4YDDB

Crystal structure of the perchlorate reductase pcrab from azospira suillum ps
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
329
structure length
329
Chain Sequence
b'MKAPRRQLTYVTDLNKCIGCQTCTVACKKLWTTGPGQDFMYWRNVETAPGLGYPRNWQTKGGGYKNGELQKGKIPPMIDYGIPFEFDYAGRLFEGKPGRVRPSPTPRSAPNWDEDQGAGEYPNNSFFYLPRMCNHCTKPACLEACPNEAIYKREQDGIVVIHQDKCKGAQACVQSCPYAKPYFNPLTNKANKCIGCFPRIEQGVAPACVAQCVGRAMHVGFVDDVNSSVYKLIKQYKVALPLHPEFGTEPNVFYVPPVLGPRIEMANGEPSTDPKIPLAQLEGLFGKQVRDVLAILQSEREKKMKGLASDLMDVLIGRRSTDMMISPLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DMSO reductase family type II enzyme, molybdopterin subunit
publication title Perchlorate Reductase Is Distinguished by Active Site Aromatic Gate Residues.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 85
structure length 329
sequence length 329
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2015-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13247 Fer4_11 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4yddB00
1C4CA 1Y5IB 6FD1A 1FTCA 2WSCC 2XSJB 1FRJA 2ZVSA 1FDBA 1FDDA 1Y5NB 2XSJA 1HFEL 1F5CA 1FXDA 1VJWA 5BYRA 2PDAA 2C3YA 1KQGB 3C8YA 2C3UA 1CLFA 4OMFG 1B0VA 1DFDA 2PA8D 1B0TA 5BYQA 2PMZD 5L8RC 3MMCB 2FJAB 1FRKA 2O01C 3MM6A 1R27B 1K0TA 1BD6A 3MMAB 3MMCA 4L6V3 2C3MA 1FRHA 4CI0B 3OR2A 1Q16B 1FRXA 3OR1B 1PC5A 3GYXB 1FERA 3MMAA 1ROFA 5FD1A 1AXQA 1JNRB 2WAQD 3OR1A 1F5BA 4AYBD 1C4AA 1G6BA 4ID8A 2VPXB 5CH7B 2VPZB 2Y0SD 1GAOA 2IVFB 4DHVA 3MM6B 1BC6A 1G3OA 3MM7B 1FXRA 2GMHA 1JNZB 4XDCA 3OR2B 4OV1A 3MM7A 4RKUC 4YDDB 3MM9B 2UZAA 4XDDA 5BYSA 1H7WA 3LW5C 3PNIA 2FJDB 2C42A 1KEKA 1SJ1A 1F2GA 2C3PA 2FD2A 3IR7B 3MM9A 1D3WA 1XERA 2V2KA 1Y5LB 4KT0C 1IR0A 2C3OA 1BWEA 4XK8C 1FEHA 1PC4A 4Y28C 3EXYA 1DAXA 2WSEC 1FDNA 1A6LA 2VPYB 2VKRA 3IR6B 3MM8B 1FF2A 2WSFC 3MMBB 1FRLA 1GT8A 2FJEB 1BLUA 1FRIA 1H7XA 3MM8A 1FD2A 3MMBA 1WTFA 2WB1D 1GTEA 3MM5B 1H0HB 2VPWB 1FDAA 2FJBB 1KQFB 1DURA 3EGWB 7FDRA 5E7OB 3HKZD 5CHCB 6FDRA 3EUNA 1JB0C 1GTHA 1SIZA 2GMJA 3MM5A 3IR5B 2V4JB 1FCAA 1B0PA 1IQZA 7FD1A 1H98A 1FRMA 2FDNA 2Z8QA 1RGVA 1Y4ZB 2V4JA 1BQXA 1SIWB 2FGOA
chains in the Genus database with same CATH superfamily
1HBNA 2B9EA 1HMVB 4G3IA 1N32F 2PD1A 3KK2B 4H4OA 4DPTA 1R0AA 4GKKJ 3IM9A 3EVOA 2MQMA 2XSJA 1VBKA 2ZM6F 1SI9A 2RRNA 4UY85 3MPVA 4X2BA 2BE7D 4CTAA 2A18A 2D9PA 4JYAF 4WF9Q 1U1LA 5KFKA 1SPBP 4ZPAA 4PG4A 3DRSA 3ZO7A 2R7XA 1ZAVA 1FFSB 1VQ4S 3MD3A 1S1TB 3J7Z5 4USWA 1ACMB 3H2VE 1MNEA 4FYVB 1RT6A 2FGCA 4DX7A 2LQ9A 2HS3A 3CIZA 2BJ3A 2WVEA 4ZPVR 1E6YB 3AXMA 1KOHA 2E44A 4ZCLA 4HH1A 2GVDB 2Z2MA 3RAMA 4QWEA 3SDEA 1HBOA 4JV1A 1HNWJ 3ZNJ1 4NASA 3NGUA 7FDRA 5LSLA 4PWDA 3PFOA 1VQ9S 4OYAA 1SIWB 2DNHA 1NKEA 4LF5J 1Y11A 4USJC 3JB9k 4DSIA 4M5GA 4OX9F 3J7YI 2F63A 2IBOA 1ZAWA 1UPPA 3QGIA 2W2OP 2LEAA 5L1KA 3DKDA 5KG0A 3RB6A 2W2MP 1ZPVA 2BUNA 3MEGA 2RQCA 4QIGA 2NQPA 3FRZA 4MK8A 4J7CA 2GIFA 5FLXU 2VC1A 4B02A 4KE5A 1KLNA 1VHIA 3MMJA 1XJWB 2YPZA 4DR7F 3CVKA 3QSYB 1IKWA 5KTQA 3VTIA 3ZTQA 4LF6F 5M2RA 1RT5A 2QTWA 3IMQJ 4N56A 1RK8A 3UDLA 1RWUA 4U67Q 1S9EA 3L95X 1X9WA 1G4CA 1VBYA 5HP1A 1SQFA 4IOAQ 2E29A 1OSDA 1VLOA 1RACB 3H8YA 5KFJA 2W01A 1B0PA 4EEYA 3Q8QB 1W26A 5IC4B 2HBQB 3G6YA 2NZCA 1BQXA 2HWTA 1YG0A 1RZMA 3OUYA 2RKIB 4G6VB 2E1AA 1X5SA 4OX6A 3IBWA 3BKTA 3ZC4A 3M9OB 4JV5F 1S6UA 4LQ3A 1VK8A 2B9WA 3L3CA 4CO0A 3JYTB 4W90B 3KHRA 4DCPB 5A2QU 2DCUB 4K4YA 3PW0A 2V8VA 3FJ2A 1KP6A 1TFYA 2KU7A 1T7PA 2VA2A 1H2TZ 2EVZA 2ZHBA 3TUZC 4FF2A 5T14A 2WB4A 1EP4A 3VAJA 1MSWD 1RAIB 3NCRA 4Y65A 2ALYB 1SC6A 3G8QA 3M8QB 1BUXA 4CLTA 3UD4P 3QT7A 4LMZA 1I5OB 2W24A 1IBKF 5DS7A 1CBKA 3HZEA 1RCOB 3J7YU 4X62J 5D0EA 1RI7A 2F7VA 5E3QA 3V4IA 2W1BA 3KUEA 2VG7A 3T1AA 3GYGA 2OD4A 2ZC4A 4J90A 3TJ8A 1S72S 1RTIB 4NLXA 1DTQB 1RU1A 3BKUA 1S1XA 1HPZB 1FJCA 2BYCA 4OZ5A 3LALA 2YWHA 1U8WA 2UV8G 3BB5A 4NLDA 4R8UA 4C8LA 4F2RA 1REVB 2DO4A 1Q8IA 1PC4A 3IP0A 2CQ0A 5F8NA 4ZIVA 2OSQA 4BHQA 3EPGA 1REGX 1RTJB 2VJVA 5HROB 3LQVA 1TL3A 4Q44A 3EWGA 2G13A 4I6AA 1ZA1B 3I9ZA 4ZKAA 2EFVA 4CYUB 4OI2A 4F0MA 2Y1JA 2QX0A 4PG7A 4ZPWR 4MK7A 4JI7F 1KVJA 3HF5A 4QW9A 3X3UA 1HA1A 2AWZA 4OJGA 5HBMA 5LL6d 5IT9Y 4Q7AA 3H25A 4MIAA 2XMJA 2QFIA 1CG2A 4URGA 2WHOA 3Q86A 2XNRA 4OI0A 3ZTOA 5B0AA 3SCKE 1KC8T 3LGHA 1N36F 1U6FA 4UY8T 3IFEA 4MJKA 4DL0C 3I5BA 1NPPA 3MI7X 3BREA 1FJEB 2C42A 1SJ1A 2V2KA 3DI6A 3DLJA 1VC0A 1HLWA 1N5YB 3MEDB 2QT7A 4PXDA 1IWGA 2KN4A 4ZCIA 3CJSA 1S9GA 3D6MB 1SJ4P 1TL5A 3J7ZT 2RUGA 1G2EA 1V5VA 1VI7A 3CD6S 4K0KJ 5EUHA 4OYIA 4PPZA 4FXDA 3MR3A 4PQUA 3FRYA 3M30B 1KLMA 3D0IE 2YNHA 3FVYA 1VGYA 6FD1A 3IWXA 2XTJP 4JOUA 4P52A 5KFAA 2PE8A 4IG0A 1VRQC 2KG1A 3I9V9 1YBUA 2C3YA 2LXIA 3RUBL 3CJKB 3FQKA 1BWVA 2PMHA 5L8RC 1RWMB 2FPHX 1RYSA 1U0SA 3F41A 1DHMA 1TKZB 1SC3B 5KFOA 3DMJA 4ECVA 2X51A 2IYGA 1EQ0A 5EX0A 2DHSA 4FYXB 3UWTA 2F5GA 2VPZB 2HBYB 1N5QA 2ZOFA 2ZUGA 2EC0A 3DLBA 1WUUA 1NHKL 3ENQA 2AQ4A 1FTRA 1Y3JA 2KRRA 1CJKA 1C1BB 3W66A 5LMUF 4D3GA 4NZ7A 1GXLA 1QTMA 1C1CA 4E0DA 1X60A 3RBDA 2B6AA 2XLKA 4I69A 2HVIA 1NCLA 2V4JB 4B3RJ 2NUHA 4P71A 2P6SA 4X4OA 4ZHRB 1NMEB 1NJIT 2UXBF 2XCPA 1RAJA 2RUSA 4F4KA 3R6GB 3CC4S 1D9DA 3Q2SC 1M5OC 1VQ5S 2KHCA 3JQKA 2DNRA 3ITHB 3OL8A 