4YDHB

The structure of human fmnl1 n-terminal domains bound to cdc42
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
178
structure length
178
Chain Sequence
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQRGLKNVFDEAILAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of FMNL2-Cdc42 yields insights into the mechanism of lamellipodia and filopodia formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Formin-like protein 1
total genus 48
structure length 178
sequence length 178
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ydhB00
3KX2A 3OESA 3R8FA 1SULA 3B2EA 4JLPA 3MJRA 2OZEA 1NKSA 2ZAMA 4QKQA 2VO1A 2BMJA 4KLZA 4M1OA 1KKLA 3U60B 2JIZA 4JSYA 1SKQA 3A8TA 2ZREA 2FNAA 2WICA 1AA9A 1R2QA 2ZYUX 1UFQA 2DYKA 4CRWB 2CJWA 2F1IA 4RD3A 5KNCA 4IOJA 4A8JC 3B1VA 2PJZA 4JS0A 2V8OA 5AJYA 4M9XA 2YOHA 4R71A 1DAHA 1KMQA 3SYKA 3CPHA 2NQ2C 4Q48A 2WPDA 1XTSA 2VRWA 3RSOA 4RZ3A 4GMXA 2WWHA 3DL0A 4B6FA 4AKGA 4ZI2A 3K70C 1CXZA 2O8FB 2YVUA 3FE2A 3MWLA 2N1BA 4N0DA 3K70D 2NO7A 4CEIA 5DH9A 4DLVA 4DT1B 2GCNA 4HB4A 1E2GA 1R0XA 2OAP1 4E03A 2QTFA 1QHGA 2GETA 3U6KA 4QL3A 5HR5A 1LW7A 3TBKA 3AKYA 2Q6TA 3VX3A 1T3LA 3ZZ0A 1EFRD 4JYCA 3DZDA 4BFZA 1OB5A 5JFGA 3CF0A 3OE7A 4LPKA 1Z0FA 3A58B 2GK7A 2ZRHA 2WTUA 5JJIA 4C3ZA 3SHFA 4ZCLA 2WWWA 3KJGA 2CMKA 3LDAA 1N0VC 3EAQA 1P61B 2NO0A 4YMSA 2PL3A 3PENA 3LA6A 4EPVA 5KTYA 1E3MA 2JCSA 4HB2A 4JJKA 4RD1A 5DHAA 4ASUD 3RS7A 1OFIA 1XEWX 3GJ3A 3X1WA 5TB5A 2OFOA 4XD7A 1Z0AA 2RGAA 5DYGA 1GP2A 2TMKA 3WP0A 4OK3A 4BFYA 3DHWC 4ZCMA 4IDPA 1JXOA 4LJ6A 3RANA 3WP1B 1TEXA 2ANCA 4C0LA 4NONA 1UBGA 2W6JD 1R5OA 2HT6A 2W6ID 4DB2A 5TXGA 2FSIA 2IEZA 3WXMA 1AKYA 1NMZA 5BQ5A 3PEUA 1AKEA 1GITA 4X8MA 1R10A 3S1AA 1A7JA 1SQ5A 1TEVA 2XOKA 3NC0C 1AK2A 1YHNA 4QJ5A 4ZKDA 3CPJB 1IN7A 4C0AC 4IDHA 1S9HA 1YZGA 3KB1A 1ZNZA 2JLXA 4TZ6A 1MO4A 1JQLB 4U00A 4CW7A 5JS7A 4UJ5A 2IXFA 1G8FA 2D2EA 2XNSA 1E9RA 2VP5A 4RSGA 4Q1DA 3EIQA 2XJ4A 3RRZA 1O3YA 1SVMA 5ANRB 1NG9A 1SZPA 5L3SA 2XZLA 2CLSA 5JEDA 2YOFA 5EXSA 1G19A 3ZLJA 3LY5A 2QMEA 3GLGA 2AXNA 2R6DA 1XEXB 3W5IA 1T91A 2E1RA 4G5QA 4QBGB 5F9HA 3H84A 4FMBB 3TW4A 3H86A 2BBSA 4BQSA 5J4VA 2O5VA 4MKFA 1NP6A 1SVIA 1QG2A 2OXCA 2AWNA 2H16A 1W5TA 1G6OA 2FMXA 3HP1A 1YE8A 5K8UA 4E07A 2X19A 1FP6A 3E2IA 1Z08A 2A30A 2FH5B 1J99A 3UG7A 3FKSD 1E9FA 1KK0A 5J47A 5KYKA 3QQ5A 3U4QB 2IEYA 4ESHA 1DPFA 1N5KA 5FUWA 3W34A 2XB2A 2HJGA 4AKHA 1S4QA 4A6PA 2DR3A 4B3FX 4XSHA 1XXHA 3VHLB 4YC7A 2VPPA 1YRBA 4ASUA 1US8B 4JLKA 4D2IA 4KSBA 4IEEA 4Q01A 2GRJA 3MWYW 4D0LB 2WJHA 1G16A 2C2HA 2IYTA 2QENA 2OLKA 4EFNA 1G8YA 1OYYA 2YNMA 3W9YA 3ZIAD 1U9IA 1EESA 3B9PA 3EZFA 3S1AB 4LHZA 3I73A 4NCHA 3CIOA 2DFTA 3C15C 3LQQA 5CJ2A 3K09C 4OHWA 4Q18A 3R7WB 4DLSA 4OJQA 3VTKA 1T8UA 1OIWA 3IKJA 4XOIA 5FPHA 2R6CA 4TL9A 1H8ED 1ZP6A 2XITA 2C9OA 3K0SA 2ZE8A 3FKSA 4G5GA 3FHOA 4A8JA 3E1SA 4PAQA 4DRZA 1CP2A 3K9HA 1DAEA 1Q57A 1MABA 1TQ4A 1BMFA 3L2OB 5CLLA 3THXB 3ND9A 3GJ8A 4WIAA 4QGFA 4WZ6A 5L3QA 1KK3A 2IUSA 3SJCA 4JVSB 1Q1EA 4D0NA 4A1FA 1KMHA 4DXAA 4U02A 1C1YA 4QGHA 4LOAA 2QAJA 4JT2A 5E7IA 3PJRA 4D4JA 4TMXA 3PG5A 3KQNA 1E79A 1Z6YA 4JBWA 2J59A 4P4SA 3AP2A 2V7QD 5FBRB 4IKEA 5LD2C 1U9IC 1RW4A 1ZBDA 1F5NA 2ZS9A 4PZZA 1VCMA 1RE0A 1NG1A 5GJWC 4ACBA 5CB6A 2ZRPA 4JZKA 1LF0A 3DOFA 2J7PA 1GNQA 3BE4A 3GJ7A 2LKCA 4YMWA 5FL7A 1KDPA 1FQJA 3VNVA 4DLYA 1R0YA 5F98A 3GJ4A 2PLRA 3RC3A 2QORA 1EFHA 3SN6A 2XGJA 1E9BA 4E09A 1IONA 3IHWA 2JEOA 1T5LA 3WRYC 4P0TA 1ZM2A 1DADA 3KKPA 3IO5A 2QQ0A 4EPXA 4PHFA 4CGZA 1W49A 1IJFA 2DY1A 1KSJA 3I92A 4V0KA 5CK4A 2WIBA 4H1VA 5DGXA 3U3OA 1OXTA 1G4AE 1FX0A 2C03A 4Y0AA 3QKTA 4Q5IA 3BFKA 4LK2A 5FUVA 1IOZA 3EC1A 1UPTA 2CLDX 4UKDA 2G0TA 1JBKA 3IIJA 2IYRA 3VR1A 5FL7D 1W5SA 4ZPXA 5JWHA 3T1QA 4AI6A 2AHOA 2O8DA 1I4DD 4C0BA 4ZDJA 1XTQA 1JNYA 2WKRA 3IPXA 2YWHA 4HDQB 3ZZUA 3AVQA 3QVUA 1RVDA 1KSHA 5G3ZA 3C5CA 2ORIA 3EA5A 4IXNA 4JLVA 3T1OA 3QG5A 5AJXA 2RAPA 2BEJA 2PZEA 1HV8A 2IYSA 4M1MA 1G21E 2WM9B 1NVVQ 1NI3A 4LC1A 1WMSA 2V6JA 3W3AA 4C0JA 1XF9A 3F3YA 3UK6A 4LBVA 3DZ8A 1COWD 1U90A 2GAAA 3HWSA 3L0IB 4Z54A 1KI6B 1N5LA 2J0UB 1LFDB 1HQYE 3JVUA 3SI7A 4YQFA 3QKSA 1P75A 1ZD1A 2RB4A 4NDZA 3DM9B 1Z0DA 1XXHB 1F2UA 3A4NA 1KSGA 1X8LA 4O2LA 1W36B 3QY0A 2OV2A 3SJBA 3UWOA 4EPRA 2V55B 4I4LA 1PLKA 4D25A 1GUAA 4IVQA 2FN4A 4NP6A 1ZU4A 5GVSA 1JR6A 1GKYA 721PA 3FOZA 4HZUA 2G1JA 2OXRA 5JRZA 2ZJOA 3LVRE 1QDEA 1DS6A 3CR7A 4DC9A 2G0NA 221PA 4LV5B 4EJSB 4RVCA 2ZRCA 4PO8A 4Q7JB 3TSWA 4G5RA 3TGPA 4Q9JA 5K8LA 1FOEB 2VF7A 2IS6A 4D80A 3KFVA 3PEWA 1DAMA 1II9A 1KZGB 3OIYA 1AGRA 1KO8A 3KKNA 1G3UA 2PJRA 1L8QA 4HLCA 4RFSB 2BHRA 2FEMA 3PXGA 4GBMA 4GP6A 3QOFA 1Z0JA 4OJKA 2QUZA 3N70A 2MMGA 4NYIQ 2EU8A 1W0KA 2ZRGA 1U8ZA 2HLDA 2JLQA 2W0SA 3L0PA 3SZRA 3IIKA 2C96A 2VEDA 3A4MA 4HZIA 4QOSA 2J0UA 4LHYA 4KO8A 2OEPA 5FBLB 4A36A 1VYUA 1NN5A 3AKCA 1G3RA 4FD2A 1XP8A 3REGA 1D9XA 1ZD8A 3ZDQA 2CLCX 1YZUA 5CYPA 3V4RA 1JECA 1SVOA 4NCNA 2JA1A 3CF2A 5IHPA 2PEZA 2WKPA 3U4QA 1GZSA 2G3YA 3TUIC 4C9BA 2FGJA 3I32A 4W9MC 2H18A 2ZITA 5A4JA 1SHKA 4HAZA 3RLFA 3P4XA 1A2KC 1TQ6A 1E32A 4K46A 3VX4A 5JBQA 1NJFA 3BOSA 3WBJA 4MA4A 2ZROA 3ADBA 4Q00A 