1SQGA 4ID8A 2HIYA 4LR9A 3PFEA 4NA1A 1HNZJ 4UUXA 2PN6A 1ZM2A 2MSSA 2JNJA 3HFZB 3ENAA 2A6MA 1BQNB 2RILA 2DH8A 3CCTA 3NG8A 3IO1A 4F4XA 2IAJA 1JJCB 3CIZA 4QZVB 2XMUA 1TV6A 2LQ9A 5HJXA 4ILMA 3QT6A 4QYZK 2ZE2B 2MQPA 3MZIA 2HRYA 5CHCB 3FVYA 1HD1A 1MWQA 1ZAXA 3BF4A 2GIFA 3CUNA 5LSLA 3HSDA 1GMVA 3M2VB 2ZNYA 4LF9F 1PAUB 4RW9A 5KFWA 1X4AA 3G6ES 4OI2A 2WONA 4ECXA 2NUUG 2CYYA 3CPWR 2FHKA 4DX5A 4ZP6A 4DR1F 2D9OA 3T6BA 3FSXA 2IC3B 2NZ4A 4NZ0A 2QL7B 1RWKB 5HN0A 1WHXA 1XBWA 4J9UE 1GMWA 3THVA 2C2KB 5F8GA 4X4RA 4HHUA 3AOCA 1FFSB 1RTHA 5B09A 4DDFA 4B3SF 3KWMA 2XSJA 1P9QC 3AJDA 1ZETA 1CJUA 1HWUA 3DLHA 2IRUA 1N5TA 1RAAB 1TKDA 3IG1A 2PI5A 3EGVA 4NXMF 1EETB 3PX0A 2J8AA 2WAQD 2ZFHA 2RUSA 5T14A 1PJ5A 1VJQA 1UPPA 5I4MA 1S1UA 1OPIA 2BMBA 3A1YG 5DGAA 1NK0A 2FVPA 4DQPA 3KG0A 4DSJA 1KTQA 2DIUA 4O4GB 4OYPA 2FTRA 3V6DB 1GEHA 3QPIA 5E5NA 2KRRA 3I9V9 5F8NA 3AOAA 4X2BA 5IT0A 1RHMB 4PQAA 2NSBA 5FD1A 3V81A 4HT7A 5HROA 3GMGA 3LQVA 4QR2A 3HHLD 2VBWA 1NBEB 3TARA 3R8YA 2MQOA 5I3PA 2XTJP 3SSQA 4O3QA 2KG0A 3GV5B 4B3TF 1IQZA 2IA0A 1Y3JA 5DDPC 4P10A 3MUVP 4RJVA 3KFWX 4W92B 3J81U 1R8BA 5KT2A 4ETXA 2EK6A 4PR6A 4ECTA 1WG1A 1ITPA 1QM9A 3W5ZA 5HAOA 2NXEA 3M32B 3E01A 3DGPB 3MMBA 3H0PA 1FJCA 1PAEX 4OIXA 1EAYC 1ELOA 3T1AA 4U7CA 1FKPB 2COLA 3G8QA 1B4SA 3CIMA 2ALZA 4MKVA 1KOOA 2ZH8A 2AJ2A 4BWMA 1X31C 4LF9J 5J2NB 1T3NA 2IBKA 2CZ9A 2NUHA 4XPEA 2ZC4A 2BOAA 4ECYA 2HFUA 3VV2B 1U2CA 1PKUA 2RUGA 5F8HA 1TL3A 3I4PA 4DR1J 1M1GA 2VODA 1ZYQA 3UN3A 3AOBA 2BKOA 2YKNB 5HMXA 3TQEA 3CVKA 3TO8A 1DTTB 2VC1A 1U2RA 1RTIB 2EFGA 2MQ8A 4TYAA 3DRXA 3CB4A 3CCMS 2A10A 3BYRA 3EYZA 2XS5A 4B3SJ 2ZBCA 1UEKA 1ZTWA 2RU9A 1K1QA 4L74A 3Q89A 1VDHA 2YX4A 1VQSA 1WOSA 2CQGA 1RT7A 2G1DA 5GAEI 1RWOB 3U02A 5BYRA 2DXDA 4NXMJ 3TAQA 1B0TA 4ZJLA 5F41A 4FS2A 4MK9A 2QZ8A 1SC3B 2B43A 1RHRB 4A8QA 4C11B 3IM8A 5AE1A 3AH6A 4U96A 3PDNA 5H9FK 3BKFA 2DGSA 2F7VA 2XMAA 1FNMA 4OYXA 2G0IA 2V8PA 3O6QA 3W62A 2E7XA 3IWNC 1NSKL 4K4XA 4ZN3A 1GMWD 4HR2A 2DNGA 3FMBA 4JI5F 3SDEB 1QUVA 4F2RA 2V0NA 1OMSA 2X1GA 3DM2A 4A8SA 1SH0A 4Q2MA 2AX1A 1RAOA 3R5JB 2W2NP 1DLOB 3OR1A 3CTRA 2UVUA 4B3OB 1T03B 4E98A 4ZPTR 4B3TJ 2N3OA 5KFUA 2XYGB 1FXDA 3QSIA 1SI9A 2VBZA 5KT4A 1N32F 3FEZA 3OL7A 1RT4B 1I6JA 5E3PA 1WTBA 1CBKA 2YKOA 1BHNA 1CJTB 1FKAF 2RU3A 3HHLB 1U45A 2RVJA 3R6LB 3DOMB 1HWIA 4DR5F 2HWTA 1BUXA 2YQ1A 1K0VA 3K0JA 1FWKA 2CKWA 4PABA 3W9JA 2GMLA 3KJNB 3AXKA 1GX6A 2XNRA 2JDJA 2R7XA 2IM2A 1NH7A 1FTCA 4X62F 4KO0A 2ZHBA 2LEBA 3M9OB 1DTQB 4K4YA 1NZ8A 4KHPF 4J7CA 4L6V3 3GB0A 1EJ7L 4DPOA 1XJWB 5KT7A 2JRSA 4CWBA 2OPQA 1Q4RA 3R2DJ 5EWGA 2D1CA 2GMHA 4P71A 5KFHA 2VPWB 1H72C 3VCDA 2RD5C 1UWBA 2J76E 2G1HA 4KY3A 3PO4A 4CDIA 1HA1A 1O51A 3KHLA 3VZIA 2W9BA 5B7WA 2EBEA 3G96A 2YQ3A 3IR7B 3T6JA 1PJ6A 4J9OA 4KGXB 4EEYA 3VQTA 4YR3A 2IAJB 2H3EB 2WBRA 4OYWA 3HK2A 4QU6A 5BR8F 2OGUA 1TV6B 3X3UA 2JJ4D 3GG0A 1NLKL 4TY8A 1U48A 2IBOA 2VFSA 4F3OA 4PG7A 4LSNA 3QRQA 3D4JA 2EKYA 2HHVA 3FGVA 2P8IA 3D7SB 2UXDF 3QIPB 4CM0A 2WSFC 3ZXWA 3IAS9 2HMIA 2Q1LA 4ZPCA 4WPAA 6FD1A 4JI5J 2WONB 3PO5A 1F2GA 3LP0A 2JEFA 1JXLA 2FHOB 3NGUA 1XK8A 4AXIA 4X66J 4H4KA 1TR0A 1LEOA 4YR2A 4XAKA 3CMQA 2ADBA 3M6WA 2CQ2A 2A2DA 3M1VB 4KR0B 1SC4B 3J80Y 1HQEA 