1YZ6A 4WWSA 4P2XA 4PWUA 2IC3A 3HHNB 5J1NA 4CI0B 2QJ3A 3G6VA 5KFRA 3R5BA 1FKPA 2AIRB 2XY5A 1G6BA 2H4WB 3NOCA 2DR6A 3I0SB 4ZCKA 2YWFA 3JAMY 2GW8A 1X4AA 4HH0A 2G0IA 1X4CA 2RQKA 2AGOA 4KT0C 2F4VJ 2AKWB 4ZVUB 3N79A 3MAAB 1UEUA 3WX8A 3UN3A 3GJSB 4FXWA 4MK9A 2GC8A 3V6DB 1U0HA 3OTOF 2YNIA 5DM6Q 2H51B 3GMGA 1HQ2A 2N4DA 2ZZNA 3RB4A 5GADI 1R8AA 2W9CA 4J9MA 3DDNA 1VQPS 2RS2A 2J7KA 4DV0F 3DGVA 4G1QB 2FY8A 4JI2F 3PRVA 2PI5A 5D78A 4H4MA 4NXMF 4F0HA 1X5PA 4IFVA 1LWEB 3FK4A 2K8GA 1Q4RA 3H2LA 3C46A 4J9NA 2NXJA 2VIHA 2O3DA 3HDSA 4K8RA 2WOMB 1CJTA 2XHWA 1I94F 3KLHA 1D1UA 5AJ3F 2VFRA 3QLHA 1UPMB 5IM0B 1R43A 4ATNA 2OPSA 3RJMB 3TAMB 2JC1A 2CQBA 3ZZUA 4C4WA 4DFKA 4NXNJ 4F2SA 2XSFA 3MTKA 4U8VA 2W7PA 2GO8A 2C22A 3ETOA 1BQNA 1IQZA 4X4VA 3HK2A 3I6PA 5KFBA 2DNLA 1QUPA 2M52A 4O3PA 1OY9A 1HMVA 2C2MB 5IOLA 4XO0A 3KK2A 5CYJA 3UN5A 5BR8F 4DX8H 1JXEA 5FIIA 2VOPA 4DV3J 4HTJA 2QMXA 3A3NB 4KHMA 3L09A 1EETB 6AT1B 3FFIB 4RX6A 1QSYA 5DO2A 5HK4A 1NDCA 3BH6B 2VICA 2KJWA 4PRFA 3MM6B 2R7UA 5D15A 3MM7B 3GB0A 4PQAA 4RNFA 1U1RA 1YJNS 3KYLA 1E6YA 5GADU 3CDUA 1I6JA 3KKFA 1HIYA 4FVCA 2CXEA 2IYIA 2VJUA 2EKNA 2GVDA 3HZGA 3H5UA 3MCNA 5C2GA 2P9EA 1ZZNA 3CMES 1X4FA 3TZXA 5D6GA 2RHSB 3MR6A 4ID5B 3GWCA 2VG6B 3PW4A 2KM8C 4F02A 2O67A 3OTBA 1OWXA 2HHHJ 1EQMA 2ZH2A 1R0BG 4I7FB 4V1Ak 1DQAA 4QIVA 3A8JA 2O1PA 1DFDA 2IM3A 2PMZD 4OLPA 2VKZG 3GG1A 2HS0A 1R27B 4CZCA 1YJ7A 4Y0FA 1NPKA 3H90A 5J2NB 3OV7A 4M5DB 4DF8A 2LQBA 2QA2A 2AP6A 1LK5A 4D3HA 2ZH4A 3T5JA 2YPYA 5D4PA 2XMVA 2R8KA 1JLGB 2G1HA 5E3RA 1CQNA 2J7WA 3AHPA 1D9FA 3TVZA 3J80U 1BLUA 2D74B 3LP2B 4A8SA 2E1CA 3KJVA 1XWLA 4DCOB 3T1HJ 1YJUA 2QGFB 2MQNA 3G87A 2N3OA 2XYGB 1S6PB 1RAGB 2WW4A 3CC2S 1C0UB 3V81B 1QAXA 2HHUA 3ZZZA 2M3DA 1C4CA 3MOJB 4H4KA 1SQGA 1FTCA 3DXSX 2F8HA 4QCLA 2YKPA 1FK9B 2RKIA 1JLFB 4F50A 5ETLA 2AYEA 3BN7A 2YWKA 1RT2B 1M1GA 1KQGB 2C2EA 1K0VA 3V6HA 2KT3A 4WZMA 1QUVA 4EMDA 3ZZOA 1HNZF 3JYTA 4OYZA 1SKRA 4J9SA 4YMEA 1R6YA 5F0WA 3KHHA 2B56A 4CIOA 1XEZA 2VQFJ 2G0CA 3J81Y 3W5ZA 3CJQA 1GX6A 2Y0SD 1AYEA 3W8PA 2ILYA 3G96A 3A8KA 2B7BB 1GMWA 1SV5B 2PFFB 1T9XA 4FS1A 1F6TA 4OIXA 4LBIA 2F4FA 1RU2A 1AW0A 4DR3F 3IBFB 3M8QA 2YXLA 2QN6B 3OTCA 4J9RA 4FPIA 2R2TA 2UU9F 5EHHA 4DR2F 1FWKA 1YJ9S 3DHXA 1RT1A 2HGNA 1XNRJ 2DRAA 2EFGA 4WFBQ 4DSJA 2IHR1 2M4MA 5J1EA 3B4MA 1DZ5A 2ZVIA 2AJ4A 4EBEA 2M5YA 4IOBA 2WSCC 3FSXA 4J9UE 3Q8PB 1VLYA 3V4MA 2JOQA 1HFEL 2QV6A 1S49A 3TNVA 2R8JA 1JLCB 1RTIA 3I5AA 2HHPA 1DTQA 2H65B 3UVJA 3TX8A 2AJQA 1HPZA 2E9ZA 4Y2MA 3SYZA 4FXVA 3SQOP 5D0RA 3IC1A 1XIQA 3P5TL 2HGLA 3K5LA 1FXRA 4HR2A 4LBHA 1HYSB 3LUYA 1TK8A 3CJ2A 3C6TB 3VGTA 4EYIB 2MKJA 4WFZA 1FFGB 2B43A 2XYPB 1REVA 1VBZA 2W4DA 2HVHA 5HANA 2QA4S 1FEEA 2OPQA 4C0HA 2CPZA 2P8IA 4KSEB 1MMNA 2HVDA 1RTJA 5HROA 1GXTA 3FMWA 3U1NA 2MJNA 2VPWB 1VCTA 3WZ0A 4Q8EA 2CA9A 3CCSS 3ENAA 5ETRA 2DNOA 4K4XA 4CYUA 2NXEA 3A8IA 2EKYA 1RTDB 1AZSB 3AXKA 5KFMA 3CJ4A 2LYVA 3ZTRA 2DITA 2CVEA 5K8PA 4QYRA 3CXCR 3EZ5A 3UE2A 3HVRA 2M8HA 1RWOB 4DV2J 3NRBA 3KJQB 1WC3A 5KFTA 1XNQJ 1IBLJ 5A0YA 2FZCB 2GV1A 2MY7A 4ZP7A 3FEXB 2J6TA 4GVBB 5H1SV 4B3TJ 3KJNB 4QJVA 2HHVA 4M94A 2IA0A 4ZCMA 3TP2A 1EX8A 3B82A 4YQWA 5LSOA 3ISNC 2G0JA 3N5BA 2NPIA 1N5YA 4LF7J 3MEDA 1YKWA 1JJ4A 2UVRA 3GP9A 1B4SA 2RS8A 2EFNA 4ZVTB 2ZDPA 1H0HB 4EBCA 1IM4A 5KFWA 1TKTB 2B4OA 5C2CA 1FJGF 1T0TV 4RW4B 1N32J 4F4YA 2UUTA 4CO3A 4A8MP 3M30A 5B08A 3BKFA 3OTEA 3Q23A 2ZH6A 4X4TA 1ZOTA 4A48A 3N6LA 4NX9A 2ZM6J 4OX8A 1K1QA 1B0TA 4LIRA 2F3JA 3K59A 2I1RA 1OY6A 4JYAJ 1YBAA 2Y8WA 4OQJA 3CJKA 3KK3B 1VQLS 4HACB 1A7GE 3M7VA 3D4JA 1HI8A 1RT7B 3BBBA 2ZOMA 1TKZA 4DZDA 2ZUAA 1RWXB 2ADCA 5B0GA 2RDDA 3M1VB 3PG9A 1WNEA 1Y5LB 3E01B 2MPUA 5DRKA 4G1PA 3C3LA 4O0NA 3PHEA 4CLZA 1C1BA 3LANA 3PKYA 2DD8S 4TY8B 1YLXA 3D6TB 1KRPA 3TI0A 1XMQF 3M4XA 2EG2A 2FDNA 3QAUA 1PJ5A 2V4JA 1VQMS 4OX9J 4LREA 1U26A 4ZHRA 1LFWA 4BWJA 1DARA 2RNEA 4ECXA 4DN9A 3F44A 2OPRB 3TJAA 1KNZA 4L72B 2KT2A 2XQCA 1ZM3A 3ITHA 1RDRA 3NG8A 3OR1B 3I96A 2FIUA 1KDNA 3OVBA 9RUBA 2DHXA 2M70A 3HD2A 3D6HB 4DR7J 2UVUA 3CB4A 4LF6J 5AE3A 1PAEX 3I0SA 3M2UB 2CZ9A 3HVTB 2AJFE 1EJ7L 1NKCA 1SH0A 3KJFB 4NLRA 4DV1F 3TQ1A 4QWCA 4F04B 4L75A 3MAAA 3TR5A 3POTA 3SSQA 1N4LA 2OFGX 2RAQA 1N5VA 2DNQA 3HSJA 2JDJA 4HHJA 1LQ9A 1K8AT 4ECQA 3CJ8A 3MD1A 1RYRA 2ACMA 3AA9A 1DRZA 2EFPA 2E5JA 4TU9A 2UXDF 2XWXA 2DGUA 2W2NP 4DR6F 1QD1A 1NO8A 4HHHA 4JV5J 4GO7X 3CT9A 4G1QA 2PDAA 2CYYA 4NWBA 2LCWA 3G86A 3NS6A 2HIQA 2JVOA 1LWEA 4DV5F 3S01A 4ANEA 1PIEA 2YBVA 3GIMA 2NUUG 3KDNA 5CH7B 1S97A 3HHLB 1YJRA 3L7PA 4IR1A 2WOMA 1T9WA 4K4VA 3PEJA 2J5AA 5JJBA 4C3KA 1QAIA 2GVZB 4USUA 2ZDOA 3H98A 3PEHA 2V2QA 3A3OB 4C8MA 5IM0A 1TMMA 1IBKJ 2RU9A 3DU5A 3TAMA 3KLEB 4TU7A 4QYZK 1P1LA 1XN9A 4DXLA 5FLXY 4DS4A 3PHTA 5K14B 3OFEA 2EFOA 3KFWX 2DR5A 2Z56B 3C15B 4OLOA 1NJZA 3NCQA 3D0HE 3PIPQ 2FJVA 2ERRA 3T5LA 3CO9A 3OLAA 3RRHA 4MIBA 4DL6A 2JZ5A 2J9CA 4ZVEA 1GK8A 5EX3A 4PYAA 3MPDA 4MKYA 3RB3A 1JQGA 2X1BA 1EETA 2RMLA 3FFIA 3T41A 2AX1A 3OXLA 4ANCA 5CZXA 5C7PA 3EPIA 3A8EA 4OYMA 3Q24A 5B0EA 2CJQA 3MM7A 1SVDA 2MSSA 3FCVA 2RDIA 3LP1B 4KAIA 2L9DA 3G71S 4ED1A 1U1NA 1VIXA 4XAKA 2ZE2B 2WW8A 4OI3A 5A2QY 4B9SA 1FVQA 3KXDA 3RR8A 3OXFA 1FWLA 3GQCA 5IS2A 1O8BA 4P10A 