2BJWA 3SJAA 3ZS8A 4Z51A 1YU9A 2RMKA 3PR1A 4X8LA 2OUKA 4HZUB 2C04A 4EPTA 1KTVA 2FV8A 1AJEA 5FOVA 2BMDA 1EGAA 4LV8B 2C99A 2ZR7A 2OO7A 2GESA 2ZVPX 4FN5A 1J90A 1WQ1R 1PZNA 4CT4B 2RHMA 4V0OA 4B44A 1SGWA 1CR0A 1KJYA 1XTJA 1GIAA 2CCGA 2JJ8A 3NH6A 3TR0A 1Z22A 3A4LA 5A0FA 4RD4A 3VR3A 3TUZC 2O8CA 2ZQ5A 2AD5A 2JJ2D 3HR7A 2PMKA 4HYYA 2P6UA 2YV5A 1P72A 1BYUA 1S0UA 3M4YA 3WYFA 3SYLA 1M34E 2F1HA 3GFTA 5DI3B 1GILA 1CF4A 3D8BA 3WHKA 1QG4A 2QMOA 1NBME 1W0KD 4PSVA 4MRNA 2O8BB 3GPLA 4JT4A 3C14C 3QNUA 3PUWA 4II7A 2FSFA 2GXAA 1YZLA 1E2LA 1TUIA 3O47A 1XD2A 5LB2A 4CZ2A 4B3CA 3EPHA 3KZ1E 2IS1A 2RKOA 2V6IA 3QG1A 4YMVA 3OE7D 3H0KA 3QVVA 3K0FA 1NL3A 3D6TB 4EJSA 1E2FA 1AS3A 1GRQA 4AYXA 2ZYVX 1E2KA 2I1QA 1NLYA 4Z8YA 2HLDD 2YWFA 3QIAA 1NN0A 4Q4HB 5J4HA 1YR8A 2F3TA 2O8BA 1Z2AA 2GHIA 3SU8A 1KO1A 1BIFA 2D62A 2FF7A 3BK7A 2OG2A 3AUYA 4BGDA 2PT7A 621PA 3MJHA 1OKKA 4FMCB 3X1ZA 3RSLA 4HAYA 1AN0A 4TYYA 5AK0A 1E2JA 3U3KA 2ZSEA 1N6NA 4EUNA 1HURA 1NVXQ 4O25A 4HSEA 5TARA 4LJ4A 2O8EB 2JJ2A 1IXZA 4EDHA 2DPXA 2NZ8A 1OH6A 4GL2A 4MGKR 3X2SA 5JJKA 4B48A 2QBYB 4B43A 1GG2A 1U0JA 5KSOA 1I2MA 1VKJA 5FPKA 1FP7A 2VHUA 3BRWD 1FTSA 4V02A 3MAAC 1NKTA 3EWAA 3ZVLA 2JJ1A 3DKVA 3MSXA 4TMTA 1UKZA 3QI2A 2NMVA 2F1RA 4QBHA 4V0ME 5IRCD 1DAKA 1SXJD 2XAUA 1KI1A 2ORWA 3AKDA 3KB2A 4A8JB 5KUTA 2Z5FA 1OJLA 2GJKA 4DSOA 1G7CA 3G82C 4WZBE 1XU4A 2GXQA 4HUTA 1E69A 2C9CA 3SBDA 4BLTA 4BFTA 2FSHA 4BLQA 1AZTA 1IBRA 1ETUA 2H7VA 3D31A 3LRPA 2F43A 4MKHA 3OIUA 3GJ5A 3BB3A 3LV8A 4IHQA 1CS4C 4FWTA 3GLIB 5BN4A 3IGFA 2QGNA 4P3YA 1WRBA 1N2CE 1WA5A 1M74A 1XX6A 4NPHA 2V7QA 4ZDKA 2F9MA 2ZRJA 3U7FB 4XWAA 2VL7A 4ILEA 1CJUC 4EQ6A 1NF3A 2J5XA 3PEVA 3KQHA 2JASA 3KKQA 4KI0A 5IF9A 5FPYA 3LQRA 3M6AA 3UMSA 5BYJA 1ELOA 5AUPB 3C8UA 1XBTA 3HU2A 4UNPA 5C1BA 1KI4A 3PIRA 4IOKA 4A0GA 1XWIA 3RWOA 1HT1E 3I8XA 3V4FA 1R0WA 3ZZTA 3NC1C 2BM1A 3B82A 4PX9A 1LS6A 1CEEA 2RCNA 2Q3FA 2UKDA 2WIAA 4XTCS 5FR1A 3RC8A 1PUIA 3O8RA 1KK1A 2IBMA 4MYUA 1E0JA 5IK2D 5TDHA 3SC3A 1WXQA 4TL6A 4MYCA 2N46A 2RGXA 1TADA 1HQCA 3EZ6A 4OKSA 1W2GA 2J87A 1E0KA 3QF4A 4URZR 3R9IA 2XZOA 5D3QA 1A4RA 4M1YA 3WYGA 5JI2E 1MOZA 2PZGA 2ORVA 5EE5B 1KK2A 2YHSA 3HPRA 3PEYA 1DO0A 3SOPA 1Z28A 3I1FA 5D3MA 3SDZA 1XCMA 4AYWA 2WHXA 1TPZA 3PFIA 2F43B 4PTLA 4RZUA 4BFSA 5HE9A 2GXUA 4DCNA 3LLUA 3AP3A 2WJIA 1L4YA 3G5UA 1PUJA 2F7SA 4LV6A 1XD8A 2IYXA 4JVNA 1SHZA 1T3SA 2ZIAA 2EW1A 4DLXA 2BOVA 1IY1A 2R2AA 2W6JA 3AF2A 1RKBA 1E2QA 3QE0A 1P2SA 4BLRA 4PANA 3RS3A 4IVRA 1KOFA 4JLBA 5J4LA 4HDOB 5ELXA 3U44A 4MKIA 4FINA 2GVDC 1EFRA 1FUKA 3SE0A 4D4KA 2VBCA 4TLEA 3RNLA 4U5XA 4QXAA 4DVGA 2QPAA 2KJQA 1EWRA 3BB1A 5J5CA 1ZUNB 2G88A 4Q66C 3ASYA 4URWR 3D3QA 2ZI7A 3SJZA 3RABA 2PZFA 5DNYB 3WMEA 1GTVA 2FZ4A 4V0LA 2YWGA 2EQBA 1HTWA 2A5JA 2D7CA 3OFND 3VMFA 3QPWA 2JDID 3A1WA 2X1VA 1QVRA 5EXPA 5FR2A 1R5BA 2CVHA 2JLSA 1GL6A 4PFSA 4Q1EA 4EIWA 1HYQA 1P7CA 1E9AA 1D5CA 3BXZA 5BW8A 1G5PA 4DDTA 3UKDA 4FW9A 1TMKA 4B3XA 1OV4A 3B6EA 4D6PA 3NBZC 1G17A 3NG1A 3PUYA 5H70A 3B78A 4LSGA 3GLHE 3B5JA 3T5GA 1II8B 1N5IA 1FZQA 2CDNA 3B1XA 4PQRA 4DIDA 4G1UC 3ZVNA 4G01B 4OHVA 1JJ7A 5LBIA 1JAIA 1FTNA 1LF5A 3VHXA 4PHGA 4GMDA 3ECCA 3FMOB 4E5UA 2V3CC 2J41A 3IDQA 5L3QB 4O0MA 2AKYA 5A5GA 1XD2B 4HI0E 1KKMA 2ZI5A 3IQXA 3O8CA 2ZM5A 2MSEB 2BKEA 2CCJA 3AH8A 3CUEF 3CR8A 2Z0MA 4JLOA 1WF3A 4B2IA 1S2MA 1DG1G 1ZC4A 4DLRA 3FGNA 1HA3A 1OHHA 1HUQA 1MR3F 3J81k 5EE1A 5EP1A 3TJZA 1QHXA 4D26A 1OFUX 4KJZA 5HPYB 4KCGA 1K6MA 3SQXA 4GOJA 5JI3E 2QI9C 4S35A 3HPQA 1XCGB 2ZSDA 3CZPA 4LBZA 3KJIA 4YMTA 1VMAA 4CYMA 4US0R 5FFMA 3F8TA 1KIMA 1W7AA 1E79D 1I2DA 2EFGA 2YYZA 3ICEA 1XMVA 3TQFA 2R62A 1YKSA 3VKHA 1N6RA 3SNHA 2QRNA 3K09A 2ZRBA 2VTKA 1T5IA 1TUEA 3B1ZA 1NIPA 3CNOA 3K9GA 4R7ZA 4WOPA 2N42A 1OW3B 2Z4SA 5KDLA 4U7DA 3WMFA 1N6LA 2J7PD 3TIFA 1GKUB 3R9WA 1R8SA 1W36D 1OXUA 3KTAB 2GF9A 4HB0A 2H17A 4UQOA 1NVWQ 4ZCIA 2HYDA 2YZ2A 3CLVA 3OIWA 1OIXA 3B1WA 1Z83A 1VIYA 2V4ZA 4PR0A 4CVNA 1XPUA 3BH7A 3GLGB 2ZS7A 3T35A 3MUFA 4AKIA 3OEHA 2QBYA 4MH0R 3LXXA 2AKAB 3WRXC 5L3SB 3W5JA 4KHZA 3Q7QA 2ODBA 3CH5A 1ZCAA 2ZJZA 2H57A 1R4AA 3LAWA 1Q1BA 2IYYA 1JR3D 2QQEA 5FOUA 2GEDA 3A1UA 2ZRMA 1ZIOA 5CITA 2QN6A 1ZM4A 1D9ZA 2RGEA 2GF0A 2ZRFA 3E70C 4FMCF 1F2TA 4M22A 1ZCBA 1W48A 2BV3A 4HLUA 1E0SA 1G9XA 4MUBA 1XMSA 3C16C 4O2RA 1RC8A 2P5SA 3DM5A 4BPBA 2OESA 4GSYA 5FI0B 4M1KA 1X3SA 3PQCA 5H68A 4P32A 1XTIA 2ZJAA 3EZ2A 2GNOA 2GXSA 3OEHD 4M4SA 4IJMA 2DHRA 5HZKA 3NDBB 2AFIE 1CJMA 4UNNA 4B71A 4NHOA 4F93B 4IW3B 4HEJA 5B30A 5CB8A 3I5XA 1K5DA 4URVR 5F3WB 4KLNA 3K0AB 5FOTA 1KDOA 3DPUA 3U44B 5GJVC 5KU1A 4OHXA 3MFYA 2GDJA 2R44A 2R6AA 1IHUA 2GVZC 1CLUA 1M8PA 2F9LA 4LYJA 4HDCA 4WXPA 1YQTA 5DISB 5TV2A 3BC1A 3P27A 3U3MA 2QTVB 1EFCA 1E6CA 1KMHB 4F4IA 2P67A 3LWNA 4PPGA 1U99A 3K1JA 4URUR 2ZYTX 1UEIA 3AV0B 4CF7A 4D0GA 4LJ5A 4V0MA 3TH5A 1R7RA 4JSTA 5DE3A 4TLBA 1CRQA 4K81B 4DKXA 2ODWA 5C18A 3CRMA 3ZS9A 5E7MA 3CW2A 2Q9CA 1X6VA 3BIFA 5HCIA 4Q4LA 4EKDA 1IJEA 4Q19A 5KSPA 2ZI3A 2AX4A 2CL7X 1ZNYA 1ZMXA 2QT0A 3LXRA 2XEXA 4C0HA 3UMRA 4HLDA 1Z5ZA 4XTRA 3T12A 1OKKD 3OEEA 2FG5A 2IHBA 4M9ZA 4GP7A 2CHVA 3DEFA 3GLFE 5EE0A 1Q12A 1BS1A 2DFLA 3MWKA 1RFLA 