4YDDB

Crystal structure of the perchlorate reductase pcrab from azospira suillum ps
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
329
structure length
329
Chain Sequence
MKAPRRQLTYVTDLNKCIGCQTCTVACKKLWTTGPGQDFMYWRNVETAPGLGYPRNWQTKGGGYKNGELQKGKIPPMIDYGIPFEFDYAGRLFEGKPGRVRPSPTPRSAPNWDEDQGAGEYPNNSFFYLPRMCNHCTKPACLEACPNEAIYKREQDGIVVIHQDKCKGAQACVQSCPYAKPYFNPLTNKANKCIGCFPRIEQGVAPACVAQCVGRAMHVGFVDDVNSSVYKLIKQYKVALPLHPEFGTEPNVFYVPPVLGPRIEMANGEPSTDPKIPLAQLEGLFGKQVRDVLAILQSEREKKMKGLASDLMDVLIGRRSTDMMISPLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Perchlorate Reductase Is Distinguished by Active Site Aromatic Gate Residues.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords DMSO reductase family type II enzyme, molybdopterin subunit
total genus 85
structure length 329
sequence length 329
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2015-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13247 Fer4_11 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4yddB00
3MM6B 2C3OA 2GMJA 1FRHA 1Y5LB 5BYRA 1BWEA 1FCAA 2VPWB 1F2GA 1H7WA 3IR6B 3MM5A 2FJEB 1BC6A 1RGVA 3LW5C 1CLFA 2C42A 1FTCA 2VPZB 1Q16B 1Y4ZB 3MMBB 4RKUC 3HKZD 1DFDA 1KQGB 2WB1D 6FD1A 1FXRA 3MM8A 3C8YA 1FEHA 3MMAA 1B0TA 5BYQA 2C3PA 2VPXB 3IR7B 2XSJA 1FRXA 3MMCA 1FRJA 2C3UA 5E7OB 5CH7B 4Y28C 1BLUA 2XSJB 4AYBD 3MMAB 1D3WA 1SIWB 1FDBA 4XDCA 1H7XA 2WSFC 3MM8B 2O01C 1SJ1A 6FDRA 1GAOA 3OR1B 1R27B 4ID8A 1C4CA 5L8RC 1AXQA 2FJAB 3MM5B 1FXDA 2FDNA 1JB0C 1BD6A 1KQFB 1F5CA 1DAXA 3OR2B 2WSCC 1A6LA 2PMZD 5CHCB 2FJDB 1PC4A 3MM9A 1JNRB 1FERA 1KEKA 7FD1A 3EXYA 2V4JA 1G3OA 1FDNA 1WTFA 1FF2A 2VPYB 4XDDA 4DHVA 3MM7A 2FD2A 2FGOA 1FD2A 1SIZA 3MM9B 1ROFA 1FRKA 7FDRA 1B0VA 1H0HB 1IQZA 1PC5A 1H98A 3OR2A 2ZVSA 1F5BA 1FDAA 2PA8D 1B0PA 1Y5NB 5FD1A 1HFEL 2VKRA 2PDAA 1FRIA 2IVFB 3OR1A 2C3YA 4L6V3 1FRMA 2C3MA 2UZAA 1K0TA 2GMHA 1BQXA 2FJBB 3MMCB 4KT0C 1GT8A 1XERA 2Y0SD 1VJWA 1FRLA 3MM7B 1FDDA 1GTHA 2V2KA 2WAQD 4OV1A 5BYSA 3PNIA 1Y5IB 1DURA 2V4JB 3MMBA 4XK8C 2WSEC 4YDDB 1C4AA 1G6BA 2Z8QA 1GTEA 4OMFG 4CI0B 3IR5B 1IR0A 3EGWB 1JNZB 3GYXB 3MM6A 3EUNA
chains in the Genus database with same CATH superfamily
1Z1ZA 2MEWA 2PFDA 3SCJE 3OQ2A 1VGYA 1DJ0A 1NHVA 1PJ7A 1RTDA 2HGLA 4WZQA 1TL7B 2D3ZA 3I4HX 3PJXA 5KFFA 2ABYA 2FJEB 2JFKA 2QA4S 3OJSA 3O2IA 4NXMJ 4YB1P 2C42A 1BC6A 4OYZA 2BW2A 3RBZA 4K4ZA 4H4KC 1KSPA 3QGGA 4X64F 3C46A 2B9EA 3F73A 1UA0A 1T3OA 3H25A 5D4LA 1VK8A 2Z30B 3I5BA 4OHZA 3BGFA 1EB0A 1YDLA 3A3PB 1NRKA 4ZVSB 1J5EF 2QLFB 5BYQA 1I94F 5LSOA 5C7PA 2J6SA 1FKPA 4Y65A 3KLHB 2OPSA 1RTHA 3M7VA 2XNQA 3J7A1 1UP1A 4XPCA 3ENAA 1ZTWA 3D7SB 3TVYA 1HBUB 3AODA 1OSDA 1RT2A 1PBAA 2LQ5A 2MKHA 3FCWA 3B6BA 3M30B 2M0GB 3N01A 1YJUA 4PG5A 5HVHA 4PYDA 4DV3F 3DI6B 5C2CA 1M5OC 3EX7B 4NE9C 2N4CA 1U0HA 3N28A 5CYJA 3H8YA 3MPDA 5L8RC 3UW1A 1JQGA 2ZE2B 1S49A 2DT9A 2W7PA 2D3UA 4Y2KA 3PR5B 1WTBA 5EWFA 4R5PB 3OXLA 4ZCKA 1GH8A 1JWWA 1R0AA 5B0CA 1S7IA 2RQ4A 3DYAA 2HFSA 2ZHAA 2FJDB 5T41A 4CH0S 3ZC4A 4IH7A 3TZZA 2GW8A 3ENQA 1SC4B 2AMCB 3MURP 3SBMA 2L3MA 4K4XA 3DGPB 1U09A 3LP2B 2XQCA 2K1RB 1IKYA 1JLEB 3W9HA 3OVBA 2K8GA 2CJ9A 2DVIA 3MAQA 5D3GA 5I42B 3F0NA 1ZYQA 4DR1J 4DSJA 4FF2A 2KHCA 2YKPA 2VG6B 4PPDA 4USVA 2V4QA 4ECXA 2MHNA 2W7AA 1M1HA 4O0NA 3J7ZT 4ECWA 2XHWA 2YPYA 3MZIA 3US5A 1CJUB 2VBWA 2RDDA 5DJBA 1FFGB 4OJGA 4NPOA 2F63A 1TL1B 1KLMB 2EWHA 2KRRA 3A8KA 3FBBA 3JS9A 4ICLA 3OR2A 3CJ0A 1BGXT 1T9XA 2XM3A 1RWOB 4KE5A 2WW8A 2QRRA 4QYRA 1TQLA 2RS2A 3M2RB 3CJRA 4JV5J 1LWEB 3GJQB 1CJVB 4USMA 1U6BA 1NB2A 4WK1A 1W7WA 3CGIA 2CZ9A 3VALA 4ECSA 1F60B 3UNGC 4I56A 2DKOB 3FJ2A 1HLWA 4RUHA 5I3UA 3BSNA 2F8MA 1RBOB 3B8HA 3I87A 3PHTA 4DUTA 4BDPA 4AXJA 1R89A 1SV5B 3EGVA 5KFZA 4BLGA 1RWMB 5BXIA 1GT8A 2MYFA 2Z2LA 5E3PA 3GWCA 1KNZA 3C14A 2XYGB 2W24A 4G1IA 1KFDA 2BBEA 1KFSA 2E7WA 3CWJA 5J1EA 3SYZA 4UTGA 4DFMA 3R7NB 2W2QP 1Q53A 1I5OB 1UFLA 2FHMA 2E44A 1VHIA 2AYMA 3KJQB 4N76A 3MI7X 2J7KA 2XI2A 4OMFG 5ETNA 4B3SJ 4LSNB 4DS4A 5DETA 2NXCA 2ZOGA 4ANDA 1IR1A 3MPUB 3V4IB 3HHLA 3IRXB 4X4NA 1JLQB 2XYPB 3UCGA 1V3ZA 2JC0A 3QAEA 5IXUA 2P9EA 3FSYA 4NLXA 5ETLA 4ZIVA 5FLXY 3J81j 2MGZA 2DNRA 2NXEA 2BE2A 1IM4A 4WCEQ 2HZVA 3W66A 1Z2LA 3LGHA 3HM9A 5K9FA 3CCQS 4J9LA 3Q22A 4ECVA 1FXLA 1Q8KA 4J5OA 4EFAC 2HHWA 3ZZYA 1O0PA 5FLXU 2ZUGA 1M1KT 3RBEA 2IM3A 3BGRB 4UF4A 4WIIA 2XSJA 3NGTA 2M8HA 1KC8T 5E7OB 2OEKA 4Y28C 1GFWB 1OSCA 2FUG9 1GMVA 1TMJA 3NG8A 5CH7B 3GYGA 4ZVGA 2MXYA 2CQPA 3GR1A 1VLOA 1H7XA 1PSDA 4DSEA 3NBPA 2BKNA 1NDKA 4P9SA 3V5RA 3Q24A 4OL8A 1GAOA 1JXEA 3W61A 1HPZB 3J7Z5 4WE1A 2GHVC 3PRDA 1D8ZA 3PX4A 2KRBA 3DDKA 3FRYA 3W2WA 4DFKA 3IRWP 1UVMA 1G1XA 2D3O1 4LMZA 4K59A 1RCXB 3AOBA 5T14A 1F5CA 5M2RA 2E7XA 1XQIA 2R7OA 2H4WB 1CC7A 1HQEB 5HK4A 5RUBA 3MXHP 3KJNB 1EJ7L 4ED1A 3DLEA 3G8QA 3SI8A 3NS6A 2E1AA 1KBRA 2LDIA 1NK4A 4DSKA 1OQ6A 5F8IA 4J9MA 3J7YU 3FNNA 1RTZA 4ZVTB 2DGSA 4ELUA 3R3TA 4CNZA 1RHJB 5D4OA 7FD1A 3BO2A 4X62J 1URNA 2AGQA 2EPIA 4OHXA 3UR0A 2ZNYA 2N4DA 2ZWPA 4I64A 4DV4F 2DEJA 3C14B 4IH6A 4OJ1A 1T02A 3PIOQ 3TRGA 1SIZA 2QN6B 3M6XA 2CQ3A 1VC5A 3DLEB 7FDRA 5IZHA 5EWEA 4ZP6A 4CLUA 2XY6A 1V6HA 5D78A 5LSRA 3VAGA 4DQQA 3SCLE 2OKQA 2YQ1A 3NOCA 