4ZJLA 2RT3A 1WG1A 2BJ8A 3UD3P 4YS2A 4JI7J 2YH0A 2DHGA 4ID5A 2AJ0A 2VG6A 1XC9A 3NAIA 4KH1B 3P49B 4F67A 5A8KB 3DNCA 5DG7A 3IS9B 2B9YA 4ES2A 1S0OA 1OYEA 4B3SF 4HVZA 4I7FA 3MFIA 4IFYB 2W2PP 4KQZA 1OIAA 2POKA 2L41A 1FFWB 2Y1LB 3QO9B 4USHA 2B4VA 3BH7B 2BKNA 2XY7A 4CNYA 3CTRA 2CJ9A 4C8NA 1N36J 4ES1A 4OYPA 3ZXWA 1UCNA 3MFHA 5J2NA 4M5DA 3JQMA 1U2RA 3W3SA 1YJWS 3C2PA 4CLFA 3DLEA 1N5SA 2CQ2A 3KUHA 3KK1B 2XB2D 2JLEA 2XMWA 2RF2B 2DHAA 3JQJA 3BQ2A 1JLGA 2EBGA 4WE1B 2HQGA 3O8WA 2IRYA 3CDEA 3NWRA 3G4SS 1YJTA 4R0JA 2E7VA 3W9JA 4WXWA 2CZVC 4C0OC 1NJYA 4O3QA 4AE5A 5F0UA 3CF5Q 2BBEA 4B9VA 2P6TA 2KFNA 1VMBA 4E2FB 1UWBB 1S6PA 2H5EA 3GCXP 4CLWA 3VAKA 2HRYA 4Q2LA 1C0UA 4J5OA 5U47A 4TU8A 2YY3A 1XQIA 1FK9A 1JLFA 1CLFA 1RT2A 3SCIE 2LFVA 1T11A 4Z7YA 4XIUA 3CMQA 3BZQA 3FUYA 5D0GA 4NL5A 5H9EK 1T9YA 5KG2A 5ADZA 4UF4A 5I3QA 4HL9A 2QSFA 3JXOA 1HHSA 4ECZA 1PILA 4CLKA 2MKYA 1BQMB 3NAHA 4WU3A 2HNDB 1SV5A 4AL6A 4JI1F 4DSEA 3KUGA 3CCRS 2ZBRA 4LR7A 2OAUA 4F26A 2QA4G 5LMUJ 4MYTA 1U02A 4BLGA 2KJVA 3R5DA 4ECWA 4LIWA 2J6UA 3QIPB 4KYZA 1GTHA 1SIZA 3GFZA 3CJTA 4ZDNA 1RADB 3CE8A 2DR9A 4RJVA 3MPUB 2Z8QA 2UXBJ 3JSBA 1UMJA 1RBOB 1SJFA 1QVFR 1S12A 1VQYA 2D3O1 3PJXA 2HFZA 2HFSA 4QWBA 5BYRA 2M8DB 1LEOA 4EGLA 1JLEA 2ZNZA 2KDOA 1NLKL 3NOGA 1YDLA 3JTPA 2VH7A 3IA0A 3F56A 4DFPA 4XPCA 4NZ0A 2GS8A 4ED7A 5CA5A 1Y0HA 3PKMA 1HYSA 3CCQS 1JLAB 2RRBA 2C3PA 3CPWR 3C6TA 1XERA 2YWGA 1Z1ZA 1K44A 5DLFA 1RJJA 4ZLLA 3P3DA 3PYEA 2XWYA 2WSFC 3OTOJ 3R2DJ 1SC1B 1FRIA 2PN6A 3D54A 2PA3A 4AUKA 4LVNP 1YX2A 2MQOA 1SH3A 2HHXA 2GJIA 3Q22A 7FD1A 4PWWA 4DV0J 4JI2J 2AEJA 5LM7E 1RTDA 1AZSA 4WIQA 4QYZJ 3FBFA 4NXMJ 2HGMA 3VQSA 1H3DA 3L7OA 4ZS6A 2BXJA 3E51A 3UPFA 1WG4A 1S59A 1WEXA 2X7IA 4IG3B 2ASJA 5KFEA 5M2UA 3VWSA 2WVBA 2DT9A 5KG4A 1R8PA 2PT0A 4IDKB 3QMQA 2E7XA 2Q6BA 5IV4A 1XR7A 1JMTA 4GVBA 4GC6A 4MMOA 1HD1A 3FMBA 1TL1B 4LRCA 2HLTA 3AQPA 1I94J 3SQGB 4NRTA 5AJ3J 3MUMP 3W63A 3X1LB 2DR7A 1N56A 1NZ8A 2XMMA 3HXMA 3W65A 4KRWA 4LRBA 2X1FA 3NNCA 1VHFA 3DRPB 2XS5A 3UQSA 5C5JA 4DJBA 2V34A 1QM9A 5GMEA 3R3TA 3EUNA 4M5KA 1WF2A 2VASA 3IN5A 2JEIA 2DEIA 3DXBA 4I4BA 2UXCF 2GGPB 2I5JB 4QPXA 3PO4A 2FHJD 5BR8J 4CLYA 3W8GA 3RB0A 2QRRA 1M0SA 1LWFB 1F9HA 1NJWA 5GAEI 4K4SA 4DSKA 4UUWA 5ETVA 2A6MA 2GAHC 1N6QB 2XO7A 1WI8A 3PJ9A 1KVIA 1ULRA 3KK3A 4DR4F 1H2VZ 2GAGC 4HACA 2DRDA 3HSDA 4F7VA 1NHVA 3NS7B 1G7CB 1RT7A 2F8EX 3AD9C 2RIJA 2AJ2A 2HAIA 4DWIA 3M1VA 1ZPWX 1WEZA 3S1TA 4F25A 1NK6A 1RBAA 3IXQA 2LLZA 4ICLB 3E01A 3M6UA 4ALZA 5IZHA 1TR0A 4KO0B 5KG6A 1YRTA 5DLGA 2CPDA 1OPIA 1T9VA 3JTOA 2WK4A 4P7TA 2HSEB 3D1HA 2LKZA 3UD5A 1FKAF 1S0VA 4P2FA 4TY8A 2RSQA 2CQHA 1VQ8S 4CWBA 5I3UB 2FGOA 1U4BA 1IXKA 2XI2A 1BHNA 4JV2A 4DLGA 3SBMA 3A1YG 5DDPC 2KH9A 2LEPA 4X4PA 2DGOA 2EFQA 2B5JB 2FZKB 3C19A 4IRDA 4M5LA 4P2MA 2K06A 1RAFB 3OR1A 4MH8A 2MZQA 3EVMA 2FJWA 2FHMA 3MCMA 2RQ4A 4IO9Q 1QDUB 4KGVB 1NSAA 5J2QB 1SXLA 1YWXA 1RXOB 4A47A 3OVAA 3HVTA 2BQ3A 1RKIA 4LSLA 4DCJB 4NI2A 2MLYA 1NSPA 4P75A 2VKRA 2JSXA 3M6WA 4DL5A 4MKBA 4O3NA 1DURA 1UEVA 3CJ5A 2MLXA 1V6HA 4NEZA 3NWGA 2Q3PA 3HHLD 1S0NA 5E3AA 1J27A 1X4DA 1WC6A 1Y5NB 5H9FK 1UW4A 4C7QA 1RB0A 2MDAA 1HNZJ 3HHKA 1EAYC 2HNZB 2Q43A 1ZYQA 3N5FA 4HLBA 3CUNA 3LO3A 5DGBA 5KOXA 4PKDB 3QYYA 4UQGA 2WAQD 3GJTB 4IOCQ 2GQQA 3DHWC 2BR0A 3V6KA 4K5RA 2YNFB 1CQMA 4A8KA 3G6ES 1P8GA 3BYPA 2IJRA 3GPAA 2XLIA 2UZAA 4N41A 4WPAA 4PXCA 2OEKA 3G8TA 5AT1B 2R7WA 3ZZYA 2ILZA 4DR3J 2N82B 2MQQA 3FEYB 3N4WA 1VYAA 5DZ7A 4EUVA 2LQ8A 1J2VA 2GVZA 2UU9J 1JXLA 4DR2J 1GT8A 3OFFA 3VR1A 2N4CA 3KLEA 2KYXA 4DG1B 2ROPA 5F3ZA 3IR5B 4RUHA 4A8WA 2HBRB 1HR0F 1GX5A 4RNMA 4FZVA 3ICLA 3BGFA 5K14A 2OTJS 1FDBA 1IQTA 4EK2A 4GMKA 3W7BA 3MEEB 2V9KA 2L9NA 5D4NA 1U25A 3IG1B 1MROB 3MAQA 3WDOA 1NM2A 2ZZMA 4R0EA 4DDFA 1ROFA 2OD6A 4TY9A 4I67A 4NPOA 2OTLS 2XZTB 5KFNA 3LAKA 1L3KA 1AFIA 5HMWA 3IRWP 3VAGA 5ITHA 4CRJA 3QIDA 2PI4A 3QT8A 4AQYF 1I3OB 3LP1A 3NBPB 4RW8B 1WDTA 4ELVA 4WJBA 2MQPA 2HLUA 5HLFB 2VQEF 4DL4A 2R8GA 3QT5A 3ZFVA 2ZE2A 3PX0A 3ISZA 2DR8A 4NLVA 3NXZA 1TAUA 2DXFA 1P6TA 4FDFA 1HWUA 2AX0A 1JJ2R 2U1AA 4J91A 5CD4H 1S77D 3I87A 2RQMA 4RUBA 2MXYA 3LOUA 5G0RB 1IWAA 1TK5A 1ZAXA 8AT1B 2CJXB 2GNKA 5A8KA 4V19J 2ZH5A 3BGOP 3IS9A 3U1MA 2CWXA 2CIMA 4DL2A 1TKDA 4I2PB 2ZBPA 5K9FA 3DDKA 4RW6B 1BD6A 1S57A 3QO9A 3UNGC 4LF5F 4Q5VA 2UUCF 2YQ1A 2JRSA 1C4AA 1NU4A 4UOCA 2HHWA 2PGCA 5EWGA 3N9UC 3DOLB 4DL3A 2CPJA 2BMBA 5BYSA 2O5DA 1B70B 3KK1A 1V9OA 1X4HA 2RF2A 2VD3A 3LP0B 1ITPA 4C48A 2NXNA 2CDRB 4IKAA 4ETXA 2HRUA 1NHUA 4WKRA 2P2CB 5L46A 4KHPF 1QSLA 2IMOA 4DQRA 4NMLA 2CJKA 3CNQP 4CDIA 4MFBB 1UWBA 1N0VC 3ILJA 5D4OA 3NGKA 2VFVA 5BXIA 1B7FA 1QY7A 2RVJA 4UZBA 1NDPA 5F8LA 3D3BJ 3AB2B 3PX6A 1U8SA 2Y9HA 3PXGa 4NLGA 4ZPBA 2ZNYA 4YY3F 1AXQA 3KLFB 1MU2B 1S1VB 3TUPA 2D1CA 5A8RB 4ILLA 1FE0A 3Q8RB 2FYXA 2G2ZA 3DM2B 1RAAB 2JNJA 1UA0A 5KFSA 1HNVB 3VVUA 1S6OA 2IDLA 2H48B 1IR0A 1BQMA 2HNDA 3TUJC 4OV6A 4EZ6A 3HFZB 4A46A 3BEGB 4QPTA 1XR5A 1UW9A 4RU2A 1HBMB 3PV8A 1XMQJ 5AXMA 3QIPA 3CCUS 2HW3A 1UVMA 4Q45A 2VV5A 3G8SA 4LFCF 1W25A 3EGZA 3VQTA 3NKYA 5CCMA 3NNHA 4A8YA 4ZPTR 2FC9A 2Z30B 4DFMA 1SBRA 4ZLJA 2W25A 4UTGA 3HD1A 1Q8BA 1BY9A 3M8YA 2I2YA 4OJ1A 5HJYA 2HG4A 3HHDA 2CQ1A 3GG0A 2FQQB 3AD7C 