4YDIH

Crystal structure of broad and potently neutralizing vrc01-class antibody z258-vrc27.01, isolated from human donor z258, in complex with hiv-1 gp120 from clade a strain q23.17
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
222
structure length
209
Chain Sequence
QRLVQSGPQVRKPGSSVRISCETSGYTFNAYILHWFRQAPGRSFEWMGWIKPKFGAVNYAHSFQGRITLTRDIYRETAFLDLTGLRFDDTAVYYCARDRLYDGSSWRLDPWGQGTRVVVSSASTKGPSVFPLLGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Repertoire of HIV-1-Neutralizing Antibodies Targeting the CD4 Supersite in 14 Donors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system
molecule keywords Envelope glycoprotein gp160
total genus 35
structure length 209
sequence length 222
ec nomenclature
pdb deposition date 2015-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ydiH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ydiH01
1FGNH 4JLRB 1WQVT 3ZYOA 4DOHB 2DQJH 1FVDA 2DF3A 5GRUH 5IJVA 3EDKA 4NBXB 3QUMA 4NKOB 5FGBA 1CT8B 1HKLL 3ABZA 4MQTB 1OM3L 3BO8B 4R7NA 5FYLD 1ORQA 3HPLA 2OX5A 3BW9A 3QNZB 2WBJC 4L4TE 3WE6B 5INCA 2YSSB 1IGJB 5C1MB 4U1SA 5D7SL 4JPIB 4R8WH 4PJXF 4LGRB 5L8JB 1R3IL 2C7UB 4F9LC 3ARBC 2FB4L 2FJHA 1M7XA 4UQ2B 5J12B 4U1LB 5D7JA 1A1OA 4UIKL 1DFBH 2VIRB 3FO1A 3T3ME 2GEEA 2DLTA 2DQIL 1MELA 3D25B 4MD0A 1I7RB 4TUKL 1G9NH 4A6YL 1UXWB 2DQGL 1WV7T 2VB5A 4TUOA 3TH2T 5L0QC 4JN2B 1CL7H 1BVLB 3SKUD 1S8DB 5BJTA 3B2UD 2HTLC 5SWQB 3OKOB 4HCRL 3MJGX 4NN5B 5E1AA 1FO0H 1HQ4A 1A02N 4XMPL 5H2BB 3WL9A 4AEFA 2CO6B 4HBCL 4F7PA 1F42A 3STZA 3G6AB 5HI3D 5J6HB 3P0VL 1V7MH 2CR3A 5HYJE 5E2VL 3ZHKA 3BRDA 1DEEB 4MA1B 4HXAL 4WNQB 2FX9H 1QFUL 1EO7A 1KJ2B 4Q9QH 3MQIA 1CICA 5DJ0B 3PUCA 5FEBA 3UZQA 4EI5B 3E8UL 3R06A 4RFOH 1MQ8A 4YPJA 5GJTH 1LEKA 4AY0A 1F3JA 1JK8B 1PJ9A 1JHTA 5KN5B 2OXGA 1BZ9A 4LARL 5KSVB 1RU9L 1MFAH 3A6BH 1ZLVH 2I9TB 4YHNB 2X1QA 2BSSB 3KPSB 3GMQA 1BVLA 1SQ2N 4GO6B 4M1CD 3BQUB 2P45B 2AEQH 2D7MA 5EU3B 5B22A 1RJYA 2J6EA 4MZ2A 5IESL 4DZ8A 2VUYA 1TJHH 5C0JA 2PO6B 5B38G 1MJUL 4OGYH 2G9HB 1ZHKB 3KJ6H 1T0NB 5HYJA 2ITDA 1RZ8B 3CU7A 2BVYA 4HEME 3FQNB 2L7UA 2R0ZL 3EYFB 3B8YA 5A2IH 3N9GL 3NCFB 2XQYK 4HC1A 4R8WL 3ULUL 1IAIM 5KG9B 1A3RH 4ZXBD 1XF4A 1G7PB 2J4WL 1IKNC 4JO4H 5HYSG 2P5WE 4M7KL 3OV6A 2VXVL 4ELMB 1O5DT 4PJ5E 5TPWH 3FL7A 3QH3B 5AWNH 1G7MB 2VITB 5HD8D 3WNLA 3HTLX 1H3PH 2IH1B 4K94H 3F8UB 5INDA 2Y07H 1D5ZA 5C6TL 1J8HD 4XPTH 5C0RH 1H5BC 3UTTA 4HJJH 3ARZA 4PJHB 1YY8A 3KJ4B 5CGMA 2Z35B 2D7OA 5EH1A 4YX2L 1MFEH 3S35X 2YWYA 1KB5L 3GO1L 1BFVH 2Z4QA 3FT2B 5DMKB 2GSIA 3AFLA 3L5WA 3QBTB 4KVNH 3OKMA 2XNAB 3BRFA 2C1OA 2ZUVA 3VWJA 5I15L 1I9IL 3BWUC 4HXBL 1AI1L 2ADIB 4ODXA 4JKPL 4L4TA 1N59A 2AABL 3VFWA 3BRGC 4FTVD 5ICZA 2CK2A 5TDNB 2EDQA 5IFJA 1TQCB 2Y5EA 3D2UB 2HT4C 2X4TA 1DLFL 1OGTB 4S1SL 1C5DA 4ZDHB 4WEBH 5JW3H 1T2QH 4FXGB 4GMTL 3GI9H 4PTUA 1CS6A 1JHTB 5KN5A 2NY0B 1F3JB 3FOLB 4GKSB 4JFQA 3WEXB 4M9OA 4HPYL 3GB7A 4DN3H 4F8QA 4RCAA 1RZ7H 3D48R 1CFNB 1GL4B 1I3RB 5DVNA 2YUWA 3FCTA 5FUOH 3UJIH 3ILQD 1C8PA 2FEEI 1E4WL 1ADQH 4NCC2 1G9MC 1B0RB 3UTSB 4UV4H 4KKBD 3RA7L 1TENA 1A7QL 4PG9B 4F57L 1YN7B 2BVPA 3DSNA 5MEPB 5KZCD 1JFQL 3DMMD 3GI8H 1ZS8B 3QUZA 2VDRH 3MR9B 5I1DB 1DTUA 1IGFH 1AQKH 1KTDB 4XPGL 1V7NH 4N5ED 3IF1A 4AL8H 3L7FA 2GT9B 4S2SA 1I1RA 1K5NB 3CDFA 2XY2A 4X9GA 3SCMB 2EYTB 2JLLA 4Z95L 1J8HE 3PDGA 5LXGL 3QISA 3NIFE 5H35A 3SE8L 2VL4A 4PRID 3TH4T 3VXTA 3B9AA 4LHUA 1LE9B 2FX7H 1I7RA 1DVFC 1P84J 4HS8L 2P24B 4EKXA 5GISH 1DQML 5CD5D 1YPZB 2XPGA 2GAZA 2CR6A 3BI9X 5T1LB 3HNVL 2W0FA 1OP5K 2KL6A 3MA7A 1ZLWH 3UMTA 4JFXA 4PP1C 1A0QL 5D7JB 3S8WA 1KTLB 5JOFB 3QQNA 3C5SB 3MUGA 4ZPVB 1HHHA 4OCSH 4XTRD 3UCRA 2H45A 3P3YA 4I0CC 1KB5B 4FMKA 1I1AD 1BFVL 4WCYL 1LHZA 1NMCC 5GJSL 4RGNC 1N5YH 2VC2L 4JHBA 5K59E 1FFQA 4E41E 5A2JH 