3VU9B 2OCBA 4M8NE 1QF9A 4F92B 1FNNA 4MGZR 2BMEA 4DSUA 2VSFA 3A1VA 2FEOA 1E9CA 1WCV1 5G53C 3MMPA 4XVRA 4TSFD 4GFDA 3EXAA 4GOXA 4HAXA 1WB9A 2CBZA 1FFHA 1SVLA 1RZ3A 1FL9A 2OAQ1 2Q3HA 2EFHB 2G6BA 1ZM3A 3B8HA 4UXHA 4OI2A 3EZ7A 2WAYA 2IX3A 1TL7C 1G5RA 1OXXK 3EW9A 4MGYR 3HJNA 2KBEA 3LW8A 1G291 1KI2A 2LKDA 3N2EA 1JEEA 1IN8A 3RHFA 1AS0A 5CM9C 1UAAA 3VFDA 1G4UR 5DI3A 3HYTA 4A15A 1OH7A 4OI0A 4KFRA 5D3MB 1A1VA 1NMXA 4HAWA 4Q21A 3RS4A 3NEYA 4P4TA 1DVRA 1TQ2A 5P21A 4ARZB 4PPNA 4L4UA 4UJ3A 2JAQA 2ATVA 3IUYA 1RRFA 2ERYA 3QXCA 3Q7PA 4KBGA 4OK6A 4F7WA 3CO5A 5KNDA 3WHLA 3ND8A 5FH9A 3BAFA 1G8PA 1Z6GA 1JQJC 1KHTA 1TU4A 2QG6A 2A2ZA 3FB4A 1M7HA 4L16A 4JL8A 1VG0B 2DBYA 1Q0UA 3EX7C 1IXRC 4DLUA 4L9SA 4I1VA 2NO6A 3OAAA 4TL7A 2A9KA 1S3GA 3TSOA 3TVTA 4AC9A 1COWA 2Q9BA 1VYTA 4LRWA 3X1DA 2WSSA 3KUDA 4EFLA 3THYA 4JBXA 4DUGA 1G3QA 2ZRNA 2A5YB 3EPKA 2DFKB 4TTPA 1JXMA 2BWJA 4MRVA 2OBNA 1DO2A 2CCKA 3AVTA 1XZQA 2ZJ8A 4WBSA 4BFVA 1PLLA 4DLZA 2D7DA 4PC1A 4LBYA 4EAQA 4B6EA 2ANBA 1TQDA 4POAA 1W4AA 1C9KA 1V5WA 2GILA 4BEBA 1KGDA 2PX3A 3PUZA 1VECA 2YC4C 4B76A 2K5UA 1EK0A 3BERA 4HUQA 4Q9LA 3TE6A 3MCAA 3UXMA 1XPRA 1YVDA 2J1LA 4QGGA 4QJ4A 1CR2A 2LCFA 1IY0A 5EZ6B 4FI3C 4JVLA 1EWQA 3QXJA 1KO7A 4JLAA 2CE2X 2OT3B 4PAOA 2PX0A 4XWKA 3ZD6A 4DUGD 4JJZA 4BFUA 3ZVRA 1H65A 4CEHB 3CX6A 3FYHA 4Q7KA 4A0FA 1AQUA 3FFBA 4B3BA 1RRCA 1U2RA 2IYLD 2IUTA 1RPZA 2RGBA 1ZIPA 2MSCB 4US2R 3AKEA 3QENA 3ZQJA 1D2EA 1Z2CA 2KSQA 5GVRA 3U2QA 1N0WA 1VYVA 3IILA 4NYIR 4DSTA 3QPUA 2IYUA 4A4DA 4F91B 2ZEJA 4KVAA 4JBYA 5TMPA 2NPIA 4DCTA 1XCPA 2QNRA 4IXMA 2NIPA 2J3EA 1L2TA 3NIBA 3GLFA 4MKGA 2V1XA 1NBMA 1X8KA 1ONBA 2AFHE 2WV9A 2ZU6A 1A5TA 3MLEA 4PC7A 3K8YA 1G1MA 3CWZA 2GJ9A 2VHJA 3WNBA 1P4SA 2DFNA 2ZI6A 3QF7A 3IO3A 3L8YA 2I4IA 3R8CA 1XFAA 2QTHA 2R9VA 3KFXA 5CIQA 3CZQA 3FMPB 3C5HA 1JEDA 1ESMA 4MYTA 8OHMA 3VNUA 1DTSA 2FJUA 1KI9A 1CJTC 1NY6A 2IHYA 3CB4A 3R7WA 2ZAOA 3QUSA 1M2OB 3TUJC 4OBEA 5JRJA 3JVVA 3K53A 1ZM9A 4ARZA 1YJ5A 4OK5A 2O8CB 5KSZA 1Q44A 5DIFA 5EE3A 4RD2A 1U94A 4TWZA 3ADCA 5LDDC 2FFBA 1UF9A 2GTPA 4Q03A 4TMZA 4D4LA 3Q3JB 5JWRA 3IPYA 1MH1A 5JS8A 3GFPA 3LW7A 4KYIB 3T15A 4BEJA 1CR1A 2XTNA 2REOA 4IRUB 4OQNA 2CJWB 4DWJA 1Z06A 4RKEA 2VA8A 3O8DA 4ZV4A 2D3WA 1WDTA 3EC2A 2WMNB 2CXXA 3CKLA 4YXWD 1W46A 5BN3A 3I61A 2JLUA 2BM0A 4D82A 2IL1A 2D4HA 3Q9LA 3B85A 3LVQE 3MG9A 2E87A 1QHIA 3DO6A 2H5EA 3AVUA 1N6OA 4QFMA 2OFWA 3AUXA 3RS0A 2R65A 1Z6XA 3HU3A 1G41A 1YZTA 4MRSA 2B7BA 1SKYB 2ODEA 1J8MF 1FX0B 1P2VA 2ZS8A 3DVLA 3L0OA 4OQXA 4GOKA 2EYUA 1Q21A 3B13B 4DLWA 1E1QA 3BD9A 4QG7A 4ZIRA 3BH6A 3C7KA 4MGIR 1E2DA 2FPMA 2W2TA 1XDBA 3GD7A 1OFHA 1W2HA 3QKSB 4WXRA 4P31A 2EYQA 1TTTA 2Z6VA 4DSNA 1VHTA 1SXJC 3AB3A 2IK8A 1YR7A 2H1LA 3BFVA 4DLTA 4TL8A 4JLNA 3RAPR 1EFUA 2ASEA 1KJWA 5JCPA 2HT1A 5H1YA 2PH1A 1SVKA 4XD7D 4GI7A 5CM8B 2G77B 1Q1ZA 4BLPA 1CKEA 4C7OA 2BDTA 4Q1AA 1H8HA 5GJCA 1T3HA 3I4LA 3K9LA 1SVWA 1U98A 4DBLC 4TYNA 4LZZA 1Q22A 3LO5A 2OCAA 2F55A 1E2HA 3REFA 2ZJ2A 5JCZA 4B74A 1J8YF 5HZHA 1VDZA 3RS2A 1W4BA 3GJ6A 2WWFA 3FVQA 3FWYA 5JECA 4DCSA 1KI3A 2HXSA 3BJIC 5CIWA 5E4FA 4C2UA 4BZQA 1P60A 1S8FA 3P1JA 2J9RA 3K0EA 3KKOA 4KU4A 2ZUBA 1ZNXA 2CEAA 3BFXA 2F3RA 4OQMA 4Q02A 1NIJA 1Q1QA 3DKPA 4KITB 821PA 2FZLA 3CM0A 1E1RA 2YC2C 3KDSE 2J45A 2QAGB 2WOJA 2VP4A 3TLXA 1HE8B 2BJVA 1VHLA 4XVQA 2ZUDA 2JATA 1DE0A 4AG5A 1LNZA 2EFEB 2J0QA 1CU1A 5KPDA 3CWQA 1FUUA 2HV8A 4V0NA 2NO1A 4ZIRB 3UPUA 5HKKD 3NDPA 2RGCA 4B2LA 3U7HB 2XSZD 3SFVA 3EG5A 4QHSA 1G7SA 1NSTA 4GRAA 3UANA 3TNFA 2GZDA 4B3GA 3B7GA 2I1VB 2B6HA 4TMWA 2Q3MA 4Q9IA 2XOKD 2KB0A 2Z4RA 3Q85A 4V03A 2VHTA 3IIMA 4LWZA 1Y3AA 3FFAA 4C4PA 2C78A 3C41J 2GBLA 3DMNA 1T4GA 2ZSBA 4MRPA 1N6PA 1JI0A 1GWNA 3AQ4A 1QZXA 1FMLA 1VCOA 1ZINA 4YMUA 4PSKA 3M1IA 4B32A 3GLFB 4AWXA 4DZZA 3X1YA 1ANKA 3RDPA 1C4OA 2A78A 1VCIA 2V1UA 4WZAE 4KFSA 1OIVA 2FSGA 2BBWA 2OCPA 4PQFA 1XEXA 3K0AA 1W47A 3CNLA 1XXHE 3KJEA 4C7OB 1KAOA 2EWVA 4NE2A 2QMHA 4WA7A 3RRYA 3CX8A 2VHQA 4LUCA 4I81A 4B2PA 1D2MA 4JYBA 1F48A 4JLMA 2XXAA 1S96A 2ZVQX 3AVVA 2FDCA 2VYFA 3W6OA 1F6BA 2WSMA 4BZXA 4R2IA 1VG8A 4NL4H 5GADl 1ZUHA 4G3XA 4IEIA 3NH9A 2DWPA 1P62B 3AF1A 3KUCA 2IT1A 1Z3IX 3NWJA 4ON9A 5FL3A 4PQYA 2GK6A 4Q1FA 1WE2A 2W0MA 2WJVA 1UADA 2V54A 2QAGC 4GZMA 4D4MA 1N5JA 1N0UA 4QBIA 1E2IA 2IYWA 1KAGA 3KJHA 5F2EA 3QBVA 2YJTD 2ZJBA 3EZ9A 3U6BA 3IHLA 1AGPA 4NYMR 2RHDA 2W2VA 2IYQA 3KKMA 1OB2A 1UM8A 2EFDB 2BMFA 2ZPTX 4L8GA 4URXR 3NBFA 2QT1A 4ESVA 4HB3A 3T61A 4US1R 1PJRA 1XJ0A 4TT3D 2QZ4A 1Z6TA 5GJBA 1MT0A 2HXYA 5JSZA 4FXPA 3BS4A 3JZMA 5G41A 2QSYA 4ZDWA 3SFZA 3EA0A 3K70B 5EP2A 1N6KA 2ZSFA 4FCWA 3M0EA 1E1RD 1UKEA 2YINC 1MRNA 1Q20A 1DARA 3A6PC 4IFBA 2PCJA 5C2JB 1WBDA 3TK1A 5TY0A 4TSFA 4C0SA 4CEHA 4TZ0A 1HEIA 3VQTA 3EASA 3P20A 4R2HA 3HU1A 2VHCA 2ZJ5A 2VP0A 5TVKA 1ZRHA 3R20A 2NZJA 4H1UA 4EPWA 2WOOA 4PHTA 4RD0A 1U81A 4TMKA 3NBXX 3O8BA 5EJEA 4JLJA 2X2FA 2QMUA 1ESNA 4PAMA 2LWIA 4A9AA 2FWRA 1J70A 5AJZA 2IXGA 1KI6A 5DN6A 1US8A 2GEUA 2L0XA 1GNPA 1G8GA 3G0HA 3CBQA 3WBKA 4B47A 4DDUA 1UKVY 4PO9A 4A2WA 1GM5A 2ZSAA 4L9WA 3W8RA 4OQFA 5CYOA 3NVAA 1BYIA 4M1SA 2VP9A 2KE5A 2WVJA 2Z83A 3I72A 4YONB 4HLUC 1T8TA 