1YITS 1YK9A 2WBRA 3BQ0A 5H9FJ 5L1JA 2ZH3A 5KG7A 2Q79A 1SKUB 3M6XA 2NSBA 3DRXA 1KTQA 1NK8A 3O6QA 1IJEB 5ETNA 4B3MF 3H5SA 2XCAA 3LPEA 2NXUA 4BDPA 3IGNA 1TTHB 2IRXA 4I6YA 1R8HA 3EZOA 2XEXA 4MYUA 4DV1J 4DPUA 1Z4UA 3DLKB 4YB1P 4RWWA 2V8HA 3MM8B 2OO4A 3KG0A 2QA1A 5B09A 2VDIA 1T8EA 5HO4A 5HVFA 1JLBB 1NSQA 2EEYA 2HIYA 4G1IA 3W2VB 2EW9A 2GFFA 2OMLA 4J9PA 4GKJF 2UXDJ 4DR6J 1RA6A 4ZVFA 1NUEA 1FA0A 2FC8A 4K2XA 2QG9B 3I55S 4JBCA 3EGNA 4X64F 3KLGB 3W1YC 4DLEA 4DV5J 1VJQA 4YFUA 1TL7A 4IG3A 4KGXB 5HI7A 4ZJQA 1TQLA 3F0NA 3QPIA 1KWMA 2ZBIA 4IDKA 3I56S 3FCWA 4LF1A 2IAJA 1TL1A 1EHWA 3SQGA 3JSMB 4FF3A 3R5AA 5CYMB 2Y0BB 2DPIA 1QLNA 1FT8A 2DEJA 1SL1A 4ZJOA 2Z58B 2ASYA 4G65A 2VZ9A 7AT1B 3CULA 5KFDA 3NGRA 1WTBA 3IWNC 2C2ZB 3I82A 2P5VA 3H2UB 4EYHB 1NEEA 3I31A 4QW8A 2BABA 4X4UA 2VA3A 5AXNA 3EMTA 1WC4A 4Q43A 1VISA 1J5OB 2GGPA 2I5JA 2J9DE 2DRBA 5I4MA 4C2MA 5GAHI 5A6WA 3TAQA 2CG4A 5SUHA 3S6EA 5LXYA 1PC5A 1ZA2B 4DX5A 4N77A 4CTAB 2Z0GA 4DUZF 3FBBA 3DYAB 3B54A 5EN1A 3R5CA 2BJDA 2DXEA 2FD2A 4F36A 4ZVRB 3T9ZA 2QSWA 1CC8A 2V0NA 3H59A 2HNYB 4ICLA 5F3TA 4ZVHA 1Z2ZA 4KO0A 1WTFA 4WTYA 5DG8A 4DSFA 1FI4A 1LK7A 5HMZA 2XY6A 4V19X 2KZMA 5J2MB 2W7AA 3QRPA 1U48A 2DH7A 1M5HA 3E3XA 5DJBA 5EDWA 1X5TA 4E98A 3UI3A 1R31A 4WKYA 5I3UA 4B3SJ 4KH0B 4A8QA 2DBBA 2DNNA 2KFYA 4P2SA 1UVKA 3PCOB 2BACA 3EGVA 4HI1A 1TELA 1EIYB 2B5JA 5IT4A 5DM7Q 2ZJRQ 2DGTA 4YOEA 4Y00A 1PBUA 2MQ8A 3WQPA 3FGVA 4I56A 1M5VC 1KN6A 4PG6A 1NSKL 3MM9B 4WXOA 5J2QA 5LOQA 3M8WA 2J8SA 3AT1B 2IM1A 2IPOB 4FBTA 3HCXA 2VODA 1EKRA 4OZNA 4DSLA 4K4TA 1RT5B 3R97A 1UP1A 1WOOA 2BRLA 2HMIB 2HYIB 5HMYA 1V3ZA 3PW5A 3T19A 2RILA 1S9EB 3EE3A 5GAHU 1PJ6A 3B78A 1MG7A 8RUCA 3UO0A 2N3LA 2QO3A 4QR1A 1YTYA 1U1KA 1GFWB 1FRJA 1YRXA 2YWWA 2BV3A 1I51B 2GCFA 2KYZA 3IBCB 1P1TA 4WP3A 3R7SB 2AV5A 1N8RT 4GC7A 1AUDA 3HP6A 2HK2A 1TKXB 2HNZA 3S7RA 5AE2A 3I4HX 2H9ZA 1UZHA 3CEDA 2ZWOA 3UNYA 4YDXA 2Y1RI 2UUBF 2GX8A 2BW2A 1HI0P 2HZCA 3WIUA 2YNFA 3GIJA 4UZCA 4JI1J 5K5MA 4NRUA 4MKAA 4Y3CA 4X4RA 4Y28C 1HD0A 4ZVGA 2YKOA 2QL9B 2HQFA 4NLSA 1NPRA 1Y9OA 3SSSA 2XO6A 5E5NA 2XBPA 3OJSA 4DG1A 4YB7A 2ZJPQ 5CYQB 3GR0A 2B7CB 3OVSA 5DQIA 3MDFA 3K5NA 2R4FA 4AFFA 3WX4A 1XK8A 3CC7S 1YGYA 3AOCA 1JKHB 1T05B 3BYRA 2ALZA 3CWJA 3GILA 1NDKA 4DQIA 5F9LA 3R6LB 1Q5VA 2ZZTA 1UL3A 4QIWD 2K3IA 1OYDA 2AU0A 2EPIA 1S99A 4O4GB 3MEEA 3H20A 4CLLA 3KOAA 2LMIA 5DQGA 2AJ1A 2R7VA 3TZWA 4WU2A 3CCVS 3V5RA 2QLJB 2DGVA 3ENWA 3KLIB 3MOZA 1PG5B 3DOMB 2ACYA 1UVIA 5AXKA 1A0OB 2ZBQA 1WC5A 3Q0AA 4ECTA 4L74A 3RW7A 3QBCA 3E8OA 3NBPA 2GIRA 1WHYA 4RW8A 3MECB 4IH6A 2I8EA 2YKQA 1U2CA 5HLFA 1NNDA 1CVJA 4C3LA 5E41A 4ES3A 1F3FA 3HULA 2VDHA 1U49A 3GTYX 2MHNA 4LR9A 1N33F 1C2PA 3SV3A 3NGTA 3AY0A 3OFGA 1PSDA 5G0RA 1S79A 2YX7A 2JC0A 4OHZA 1WD6A 3IGVA 4U95A 2KXFA 1BMQB 2Y1IA 3W61A 4DPOA 2BKPA 2CG8A 2L9WA 4RW6A 2HFOA 1ZBTA 3MTJA 5J2PB 2WCXA 3ETMA 5KT3A 1TUGB 3AA8A 2B8QA 2ZHAA 3G6XA 4M1KA 2D69A 2QEXS 1RKJA 2RJZA 4NLUA 4F4XA 1RISA 4FS2A 2IA6A 3MPYA 4LF8F 1K73T 3OTDA 3DOLA 1FKOA 5LMNF 3HI9A 2IDEA 1RLCL 3M05A 4KPYA 2N7YA 4CM2A 3LP0A 4KGKA 5L39A 4N76A 3FZ2A 1AA1B 4UQTA 2DTJA 2NZ4A 1VDHA 2OEMA 1VR6A 2SXLA 2ZITA 1AUSL 1RA7A 1FRMA 1RWVB 2UXCJ 2ZOGA 4FNHA 3PW7A 4MFBA 1TZ0A 4ZVPB 2BOPA 3ZZTA 3WC2A 3MR2A 4YP3A 3R1HA 4NCBA 2H4YB 2PA8D 2CJYB 4RR5A 4EO6A 1KSPA 3W2WA 1PBAA 2MZSA 4L73A 4DR4J 4KTQA 4F3OA 4NZ6A 2VBXA 3B6BA 3FDSA 3OR2A 1Q1KA 4C97A 3ZZRA 5DDQC 3IRXB 3KLFA 1IKVB 1MLAA 2WONB 5GMKa 4HDGA 4IQXA 4KBIA 2Z2YB 2W2QP 3PNIA 4S0MA 3IR7B 5D3GB 5KFPA 3N01A 2CQIA 4UW2A 2MSTA 2DB1A 1F9EB 3WIVA 4OFZA 2H5IB 2BANB 3ET6A 1K1SA 4WK3A 1SQEA 2Z57B 1U1PA 3EGWB 4BCAA 3BM7A 1BXNA 2EK6A 1JB0C 1HBMA 2R2RA 5HMXA 1CJKB 4BS2A 3T6JA 4MT1A 3HVWA 2BM1A 3OD2A 2LDIA 2M9KA 8ATCB 2ZWPA 2D3UA 4YEAA 4JUZA 4LF4F 4F4WA 4CLUA 5F8IA 1SH2A 1F5CA 3HT0A 4BC7A 3NGDA 3FSIA 1QAYA 1IN0A 2MQLA 4X66F 3K5OA 2JFKA 3BO2A 3MMCB 1UA1A 1S1TA 4EU0A 3LWLA 2MKKA 3ILLA 2G2OA 3CJ0A 3W5YA 3US5A 3TW0A 4LFAF 2XMUA 1NH8A 1U1MA 2IC3B 3HX9A 1H2UX 2BEFA 3GU0A 3A4TA 4DPYA 3TUIC 4JI0F 3PDNA 1VRTB 2FJDB 2RB7A 3K5MA 4J9LA 2AYBA 4USVA 2XM3A 1BGXT 4O44B 3DN9A 2BX6A 1UKUA 3DLKA 1IUJA 3ULHA 3TZYA 3MM8A 2CWKA 1FDAA 2E9RX 2YKMB 3R27A 1O51A 1JLBA 4ECYA 3K89A 3TJ9A 3W2VA 1QVGR 4JI8F 3DFEA 1P27B 3PYDA 3SV4A 4I6WA 1NAQA 2KB2A 3QJJA 3MCOA 4QR2A 4DV7F 4ITSA 1HWLA 1UWAA 1D0EA 1DJ0A 4RNNA 2KHDA 3R5GA 3DDIA 3KLGA 3DLGB 1EKSA 4X4SA 2ATCB 2KI2A 5KG3A 4RBUA 2ROEA 2MB0B 1U7LA 2A1BA 2BJ7A 2GMHA 4M5NA 4M95A 1OMSA 1Y00A 1DQ8A 3R1LA 1N48A 2HFNA 2OEJA 2FJXA 3TVYA 3N0VA 2MJUA 3JSMA 3M8PB 5CYMA 2HAFA 1VOMA 2ABYA 1WEYA 4FBUA 4ED4A 2DKOB 1CJTB 3J81j 5AE1A 4QR0A 2ZC3A 5HJXA 5KFYA 4E8UA 1QTNB 4K50A 4B9NA 4HDHA 3EJMA 2LP4A 1HR0J 3V2UC 3PO5A 3LPYA 1VQOS 1H73A 2VBYA 2KM8B 5IQQA 3QRQA 2EK1A 2CPXA 3QWPA 1X8DA 1TL4A 2W9BB 2MKCA 1YVFA 2APOA 2F1FA 3RBEA 2J76E 2KXNB 2NS1B 3BSOA 2J6SA 3QRRA 3HPOA 1Y7PA 2CPFA 4DI6A 3O5TB 1VQSA 2D41A 2YKNB 1AFJA 3FNNA 4IH7A 4NEYA 4PG5A 2CPEA 1FRHA 2MGZB 2XZWA 5HVGA 3AFGA 1U24A 3VZHA 2FVPA 5E3PA 2IJFA 2QC3A 4OYOA 2M88A 4AQYJ 4WYLA 4NOHA 3DYAA 3VCDA 4BC9A 4CT9A 3MR5A 4KKOB 3D3CJ 2R3VA 3TAPA 2VQEJ 4B3OB 1JJHA 1T95A 3BGLA 1VS3A 2HNYA 4OJ3A 3CIMA 4OHWA 2R7QA 1KQFB 3CCZA 3GIRA 