5KS9E 3SDCD 5I75B 1B0WA 1BGXL 2AI0L 4U33A 2R4SH 2O93L 3QUMB 5AYUH 4ZFZB 4AEIL 3MROB 1QRKA 3D87B 4GAYB 3U7YL 2XTLA 1BVZA 2F9BT 3MV8E 3KYOB 1UZ6F 1UZ6E 3G5ZB 5MP6L 1TCRA 4NNYA 2WIIB 4I77H 1CVSC 3WXVL 4XVUD 4XVSH 5EO9A 5CP3H 4FTVE 5CCKH 1TLKA 4RFOL 4YPGA 4M6OH 1MPAL 4OM1H 4YHZL 4JFOA 4YR6A 3RZCD 3LS5L 4WO4D 1A5FL 1U91B 4G9FA 4YNYB 5D2LB 2P5WB 2AK4B 3BJ91 1RULH 3TYFA 1N5AB 5IVZA 3T4AA 1D5IL 3VWJD 3UBXI 3L5JA 4X7SL 3TFKD 4NRZA 4MJ4A 4Y2OA 3I02A 1I1AC 2QADB 5JW4M 2XG4A 3RVXC 5F88B 1XAUA 4MXVE 3LB6D 3VFGL 3ULUF 5I0DA 2JELL 3HE7B 3HUJE 4UIMA 1HH9B 2H3NA 4ZFFB 5FO9B 3BGAA 4QRUA 4NFCA 5JOFA 3U30C 4PGZA 2C5DC 1N3NB 2AP2A 4PGDB 4WU7B 4YHKL 4GQ9L 4W4NA 2RAMA 2GAZB 4DW2L 1H5BB 1L7TL 3BPLB 4KK9D 1KV3A 4ZO8A 5JHDE 4N0FA 4NQCA 1DBMH 1XR9A 4GXUM 1KTKE 1IMHC 1S3KH 5E6YA 4N0YH 5DJDA 1A21A 4OTXH 4HK0B 2X4SB 2BP3A 1L6ZA 1Q0YL 1JUFA 3MJ9H 4XVUC 5IGXH 1AKJB 1N7ML 5ESAA 2DYPA 4MSWB 3ARBB 1ZKAA 3QULB 5IHUH 5HGHA 5IVXA 5DEFA 1DBKL 2BOCB 1LK2B 1YEGL 4X7CC 2UWEA 4YC2C 5SWSB 1KCRH 3D2UD 3TA3A 4I0PB 4I2XE 1BWWA 1GOFA 4PJDF 2VDNH 4FQ1L 3VFMB 2O5YL 5IBUB 2WUCL 1K8DB 1OM3H 3CFCL 4U1GC 3GK8L 3QIWA 3QDJA 1U8LB 4OV6F 5ITFA 2HH0H 1X6LA 3U46A 1S5IL 2X4QB 1OGAA 3LDBC 3F62A 3SDXE 3ZL4H 4IMKA 4MAUL 3WYRA 1QSFD 3C08L 5ID1B 2AS5M 3VWKC 3ULUE 4AT6A 2XZAL 5F9DC 4UDUB 4NWTL 4GFTB 4PJBA 5CD5C 3TYFB 4M61A 1UEYA 4I48B 4HUUB 3MBEA 2PYFA 1LDPL 2YC1A 3TO4D 3SDDB 5GGVY 2QHRH 3REWA 5IT2H 4CRPA 2WP3T 4HS3A 3HCVA 4UV7L 4ZQKA 5ADOL 3CZFB 4B5EA 3WBDA 5I74B 5J1TC 3NH7H 4HFWA 1HI6B 2R2CA 3FTGB 2WBJB 4QNPF 3G5ZA 3RKDC 4MNQA 4NQSA 1F4XL 5FYJL 3O3BA 2JKXA 4L3EB 2C3VB 4OF0A 1WZ1H 4GAYA 3QP3A 5CGYC 2OBGA 4CJ1A 2IADB 1QPPA 4HZAA 4W4OA 1CLOH 5EZIH 1VACA 3QXUA 4X7EC 2E27L 5T5FH 1YEDA 3V9FA 2F54B 2NX5D 5GS2D 2EC9U 4YJZL 2XWBB 4OZIA 4WUKL 2CRMA 1DVFA 5FGRA 3DYMA 3GSNA 4TSBH 4O58L 1PX3A 4YGVA 3QDHA 4GRMB 3LKOB 3DX7B 5T1LD 3O6FA 3I3BA 4AENB 2CK0L 2O61B 1MFDH 2CRYA 3R8BB 4GW4A 5SX5H 2EH8H 1J7VR 3ZKMC 2K9UA 4BFGA 3MGOA 4WUUB 1V05A 3D0VA 1MWAB 4ZNEA 4UDTB 3KG5A 1YEJL 4K94C 4I2XA 1RZGB 1IKNA 4A2LA 1QQDB 2X6MA 5JIKA 5CJOL 4PD4J 4F15B 2QQKL 2YMXL 2JJUA 1NL0L 2HG5B 5DD0L 3MJ8B 3DMMB 4YO0A 2NXYD 4WGWB 3GKWH 4PJXB 2Z31A 4NRXA 4OI7A 1U3HA 1JYVA 4ZAKC 4LQ1A 1UQSA 1RD6A 5FKPA 2OZ4H 5D1XC 2OI9B 3AC0A 2DTSA 4B53A 3WNMA 2G5RA 1RZFH 2AJSH 2SEBA 3ARGA 3ECBA 5GS2H 3F7PC 4X6DE 2Z92B 2H32B 1FZOB 3C5ZB 3L3OB 4JFDA 4QXTA 1RJCA 1T22B 4M62L 1YQVH 4XBEH 2AV7B 2JE8A 4XVJL 4HJJL 4E42A 3BP4B 2D0GA 1LEIA 3MRBA 3TJEL 5JHDB 2XRAH 4WEMB 3GB7B 3TA3D 4EOWH 2F53D 3D9AH 4G8GD 3VE0A 1YC7A 1TDQA 1G7JA 4QRSB 2HMID 3NMEA 4APQD 5I17B 5AD0A 2Q86A 3OPZH 4EQ2A 4K71C 3LRHA 4G3YL 5DRXB 5FB8B 1GOGA 3DMMA 3BYTA 2F19L 3V52L 4QO1A 3BWAB 1UZ8B 5CP3A 1GPOL 2XA8H 1IGIH 2WBWB 4HFUL 2CH8A 1G7IA 3T3MF 3DX6A 1MHHA 1YEHL 3KWWB 3VFWB 2DIJA 3HG1A 3D25A 5DGRA 4XX1E 4F58L 3FRUB 3GSNH 1RQ5A 1MJJB 5BZWB 3DTXA 2C1OB 3TVMB 2GQHA 3WXWL 3C6LA 4K3EH 4JRYA 1T83C 2OR8A 3F58H 5FGCB 1CFSA 2N56A 2XFXA 4JFDE 3HZMB 4NM4L 1QRNA 1F45A 3W11C 5IBLC 1Q9WB 3QIUA 1H3PL 5EZOH 1Q0XL 4X7TB 4LKCA 1JRHL 4GXVL 4HGWA 5T1DL 1S9VB 3NABH 5CZXD 1JGUH 1HH6B 3MLRH 5C0AA 2HVKB 3BW9B 3QNZA 2ATPA 3NGBB 2HP4A 5I8EB 4D0CA 3JWOC 4DVRH 5HD8C 2NQCA 4ZS7H 1G0XA 1AHWB 3MRLB 3BP7B 3RUGF 4BSWB 2VLKD 2VUOA 3WUWA 4X6DF 3B9KB 3QXAB 3MRFA 2CDGB 5DK3A 3BGMB 4PBXA 5CIPA 2QQKH 4G6KL 1A9BB 3UJTH 5I18L 4KKAC 3IJHA 5C09B 4RWYH 5HHQA 3V5KA 5L7XH 1AO7A 1UXSB 1P84K 3N50A 3O6FC 2J5LC 3HE6A 1BFSA 4TULH 2NYYD 1MAKA 2W38A 4OD3H 5MI0C 3VFRA 2BJML 1HXYA 3QDGE 4Z8FH 1CXEA 4J8RA 2R8SH 1NAKL 2YS4A 1HSBA 4E41B 3PHSA 5KS9B 1VGKA 2A77L 2V17L 3HPJA 4HWUA 2B5IC 5C0CD 4YFLI 4XHQA 1UB6B 3R0NA 4G80B 3QWRD 5GSRB 4GBXD 5D70L 1AY1H 1I3VA 4EUPH 2FJFA 4ZTOH 1FZOA 1KELH 3L3OA 4QXTB 1MRFH 4YXLL 3O3EB 1QLFB 3H9SB 4GT7A 