1OYWA 4MDEA 1E94E 2I3BA 3EWSA 4JKIA 2CNWD 4KV9A 4OL0A 1KY2A 2OLJA 4B34A 4BLOA 3NBYC 1B23P 2OBMA 5CDFE 3ZIAA 1YR9A 1XD9A 1II0A 4NMMA 4B73A 4DEXA 2O0KA 1II8A 1W1WA 2FX3A 5M04A 1A2BA 5DI9A 1G7RA 1NLZA 4P4UA 4S2EA 4TMVA 2MMCA 3OF5A 1H8EA 4DHEA 3UWKA 1ZJ6A 4KSCA 1ZU5A 3R9XA 5J40A 3RWMB 1G3MA 4JL6A 1F2UB 2P3SA 1XNJA 2BC9A 2JLWA 2GCOB 4QM6A 5KO2A 3TRFA 3IBYA 4W7SA 2QA5A 1VPLA 5FOWA 4RFVA 1IM2A 1P9NA 2FPLA 2RGGA 1YR6A 2WMOB 3T06B 3GLIA 2ZU0C 4Q4AA 5JLJA 1EXMA 3DOEA 2NOAA 3ZYCA 521PA 4A0RA 2R8RA 3U3JA 3U61B 5FTLA 4FMDB 2BCGY 1GKIA 1Z0KA 2WAXA 2YKGA 1E4YA 1IN6A 1X1RA 2IF0A 5FI1B 4FMDF 4GPTA 3HR8A 1RJ9B 1QVAA 2IC5A 4IDOA 4BFXA 3OIVA 4GT1A 1VCNA 2XTZA 4LGMA 3LD9A 2VH5R 3H2YA 1P5ZB 4ZKEA 1J2JA 1OPXA 3GEEA 1N3BA 2AK3A 2ZI9A 4PZLA 2GZAA 3TAUA 5EUMA 2V9PA 5AR1A 4YDHB 2QSZA 4TTQA 1JALA 5AJWA 3BB4A 2J46A 1N6IA 2H92A 2ZE6A 3QXSA 1E99A 2FFHA 3LNCA 5B2ZA 2REXB 5FUYA 3ADDA 2WJGA 3U3RA 1J7KA 4NCKA 3QEOA 4NBSA 2EVWX 1ZNWA 4A0HA 1L7VC 1DOAA 1M6NA 1CBUA 1N25A 1U8YA 3ZGXA 5JZVA 2JIZD 3BWDD 4M9SA 3THXA 1EX7A 4RJLA 3AM1A 1XRJA 5BXQC 5EZ5A 1ZD9A 3SS8A 2QPOA 3UG6A 4F4JA 4LI0A 5FOXA 2X2EA 3MRSA 2PCLA 5KHOC 5DLQC 3AVXA 1T0HB 4KVGA 5B64A 3U7EB 4MQBA 1A82A 2REBA 4LDJA 1GVNB 3HDTA 4K8OA 3ZQ6A 1ZM7A 2OFXA 3LBNA 3Q5EA 4CT5A 4QNRA 1JPJA 1SKYE 2XTMA 4ACAA 4NYJR 4LYFA 1K5GA 3AVPA 4RZ2A 4OYHA 1E98A 2GEVA 4MYHA 4UNSA 2GZHA 4AYTA 2QROA 3RYTC 1DEKA 1FMJA 1SXJE 2IA5A 1ZAKA 2RGNA 2GA8A 2IW3A 2ZTSA 3KXLA 3T1VA 4I99A 1NNEA 4LYHA 4W5WA 4HAVA 1HT2E 4M21A 1OH5A 4XIGS 2D74A 2YOGA 3TR5A 1TF5A 3BBPA 2DB3A 3GJXC 4I1OA 2OE2A 1LB1B 4Q7MB 3ASZA 4D81A 1KYIA 1Z29A 4QRHA 4BE7B 4BRUA 2C5LA 6Q21A 3QEJA 2GWHA 2BKUA 4QHYA 4CEJB 4AD8A 5BN5A 1AS2A 2JLRA 2ODNA 1P2TA 4ERNA 1UJ2A 1GAJA 1QBKC 2OHFA 3VU9A 3NHBA 2WWXA 1KDTA 2WJYA 2KBFA 1PV4A 2J0VA 4E22A 1T9HA 1VIAA 3BH0A 5JHHB 2RGNC 3B9QA 2ZETA 1VTKA 5L8VA 2ZE7A 4X8HA 2XZPA 1KI7A 4Q9KA 4EJSC 1KSFX 4TQUS 3T5DA 3THWA 3LX5A 5E7JA 5SZJA 2IYVA 4W5JA 5JWOA 4HUQB 2JJ1D 2SHKA 3LH5A 5AUOB 4RKFA 4MRRA 4TYQA 4OI1A 3CRW1 1ZYUA 4LY6A 4M2LA 2XXAB 1GRNA 2IWRA 1TX4B 4QBFA 1JR3E 3UIEA 3QKRA 2OCYC 2PBRA 2CE7A 1G18A 1U0LA 2X77A 1AM4D 3NXSA 3BGWA 2VSXA 4XJXA 4P4SB 3TKLA 5DSZA 1G20E 2A5FA 4AURA 1DAFA 2RGDA 4LHXA 5JEEA 1R0ZA 1Q3TA 3E5HA 1FNMA 1NLFA 1BH2A 4I1UA 3FTQA 5CJPA 4F4CA 3AP1A 2B21A 4OI4A 4TQ9A 1UDXA 3KQUA 3TSZA 4IDNA 2A3RA 2CHQA 3PVSA 3NTUA 1K8RA 2AK2A 2FGKA 3FDIA 1IQPA 5KSYA 3ETLA 2AXPA 4Y0VA 1D6JA 1JJVA 3D7MA 3NKVA 1BMFD 3FKQA 4PSAA 1X1SA 1U0HC 2QL6A 2WWGA 4BFWA 2WSSD 1LTQA 4L5BA 1WBBA 4R9UC 5FBVB 2BIFA 5IDVA 5KDOA 3ICQB 1NMYA 1U8AA 1UBCA 1YZKA 3CRRA 4PC6A 1P2UA 2QP3A 4M53A 5IT5A 3IEUA 4PC3A 5EE9A 2ZYWX 4B35A 5AUNB 1F2TB 2OSBA 3W6NA 2NG1A 4BRWA 4LJYA 3GLHA 1LV7A 1R8QA 4TYPA 1P9RA 2ZRKA 1E9SA 3QSYA 3TQCA 4A2PA 1FW6A 4B75A 1O87A 2G9NA 5UKDA 3AF3A 4DEYA 2ERXA 2BBTA 2UZIR 4GZLA 2P6RA 1M7BA 5LPNA 1IXSB 3GCGA 4M0LA 1CIPA 1R5NA 5HTKA 3CONA 1KO5A 4M1TA 4Z1MD 2GJ8A 1E0AA 4HLQB 1KDRA 1S1CA 2JDIA 4PXAA 1HH4A 2Y8EA 1XEFA 2PLFA 2W00A 4DB4A 4B33A 4O3MA 5C4MA 4JKYA 1FPMA 3Q5DA 2QPTA 4FWIB 5G40A 3B60A 1RIFA 3F5FA 5LD2B 1P73A 2X8AA 1UBEA 3W6PA 1NBMD 3K0CA 2UVQA 4TT3A 4Q1BA 1HE1C 3RS5A 1GL9B 3P26A 3SR0A 4Q4JB 2F1JA 3FMFA 2P65A 1CRPA 3QJYA 1XTKA 3GEIA 3PV0A 2O8FA 4LJ8A 5C4GB 5E3HA 3GEHA 4EFMA 1ODFA 2A5GA 1PLJA 1R6BX 4BUJA 2W58A 4X8OA 3CRVA 4Q4HA 1YRAA 3MGCA 2QM8A 1MV5A 3AVWA 3I5YA 1DBSA 1QHSA 1L4UA 3IQWA 1GSIA 5EQTA 2O8DB 1DELA 4N1AA 3EIHA 1UEJA 4G0NA 5HKKA 2QP9X 3KQKA 1SXJA 2HCJB 2R6FA 1TNDA 1EG7A 3N5CA 4AIIA 1Z8FA 3THOA 2F6RA 5EP4A 4LCBA 3AF0A 4OQLA 3CH4B 2JGNA 2DWQA 3LLMA 4QGAA 4JVMA 2AWOA 3SBEA 1Z63A 1ZUIA 1N6HA 5G3YA 1M1YE 5EUQB 3RRNA 5J4KA 3DMDA 4F38A 1TF7A 3HYRA 3LBIA 1G8HA 2E9SA 1XMJA 2VF8A 2O8EA 2JLVA 2O0HA 2ZE5A 4GNKA 4H9GA 2BCJQ 1IN5A 1G6HA 4TLDA 1JB1A 3CF6R 4C0KA 2CNWA 4LC0A 3V00A 5FTMA 1W4CA 3SYNA 4AKEA 2IS2A 1NN1A 2RH5A 1KI8A 1W4RA 2W6IA 3K9NA 3GLGE 1I4TD 1MO5A 2C95A 3L43A 1T0JB 2ZRDA 3Q8XB 2EFCB 2GCPA 5CDFA 4BWYA 3AVYA 5CK5A 2XJ9A 1BKDR 4YXWA 3U5ZB 2CVFA 4HATA 5FTNA 1PVOA 2IUUA 1NVVR 1V43A 3PITA 3OHMA 4I1SA 4KBFA 1CTQA 5C46F 4MUAA 3GP8A 4MDFA 3THYB 3WY9A 3TW8B 4RD6A 1UKYA 1Z0IA 3FHCB 4OHZA 4NZYA 3DDCA 1TU3A 2HF8A 3QPVA 2FFAA 4DCUA 3L8ZA 4Q9HA 5HCNA 3KQLA 1AQYA 2CL6X 1YZNA 1KZ7B 2HUPA 4NYJQ 1P9WA 1E2PA 2QGZA 2Z43A 2QY9A 2ZRIA 1YZQA 1S1MA 2XSZA 3WMGA 1E1QD 4EPYA 4NYMQ 5DHFA 2PT5A 2ONJA 2GBLC 3QKUA 4UXJA 1Z47A 1Z07A 2OBLA 2P5TB 3GFOA 2QP4A 2B8WA 2HJVA 3CX7A 3QXHA 4PHHA 4ZDIA 4L15A 4JMPA 4NU0A 1T6NA 4IOLA 2XX3A 1OT3A 2IF2A 2QEQA 1CR4A 1MO3A 2A5DA 1XJQA 4CEIB 1W44A 3QF4B 1H8HD 4Q47A 2FPKA 2OM2A 3CPEA 3A37A 2BBOA 1BOFA 1E2EA 4NCJA 2VP6A 5IK2A 2AD1A 3SQWA 3MD0A 2XNDA 4ABYA 1E9EA 4BLSA 5EXTA 1ZC3A 4TQAA 5EXXA 3AEZA 4TN1A 4NTZA 1KJZA 3LX8A 3B1YA 2B92A 4YDSA 1OHHD 2O0JA 3UATA 1D2NA 2HYIC 3PCRB 5SZKB 3T34A 4XWOA 3VR2A 4A6XA 1S9DA 1OSNA 4B3DA 1SXJB 1VG1A 2HEIA 1E2NA 4BASA 2NTYC 4NKRA 2FU5C 3UMFA 2QM7A 3FPAA 4KYUA 5K8IA 4BECA 1NY5A 1CULC 2ZANA 3EIEA 4AK9A 2ATXA 2UZ3A 1OXSC 4IOMA 1RRPA 1RYHA 2HCBA 3VAAA 2W83A 4MITA 3KXKA 1Z6AA 3L0SA 2XNDD 4C0QC 2KWIA 3GLHB 1IN4A 2IXEA 1DAGA 1TAGA 