1N32J 4K0KJ 1CLFA 3QATA 1IKXB 4YHHF 3IRWP 5IQ6A 3CDWA 4RZRA 1WHWA 2VC0A 3M8YA 2F63A 1KEKA 2ZZMA 5D15A 1HBNA 4P7TA 5A0YA 1IR1A 3HVWA 4Q43A 2RRNA 1RE1B 3BN7A 3PACA 1YRUA 3RB0A 3U1NA 5IWAF 1U1KA 3BREA 4UZBA 3QT8A 3EGZA 3UNYA 2AV5A 2D3UA 4ZHRB 4KHRA 3H20A 5CYMB 1MWZA 2QN6B 3DDKA 2HURA 4X62J 1KN6A 1S1UB 2VG5A 4NLXA 4LR8A 1YSJA 4KHPJ 2IA6A 1R7IA 4P73A 3NGDA 3GFZA 2HVHA 1M5VC 2LU2A 2CNOB 1FRHA 2PSZA 4NYZA 5JXSA 1R0AA 2FLOA 5HROB 2HQCA 4NZ6A 3N5BA 3QT5A 1FI4A 3HHEA 5DGBA 2PDAA 1T0TV 2EXUA 1BGXT 1VMBA 1IVZA 2NXUA 3I4HX 1QSYA 5AT1B 2XZDB 2DNYA 1G1XA 1Y0HA 3MAAA 3S7RA 3OTBA 3MWBA 2ZHOA 5JVHQ 3OVSA 3W5XA 2GV1A 3DI6A 1I5OB 4KV8A 4DPWA 1KQSR 2VOOA 1K9MT 3FRYA 2KVQE 5BR8J 5HMZA 2QO3A 2KDOA 2MZJA 2EI5A 3N6NA 1VQ7S 4NEYA 2UXCF 3E01B 3EXCX 3OFHA 3T5KA 3ADAC 1RLCL 1Q7YT 3GU0A 4C8KA 4DV7J 3D68A 5JVGQ 3MGJA 5DLGA 2QTWA 4ZVTB 3TI0A 5HMWA 3GCXP 3C3LA 2UXDJ 4F0MA 4GVLA 3HVTB 4FXWA 4I1TA 1PJ7A 2CPYA 5U47A 3IFEA 1S5ZA 3V6HA 1MMLA 4F2SA 2ROPA 2XGPA 1IJFB 3N9UC 2OMOA 4WWSA 5GAHU 4IOBA 1RP5A 2DNMA 4OFZA 4NLOA 1FDBA 4O3NA 1IWGA 2NPIA 4L75A 3JXOA 3QSYB 3C14A 1EQ0A 3CJQA 3BS9A 2DEIA 4OMFG 1UPMB 3RRKA 4YHHJ 2X1FA 1X4BA 2HKEA 5DLFA 2AIRB 1BC6A 3M8WA 1SIZA 2N7CA 2GS8A 4DXLA 1LWCA 2V2QA 3PJXA 1WUUA 1Y5NB 4H4OA 2VONA 5LM7E 4B9UA 2CPFA 3WX8A 3HHDA 1Y5IB 1RT7B 2NLWA 2QEXS 1N5VA 3PHTA 2A18A 3KJQB 2CQ1A 2G0CA 2RNEA 2KM8B 5J1NA 3JYTB 1Y00A 3MM6A 2QLBB 1Z2ZA 4ED3A 3OTOJ 2DK2A 4DFMA 2PI4A 5JUMA 1KC8T 3QFWA 1HD0A 2UXBF 2P5VA 1H98A 5G0RA 3TYTA 3GV8B 3H59A 4ZITA 1HMVA 4QWEA 3SQOP 2VA3A 4ZMMA 4UUWA 1PYOB 5AXLA 5ETMA 3CCES 4CNYA 2DNNA 4I2PA 5BJRA 2JVRA 3G6VA 5B08A 1DAXA 4ZCKA 2AEMA 3NRBA 1GXUA 1IBKF 3ZNJ1 1ZOTA 2J6SA 2F40A 1DQ8A 3CDUA 4CLTA 2Z4PA 2R8IA 4DWIA 4DR4F 2MHEA 2Y1LB 1GK8A 2IVYA 3GIKA 1UVNA 1VISA 1G3OA 1QTMA 5B0FA 1APSA 4IG3A 1WELA 1ZBTA 3KNGA 3LO3A 1HBOB 1XEZA 3LTOA 5CYQB 2O66A 4GVBA 4OHZA 4JB8B 5L39A 5CAAA 1RTZA 3I5CA 3SMZA 2LDIA 1FRKA 4OZ1A 5HK4A 5DM6Q 4GMKA 1L3KA 1R6YA 1WEXA 3C15A 1KQGB 2C3UA 3D1QA 3CXCR 4N56A 1BQXA 3HZEA 1N6QA 2KXHA 2VASA 4DL6A 5FIIA 2MEWA 2HNZA 2FJBB 3ILJA 4C0HA 2ZVIA 4P2XA 4OZNA 3O44A 3JS9A 3ZNUA 4YS2A 3NS6A 4ZPBA 3T5JA 2GHWA 1RU1A 2JHEA 2GGPA 1T9TA 5HQLA 3OR2A 2CWXA 2WVCA 3ITHA 4EO8A 3O3LA 4JI3F 1S12A 4DUYF 1UWBB 3MEGA 2UVWA 1KKHA 3DRPA 3NL0A 1UP1A 1AB8A 3EDQB 3HKWA 3J7Z5 2QMXA 4OL8A 1TL1B 4YB5A 1HBMA 2KN4A 2H4YB 3TW0A 3EVWA 1YJ9S 3CJKA 4DR7J 2DNQA 3GLJA 1B3TA 4A47A 3QFHA 4O3PA 3OLBA 1AUDA 3BO3A 1SJ1A 2OEMA 3V4IA 3KK1A 2QRRA 1HL6A 2C3PA 5DG9A 3GTYX 1NJWA 4OHVA 3RR8A 4ZDNA 4LSNB 1G2EA 3SV3A 2F9JA 3NBPB 2M2BA 2LFVA 4K4ZA 1M0SA 2C3MA 1DHMA 2KFNA 1Z1ZA 2VB6A 2UXBJ 3PRDA 1SH2A 4IO9Q 4QW9A 3J81Y 1R6VA 2H5IB 5CABA 1RWMB 2YPZA 4G1QA 2RQ4A 3I9ZA 2MKHA 3O8WA 4ED1A 1OJ4A 5F3TA 1NMEB 3CWJA 2R2SA 4QQBA 3GYXB 3RGIA 3R97A 4PPDA 1OPZA 1Q81T 4C8NA 4S0MA 3KOAA 3QQCD 4ZOSA 1AFJA 1HQEB 3Q86A 4J90A 2KZZA 2PFFB 1PBAA 1RZMA 4LQ3A 4DR4J 1RKJA 2VV5A 1YBUA 3MPDA 3TNVA 4ZLJA 2W25A 3GFHA 2MZSA 4FKXA 4ILRA 1VHIA 1HBNB 2G9OA 5A0YB 5AJ3J 1JLCA 1SV5A 2L9NA 3EZ5A 1GAOA 2MGZA 5BYSA 3H4DA 5EGYA 5B0GA 3DRRB 2L41A 1YIJS 4RW7A 5A76A 2FUG9 2V34A 2PA3A 4K59A 4LFCF 3PW0A 2HQDA 2HK2A 1HNWF 2V4RA 1U02A 2BZ2A 3GFXA 4FYWB 