4K8RL 3RTQB 4JO3H 5HGAB 4OCYH 4I0PA 3IU4L 1WZ1L 1QFWI 1C12B 1QOKA 1VEMA 3G6DH 3MNZA 3O3BB 4JHZA 3QG6B 1M05A 4XNYH 5H2BA 1DSFL 5IB5B 3PP3H 4JRYE 5I1IL 2XQYG 4JR9L 1NC2B 4RAVB 3K2UL 2BNQB 3H3KA 3TN0B 1VADA 4AJ0A 3SEPA 1DBBH 4O2FA 4M3KB 2NY5H 5ISZB 3D9AL 2E7BA 4LCWB 3DXAD 3MV7A 4TNVK 4QXUL 2FB4H 3TZVD 4YE4H 1R3IH 4Z7NE 2NXYB 4QXGH 4D9RE 3MTRA 1K4DB 2BNRD 1OPGH 3HZKA 4JG1L 2GJ6E 3ZL4L 2CLVB 1U8KB 4GW4B 2FX8H 2ZG1A 5MEOB 3CPLB 3NCYS 3RWJA 1F11A 2A6KA 3S9DB 3QUXD 3U79A 1A64A 1NGZA 3WS6C 1U8OA 4LVNC 4U1SB 5GS1B 4PRDB 5DRNB 2XKSA 4I9WE 1RSFA 4PJAB 4GAFB 1SEQL 4KDTA 4DAGL 1PW3A 3NBNA 3PNWB 3LSOA 3V5HA 5C7XH 1F97A 4MMZC 4BYHA 3BXNA 4Y0GA 4P2QB 3EGSB 1YEGH 4X8JA 4FQIL 1BD2A 4Z78B 3Q0HA 4QHUB 5EOQL 5IVXB 4NO5A 1LP9F 3CVIH 2DM4A 1RUQL 4HXAH 2WBJA 3ARED 3IT8D 1QTYT 1UG9A 1FH5L 1GXEA 4OF7A 4KMTL 2PKDA 2B5IB 4U3CA 1OD9A 4HBCH 1H8OA 5L2KA 3SQOL 2I07B 3RX5A 5AG9A 3I2CL 3BVNA 1NC4B 3B83A 3EOBA 4H88H 2W0LA 3ZDXF 2MHAA 2QSQA 2YPLA 5IMLA 2J8UB 1TCMA 2VQ1B 3MC0A 2HJLA 4YFLF 1F6LL 4KK8D 5DQJB 3LH2H 1IEAB 1QYGL 5AYQA 3DROA 1MLBA 2HFTA 2V9TA 2HRPL 2ED9A 3B5HA 5LGJA 4XNUH 1MJ7L 2JF1A 4FP8H 1CDHA 4ODHH 2ZCHH 4V2CB 1JWUB 2YD8A 4KRMB 1XCQB 4HWBA 4BH8A 1QSVA 4W68A 5GGQH 4BSVB 3X17A 3PWUB 4CGTA 5HHMD 1AE6L 1U93B 4LNRB 5DMIL 4IDJL 4JFOB 4YR6B 4NO0B 4HIIB 4OZ4A 4C56B 3WHE0 1A1NB 3LZFH 1OTUC 5EBMA 5ACZA 1R6VA 3CDGB 5J11B 4YBHA 3W5NA 3M45A 1YJDC 3HB3C 3L95A 3HLAA 4ZAKD 2X10A 3V8CA 3KYOA 3FQRA 1ZWIA 4I0PD 5CBEB 3OKNB 5A3IC 2NY3B 1XGRA 1P6FA 3GSQA 3T4YA 1R0AL 4JM4L 2NY7L 1FSKB 1SJVA 1KYOK 5C86A 3MZTA 5E70A 4KTYA 1OTUD 5JLZB 1C16A 3ZKQD 1A7BA 4BH8B 4WU7A 3OX8A 5DHYB 2B7DT 2BVOA 3MV8B 5JA8B 3UP1A 4YHPB 3TBVA 4FXLA 1KOAA 2B1AL 4O51B 3ROOB 4KQ4H 5D2LE 4LCUB 5F70A 1EJOL 5MEOA 4YDLB 2VR4A 4O58H 4LGSB 1QKZH 5DSCA 4U7KA 3S37X 3NCBB 3RWCB 3DROB 3VWJC 3I02B 2PN5A 1YEEH 4CL7A 1WJ3A 5HHVH 2DWEA 2YD2A 3U2SB 1YPZA 2IH3A 2M2DA 2NY6D 1DBML 2AK4A 4K7PH 1H3TA 4PJDB 3C6SA 3VG0L 2B2XH 4S1DD 1MCFA 6CGTA 3CH8A 1KCKA 3O3UN 2L0DA 3UBXG 4UQ3A 4H8WC 1K5NA 1Y6MR 3HUJB 1NJ9B 4G7YH 1GC1L 1RUML 3L3GB 2I9LB 2GSIB 3RKDD 4RMRA 5EWIH 3VFGH 3ISWA 5JXAL 4F57H 3FQUA 3STLA 4YBQC 3G5YB 3E6FA 3LV3A 4PJGA 1MCPL 5I71B 1J9CT 3KLAB 4I3GA 2C3GA 4LCCB 1QBLL 1FYTE 4APQB 1FFNA 3FCTB 1B6DA 2UYLA 5ADPH 4KVCH 3O6ML 3PNWA 1CFNA 1A6AB 2ZG2A 2DLEA 3QHTC 4LLMB 2R0LH 2OL3B 2B1HL 4PRHE 4KKCC 1NBZB 4LASH 4QRRE 1JV5B 2ZUWA 3UBXB 3QEGH 2AV1B 1GH7A 3FRPA 4PY8I 5JDJA 3V7AG 1E27A 2DL2A 3ARWA 3S97C 3SDCB 3SDAC 2P5ED 5HY9B 2UZYB 1KNOA 3IDNA 1HXYB 1AXSB 3MA7B 4TVSa 2Y7QA 3OMZA 4PY7A 3T0EB 5TE4H 1CE6B 3K2MC 4I9WD 3EJJX 2XTJB 5HVGB 3MRMB 2PO6D 1VFAB 1KTRL 4XPBL 3WFEL 1YEKH 1N59B 3O11A 3PG2A 3O45B 5DMGC 2VXTL 3GUTA 4AM0A 3DGCR 3ORJA 1K2DA 3ME0A 2ITCA 5C0BE 2UUDK 4LCWA 4G6KH 4LLDB 5HYQA 1ZK9A 2XI9A 4MB4A 3C08H 4CMHC 3BGMA 4NN6C 4NN6B 3ULVL 4JFEA 5FA4B 3NCEB 4G43A 3OKYA 5EU7C 4CN1A 2I9TA 4BUHA 2YD3A 2WINB 1L0QA 2FH6A 4O4YH 4RAVA 5KSAB 1QVOA 4XB7A 3ZMRA 2HAZA 1QSFA 1Z5LA 5EFIA 3EGSA 1A22B 4YC2B 4Z7WF 4NDMA 5I74C 1YQ2A 1FJ1A 2HVKA 4MJIE 3HNSL 5IB1B 1DSFH 4HWEH 3F5WA 2FX7L 4PJAA 3A0OA 1XR8A 4LQFL 3DBXA 2VAAA 4RSVA 3I6LE 3HC0B 3C8KA 3O6MH 1ZTXL 5CJQH 3S4SG 2M26A 5CZVL 1Q9OB 2CIKB 4P4KA 5DRWA 1IAII 2ZOKB 4K7PL 4ALAL 2IFFL 4JJHA 5KJRH 5D96C 3VWKB 4HIEB 5I18H 3WN5B 4Y4FC 3KJ6L 5JDSB 3WFCL 5I1CH 4OKDA 5SV3A 4Z7WB 2G9HA 1S9XB 5J4MA 3UYRH 4OCLC 1NCBH 1L9NA 4JG0L 1MPAH 4ONOA 5CEXA 1CN4A 2EECA 4OM0L 2BSED 4GSDL 3ZE2E 1B88A 1EHAA 3OQ3B 5JDSA 3MLUL 3FAXA 2X41A 1I1AB 1AR2A 1S7WA 2BHUA 4PUBH 2OR9L 3V0VB 3VXRB 2QLVB 2NX5A 1Q9OA 3VXPA 1LEIB 1LO3L 1Y6NR 4Y1AA 5HDBF 4Y5YA 4HMCA 1R24B 4KJWC 3O3DA 1RZJH 5I8EA 1OWWA 3VH8B 2K7QA 1F02I 4KJWD 4RIRB 1B4RA 4K7PY 3S35H 1UB6A 4YDLC 4WCYH 1OT1A 4PV9B 4HKXA 4ZD3L 5KOMC 4QOKD 2GFBB 2H1PL 5B4MC 