3OAAD 2C98A 1ZW6A 4G5SA 1NVUQ 2FOLA 5J4YA 1Q3HA 4PO1A 3TMKA 3ZD7A 3JZAA 5FUXA 1JAHA 4QC2A 1E96A 1UBFA 2P0EA 4Q4JA 4TTRA 3ZJYA 4ZO4A 4WAUA 1IY2A 5LB4A 2VLIA 2A7QA 3GQBA 1SVSA 2YWEA 2ZI4A 2P6NA 2QAGA 3WNCA 1IAQA 2PMDA 2QE7A 2W2XA 1XEWY 2C8VA 5L3VA 2ZUCA 1JR3A 3P4YA 3ADKA 1QHYA 4TLCA 2JLZA 1XMIA 1XTRA 2HDNB 3GMTA 1D8TA 5KOYA 2Q21A 3VR6A 2EWWA 1B0UA 1GOTA 4FCVA 3K0FB 2CHGA 3OFNA 4URYR 3T1TA 4LX0A 3I62A 1QHHA 3RRMA 4KFUA 3IEVA 4HAUA 4C30A 3EPLA 2Q0HA 4JIMA 1OFTA 3OEED 1EFTA 4PZYA 1G7TA 2WBLC 4CDGA 3F0TA 4M9QA 4PPFA 4RY2A 2AR7A 5AJVB 3KTAA 1UDWA 121PA 2AL7A 2GAOA 4LJAA 5EP3A 3QKRB 5FOSA 5H8WA 2CK3D 3OZXA 1W36C 3AVOA 2D06A 4Z8XA 421PA 1NSFA 2VSOA 4PPQA 4DDWA 1S3SA 4KODA 5KNBA 1EX6A 2WWIA 4KXFB 1KY3A 5DO9A 5FBWB 4A2QA 1XPOA 1OF1A 3TAHA 3TVDA 4EQ6B 4QM7A 4KFTA 1MRSA 3KL4A 4TLAA 1GFIA 5JJLA 4UNQA 4XSGA 4N3NA 1DAIA 3H4MA 4M1WA 5K8TA 4GDFA 2WKQA 4QHTA 1LVGA 4IVPA 4A82A 2G83A 3U7GA 1GRRA 1AZSC 2NGRA 3ZVMA 1GNRA 1OLOA 2ZR0A 3P32A 2D2FA 2Q9AA 3NHAA 2VP2A 4RCYA 4R98A 2FE4A 4LBWA 4RCZA 4QJ3A 2BEKA 1GL7A 4LJ7A 3VR4A 5JMTA 3QBTA 3ZH9B 5SZHB 2DWOA 4JL5A 2CL0X 2BVNA 4YLGA 2CK3A 4CEJA 3I3SR 3LFUA 5DN6D 5KPJA 2ZXUA 2AN9A 4C2TA 4PC2A 2FFQA 1P6XA 4NH0A 5AWFC 3BORA 1HY3A 5BYKA 5B57C 5SZIA 4OHYA 1E9DA 1VG9B 1W0JD 1Y63A 1DG3A 2WZQA 5AUQA 4DDVA 1G3IA 4DJTA 2VIIA 5BWMA 3I8SA 5JSZB 3CNNA 4KAXA 2C77A 3H1TA 3SHWA 1KNXA 3KXIA 3PUXA 3PUVA 4WVFA 4A92A 2IYZA 4LJ9A 4TYWA 2QU8A 1X8JA 4Q7LA 3LBHA 3EPJA 1P3JA 1NN3A 2GJSA 4RZXA 2ECKA 1NRJB 4WW0A 3GLIE 2KI5A 4JLDA 4W5HA 1XB2A 3VR5A 5HE8A 5DYIA 3FHTA 4IFEA 2MSDB 3RVBA 1XZPA 1AIPA 4IDQA 2P2LA 2GJAA 1TF2A 3C4JA 5FBQB 2ZRLA 4Z1MA 4DT1A 2VQSA 1G64A 2QE7D 2WPDD 2XB4A 4J0QA 1E2MA 1F60A 1W0JA 1I4LD 4UXIA 1RRGA 3V9PA 3A1SA 5KDDA 2WWYA 3GJ0A 2NPFA 4FCTA 1KNQA 4QNMA 5FPTA 2J7KA 4BZPA 4AY2A 5FTKA 2R6GA 2B7CA 3K0CC 2J0SA 2B8TA 3VKWA 4G5OA 1LY1A 1G5TA 2ZJYA 3A36A 1KO4A 1ZVQA 2NO9A 2PEYA 1JPNA 4P33A 4LHWA 2IWHA 1QHNA 2H8KA 4ZI3A 1QHHB 4Q1CA 1BO6A 1GDDA 4UNRA 3ONWA 3W3ZB 1CJVC 2DCUA 3CRQA 3EARA 4FIDA 4ITRC 2WJJA 1E4VA 3A1TA 2G1KA 3SEAA 3W8NA 3WNDA 1MABB 1NJGA 2GKSA 3VKGA 1RJ9A 3IBGA 1MKYA 3QXXA 2ZRAA 1M7GA 2QRZA 1X86B 1QRAA 2IS4A 1RYFA 2OILA 1OE0A 5L3RA 1OH8A 4DIEA 3AF4A 5FTJA 4Q4AB 3L82B 1LS1A 4LYAA 2JLYA 3NEJA 3THWB 3W90A 3AGQA 1MO6A 1FQKA 4XVUA 2C9YA 3FMIA 3X1XA 4CIDA 2ZR9A 1F3OA 2FA9A 4LPSA 1XJCA 3WYAA 3Q72A 5F9FA 2ONKA 1OXVA 3N2IA 4AG6A 1CJKC 2HF9A 4N0EA 5CLQA 5FPSA 2GCOA 3MWJA 4RFSA 2O52A 3AGPA 4XH9B 5JHGB 5B58C 5E95A 4NCIA 4DCVA 1WP9A 4LHVA
chains in the Genus database with same CATH superfamily
3B2EA 4JLPA 1Y7PA 4OUKX 3RFUA 4OSOA 3RTBA 2ZAMA 4QKQA 2V0CA 2SKDA 3OEYA 5K20A 3C3WA 1YHYA 1YRWA 2WA1A 1H0HA 1EINA 2BMJA 1LDNA 4YRDA 5LYJA 4M1OA 3U60B 4HNUA 2FNAA 2J5QA 4JBNA 3U9LA 2YXDA 1ODSA 5T67A 1R2QA 1KEPA 4CRWB 3PRKE 1AO3A 5KNCA 1SD1A 2JLBA 3IT1A 4P2BA 4X9XA 2ZSIA 4N5HX 4HNVA 1B6SA 4A8JC 2CXNA 3B1VA 4JS0A 2ZJ1A 2HRDA 3VPDA 2AEJA 1CUJA 3JQCA 3V7NA 1KEZA 1HORA 4HTFA 4BNMA 2YOHA 3DLAA 3CE9A 3R3WA 3A1DA 2Q7OE 3RLIA 3IXMA 4Q48A 2JEZA 4EZBA 3QPDA 1B0AA 4EG7A 3ZCQA 1NXSA 2Z2ZA 1FS6A 1VYHA 1ZIDA 1CXZA 2NTVA 3NORA 2HEGA 3O3CA 4QUHA 1UPXA 2F48A 5H16A 4DSZA 4C5AA 4Y2TA 1NVFA 1OR8A 1NQUA 2FMUA 1L7PA 4UEWA 4DT1B 2QX7A 1DBVO 3HI6A 1H0SA 5A71A 1D6MA 1KU6A 4HB4A 1W1IA 1R0XA 2OAP1 3I6YA 3UJDA 4M55A 4ECAA 1QHGA 3O90A 3WIEA 1MFZA 3IAAA 4EG6A 1AH2A 3X1MA 1FS4A 3V1LA 1FSZA 4ZAVA 1WETA 4B09A 4KV7A 4AS1A 4EA7A 3ANMA 4Z7JA 3DZDA 4ZAZA 1BSVA 1T8WA 3CF0A 3IS3A 4M8IA 3U80A 1DC8A 4TVBA 5AQ1A 1O94C 2WTUA 1BJTA 1QFMA 4O4JA 4MVWA 1RWMA 3SHFA 1P2GA 2PIDA 2XRYA 4RY0A 3RARA 1RRKA 5MDHA 3KD3A 3HRHA 1ESCA 2Z95A 3EAQA 2NO0A 3OZUA 5ILQA 3N2KA 3S99A 1ORHA 1WB4A 2C2XA 4BB6A 2P0AA 3EGDB 5K7SA 3AFIA 3GVIA 2JARA 2JCSA 2QV0A 2BEVA 2VPXA 2FUCA 4GM1A 4JJKA 4RD1A 5DHAA 3RS7A 4ASUD 3GJ3A 3PNBA 3X1WA 2COEA 2HV9A 3O4JA 1RHMA 1H94A 2RGAA 4PZDA 4XD7A 5DYGA 3UN1A 4BFYA 4P7FA 2E7ZA 3C70A 2YV3A 3AL2A 4ZCMA 4IDPA 3WP1B 2O2HA 3FLMA 2ANCA 3NM6B 1I8TA 1M34B 2WFZA 1LCIA 2BAGA 2XDAA 4LQLA 4NONA 2W6JD 2HT6A 4Q0MA 5FX2A 1N5MA 1UP6A 3GRRA 5TXGA 3DDUA 2A14A 1QUEA 1UPFA 2FSIA 3SHQA 3BSYA 4UD2A 4ID9A 1AKEA 1E9VA 4X8MA 3HB1A 1H0RA 4Z9AA 3S1AA 3DDHA 5EJMA 1ST2A 1ZGBA 2C5SA 1JG6A 4L6IA 3F3SA 3R3YA 3KB1A 1RYDA 1DMSA 5JCJA 2ZYDA 13PKA 1QDLB 2G76A 3MJFA 2ES4A 3OQHA 4NXNB 2L42A 4AUMA 3ZC3A 4QGBA 5JR3A 1MO4A 1JJBA 1YUNA 1NLMA 1PZFA 4WBNB 1WKBA 4UJ5A 2R751 4QXPA 1G8FA 3WQBA 1L7XA 2C29D 3DW1X 3IDOA 1NUPA 4FOSA 4GG1A 4LOHA 5AJUA 3O94A 3ZX5A 1SVMA 4RS3A 1FJXA 4Q3NA 1W9HA 2YN4A 2YJ3A 1UC5B 2ZUTA 2HAEA 4F72A 4CM4B 3FZYA 5EXSA 4D41A 1I7NA 3LY5A 2QMEA 2AXNA 2POCA 3W5IA 1YI0A 3STVA 2E1RA 1O95D 1RABA 2A57A 5EMJA 5HS4A 5JZOA 4BQSA 5J4VA 2BBSA 4XGKA 4UVDA 3I83A 3ZHYA 3DBRA 4JUIA 5JYEA 1U3GA 5I5GA 1SVIA 3AOEC 4GU5A 4Z4GA 1L5LA 2G8LA 4LXGA 4TV8F 3H5RA 1FP6A 2VCYA 3E2IA 1V5IA 2WTBA 3FKSD 1E9FA 1KK0A 1TB4A 3RSQA 3LLSA 1QFYA 1IRXA 4Z99A 1OBFO 4EK9A 4F06A 1A9XB 1GAWA 1KFCB 2YZNA 1QFXA 4A6PA 1DKLA 3PDJA 4J75A 2GJ4A 2QU7A 1XXHA 3MWDA 4UEQA 4ZVRA 2DR0A 4NECA 2GA9A 3S28A 3GUZA 1Q6ZA 2B5VA 5GONA 2HTFA 4N82A 1R0CA 4FZ3A 4JLKA 4UMDA 