1Q81T 2B9XA 2V9WA 2WVCA 2W8LA 2DH8A 5BJRA 1PGZA 4ZMMA 3AH6A 3QGHA 1FCAA 3GONA 3D68A 4H4KC 2XMAA 5J2MA 4DL7A 4J9KA 4KGMA 2GQ2A 1JIHA 4JI6F 4IRKA 1VJWA 1E6VB 3CJ3A 3PW2A 2C2KB 2DIUA 2OP5A 2B4UA 4EI2A 2XI3A 2OHDA 2UUCJ 3UCGA 4RU9A 4ZOSA 3N6NA 4HI2A 2QFJA 3T5KA 2ZFHA 1IBMF 1U6BA 3GV5B 2V8DA 1ICEB 4OV1A 4WFXA 2R7OA 1WACA 2DVIA 3D1OA 3GE9A 2JH3A 3MM9A 2CJBA 4DF4A 3O3LA 3MURP 2RRAA 3CD0A 2F8MA 3DRRB 4J9QA 2FJEB 2V5HG 3CD5A 5I42B 4KHPJ 3K7RA 1WHXA 4HEA9 3NLCA 5B0CA 2UP1A 3OHAA 2HMIA 2M2BA 3NGSA 1PYOB 4DEZA 3M8ZA 3EX7B 4OHXA 3Q8SB 2K7KA 3KJVB 2DPJA 4IRCA 3CGIA 4P7VA 3TO8A 1NZAA 4NMXA 3DLHA 1KR4A 3BPSP 4EWTA 2CNNB 3BDEA 1FXLA 2RD5C 5KG5A 2CDQA 2V69A 5DQHA 2WTFA 4NLQA 3NP5A 4YY3J 3QQCD 4M8LA 1ZTTA 1NXIA 3D5MA 1TKXA 3E2EA 4GRSA 1N34F 2FY1A 3RAQA 2HZVA 2BQUA 1X0PA 3MWBA 4B9MA 4RKUC 1Q78A 2HHQA 4DUTA 4X84A 5B7WA 1ZH5A 2OELA 5MAOA 2RU3A 1HQUB 4QQBA 2PSZA 5HAOA 4B9UA 1FHTA 2MLZA 4K5SA 1PCAA 2DY1A 3GIKA 1LWXA 4WFAQ 3TARA 1RWWB 2EWHA 5E7OB 2OGUA 2A2CA 4LFCJ 4K59A 4ZP6A 2CUYA 3I5CA 4ZVSB 1H98A 5CYQA 4DU8A 2KVIA 4JI5F 4CCHA 3R7BB 1SUQB 4FF1A 2VBWA 1RT1B 1MWZA 1FO1A 3EXCX 1JKHA 1T05A 2IIHA 5M2PA 4RUCA 3CCWA 3OW2R 5J1EB 2K7JA 2KVQE 4TYAA 4CNZA 2YKAA 2NPFA 2XGQA 2D3OR 3R5JB 1N52B 4RWXA 3C16B 4O4GA 4WCEQ 2OLWA 3HT3A 2PEHA 2Y8YA 3L4BC 5ETOA 1RWPB 3UVJB 3VALA 1NB2A 4B3MJ 1BC6A 1RT3B 3KLIA 3DOMA 1PO6A 1UFLA 2BZ2A 3TEHB 5C42B 2A2DA 4XK8C 2QMWA 4FPRA 2FLNA 1VQ6S 4A8XA 3AAWB 3MMBB 4X4QA 3MECA 2Q1LA 4PXEA 3GLJA 2OUGA 2R2SA 3PACA 4Q2MA 4LR8A 2JFDA 4W98A 2A6OA 3HSZA 1SCJB 1B7YB 4GKJJ 2D7SA 5AXLA 2QMUB 4U9RA 2OPQB 1TVRB 4GO5X 4R25A 3AJ2A 1L3TA 2QLFB 1TU0B 4X64J 3NL0A 2RDJA 1OPZA 2WVDA 1HWKA 1DY3A 1WJ9A 4A8FA 1TK0A 4FN5A 4U96A 1EARA 2CQ3A 2IFXA 1Q16B 3G2XA 5KFZA 4DR5F 1DLOB 1NH7A 5J2PA 3GV7B 1F1BB 4I68A 1S1UB 5A0YB 4LSNB 4IYQA 3CDWA 1FE4A 2LVWA 3OPKA 5I3PA 3TVKA 3V6DA 2KFZA 4OX7A 2Y3YA 2ASLA 2C2RA 3UR0A 3BN4A 3VAFA 3PYGA 1WHVA 1UZDA 3D67A 1R8BA 1G1XA 4PEOA 5D0HA 3MM5B 3NNAA 3PYFA 2FLOA 3TA0A 2ZBCA 2HEKA 2DY9A 4JP8A 5LJ5Y 1H74A 5B0FA 1W7WA 1RSCA 4JI3F 1Y4ZB 4HTIA 4USIA 4FYWB 4PR6A 3LWMA 5DGAA 3FKBA 2B51A 2XNQA 3EM1A 1SKWA 3PTWA 2R8IA 3TZZA 4ZLPA 2HFUA 3RRKA 1EB0A 3ZNUA 4DS5A 4AYBD 2CNOB 4DUZJ 2E7WA 3IRXA 5LJ3Y 2V8PA 1YRUA 1IKVA 2JHEA 4Z2XA 2WONA 3AJDA 3BBCA 2AZ1A 2J7UA 2XULA 5D3GA 3Q89A 3UW1A 2OFHX 4ER8A 3TYTA 1H7XA 1ELOA 1PYTA 3MR7A 2BANA 3HHEA 2JLFA 2FLLA 2PC6A 4DPXA 2XS2A 6FDRA 3NY0A 4O3RA 4O4RA 1F5AA 2CFXA 2CKWA 2Q66A 5IXUA 3KNGA 1NRKA 4OYXA 3GFYA 1YHQS 1FDDA 1LKZA 5HL7Q 5A8WB 1JLQB 3FBCA 1D09B 2AT1B 5BYQA 2B3TB 3UN2A 4DV6F 4ZVQB 3MM6A 1QE1B 5E3CA 3MMCA 2Z4PA 5KFVA 3T3FA 1ZM9A 1WHWA 3D66A 2YQ0A 3SCLE 1XBWA 1A9NB 4W4MA 2O66A 4BBYA 2GHVC 1Q7LB 4IO1A 2QYGA 5FDLB 1OSCA 2G9OA 2CNKB 1KD1T 3HFVA 1OJ4A 1RBLA 4OI6A 1MW7A 1B3TA 2HHSA 1MN9A 4USTA 1VRTA 1F0XA 4KV8B 4LRFA 3BSAA 3EDQB 1CSJA 4O44A 4CM0A 3AODA 3BBFA 4HKQA 4PXBA 3QZ7A 4I2QB 3D2WA 4DQQA 2QL5B 2LU1A 2ZH9A 2V6AA 1NBEB 3R2CJ 1MMDA 4M5MA 3R9LA 2YKMA 1HHQA 1H72C 2LEBA 4K4WA 3C14B 3POTB 3M2VB 1NB7A 3UDVA 5HN0A 1CPZA 1ZM2A 2ZVSA 3KHLA 2W4CA 4RW9B 5KAKA 4ZITA 2C3UA 3R7NB 2HK3A 4QWDA 1X0FA 3W9IA 5F41A 3MPWA 3OL6A 3IO1A 3VAIA 1LW0B 2I38A 3DLGA 2MMYA 3LTOA 2UUAF 2L3MA 2A0FB 2HBZB 2UUBJ 1RWNB 5CQGA 3BGRB 4H54A 2XGPA 3AD8C 5HSPA 4C8KA 2EI5A 4U6PA 1Y3KA 2UVWA 3Q8UA 3UCUP 3WC0A 3LP2A 3KHGA 1C0TB 4RNHA 1KEKA 1F2GA 4DR1F 5KT4A 1D3WA 3M9MB 1ZM4A 1UTAA 2CQPA 3M8PA 3IR6B 1VK3A 4B08A 1U09A 2XMTA 3V81A 3G82B 2AGPA 4HHUA 1DTTB 1S48A 2U2FA 2LA4A 2HQDA 3QJPA 3TEGA 2VFTA 2NR0A 2HQCA 3D0GE 3GIIA 4LUBA 2CQCA 1S7IA 3T1YF 2W9BA 2FLPA 3SFUA 3BSCA 5KFQA 1HWJA 2EBEA 5KFUA 3SIPB 4OMFG 4KB7A 3PRBA 3M8RA 3T5HA 2YKNA 4TYBA 1UJ4A 3HFKA 5EGYA 5LXRA 4P72A 4NE9C 4K4UA 1D9AA 2MGZA 3K0JA 2KO1A 1F3VA 1TUVA 3A12A 2K1RB 2V68A 2HVEA 5MLCV 4NA2A 1NK5A 3P8BB 1WKKA 4KKOA 1DAXA 3SZ2A 1YZ7A 3ENVA 3K8VA 2H54B 4B3OA 3B8HA 3VZIA 4EO8A 2E5IA 4XPEA 4ZPDA 4RBTA 1M5PC 2H3EB 1GMUA 2KXHA 1N33J 3HKZD 4UOGA 5KFHA 5E33A 3THPA 3FBEA 4U8YA 5T7LB 4P9SA 4RZRA 1JLCA 4B9TA 1S10A 3BS9A 3OQ2A 3BJYA 3GV8B 1HNIB 3SFGA 3SI8A 3KLVA 1Q8LA 1HL6A 1N54B 3GSIA 2QYCA 4JI4F 2GHWA 1E6VA 2HQIA 2RHQB 4DV4F 2MHEA 1V3SA 2G2YA 2VOOA 3OL9A 1TMJA 3VAMA 1X31C 3RG6A 1R6VA 4TQSA 4WP9A 5C25B 4LF8J 2V63A 4TLRA 1F9FA 4WBFA 5LMNJ 5KFXA 5KT2A 4AT1B 5ETQA 1H38A 2DIVA 1KVKA 3OXGA 3M8SA 3HO1A 2ZJQQ 1IJFB 1HBUB 4USKA 2WSEC 4X4NA 4YR3A 3DLEB 2BRKA 4ZN1A 3RBXA 3AOBA 3DRRA 2AYMA 2LQJA 4LQ9A 4N5SA 2DNGA 5I42A 2JEFA 1OS5A 3U1LA 2X1AA 4O0IA 4YHHF 4LFBF 1D8YA 3QATA 3O1LA 2XYHB 1O5JA 1OY8A 1R0CB 2YNGB 2FB0A 2A10A 2M0GB 2DNKA 1LXNA 3QJLA 5HQMA 1GMWD 1SL0A 4ECSA 3DOKB 1OQ3A 3L7UA 4LF9F 1VRUB 5HATA 2BKOA 4FYYB 4NCAA 5ETTA 4WFYA 4NLPA 1LWCB 3VGUA 3KDOA 5GVQA 1KHWA 3CSKA 4EFAC 4DUYF 3BO3A 4C3MA 1TFWA 1WI6A 2XG8A 4DBQA 1VBXA 1HQUA 2VPYB 1TKTA 2CPIA 4RW4A 1HNXF 4C11B 4Q0BB 2VG5B 4P6QA 3Q83A 2DNMA 1IVZA 1LXJA 1JXVA 4CH1A 3EDRB 4ZIWA 4NLOA 1NK9A 4PG8A 4ILMA 4LF4J 3HLUA 1HWIA 1SUQA 2UVVA 1T9UA 3ELHA 4X66J 3ISND 4A4JA 1M5SA 3SCJE 4U7UK 3M32B 3T6BA 3GR1A 2C3MA 3BGUA 3C16A 1CJVB 2BJ1A 2FHJA 2E5GA 1JLEB 4LFAJ 1F5BA 2DHHA 1S6QB 3RBZA 2DK2A 3BF4A 2YVSA 2IVFB 1G3OA 4JI0J 2QIFA 3VAHA 1T9TA 2HQ3A 