4WO4A 2E9JA 1MHPH 4LU5L 4L4VE 3MJ7A 3S6CA 1CL7L 2GFBA 4Y7MA 5F7DA 5EUOB 4MCZB 2FO4B 3C6LB 2YMXH 4FQXA 4LLVA 5C0RL 3GJFA 4PP1D 2EZ0C 5GGVL 2R2HB 3DWTA 4UNTA 3SGDI 3UTZB 3PV6B 1VFAA 1R3JB 1R24A 2NY3C 5T3XD 4Y5YB 2AJSL 1FE8H 3WO3B 1DVFD 1YNKH 5FECA 2X5PA 1F6FB 1S7TA 1H9VA 4QTHB 5D7JC 1FNAA 3LZFL 4U1LA 4P5MB 1Z9LA 4MNGE 4H1LB 1U95B 2JB6B 1K3IA 3ULUH 3LKOA 5GGTL 4BSWA 3SO3C 5BO1H 1G7JB 4QRSA 3MRLA 1C5CL 3MRGB 4Y4FA 3ZT7A 1U3ZA 4HDIB 1NPUA 2UYLB 1HINL 2A73B 3TEUA 4CNIB 1U3YA 3NA4A 3O0RH 3JZ7A 4C4KT 1I8KB 3P9LA 3MRIB 4EVNB 2H2SC 4KHTL 4PLJD 5F7KC 4R4BA 3CVHA 4KJQD 3OJVC 2LE9A 4P9HL 5BV7C 3S36X 4B0MM 5IF0A 1W72A 2CJUH 5HTSA 5JIHA 5L8LB 5D5ME 2AK4D 4LCIL 1RAMA 4IMKC 2V2XB 4TRPH 1ORSB 2AJ3B 2Q3AA 3F5WB 3REWB 2GIYA 3P9WB 3VFPA 4Y88A 3LMJL 1MHHB 1FZMA 3KWWA 5GGTA 4DKDC 5D7IF 3MLWH 5ESVB 1MQKH 1JHLL 2GUOB 1EEYA 1CLOL 3RJDA 1TVHA 3IU3B 5FF6A 4MQXC 2PYEE 3PWPA 3ZKXC 3MGOB 1QVOB 1P4BL 4NZRL 5KSAA 1GHFL 4TOYL 3BPCA 5DR5L 3Q6GH 1WAAF 3WS3A 4PS4H 3BE1H 2APXA 2FO1A 2R15A 3PDOB 2HLAB 3SGDH 3F7RA 3ALPA 3HC0A 3O41B 1U8LA 3G08A 2AV7A 3N1PC 1T7XA 2X44D 4FFWC 4MCYA 3PHOB 1SY6H 2BRRL 1FQ9C 3P77B 3JTTB 4NBZB 4NPYB 1CE6A 4PJ8C 4XAWL 1J8HA 4M03A 4RISH 3GJEB 4ZUVB 1UACH 4NO3A 4RGNB 1SVCP 3ILPA 3IVKB 4Z7UA 1IEBA 1EEUA 3TCLB 3I9GL 3LN9A 3RVXD 4NC0B 1GAFH 2EH7H 3TFKC 1QSED 4AG4H 4S1QL 3OKLA 1N7MH 4XHJD 4XPAL 3WJJC 1KIPA 3MCLH 2MJWA 3WO4C 4LLYA 3MACL 5LWYH 3SCMD 4C56A 5I1KH 3MO1A 2W9EH 2VNCA 3D85B 2OJZL 4TYUA 3LKQA 1IAKA 3KPQA 5DO2C 4Z18A 3I85A 4WENB 5ANME 5EOCL 2H2PC 5K9QG 3MNVB 3IDNB 4LKXB 4RX4A 3L3HB 4TSAH 4OCYL 4Q74A 2E9BA 4EUPG 5I66A 5GSVA 1G7LA 5IMOA 4YZFE 8FABB 1NJ9A 3NA9L 5T3XL 5HDLA 3F7QA 2Z93B 3UTSD 5HVHB 4O9HH 4QRRA 2OL3A 1OGAB 3U7WL 2V5TA 4I0KA 4L4VB 2YPKB 2ARJA 4N0UE 4PJ8D 5E56A 2GJ6B 3X3GH 3PGFL 1FFNB 4G6FD 4MAUH 1F6AB 3KXFD 5BVPL 2H9GA 2V6HA 3VD9A 2IADA 1NUGA 4XBGA 4H20H 3LMJH 3RWIA 1TQBC 4HAGA 5T1KD 2XV6B 4W4OC 2UWEB 3D69B 2J8UF 3I6GA 1TVDA 3QWOA 4NFDA 4DZBB 3N1MC 1A1MB 2WIIA 4N5EC 3ZDZF 3MLRL 4WEUD 4ISVB 4PS4L 5AZ2L 3KPRB 2BXYA 4UT9L 1YYLH 3JBG7 4ZOBA 5DQ9B 3HMWL 4XWGL 3BH9A 2V2WA 3M8OL 5DD5L 5HYIA 4IRZL 5GRJL 2DM2A 4IS6A 2ICES 4DGIL 5F89B 3SDXF 4RWHA 5MENE 4M4RA 1B4JL 5I8KH 1IAMA 4MQ7B 2PO6C 3OKNA 1VB9A 3RWCA 4U05A 1U8NB 3S34L 4PRDA 3SPVA 1R5WB 2A38A 2HJFB 2F5AH 2W65A 4Q9RL 3PIQA 2NY0D 1RZKL 2NW3A 3LN4A 3P11H 3FOMA 2ADGA 2VZOA 5I1EH 1OL0A 1E6JL 1YN6A 2YOCA 4X8XA 2ZUXA 5DVKA 5F88A 4KRNA 2HT4D 4MD4B 1IJ9A 2V5MA 2YRPA 1T83A 3AGVA 4KKCD 4I77L 1K8DA 2FD6L 3DGGA 5MP6H 2IAND 4M3JA 1K9TA 1KLFA 4J6RL 5FIEA 2J1KA 5CEYA 2KDGA 4L5FH 5M95B 1XGRB 1T7WA 4QNPE 2YR3A 2V5YA 4M7JH 3TBTA 5DQ9A 3RZCC 3T3PF 4XCEA 1CXHA 3QUML 1AIFA 1ITBB 1QACA 1YECH 3FO0L 5A3ID 2AJYL 5DWUH 5F1NA 1KIRB 5TJWK 5IMOB 2MWCA 1MLBB 1H3VA 5ESQA 5SWZB 2WQ8A 5MERA 3QWOB 2VKXA 2E7MA 2DQTH 4OV5B 5I71C 4UBDC 3RWIB 5E2JA 3NTCL 4XMKH 4XC1L 2GJZB 4G8IB 1E4WH 2I07A 4Z7QE 1DP0A 3HUJF 4PGDA 2FJFB 4UILL 2CGRL 4W6YB 4HDIA 5CJQL 3IRZA 3QFJB 5GSRA 2WAHA 1MCHA 2V9RA 4DGYH 4NSKB 5B38A 3HC4L 5LGJB 1T2XA 2DIBA 2YA0A 1T5XB 1HILA 3HPJB 1CLYH 3TPKA 3SE3C 1MLCA 1WWAX 4KRPC 4ZUSA 4P5MA 1DQTA 4K3DH 3RPIB 3U6RB 4PBVC 2EE9A 1OGTA 3I2CH 1OSPL 3EIFA 3LKPA 4HEPG 5DEZA 4OZHE 4P2QA 2VQ1A 3EO9H 1N6QH 5JW4N 3EBAA 3IFLL 1KBGH 2JJSC 1J18A 3AMKA 1UH3A 3GMOA 2GTZB 4MB5A 3ZTNL 4L4TB 1D6VH 3DURA 4OZFA 1OSPH 5DRNA 2NNAA 3LVEA 1ZA6B 3HFMH 4RNRB 4YBLC 3OJDB 3QDJE 1D5MB 3TT3L 4HPYH 3VFTB 3FQXB 2FGZA 3SPVB 3HZYA 2GITB 1KIUA 1R3KA 4LFHD 3VXSA 1KEML 5DA0B 4IOFC 1E4XI 1UM6L 2PTTA 1TPXB 2JIXD 3ILPB 3HHRB 1ZS8A 4HF5H 4ZFZA 1I7ZA 5HDQH 3D3VE 1U8HA 3RWGB 2H6PA 3MGTB 1ZT1A 4P2YA 2VO5A 5ELIA 4N0UB 4BUGA 4FABH 5KSBA 2P5WD 4YAQB 2PXYC 4V2BA 2Q76B 4KQ3H 4IBLT 1T1ZB 3K1DA 4JQIL 4CW1B 1PD6A 5CSBA 5HHXL 1OAQL 2NX5B 1Q1JH 