1Z4KA 4CKWB 4EH1A 3L79A 4Q01A 5KAMA 3ID6C 2WJHA 4KGXA 2D1TA 1UMDB 1G8YA 1DTWB 2B8EA 1M2GA 2YNMA 3A3YA 2IPMA 3ROEA 1TI7A 1LLQA 2PKCA 4O59O 3EZFA 1EUCA 2Y93A 3KJXA 1Y6ZA 4TXLA 3I73A 4NCHA 2DFTA 3LQQA 5CJ2A 2Y1DA 1GYRA 4KWCA 4Q18A 4A8TA 3AF6A 3QYPA 4ZT2A 1MRZA 2H7XA 3IP8A 4XOIA 5FPHA 4TL9A 4OAOA 4ZHQB 1H8ED 1ZP6A 2YYAA 5JD6A 1HF3A 2O20A 3FKSA 4KNWA 5SYAA 3JAWA 4FKBA 5B3KA 4XQGA 1Q57A 3WQSB 2Q4DA 5CLLA 1BQ4A 2J33A 3THXB 5IASA 3JR3A 4TWBA 3PBKA 2R87A 2GM5A 4KH1A 4WIAA 5ENDA 5THXA 3WWCA 4C4SA 5L3QA 4R1PA 2WE8A 3QNWA 1KK3A 3ZHCA 1K66A 2NQ8A 4JVSB 4KKXB 1GXSA 1KMHA 5F2NA 3ZOKA 1TYEB 1WF6A 3TXAA 1N8KA 3IESA 4QGHA 5JH7B 3E22B 1KF0A 4LOAA 3IH5A 2GD1O 3AHEA 1JYSA 3BFJA 1AVTA 4YDRA 3J81A 1JGTA 2CEKA 2HWWA 1E79A 1NXXA 4Z4CA 3D7NA 4P4SA 3SQNA 3AP2A 1GG9A 1USIA 5FBRB 3WGYA 2OC4A 3D3JA 1U0EA 1BE8A 3PDIA 2VXYA 3F7MA 3V2GA 4ZVLA 3VI3B 1RE0A 5CB6A 1JMVA 2AVNA 1ZI9A 1S3IA 2YBEA 5C5CA 5FAXA 5CA0F 1VZ3A 2PNJA 2GN8A 4R5MA 1TMGE 4TS1A 3WHIA 4YMWA 4CIVA 1KDPA 1FQJA 1FRQA 3RK4A 2H2DA 3Q15C 3VZRA 1M2HA 1JG2A 1XKQA 3EHEA 2G28A 2I1LA 4Y8VA 4BB0A 4KFCA 4GYKA 4KTTE 4AXBA 1E1DA 2VK1A 4RPIA 3RAEC 4EJ0A 2XGJA 3H13A 5EZSA 4GP9A 4UDYX 1J20A 1NFQA 4J1QA 3WRYC 2LCQA 4BN0A 3ZWNA 4EPXA 2QQ0A 3QFRA 5CVDA 1JIVA 1PUXA 4MW7A 1VRCA 3I76A 1NR7A 1L7AA 1IJFA 1W49A 2DY1A 2IOYA 3IAXA 1O95A 2X22A 3JAKB 1TJYA 3LECA 2WIBA 4H1VA 4H3HB 3MWDB 1U0BB 4ZOEA 1XF1A 4OP1A 2C03A 1PNTA 3M81A 4KQHA 1GAEO 4NARA 4Y0AA 5CDGA 3LY7A 4G26A 2P40A 2WF5A 3M9WA 1OI4A 2C1ZA 3AIOA 1WAMA 2CLDX 3P94A 1OY1A 2G0TA 2VQ6A 3IIJA 4JBIA 1UIMA 4RHUA 3F73A 1FFDA 4WDRA 3CMMA 3RE1A 3VYTB 1BKYA 2AHOA 2RBGA 3VKVA 5LMNB 1I4DD 5JNRA 1PIWA 1O0BA 2G0AA 2YWHA 3IPXA 5EKTA 4OEHA 2XH8A 3E7FA 3QU7A 3N2KB 3VJKA 5FORA 5A4MS 1O2DA 2J31A 3ESDA 4FLFA 3WIDA 1J8VA 4I3FA 2AE1A 3EXFA 4IXNA 2C0QA 3EA5A 4JLVA 3QG5A 2H2IA 3QFHA 5AJXA 4R2KA 3AETB 4K9RA 4RX1A 3PFKA 1QONA 2HR1A 4RORA 2PZEA 3PNYA 5F76A 2H63A 1YS7A 4ZHSA 2HL6A 1G21E 1XDUA 2OHJA 2P75A 1IJKA 3H83A 3OZDA 4LC1A 1NI3A 4E7OA 1WMSA 3W78A 2HIAA 1JE1A 4ECEA 4S1WA 3TSYA 3F3YA 4JP2A 5JPCA 3FWZA 3RS8A 3TCXB 2QIPA 2I1WA 2Y67A 1UZLA 3HWSA 3L0IB 4JR2A 5JQWA 1FDOA 2J0UB 1OCEA 4C22A 3COVA 3AR5A 3PSAA 3QKSA 1VP3A 2H1VA 2RB4A 2B0JA 4FHDA 1MQAA 1H3EA 4JI7B 1F2UA 3A4NA 5DNAA 1KSGA 1R6VA 1J9EA 1ONNA 1R4NB 3UQZA 4AX4A 3BJZA 4MQ6A 4O4LF 3WGTA 2QVLA 4ZYXA 2AW5A 3UWOA 3PYLA 1OXBB 1Y5LA 4C76A 2PWZA 1TECE 1IEXA 1FP1D 2V55B 1NTOA 3L9XA 3LDFA 4K6OA 4QODA 3WK4A 5ADVA 4D25A 3UEOA 1ZU4A 4Z4IA 2E18A 721PA 3FOZA 3GGJA 3H18A 1W2WB 1RR6A 5B55A 2OXRA 3LVRE 1VI5A 2Z2YA 2G0NA 1KYXA 1VE7A 3HLTA 1JAYA 4NNOA 5KTKA 4RVCA 1B76A 4G5RA 1MXFA 2VF7A 4RTOA 1IDOA 1NONA 1ES9A 1AXRA 2DOKA 3EGEA 1KZGB 2JIQA 2HSGA 3FF4A 3KKNA 4JEHA 4KW7A 2PJRA 1EJ6A 3NOQA 3RYIA 4N0PA 1Y8ZA 1V5GA 5AQEA 5AKEA 1SG9A 4D56A 3OBBA 1F9AA 2BHRA 1N57A 5TPZA 2DKOA 4I6GA 4GBMA 2H31A 4EW1A 5AW3A 4GP6A 1YJXA 4HSGA 3QOFA 3L06A 1N33B 3C39A 4ZJYA 2EU8A 4W82A 5BQOA 3DJYA 3AEQA 1S5PA 2HLDA 1WCIA 2V97A 2W0SA 3FHLA 3IIKA 4DGSA 4F6CA 1S02A 4OAQA 2C96A 2FLKA 4QOSA 2WVGA 3RGWS 2Y2UA 1ITZA 3QPCA 4F2HA 1B16A 2H0QA 2P3QA 3GZJA 3RJTA 1VYUA 3M7IA 4AMBA 1XZAA 1FRVA 1BH6A 3REGA 1D9XA 3N3BC 1KS2A 2H1CA 5IVPA 1NQWA 4BGVA 4NCAA 1JSCA 2X3FA 5CYPA 3V4RA 4U4AA 1QTQA 3EGXB 2CWDA 4NCNA 2RGRA 1RHQA 1HDEA 2O2EA 2PEZA 3M2TA 3U4QA 3EXEB 2PZKA 1GZSA 1ODIA 1HNWB 4YCCA 1ZGAA 4C9BA 3DV9A 4WOKA 4BGEA 3OWOA 4ENRA 3FSGD 2H18A 2ZITA 2H00A 1J9ZA 3EXIB 1W75A 3DFUA 3P4XA 3FM9A 4HAZA 4ZT7A 5B6JA 4K46A 1A7KA 1JZQA 1P4RA 5LUAA 4OLHA 1PG2A 1UWCA 3HZOA 3QHQA 1UOOA 3WLJA 1CJSA 2FMTA 3WL8A 5EIEA 4Q00A 1V45E 4MCJA 4XARA 3T7TA 3IBTA 3K1AB 1V8DA 2JGFA 2JHPA 1BFKA 2QRPA 3L8MA 4ZI7F 1V35A 3TB4A 1M2WA 1U3DA 5LYJB 3LCVB 1MEJA 3IMEA 3HCDA 5FOVA 3T5PA 1N8NA 1JA1A 3JQ8A 4LV8B 5DEIA 2C99A 5KYXB 4HFJA 2OO7A 1QO9A 4R0MA 5J2UB 2BR5A 3DL7A 1J90A 4C4AA 2TYSB 2FPIA 1Y3CE 2RHMA 1Y37A 2RHCA 2VDOB 4MIKA 2H8GA 3H2IA 4HN4B 4QQ8A 3K4PA 1SGWA 3L8GA 2CCGA 3IEPA 1GIAA 4R9SA 3W4KA 1XDGA 4C4TA 5CHYA 5CRIA 3TR0A 1L4HA 1P77A 3A4LA 3FMVA 2O8CA 2PIAA 1EK6A 2AD5A 1A04A 3GNLA 2PMKA 4UFPA 2PYDA 4OJTA 5IVIA 3UFXA 3U7RA 3D3NA 4YCSA 5JCOC 1GV0A 4J0EA 2KMLA 4JV5B 4DJJA 4CKBA 3M4YA 1PJZA 2J8ZA 3DQQA 4V39A 4PGAA 1U80A 2IOFA 4I7EA 5CT4A 4CXMA 2WKSA 3D8BA 4TROA 4C4YA 3OG9A 3G6KA 2IZ5A 3U7JA 4D8VA 1JKJB 5BYBA 1JT9A 1W0KD 4PSVA 4RK5A 1YB5A 3M3HA 5A0TA 3QMPA 4BNFA 1YVPA 2JJQA 3K31A 2C7QA 1ATIA 4D4GA 2QDKA 4B0OA 5DNEA 3IPAA 3GLQA 2C07A 4YRIA 1XCBA 1YZLA 4BKRA 2QR2A 4BNGA 2FPSA 1IJBA 3EF3A 4BBPA 1NPDA 2FP3A 2ZOSA 3OLQA 2Q50A 2VJAA 2Z2KA 3CH7A 4R6WA 4CZ2A 3NHFA 3TFOA 1V0JA 3EPHA 3L6CA 4AY6A 2ZWIA 2JFVA 2NZUG 1DWPA 4RHFA 4JXKA 1BA2A 4QLAA 4F71A 4PX3A 3OLXA 3D6TB 5GOZA 1IUOA 4EJSA 5C53B 1BJKA 1X15A 1NXTA 1CFJA 5EJAA 4AYXA 2QN7A 4TV8B 4DYDA 3SS9X 2ZYVX 5E4TA 2FOXA 2NVUB 3H9QA 2I1QA 4UMVA 3KPWA 5BOSA 3B7PA 4WMLA 4Z8YA 3W79A 4BO9A 3NHSA 1AXGA 4MCHA 3U9SA 1EFLA 3I6BA 3GHYA 1Z2AA 2GHIA 5IBCA 1C0LA 2GB4A 3GQBB 4DADA 4XWWA 4LF5B 1JJFA 1DJQA 4D98A 5AK3A 4X94A 2XF2A 3DYBA 4BGDA 1DXQA 4WNAB 1QQ6A 4L3WA 3REQA 3MJHA 5EIXA 3D7RA 1OKKA 4JQZA 1XU7A 2H4XA 4E3ZA 3IA2A 2OKCA 