1RT3A 3K17A 1WC1A 1TV6B 3D6FB 3H4DA 4FNIA 5C42A 5LT5A 1UETA 1KS2A 5K8OA 1CULB 4L76A 2PFDA 4K4ZA 3LGNA 3O2IA 3DGPB 4ED2A 2JEJA 1K9MT 3MMBA 2R7RA 4AL5A 1HKAA 5JMNA 2J0SD 3T9NA 1KTVA 3RYLA 4ZLNA 1VQNS 3DCAA 4JI8J 2OPRA 2BJ9A 2X3DA 5JXSA 5L9XA 2J9DA 1NDLA 4USMA 3DU6A 1TVRA 1CEZA 3MCSA 4DV7J 2JVRA 2MYFA 3PM9A 1WOPA 3DC2A 4QZVB 1LNQA 3JS9A 3EVWA 1RT4B 1FRKA 1Q0NA 1WF1A 3LA0A 4NLWA 3M2UA 1R89A 4ERDA 1T03B 5IWAF 1JX4A 3ZZ0A 3CO0P 2DJWA 1DLOA 4I0WA 1W2BR 1S1UA 4LSNA 1KBRA 1VQ7S 2DISA 1T94A 3MUVP 2C3OA 5D8HB 2ADBA 5GAEU 2GA7A 5RUBA 1X4GA 4ZK7M 1X4BA 3JTNA 2BM0A 4TKTA 3MM5A 2J0QD 3KWMA 4ENOA 2KT5A 3GYNA 3Q8YA 4TN2A 3MHYA 3SXLA 3FZBA 2LXFA 2VC0A 2E5LF 4J9VA 4FP9A 1KQKA 5KG1A 5EWEA 1QAJA 1Q5YA 1XMOF 4F8RA 3HM9A 4N47A 3LAMA 1J5EF 2FJAB 1LW2B 1U1OA 3HHLA 3MMAB 1WDDA 4B17A 1S4FA 1TUWA 3BPDA 3A3PB 2KRBA 4HYKA 4PZVA 2YX1A 3P4UB 2LECA 2B0GA 1R3NA 4UUXA 1RLDA 2CADA 4YB6A 5L1LA 3M2RB 3SMZA 4Y2AA 2AHOB 5IV3A 1VIOA 1UJ6A 3GJQB 1RUSA 3EICA 5JVHQ 1M1KT 3K5PA 4YN3B 4X65F 1UEKA 3W64A 2PEBA 2MY8A 3VGVA 2FVQA 4J9OA 2NLWA 1VFJA 3ADAC 3KMQA 2CNLB 1KONA 3C15A 1LOUA 1IR2A 1GXUA 5L1IA 4MKVA 3CJRA 2V2VA 3GFHA 3C6UB 4JI6J 3OL7A 4MIWA 1L3VA 4C98A 3CCES 3PIOQ 5J1PA 3Q8VA 5EWFA 3IM8A 3D7SB 1FWPA 4GKKF 5A8WA 1X4EA 3BR9A 1JLQA 2V8GA 1RAHB 2V50A 4PABA 5K8NA 3HJFA 2AD9A 4L6V3 4KIAA 1U47A 1VQKS 1FRXA 1QE1A 4M5IA 4M5JA 2CJAA 4KGZB 4CQ1A 3PX4A 3QZ8A 4N7TA 3UCZP 2J8AA 1IBMJ 3HHLC 4HT5A 4LVOP 4ZA1A 5FDLA 1HW9A 3VV2B 3OSPA 3IAS9 1PJ7A 4RO0A 4WYWA 2BE2B 4IQMA 3K58A 4MTPA 1MMLA 2MEWA 1V5IB 2IRUA 1FDNA 1B99A 5ETSA 2HURA 4RW7B 4C8OA 4KV8A 1FNMA 2JX2A 4FF4A 1XR6A 2WZ1A 3SEOA 2ATLA 1HNWF 1WF0A 4LSLB 2XMKA 1O0PA 4NI2B 4I2QA 1F60B 2W8KA 4IFYA 3MAHA 4FKXA 4OJHA 2AF6A 3C14A 1HHTP 3M2VA 4BWMA 3RAXA 2VONA 4RW9A 1RHMB 3QSIA 1CJUB 5ETPA 3WBZA 3NMRA 1K0TA 4KFBB 3GJRB 4CH0S 3GYXB 1R8CA 1LW0A 1IKXB 1N34J 3QAEA 3EZUA 3UR3C 1YIJS 1RTHB 3BGRA 3FC9A 4Y2IA 2X3GA 4WE1A 4I64A 2OJ3A 5THWA 2XC9A 4O3SA 5DETA 3RR7A 1C0TA 3RZAA 3H7HB 1FJGJ 4O23A 1FEHA 1SB6A 1IKYB 3ZTPA 2AEFA 1K47A 1U6ZA 3GCWP 3UFCX 4Z37A 2MZJA 3TQEA 2C2DA 1URRA 3IAM9 1M5KC 3HSGA 5IQ6A 3G82A 2B4PA 1DTTA 2IVMA 4JI5J 3IWLA 4A8OA 3TX0A 9ATCB 3I4PA 4DFJA 4TXSA 1RQ0A 1QSSA 2VUGA 4LBPA 5K20B 1OO0B 2Z2ZA 4URQU 3MZIA 4L3KA 1YBTA 4OI4A 3S8SA 2NXCA 1PAUB 2ZD1B 4KHRA 4PUOB 1AB8A 1X9SA 4CH7A 2MKIA 1P9YA 1RE1B 4ID8A 4CLPA 2A3JA 3CCJS 3HVAA 4P73A 3VGSA 2K1RA 5F8GA 4Y6IA 3W5XA 3P6YC 4YDDB 5IC6B 5CABA 2ROGA 4GVLA 3HJVA 5E0OA 1UVLA 5IT9U 3C66A 4DX6A 3LF0A 1S1WB 4ILRA 2FVRA 4Q8FA 2OIHA 4ZVOB 5KFLA 1OQ6A 1IR1A 3J7A1 3KMSA 1UVJA 4X62F 1CS4B 5D77A 3PR4A 4DQSA 3PY8A 4CO1A 1L3UA 2QLXA 2BA9A 5T7LA 2JL9A 3AOAA 5DDOC 1HNIA 3QT6A 3OFHA 3C8YA 1FD8A 2K3KA 2KL8A 4K2JA 1RHUB 5G4DA 4DR5J 4Y2KA 3WHIA 3TA1A 1Q82T 1JLAA 1KFDA 4RUAA 3BQ1A 2DGSA 1P9QC 1HQEB 2E1MC 2ASDA 4ANDA 5C25A 4W92B 1JNZB 1SJQA 3W60A 2E9TA 3OJUA 2HWHA 4XDDA 3PJWA 3MUTP 2OI2A 2W9AA 1FESA 3CDBA 1FJ7A 2OPPB 1DBDA 1URNA 1HBUA 3MXHP 1APSA 4ED5A 4TLQA 3PFEA 3RRGA 2WBMA 1CC7A 3N6MA 2W4PA 5CAAA 1WG5A 2FTRA 4WP8A 5CHCB 2DYAA 5C24B 1X7VA 4JI3J 2RH3A 1IM6A 3TANA 1M90T 4DZ6A 3I0RB 2LA6A 4R5PB 4N8NA 3PR5B 2DNPA 4OZLA 2L08A 2BOAA 1H6KX 3BSNA 2GZOA 3P45B 5L38A 3VF0B 2LDYA 2QZ8A 2YNGA 3CDAA 4NYZA 1KKHA 4LRAA 1S7HA 5FJ4A 5HVHA 5HQ8A 5KFCA 2YQ3A 3KNAA 1X9MA 2ZH8A 4CT8A 4ELUA 3DOKA 4ZP9A 2E1PA 3FEZA 1VRUA 2DCLA 4L3NA 2MZTA 5F8HA 2N7CA 1LWCA 3DRPA 4PYDA 4RPFA 3EYZA 2FHKA 5A76A 4TQRA 3CW2C 3CMAS 4UOHA 2AW0A 1SL2A 3W9HA 4LSZB 4UOFA 2D3ZA 2WRMA 1Q95G 3ILOA 4NCGB 2VB6A 2R42A 4C11A 4Q0BA 2VG5A 4K0KF 1Q86T 1HBNB 3NEKA 1LWFA 2CAJA 2NYIA 2JLGA 4H4OB 3CD7A 1LFPA 1R0AB 3TWZA 1N6QA 3JAMU 2XSJB 2BDPA 1JK9B 4RLEA 3KG1A 4F0KA 1N0UA 4RL1A 2CQGA 2MZRA 1T02A 4DV6J 2VF3A 4NYOA 3HMJG 2J9EA 4LRDA 2DGQA 1S76D 4OZ0A 1Z2LA 3H42A 4P74A 3DRSB 3M32A 4KC5A 3OBIA 1CJVA 3QGPA 3GZ7A 2HWIA 4LT6A 1IBCB 1S6QA 1RT6B 4IR9A 1U1QA 1UAWA 4NYPA 2FVCA 1HW8A 3LW5C 5KT6A 4QIEA 2JJ4D 2HFVA 2R8HA 4AXIA 5IT0A 1TV6A 3SDEB 1MN7A 5L9NA 4IH5A 1HBOB 1CULA 1WOSA 2CRLA 1RAOA 3DGPA 4PWDB 1TAQA 1M1HA 2FHOB 2HHTA 3RW6A 3AB4B 3L9ZA 2UUWA 1GMVA 4HT7A 4B3RF 2CPYA 5B0BA 2J0XA 2BVZA 2IBKA 2P9GA 1PKUA 1QJHA 3VHQA 2V4QA 1UFWA 2EXUA 3RTVA 3J7AN 4PPDA 2YWEA 3MEGB 5CZVA 4Z7CA 1Q7YT 4XTTA 4YB5A 1YI2S 4NLYA 1RP5A 5F8JA 1RT4A 2UUAJ 2KKHA 2GMLA 2NCKL 5SZTA 2YH1A 2C2NA 4OHYA 3G9CA 1T03A 1TL7B 2JWNA 1Q53A 1IKWB 1S5ZA 2ZKUA 3MEKA 1B64A 3Q2TC 3TRGA 4DR1J 4WIIA 1RABB 2OH2A 1NK4A 4LJMA 2COLA 1UFKA 3FCHA 2AGQA 3V6JA 2F4VF 3VVTA 5HP1B 2IAJB 1FRLA 2DNYA 1ZTWA 2FVSA 1WSVA 2FJBB 4OL8A 5A6PA 3DRYA 4M63A 2MKHA 5CXTA 3K57A 2NREA 2KTQA 3OUYB 2FZGB 3T1YJ 2ZH7A 4YR0A 1RTZA 4NA3A 3H0PA 2KG0A 4DU7A 4URSA 1WKJA 3CCLS 3GFXA 2BJEA 1Q8KA 4AL7A 1PYSB 1YQHA 3R8YA 3D9BA 4YUDA 5CCLA 3F73A 1WSRA 1LW2A 3PVXA 4CLSA 1DQ9A 1FERA 3MMAA 4ETZA 1SJ3P 1EP4B 4TVAB 3QGGA 4O3OA 3THVA 1GAOA 4DHVA 1NK7A 2CQDA 4UT4A 3CCMS 3M2RA 1UVNA 3B4DA 1ZS6A 3H4BA 1RHKB 3D28A 3KG4A 2LXUA 1NKBA 4WZQA 2DNZA 2ZH1A 5KFGA 5DZ6A 2OSRA 4Y34A 3K8WA 4QOTA 4NXNF 2HVZA 4KPCA 4JV0A 1GQEA 3V4IB 2GJFA 3JSRA 2ZHOA 3N28A 4F3MA 2VG7B 5KFIA 4QBUA 1FNOA 5B0DA 3C6UA 2R7SA 2QE5A 2F65A 2NYHA 3IG1A 4C8YA 3TA2A 4JI4J 3AJ1A 4ED6A 1T3OA 