2OP5A 3OVBA 4K8RA 2ZD1A 3OBIA 3LALA 3SYZA 2ZBQA 2OH2A 2Y9HA 2M7SA 1BWEA 2QMUB 2RS8A 1VQ6S 3ET6A 4JV2A 4IQMA 1GXTA 1AFIA 2E66A 3FUYA 2NR0A 1NK8A 4JV1A 2ZITA 4JI3J 2E5HA 4MFBA 5DETA 2E5GA 3SFGA 3BZQA 3KNAA 4JUZA 3NCQA 2RKIB 2LCWA 5F8MA 4ELTA 2G2ZA 1Y11A 3MAAB 3AD8C 4WK1A 3TVKA 4OI6A 2QJ3A 4YOEA 3R5CA 2R7UA 2GJ2A 1S0NA 1IKYB 3DI6B 3BN4A 2W9CA 3C16A 1GQEA 1XIQA 2D3ZA 4HI2A 4EU0A 4WE1B 3R7NB 2Z0GA 4OYAA 4Q0BA 4UQTA 1FO1A 7AT1B 2UU9F 4B9LA 4OV6A 4PQUA 3KUEA 3OPKA 3GJTB 3R7SB 3CD5A 2B8PA 2H5JB 3MM9A 1SQFA 2DNHA 3FZ2A 1RKIA 2YWKA 1CJVB 5KG3A 4ZN1A 1NRKA 3BR8A 1UJ6A 1ZTTA 2MB0B 1OYEA 2DHHA 4CNZA 5F9LA 1JNZB 2XI3A 4Z2XA 4QBUA 1AW0A 4M5HA 2FGCA 3IM9A 5F8LA 3JSMB 1KTVA 4CRJA 1KQKA 2CQBA 1DZ5A 3MM7A 1J5OB 4OZLA 3DXSX 2DJWA 1GMUA 4ERDA 1EHWA 4DFPA 2J0SD 1LOUA 3AA8A 5L9NA 2ZH7A 4ZK7M 2KXNB 2B4UA 2FQQB 1HHTP 1TELA 1VQLS 4AYBD 4OJ3A 4IFYA 1R8AA 5K9FA 4USVA 5HLFB 1LWCB 2ZBRA 3MMAB 4F4AA 1S9GA 2DPIA 2J6TA 1RXOB 3GG1A 3OXGA 1VRQC 2GIRA 4M5DA 4U9RA 1MW7A 1IN0A 1S76D 4J9RA 2DNKA 5DJBA 1HNWJ 4OX8A 1IBMF 1S72S 3MM6B 3W8PA 3AHPA 2HGLA 2W1BA 1WG4A 5CZXA 1RAFB 3K5LA 2EEYA 4ZCMA 3CDEA 2ACMA 4OJHA 3DNCA 5HVGA 5G0RB 4Q44A 2ATLA 3PYEA 1HMVB 1D1UA 1RTDB 1H0HB 2K3IA 5GMKa 1AZSB 3KJVB 2HQFA 2BW7A 1HLWA 2KL8A 1FESA 1S7HA 3ZO7A 4I2PB 4F4WA 3RR7A 4DQSA 1M5OC 1C4AA 4WTOB 5DRKA 3M7VA 3CSKA 4A48A 2PO4A 4UOHA 2W4DA 3W3SA 1CVJA 3DN9A 3M9NB 3RJMB 2YNGB 3FK4A 4DQQA 3ENWA 4KIAA 4NLQA 3BKUA 3FRZA 1IKVB 4IG3B 4B17A 2B51A 1HW8A 4H54A 2DNPA 5KFBA 2V6AA 1RT5A 3B82A 1CEZA 2EK1A 2UU9J 1U25A 2HS0A 1JKHA 2LQ5A 3QJJA 2NS1B 1H2UX 4HH1A 4IDKB 3C15B 1P9YA 3OTDA 2LVWA 1ZM3A 3D28A 2R2TA 2YWGA 1RT2A 2I9SA 4DN0A 5T7LA 1FKOA 2CDQA 4RWWA 3N6MA 4CYUA 3DDIA 3UO0A 2B7CB 4KKOA 3Q0AA 1YKWA 4ZVSB 5DM7Q 2NQPA 5DZ7A 1JLEA 3R3TA 1S0VA 2Y0BB 2GGPB 1N48A 1WJ9A 3H2LA 2JC0A 3MEGB 2DTJA 1F1BB 4ED8A 3Q8RB 4DN9A 3DRPB 4NEZA 4FPIA 4DS5A 2QA4G 4MIAA 3MAQA 2M52A 5KFEA 2ABYA 1HBMB 1F9FA 4OX9F 3CJKB 6AT1B 2VG6B 4J9PA 4IOCQ 2BE9B 1S1WA 2IRXA 3I31A 1NPRA 5KFTA 4YN3B 1JLFB 4RPFA 2DHGA 2XCPA 1Q0NA 5D0EA 5FDLB 3OLAA 2G2YA 3UVJB 2CPDA 4RWXA 3GYGA 4G1PA 2C3OA 5SZTA 3I82A 1R0CB 1LK7A 3HZGA 2MDAA 1T9YA 4I0WA 3CJ8A 2XB2D 2PGCA 3Q8YA 3PY8A 2IHR1 5IV3A 1HBUA 4LIRA 1S77D 4KC5A 2ZH1A 1OWXA 2XULA 4NLRA 2M0GB 2VHGA 4PG4A 4IR1A 2PFDA 3QMQA 3I5AA 2ZJPQ 2GQCA 3ETMA 1LWEA 3Q22A 2BRKA 3WHIA 2UUCF 2KO1A 2MLXA 2MKYA 2KT5A 3TX8A 1EB0A 1BY9A 2OTLS 4QIFA 4XDCA 1Y5LB 1XNRF 3QO9A 1RT6A 1SL0A 2ZUAA 2DGVA 1C4CA 3TA1A 1PGZA 3HHNB 4QYRA 2W7AA 4K5SA 4MJKA 3M8RA 4FP9A 2BM0A 5ETPA 2R4FA 3PW4A 2GVZB 1JLQB 2CAJA 4RW7B 2B0GA 4F0KA 4CO3A 5HVHA 2CJBA 1VRTA 3B54A 3TRGA 1UVJA 3QAEA 4WXWA 2NYIA 4N77A 2ZD1B 1HWKA 1T02A 3K5NA 5LMNF 2YWEA 2IMWP 2ZOFA 3R5DA 3PW7A 1SPBP 2V67A 3NS5A 3BO2A 2B5JA 3LGHA 2HG4A 1ULRA 4FBUA 3EUNA 4DL2A 2AJQA 1NJYA 3CCRS 4RLEA 5C24B 5LT5A 3OUYA 5E3RA 4DG1B 1YTYA 4C3KA 4DV3F 1FRMA 4W90B 4LUBA 4OX9J 3O5TB 2GAGC 5E33A 3GQCA 4CLYA 2BANA 1AYEA 4X4OA 2FJVA 2W9CB 2GA7A 4DJBA 3C16B 2ZZTA 3WC2A 2DGOA 2BBEA 2FLPA 4ILLA 2O67A 2D7SA 3WIUA 3PZPA 1J2VA 2DR8A 2YKMA 3W2VB 2ZWPA 2LP4A 2D69A 3TR5A 5J1PA 4TU8A 4NI2A 3PG9A 4ID5B 1VQ9S 2X1AA 4PQUB 1WKJA 2JL9A 2KVIA 2DGWA 2HAFA 3IS9A 