2MOVA 3LS4L 1KC5L 2BX5A 4RMUA 4ZPVA 4YXLH 3BPOC 35C8H 4HG4J 1JGEA 4M7JL 4PLKC 2QSTA 1XH3A 4OLWH 3HS0B 4BQ6A 1J0ZA 1NGYA 5E8PA 3H9SA 4Z7VA 4Y8AA 4XCCH 5D9SB 5CZKA 1TMCB 4DGYL 1DANT 1NCUA 3IDYC 3WIHA 3B6SA 2DAVA 5ICXB 2YPKA 1NGPL 1PFCA 3BWAA 4JQVC 4XP6H 2FEDC 4CN4A 4QRRB 3ZDXE 3O2WH 4P3DA 1M1SA 5C08A 2HA1A 4ZOCA 1Y0LB 3P11L 4OD3L 1VADB 5BZDB 2FEDD 1HDMA 4WTZG 4K8RH 4H1LA 2VXVH 5I66B 1NC2A 3LY6A 2EE3A 1A4KA 4NKMB 3AM8C 3VE0B 4P2CG 4P9MH 5CILL 3HN3A 2BSRA 3HAEA 4PJGF 1XCTB 4ELKA 4LSQH 1IILE 3NAAH 2XTJE 2P43B 5C2UB 1BX2B 5IV2A 2BNRB 4ZUTB 3MLSH 2WBJD 5INDB 2VERN 1T03L 1CBVH 4PRBA 1IEHA 2D4DA 1J1OL 1MHCA 3G6JB 2APBA 3UZEA 3AS2A 4QHNB 1BEYH 1JL8A 3HMWH 1NSNL 4B41A 4U1NA 1MAML 4LCWD 4OIAA 2VR5A 4G42B 2RQ8A 3SO5A 4OGXL 1RU9H 1TVBA 1ZOXA 3A6BL 3RX7A 4BFEA 5TPWL 5MENA 1N8ZB 1EUUA 5I30H 4RGOL 5FECB 3LEVL 5F6HI 5HYJB 5B39A 4FFZL 3WDIA 4M8QA 4L8BB 2XZCH 3UTOA 4ELME 4G6MH 3VD5A 2J6EH 3DYOA 3O45A 1IFHL 4YHYC 1JTOA 3MUHL 3OJMB 3JXAA 1H3GA 5BCAA 2FGWH 1UM4H 3B2VL 3S96B 4Y19A 3UTSE 3SGKA 1XCTA 3DX8A 4ELKB 1PY9A 4E0RB 4OGYL 3CMGA 4JFYA 5TF1L 5E8EA 2FHCA 2J6EL 5SWSD 1ES0B 5C0DB 5IG7A 4GQ9H 2DQUL 1NCAL 1OOAA 4S1DC 3BSZH 3ZHDA 4CMMA 2X4NB 5DC9B 2OMNA 2VXUH 4CVUA 2WBKA 3OAZK 3H9HB 1ZMYA 1WFNA 4JFPB 2BNRA 3U7YH 4XGZB 4X6CE 2H8PA 4GRLB 4NKMA 4KI5C 2EH7L 3KPNA 2BSTB 2V5SA 3MLSL 25C8H 3VJ6B 2HRLA 2NY2B 2QSCH 5JUEL 1VHPA 4LVNB 1J87A 3NA9H 5CEXB 2A73A 1NEZG 2Q1EA 3KLDA 7FABL 3MXWL 4LSUL 1S9XA 3ULUD 2IPUG 4TTGA 4X5WB 1KACB 3BKML 3ZKMD 5GRVK 4LSPH 4NNXA 1G6RL 1ZXQA 1RIUL 2P47B 2WINA 3VWKA 4FZ8H 4Z9KB 4ZXBB 2B4CH 1XF2B 1R3KB 1MJ7H 2DQIH 1T1XA 2IBBA 4V1DB 3PWNA 4QHLB 4BZ2H 3I50H 4PRPE 4FMFA 1Z6JT 4YHPA 3DBXB 4ZFGH 2IPUK 1T22A 4LSRL 2RCSL 4M6AA 1B90A 1VFBA 1SM3H 4WV1C 4WI6A 3F7YB 3CK0H 4ZSOA 4F7TA 4EN3C 2PXYD 3TJHD 4UZGA 4PJ9D 1U8HB 3B9KC 3RWGA 2ADFH 3BUYA 5EFIB 1QSFE 2R1XA 3SGKC 5IHBA 1GZPA 3QUYB 1MH5A 4TSCH 5CEZD 4G7VH 5GS1C 4FABL 2FYYB 2K3TA 3FQRB 1IC4L 4ODTH 3A6CH 5HGHB 1N0XH 4XWOD 5DQDH 4OUOA 4ORZC 4PRHA 3SDAA 3T0EE 4HUNB 5DVMA 1MCEA 1N4XH 3MV8D 1H3XA 2JK5A 4QHNA 4PIRF 2OLDA 3O4LB 3K4ZA 1LO2H 5ACZB 5MHSD 1NDGA 4L8DA 1KENL 3BH8A 1CD9B 1S5HB 3SKNB 4L9LA 1IM9B 4LAQL 3GI9L 3IKKA 3NH7L 4Y8DC 1G6RH 3P2TA 4F7MB 1A7NH 3VDBA 3LKPB 4KJYB 3AAZB 4JPVH 1ZHNA 4BKLA 4KUZH 5MERB 1HDMB 4X4XA 4JZJA 1VKXA 1JGLH 2Z31C 3GM0A 1EA9C 3CZFA 1HSAA 2G75B 3PDDA 4NSKA 2PTUA 5GQBA 1X5HA 1OTTC 1CZ8L 5HSFA 3B6SB 3WHXB 3W82A 3ZE1F 4APQA 4PJDA 4HUUA 3ZKSD 5E8PB 1INQB 4FXKB 4OCXL 2RJMA 3KPOB 4U0RB 1NC4A 4OD1H 4QY8B 4N0CD 3G5VB 2HN7A 1NAKH 5FAAA 4FQJH 2NY0C 4YWGL 4MA8H 4UUJA 5FHBH 3T08A 1DCLA 3GBNL 3NTCH 1A6UH 2I9LA 3EDEA 2VLRA 4PREB 4P4KB 1A3QA 2YBRB 4NQXA 4YHLL 1OY3B 1JHKL 1SEBB 4RAUB 4L4JA 5C9JB 1G7HA 4QT5B 4WFHD 4Y5YC 3EUUA 3OKEA 2R0KH 1BAFH 3C6SB 1W0VA 4WV1A 3BAEL 4G8FA 1QBLH 4WY7H 4LHQB 3GO1H 1AJ7L 3EZ8A 3L6FA 3MFFB 5GGRB 5DZNA 3MLZL 4NUJB 1ZANL 2BOCA 2VDQH 2I24N 1VENA 3L3KA 3E0GA 5C6TH 1V3JA 2NCMA 2X42A 4MAYA 2EDEA 1OAYL 3FQXA 5F7EH 4FG6C 3D5OF 2DLFL 4X4ME 5DUPH 5I0ZA 4X99A 4DWHA 4BM7A 4UOJA 2Y6SD 3CDGA 5TQ0H 4BSJA 3U0PA 1S7XB 1FRGL 2HN7B 1KB9J 5DRZB 3W5MA 1Q0XH 3CZJA 2F5AL 5FGCE 2KBGA 2J3SA 1AGEA 1FVEA 5ILTL 5IBTH 4JKKA 1XCQA 2ICWB 2PXYA 2I5YH 1AGDA 2V2WB 3F58L 2GJ6A 1WIPA 3X3FL 5HYEA 4FQHA 1SJEB 4U2ZA 4UI2A 4HWBL 1HSAB 3ZTJH 5KVDH 1QFUH 2HFGL 3I6LD 4U1KB 4PJEF 1YEFL 3NIDE 3O6LH 4M43H 5C6WH 1A1MA 5IESH 1JYNA 1RUKL 4FQIH 5L2JB 4YQXL 3D69A 2Q8AL 3N06B 4WO4C 2DTML 2NYYC 2ZJSH 4FTVA 1BM3L 2X7LA 5D2LA 1AQDA 4OI8A 4G6AC 4OF6A 1BQUA 5D93C 3LKQB 1ZT7B 3EOBB 3MRNA 4L8CA 2IANE 5DMGD 3KJ4C 5F1SA 4OV5A 4P48A 5I1GL 1UKQA 2ZNXA 4U49A 1JRHH 1HXMB 1ZANH 3CFDA 3F6LA 5DUPL 1IQWL 4UINH 2W07A 3EO1B 5FV1L 4UIMB 2XYCA 4NNYB 3OB0K 2Z93A 4OLVH 1ZGLB 3Q3GA 1TETH 2AJXL 1Z2KA 1VGKB 1KCVH 