1S0MA 1MROA 2AMCB 5DDRC 2I9SA 1S1XB 4DV4J 5ETMA 4I1TA 2R9LA 3D1QA 1BE4A 2BW7A 1VC6A 4DV3F 2Z2LA 1U45A 1I1GA 1W2IA 2V67A 1XTZA 1WKLA 5KT5A 1JNRB 3I32A 4R8UB 2HZAA 2VPXB 2XS7A 3RGIA 2W7OA 4YR2A 4PAAA 4OZ3A 4QU7A 1XMBA 2VHGA 2FUG9 2E66A 4AD6A 3QNWB 3H40A 5HQLA 4AXJA 2GHPA 2BE2A 2EC2A 2NSCA 3EXYA 3NS5A 1TL3B 5F9NA 2LQ5A 2IJNA 1L5UA 4RW7A 3A13A 4C0BA 2WB1D 2F40A 4Y2CA 2LU2A 2HPUA 4YHHJ 2P9CA 3J81U 5H9EJ 4CP5A 4LFBJ 1RGVA 3GSDA 5JVGQ 4DQPA 4I2PA 3K2YA 4RBVA 2HHHF 5HBMB 2IY5B 5LSRA 3U7JA 4J37A 5JUMA 2BQRA 1LV5A 2C28A 2K2PA 1TP7A 1X5OA 2CZ4A 4WFNQ 4U7CA 2L48A 2PMWA 1CJUA 4LF9J 3P5BP 4EBDA 3OT9A 2GIQA 4KFBA 3NCPA 3P96A 2I0XA 1SJRA 5DG9A 1IKXA 3M9NB 3RU0A 4QIFA 2IM0A 1FNXH 4DMZA 2RE1A 1FX4A 4OZJA 1RTHA 4FKYA 4B9LA 4DUYJ 1R7IA 3DI6B 1H7WA 3SSRA 1KQSR 1ZZFA 1RHQB 2XLJA 3H5XA 4KR0B 2VL1A 4NA1A 1S9GB 3ZZPA 1RHJB 5T41A 1A6LA 2AEMA 3W62A 5GAGI 1HNXJ 1N88A 2M7SA 1FVSA 3BDPA 1IKYA 1FF2A 4KJIA 2E5HA 3U27A 2YTCA 3O44A 3H5YA 3ZTSA 1RHRB 4PQUB 1WORA 4QWAA 2GMJA 2H5JB 1KLMB 2XZDB 1GH8A 3T1HF 5CD4A 2YNHB 2PO4A 1Q79A 2DGWA 1Y5IB 1RWKB 1KFSA 1S9FA 4IG0B 5F8MA 1HI1A 4QU6A 1FXDA 1SC4B 3QWUA 4OZ2A 2OMOA 1MU2A 1S1VA 4TNOA 4ELTA 5A8RA 1S4EA 3BR8A 1HARA 4OYBA 3UDCA 2ZD1A 1NJXA 3DMJB 2GJ2A 3DM2A 1FX2A 1HNVA 2WVFA 1JWWA 4M5HA 5E2QA 4ED3A 3BV8A 2VQFF 4PUOA 1SKSA 3MF5A 2I6WA 2R7TA 2HRTA 4ED8A 5KFFA 4FYDA 2KZZA 1AROP 3J80Y 3LH2S 4N8OA 2VFSA 2QLBB 1MWYA 2V94A 4ZP8A 2DH9A 1BWEA 4OI1A 3HKWA 1KHVA 1ZETA 3CCTA 2H1YA 2V4RA 1Y10A 2QLWA 4ED0A 1EZZB 1C1CB 4K7QA 1FD2A 1S1WA 2B6AB 3JSYA 1U2FA 2AYGA 2MTLA 4U7UD 3DLLQ 1JJCB 1XNRF 4F4AA 1CS4A 1YJVA 1GNKA 4JB8B 2VFUA 3ILIA 4MAKA 4CO4A 2R2UA 4NLTA 1AT1B 2IVYA 2VBZA 2V2ZA 4EZ9A 2DXDA 1B0VA 2BE9B 2O01C 4OZ1A 2G4BA 1WELA 2C2OB 4ZN3A 4C8ZA 4ECUA 2QL7B 4OYWA 1FKPB 1T3NA 2Q6CA 5IWAJ 5FD1A 3THTA 2GQCA 1RAEB 1F2HA 3NMAA 1V3RA 4CO5A 5GAGU 1VC5A 3FQLA 4XDCA 1HQEA 4DOZA 3OLBA 4ZPCA 4DPWA 1L3SA 3UDEA 2GO9A 3PZPA 4C9DA 2D9OA 2MZ1A 4C6AA 4WK1A 1NK0A 1UJ5A 4DN0A 2B8PA 2OPPA 1U0HB 1FKOB 2F9JA 2G1DA 2YNIB 5IFMA 3U02A 1GEHA 2UV8A 3ONQA 2W9CB 4OHVA 2JEGA 5C24A 2DO0A 2OKQA 2MKSA 4RNOA 2E5LJ 3I0RA 2E1RA 3M6VA 1MWQA 4R5PA 4IUFA 2AZ3A 4H4MB 2CPHA 1XMOJ 5ETKA 4IFVB 3KTQA 1J5EJ 2VU5A 4ECRA 4LF2A 2HKEA 2DGXA 3LGMA 2CVIA 5GMDA 4DV2F 4F4ZA 1RCXB 5KT7A 2IMWP 2ZKTA 2PIIA 3PRDA 1XNQF 1IBLF 1WWHA 1YSJA 5D4LA 4KY3A 1KOOA 3FSYA 3W2WB 3QFWA 2EG1A 4B3TF 2X1GA 3OSNA 2CQ4A 3OR2B 3KLHB 1N5TA 2XHCA 3QFHA 2YX4A 1O6XA 3QLHB 4X65J 2OPSB 2HS4A 3MGJA 3TOQA 4F3QA 4FVMA 5KOWA 4LF7F 1D8ZA 3BO4A 1WC0A 1GTEA 2F9DA 3AQOA 5K8MA 1J5OA 2C1EB 4CO2A 4NCGA 1BQNB 2J0WA 2IM2A 3OHBA 4WTOB 3ET6B 4PCQA 2ZEJA
chains in the Genus database with same CATH topology
3CC7S 4ILMA 1HBNA 1YGYA 1HMVB 4G3IA 3HLUA 1N32F 2PD1A 1JKHB 1HWIA 1T05B 3KK2B 2ALZA 4OLOA 3CWJA 4H4OA 1SUQA 1NJZA 2UVVA 3GILA 3NCQA 1R0AA 3D0HE 3PIPQ 2MQMA 2XSJA 4DQIA 5F9LA 2ERRA 2FJVA 3T5LA 3CO9A 3ISND 3OLAA 2ZM6F 4MIBA 3RRHA 1UL3A 4QIWD 4A4JA 1SI9A 2K3IA 2RRNA 4DL6A 4UY85 3MPVA 2AU0A 4X2BA 2JZ5A 2J9CA 1M5SA 2EPIA 1S99A 4O4GB 4ZVEA 3HK2A 3MEEA 5EX3A 3H20A 4U7UK 3SCJE 4CTAA 2A18A 2D9PA 3M32B 3KOAA 3T6BA 4MKYA 3GR1A 3RB3A 2LMIA 4JYAF 2C3MA 5DQGA 1U1LA 4WF9Q 2AJ1A 3BGUA 5KFKA 2R7VA 2X1BA 4ZPAA 4PG4A 2FHJA 1EETA 2E5GA 3DRSA 4WU2A 1JLEB 2RMLA 3CCVS 1F5BA 3FFIA 3V5RA 1S6QB 2R7XA 2AX1A 2DGVA 3ENWA 3KLIB 1ZAVA 3OXLA 2DK2A 1VQ4S 3BF4A 3MD3A 3MOZA 2YVSA 5CZXA 2IVFB 1S1TB 1G3OA 3J7Z5 3EPIA 2ACYA 3A8EA 2QIFA 3VAHA 3H2VE 3Q24A 1MNEA 2HQ3A 5B0EA 1UVIA 2CJQA 3MM7A 1RT3A 2MSSA 1RT6A 5AXKA 2FGCA 2RDIA 2LQ9A 3LP1B 2HS3A 3CIZA 4ZPVR 4KAIA 1E6YB 2L9DA 3Q0AA 3G71S 4ECTA 4ED1A 1TV6B 1U1NA 1KOHA 3H4DA 4FNIA 5C42A 3RW7A 5LT5A 3E8OA 3NBPA 2GIRA 1UETA 1KS2A 2E44A 5K8OA 4ZCLA 1VIXA 1WHYA 4K4ZA 4HH1A 3LGNA 4RW8A 2Z2MA 3RAMA 3MECB 4IH6A 2I8EA 2YKQA 4XAKA 4QWEA 2ZE2B 3SDEA 2WW8A 3O2IA 4ED2A 5HLFA 1HBOA 4OI3A 5A2QY 1NNDA 4JV1A 1CVJA 2JEJA 4C3LA 5E41A 4ES3A 4B9SA 1K9MT 1FVQA 3MMBA 3RR8A 3OXFA 2R7RA 4AL5A 7FDRA 3GQCA 1U49A 5IS2A 2J0SD 5LSLA 4PWDA 3PFOA 1O8BA 2MHNA 1WG1A 2RT3A 3T9NA 1KTVA 3RYLA 1N33F 1C2PA 3SV3A 3UD3P 1VQNS 2YH0A 3DCAA 1VQ9S 2DHGA 2OPRA 4ID5A 5JXSA 2AJ0A 2VG6A 3AY0A 5L9XA 1XC9A 2J9DA 3NAIA 3OFGA 1SIWB 2DNHA 1NKEA 1PSDA 4USJC 3DU6A 5G0RA 4F67A 3JB9k 4DSIA 1TVRA 3P49B 5A8KB 3DNCA 4OX9F 5DG7A 1CEZA 3MCSA 1S79A 3J7YI 2JVRA 2B9YA 2YX7A 3IS9B 2IBOA 2MYFA 2JC0A 3PM9A 4ES2A 1ZAWA 3DC2A 1S0OA 4B3SF 4OHZA 4HVZA 1WD6A 3QGIA 4I7FA 3MFIA 2LEAA 3IGVA 4IFYB 2KXFA 4QZVB 5L1KA 4KQZA 5KG0A 1OIAA 3RB6A 1ZPVA 2BUNA 2POKA 3MEGA 2L41A 2Y1IA 2RQCA 1RT4B 1FRKA 4DPOA 3QO9B 4QIGA 4USHA 2NQPA 2B4VA 2L9WA 1WF1A 3FRZA 4MK8A 4RW6A 2XY7A 2HFOA 4NLWA 2VC1A 4B02A 4KE5A 3M2UA 1ZBTA 3MTJA 4CNYA 5J2PB 1R89A 1KLNA 4ERDA 2WCXA 5KT3A 1T03B 3AA8A 3MMJA 5IWAF 3CTRA 1JX4A 3ZZ0A 2ZHAA 3G6XA 2CJ9A 4M1KA 4C8NA 4ES1A 2DJWA 2QEXS 3MFHA 5J2NA 1RKJA 4M5DA 2RJZA 1U2RA 4NLUA 4F4XA 1DLOA 1RISA 4FS2A 2IA6A 3W3SA 1YJWS 3MPYA 4I0WA 3C2PA 4LF8F 3DLEA 1N5SA 3CVKA 4DR7F 1K73T 2CQ2A 3OTDA 3KK1B 1W2BR 2XB2D 1IKWA 1S1UA 3DOLA 1FKOA 4LSNA 5KTQA 5LMNF 3HI9A 1VQ7S 2JLEA 2DISA 2XMWA 3VTIA 2RF2B 3M05A 4LF6F 1T94A 2DHAA 3MUVP 5M2RA 1RT5A 2C3OA 3BQ2A 1JLGA 4N56A 5D8HB 2EBGA 1RK8A 