3MEEB 4D3HA 4X64F 5D0RA 2FZKB 3POTA 2Z30B 2LXUA 1XTZA 4AXJA 4WKYA 1NPPA 4CQ1A 4NLVA 1FTRA 1VBZA 2WCXA 3P5BP 2AMCB 2G4BA 4FYVB 2XHWA 1YJ7A 4DSFA 1KP6A 2IJRA 1Q79A 1TKZA 1PBUA 4KH0B 2AGPA 2BQ3A 2UUCJ 4LQ9A 2FVSA 5GADU 3C2PA 1U26A 4ES3A 4NYOA 2Z2ZA 3CJTA 3BSNA 2HPUA 3E51A 3UE2A 3VAMA 4DMZA 1KD1T 2VIHA 4WJBA 3LP2A 4FNHA 2HQ3A 1PG5B 1C0TA 3HVRA 1RCOB 3KK2A 1RADB 4RW8A 3NGRA 3BSCA 4HTIA 2XM3A 3BSAA 3JAMU 1S6QA 2OIHA 2OI2A 1XMQF 3CEDA 3OFEA 2HBYB 3CJ3A 4O3RA 1HQUA 2D3O1 3T1YF 2UVVA 4AQYF 4PWDB 1U8WA 2B8QA 2OPPB 4LF5F 4F26A 4P72A 2OFGX 2HHSA 3HXMA 3VHQA 3R7BB 2DHSA 1H2VZ 3AB4B 3MECA 5LMNJ 2PEBA 1JNRB 3U7JA 1FT8A 2XZWA 3T5HA 1LW2A 4WIIA 2X7IA 4HACB 1FNXH 3DYAA 2OPRA 2BM1A 2R3VA 4A8MP 4GO5X 1WSRA 1FFGB 3ZTOA 2HHHF 3T19A 3DLBA 1N36F 4NA3A 3MPYA 4JI8F 1SH3A 4UTGA 1RYRA 2Y1IA 3NGTA 2N4DA 3LF0A 1FXRA 4DV3J 1CJKB 3SFUA 4YDDB 3CD7A 3F73A 2V5HG 2RSQA 4CO5A 4B3RJ 3Q23A 4YB6A 1FFWB 2XNQA 2VL1A 3RRGA 3ISNC 4NLWA 2WHOA 2JZ5A 1T9UA 1A7GE 3ZZOA 3IR6B 2VDIA 3I0RB 3DLGB 2XZTB 2VQFF 2J5AA 1TMJA 3W2WA 2WB1D 4ECVA 3M2UB 4L73A 4AL5A 4IH6A 1CS4B 1VFJA 1HHSA 3UWTA 4A8YA 4X64J 2ZOGA 1UVLA 1NB2A 1ZA2B 3J7AN 3DLEB 2WVDA 3PYDA 4AL7A 2GFFA 2CPXA 2E1PA 5LL6d 1JJHA 1RT2B 3B78A 4M95A 2Y3YA 1T9WA 5T7LB 3I32A 4EBDA 2MKKA 1VQ8S 3TWZA 1U1MA 1KS2A 3EICA 3IWXA 2AP6A 1H74A 2ZE2A 4KKOB 5F3ZA 1WWHA 1J27A 4IRDA 2NCKL 1RBAA 3GJRB 1SKWA 4PXEA 5E41A 3QWPA 1XMBA 4DL0C 2I5JB 2FDNA 2P9EA 4CLKA 3FMWA 3M2VA 4NCGA 3WBZA 2DH9A 1M5PC 1TK5A 2J6UA 4EZ6A 4C6AA 4RNMA 3VVTA 1N4LA 4IRKA 1RJJA 4ZIVA 3FBEA 4ALZA 5KFDA 1FJGJ 4ED0A 3ZZRA 2HGNA 2AEJA 3AODA 1FEEA 3RW7A 4GC6A 2MQNA 2IC3A 4DV6F 4DL4A 3GPAA 1XMQJ 4BLGA 3FBFA 2FPHX 4FF1A 2QL9B 4AQYJ 2BR0A 5KFQA 4B02A 4LF5J 4XPCA 1YVFA 1FNOA 1NO8A 2F5GA 1NJZA 3CD6S 3CT9A 3A8KA 2AYBA 2Q6BA 1QSSA 1DBDA 5H9EJ 4L76A 1YWXA 4ZVUB 4R0EA 4N5SA 3JB9k 4C3MA 2HHHJ 1EETA 1SXLA 1N36J 1J5EF 4JI8J 1LWEB 3MMCB 1QSLA 5AXMA 2LQBA 4ECUA 2XGQA 2BQUA 3O2IA 1HARA 5A8KB 4O4GA 3W8GA 1NXIA 4PUOA 3KG4A 2GO8A 3UDLA 4KAIA 4DI6A 4LT6A 3D0GE 4RO0A 3QO9B 5KFMA 1XQIA 1X5SA 3PVXA 2MMYA 4O44A 4DQIA 1T95A 1JQGA 2HEKA 4I67A 4IFVA 2V2KA 3CNQP 1XR7A 1B70B 4WF9Q 2B9XA 3MD1A 4OQJA 1L3SA 4I64A 2MJUA 2A3JA 1XWLA 4NE9C 4QYZJ 1TQLA 2XG8A 5LJ3Y 9RUBA 5KG4A 1VRTB 1VC6A 5DQIA 2KB2A 1KVIA 1NKBA 1GTHA 4DFJA 4UF4A 2O5DA 3TVZA 3M8SA 3EM1A 3R27A 1TUWA 1BD6A 3R5GA 3DGPA 4DUZF 4NLPA 2IJNA 4TLQA 3D67A 1WKLA 3SZ2A 4OYBA 1NHKL 3J80U 2XS2A 4OZ0A 3QJLA 2B5JB 3JSBA 2OUGA 3M8QB 2PD1A 3M05A 1WC3A 1RHKB 2N82B 2DEJA 5J2NA 1QJHA 3MEDB 5LMUF 1RU2A 4X4SA 3HT0A 1YBTA 2CQPA 3FCVA 1GFWB 2DRBA 1U0SA 4YEAA 2VJUA 4DCOB 2ROEA 1SC1B 3I96A 2H51B 3ZC4A 2J8SA 3PRVA 3ILIA 3UDEA 4N8NA 3OV7A 4DV6J 3BM7A 4WU2A 3FZBA 2RQMA 5KFZA 5B0CA 4L72B 1RTIA 4ED5A 4OV1A 6FDRA 2YNIB 3ISZA 2YKMB 2GX8A 2HZVA 4CO0A 3UW1A 1C2PA 2JSXA 5GMDA 1OSDA 2RS2A 3TAMB 2QX0A 3POTB 1ZPVA 3MUMP 2ZDPA 3I56S 5AE3A 3EPIA 4JV0A 2RT3A 1D9FA 4KQZA 4NLUA 1YRXA 1FWLA 2QA1A 4KBIA 2WOMB 4R25A 1RA7A 2LA4A 2O01C 1YGYA 1J5EJ 1FERA 4WP8A 3FSIA 2JWNA 4C11A 4WFZA 2Z56B 1U6ZA 4ZLLA 5D6GA 4U6PA 3IRXB 4RUHA 2CFXA 4TXSA 4RR5A 1IBLF 5I3UA 1DQ9A 3OT9A 5D3GA 4PAAA 1U1RA 1WDDA 2H65B 2QLXA 2Q6CA 2KI2A 3SDEA 2MZTA 2QLJB 