3R5JB 4ID5A 4C8NA 4NCAA 4IFYA 1RYRA 4EU0A 1QVGR 1S5ZA 4EEYA 4HT5A 5CZVA 1S59A 1UEVA 5KFLA 5F8LA 1FA0A 1S6QA 2U1AA 5IFMA 4N8OA 3KKFA 2WZ1A 4C2MA 2DPJA 3DLLQ 1W2BR 2DGWA 2RIJA 2RRAA 1DTQB 2E1RA 2EW9A 1LFPA 4A8FA 2GQQA 4LSLA 1RTIB 2XTJP 3QZ7A 4PRFA 4L6V3 4GKKJ 5KG7A 1JJ2R 2B7BB 2CKWA 2QIFA 3FBCA 1KTVA 2XB2D 2RH3A 4YY3J 1T9TA 1NB7A 4JYAF 1SVDA 1S6OA 1U2FA 2JVRA 4OX8A 3J81U 1RAGB 2XLJA 2GO8A 2XMTA 1VQ4S 4H4OB 2YVSA 1KOHA 2ADBA 2PI4A 4LF7F 2EKYA 2GQCA 2VFSA 4EK2A 2QFIA 4J9SA 3C66A 2CNLB 4ILRA 4TN2A 3AB4B 4USJC 3A3NB 2LXIA 4OYMA 3WQPA 2EFPA 3IFEA 4ECZA 2UXBF 5I42A 2FLOA 2DXFA 1X4HA 3I82A 3BB5A 4JI6J 1NPPA 3M6VA 4J90A 2KT5A 4WYWA 1LV5A 4Q0BB 2O66A 4FVCA 4OZ1A 4DR5J 1WC5A 1SQGA 2DD8S 1RA6A 4FPIA 3K2YA 3OXFA 4I68A 1KKHA 3T1AA 1WF1A 2W2OP 5CYQB 2NXNA 4Z2XA 4IQMA 4OZ2A 2V2VA 4ZOSA 3S6EA 3JSMB 4ZVHA 2FHOB 2ZJQQ 4RJVA 2QSFA 1NAQA 3RG6A 4CTAA 5HAOA 4ECTA 3V4IA 2G0CA 3HHEA 2UUAF 2XMJA 3QQCD 3VHQA 3PM9A 2DHHA 3CC4S 4R5PA 3KMSA 1P1TA 3GV7B 1NK9A 2KVQE 3FQLA 3HCXA 1LQ9A 3IG1B 1S97A 2RUGA 3OSPA 3M2UB 1T95A 2YPZA 2ZC3A 3LP1B 3BPSP 5C25B 4WFNQ 4RKUC 5J1EB 4LUBA 3UDVA 3UD5A 3TW0A 2AIRB 3UD4P 2D41A 3ET6A 3NAHA 5KFNA 1TZ0A 1BE4A 1R7IA 2HKEA 3A13A 4PAAA 2J5AA 4DX5A 3K58A 5C5JA 4O23A 1MWQA 2ZC4A 3T5JA 2CYYA 4GMKA 2QYCA 2V6AA 4KO0A 4JB8B 4K4YA 3R2CJ 1TV6B 2Z2ZA 3MMAB 5CZXA 3PXGa 4UUXA 5LJ5Y 4YHHJ 4LFCF 2HS0A 4NYOA 4ZLNA 5I3UB 2AT1B 1U4BA 1NJWA 2G0JA 2PC6A 4X65F 4MKVA 5L9XA 3GILA 3UCZP 3OR1B 4HH0A 2GHWA 1WC6A 2A3JA 2FC8A 3NS7B 3JTPA 3W2VA 2I9SA 3DOMB 4AD6A 5KFOA 3QATA 3HZGA 3HFZB 1UZDA 3I0RA 2MZ1A 2GO9A 1R8BA 2LQ8A 3EM1A 4CDIA 2VJVA 3O5TB 3OPKA 4DSIA 1N5TA 1UJ4A 1YSJA 2CQCA 3PG9A 4DV3J 2V34A 2LEPA 2J7WA 2WSCC 4PWUA 3KLFA 5AXNA 1KLMA 4IOBA 4GO5X 1U1PA 1RUSA 3UI3A 4CO3A 1VRTA 3QZ8A 4FKXA 3BYRA 4MK9A 2XMVA 3FSXA 1SUQA 3BH6B 1S1UA 3SDEB 1J5OB 5A8KA 2QG9B 1NSPA 1RHQB 4P2XA 5HMZA 3M8RA 3BBFA 1T03A 1M5PC 4FDFA 2ZBPA 3A8IA 5C24A 3CCRS 4RU2A 3RR7A 1X7VA 1X4BA 2DGOA 3MAHA 3S8SA 1S9GB 3J80Y 1ZOTA 1HHTP 2K1RA 2KU7A 3KLIB 3DU6A 1ZPVA 5L1KA 2ACMA 4IRDA 2HNZA 4BHQA 1XR6A 1ROFA 4Q45A 2B7CB 1X4AA 2YX4A 4OJ3A 3DOLB 3IWNC 3MUTP 4OX9F 2ZH8A 3KHLA 4PXBA 5DG8A 2ASLA 1RAIB 2YNHB 1X9MA 5KFDA 3G86A 5KT4A 3HULA 4B3OA 4RNOA 3H5UA 2BACA 2MQPA 3T9ZA 1FRIA 2F3JA 2YWHA 1N5YB 5A8WA 1JLGA 1D9FA 3KK3B 1R0CB 2XG8A 4LF4J 2BRLA 2GGPB 1TUVA 2WONA 4NZ7A 1RT2B 4HDHA 1ZM3A 4K8RA 1PYOB 4ZLLA 1CC8A 1BQXA 1CS4A 3R5DA 4DR6J 3IN5A 4YS2A 1D1UA 4UZBA 4DL7A 1S76D 1ICEB 2DXDA 2IJNA 3D68A 1HARA 1IBLF 4CLLA 2HMIB 4UY8T 1WF2A 3FKBA 4F3OA 4DS5A 2M88A 1FDDA 5L1IA 1NK5A 2E9TA 1N5YA 3JQKA 1SCJB 4CWBA 3HXMA 1SJRA 3GB0A 4L75A 1AFIA 2JHEA 2B6AA 5LMUJ 3BEGB 4KH0B 4F0KA 4DR4J 5E3QA 3UDCA 2LQJA 5AE1A 4QR1A 1P27B 2ASJA 3TAMB 1CULB 1WSVA 1DBDA 5LJ3Y 2CXEA 2RSQA 4RNHA 1S12A 3SEOA 2VUGA 2K2PA 2GIQA 2A1BA 2HBZB 2GMLA 4WPAA 3CMAS 3R1LA 3ITHA 4ED0A 3ITHB 3KLGB 4PCQA 3BSCA 3AD8C 2KJVA 5A0YA 1SKWA 2V9WA 2NCKL 3T9NA 1WDTA 1XNRJ 1P9QC 4WWSA 4MIBA 2Z4PA 5D0GA 5JVGQ 3NLCA 4CQ1A 5DGAA 3KJVB 2XEXA 3LW5C 4NI2A 1FTCA 2Z2MA 1AA1B 3OL6A 3MAAA 4DR7F 5BR8F 1JLCA 1N32F 3UWTA 1WI6A 3V6KA 1KLNA 2HWHA 4R8UA 3SZ2A 2VPXB 2XC9A 4B9NA 2M4MA 2Q6CA 1HQUB 4N8NA 1SKRA 2UU9F 2QA1A 2QMWA 3CDBA 5KFVA 1S77D 8AT1B 4B3RF 1D3WA 2BEFA 2GS8A 2YY3A 2YWGA 3BH7B 3B82A 3BYPA 4RW9B 3MM8B 1Q82T 3QT5A 2ASYA 2O01C 3PW0A 2OPQB 1WKJA 1H38A 1VQ9S 1NDPA 2BRKA 1WKLA 1WSRA 1LNQA 1NM2A 5B0AA 4V1Ak 3SSRA 3TZWA 4QWAA 5IWAJ 1LXJA 1Q4RA 2VBZA 4O4GA 3OSNA 1JLAA 1XNQF 1SH0A 1N36J 4QOTA 1VQLS 2ZZNA 1P1LA 3OL7A 1X4EA 1L3KA 4USHA 5J2QA 1TKTA 4C9DA 3ULHA 1RAOA 4I7FA 4RBUA 5KFBA 2R2TA 4EYHB 4ILLA 1XK8A 1IKVA 1Q86T 2JEGA 2IM0A 5A0YB 1T11A 1E6YB 2Y1RI 1N33F 2YWKA 2VICA 1XMQJ 2P9GA 4NYZA 4U7UK 2KXFA 4ZPAA 3FCHA 5F9LA 2XWYA 3K89A 3M8WA 3NGUA 5ETVA 3NP5A 1FERA 1IBMF 1IXKA 2CDQA 2DRDA 4FN5A 4WZMA 3KLVA 2AGOA 1ZM9A 4DCOB 1B4SA 2R7TA 5L46A 1S0NA 2XULA 3D6MB 4HLBA 5DZ6A 1FF2A 1HBMA 1NBEB 2VPYB 3DRXA 1HI1A 2FHJD 1JK9B 2BKPA 2QO3A 2W1BA 3QGIA 1SH2A 2YNFA 1VFJA 1S10A 4C97A 5L1JA 4LSZB 3UD3P 1Q5YA 2AYBA 4CM2A 2R7UA 3BGUA 1H72C 5THWA 4OLOA 5A6PA 3TEHB 5B0EA 2RB7A 2ZH4A 4I7FB 1UVLA 4M5JA 5DGBA 1TKTB 3KUGA 4TY8B 1TR0A 5L1LA 4TVAB 5CA5A 4A8YA 5D8HB 1C0UA 4W98A 3ZTOA 3H4DA 5JVHQ 4B3OB 3JXOA 3PX6A 3KHRA 4KV8A 4USKA 1SXLA 4YFUA 3OTCA 1NEEA 1FRMA 2DBBA 3BF4A 1AYEA 3MEKA 1H2TZ 4KGKA 2BJDA 4RX6A 5DZ7A 5IT9Y 3QO9A 5AJ3J 2AJ0A 1KONA 2JOQA 3Q8UA 3DDIA 4LBIA 4OYWA 2DHXA 1N6QA 4DPTA 3ZZRA 4IUFA 3R9LA 5DDOC 3DNCA 3RB6A 4DF4A 3A3OB 3M2VB 3MMJA 1TUWA 4DX7A 4Y3CA 1RXOB 2IJRA 1VJWA 1OJ4A 4LT6A 3BQ1A 1S9GA 1RWVB 1VQKS 2APOA 3TOQA 3GFZA 3I0SB 3K5NA 2X1BA 2A0FB 2KDOA 3AB2B 4CO2A 4YDDB 3HHNB 4P2MA 2HIQA 1HI0P 3X1LB 4L72B 1WC4A 2EVZA 4DR5F 2OTJS 2UUBF 1FKAF 1M0SA 3Q2TC 3OTOJ 2K3KA 2XLIA 4NCGA 3THVA 4U6PA 1RISA 4N47A 2CJKA 2O67A 1JJCB 4JI8F 2KZMA 2CZVC 1WHVA 5IQ6A 4NOHA 3WX4A 4ECYA 3D0GE 1GNKA 3DHXA 4OZ5A 3U02A 1Q7LB 1RT4B 2C2DA 1BQMB 3Q8VA 1C1BA 3MM6B 5BYRA 2VPWB 2JVOA 1VQMS 2PI5A 4OLPA 4O3PA 3TAMA 2VQFJ 4NXNJ 2RQCA 2B4UA 3R5CA 3PJWA 1NZ8A 3GFHA 4KKOB 2KB2A 3CVKA 4PR6A 1Y0HA 1HR0J 2R4FA 2ADCA 4C8ZA 1L3VA 1U02A 1TVRB 3AFGA 4HACB 2C3PA 3EZUA 2WOMB 1RT6B 2MLYA 2ZWOA 3RAXA 4QWDA 1RQ0A 4A8MP 