3C60B 4NZTL 4FXGA 5FYJU 1KCUL 4NO3B 1AGDB 2X4TB 4MMXC 5I73B 5GGSB 5KJRL 4FQLH 4WI3A 1PKQA 5IBTL 3G6JF 3ZYZA 1H8SA 4C83A 2FIRT 2DWEB 3WNNA 3MV11 1AO7B 3VXUE 1DZBA 3QIWD 2B0SL 4U3XA 1NGXB 2ED8A 1KIPB 1PQZB 3DSFH 1CDCA 2LU3A 1GC1H 3C5ZD 1VKXB 1CTNA 1I8IB 1PSKH 3PIQB 5FK9A 3GMLA 5E6IB 1L0YA 3VRLE 1I75A 2I60H 2D2OA 4MA8L 4O5LH 3DVGB 3DMMC 3CXDH 1YY8B 2ID5A 4MJ5A 2ZSVA 4YUEH 4F7MA 4X8JB 4EBQH 2ZUTA 4P5TC 3RVVC 1IM9A 4RA0C 4U0QB 2Z8VC 3HR5A 5B8CA 1MCNA 1HHJA 1L0XA 5CJBA 4GRWF 2A6JB 2E7LA 4JO1L 5I73C 4XP4H 3INUL 1ZHLB 1DQJA 2EDDA 4WFHE 4DJMA 3HE7D 4AMKH 4M9PA 1N64L 2XACC 1BIIB 5IW3A 4FNLH 4LAQH 2P46B 5KVEL 1MHEB 4ZFOB 3QUZB 1RUQH 3K1KC 4GRLA 2DLHA 5HHOB 3I75A 3LB6C 2FR4A 4RDQF 1EGJL 3OKKB 3F7VB 4JJ5B 2PW2B 1NBVL 1QLFA 2PO6A 4MZ3A 1J5OH 1FYHB 4CNIA 5ESVA 1X5YA 3MV7B 1ZGLP 1YEJH 4FZ8L 3ESVF 1T89C 3LHPL 3DUSA 4IDLA 2VDOL 3IB4A 3QRGH 4AEHL 4XXCC 3CX5J 4Q6IC 4U1JB 4M1DH 3WIFA 2G75A 1FCCA 2BDNH 1MFDL 1K4CA 3LEXA 4QXWA 5C0DA 1MCIA 4BZ1H 4JCMA 1R3HA 1MCKA 3CMOH 1A6TA 4F37K 3VI3E 4GH7B 1FV1A 2VLME 3R06B 2D4FA 3MMEA 5J1SC 2Z0BA 1DQLL 4J2XA 5ICZB 2EZ0D 2VLRE 2C3HA 4DN3L 1I8KA 3MO1B 3O3EA 3RUGE 5BS0E 1AD0B 2VDMH 1A2YA 2GHWB 3JV4B 3PP4H 4HG4K 1MJ8H 4HK3J 5EORH 5KOVC 5EO1A 2BY2A 2DMBA 5L88H 4R3SA 5J06A 3MUJA 4S10A 2AXGA 2Y23A 1IBGH 1PSKL 4NRXB 1QYGH 3O3AA 4PJBF 5I1IH 1ULVA 1RFDH 3FZUC 1JZ6A 1P5VA 4FFVC 4JM2F 3P4OB 5DI8A 2WP3O 3IDIB 4F9PA 4XNQB 1DL7L 4I3SL 2QSCL 4NPYA 4LNVA 1KN2H 1TZGL 1MHPL 3T65A 1GPOH 2VLLA 5L2KE 1QLEH 4D9LL 1NAMH 1BX2A 3DUUB 5TH2A 4Y1AB 1A9BA 1EAJA 4P46B 4QHLA 1A1OB 3AY4A 3RVWC 3O81A 3V0VA 3VXRA 1CYGA 4PD4K 1FNSH 3BPCB 3V4VL 3T8XB 5BZDA 1VEPA 1KEGL 3GBMH 3KXFB 5E5RB 1RUAL 1AGFA 4P3DB 2NMSA 2IG2L 1ONQB 2VWEC 1BD2D 4X6BB 2WK2A 3VXUA 3FMGL 2HFEA 2PYEA 3PWPE 4PJEE 4GW1A 3BPLC 5C0AB 3BEVB 4Y4FD 2AVGA 3IDIA 1AFVL 4FQCL 2OZ4L 3ZE0E 1ZLUK 2QTEA 4NT6B 4N8CH 3BMVA 2HVJB 3QDGB 2V2XA 2OK0L 1BEYL 1EEZA 3TN0A 1JGEB 3FZUD 1LDSA 1QFWH 5I1JH 2Q86B 3FN3A 4N9GA 2LV4A 3HZMA 1TJHL 3FQNA 3UTQB 3OF6A 5DD5H 3TYGL 5IGXL 5IR1A 3RX8A 1TIUA 4NT6A 3P40A 4KJPC 3P9LB 4L4TD 3JV4A 1IFHH 2F54D 4JREC 4NO2A 2Z92A 4F9LA 1MFAL 1A6WL 2XN9E 4KDVA 3TF7C 5CBAA 4HH8A 4M61B 1SBSH 3MRHA 1FL5A 4DEPC 1AGFB 3B2UC 1QFPA 4P59H 3EYQC 1DBKH 3IDGA 4E5XA 4P2QD 3FHQA 3GBML 1VFOA 2JB6A 3GSRB 3O4OC 3I84A 2HKHL 1Q38A 4OCWL 1CD0A 3U46B 3TT1L 2YD4A 2WM0A 1FZJA 5CMAB 4ETQA 1ZA6A 3MLZH 1Q0YH 4LCWE 4JDZB 5ETUB 1OP9A 3U7WH 1JF6A 3P0YH 1OLLA 5IB1A 4F2MB 5KVMC 5T3XE 1X5GA 4ZAKA 4L8BA 1FFOB 1IVLA 3NAAL 2Y25A 3SDAD 5JA9A 5E5MB 3IXTA 4WW2F 1UH2A 4Y19D 5D1ZC 5LJYH 2FIKA 4WHYG 2Q20A 5IFHL 2NR6D 4NC2B 4OLZH 5I2IA 3ZE0F 4RGMC 1BIIA 1HNGA 5EBGA 2F15A 2AXGB 4ZXBC 1JV5A 3QULA 1QD0A 2HVJA 1OTSD 3CFJA 2HFFB 5DURB 4JRXA 1IGCH 1T21B 2Q76A 2NY4D 3B4NA 1G9EA 2XWBA 4LSSH 4YHOH 3MLYH 4J4PA 1CR9H 3G6JA 3OZ9H 3TV3L 2O26U 1J1OH 1MJ8L 1A2YB 4D0BA 4X6BA 4PRBB 1VSCA 1WBYA 3DLQR 1CT8A 4FQLL 3TC9A 3QI9A 4Z5RB 3NFSL 1GGYA 2IQ9H 1PKOA 2VKWA 3IS0X 4JN1H 1X4ZA 1IGML 3L3IA 3NN8B 1A4KB 5BRZA 4OFPA 4R0LA 2VXSH 4GLRI 4J3OC 4HFWB 4JPWH 4JPIA 4NQEE 1YJDH 5F1NB 4DVBA 3ARBD 1NBZA 3UBXA 3HCVB 3DTXB 3WCYA 2D9QB 3IFNL 5DD0H 1QA9A 3C6LC 4MWFB 5F7HA 2IGFL 2VDOH 3QRGL 1KB9K 5EU4A 4WTZA 3T65B 4TQEL 3BT2L 5EB9A 4G7YL 1IKFL 4I48A 1HYSC 3FFCD 1CD8A 3Q6GL 3HS0A 2Q8AH 3NZHL 5LBSH 2GK0B 4S1SH 3D3VD 5I6XB 5K9QI 3BDXA 1Q94A 1T5XA 1INEH 1UKTA 4XMKL 4P4KC 4LIQH 3QZWG 3C87A 4ERSH 2ENSA 5HHNA 4AMKL 5EO1B 2F5BL 3E3QE 1JFQH 2DQTL 1D6VL 1J12A 3H3PL 3KPLA 1DUZA 1EHXA 2RGSA 1AP2A 3VFMA 2LVCA 4ONHB 4U6VH 4QWWD 1ZT1B 4P49A 3VMPA 4NDMB 3RAJH 4G6AD 4YX2H 3IFPB 2CKBA 3VXME 2Q7YB 3BP6B 4ZFGL 1SMOA 3AU1B 1T04A 4Q0XL 5B3NA 1JGDA 3HAEH 1UJ3A 2EXYC 5DSCB 5CKAA 2VQTA 2NY1D 1HQRB 4PYHA 4AL8L 1BQHB 2FD6H 2YUVA 2WLZA 1IC7H 1V3KA 2E8YA 1S9WB 3JV0A 