1RWWB 3I0SA 2OSQA 5LSRA 3K59A 1W25A 4M5NA 5KFOA 3N28A 3CO0P 5EWEA 3OHBA 3KK2B 4B3OA 1T03A 3LA0A 4RW8B 1YJNS 4YMEA 2V69A 1X4DA 1S6QB 3JSRA 2DD8S 3KHHA 4ZS6A 3ICLA 4LRAA 4FF4A 3P8BB 4TKTA 1HQUB 1RT4A 3VVUA 4DU7A 1HW9A 1CJTA 2E9ZA 1U6BA 5ETLA 5C7PA 1XERA 4DOZA 4DUZJ 2CNLB 4WFNQ 3EDRB 2IVMA 2WVBA 3D1HA 2YKAA 4RX6A 4JOUA 3D54A 2HLUA 2YH1A 3CMES 4LREA 2X1BA 4LF8F 5CD4A 3DHXA 3D0HE 2HSEB 3ZTPA 4CO4A 4OZJA 4DX7A 4NLTA 4F67A 1RBLA 5HMYA 3SQGB 4UOGA 5CZVA 4Z7CA 2IFXA 3FKBA 2WW4A 2X3DA 3CJ0A 5HQMA 1CC7A 1Q7LB 2B6AA 2RH3A 1SKRA 3CCZA 2QV6A 3SIPB 1PCAA 1M1KT 4LRDA 4PXCA 3W2WB 4RBVA 3MUTP 3WDOA 2CIMA 1ZA1B 1ZPWX 3K58A 2BE7D 3B6BA 1QE1B 4TYBA 2CQIA 1URRA 4GO7X 5KFPA 1FK9B 5H9FJ 4KFBB 1SVDA 5C2GA 2DRDA 4JI7F 2XSFA 1S48A 1F9HA 2DY1A 4ECSA 4WFXA 2KFYA 2XY7A 4UZCA 4MTPA 1QAXA 2VQEJ 3F0NA 3WC0A 3KLEA 3VQSA 2VU5A 4OHXA 3G87A 2KT3A 1DRZA 4M5GA 3VALA 2FB0A 2BJ8A 5HL7Q 1FJEB 1RWVB 1H7WA 3L7UA 3IAM9 3ZTRA 3C6TB 3QIPA 2FC9A 4NCGB 3OJSA 1IJEB 4FDFA 1M5HA 4ANDA 3PX6A 4LF1A 1C0UB 3TAPA 3OFFA 5KG6A 1SJ4P 3THPA 2AGQA 4U7UK 4PXDA 4O3SA 3ZZTA 2B9YA 3HSGA 1TUGB 2DR7A 1IXKA 3P4UB 3QWUA 3A13A 3M1VA 1HPZB 4B08A 3OSPA 2DCUB 1KDNA 1SIWB 1IKXA 3NNAA 2JH3A 5B0EA 1S1TA 2V4QA 4OYZA 2HBZB 3GR1A 4QIWD 2L9DA 3HPOA 1DURA 1JXVA 1RT3A 2JLFA 5L1IA 2ZH9A 2BW2A 3VAJA 3A4TA 3BH6B 4ZHRA 2V9WA 4LF8J 3AQPA 4FNIA 5CYMA 1FHTA 4KGVB 4J9VA 5M2PA 1KR4A 3NMAA 4ZJQA 4DR3J 3G82B 1NU4A 5K8OA 2CJAA 2DGQA 4I69A 2H48B 3UNGC 4ECZA 1REVB 3ZZ0A 4PUOB 1LWXA 5EDWA 4WP9A 1D09B 1C1CB 3BV8A 3NGKA 1NNDA 2J7KA 5F0WA 4DSIA 4FYDA 2JLGA 4X4TA 3Q2TC 5HP1B 3HSJA 4O44B 1PSDA 1AXQA 2EG2A 2MTLA 3PYFA 4IFVB 1T94A 1U0HA 5CA5A 2AW0A 3PKMA 3EJMA 2DH7A 1ZAWA 2DITA 1NH8A 4EGLA 4YB1P 1N54B 2FZCB 4A8WA 1YJWS 5E3QA 4B9NA 2Y8WA 3MM5B 2BJ7A 2XS7A 1UETA 2ALYB 3H42A 4JI7J 3G6XA 3R6GB 3UCZP 2MKJA 2BKNA 2MZQA 2E7WA 3PV8A 3ZZYA 3GSIA 2V2ZA 2WRMA 2MSTA 4ZA1A 4K4TA 4ECQA 5A2QU 2P9GA 5AXNA 5L38A 3W7BA 3HVTA 4OYOA 1E6YB 4EWTA 3SI8A 1JLBA 3WZ0A 3JAMY 2YPYA 3RBDA 2NSCA 4OI0A 1X8DA 4I2QB 1YBAA 1TKTB 5KFGA 2XMTA 2IMOA 1N33F 3MI7X 1RHQB 3OJUA 3CE8A 4P7VA 1UVMA 1T05A 4CLLA 4CLPA 4C8LA 3V6KA 4LBIA 2PA8D 1TTHB 2QSFA 3M30B 3MAHA 2MQMA 2XMMA 4P75A 2YWWA 3C6UA 1TMMA 3BBFA 2PMZD 3T9NA 4ZKAA 4NPOA 3ULHA 2Y8YA 2M70A 4PRFA 4ES2A 5KOWA 1UJ5A 1S79A 1SJFA 5D0HA 4C8OA 4BHQA 1RTJB 1A6LA 1UVKA 1FCAA 5ETVA 2C2OB 4F7VA 4CCHA 4OJGA 3HJFA 2M3DA 4Y65A 3D5MA 4USWA 2WK4A 5KFVA 4C97A 1VYAA 3N01A 1NJIT 4BC9A 4CLUA 1TAUA 3JYTA 2QG9B 4BC7A 3RYLA 4Q45A 1OQ6A 4FF2A 1RA6A 3VTIA 1V9OA 2JEGA 1FD8A 1U49A 3MR7A 5I3UB 1UTAA 5D3GB 3MTKA 1Y9OA 1VHFA 2XO7A 2D41A 1R43A 2GMJA 2F8MA 4DL3A 1RAJA 2FY1A 1Q95G 4RNHA 1GNKA 1OIAA 4K2JA 2OMLA 4FXVA 3I0SB 3BO4A 4ICLB 3MR5A 1DY3A 3CJ5A 4H4MB 4PG6A 2YX1A 3ILLA 4Y2KA 5K8NA 3FBBA 4PCQA 1X5OA 4CI0B 4YFUA 2CJYB 5C5JA 4PPZA 3K5PA 3KLGA 3BEGB 3L95X 2R7RA 4N41A 1YJUA 2C2MB 3AY0A 5GAEU 2W01A 2XI2A 3KLFA 3PIPQ 2FYXA 2X3GA 3M6VA 4KRWA 3DU6A 1HBOA 5GVQA 4X4QA 2OELA 5CYQA 3QAUA 2NXJA 3Q8QB 2W9AA 4ZP7A 3DLJA 3CULA 3QGHA 3GSDA 2QE5A 1VQYA 2Y1JA 1U4BA 4RBTA 4C8ZA 1EIYB 3LP1B 3R1LA 2WSCC 1WC1A 5KFNA 2MY8A 5KT3A 4ZP8A 3CJ2A 2ASLA 2SXLA 2ZH3A 3WIVA 4ZIWA 3S1TA 2R8KA 2B6AB 5D4LA 2F4VF 2DO4A 