1YTYA 2AJFE 4V19X 3SQOP 1RJJA 3G87A 2V0NA 4JP8A 4KFBB 1WG4A 4LREA 4DOZA 3D67A 3M1VA 3NGKA 4LRAA 1S48A 1WC0A 2CJYB 3ET6B 4M5LA 4A4JA 5G0RA 3TWZA 5AT1B 1JLGB 2CA9A 3LP1A 5C25A 1S1TA 3TQEA 1RK8A 3EZ5A 2AZ1A 2NR0A 3CUNA 4TQSA 2BJ1A 2YNHA 2MKCA 1FXDA 2CUYA 1WC3A 2FDNA 1JB0C 3F56A 3R5GA 3CJ4A 4DU8A 5SZTA 1K44A 2ZH1A 4M5DB 2QYGA 3DOLA 2EG2A 5EN1A 4F04B 4UZCA 2FQQB 1O51A 4IDKA 4P2FA 4L3NA 4C0OC 4NLUA 4ZCIA 2B4VA 4GRSA 3MDFA 2YX1A 1PC4A 1T3NA 2YNGB 1L3TA 3CULA 4ES3A 4RUCA 2POKA 5EDWA 1S72S 3HI9A 1O5JA 3KLIA 3BR8A 3RAMA 4WFBQ 1F3FA 2J0WA 3EDQB 1CJKB 5F8NA 2V4JA 3O1LA 1FDNA 3PCOB 3OJUA 2CNOB 1FFSB 5HN0A 1ACMB 3DRPB 5D0RA 3QRPA 5HMYA 3G6ES 3AJDA 2RF2B 3ZTQA 1T03B 3DC2A 4URSA 3R6GB 1MG7A 2DNOA 1S1UB 1WG1A 4R0EA 3CE8A 1FD2A 3OBIA 2MLZA 3FEZA 4KYZA 1YJRA 5KFAA 3U1MA 2XCPA 3KK1B 2OD4A 1VBXA 1B0VA 2FLPA 3OD2A 4N77A 3CSKA 3RYLA 2DHSA 1RU2A 2OGUA 3BKUA 3QGPA 2DR7A 3BREA 3EMTA 3T3FA 4OI0A 3G82B 3CJ5A 2FIUA 1U1LA 1Q7YT 5D0HA 3OW2R 1NPKA 4LSLB 1V3RA 2Q1LA 5J1NA 1J2VA 3M8PA 2HQ3A 2FB0A 1YG0A 2CPFA 1NUEA 2IDLA 2PDAA 3OR1A 1FJEB 3KOAA 2C3YA 1ITPA 2Z57B 1Q78A 3VV2B 3MR2A 3CCUS 1AW0A 4I4BA 4UOHA 2AGPA 4DL0C 4IFYB 2D9OA 2B56A 3M32A 4KIAA 3OUYB 1VQ7S 1B7FA 3PIPQ 3MEGA 1SQEA 4J9UE 2HVHA 1QTNB 1NHUA 2ILYA 4RW6B 2YKAA 3VGTA 3KK2B 3NNCA 1NSQA 3MMCB 4PG4A 3ZO7A 4C0HA 5CXTA 2CPHA 3P6YC 3AQOA 4LFBF 4QW9A 2R7QA 3NKYA 4WKRA 5BYSA 3AXKA 5HROB 1Y5IB 4M63A 3TQ1A 4CLZA 5IC6B 3QT6A 3EPIA 2OTLS 3CJ3A 4OX9J 3TJ8A 4C3LA 3D2WA 3IG1A 2ZKUA 1EETB 5KFKA 1I51B 3O8WA 5E3AA 4RZRA 2K3IA 3HHDA 1HMVA 2V2ZA 1YLXA 1FNXH 3W9JA 2DR9A 3HSDA 1QAIA 4C8OA 1HHSA 2UXBJ 3RRGA 2IBKA 2JEJA 2PD1A 4KY3A 1WWHA 3PEHA 4C7QA 1U48A 2IRXA 3R5AA 2CPYA 4Q7AA 4RL1A 3R5BA 2C2NA 1Z2ZA 3W2WB 2Y0BB 4CIOA 2RMLA 2RS8A 3DN9A 3EWGA 2W7OA 4FP9A 1IR2A 2KG0A 4ZJQA 5JMNA 1XEZA 4NRUA 5DM6Q 2HEKA 3KYLA 3WC2A 1HPZA 3J7AN 3NNAA 4CZCA 3T5KA 4CCHA 3MUMP 2R2SA 1DZ5A 3VCDA 1KR4A 2WB1D 3RJMB 4PQAA 3POTB 4C11A 3K5MA 4ECRA 3NMRA 4YOEA 3R7SB 1FJ7A 4AQYJ 2J0XA 3QLHB 2HIYA 4CLWA 3M9NB 4MK8A 3CEDA 2H54B 4FNHA 1FX4A 2D69A 4OFZA 5SUHA 3PW4A 2HS3A 1S57A 2XMKA 3Q89A 2OH2A 2J0QD 1RWPB 3VAMA 1RADB 2MLXA 3BN4A 5F0WA 1OQ3A 5LT5A 2ZBRA 1AFJA 3HFKA 3ISNC 5K5MA 4EGLA 3DM2A 3TJ9A 1Q95G 3DRRB 2R9LA 3MR3A 4U8YA 3DOKA 2B9XA 1JLQA 1KQFB 2EBGA 2BJ7A 3H0PA 1DQ8A 4I69A 2HRYA 3HHLB 4O3QA 1HD0A 3IBWA 3OL9A 1LFWA 2WBMA 2PMZD 2UUCJ 1X31C 4NZ6A 1OIAA 4FF1A 1NK6A 4ED2A 2ZKTA 3UQSA 4K4TA 2F4FA 1EQ0A 2M5YA 3ILOA 3IMQJ 4DUZJ 1N36F 1JNRB 2CPJA 2YQ3A 2I8EA 2M9KA 4G1PA 5B0GA 3EVOA 3UCUP 3CD7A 4HHHA 4KBIA 3R2DJ 2VBXA 4RR5A 3Q8SB 1SJ3P 1F9EB 4JI7J 1RHUB 1TK5A 4DLGA 5MAOA 4C4WA 2FGOA 2GAHC 3LPEA 1T05A 4NZ0A 5I3QA 5FIIA 4WP3A 2OLWA 4QIFA 5D4NA 5KFGA 4AQYF 2R8KA 3KUEA 1UKUA 3P96A 1LOUA 1FKOB 3GE9A 3ICLA 3OVAA 3RRHA 2V8HA 3V6DA 4I2QB 2OFGX 3M32B 4QWCA 1NLKL 5BR8J 2PA8D 1D8YA 3OLAA 1MROB 5GADI 3CJTA 1HWJA 2RUSA 1HWLA 3AA8A 3CJ2A 2MZSA 3LGMA 4J9QA 2A10A 2OPRB 4DL4A 4ES2A 3D3CJ 1PJ5A 1LWEA 3CNQP 3FMWA 4WE1B 3AQPA 5GMEA 4CT9A 3HLUA 2HS4A 4JI1F 4JOUA 1XR5A 5CYMA 2BABA 4I6AA 4CNYA 2JL9A 3DLBA 4DG1B 1VDHA 3GONA 2EFQA 1FVSA 1MN9A 5GADU 2HAFA 4RO0A 4J9OA 1QLNA 2NUUG 2ZDPA 2FJBB 2I5JA 4OIXA 2QLBB 4PXDA 2ZBCA 1TK8A 4OHWA 2J7UA 2VG6A 3AA9A 3MHYA 3MR6A 3TEGA 3DLGA 2VFRA 3HHLC 3PKMA 1RT5B 3PYDA 4OV1A 4F4AA 4F2RA 1XMBA 1NNDA 2IVMA 2D74B 4P2SA 1JLEA 3G6VA 2MGZB 4ZP8A 2XGQA 3LP0A 4ED4A 2EEYA 1F3VA 2ZNZA 2E1MC 1UPMB 4HL9A 1WHYA 3GQCA 4TNOA 4AL5A 1GXUA 3C6UB 4RUAA 1NZAA 2L9WA 3DYAB 4B08A 4P75A 3CF5Q 4F3QA 2QA2A 4QPXA 1AZSA 3OL8A 1B3TA 1HD1A 4OX7A 4FXDA 3MUVP 4DR2F 3NS5A 2W9AA 4A8OA 2B9YA 4XPEA 4MIAA 1NK8A 4KSEB 2DIVA 4EBEA 1NKEA 2VPZB 1U0HB 2E29A 2ZFHA 5HP1B 2EG1A 2KT3A 2QSWA 2Z58B 3HKZD 4B3MJ 2XYHB 3D3BJ 2KH9A 2FHJA 4RWWA 4J9NA 5LMNJ 2E1PA 4JI5J 4JI1J 3C8YA 5DO2A 4CYUB 2G1HA 2DH7A 2XNRA 4Y2IA 2BJ3A 4KFBA 4LF6J 1CPZA 1UFWA 1TL4A 1WOSA 2W4CA 1HWIA 4TQRA 2RQKA 3EXCX 2CVEA 2WVCA 1BLUA 1FKPB 1SV5A 3CIZA 1T8EA 3PJ9A 4LRFA 1NJYA 2Q66A 2FVPA 3QMQA 4BC7A 4XDCA 4DV2J 2BDPA 4DWIA 3TNVA 2FVRA 4K5SA 4PZVA 1NK7A 3FVYA 4LJMA 3BDPA 4KHPJ 4F4XA 1GX6A 4FXWA 3UVJA 1RP5A 1RB0A 4ITSA 4O3NA 4YR0A 2IVYA 2MTLA 3W8PA 5GAGU 1AXQA 1IBCB 5KT3A 2DH9A 1TL7A 3M2RA 2L41A 3H40A 2AD9A 3D66A 3IGNA 3TUZC 1M5KC 3CJSA 3EVMA 1RAJA 2ZJRQ 3PO4A 4Z37A 1HI8A 5K20B 1YWXA 2CQIA 3K7RA 1OY8A 2B4OA 5H9FK 1X5OA 2OEJA 1QSLA 4FYYB 3MM9A 2QEXS 1PAUB 2BJEA 4DL5A 1UETA 3VAIA 2G1DA 2C2MB 2XBPA 5KFYA 3IBCB 4ZCLA 5CCMA 5F8MA 3BSOA 4K4SA 2K06A 2XS2A 3TYTA 1M5SA 2BW7A 2QA4G 2HHVA 5J2PB 4B3MF 3IP0A 4PG8A 1PAEX 1XNRF 1IKYB 2BKOA 4YHHF 1W26A 3C15A 1IJFB 2B9WA 2H5JB 3EJMA 1HNVA 2IIHA 4IQXA 2MZRA 2JSXA 2VQFF 2FHKA 4NLVA 3OVSA 4OI6A 5ETQA 3D0HE 1KHVA 3WIUA 2IA0A 3TUJC 2IM1A 4TYBA 3QO9B 3M8QB 4OYOA 2M8DB 1SH3A 3T1YJ 3NCRA 4ANCA 4A8SA 1MMLA 2MKSA 1QTMA 5B0BA 3CB4A 3OXGA 4X4VA 2VOPA 1X9SA 1ZAVA 5K8NA 2L9NA 5E0OA 1UWBA 3FZBA 1C0UB 1U2RA 3I5CA 3TJAA 4QW8A 3HT3A 4GVBB 3LQVA 4HVZA 2X1FA 2CJAA 3CJKB 2FC9A 3D54A 5G0RB 3S1TA 5ITHA 1UVIA 3GIKA 5JJBA 2HHQA 4DN9A 4OHVA 2L48A 2QC3A 4UOFA 3WZ0A 2R7RA 1HBUA 2MQNA 2PEBA 1RTJB 3PEJA 1SC6A 1UL3A 4ECUA 2OPSB 2XMWA 1ZZFA 1RT6A 2BX6A 2VFUA 5E3RA 4CP5A 5J2NA 2R2RA 3K17A 4DBQA 2M3DA 