1JJAA 1I6WA 2WFMA 4M7PA 2MDTA 1Q0HA 2I8AA 1GGFA 3F7OA 3IKTA 4AQ7A 4D45A 1X77A 2NAPA 4JZYA 5AK0A 1BHO1 2Q7XA 1RMQA 4MUIA 1X7GA 2IVFA 5F33A 1LEHA 3SQDA 4BDTA 4EUNA 1EAYA 4GX1A 1GNVA 4BTEA 4LJ4A 2QLNA 3TW6A 1V25A 2RHWA 5C1OA 4FGJA 4QUAA 1LPOA 4YEDA 3H9JA 1IB6A 1D07A 1QH1A 3O03A 3LP6A 4Z2AA 4B1FA 5ALJA 3HSKA 2Q49A 4WLNA 2PXHA 3R7AA 2Z8ZA 2H2WA 5KVAA 3RYCB 2J3HA 1UM9A 5E6RB 5HUJA 1E5TA 3FZEA 5TQJA 3ZBPA 1FP7A 3MCVA 2VHUA 4K2AA 1IWBB 3GLUA 5K8JB 2OQIA 2WQ6A 3D4OA 5IX8A 1FTSA 2ZUVA 1FUYB 3WNZA 3UOWA 2WB4A 2I6TA 2LBPA 4GEKA 4Y2HA 5KI6A 3M70A 1BX1A 2QRGA 5D7BA 3WLFA 1MB2A 1MA3A 4CTOA 4Y2YA 4BE9A 5BUQA 2NMVA 3A6LA 1AUPA 1BNCA 4PYKA 1HDRA 4IWXA 5LP6C 4GSLA 2FR1A 4RABA 4EY8A 4ZTZB 2P4SA 1YCGA 5I47A 1DPGA 2ORWA 3UJ7A 3LZDA 4CNBA 3HB4X 4IFTA 2Z5FA 4HRXA 4QO7A 3VTFA 1FYVA 3BBLA 3HWX1 2QX9A 2PFGA 1XU4A 1SUWA 2O4UX 1T3TA 4BLTA 1PHPA 2FSHA 4BLQA 1Y7TA 1LBQA 1UBSB 4DBVO 4B3MB 2H7VA 3D31A 3LRPA 4PS1A 4R54A 2QE6A 4BV9A 4CGYA 2JCXA 4IHQA 3CZMA 3GLIB 1K7CA 3JQ7B 1J4AA 2ZRQA 3IGFA 4P3YA 4NPHA 4QUBA 4B83A 4ZDKA 2F9MA 2HBRA 1QHEA 1XDSA 4K2HA 4OQ4A 3ZWVA 1M2KA 1WM1A 3C1AA 3DWEX 4E30A 2PX4A 3IBFA 3MJDA 3KZOA 4JT9A 3KK0A 4HX9A 2PG3A 4YJ2F 4DLAA 1BD4A 1BHQ1 1T1EA 1VKHA 5KVCA 1OGIA 4W9NC 3LQRA 1XGKA 2WSIA 1ELOA 2QTBA 4DLLA 1O5OA 1ZOSA 3BE5A 2GBPA 1XBTA 3HU2A 7YASA 2SNIE 1KI4A 1PZXA 2LVBA 1C0EA 3PIRA 4ZT4A 3RRFA 1XWIA 1HT1E 3I8XA 1J00A 1R0WA 2H5JA 1QGYA 5A4FS 3I1YA 3RJ9A 3NC1C 5K0SA 3B82A 1IUKA 1UDAA 3OO0A 3U7QB 2NT4A 3WMWA 3FI0A 1CEEA 2Q3FA 1FVFA 3K0HA 1PZMA 2ZIGA 5FNVF 1OMOA 4MYUA 2A0UA 4YJHB 4JXZA 2QUBA 2OHHA 2PQ6A 4XUEA 4TL6A 7GPBA 1JL3A 5L4SA 2N46A 2AFRA 1HQCA 3WSTA 3DEAA 3CZCA 4KN5A 3GGSA 4OKSA 2J87A 3JWGA 5ALWA 4EF5A 3NTQA 4C0WA 1E0KA 3R9IA 1G8MA 2XZOA 1A4RA 1THZA 3PLNA 4M1YA 3VSBA 3SM3A 5JI2E 5KYYB 1QGAA 2PZGA 1MC4A 2ZPUA 1X19A 2FX2A 3UCEA 1KOGA 2YHSA 1QZ3A 4FVTA 1DO0A 1EXNA 1FUEA 4H7IA 2EATA 3GVCA 4L2IB 4NOMA 4Q39A 2IKQA 4BNYA 4CV3A 4DA7A 1O97D 1X1AA 3O1LA 4NV1A 4WJZA 1QJCA 3AB8A 1KFKB 1TPZA 3ISVA 2F43B 3ZCTA 4BFSA 1JH8A 2GPJA 4Z9XA 1Z5UA 4DCNA 3KL2A 2WJIA 1WTAA 4FR5A 2PY6A 4IZOA 2GPWA 4X6UA 4YJGA 2VXCA 3URMA 2F7SA 3N6XA 4D0SA 2IYEA 1CP3A 5HGXA 2H1RA 3WB1A 2IYXA 1Y1LA 1SHZA 1E77A 3HKBB 1CZNA 1T3SA 2ZIAA 3AR7A 4GO1A 2BOVA 3AF2A 1E3SA 1RKBA 1SJ9A 5IDYA 2KM1A 5FFFA 1YI1A 2Q2WA 5ICFA 2PUEA 4PTZA 2CLFB 4ALLA 2DBQA 5BSWA 1UDRA 5EWLA 1KOJA 3I9V1 2QN2A 1LDMA 2PPVA 1AKMA 3SE0A 4ZJUA 2CXUA 1L6RA 3JXEA 4D4KA 3KJNA 3D7LA 4Z5XA 3GAFA 2VKTA 2CXSA 1RFGE 2HQ1A 5F3DA 4PIPA 4YRZA 3FR8A 2CF6A 4X1KB 1BE0A 3AHGA 1E5DA 2BGLA 1PJCA 3SSMA 3D3QA 1DX4A 1VB5A 4JKOA 3BSWA 1X14A 5EIFA 5JSUA 4BKQA 2D7CA 3C6KA 5TGZA 3QPWA 1DINA 3OICA 3OOWA 4DM7A 1J06A 1GGMA 1QVRA 1D1QA 2D0IA 5IYZF 4IYJA 1QC5A 2CVHA 2GEJA 3PWKA 1DV1A 1GL6A 4WERA 4PFSA 2VPIA 4DCMA 4D44A 1ISFA 3N2LA 4RJKA 3IUMA 2JJYA 5HF6A 2AI3A 1E9AA 2N47A 1D5CA 4MI1A 1RLMA 2GBIA 2ET6A 3WNVA 4WV3A 4D4IA 4DDTA 4DY4A 4FYXA 3NHZA 3HHEA 2HK9A 1TMKA 3E3MA 3ZNOA 4B8ZA 5HP4A 5JZ9A 4BJ5A 2CZGA 3NBZC 4K9KA 5KYTA 1XNQB 1MZPA 3ELBA 3B78A 5E1BA 3DBIA 1FIUA 1O1YA 2XMCA 3B5JA 1ZN7A 4R8KA 1C2YA 1BCSA 2XWSA 3UK0A 4RWZA 4PQRA 1SRQA 4G1UC 3PL5A 5TMDA 1GFWA 3DPSA 3H2GA 4G01B 1JJ7A 5LBIA 4D8YA 3GUCA 4LYYA 1TEZA 1JAIA 2M6LA 4G5HA 4XWGA 4GMDA 4E5UA 3ZHQA 3IDQA 1JYEA 1SQGA 4GXQA 3U4AA 1KP9A 1W4ZA 2AKYA 3DYIA 2MSEB 3CR8A 4TTAA 3KZXA 3ONDA 1CC1S 2AI2A 4H7KA 4JLOA 2B3DA 1SCJA 2CDCA 2X5KO 5FWNA 1A8QA 1S2MA 1IULA 5EJFA 1ZC4A 1V8ZA 1R12A 3HVRA 4NPCA 1OHHA 1MR3F 3T9DA 2P30A 5EP1A 1OFUX 1OTYA 4RVOA 5AXBA 4KCGA 1OX6A 4MW0A 1K6MA 1ULSA 3OTIA 5D1HA 1XVVA 2HBQA 5LQSA 4CMGA 1M0EA 1JWAB 3G2MA 4S35A 3SQXA 3BWCA 2XLBA 3M6VA 3ADPA 4R2WA 3F8TA 5FFMA 1Z88A 1IPHA 3EZNA 1IC6A 1T4MA 4X20B 2O59A 4CN9A 4EA6A 3P9QA 1GCIA 2YYZA 2VJPA 3ICEA 1YKSA 3Q0IA 5AVXA 5IZCA 5F1YA 2GBGA 2IHKA 1T5IA 2BDEA 4R7ZA 4RQTA 3UV7A 4CI9A 3ZHXA 3ITEA 2FZGA 3TIFA 4RYLA 3MCUA 5AVTA 1XMOB 4DYHA 1PG5A 3HL0A 3L7YA 4K86A 1Y3HA 3A25A 4Y6OA 3KLPX 1ZA1A 4AJIA 4YY3B 2HMVA 3DEJA 2PWBA 5G02A 2GNPA 3KBBA 9LDTA 4MEBA 4XFKA 3QVGA 5GQSA 3UAOA 1VIYA 1GA1A 2WTEA 3OFVA 3HXTA 5I9NA 2Z57A 1VDMA 4BX2A 1XPUA 3GLGB 1H9BA 2ETXA 2ZS7A 3NW9A 4NZZA 1U2GA 5FYDA 2O0MA 3C3AA 3Q3VA 2AKAB 3OTWA 3WRXC 4PLFA 3KZMA 4R71A 4C29A 3M9LA 3FNIA 4NJEB 4QUIA 1ZCAA 3HUDA 1Q1BA 3JAMA 1CV2A 2D8MA 2QQEA 3JD1A 2R2GA 2XYGA 2OK8A 4BAUA 2N3ZA 4C01A 4AWAA 4CR6A 5LQCA 1T1JA 2PS0A 1V8PA 4Y1RB 2NP6A 1LD3A 4Z7QB 2GF0A 1NDHA 4M22A 5DFAA 1T34A 3THSA 3GJSA 1W48A 3ILXA 1YIAA 2Y1GA 3EF0A 4HLUA 4KLRA 1CZLA 5HM6A 1E0SA 1G9XA 3IUPA 1XMSA 1ICIA 4YAGA 5J2TB 1DFIA 1IM8A 1Y4ZA 1Q74A 3E53A 5CBPB 1UC8A 3OZAA 1LLFA 3NYQA 3DM5A 1L5GB 4GSYA 5FI0B 3CA8A 4IIEA 4Q3DA 4P32A 1XTIA 2ZJAA 4M4SA 2GNOA 2GXSA 3VVBA 2DHRA 3NDBB 4CMBA 1CJMA 1JN0A 5JAQA 3WICA 1TYAE 5LA6F 5HF9A 4B71A 1Y82A 2NU9B 2ZGVA 1OXMA 1XUOA 3GGPA 4IW3B 3VPBA 5CB8A 3DG9A 5C5DA 5KTMA 4PWYA 3TTYA 1IWPB 3QVMA 5LQKA 1T0BA 3FYTA 1YZVA 1AUQA 3FJYA 5FOTA 1GAXA 3DPUA 2AN4A 3AFMA 5GJVC 3WL6A 4E5VA 2FSPA 4BAZA 2Q3DA 4YT4A 3MFYA 4M7RA 4ZVPA 5E4JA 3UAVA 4AJ9A 3L46A 4WXPA 4HDCA 2XQFA 1DRJA 2ZK7A 3KO8A 4S1VA 4F4IA 1E6CA 2OWEA 1B8VA 2GZ2A 