3ENQA 5ADZA 5DDQC 4USJC 4GKJF 4WFAQ 4URGA 5IT9U 2CVIA 3BGUA 2OEKA 2RHSB 2KXFA 3DDNA 2WVFA 3QZ8A 2D74B 1TL1A 3AFGA 2V2VA 4DV0F 1KSPA 1WF2A 4XTTA 3TOQA 1IWAA 4X84A 4LMZA 2Z8QA 2W8LA 3IBWA 2ASYA 2XLJA 1WEYA 4G3IA 4CLFA 4EI2A 4DSKA 2LEPA 2EG1A 4QIVA 1W26A 1RT1B 3TZWA 3KLEB 3TUZC 3G8TA 4QWAA 3Q2SC 1K8AT 3NBPA 5KFFA 5GAGI 3BB5A 1H73A 1S1VB 2GHPA 1Y7PA 1B0PA 5CCLA 2RIJA 4ZJOA 4QU7A 3A3PB 1VC0A 4DSEA 3HJVA 4USMA 3VWSA 3UFCX 1O8BA 1UA1A 5A6PA 4YP3A 1X60A 1BE4A 1V3RA 1BXNA 3OTCA 1MN9A 1P6TA 5D77A 1S1XB 4MIWA 4NMXA 1YQHA 3LGNA 5KOXA 3M4XA 4EK2A 3KMSA 1D8YA 1LWFB 4Q5VA 3HO1A 2EWHA 1UVIA 1ZH5A 4WIQA 1S1TB 3MURP 4B9SA 4DR6F 2XMJA 1N56A 4DLGA 2HWHA 2PMWA 4QR1A 3DOLA 2VICA 1HNXF 1HNIA 4DR5J 1RT3B 5L46A 4ZVFA 3BYPA 2KYXA 1KOHA 3DRRA 3TA0A 2LXFA 1PYTA 5HANA 3ISND 1K0TA 2KZMA 3RTVA 2OTJS 3Q24A 2BJDA 3A8EA 4JBCA 4CTAA 4V19J 2GW8A 3H98A 2WVEA 3KLHB 1I94F 3F41A 3GP9A 1I1GA 3PFOA 3LW5C 4EBEA 2M4MA 3NMRA 1SJ3P 3FDSA 2UUAF 2I0XA 1HNVA 1U6FA 2ERRA 4GKJJ 1U0HB 2V8GA 5I42B 3HSZA 4NLGA 2RKIA 1LXJA 2VKZG 4M5JA 3EE3A 2XYPB 3LGMA 3KLIB 2B4VA 4G65A 1S59A 4DV0J 2R8GA 4W4MA 1IKYA 2I38A 3VGTA 3KG1A 5K5MA 3DRSB 2HZCA 2R7QA 3EVMA 4K4SA 1TL7B 5DDOC 5B0DA 3TA2A 1N8RT 2QYCA 4A4JA 2V8HA 3K89A 3GZ7A 2RRAA 4WE1A 2Y0SD 1VQPS 3IWLA 1YG0A 1XN9A 3AQOA 2DY9A 2F8EX 2WZ1A 2HFNA 4IG0B 2A6OA 4IQXA 1QTNB 1JLBB 5JMNA 1RI7A 3GILA 4ZVPB 3VR1A 1CJVA 1I51B 2JEJA 1A9NB 2RE1A 2DNZA 2CG4A 2OFHX 1T8EA 1NB7A 2J7UA 1DJ0A 4UOCA 1AUSL 3CCSS 4R8UA 3CCWA 3J7YU 1Q1KA 2OD6A 3JSMA 5K8PA 1LFWA 4MK8A 2KG1A 1T9VA 4DUTA 1T05B 1OY9A 1J5OA 2DO0A 2HFZA 3MOJB 2AJFE 4NCBA 3I5BA 3I87A 4KH1B 4B9VA 2OPSA 2C2EA 2IVFB 2ZBPA 1QLNA 4C98A 4GC7A 3C6UB 4LF6F 2ADCA 1S57A 4DR6J 4Y2CA 5HLFA 2DYAA 3AD7C 1L3VA 3MMAA 1SB6A 5IZHA 1RQ0A 5JJBA 4RNFA 4RW4B 1XNQF 3W9IA 1WSVA 5IWAJ 2QLWA 3MHYA 2CUYA 1AROP 2K7KA 5RUBA 5KAKA 3CCQS 3Q8UA
chains in the Genus database with same CATH topology
4DMZA 3PDNA 1KD1T 4WJBA 3LP2A 4FNHA 2DGSA 2HQ3A 3BDPA 2F7VA 1FNMA 2LLZA 1C0TA 2RQKA 3O6QA 3HVRA 2E7XA 3IWNC 1YRTA 2IYIA 1JLGB 4CO2A 3KK2A 4DF8A 4K4XA 2J9EA 1H6KX 4RW8A 3BSCA 4TNOA 1KLMB 4HTIA 2DNGA 2EFOA 5J1EB 3FMBA 4JI5F 1VIXA 4Q7AA 3DLKB 1MROA 3BSAA 3SDEB 1QUVA 4F3QA 1S6QA 2OIHA 4F2RA 1XMQF 2RJZA 2V0NA 2H5EA 4XIUA 2X1GA 3DM2A 1G6BA 2HHPA 4A8SA 3CEDA 1SH0A 3OFEA 3CJ3A 4ICLA 5KG2A 4OI4A 4Q2MA 2AX1A 4H4MA 4O3RA 1HQUA 3T1YF 1XR6A 2UVVA 4AQYF 1RK8A 1DLOB 3DOKB 3CTRA 2E44A 3OR1A 2UVUA 4B3OB 2BJEA 4PWDB 1T03B 2I1RA 4E98A 4ZPTR 1S97A 1VS3A 1RTDA 2ZZNA 2N3OA 5KFUA 4NXNF 2OPPB 1DQAA 4LF5F 1Q78A 4F26A 4OHYA 4A46A 1FXDA 4LSLA 2OFGX 3MMJA 4I6WA 2HHSA 1SI9A 1KQFB 2J7WA 2JVOA 3HXMA 2VBZA 5KT4A 3LAKA 1EP4B 3P96A 2CPEA 2DHSA 4U67Q 3KJVA 1H2VZ 3AB4B 1S0OA 1N32F 4C3LA 3MECA 3FEZA 4YY3F 3OL7A 1K1SA 1TK8A 1JNRB 1QY7A 2YY3A 3U7JA 1FT8A 1RT4B 2XZWA 4RUAA 3T5HA 1LW2A 4K5RA 4QJVA 4WIIA 3MM8B 4EZ9A 1I6JA 3GYNA 5E3PA 1U47A 4FF3A 1WTBA 2YKOA 1FNXH 3DYAA 5IT4A 2OPRA 1FKAF 1DARA 2BM1A 1N5SA 4A8MP 2RU3A 4GO5X 2MYFA 3HHLB 2F8HA 2MQLA 2HHHF 3T19A 3DLBA 1N36F 2HW3A 5EHHA 4NA3A 2RVJA 1U45A 3MPYA 3KLGB 1YI2S 1HWIA 2KU7A 4DR5F 1NKCA 4FXDA 2HWTA 4JI8F 1SH3A 3MXHP 4Y6IA 2HS4A 4UY85 4WKRA 2VBYA 4O3OA 1RYRA 2Y1IA 