2HQDA 4WFXA 3MM7B 2ZHBA 4IG0A 1OMSA 1HBMB 2LDYA 2LQ9A 4M1KA 1GXTA 3PHEA 4WP8A 1VR6A 5AE2A 2V8VA 5HSPA 4B9MA 4Q44A 2IA6A 1QY7A 1A7GE 1FI4A 2HNYB 4UOCA 3ELHA 2VV5A 3HVWA 3UR3C 2XSFA 4A46A 1K9MT 4LVOP 4OZ0A 4ZN3A 1HNIA 2RILA 1GX5A 2ZOMA 4LFBJ 2W4PA 1TFYA 5D0EA 1NJZA 2PA3A 4QQBA 3CCVS 2V8PA 5K8MA 1ZM4A 2WTFA 2YH1A 4NCGB 1D09B 5EGYA 2H65B 4JV1A 3MR5A 3GIRA 2MJUA 1RKIA 1EP4A 2OD6A 4TXSA 2BVZA 1TK0A 4Z7CA 4IKAA 4KAIA 1UA1A 1OWXA 2DK2A 3JSMA 1PILA 4RPFA 1M5VC 4LIRA 1RAFB 3K57A 6AT1B 1PG5B 3MM8A 4X4SA 2YNIB 2AJ1A 3W5ZA 3HHLD 3QNWB 3Q0AA 3GSIA 1QM9A 2IBOA 2BYCA 2L9DA 3I4PA 4G1QA 4MH8A 2B0GA 4G1QB 4JI2J 2W9BA 2W8LA 1K8AT 4YN3B 1FDBA 5L39A 4H4KA 2YNIA 3ZZZA 1JLCB 1KP6A 4WFZA 4IRKA 2VODA 2NSBA 4X65J 2HLUA 2WW4A 4UT4A 4KV8B 2J9CA 3JQJA 2J0SD 5IS2A 1C4CA 4WF9Q 1SI9A 1DRZA 2K7JA 4UQTA 4DEZA 2Y1IA 3TAQA 1V5VA 5J2MA 1RLDA 4TY8A 2GAGC 2JC1A 2W2PP 3B54A 3M6WA 2V4RA 2VONA 4TY9A 1I94J 3G96A 4XIUA 3HX9A 3HK2A 2BA9A 1AT1B 5HATA 3KLEB 2XLKA 1HNIB 4B3RJ 2VJUA 2RHQB 5HQMA 2IAJA 4NEYA 3H20A 2KFZA 1VI7A 4RW7A 2EKNA 4MIWA 1X5PA 1KDNA 3ZZUA 2PMWA 5C42A 2WK4A 5IWAF 2Y1JA 1DQAA 2GJ2A 2GC8A 3FEYB 4KPCA 2YWWA 3HMJG 2CWXA 3C3LA 1J27A 5AXMA 3R7BB 5HI7A 4LQ9A 2AU0A 3CMQA 2E66A 3MM7A 3IO1A 5AXKA 4ED3A 2FVCA 2FLNA 1VYAA 1CVJA 3B4DA 3G8SA 4ED8A 4ZLPA 4NLQA 2DISA 1GXLA 2ROEA 5DDQC 2FJVA 1UVJA 4URGA 2YKNA 1CS4B 4DXLA 1NCLA 1PC5A 5KFMA 1P9YA 4B9SA 3QJLA 1F9FA 1FJCA 4B9UA 1F1BB 2PMHA 4JI6F 4U8VA 4KTQA 2F8HA 1UAWA 1B0PA 3MWBA 3P4UB 3WX8A 4EWTA 4EO6A 2HVDA 4N41A 1EQMA 1T9UA 4DUYF 3T1HJ 1OY9A 4C98A 4DX8H 5E3CA 2IY5B 3D28A 4PPZA 3VR1A 5HQ8A 4O4GB 1GMWA 2VKRA 4XAKA 4JI5F 4I2PB 1K1QA 2X51A 1PIEA 1KN6A 3DGVA 1U1KA 3M6UA 1PYTA 4QPTA 3UDLA 4KGXB 3RB3A 2DEIA 3QT7A 5E41A 4AXIA 1VRUB 3G4SS 4GKKF 2CZ4A 3IBFB 2HG4A 1Z4UA 2HNZB 2LFVA 4LVNP 3T19A 2BJ8A 3DCAA 2LCWA 1WNEA 4M5GA 1U8SA 3D4JA 3GJSB 2MHEA 5J2PA 3PFOA 1S79A 1N5SA 5I3PA 3QFHA 4HTIA 1ZPWX 2W01A 4CLPA 5C24B 3GV8B 2JEFA 4AL6A 4U7UD 3EDRB 4O0IA 3KUHA 1R8PA 1G6BA 3A1YG 2E1CA 4FF3A 5DG9A 1FWKA 1WUUA 2DCUB 2PO4A 4OI2A 2MZJA 4CI0B 3EVWA 2V8DA 3GYXB 1IBKJ 2GHPA 2GX8A 1VRTB 5KFCA 1VRQC 4WIQA 1HBOB 1YRXA 2J9DE 3HSJA 3PTWA 2KYXA 3I55S 2ZDOA 3W5YA 4QCLA 2C3OA 2PN6A 3QFWA 1VBYA 1F2GA 1K1SA 4CH1A 1CULA 1Q0NA 2GVDB 3MM5A 3JAMY 2B43A 3ILLA 1DLOB 1RGVA 1H73A 3W2VB 1K0VA 2HVIA 3M05A 5JXSA 3MMBB 4U95A 4BWJA 3ZTSA 1QDUB 4IR9A 4C8KA 2M52A 2A2DA 1HBNA 3D6HB 3ETOA 3UPFA 1X5TA 3QPIA 3C19A 4DV1J 2FY1A 1FFWB 2HLTA 4F4KA 4DPOA 2QGFB 5KFSA 2HAIA 3FUYA 2MQOA 2VU5A 2DRBA 2QTWA 2EC0A 2H9ZA 1SIWB 3KXDA 5IQQA 4M5KA 4E98A 2L08A 1NJXA 1ZAWA 4X4OA 4RW4B 4OQJA 5KG1A 2WONB 4K0KF 4X4UA 1IN0A 3KK3A 4DV6F 1ULRA 1WDDA 1F2HA 4ZVFA 5F3TA 4ZA1A 4FYXB 1P6TA 1ELOA 3CIMA 1IUJA 4J37A 2EC2A 5K14B 2DJWA 2FVSA 1LKZA 2I1RA 2F40A 3EZOA 1FTRA 2EFOA 3I31A 5IT4A 1U6ZA 2BUNA 3PYEA 3GR0A 3LGNA 3TR5A 4F36A 1QSSA 3M8QA 3BV8A 2DY1A 3FGVA 3C6UA 3SMZA 2BQ3A 2GNKA 4LFCJ 1RWKB 5LXYA 1VQ5S 3K8VA 3TA1A 3W64A 5D4PA 1FK9A 4NLWA 2UVUA 2UUCF 3C15B 3EYZA 1VBKA 1TL3B 2Q43A 2LU2A 1JXLA 3SCIE 3W65A 2NZCA 4DQPA 3N4WA 2DNLA 3DHWC 4W92B 4CH7A 1QE1B 5B09A 1U1RA 4DHVA 2KI2A 4G6VB 3T41A 4WTOB 2CADA 5T7LB 2H48B 3I32A 3LPYA 3H5XA 2LVWA 3HD1A 1SUQB 4KB7A 3MM9B 2I5JB 3DLKA 3RRKA 4RUBA 2GJIA 5DM7Q 3NEKA 4FYVB 4V19J 2BV3A 9ATCB 1IQZA 1TELA 4X4QA 3PX0A 5HJXA 1TKXB 3KLFB 1VHFA 4ELTA 1S99A 2CQBA 1MWZA 2GQ2A 3MTJA 3LO3A 4LF2A 5L9NA 5HLFB 1YKWA 4JI8J 4Q8EA 5FD1A 1W2IA 1YRUA 3ISZA 1N88A 3BN7A 1DTQA 5LSLA 2KXNB 3CTRA 4BS2A 3TARA 1NH7A 1NSAA 4AFFA 1SL1A 1IVZA 2PIIA 2AQ4A 2RD5C 4ILMA 2CFXA 3GG1A 5HBMA 1FWLA 3D6FB 2R3VA 4WKYA 4F0MA 4RW8A 3RBXA 2DR8A 2AYEA 8ATCB 4EO8A 2V68A 4F7VA 1N5VA 1OPIA 4ZPBA 1FKOA 3VTIA 2GV1A 2E5HA 5D77A 3V6JA 2DGTA 2BZ2A 1JXVA 2HZAA 3MOZA 3MOJB 4X4PA 2RKIA 2NLWA 3I96A 2W2MP 3N5BA 1OO0B 4CYUA 4F25A 2AEJA 3QIDA 4L73A 5AJ3F 1LW0A 2B4PA 3BBBA 3E8OA 3Q8RB 1Q79A 2HGMA 2VB6A 1RU1A 3KFWX 1PYSB 5HP1A 1VQ8S 2WSEC 3B4MA 1IJEB 1RT7A 1LWCA 1R31A 2N3LA 3A8EA 4E8UA 2KHDA 4NEZA 5DDPC 2ERRA 4PUOA 4HR2A 2E9RX 4NX9A 1S1VA 1JNZB 4EUVA 2UVRA 4JYAJ 4PXCA 2NREA 2HVEA 4KR0B 4F4YA 1XJWB 5DS7A 2DB1A 4CTAB 1RT3A 1KRPA 1S1WB 3N6NA 2MQ8A 2QFJA 1FRHA 4OYBA 1Y11A 1S9FA 4M5MA 3DOKB 4QIWD 3NGSA 1VC0A 2UXDJ 2GJFA 5E33A 3FQKA 4O44B 4Q0BA 3GFYA 4TYAA 2QL5B 4KRWA 3RZAA 1LXNA 3QSYB 3RR8A 4G65A 2JJ4D 1A0OB 1RT5A 2UP1A 2J76E 4LRDA 3U1NA 3ZTRA 4K4WA 3NBPB 6FD1A 2DNNA 3BZQA 5L38A 3CCSS 2MPUA 1LWFB 2KG1A 2DITA 1EHWA 1V5IB 2XHCA 2YTCA 4WBFA 3U27A 4H4OA 4X84A 1X4GA 5DQIA 4DPXA 3E3XA 4K4VA 4FKYA 4ALZA 2UVWA 2KXHA 1CQMA 2ZJPQ 3IM8A 2WSFC 4C8MA 2R7XA 5M2PA 2HNDA 4MFBA 4FPRA 3IAM9 4KHPF 2CVIA 1YJ7A 4HHJA 1RTIA 1JLBA 2M7SA 1NJIT 5K8OA 1C2PA 1R27B 1Q8IA 3VZIA 4DV2F 3X3UA 1U8WA 2H3EB 3HHKA 3IM9A 5GVQA 3G8TA 4JI0J 2OPRA 1C0TB 2FJAB 5CQGA 5H9FJ 1S6QB 3H90A 2ZH2A 3DU5A 2YKOA 4AE5A 1QAYA 3CC2S 4CLFA 4LF1A 1F9HA 1Q1KA 3HFVA 1EAYC 3MF5A 4U7CA 4I2QA 3ETMA 5GAEI 4ID5B 3PW2A 2MMYA 4B9VA 1XBWA 5KT7A 3ENWA 4OI4A 3TX0A 3BO4A 2OPPB 2ZBQA 3OV7A 4B9TA 1IKWA 3TZYA 3SXLA 2VFVA 2FYXA 3W9IA 2XO6A 1HMVB 2FVQA 4IOAQ 2AYGA 1T05B 1RT7B 4NXMF 1U1MA 3VF0B 4P6QA 2N82B 1ZETA 3DRSB 3KG4A 1ZS6A 3QT8A 1ZTTA 1ZBTA 2Y1LB 3AD9C 4ZDNA 4HI2A 3TP2A 4X4RA 