3IR6A 3V4ZA 3ZLTA 1UEIA 2I55A 3IDZA 3KSZO 3O83A 4G89A 5FWYB 3DAHA 2Q4BA 4D0GA 5EY5B 4ZCQA 5KNDD 4V0MA 3ICCA 5LP6F 3ENZA 4LEIA 1R7RA 4DAEA 4DMRA 2BEWA 3SQOA 1JG3A 3DBHB 1MX5A 2D5LA 1U8CB 4NBNA 1CS0A 2JVKA 2POQX 2Q9CA 1BWSA 4B3IA 4ZEMA 4M38A 5HCIA 1EI9A 2BCEA 1ZVVA 2CL7X 1XAGA 2HTEA 1ZMXA 1UK8A 2G72A 2QT0A 3F2IA 3H1FA 4NX2A 4JENA 4FGWA 2XEXA 1RHUA 4YS6A 3B6KA 4QEKA 3GLFE 1XZLA 3JD4A 4MMXB 1Y7LA 3OEEA 4M89A 1YU6A 4BBZA 3LYAA 1WDMA 4GP7A 2P4HX 2FPIB 3DEFA 2BGKA 2NTNA 3VUEA 1Q12A 2EQAA 1CIVA 4DL9A 1XQYA 2Q2QA 2MWMA 3JPYA 2PUGA 1QH8B 2OGWA 3PGKA 2Q8PA 4XVCA 3VSDA 5KWSA 4D4HA 2L17A 2JVJA 4DY6A 2FG6C 4F92B 3T4PA 2DC1A 3LWBA 4D02A 3R0XA 1N2CB 1USUA 4NY1A 1KFEB 3OJLA 4I5DA 4MPDA 4CIAA 2WT8A 3G0GA 3QLJA 1E9CA 3KD2A 1QPBA 3JTMA 4NBVA 1KU0A 1F8XA 1QCYA 1IZYA 2IYFA 3EEQA 5D51S 5G53C 1U2GC 2WHEA 3R23A 5SICE 2HB6A 2V6MA 4UU8A 1F0KA 2MJLA 4GFDA 5C8VA 2YFKA 3A11A 4HAXA 3SFTA 3FCCA 3WRVA 3UMCA 1RZ3A 3NCHA 1U5BB 2EFHB 2OAQ1 3FWKA 3FD8A 2ZWPA 3B2QA 4DARA 3N39C 4OI2A 4GWLA 4QOHA 5LXTF 3TKAA 4ZZ1A 1DRWA 5KUTA 3I64A 3ZWQA 4CM9A 3AG5A 2QJTA 1PCXA 1RJEA 1DJOA 4FTWA 4FEYA 2MSLA 1G291 3ANYB 5KQLA 4NZOA 3N2EA 2LKDA 1D6NA 2FN8A 1WNTA 3A4YA 4Q3KA 1AS0A 2B8JA 5CM9C 4NMHA 4UEOA 3KQYA 1UBRS 1WHSB 5DI3A 2UYYA 2YNMC 3K8ZA 4NK4A 1PZHA 4KFRA 1VJ5A 4G4GA 6REQA 4G1EB 4Q21A 2B1JA 3NEYA 3RT9A 4P4TA 4QUEA 3HI4A 1TQ2A 2JFPA 4BNHA 4R0NA 5P21A 2FRVA 2VDRB 3U1VA 3F97A 5JJCA 1GTRA 2NQTA 3UJCA 2ATVA 1VIVA 3KT8A 2BR3A 4PFJA 1MDBA 3CO5A 3JVDA 3RVRA 4G5XA 3WHLA 3ND8A 5FH9A 2QVXX 1G8PA 2GEKA 5TX7A 1C9YA 3ONFA 1DB3A 2PXAA 1GTZA 1P6QA 2VSYA 1J09A 4R3UC 3HN2A 4BMZA 3PTAA 1KHTA 4LNUA 1TU4A 2ZG6A 4CQNA 3L18A 1M7HA 3I30X 2SCUB 2C0PA 1QVWA 4L16A 2JBAA 5DTMA 1VG0B 2DBYA 2HADA 2OR3A 4WK4B 1CY0A 5CFNA 4EBBA 1NW9B 4KQKA 3EX7C 3DMTC 4I1VA 1M6EX 5HZMA 2WYOA 1U6IA 1S3GA 3ZK8A 3TVTA 1RS0A 1XN1A 1COWA 2R1TB 2VJOA 4NF2A 3RROA 2OHGA 1I3KA 5CDUA 4F12A 4MQEA 4QULA 2WSSA 3SVZA 4MV5A 5FTWA 4JWTA 4XJSA 5JH7A 5MN4A 1G3QA 2ZRNA 5BSUA 3V34A 4XUCA 3LO8A 3V8PA 1XRMA 3IE1A 4E2YA 1DO2A 1NC3A 1JSZA 2RSLA 4K7JA 1FP4A 4HADA 4ZU6X 3D8HA 3M6XA 2D7DA 4EAQA 1R0RE 4QT4A 2AMVA 3JATB 2NXCA 1DRVA 1TQDA 3KUKA 4U9HS 1U3VA 3HKEB 3CCFA 3S2FA 1NRWA 2A0WA 3CN9A 3JQBA 5GWXA 5KKNB 1JLHA 1EBFA 1VECA 2WFLB 2Y27A 4B76A 2E21A 5B3LA 1T5OA 1MX1A 1UBJS 1VGQA 3DUFA 4N0QA 2HMSA 1A4IA 3IQZA 3L8FA 1U1IA 2I62A 1H2BA 4QJ4A 4CKBB 1NBWB 4HFRA 4EY3A 4N65A 1JHRA 1GPH1 4JVLA 2GO1A 3UGTA 3GL9A 5IT9A 3N7UA 2NU7A 1GGHA 4XWKA 4L27A 4DUGD 4HQ0A 3RKRA 2HHLA 1PL8A 3ZVRA 4BV3A 5ETJA 3STTA 2Z6AA 3FYHA 1ISSA 1FXWA 2C3YA 4B3BA 2HLPA 2IZ7A 2PKRA 3FFBA 1RRCA 4HOYA 4OHPA 1HDCA 1DBQA 3L07A 4Y2GA 1ZUD1 1ZIPA 2YXLA 5HFAA 2HZBA 4US2R 1H4QA 1MHTA 2KSQA 4H2DA 3U2QA 1VYVA 3SY8A 1MV8A 4RVNA 2SICE 4YAOA 1IYZA 2AVDA 3T99A 2ZBFA 2NPIA 3HDVA 2XCRB 2GCEA 1ODJA 2NX2A 3CURA 3TZCA 2FE1A 3W2EA 3MS2A 1M1YA 4PE5B 4KE9A 1GGEA 4PFQA 2HF7A 1NBMA 1C7IA 1X8KA 1K7FB 2WV9A 3DE1X 3LXUX 4U39A 3UCXA 3HACA 3GFFA 4X6YA 1A5TA 5A6VA 3MLEA 5I9TA 1G4HA 3O9VA 2CXHA 2VBIA 3RVMA 2WAMA 2ABWA 2XZDA 2GJ9A 4FYHA 4ZVUA 2Y4OA 4WXMA 2E89A 1GCOA 4YCLA 1GLVA 3KR2A 5JUWA 3R8CA 2R9VA 3TD6A 3W1WA 5CIQA 1G2QA 2VK8A 2CFIA 1U4NA 5FXMA 1F7VA 3VNUA 8OHMA 2FCRA 2Y9MB 1YRLA 2OYSA 4GOOD 1QLWA 1UXOA 1U1EA 4JQOA 2QUHA 1MAHA 3SSNA 3CB4A 3ES9A 2TECE 3TI7A 3PXEA 5JH7F 5U9CA 1V7PC 1UXHA 1DFHA 3INGA 2I3ZA 4LTMA 3WVNA 4KXUA 1W5FA 5CAEA 2QWXA 3KU4A 1JEYA 4KWTA 1ZGCA 3G3EA 4IMRA 2X1MA 4X91A 3GIDA 1YT5A 3ANNA 3TX2A 5A9SB 4BMPB 1K3UB 4RD2A 4RMHA 4TWZA 4EUFA 3S68A 1YFLA 3I6MA 4Q03A 4TMZA 5I3ZA 3WAGA 1DL5A 4MNTA 2X8JB 4HR7A 3GFPA 3GFBA 3WGUA 5I9IA 2OECA 3DZGA 3Q9UA 2REOA 1K9VF 4IRUB 2CJWB 2GZ3A 4MV6A 4X44A 4A6EA 4DWWA 4DWJA 4CLXA 3PC8A 4EG0A 1Z06A 4AO7A 1O97C 3FPFA 5ALXA 1GARA 1P5JA 4ZV4A 4N76A 3OD5A 1ZJZA 4ZVTA 3GGDA 4I4TA 2CXXA 1W46A 5KTSA 5D8DA 3HJGA 1S2IA 2IL1A 1R16A 1Q7CA 3Q9LA 4D82A 1GG8A 3LVQE 2E87A 4TTTS 5CW1A 3GFQA 3H9UA 1N6OA 1B93A 5T4FA 5FF9A 3MMNA 3I28A 2QXUA 3FNFA 4B79A 5A1JA 4QECA 5IT0A 4OOEA 5AXCA 3RS0A 1RQGA 3HU3A 4WADA 1AK1A 2H3HA 4R8MA 2MCFA 5LIRA 4JB0A 1P3DA 4C08A 3WWYA 1P2VA 1WIWA 1R88A 2JFOA 2WWRA 5IBRA 4TS9A 2QRJA 4GOKA 4TRJA 4KPUB 1GZHB 2X7HA 3B13B 5CB4B 4DV1B 1U31A 3PJEA 3UPTA 3C7KA 3QLUC 4BQOA 4UD6A 3GD7A 3WV4A 4WCFB 1W2HA 2G9QA 3HADA 5BNIA 1UZNA 1SXJC 1VHTA 3AB3A 2WWTA 2VDWA 3VU1A 3PFGA 3QYFA 4J6EA 1K8XB 3QE9Y 4J0IA 2ASEA 1KJWA 1WDKA 2QPLA 4QT0A 4D43A 2HT1A 3QEMB 4U63A 3DC2A 1I10A 4XD7D 4GI7A 1KWKA 3VAZA 2BZGA 4BLPA 2B4AA 3MW8A 1BXRB 2BI8A 4MP6A 1E58A 2BDTA 3R6LA 1MX9A 3QWFA 3LL4A 2VAPA 1EMDA 4D8XA 1SVWA 5K0EA 4U5QA 4X6LA 2UV8A 1QP0A 3A7DA 1K92A 1Q22A 2IPNA 3AJRA 3LO5A 4IXDA 3T3MB 2F55A 1NOJA 1T8SA 2WQZA 4YT2A 3REFA 1AGYA 3PU6A 5IDXA 3K9WA 5E0KB 4B74A 5AHOA 1IVSA 1D6SA 1VDZA 1W4BA 5DT2A 1THGA 3FVQA 1PKEA 1Z12A 3WLRA 2YVKA 5CIWA 1DCMA 1O4WA 2I0FA 2MSKA 5E4FA 3PLRA 4A26A 5JARA 4C2UA 1G98A 3D1LA 1UPBA 3K0EA 4ZOLA 4BVHA 4NABA 2NAFA 1YE5A 2P62A 3G02A 3M6FA 5JXWA 2E55A 1VE6A 1LSSA 3USCS 2C97A 2F3RA 3A6GA 4OQMA 1LW6E 4F97A 5DXJA 3O8QA 4ZYVA 4BVKA 5MGNA 4PVCA 2H1OA 2COKA 821PA 3KDSE 1DOZA 2PTHA 2ZQYA 3QX7A 3EYAA