1X5TA 1K0VA 4BCAA 3DMJB 2WSEC 2YNGA 3K0JA 2N4DA 4IYQA 3LF0A 2P6SA 2UZAA 2XLKA 1D3WA 3KLFB 2DCLA 2CKWA 3V5RA 2CJ9A 2VG7A 1FXRA 1H7XA 3SFUA 4YDDB 2BUNA 3CD7A 4MYUA 2V5HG 2RSQA 4CO5A 3KK3B 1IKVA 3F73A 2RDJA 2FJXA 2E9RX 3Q23A 4YB6A 2GMLA 4X4VA 2XNQA 2A2CA 2CZVC 2VL1A 1GX6A 2XNRA 1VQ4S 2VZ9A 3RRGA 2BOPA 2JDJA 3ISNC 4FPRA 4RNOA 4NLWA 2R7XA 5KFXA 2IM2A 3RB4A 1NH7A 1FTCA 2WHOA 3BGLA 4X62F 4CH0S 4MIBA 1D9DA 4KO0A 2JZ5A 2ZHBA 2LEBA 5EWFA 3M9OB 3EGWB 1DTQB 3LP1A 1H3DA 4K4YA 4YDXA 1A7GE 3ZZOA 5DDRC 3CCVS 3EXYA 4KHPF 3IR6B 1S10A 3C46A 3H5UA 4L6V3 4F25A 2W8KA 1U1QA 2NPFA 3I0RB 3DLGB 1JMTA 4IDKA 3V2UC 3GB0A 2VQFF 3S6EA 4DPOA 5KT7A 3M9MB 2J5AA 2JRSA 3W2WA 2VPYB 2W4PA 2WB1D 4QIEA 2ZC3A 2E9TA 4QPTA 2EW9A 3ONQA 3HHLC 4ECVA 2OPQA 3UDCA 4FBTA 3DFEA 1N6QB 2V4JB 3M2UB 1Q4RA 4AL5A 4IH6A 1VFJA 4EYIB 1HHSA 2IJFA 2AJ0A 3UWTA 4ECRA 5EWGA 2D1CA 4A8YA 1LK5A 2C3YA 2GMHA 3Q8PB 3GIIA 4OI3A 2ZOGA 1UVLA 5KFHA 2VPWB 3VCDA 2RD5C 2HNZB 3Q8SB 1UWBA 3DC2A 3DLEB 2J76E 3PO4A 3DXBA 4AL7A 2KRBA 2E5IA 2GFFA 3K2YA 5E7OB 1HA1A 3BSOA 4F8RA 2CPXA 2ASJA 1KHVA 5LL6d 3T9ZA 1JJHA 2VKRA 2HNYB 1RT2B 3B78A 1O51A 2HQIA 3KHLA 4M95A 2J9DA 5T7LB 3VZIA 4IH5A 1QAYA 3I32A 4ZCIA 3IN5A 2MKKA 2W9BA 4IO1A 4EBDA 4Y00A 5B7WA 2EBEA 1VQ8S 3G96A 1U1MA 2YQ3A 3IR7B 2R8JA 3OR2B 3T6JA 1KS2A 3ITHB 3IWXA 1Q16B 4J9OA 2BRLA 2AP6A 2GIQA 5D4PA 2CJQA 2ZE2A 4KKOB 1KVJA 4EEYA 5F3ZA 1WWHA 5C42B 1TP7A 4MKBA 4IRDA 4KSEB 3VQTA 2CQDA 4YR3A 5F0UA 3CGIA 2YTCA 2ZM6F 5E3CA 1G7CB 2IAJB 2FJEB 3HDSA 4PXEA 2WBRA 5E41A 3QWPA 3HF5A 1Q8LA 1XMBA 1SKWA 5KG1A 3HK2A 4IUFA 4QU6A 1BLUA 4TQSA 4RKUC 1YHQS 1VQNS 2BE2A 4E8UA 5BR8F 3GE9A 1TV6B 5IM0A 3RB3A 1HI8A 4DL0C 2I5JB 1X4HA 1RT1A 2JJ4D 3X3UA 3H40A 2FDNA 2MHNA 2P9EA 2AYGA 4JYAF 4MH8A 3FMWA 3M2VA 3GG0A 4NCGA 1FE4A 3WBZA 4TY8A 1U48A 2IBOA 4WYLA 2VFSA 3MD3A 4CH7A 3BQ2A 4KTQA 2E1AA 2W4CA 2FJWA 4F3OA 4PG7A 2VG6A 2DH9A 4LSNA 3G8SA 1M5PC 1TK5A 2EKYA 3CMAS 3CDAA 1S1VA 2J6UA 2HHVA 3FGVA 4EZ6A 4JI6F 4RNMA 2EPIA 1U1LA 2UXDF 4C9DA 1R31A 1N4LA 2ZHAA 1RJJA 3PJWA 1NK4A 4IRKA 4AL6A 3V4IB 5KG5A 4X4NA 3KK1B 1F5BA 1JLFA 3QIPB 4TU7A 4ALZA 5KFDA 2WSFC 2XY5A 4ED0A 4K4VA 3ZZRA 2B3TB 2FVRA 1WI6A 2FJAB 2HGNA 3IAS9 3HKZD 2HMIA 1FEEA 4OLPA 3RW7A 2Q1LA 4GC6A 5J2QB 4I7FB 2MQNA 2IC3A 4ZPCA 2H9ZA 5FDLA 4ZCLA 6FD1A 2WONB 3TQ1A 3PO5A 1F2GA 4DV6F 4PXBA 3LP0A 3TUJC 3RRHA 4DL4A 2FVQA 1WNEA 2JEFA 1JXLA 2FHOB 2PMHA 1LW0A 2FPHX 3MDFA 4FS1A 4FF1A 1XK8A 1N52B 4AXIA 5MAOA 3FFIB 4WXOA 5D4OA 1S4FA 5KT6A 4WZQA 4H4KA 1X4CA 1TR0A 2ROGA 4YR2A 4DS4A 2BQRA 4XAKA 2BR0A 1H2TZ 3BGRA 1S1XA 2HHWA 5KFQA 4B02A 4QW8A 3CCLS 4XPCA 5FJ4A 2ADBA 3M6WA 1YVFA 2CQ2A 2A2DA 1FNOA 3M1VB 3VAFA 4G1QB 4KR0B 3PIOQ 3VAIA 3N4WA 1NO8A 1NAQA 1UKUA 3J80Y 1NJZA 1HQEA 3CD6S 3EGNA 3CT9A 2B4OA 1LWFA 1CLFA 2AYBA 2Q6BA 3OSNA 1QSSA 1B0VA 1IKXB 1DBDA 4TLRA 2K7JA 4YHHF 3SCKE 5H9EJ 3IRWP 5IQ6A 3CDWA 1YWXA 4RZRA 5LXRA 4R0EA 3UD4P 1WHWA 2MY7A 2VC0A 1S6UA 4LF7F 5E0OA 4N5SA 1KEKA 2XLIA 2ZZMA 3JB9k 4C3MA 1NK7A 1HBNA 2DNLA 4P7TA 5A2QY 1EETA 1SXLA 4Y2MA 3K5MA 4R5PA 5A0YA 1J5EF 3HVWA 4Q43A 1LWEB 1O0PA 2RRNA 3MMCB 3OQ2A 3BN7A 3LH2S 3PACA 4UW2A 1YRUA 1D9AA 3CD0A 1QSLA 3RB0A 3G71S 3U1NA 5AXMA 2LQBA 5IWAF 1U1KA 