2DNZA 4Y6IA 5KFHA 2HRUA 4P72A 2U2FA 4QZVB 1BUXA 4OYPA 1RYSA 2UXDF 3OHAA 1FRKA 2OPPA 4GVLA 3R8YA 1VOMA 1TKDA 1B70B 4ED7A 3U7JA 2P8IA 5HVFA 4JI3J 2VIHA 2DRAA 3OUYA 2H4YB 1H2UX 2AP6A 2NYIA 2AJ4A 4TKTA 2Z2YB 1C0TA 1UVKA 3TUPA 3DM2B 2HHUA 3JSRA 4P73A 1RLCL 1SC3B 4OJHA 5KFRA 4R0JA 4M5HA 4J9RA 4USWA 2B8PA 1O6XA 2LLZA 4DPUA 1HR0F 2CG4A 2HNDB 2QL7B 4MFBB 2NQPA 1K0TA 3AY0A 1TKXA 4ZHRB 4PWDA 1TL1A 2V8GA 4NLTA 5KFIA 3AD7C 3BGRA 4CO4A 1YI2S 4L3KA 1HA1A 4GKJF 5EWGA 3POTA 2MDAA 1RWWB 2ZM6F 4OZLA 2OJ3A 5A6WA 2NPFA 3TVZA 1C1CB 1E6VB 3FFIB 2V4JB 2UUWA 1EARA 3D1OA 5ADZA 2PFFB 1HL6A 1HWKA 2HBYB 5LXRA 4FXVA 2LEBA 3PV8A 4PQUA 2OSQA 3DGPA 3VVUA 3ZFVA 2KM8C 3IR5B 4W4MA 5HANA 3JSYA 4FF4A 1IR0A 4KPYA 2JZ5A 2CQHA 2K7KA 5E5NA 1RT3B 2ZM6J 1NDCA 2KT2A 3CD6S 1S9EA 3M8YA 2X1GA 5DLFA 2OMOA 1WI8A 4Y2MA 5IC4B 1UTAA 3C6TA 4LR8A 2XGPA 1XTZA 4FS1A 4A8KA 1L3SA 4QYZK 1WKKA 3CCZA 3AJ1A 4PUOB 3NGRA 2AW0A 2ZE2A 2ASDA 4PABA 3K5OA 1CLFA 1VQYA 4ZVOB 4F2SA 3ILIA 5HVGA 4NLGA 2PE8A 3DLHA 1U47A 1L5UA 2XI3A 1DFDA 2C2EA 1RI7A 1VLYA 4L76A 2BE9B 4QJVA 3Q8PB 3M1VB 3HD2A 1BMQB 2VH7A 2V63A 3OTEA 2GIRA 1DARA 4J9VA 2JFDA 3FSIA 1VQNS 2WVDA 4RW6A 3KK2A 3A4TA 2WOMA 1YRTA 4CRJA 3CPWR 2BMBA 3MEGB 3QAUA 1RT1A 3MEEB 2KL8A 2LXFA 1TVRA 2JRSA 4ZPVR 4Q43A 4DQSA 3L4BC 1Q81T 1FEEA 2OFHX 3IXQA 3K8WA 1S0VA 3P5BP 2C28A 2E5LF 3DRYA 4DR3J 3BKFA 1T9YA 5F0UA 1T7PA 4DX6A 4DV4J 4ER8A 4I0WA 2R7VA 1Y3JA 2BE7D 4ZLJA 1N48A 3PO5A 1KD1T 5HLFA 1FX2A 3VAJA 2HHPA 4X62F 2VD3A 3G82A 3JB9k 1RT4A 2VG5B 3HKWA 1U26A 2QLJB 3UDEA 1N4LA 2H5IB 1QD1A 1HBOA 1A6LA 3DXSX 4NASA 4TLQA 3G71S 4WYLA 1IBMJ 4YB6A 2HHSA 1I6JA 2HWTA 1TUGB 3DLKB 4FYWB 4WFAQ 1GK8A 5IV3A 2G0IA 2PEHA 3MFIA 4DV5F 2N7YA 1BXNA 5DQHA 2VBYA 1J5EJ 5F8HA 2R8IA 1U0SA 3O3LA 2M2BA 2VC0A 2MY8A 3LUYA 3I0SA 1SL2A 3IAS9 3JTNA 4K0KJ 2CJXB 1HNZJ 1CJKA 3HJVA 2DCLA 2HQCA 4QU6A 3CCTA 2EK6A 1TL3A 4ZVQB 3GMGA 2XWXA 3UN2A 1FK9B 3N6MA 4ZVUB 4A48A 1D0EA 5KOXA 2YNGA 3QWUA 2C2KB 5CD4H 1A9NB 1NDLA 3VVTA 4DU7A 2R8JA 2W4DA 1X9WA 2HFOA 1QAXA 5D6GA 2LMIA 1NKBA 4WU2A 1R0AB 4M5DA 1RHKB 4ZVRB 1N34F 3IA0A 4CT8A 2IFXA 1IBKF 4C6AA 3EGNA 1HFEL 4P7TA 1APSA 2CQ1A 2E5IA 2HWIA 5K14A 4RU9A 2H1YA 5ETTA 3GYNA 4C0BA 2IVFB 4K50A 2X7IA 3DI6A 1NXIA 3CJQA 3ISND 3L95X 1X8DA 3DXBA 3OT9A 3M30A 3S01A 2WRMA 3CO9A 4RW4A 2UZAA 2RHSB 2GMHA 2YQ0A 3GIIA 5M2UA 2YKNB 1RTHB 1ZA2B 4LBHA 3W63A 2NZ4A 1RABB 2DH8A 1ZH5A 1XERA 2Y0SD 3AOCA 1JLFA 4LIWA 3THTA 4HACA 4Q5VA 2VDIA 1U7LA 4F50A 2XY5A 3PW7A 3AH6A 1D9DA 2J6TA 2V2KA 3DFEA 4PXEA 3SDEA 2YKMB 1WG5A 2DTJA 4DV0J 2HVZA 4DV7J 4HKQA 3MMBA 8RUCA 4RLEA 4KKOA 4EMDA 5CD4A 4PWWA 3PW5A 3EGZA 5IT0A 1TL5A 3IWLA 5KFWA 4YQWA 2UXCF 1MW7A 1MN7A 1XR7A 2CDRB 2KVIA 1F5AA 1S1XA 1YGYA 2Q6BA 4LFAJ 3W62A 3JAMU 2XZTB 3MM6A 4DV7F 1VIOA 4QYZJ 1YBAA 2B51A 2DGXA 2UUTA 3MCOA 3W8GA 2F4VJ 2CRLA 4ENOA 2KO1A 4OI3A 4J91A 4PG7A 3E2EA 3K0JA 4CLKA 2RRBA 1Y5LB 4BWMA 4BCAA 4QR0A 4RNNA 1K73T 5J2MB 4P74A 1H7WA 3IS9A 3IR6B 5AE3A 1H3DA 3RW7A 3T5HA 3Q2SC 1DY3A 5EUHA 4ZK7M 2P5VA 3CD0A 4DQIA 3UFCX 4ELVA 3C16B 5KOWA 4DSLA 4X66F 3FEXB 2WVFA 4RBTA 4IR1A 2DNKA 1PJ6A 5B0FA 1UEUA 3DMJA 1FNOA 3WBZA 1H2VZ 3CCES 1KQKA 4XO0A 5IM0B 3SV3A 1VBZA 2XS7A 2R7SA 5H1SV 4CO5A 4OHYA 3QWPA 4JV5F 3IR7B 3RTVA 2ZBIA 3H42A 5CCLA 2BANA 2XMAA 4RBVA 3F44A 4LRCA 1YK9A 4G3IA 2IPOB 3W3SA 1VRUA 2OELA 3ZZPA 1N6QB 3MGJA 1U24A 3QYYA 1R0BG 5IM0A 4DPWA 3G6XA 3A12A 5K8PA 1NU4A 3AHPA 4IYQA 3Q8QB 2DNYA 4MT1A 4I2PA 1EKSA 4HTJA 4HYKA 2RAQA 3C16A 1F6TA 1Q5VA 2MQLA 4QIEA 1UCNA 3MEDA 2AWZA 3T5LA 4H54A 4AL7A 2HSEB 4IG3B 2I6WA 4DR1F 4N5SA 1WEZA 1MMDA 2HBQB 2ZVIA 3HVTB 1YIJS 3FZ2A 4F8RA 4LF6F 2HYIB 3NL0A 3NRBA 1KHWA 1AROP 4HHUA 2LU1A 3BO3A 5LMNF 3KNGA 2VG7B 3GU0A 4M5NA 1HW9A 4ZPDA 4DZ6A 4DV5J 2DGVA 2YNFB 4ETZA 2R2UA 3C2PA 2IYIA 1WOOA 4KH1B 1JKHA 3HP6A 3W1YC 3EE3A 3V2UC 5ETSA 2B6AB 2VKZG 4DR2J 4NMLA 4WK3A 4FBTA 1RE1B 2HFZA 3NWGA 2YKMA 1HWUA 3RGIA 4C3MA 2P9CA 1G4CA 1REVB 3CDUA 4KHRA 2FD2A 1JLFB 1REGX 3JTOA 1RSCA 3KDOA 2HMIA 3BPDA 5A2QU 4IO1A 3J7YI 2IAJB 2ATCB 2DGQA 5KFEA 4DV6J 4CM0A 3OLBA 1ZZNA 1WHXA 2EFGA 5DLGA 1MU2A 4MTPA 3BDEA 4HI1A 4WU3A 4NLPA 2O3DA 4FYDA 4NL5A 2HFUA 1NPRA 1XWLA 1Y5NB 2WB4A 1EX8A 2QV6A 3PYGA 3J80U 5A8WB 4GVBA 1EIYB 5HQLA 1VIXA 2ZHOA 3QIPB 2FJWA 1UWBB 1ZAXA 2LQBA 3KG1A 4AUKA 1JLAB 4A8QA 2GCFA 2ZD1A 4NLOA 3VQSA 3TZXA 1UVNA 2ZZMA 4DMZA 3QSIA 1D9AA 3GCWP 3UN3A 4EBDA 4A8XA 3K59A 1WACA 2V67A 1FJGJ 4YEAA 1ZM2A 3L09A 4Y2AA 3MD1A 4ZS6A 4F26A 2W9BB 1EKRA 2OI2A 2EFNA 3M8SA 2A6OA 4PYAA 4GO7X 2J9DA 5GAHU 4DFPA 5KFTA 1MSWD 2NPIA 3FRZA 1TKZA 4NA1A 4R8UB 2B3TB 2Q3PA 4BC9A 2MQQA 2N7CA 1KQSR 1CEZA 4FS2A 3CJ8A 4QWEA 3CCLS 3GLJA 1OY6A 2WAQD 1PCAA 3ZNJ1 3MTKA 2VDHA 3MAAB 5LOQA 2X1AA 2J9EA 4TU9A 4B9LA 2GA7A 1HIYA 5EX3A 1OS5A 4YB5A 1EP4B 5A8KB 5KT2A 3VGSA 3EPGA 2MQMA 2YH0A 1RWUA 3K5LA 2DHGA 1FD8A 2XO7A 1RBLA 1KVJA 1Q8BA 5GMDA 4DN0A 2G4BA 4IO9Q 5LL6d 3RAQA 4LF5J 1YBTA 1HNWJ 2MB0B 2GMJA 1BWEA 1S1XB 2E7VA 1LWXA 2HNYA 5HMWA 2AX1A 3MCMA 3DOMA 2IRYA 4NLYA 2WBRA 4DUZF 2KFNA 2CPEA 4OI1A 4MMOA 2CJBA 4DJBA 1KQGB 4K2XA 4OZJA 4U96A 4X4TA 1MNEA 2Y8YA 3ZZTA 3ILJA 2DR6A 3MEEA 1TV6A 3HZEA 1B0TA 2IJFA 3MMAA 4DDFA 3G9CA 3LF0A 1HQ2A 1FRXA 4KO0B 2RRNA 2FTRA 