4KPYA 2ADBA 3UDLA 5GAEU 1RWUA 4U67Q 1S9EA 2N7YA 3L95X 4WE1B 3LP0A 4KGKA 5L39A 3O8WA 4N76A 2GA7A 1X9WA 2IRYA 3CDEA 3FZ2A 1VBYA 1X4GA 3G4SS 1YJTA 5HP1A 4ZK7M 4IOAQ 2E29A 4R0JA 1X4BA 4UQTA 2DTJA 3JTNA 4WXWA 2CZVC 2BM0A 4TKTA 4C0OC 1OSDA 4O3QA 4AE5A 1NJYA 2NZ4A 5F0UA 3MM5A 2J0QD 2SXLA 3H8YA 2BBEA 5KFJA 2P6TA 3CF5Q 1B0PA 4B9VA 2KFNA 4EEYA 3Q8QB 3KWMA 2ZITA 1VMBA 2KT5A 3GYNA 1UWBB 1RA7A 1FRMA 3G6YA 1BQXA 2HWTA 1S6PA 2ZOGA 4TN2A 2H5EA 3MHYA 1YG0A 4FNHA 3SXLA 3OUYA 2HRYA 2RKIB 3FZBA 4Q2LA 3VAKA 4G6VB 2E1AA 2LXFA 1X5SA 1C0UA 2VC0A 4J5OA 5U47A 3PW7A 4TU8A 4MFBA 2E5LF 2YY3A 4OX6A 1TZ0A 3IBWA 2BOPA 4FP9A 1KQKA 5KG1A 5EWEA 3ZC4A 3M9OB 3ZZTA 1QAJA 3WC2A 3MR2A 1FK9A 4YP3A 1JLFA 3R1HA 1S6UA 1XMOF 4F8RA 4LQ3A 4NCBA 4JV5F 3HM9A 1CLFA 1RT2A 1VK8A 3SCIE 2B9WA 2PA8D 4N47A 4CO0A 3L3CA 3JYTB 4W90B 3LAMA 4EO6A 1J5EF 1KSPA 3W2WA 2FJAB 2MZSA 1LW2B 4XIUA 3KHRA 1U1OA 2DCUB 4K4YA 3PW0A 2V8VA 3FJ2A 3HHLA 4NZ6A 4F3OA 4KTQA 3BZQA 3MMAB 1TFYA 2KU7A 2VBXA 1T7PA 3OR2A 3FDSA 1Q1KA 1H2TZ 4C97A 2VA2A 4B17A 1S4FA 2EVZA 4NL5A 3ZZRA 2KRBA 4HYKA 5DDQC 2ZHBA 2YX1A 2LECA 3IRXB 3TUZC 2B0GA 5KG2A 5T14A 5ADZA 1R3NA 4FF2A 2WB4A 3KLFA 4UUXA 1IKVB 1EP4A 3VAJA 4YB6A 5L1LA 1MSWD 2WONB 3M2RB 5I3QA 5GMKa 4HL9A 4HDGA 4IQXA 4DQQA 3SMZA 2QSFA 4Y2AA 3NCRA 4KBIA 1HHSA 4Y65A 4ECZA 3PNIA 1PILA 1SC6A 1BQMB 3NAHA 1VIOA 1UJ6A 3G8QA 3IR7B 4WU3A 2HNDB 1SV5A 3M8QB 4AL6A 5D3GB 5KFPA 4JI1F 3N01A 5JVHQ 2CQIA 4DSEA 4UW2A 3K5PA 1M1KT 2MSTA 4X65F 3UD4P 3CCRS 2DB1A 2OAUA 4F26A 4LMZA 2QA4G 4MYTA 4OFZA 2MY8A 2BANB 1K1SA 2FVQA 2KJVA 4WK3A 2W24A 4J9OA 1IBKF 2NLWA 5DS7A 3R5DA 1VFJA 4ECWA 3KMQA 4LIWA 1KONA 1SQEA 3HZEA 1LOUA 1GXUA 3J7YU 1U1PA 2J6UA 3QIPB 5L1IA 3EGWB 4BCAA 3BM7A 1JB0C 1GTHA 1HBMA 1SIZA 2EK6A 2R2RA 1RI7A 3GFZA 5HMXA 2F7VA 4ZDNA 4BS2A 5E3QA 3CE8A 3GFHA 3T6JA 3C6UB 3V4IA 2DR9A 3HVWA 2Z8QA 2BM1A 2LDIA 2M9KA 3JSBA 2VG7A 1UMJA 3T1AA 1SJFA 1QVFR 3OL7A 2D3UA 2OD4A 4MIWA 1L3VA 2ZC4A 4C98A 3CCES 4YEAA 4JUZA 4LF4F 1VQYA 3PIOQ 5J1PA 3PJXA 4F4WA 5F8IA 5EWFA 1SH2A 1S72S 2HFZA 4QWBA 1F5CA 1RTIB 5BYRA 4BC7A 3NGDA 3FSIA 2M8DB 4NLXA 4GKKF 1DTQB 5A8WA 1X4EA 1QAYA 1IN0A 3BR9A 1S1XA 4EGLA 1JLEA 1JLQA 2MQLA 2ZNZA 4X66F 2V8GA 2KDOA 3K5OA 2JFKA 3BO2A 3MMCB 1HPZB 3JTPA 1UA1A 2VH7A 3IA0A 1S1TA 4EU0A 1FJCA 5K8NA 2BYCA 3HJFA 2AD9A 4L6V3 3LWLA 4KIAA 1U47A 3F56A 1VQKS 4DFPA 1FRXA 1QE1A 4XPCA 2MKKA 2CJAA 3CJ0A 4OZ5A 4CQ1A 3PX4A 4NZ0A 3LALA 2YWHA 2UV8G 4ED7A 3US5A 3QZ8A 3TW0A 3BB5A 3UCZP 2J8AA 4NLDA 4R8UA 4LFAF 5CA5A 2XMUA 1NH8A 3HHLC 4HT5A 1U1MA 1Y0HA 2IC3B 4C8LA 3HX9A 4LVOP 1H2UX 4ZA1A 5FDLA 1HW9A 3OSPA 3IAS9 4F2RA 3TUIC 3PKMA 4JI0F 3PDNA 3CCQS 1JLAB 1VRTB 2FJDB 2RB7A 1REVB 1HYSA 2RRBA 3K5MA 2DO4A 2C3PA 3CPWR 4J9LA 3C6TA 1XERA 2AYBA 4WYWA 2BE2B 2YWGA 1Q8IA 4IQMA 3K58A 4MTPA 1Z1ZA 1PC4A 1MMLA 2CQ0A 1BGXT 2IRUA 5F8NA 4O44B 1FDNA 2OSQA 3DN9A 4BHQA 5DLFA 3EPGA 1RJJA 4RW7B 4C8OA 4KV8A 1FNMA 2JX2A 3P3DA 1RTJB 2XWYA 4FF4A 2WSFC 1XR6A 5HROB 1UKUA 3DLKA 1IUJA 1FRIA 2PN6A 3LQVA 3SEOA 3ULHA 3D54A 3MM8A 1TL3A 2PA3A 4Q44A 4AUKA 4LVNP 2ATLA 2G13A 1FDAA 1HNWF 1WF0A 4LSLB 2XMKA 4I6AA 2MQOA 2E9RX 1O0PA 1SH3A 2HHXA 2YKMB 3I9ZA 4I2QA 4ZKAA 2GJIA 3R27A 2EFVA 3Q22A 1O51A 1F60B 4OI2A 1JLBA 4ECYA 7FD1A 2W8KA 2Y1JA 4IFYA 4PG7A 4MK7A 3MAHA 4ZPWR 3W2VA 4JI7F 4OJHA 2AF6A 1QVGR 4JI8F 3DFEA 1KVJA 1P27B 1HHTP 3SV4A 4I6WA 1RTDA 4QYZJ 3M2VA 1NAQA 3HF5A 2KB2A 3QJJA 4QW9A 4QR2A 4BWMA 2HGMA 3X3UA 1HA1A 2AWZA 4OJGA 3RAXA 5HBMA 4DV7F 4ITSA 1HWLA 3VQSA 2VONA 1H3DA 5LL6d 3L7OA 4ZS6A 2BXJA 1D0EA 3E51A 5IT9Y 1DJ0A 4Q7AA 4RW9A 1WG4A 3UPFA 4RNNA 2KHDA 1WEXA 3H25A 3KLGA 4MIAA 3DLGB 2XMJA 4IG3B 3WBZA 2ASJA 1CG2A 5KFEA 5M2UA 4X4SA 3VWSA 3NMRA 1K0TA 4URGA 2DT9A 5KG4A 4KFBB 2KI2A 2WHOA 1R8PA 5KG3A 4CH0S 3GYXB 4RBUA 1R8CA 1LW0A 2PT0A 1IKXB 4IDKB 2ROEA 2XNRA 3QMQA 2MB0B 2E7XA 2Q6BA 3QAEA 1XR7A 4OI0A 1U7LA 1JMTA 2A1BA 3EZUA 3UR3C 5B0AA 4GC6A 1YIJS 4HKQA 1RTHB 3SCKE 3BGRA 4MMOA 1KC8T 1N36F 1U6FA 1HD1A 3FMBA 4UY8T 4Y2IA 3IFEA 1TL1B 2GMHA 4M95A 2HLTA 3AQPA 2X3GA 4WE1A 4I64A 4MJKA 4DL0C 3SQGB 4NRTA 1Y00A 1DQ8A 3I5BA 3MUMP 2OJ3A 5THWA 3MI7X 3BREA 1FJEB 3X1LB 2XC9A 2DR7A 2C42A 4O3SA 1SJ1A 5DETA 1N56A 3R1LA 1N48A 2HFNA 2V2KA 3DI6A 3DLJA 3RR7A 1VC0A 1N5YB 2FJXA 1C0TA 3RZAA 2XMMA 3MEDB 4O23A 3TVYA 1FEHA 2MJUA 2QT7A 3N0VA 3JSMA 3HXMA 3M8PB 4KRWA 5CYMA 1VOMA 1SB6A 1IKYB 2ABYA 4PXDA 1WEYA 2X1FA 2KN4A 4FBUA 3NNCA 1VHFA 3DRPB 4ZCIA 1S9GA 2XS5A 3UQSA 1SJ4P 1TL5A 5AE1A 1U6ZA 3UFCX 3J7ZT 5C5JA 4Z37A 2MZJA 4DJBA 2RUGA 1G2EA 4QR0A 1VI7A 2ZC3A 2C2DA 1URRA 3IAM9 5KFYA 1QM9A 4E8UA 3CD6S 1M5KC 5EUHA 4K50A 4B9NA 4HDHA 3R3TA 5IQ6A 3V2UC 4PPZA 3PO5A 3EUNA 3LPYA 1VQOS 4FXDA 2B4PA 1WF2A 3MR3A 4PQUA 1DTTA 2VBYA 2VASA 3FRYA 2IVMA 3M30B 2KM8B 3IN5A 1KLMA 5IQQA 2EK1A 3D0IE 2CPXA 3QWPA 2JEIA 1X8DA 3IWLA 3DXBA 4A8OA 2YNHA 1TL4A 3FVYA 2W9BB 1VGYA 2MKCA 3I4PA 4DFJA 6FD1A 4TXSA 1YVFA 1RQ0A 2APOA 3IWXA 4I4BA 2F1FA 1QSSA 2UXCF 2GGPB 2VUGA 2I5JB 4QPXA 3RBEA 4JOUA 2J76E 3PO4A 5KFAA 2FHJD 2KXNB 2NS1B 2PE8A 3BSOA 1OO0B 4IG0A 2KG1A 3RB0A 4URQU 2J6SA 2QRRA 3I9V9 3HPOA 2C3YA 1M0SA 3MZIA 1Y7PA 2LXIA 1LWFB 4OI4A 2CPFA 3O5TB 3CJKB 1NJWA 5GAEI 4K4SA 4DSKA 1VQSA 3FQKA 4UUWA 2D41A 3S8SA