4QRRD 3V6ZA 3MGAA 4PRHD 4LDEB 1WZKA 4IRJD 1A14L 4HK0A 3DSFL 5EBMB 3IFNH 3GUTB 1CXLA 2GTZA 5D96B 5T1LA 7FABH 5SX5K 2NY1B 2J8UE 4C83B 3EO9L 1N6QL 4XP9H 5J12C 1FORL 4JFFE 3HNTH 4FQPA 1ED3A 1RURL 4NP4H 1O0VA 3DX7A 3TNNA 4BZ2L 3V95A 4U6HB 4KROC 5DC0A 5FHBL 3QUYC 4ZS6D 1NMAH 3NABL 2A83B 3O8XA 3QFJA 4XI5D 2X4SA 4XVJH 5EIVA 2F54A 4C55A 2CKBB 4K9EL 1KF9B 2NW2A 5CEZL 3TO4B 4QRPA 4GRLC 4WU5A 3PWUA 1Z3GL 3G5YA 1DUZB 5C0ND 3WLWC 3QUZD 1G7HB 3C2AL 4QT5A 3KPRA 4L3AA 5HGDA 1A3LL 3MV7D 4D9QE 3X11B 1A3RL 4NZUH 5HHNB 2IAMB 3WN5C 3OKLB 3TNMB 1NCBL 5DUBB 3MBED 5KANI 5GGQL 5IB3A 5TE6L 3M17A 5BVJB 4FQHB 4RMWA 1C5DB 4Q6YA 1KJMB 3TIDA 5F8RC 1JMZA 3DETD 3T4AB 4XZUA 4O9HL 1ACYH 1MIEL 2YPLB 4OCWH 3F12A 2X4PA 4M7LT 3M8OH 2DKMA 1FO0B 4NKIH 4HHAB 4PJIE 4MCYB 3BIKB 3V0WL 3G08B 5I1EL 1VPOL 1LK3L 3BZEB 3K46A 2XNAA 2OTUA 1U6AH 3R1GL 5GSVB 5MHSE 2FLBT 2C4XA 3QHFL 3P30L 5M7QA 2IMNA 3NPZB 3K0WA 3UTTB 3LRGA 3CMOL 1OP3H 1ZVYA 1QSEE 2W0FB 3UEZA 1UM4L 3PWLA 1LDPH 3IU3A 5FF6B 4ERSL 5DJ6B 5EUKA 1XFPA 5FHAL 5EZIL 4XHJC 1TJIL 2P8MA 4UT7H 2CO7B 2NLJB 3P0VH 5H35B 5C71A 3MLXL 4JQXC 2Z8RA 1MCCA 1Z9OA 5CBEA 5HYJD 3KYAA 1BMGA 5J0BA 5J1AA 4ISVA 2VRAA 2W59A 5GS1A 4ZNCD 5I16B 2YBRA 5D71H 3FB5B 1GRWA 3PABA 3Q1SH 1G9ML 1JPFA 3BD4A 1GZPB 1I8LC 4KV5E 5IB5A 2EH8L 3QG6A 3CFCH 5GJTL 5ANMA 4OZFH 1DANU 2V7HB 4OUUB 4UT6L 1J8HB 2VLKA 1UJ3C 1BQLH 4OLUL 2VISA 1MIMH 3K2UH 1C08A 4PJ9C 4XBGB 1JGVL 3OXSA 5JMRA 4TUKH 4XNYL 2VLJB 3MACH 2IAMD 5J89A 5TDOA 5EC2A 2DQFB 1OCWL 3V6ZB 3Q48A 1P7KA 2R1WB 3SDYL 3T0AA 4D9LH 3QIBB 3K4AA 3GHBL 3U9PH 4NN7C 1FPTH 4X98A 4POYA 5TE4L 3QIUD 4XVTH 1M05B 4LVEA 5DQJA 1J0IA 4DTGL 4HUXA 3SDDC 4NQCE 4PJ8A 1MEXL 4XP6L 3ROLA 2HT3C 2J8UA 5CHNB 4YIQA 4ONHA 3PQYE 2DQGH 2WW8A 4GKNB 1PG7X 4KJPD 3RI5K 3UTSA 4L9LC 4L9LB 3UTZA 3T0DA 3QWQB 5F93C 3BE1L 4P23B 1C5BL 1MFBL 5IB2A 1DQDL 3DUHA 2HMIC 1EJ6A 3ZKNC 4HBQA 1GCFA 4NQXB 3PF2A 3UPRB 3UPAA 2BSTA 4RA3A 3QXAA 4RZCB 5JW5B 1K6QH 1CQYA 2KZ1B 1X6NA 1W0WA 4BFBD 5C6PB 1BD2B 4Z78A 4KI5D 5HHXH 3BP7A 3CFIC 1TTUA 2APVA 2E5EA 1KT2B 5D7KE 4CVZA 4YGAB 3BEVA 1BFOB 1S78D 4G6JH 2ZUSA 1H8NA 3MLWL 5DF0A 5EU4B 4KTEL 1A3LH 4RDQG 4PTTA 2BDNL 2G5BA 5I30L 1JJUA 1G7PA 2PETA 1H3WM 5IG7B 3W11D 1ES0A 2HKFL 3LHPH 3TCXA 3BDYH 5JIPA 3VW3L 1AXIB 4KKAD 4CVXB 3PWNB 1CLYL 1T1XB 2OXHA 4GAJL 4X9BA 2V9QA 5L7XL 4P23C 3GKZA 4JB9L 4M7LL 1KFAH 3GZKA 2GJ6D 3T2QA 4NJAL 5HHPA 3PV6A 4HWBH 5KVDL 2C1PB 4D0BB 1CFBA 1UA6H 2EDYA 4LHUG 5LCVH 3O6FD 5I1JL 1A9EB 5GGTH 3LDBB 4LPXA 1MCBA 2QADD 3W2DH 4ZS7L 4S2SB 4LPCA 2GT9A 3L7FB 4MGXA 4P5TA 1WT5A 2P48B 2BNQA 4MNGB 1TVBB 2XA8L 5I17A 3QUYA 1JK8A 1IL1B 3EYSL 5EPMB 1YC8A 3WFBH 1HNFA 3FT3B 1YN7A 2BVPB 1KGCE 2DN7A 2GJJA 1IC7L 2PF6A 3D39E 5EU6A 1AO7D 5FCUH 1X5ZA 4CU7A 1AD0A 1TXKA 5DJCA 1XGYH 2KZWA 2H41A 1XF3A 2OR9H 4DZ8B 4GKNA 2EDHA 3HI1B 1INDL 4ZPTB 1A6ZB 4ESKA 2GKIA 1D5IH 4OLXL 1QLEL 3IDXL 4URTB 1FV1B 1T20A 1FNGB 3HRZA 2NXYC 1KC5H 1TZIB 3D85D 4WFGE 5KSVA 5E1AB 1PYWA 3JV6B 4NP4L 4XP1L 5KAQG 3UAJC 3KYKH 1JZ5A 3QUMH 1BF8A 3QFJD 3VFRB 4UTBH 4MB3A 4LLDA 5HYQB 3S96A 4OZIF 4OZIE 4L9DA 1H15A 1L6XA 1NKOA 2YRLA 5E2TL 1NL0H 5EOQH 1PG7H 5C09A 3QYCA 2NY6B 3WMSA 5DD1L 3FFCE 5GRZA 4XWGH 3I75B 1Y18B 1MREL 3MLUH 3FT3A 1AXSA 2J7LA 3WNOA 2VDML 3EYSH 3U0TA 3KPNB 1KIQB 4XPGH 3FB5A 1ZHBB 3BDYL 3VW3H 1FL3B 5DC4B 4Q2ZA 5F1IA 1TFHA 2VDRL 5JOPD 3VU2A 1T1ZA 3LQAH 3SOBH 2FRGP 3GSNB 2YSSA 3F65A 4XP9L 1S9YB 5ID0B 1A9EA 2VN4A 3QFJE 1WBXA 2LQRA 2WWKT 3VGDA 4DGIH 2YK1H 2R4RL 5IJVB 4WFGD 3UYPA 4U1IA 4M5YH 3D0VB 1Z5LB 2VIRA 2Q7NA 4JVUA 2W60A 3UAJD 2PTTB 1SYVB 4Z0XB 3EYFA 5DK2B 3DHMA 4JQVA 1MFEL 1NBVH 3QXTA 3J8F7 1EHLH 4LSVH 5D7LE 5I75C 2AQ1A 5C08B 4BJLA 3D39D 2ITCB 1SEQH 2HWZH 4Y1AD 4GW5B 2X1XR 3ELAT 4CJ0A 3QB7C 2PYFB 1WC7B 4GG6A 3UYRL 4PY7B 2Y7QB 2P8LA 4PJXE 