3H59A 1NH8A 3SSQA 2QT7A 3OFEA 4AYBD 1HNZF 4DPYA 2BOAA 4ZP9A 3CDWA 2I0XA 3R1HA 3SQGB 3RW6A 2LA6A 1VMBA 4MYUA 3JYTA 2IC3A 3V81B 2IRUA 4F0HA 3NCQA 6FDRA 2R8GA 3CJKA 1R6YA 2CNKB 2E5GA 2MKJA 4PEOA 4Q2MA 2NXUA 2HW3A 4ID8A 2W9CB 1UFKA 1Y3KA 2LEAA 4L74A 3KDNA 4LRBA 4NMXA 2VC1A 5HO4A 2KJWA 4ZJLA 3LAMA 4H4MB 5E2QA 1S0OA 2QE5A 2RQMA 4ZVPB 4ZKAA 1IKXA 3LWLA 2C1EB 4RNMA 3KJFB 1S9EB 3PDNA 5KFUA 2AJQA 2CPZA 2DR5A 1B7YB 2CAJA 2F8EX 3J81Y 3M9MB 3N79A 3D0IE 4PQUB 2CNNB 3FDSA 1VJQA 1U1QA 5C2GA 3G6YA 4FBUA 3E01A 1WEXA 3H5SA 3TA2A 2DO0A 3A8JA 3BM7A 2HBRB 1U6FA 1VQSA 3FC9A 3PACA 1C1CA 1E6VA 3FFIA 2C2OB 4IFVA 4NYPA 4P10A 4S0MA 3DLGB 1IWAA 1HNXJ 2AKWB 1YZ6A 4XDDA 4X64J 3HVAA 1WEYA 4MKBA 3LH2S 1RKJA 1JX4A 1J5OA 2YKQA 3H2VE 4F4WA 4TU7A 2QX0A 4O3SA 3GV5B 4DSFA 1I3OB 2O5DA 1HW8A 3U1LA 2EXUA 4ZHRA 1H98A 1VS3A 2A2CA 4PWDB 3KTQA 2VG5A 1H6KX 3MECB 5A8RA 3RBDA 3M4XA 2E9ZA 4DG1A 2DXEA 4J7CA 3RU0A 5BJRA 3V4MA 2BM1A 1UJ5A 1CBKA 2JLEA 2V69A 3I0RB 4LR9A 2HK2A 2RVJA 2HZCA 1Y9OA 2NSCA 3B78A 3NOGA 4R25A 3SFUA 3QGHA 3WC0A 3O6QA 2X3GA 2XCAA 2DPIA 2VZ9A 3UVJB 7AT1B 2F9DA 2OHDA 3BGLA 4K7QA 3PKYA 1VC6A 2MJNA 1YJTA 1O8BA 2AEFA 4LF5F 1S6PB 3CCMS 1RT1B 3CD5A 2YWEA 3V6DB 2EK1A 3KG0A 2PGCA 4MYTA 4Y2CA 3R27A 2OSRA 1QVFR 4MK7A 3N0VA 2MKIA 3LWMA 5H9EK 3MPWA 1UW4A 4OV6A 1SB6A 3ADAC 3PR4A 3L7OA 4O4RA 1FNMA 1GQEA 2AV5A 2J8SA 1N8RT 2V94A 3O44A 2IDEA 1BQNA 1NMEB 5IT9U 4B3SF 2Y9HA 3M2UA 1Y00A 1YVFA 3FMBA 2MY7A 3CO0P 3LTOA 2V9KA 1F0XA 2HHHF 3QRQA 3FBEA 1LK7A 1L3UA 1YJWS 3EGWB 1AZSB 2RJZA 2YWFA 1N5QA 3C6TB 3HJFA 4K4UA 4LR7A 1IQTA 1HQEA 3R97A 4F3MA 3KLGA 3VGUA 1LEOA 1JMTA 1RHMB 1WF0A 3EUNA 4J9PA 2ALYB 1HNXF 5KG6A 4ZITA 2EI5A 3MR7A 4D3HA 2GVZA 3EICA 4WJBA 4FVMA 5CYQA 4KGMA 1FCAA 3ZXWA 4A47A 3QJJA 2ALZA 3LP0B 2IYGA 1R8CA 2KM8B 2P6SA 1SJFA 3BS9A 1JLBB 4OX6A 2YXLA 2E5JA 3H7HB 1FO1A 1U2CA 2UV8A 2BM0A 2F1FA 1FEHA 1VQPS 5LM7E 1LW2A 3Q8YA 3VAKA 3F41A 2HPUA 3L9ZA 2CIMA 3ZNUA 1B99A 4DCJB 2LECA 4LF8F 3PRBA 2XSJB 3ZZ0A 3THPA 5F41A 4TU8A 4U9RA 3T1YF 1LW2B 4EBCA 1YITS 2YBVA 1KVKA 4C11B 4JI4J 2CJQA 4JI7F 2E5LJ 4JUZA 3QBCA 5CYMB 1OYEA 4XTTA 1K47A 3WDOA 4NA3A 2VQEF 2WVBA 2RU3A 4CLSA 2BE2B 2H51B 1JJ4A 2ROGA 4O44A 4N56A 1HHQA 1MLAA 1RACB 2BQRA 3T6BA 3GIMA 2ZH6A 2ZZTA 3IC1A 3MFHA 1OYDA 3MCSA 2VQEJ 2RNEA 1UZHA 3GSDA 3SV4A 4LF7J 3IRXA 1MROA 1XMOJ 4HT7A 1UPPA 2OP5A 1YZ7A 4USUA 1SC1B 4B3TF 4OYAA 4JI4F 2JX2A 3FBFA 4ATNA 1TMMA 3W5XA 3GPAA 4PG6A 1DTTA 2YX7A 1XMOF 3TO8A 4ED6A 1H74A 4JI2F 4AT1B 1S1VB 1UWAA 2GZOA 5FJ4A 1B64A 1WORA 2ZOFA 4HDGA 5GAGI 5MLCV 1S4EA 2PSZA 4YMEA 4A8WA 2HHHJ 1VK3A 3TVKA 3ZTPA 3H2UB 4NLDA 2NUHA 2QLXA 1VCTA 3GFXA 4PKDB 1N56A 5HROA 3DRSA 3R6LB 1HNWF 2BJ9A 2Y8WA 1U45A 2HURA 2Q79A 1UEKA 2ZH7A 1S0MA 4KGZB 5CABA 2ZEJA 2MZQA 3HVRA 3OFHA 2UU9J 2J6UA 4Q8FA 3OFFA 1IKWB 3RB0A 3D1HA 2XZDB 3AAWB 4N7TA 1DTTB 1H0HB 2D3OR 4M95A 4KQZA 4F67A 4DL6A 4Y00A 1BHNA 2AZ3A 3PYFA 3VWSA 2ZVSA 2V5HG 1FDAA 3P8BB 2HFNA 3SCKE 4FNIA 3L3CA 2AX0A 2XY7A 1CG2A 2A6MA 1NSKL 3DRRA 3M8PB 2FPHX 1TAUA 1U49A 5KAKA 3SSSA 3WIVA 4ANEA 5DDRC 3AXMA 2VA2A 4EI2A 3Q86A 5H9EJ 1AUSL 1QAJA 3MECA 4QBUA 1YBUA 2D7SA 5A8RB 4YY3F 3BKTA 2N3OA 2VA3A 1FJGF 4ICLB 4UW2A 2FY8A 1X0PA 2D1CA 3K5PA 3QLHA 2KN4A 4F02A 3NWRA 3NNHA 4GC7A 4LF9J 1CJUA 2JWNA 1YX2A 4I6WA 3RUBL 3CW2C 1T94A 2CQDA 4Z7YA 2CQ4A 2HQFA 1LWFA 4QR2A 3TAPA 3TI0A 4IRCA 1QUVA 4KGVB 4MJKA 4JV0A 3KNAA 1FRLA 1MWYA 4MKYA 3CCJS 4ZPCA 3DRPA 5D15A 1QE1A 3GJRB 4DV0F 3H5YA 2UV8G 4W90B 4K2JA 5D3GB 4ZP7A 3UN5A 4ES1A 3P5TL 1M90T 1T9VA 3E01B 1C4AA 1NKCA 2DYAA 2GIFA 2Z8QA 3I5AA 2DHAA 2NYHA 4IH5A 1TFWA 5HJYA 2HHTA 3BSAA 3N5FA 2M70A 2GVZB 1S1WA 2BXJA 4ZPWR 3NMAA 1QUPA 3MCNA 4I1TA 5J1PA 5DRKA 5KFJA 3S7RA 1NHKL 1GMWD 4M5IA 1R3NA 1RDRA 3BGOP 1IKXB 1XN9A 2HQGA 3MPVA 4H4MA 1RHRB 4LSNA 1EZZB 2QMXA 2CQ0A 2ZH5A 3CC7S 4KHMA 1EETA 3Q83A 1LWCB 4LQ3A 2UVVA 2CQGA 1N54B 4Y0FA 5KG3A 2XMUA 4QIGA 3SIPB 2KFYA 1Y4ZB 2JH3A 1CSJA 3BQ0A 3D1QA 1SL0A 1BQNB 1R6VA 3HDSA 4MAKA 4M8LA 5KFXA 1NK0A 1LW0B 3M8ZA 4O3OA 2X3DA 5KTQA 2IC3B 3PVXA 3CT9A 1N34J 1FXRA 2KYZA 2EBEA 1KTQA 3KWMA 5B0DA 3SQGA 1SPBP 2W2NP 4OYIA 1T0TV 2OAUA 2H5EA 3MD3A 4YR3A 3MMCA 3T1HF 2RKIB 4U67Q 4I6YA 1V9OA 3UNYA 3KLHA 3BQ2A 3GCXP 4WP9A 1GEHA 5F3ZA 1HBNB 3DKDA 1P8GA 1BWVA 2NS1B 3HSZA 3MPYA 4NWBA 4RW8B 1S6PA 2FLLA 3DLJA 2FZKB 1XNQJ 1SJ1A 5HBMB 1RWXB 3SFGA 4HH1A 1M1GA 4DCPB 1QJHA 2OUGA 1CJVA 3CDEA 4NRTA 1BY9A 2CPXA 4DF8A 2MSSA 2KKHA 2Z56B 3CDAA 2GVDA 3MM5B 2DNGA 2ZH9A 5AXLA 1XC9A 1RTDB 4ZJOA 1RWNB 2HHXA 1BD6A 1R8HA 2DGUA 4OZNA 1C1BB 3VGVA 1BQMA 3OTDA 4E2FB 3IWXA 3OR2B 1WJ9A 3M9OB 2IHR1 2F7VA 2JDJA 1WD6A 2HGNA 3NXZA 1N32J 2JLFA 4I67A 2DNHA 4X66J 1IM6A 1FHTA 3KK1A 5FDLA 4DZDA 1R43A 2VASA 4NLRA 5U47A 3PY8A 5KT6A 5T7LA 3I9V9 5ETOA 4DQRA 2RF2A 3LOUA 1X4DA 2EFVA 1RBAA 4DR3F 2UXCJ 1MMNA 3ONQA 4IFVB 1U1NA 1KS2A 1WTFA 4WXOA 1PGZA 4OYXA 4C8YA 2C22A 2I2YA 2FZCB 4P71A 2CQ2A 3TUIC 2G2OA 3LP2A 1RCOB 3VAHA 1KVIA 2F4VF 2AJ2A 2JLGA 2CWKA 3FCVA 5DG7A 4LFAF 2DNPA 2MSTA 4Q2LA 1X0FA 4TLRA 4NCBA 1X5SA 3UE2A 2KTQA 2MKYA 4IDKB 5I4MA 1FWPA 5ETKA 2CPDA 4DR4F 1G2EA 2LA4A 2ATLA 1YJNS 3N6LA 4FZVA 2A18A 2COLA 2VL1A 3I56S 2VOOA 2LP4A 5F9NA 5GAHI 5F8JA 1WELA 2W9CA 2BQUA 