2PE8A 4UQGA 3BREA 4ECUA 4PG5A 4DSLA 2XGQA 4USIA 2ZVSA 2BQUA 3EGZA 3HLUA 3O2IA 1HARA 5KTQA 5A8KB 4O4GA 2AV5A 2D3UA 3MR2A 3MR6A 1VQMS 4KE5A 5IQQA 3TANA 3MOZA 4ZHRB 5J2PA 3DOLB 4KHRA 1HNIB 3H20A 4PUOA 4CT9A 1JJ2R 5CYMB 1RDRA 1MWZA 1P27B 2LEAA 2HS3A 1JLCB 3KG4A 2GO8A 3UDLA 2YX7A 2BVZA 4KAIA 4A8XA 1SV5B 1QVGR 4B3MF 4LT6A 3DDKA 2FLLA 3D0GE 3QO9B 3KLHA 5KFMA 2MGZB 1KN6A 1S1UB 3HHKA 1X5SA 1JLQA 2R7SA 1MU2B 3PVXA 2MMYA 1UL3A 2VG5A 4NLXA 4O44A 4ZLPA 4DQIA 1YSJA 2OJ3A 2K1RA 1VRUA 1T95A 1NK6A 2IA6A 4I67A 1K73T 4IFVA 1R7IA 2V2KA 3JSYA 3I55S 2E1RA 4HL9A 3NGDA 3GFZA 3RAXA 2GO9A 1XR7A 2HVHA 1M5VC 4Y34A 4WF9Q 3BJYA 1FVSA 2B9XA 2L08A 2LU2A 5G4DA 4CTAB 3MD1A 2R7OA 3PHEA 4QR0A 1FRHA 2PSZA 5E2QA 3PM9A 4NYZA 5A8RB 5JXSA 5HQ8A 4OQJA 1L3SA 4I64A 2MJUA 5LSOA 2A3JA 1XWLA 1R0AA 4QYZJ 2FLOA 5HROB 1TQLA 3B8HA 4NZ6A 3N5BA 2XG8A 5LJ3Y 3FEYB 3HHEA 5KG4A 5DGBA 2MKSA 1X4FA 1VRTB 5LXYA 2BDPA 1VC6A 1TKXA 2PDAA 5I42A 2Q3PA 5DQIA 2KB2A 1IKWB 3AJ1A 4RW6B 1KVIA 1NKBA 1BGXT 1VMBA 2JEIA 1GTHA 3LOUA 3OL6A 2NXUA 4DFJA 1HNVB 2O5DA 4Y2IA 3I4HX 1QSYA 2OO4A 4M94A 5LJ5Y 3TVZA 1FF2A 3M8SA 3R27A 2DNYA 2FGOA 2ZUGA 2E5JA 1U2FA 4JI0F 4ETZA 1Y0HA 1G1XA 1BD6A 3S7RA 3KLIA 3DGPA 4DUZF 3GIJA 3OTBA 4NLPA 4OJ1A 3PX4A 2DPJA 2R7VA 2IJNA 2XY6A 3MWBA 4MFBB 4TLQA 2ZHOA 5JVHQ 4NRUA 3OVSA 1URNA 3SZ2A 1KFSA 5A8WB 2VBXA 1ZZFA 2GV1A 3DI6A 1OSCA 5C24A 3DRSA 4KV8A 2XS2A 5KFIA 4OZ0A 2VOOA 1KQSR 5GADI 3QJLA 1X5PA 4DG1A 1K9MT 3FRYA 5HMZA 2B5JB 2QO3A 2KDOA 1WHYA 2MZJA 2DB1A 3JSBA 2EI5A 3X1LB 3N6NA 1VQ7S 5KFYA 2UXCF 1HR0F 2GJIA 3E01B 3EXCX 1U1PA 3M8QB 2PD1A 3M05A 3OFHA 2GC8A 4B3RF 3CCJS 2N82B 2RF2A 1F5CA 3HM9A 1CQNA 5J2NA 4NYPA 3T5KA 1Q7YT 2W7PA 4KGMA 5C25B 1QJHA 4C8KA 1VK8A 3H5YA 3MEDB 5JVGQ 5LMUF 4I6YA 4X4SA 2C2RA 3MGJA 5DLGA 2CQPA 3G6YA 3TI0A 3LPYA 5HMWA 3CDBA 2VPXB 1ZZNA 3HI9A 3C3LA 2DRBA 3EZUA 3HVTB 3MR3A 4YEAA 4FVMA 4C2MA 4DR2F 1RISA 2HFOA 1UEVA 4IG0A 4FXWA 3CCUS 4I1TA 2XC9A 2ROEA 4DF4A 3NP5A 2A1BA 3I96A 1VLYA 2CPYA 3VZHA 3W2VA 5U47A 3IFEA 3ZC4A 4ELUA 4NMLA 1UW4A 1MMLA 1TL4A 3V6HA 4F2SA 4N8NA 1E6VA 2ROPA 4Q0BB 3OV7A 4N76A 2XGPA 4IOAQ 3BDEA 3NCRA 1IJFB 3N9UC 4ID5A 2OMOA 3BM7A 4WU2A 5GAHU 5F9NA 3FZBA 2R7UA 4IOBA 4LVOP 3MEEA 1RP5A 1GTEA 4LFAF 3UD3P 2DNMA 4Y0FA 2RQMA 4OFZA 2AX0A 5KFZA 5B0CA 1VJWA 3MM9B 2IYGA 4L72B 1RTIA 4NLOA 1FDAA 5J2MB 4ED5A 4CH1A 4R0JA 2POKA 3K8VA 4OV1A 1FDBA 6FDRA 2R2RA 2YNIB 3ISZA 2YKMB 2GX8A 4O3NA 4CO0A 2BACA 3UW1A 2CQCA 1C2PA 2JSXA 2F9DA 1QAJA 2NPIA 3SV4A 1OSDA 1IUJA 4FZVA 2RS2A 3TAMB 2LKZA 3M6XA 3GWCA 5D4NA 3POTB 4R8UB 2MQQA 1IR0A 3BS9A 3IA0A 4DV2F 4UY8T 1N5YB 3OFGA 1ZPVA 3MPWA 4OMFG 3VF0B 3MUMP 2ZDPA 3RRKA 1C1BB 2GCFA 3I56S 2FHMA 2LXIA 5AE3A 3EPIA 4QOTA 1X4BA 5AXKA 2X1FA 4JV0A 1U09A 1WTFA 5HO4A 4TU9A 5DLFA 2LU1A 5AE1A 3DCAA 4DV5F 2Q79A 2RT3A 1BC6A 4C7QA 3MM7B 1UMJA 3BQ1A 1D9FA 1SIZA 3AA9A 4KQZA 3KKFA 4NLUA 2HNDB 3SSSA 2N7CA 3SEOA 3NNCA 1WG5A 1YRXA 2QA1A 2UUTA 4KBIA 2WOMB 1HYSB 4DBQA 1LWCA 4MMOA 4R25A 2AQ4A 1RA7A 1S9EB 2LA4A 2O01C 2J9DE 3PJXA 2B9WA 1YGYA 1Y5NB 1FERA 4H4OA 2VONA 1VBXA 2QSWA 4RW4A 1T7PA 2OPSB 3QIDA 4B9UA 4P6QA 2CPFA 3HHDA 4HHJA 3FSIA 2P6TA 4DFKA 4EFAC 4RU9A 5DG8A 2JWNA 4C11A 1JLAB 1Y5IB 1RT7B 4WFZA