4NXNF 2F5GA 3QIPA 4ETXA 1S1TB 2AHOB 4DFJA 1IBLJ 2W25A 3P49B 2NXJA 4HEA9 2QJ3A 4CLYA 4URQU 5HL7Q 3VAFA 2G9OA 2W8KA 1PO6A 3JYTB 2C3MA 4WTYA 3V81A 2DY9A 3CCWA 1TU0B 4LF4F 1RAEB 4WFYA 3OTOF 1M5HA 3HPOA 3GG0A 4LF9F 4KT0C 1UW9A 2UUBJ 2G2YA 2R42A 2F9JA 1UJ6A 3L7PA 2GFFA 1REVA 1URRA 2VF3A 2P2CB 1TP7A 2QLWA 1X60A 3V6HA 3PNIA 4D3GA 2MKKA 2C2RA 1FE4A 3P3DA 4OZ3A 1TAQA 4XK8C 3Q23A 3CXCR 4GKJJ 5GMKa 2G2ZA 3W60A 1GTEA 1DLOA 1VISA 4RW7B 4ZVEA 1R8AA 1SQFA 2V50A 4ZPTR 3H98A 3VZHA 3LAKA 3FK4A 2OEMA 3JSBA 3BJYA 1YJ9S 2VG7A 1QSYA 1X4FA 1PBUA 1E6YA 2P6TA 2RDIA 3H2LA 3KLEA 4IOCQ 4RWXA 1IKVB 2RU9A 4YP3A 1SJ4P 4QWBA 2RT3A 3H4BA 4UY85 2G13A 1CJTA 3HVTA 2CG8A 4K5RA 4CO0A 2B5JB 2C2ZB 2VFTA 4YDXA 2DO4A 4KC5A 5EX0A 2HK3A 3PFEA 2ZUAA 2IM2A 2RDJA 1Q16B 3LANA 5EHHA 1S7HA 3OHBA 2FJXA 4E0DA 5G4DA 2WVEA 2HRTA 2WCXA 3GIJA 3PZPA 2OPQA 2XS5A 3GTYX 2FZGB 5B08A 1SKSA 1S4FA 4X2BA 2ZITA 2R7WA 2V2QA 3KHGA 3AT1B 3NGDA 2LKZA 1TKZB 3D6TB 4UOGA 3M2VA 1FVQA 1FRJA 2C3UA 3LA0A 3JQMA 4USIA 2BANB 3D9BA 3QJPA 3T6JA 3KMQA 2Z0GA 5KG4A 2I38A 2J8AA 2AF6A 3KHHA 1I1GA 3DMJB 2WHOA 5IV4A 4B3TJ 2JNJA 5GAEU 4YR2A 1XIQA 3TX8A 1FESA 2ZD1B 1JIHA 4LBPA 1DHMA 1YQHA 5KFQA 5KT5A 3QRRA 2PT0A 4NI2B 3HT0A 4GC6A 1UMJA 3IGVA 2ZH3A 3KJVA 1RAHB 4DLEA 3VQTA 1HYSA 2B5JA 2ILZA 3OTBA 3PRVA 1XMQF 1HKAA 4NA2A 2MZTA 1N33J 1IWGA 1S6UA 1T9WA 5ETRA 1NO8A 1Q8LA 1DAXA 3GZ7A 4QIVA 2AEMA 3NCPA 3W7BA 4USTA 2FGCA 1Y10A 2CPIA 2OO4A 1CQNA 1MU2B 2DNMA 3I6PA 5CHCB 3BR9A 4C8LA 5KG2A 5IOLA 2QL9B 3ENVA 4LF8J 3D5MA 4JI0F 3DDNA 4KJIA 1YHQS 5JUMA 2HFVA 1LK5A 2ROPA 2LXUA 5HMXA 1KEKA 3G2XA 2IMWP 1TTHB 3EXYA 3UO0A 4EYIB 1G3OA 2DIUA 4WXWA 3GJTB 4DR7J 4O3RA 1G7CB 1N52B 4P52A 5CAAA 2SXLA 4IG0B 2Y3YA 5KFPA 2UUAJ 1W25A 4RNFA 5C42B 1JKHB 4NLSA 1SBRA 4UQGA 1AUDA 2JEIA 2IMOA 1N0VC 1RAAB 1X4CA 4B17A 5J2NB 1RZMA 4UUWA 4C3KA 3LALA 2D9PA 3NY0A 4CO1A 1GMUA 2XZWA 3P45B 1RTJA 1KWMA 1SJQA 2HQIA 4P7VA 1U1OA 1F5BA 4ECQA 2GGPA 4Y34A 1FT8A 1Y7PA 1U25A 4YB7A 4CLTA 2LYVA 4C48A 5KG5A 5J2QB 1WC1A 4IG3A 1DQ9A 3HF5A 1HYSB 3BBCA 1N0UA 3OFGA 2F65A 2DNQA 3MEDB 1ZA1B 3AOAA 4JBCA 4YUDA 4ZMMA 3WHIA 2BOPA 4ED5A 2KZZA 5ETPA 3TANA 5LMUF 4J9KA 4EZ6A 4ERDA 3ZZOA 3GP9A 1KOOA 2QZ8A 4DI6A 4M94A 4RW9A 5A76A 5KG0A 4DV1F 4F4ZA 4ZIWA 4EZ9A 3HO1A 2R8HA 1SKUB 4QU7A 1VQ6S 1HQUA 5B7WA 4DL2A 3AJ2A 2OIHA 2O1PA 1HNVB 4DR6F 3TA0A 3NAIA 5DQGA 1VQOS 4JV2A 1GTHA 2XMMA 1RA7A 2ACYA 5F8GA 4DUYJ 2BR0A 3HSGA 1YJVA 4MKAA 5ETMA 1FE0A 2RE1A 3E51A 1DURA 1V3SA 4ZCMA 3N9UC 4BBYA 2VHGA 4ZN1A 1PKUA 2QMUB 4JI3F 1AB8A 1OPZA 3IS9B 1WOPA 5FDLB 3CMES 1WHWA 3I9ZA 1CJTB 2OMLA 5A2QY 9RUBA 4B02A 3RB4A 4DL3A 1JJHA 3L7UA 2B8QA
chains in the Genus database with same CATH topology
1Z1ZA 3SCJE 3OQ2A 1VGYA 1DJ0A 1NHVA 1RTDA 2HGLA 4WZQA 2D3ZA 3I4HX 3PJXA 5KFFA 2ABYA 2FJEB 2JFKA 2QA4S 3OJSA 3O2IA 1BC6A 4YB1P 2C42A 2BW2A 4K4ZA 4H4KC 1KSPA 3QGGA 4X64F 3C46A 3F73A 1UA0A 1T3OA 3H25A 5D4LA 1VK8A 3I5BA 4OHZA 3BGFA 1NRKA 1J5EF 5BYQA 1I94F 5LSOA 2J6SA 1FKPA 4Y65A 3KLHB 2OPSA 1RTHA 2XNQA 3J7A1 1UP1A 4XPCA 1ZTWA 3TVYA 1HBUB 1OSDA 1RT2A 2LQ5A 2MKHA 3N01A 4PG5A 1HNZF 3M30B 2M0GB 4DV3F 1YJUA 3DI6B 1M5OC 3EX7B 2N4CA 5CYJA 3N28A 3H8YA 5L8RC 3UW1A 2ZE2B 1S49A 2DT9A 2W7PA 2D3UA 4Y2KA 3PR5B 1WTBA 4R5PB 3OXLA 4ZCKA 1GH8A 1JWWA 1R0AA 5B0CA 2RQ4A 3DYAA 2ZHAA 2FJDB 5T41A 4CH0S 3ZC4A 4IH7A 3MURP 2GW8A 3ENQA 2L3MA 4K4XA 1U09A 3LP2B 2K1RB 1IKYA 1JLEB 3OVBA 2K8GA 2CJ9A 2DVIA 3MAQA 5D3GA 5I42B 1ZYQA 4DSJA 4FF2A 2KHCA 2YKPA 2VG6B 4PPDA 2V4QA 4ECXA 2MHNA 2W7AA 4ECWA 2XHWA 3MZIA 3US5A 2VBWA 5DJBA 4OJGA 4NPOA 1TL1B 1KLMB 2EWHA 2KRRA 4ICLA 3OR2A 3CJ0A 1BGXT 4KE5A 2WW8A 2QRRA 4QYRA 1TQLA 2RS2A 3M2RB 1LWEB 1U6BA 4WK1A 3VALA 3CGIA 4ECSA 1F60B 3UNGC 4I56A 3FJ2A 4RUHA 5I3UA 3BSNA 2F8MA 3B8HA 3I87A 4BDPA 4AXJA 1R89A 1SV5B 5KFZA 1GT8A 2MYFA 2Z2LA 5E3PA 3GWCA 1KNZA 2W24A 4G1IA 1KFDA 2BBEA 1KFSA 2E7WA 3CWJA 5J1EA 3SYZA 4DFMA 3CCRS 1Q53A 2FHMA 1UFLA 4N76A 2E44A 2AYMA 3MI7X 2J7KA 2XI2A 4OMFG 4LSNB 4DS4A 5DETA 2ZOGA 3V4IB 3HHLA 3IRXB 4X4NA 1JLQB 3UCGA 1V3ZA 2JC0A 3QAEA 5IXUA 2P9EA 3FSYA 4NLXA 5FLXY 2MGZA 2DNRA 4WCEQ 2BE2A 1IM4A 1Z2LA 3HM9A 5K9FA 3CCQS 4J9LA 3Q22A 4ECVA 1FXLA 4J5OA 4EFAC 2HHWA 3ZZYA 1O0PA 2ZUGA 1M1KT 3RBEA 2IM3A 3BGRB 4WIIA 2XSJA 2M8HA 1KC8T 5E7OB 5CH7B 4Y28C 1OSCA 2FUG9 4ZVGA 2MXYA 3NG8A 2CQPA 3GR1A 1H7XA 1PSDA 4DSEA 3NBPA 3V5RA 3Q24A 4OL8A 1GAOA 1JXEA 1HPZB 3J7Z5 4WE1A 2GHVC 3PRDA 1D8ZA 3PX4A 2KRBA 3DDKA 3FRYA 3W2WA 4DFKA 3IRWP 1UVMA 1G1XA 4LMZA 4K59A 5T14A 1F5CA 5M2RA 2E7XA 2R7OA 1CC7A 1HQEB 3MXHP 4ED1A 3DLEA 3G8QA 3SI8A 3NS6A 2E1AA 2LDIA 1NK4A 4DSKA 1OQ6A 5F8IA 4J9MA 3J7YU 3FNNA 2DGSA 4ELUA 3R3TA 4CNZA 5D4OA 7FD1A 3BO2A 1URNA 2AGQA 2EPIA 4OHXA 3UR0A 2ZNYA 2N4DA 4I64A 4DV4F 4IH6A 4OJ1A 1T02A 3PIOQ 3TRGA 1SIZA 3M6XA 2CQ3A 1VC5A 3DLEB 7FDRA 5IZHA 5EWEA 4ZP6A 2XY6A 1V6HA 5D78A 5LSRA 3VAGA 4DQQA 3SCLE 2OKQA 4ID5A 3E2EA 4C8NA 4NCAA 4IFYA 1RYRA 4EU0A 1QVGR 4EEYA 4HT5A 5CZVA 1UEVA 5KFLA 5F8LA 1FA0A 1S6QA 2U1AA 5IFMA 4N8OA 3KKFA 4C2MA 3DLLQ 2DPJA 1W2BR 2DGWA 2RIJA 2RRAA 1DTQB 2E1RA 2EW9A 1LFPA 4A8FA 2GQQA 4LSLA 1RTIB 3QZ7A 4PRFA 4L6V3 5KG7A 1JJ2R 2B7BB 2CKWA 2QIFA 2XB2D 1KTVA 2RH3A 1NB7A 4JYAF 1S6OA 1U2FA 2JVRA 4OX8A 1VQ4S 2XLJA 2GO8A 2XMTA 4H4OB 2YVSA 1KOHA 2PI4A 2EKYA 2GQCA 2VFSA 4J9SA 3C66A 4USJC 4ILRA 4TN2A 3AB4B 4EZ6A 2LXIA 2EFPA 3IFEA 4ECZA 2UXBF 5I42A 2FLOA 3I82A 1X4HA 3BB5A 3M6VA 2KT5A 4WYWA 1LV5A 4Q0BB 2O66A 4FVCA 4OZ1A 2DD8S 1RA6A 3K2YA 3OXFA 4I68A 3T1AA 1WF1A 5CYQB 4Z2XA 4IQMA 3S6EA 4ZOSA 4ZVHA 2FHOB 2ZJQQ 4ECTA 2QSFA 1NAQA 4CTAA 3V4IA 2G0CA 3HHEA 2UUAF 2XMJA 3PM9A 3CC4S 4R5PA 3KMSA 1P1TA 3GV7B 1NK9A 3FQLA 1LQ9A 3IG1B 1S97A 2RUGA 3OSPA 3M2UB 1T95A 2ZC3A 3LP1B 5C25B 4WFNQ 3J7ZT 4RKUC 5J1EB 4LUBA 3TW0A 3UD4P 2D41A 3NAHA 5KFNA 1TZ0A 1R7IA 2J5AA 3K58A 5C5JA 4O23A 3T5JA 2ZC4A 2CYYA 4GMKA 2QYCA 4KO0A 4K4YA 1TV6B 3MMAB 3PXGa 5CZXA 5LJ5Y 4UUXA 4LFCF 2HS0A 4NYOA 5I3UB 1U4BA 1NJWA 2PC6A 4X65F 5L9XA 3GILA 3UCZP 3OR1B 4HH0A 2GHWA 5KFOA 2A3JA 2FC8A 3W2VA 3JTPA 2I9SA 3HZGA 3I0RA 2MZ1A 2GO9A 1R8BA 3O5TB 3OPKA 4DSIA 1N5TA 1UJ4A 1YSJA 2CQCA 4PWUA 2LEPA 2WSCC 2J7WA 3KLFA 1U1PA 5AXNA 1KLMA 4IOBA 4GO5X 3UI3A 4CO3A 1VRTA 3QZ8A 4MK9A 2XMVA 3FSXA 1SUQA 1S1UA 3SDEB 1J5OB 5A8KA 3M8RA 1T03A 5HMZA 1M5PC 4RU2A 5C24A 3RR7A 1X7VA 1X4BA 2DGOA 3MAHA 3S8SA 1S9GB 3J80Y 1ZOTA 1HHTP 2K1RA 2KU7A 3KLIB 3DU6A 1ZPVA 5L1KA 4IRDA 2HNZA 4BHQA 1XR6A 1ROFA 4Q45A 2B7CB 1X4AA 2YX4A 4OJ3A 3DOLB 3IWNC 3MUTP 4OX9F 2ZH8A 3KHLA 4PXBA 5DG8A 2ASLA 2YNHB 1X9MA 5KFDA 3G86A 5KT4A 4B3OA 4RNOA 3H5UA 2BACA 2MQPA 3T9ZA 1FRIA 2F3JA 2YWHA 1N5YB 5A8WA 1JLGA 1D9FA 3KK3B 2XG8A 2BRLA 2GGPB 1TUVA 2WONA 4NZ7A 1RT2B 4HDHA 1ZM3A 1CC8A 1BQXA 3R5DA 3IN5A 1D1UA 1S76D 4DL7A 2IJNA 1HARA 1IBLF 2HMIB 4UY8T 1WF2A 4F3OA 4DS5A 2M88A 1FDDA 5L1IA 1NK5A 2E9TA 3HXMA 1SJRA 3GB0A 2JHEA 2B6AA 3BEGB 5E3QA 3UDCA 2LQJA 5AE1A 4QR1A 1P27B 2ASJA 3TAMB 1DBDA 5LJ3Y 2RSQA 4RNHA 3SEOA 2VUGA 2K2PA 2GIQA 2A1BA 2GMLA 3CMAS 3R1LA 4ED0A 3ITHB 3KLGB 4PCQA 3BSCA 5A0YA 2KJVA 1SKWA 2V9WA 1KVIA 3T9NA 1P9QC 4MIBA 2Z4PA 5JVGQ 3NLCA 4CQ1A 5DGAA 3KJVB 2XEXA 3LW5C 1FTCA 2Z2MA 3OL6A 4DR7F 5BR8F 1JLCA 1N32F 3UWTA 1WI6A 3V6KA 1KLNA 2HWHA 4R8UA 3SZ2A 2VPXB 2XC9A 4B9NA 2M4MA 2Q6CA 1HQUB 4N8NA 1SKRA 2UU9F 2QA1A 2QMWA 3CDBA 5KFVA 1S77D 4B3RF 1D3WA 2YWGA 2YY3A 3B82A 4RW9B 3MM8B 1Q82T 1H38A 2ASYA 2O01C 3PW0A 2OPQB 1VQ9S 2BRKA 4QWAA 5B0AA 3SSRA 3JSMB 1LXJA 1Q4RA 2VBZA 4O4GA 3OSNA 1JLAA 1XNQF 1SH0A 1VQLS 4QOTA 1P1LA 3OL7A 1X4EA 1L3KA 4USHA 5J2QA 1TKTA 4C9DA 3ULHA 4I7FA 4RBUA 5KFBA 2R2TA 4EYHB 4ILLA 1XK8A 1IKVA 1Q86T 2JEGA 2IM0A 5A0YB 1E6YB 2Y1RI 1N33F 2YWKA 2P9GA 4NYZA 4U7UK 2KXFA 4ZPAA 3FCHA 5F9LA 2XWYA 3NP5A 1FERA 1IBMF 1IXKA 2CDQA 4WZMA 4FN5A 3KLVA 2AGOA 1ZM9A 2R7TA 1S0NA 2XULA 4HLBA 1FF2A 1HBMA 2VPYB 3DRXA 1HI1A 2FHJD 1JK9B 2QO3A 3QGIA 1SH2A 2YNFA 1VFJA 1S10A 4C97A 3UD3P 2AYBA 3BGUA 5THWA 4OLOA 5A6PA 5B0EA 2RB7A 2ZH4A 4I7FB 1UVLA 5DGBA 1TKTB 4TY8B 1TR0A 5L1LA 5CA5A 4A8YA 5D8HB 1C0UA 5JVHQ 3H4DA 4B3OB 3PX6A 3KHRA 4KV8A 1SXLA 4YFUA 3OTCA 1NEEA 1FRMA 2DBBA 3BF4A 3MEKA 4KGKA 1H2TZ 4RX6A 2BJDA 5IT9Y 3QO9A 2AJ0A 1KONA 2JOQA 1N6QA 2DHXA 3ZZRA 4IUFA 5DDOC 3DNCA 3RB6A 4DF4A 3M2VB 3MMJA 4Y3CA 1VJWA 4LT6A 3BQ1A 1S9GA 1VQKS 2APOA 3TOQA 3GFZA 3I0SB 3K5NA 2X1BA 2KDOA 3AB2B 3HHNB 4CO2A 4YDDB 3X1LB 2HIQA 1HI0P 2OTJS 4L72B 2EVZA 4DR5F 2UUBF 1FKAF 1M0SA 3Q2TC 2XLIA 2K3KA 4NCGA 3THVA 4U6PA 1RISA 4N47A 2CJKA 2O67A 4JI8F 2KZMA 2CZVC 1WHVA 5IQ6A 4NOHA 3WX4A 4ECYA 3D0GE 3DHXA 1GNKA 4OZ5A 3U02A 1Q7LB 1RT4B 2C2DA 1BQMB 1C1BA 3MM6B 5BYRA 2VPWB 2JVOA 1VQMS 2PI5A 4OLPA 4O3PA 3TAMA 2RQCA 2B4UA 3R5CA 3PJWA 3GFHA 4KKOB 2KB2A 3CVKA 4PR6A 1Y0HA 2R4FA 2ADCA 4C8ZA 1L3VA 1TVRB 2C3PA 3EZUA 2WOMB 1RT6B 3RAXA 4QWDA 1RQ0A 4A8MP 1YTYA 2AJFE 4V19X 1RJJA 4KFBB 2V0NA 4DOZA 1WG4A 3NGKA 3M1VA 1S48A 4A4JA 5G0RA 1JLGB 3LP1A 5C25A 1S1TA 1RK8A 3EZ5A 2NR0A 3CUNA 4TQSA 2YNHA 2MKCA 1FXDA 4YR2A 2FDNA 2ADBA 1JB0C 3F56A 2ZZNA 3CJ4A 5SZTA 2ZH1A 4M5DB 3DOLA 2EG2A 5EN1A 1O51A 4IDKA 4L3NA 4C0OC 4NLUA 4ZCIA 2B4VA 3MDFA 2YX1A 1PC4A 1T3NA 2YNGB 1L3TA 3CULA 4ES3A 4RUCA 2POKA 5EDWA 1S72S 3HI9A 1O5JA 3KLIA 3BR8A 3RAMA 4WFBQ 2J0WA 5F8NA 2V4JA 3O1LA 1FDNA 3OJUA 5HN0A 3DRPB 5HMYA 3G6ES 2RF2B 1T03B 3DC2A 4URSA 5EWFA 2DNOA 1S1UB 1WG1A 4R0EA 3CE8A 1FD2A 3OBIA 3FEZA 5KFAA 3SDEA 1YJRA 3U1MA 2XCPA 3KK1B 2OD4A 1VBXA 1B0VA 2FLPA 4N77A 3CSKA 3RYLA 2DHSA 3QGPA 2DR7A 3BREA 3T3FA 4OI0A 3CJ5A 2FIUA 1U1LA 1Q7YT 3OW2R 4LSLB 1V3RA 2Q1LA 5J1NA 1J2VA 3M8PA 2HQ3A 2FB0A 1YG0A 2CPFA 2PDAA 3OR1A 1FJEB 3KOAA 2C3YA 1Q78A 3MR2A 3CCUS 1AW0A 4I4BA 2AGPA 4DL0C 4IFYB 2D9OA 2B56A 3M32A 4KIAA 3OUYB 1VQ7S 1B7FA 3PIPQ 3MEGA 1SQEA 2HVHA 4RW6B 1NHUA 2ILYA 3KK2B 2YKAA 3NNCA 3MMCB 4PG4A 4C0HA 5CXTA 2CPHA 3P6YC 3AQOA 4LFBF 4QW9A 2R7QA 3NKYA 4WKRA 5BYSA 5HROB 2OTLS 1Y5IB 4M63A 3TQ1A 2JEIA 3EPIA 3CJ3A 4C3LA 3D2WA 3IG1A 2ZKUA 1EETB 5KFKA 3O8WA 5E3AA 4RZRA 2K3IA 3HHDA 1HMVA 1FNXH 2DR9A 1QAIA 4C8OA 1HHSA 3RRGA 2IBKA 2PD1A 1WWHA 3PEHA 4C7QA 1U48A 2IRXA 3R5AA 2CPYA 4Q7AA 3R5BA 1Z2ZA 3W2WB 4CIOA 2RMLA 2RS8A 3DN9A 2W7OA 4FP9A 2KG0A 1XEZA 4NRUA 5DM6Q 3KYLA 3WC2A 1HPZA 3NNAA 4CZCA 3T5KA 4CCHA 3MUMP 2R2SA 1DZ5A 3VCDA 1KR4A 2WB1D 4C11A 4PQAA 3POTB 4ECRA 3K5MA 4YOEA 3NMRA 1FJ7A 2J0XA 3QLHB 3M9NB 4MK8A 3CEDA 4FNHA 2OH2A 3PW4A 4OFZA 5SUHA 2HS3A 2XMKA 2J0QD 3VAMA 3BN4A 5F0WA 1OQ3A 5LT5A 1AFJA 3HFKA 3ISNC 5K5MA 4EGLA 3DM2A 2R9LA