3P4LA 4F33A 1N8ZA 1FGVH 4YHNA 4GG6F 2G60H 5GRXG 2WSKA 3SO3B 5K9OB 4YE4L 3KYNA 4XNMB 1ZTXH 4K7FB 5EOCJ 5SX4H 1FG2A 1MFBH 1MHCB 5B3JE 4N1EA 3OX8B 2VYRE 3ES6B 2VL5B 1OW0A 3SCMC 5D7LA 1QSZA 5DD6B 1RIHL 4HD9A 4OLZL 2BY1A 3DIFB 3CAFA 4PJ8B 3GSQB 3T4YB 4RGNE 1LK2A 3CFEA 3OAYK 4LSTL 5L6YH 3RZCA 1FBIH 4KKLD 4PGEB 4X80L 3MREB 3CSPA 5ID1A 1A6WH 5DEFB 1NKRA 4JM2C 4WWID 2X89A 5SWQA 3PE9A 3TBSB 3HZYB 2XIDA 1KCRL 1Y0LA 4HGKC 3SGJC 4NWTH 4U1JA 1D5MA 1WUNT 1P4BH 5DJDB 1BBDH 3V4PH 4KVNL 3EAKA 1TETL 2ICWA 4J4PD 4P2OD 3S88L 5FUCC 2EYSB 1M71A 1MFCL 2EDRA 5CLWA 1CR9L 5EN2A 4UDTA 3ZT5A 3E6HB 3BN9D 3BUTA 3U0PB 3Q6FB 5C70A 2MPAH 1RZIA 1QUNA 2O61A 3FQTA 1EO8H 4GRMA 4Z7UE 3FMGH 1PY4A 2X4UB 5T1MB 4CW1A 2AJVL 1HQRA 3T2PA 4PJBE 1DJSA 1F90L 3PQYD 5DHYA 1I8LA 1TNMA 1AKJA 3FKUS 4HIHB 1JGDB 3T09A 1T04B 4RRPA 1BZ7A 3VRJA 2AK1H 2JELH 3HPLB 1PG7L 5CSZB 5LG1A 4KK5D 4G8FB 1GZQA 3QCVH 3MV9A 5E2VH 4OZHB 1AP2B 4MJ6B 1L4IA 4G8GB 4RQQA 4YPGB 1HWHB 4EI5D 3CC5A 4CN6A 3DVGA 1B9ZA 5KSAD 5H94B 1T2JA 2ZUQB 2NXZC 5ESQB 3AY4C 3LS5H 4IJ3B 5IMMB 3KXFE 4HFUH 4N0RA 3HE6D 4N0CC 1IC5L 4ZQKB 3BZ4B 4EI5C 3MBXL 3VMOA 2VLJE 1IZKA 2IBGA 3DURB 4HWNA 4DEPB 3OB0H 1WIUA 4PJEB 1DBJL 1ZEAH 3T0XA 3F12B 4HKJA 5AAWA 1J1XH 4EI6A 5LQBL 3GSXB 5IKCA 3TIDB 4QHMB 3FONA 3RPIA 5CAYB 5BS0D 1SYSA 5BVJA 4UTBL 4UIKH 4GBXB 5EO9B 1BZQK 3GMNB 1V3LA 4WI2A 3I6KB 4FG6D 5FFLA 5DMJB 2HJFA 1HXMA 3CFDB 1R5WA 2OK0H 5DYOB 2VXQL 4J3SA 3AROA 3OJ2C 4OBSA 5ALCL 4RISL 12E8L 2OJEB 4NYLA 4XAWH 2Y72A 3PGCA 1K4DA 1DE4A 5IMLB 4OFYD 3U7AA 2EICA 3D85A 5IFAL 3BVNB 3P4NA 3QSKB 4FTVB 4LHUB 5FCUL 1RFDL 3VRJB 3DVNA 3N0PB 5B39G 3GNMH 4YDIH 1KYOJ 1A14H 2N4IA 1JTPA 1YMHB 1U92B 2R56H 1EEQA 3SDCC 3SDAB 5AYUL 3RY5A 3IKCA 3CFJB 1X7QA 1AIFB 5FO7B 43CAA 3B9KD 5SWZE 3BESR 1P69B 1XIWD 5I1DA 4K8RC 3ZSSA 3W9EA 2FECL 2H1PH 2ICEA 3V8OA 4JFXB 4OM0H 1JHLH 4OSUL 2CK0H 5EN2B 2O5ZL 2Y9RT 3AB0B 2QL1A 5DD3L 4N90D 3FO9B 4FFWD 1U8OB 3SKOB 4U6XA 5AAMA 3C09B 5K9KA 2VE6A 5CJOH 1U58A 3QCVL 4JFZL 4QXUH 4RBPK 5IJKC 4MAYB 4F7EB 4I0PC 3GSRA 1CXFA 4ZXBA 2F74A 2Q87A 4YUEL 3HZKB 1MFNA 3QUZC 2QJDA 2YKLL 4O5LL 3SJVA 2EIZA 1BF2A 4ODUB 4MHHG 1Q72H 2IEPA 5TDNA 1NFDA 3GSUA 1OB1A 1FZMB 1NFIB 1NDMA 4RMQA 4U1HB 1YUHA 1WWWX 2QHRL 3GEWB 4QYOB 4RAUA 4F80A 2QHLA 3DRTA 1ZLUH 4TTDC 3OKMB 4AIZA 3GGWB 3NOIA 5I1AA 1JZ8A 4H25A 5L9DL 3UTPE 3DYPA 4JZOA 4Z7UB 1IGTA 1A47A 3DI2B 1KG0A 3D3VB 1DQDH 3KPOA 1NGQL 1GGCH 2CKNA 4D0CB 2QV2A 3V5HB 4KY1L 1SY6A 1ONQA 3O2WL 3RWEA 3MJ6A 4IRJA 1XF4B 1NH6A 1R3LA 4AEEA 3L7EA 1KPRB 1MFCH 4R0LB 2EC9T 1CFVL 1ZHNB 4X6CB 4BKLB 2ESVB 4ZTOL 3L3IB 3NN8A 4GKOA 1NCDL 1S7TB 4JRYB 4ONGL 4TOYH 1LQSR 1MCOL 3U48A 3BHBA 1LP9A 3EOTL 3FFCB 4Z5RA 1NEZB 35C8L 1RZJL 4L4VD 4C59B 4XCNA 3DX6B 3QFDB 5F9WB 3LPGA 2A77H 4KC3B 5D70H 2R69L 1FIGH 2X4OB 4FQXB 5CIPB 1DQQA 5FA3B 4NQUA 5ENWB 1DR9A 5F7DB 4O2FB 4AH2A 3CFKB 4TRPL 4ONFL 2O5YH 4KXZH 3VFUA 3BKYH 3FHAA 5E6IC 4WO4B 1LEKB 3QT2A 5E2WH 4OQTH 1KCLA 1WWCA 4LF3B 4N5UA 3SE4C 4EVNA 1JNHB 3JTTA 3MRKA 1JYWA 3C5ZA 1VFBB 5D8JL 4IHOB 4HZLB 2A6DB 2EO9A 4ETQB 3TYGH 2RHEA 3T2NL 4MJ2A 2HLAA 3U1SL 4Y2DB 4GRWB 4V1DA 15C8L 2IWGA 1EDQA 1EJOH 3WKMH 1CFSB 2XFXB 2ZCKH 5HGBB 3LKNB 4BQ8A 3X13A 4NKQB 2R8SL 4LAJH 5HDOA 1F2QA 1I9JH 4BK4A 1L7IL 2BRQA 4PJ7E 2F19H 4OLXH 2AJVH 2JCCE 4QTIH 3ESUF 5FYLH 4D0DB 2QQLL 1WIOA 4K3DL 5T3ZE 2OMBA 5B3JF 5TQ2H 1XGQA 1QQDA 2R2EB 3H8NA 4F3FA 2MPAL 3O8XD 1ACYL 5FGBC 4EDXB 4JFEE 1WBZA 2DTMH 2KKQA 1I9JL 2AW2A 3X14B 1WEJH 3FT4A 3AXLA 5HHVL 4KY1H 4KHXL 3STZB 4LOUD 5DRXA 5FB8A 5HHOA 3QCTH 4MDJB 3TA3C 4A6YH 4ZUWB 2ARJQ 3IFOA 4FS0A 4GBXC 2Z4QB 2H26B 3W0WB 4N9GB 3BAEH 4WY7L 7CGTA 5DRWB 5IFAH 5IVOA 3MOBH 2Y5TA 1VERA 4PJHA 1FN4A 1EEZB 4K3HA 4NZUL 3SQBA 4LSQL 1LD9B 5CWSB 3REVB 5INCB 5D8JH 4PJAE 3RGVA 1HZHL 2QR0A 4PJCE 1EFXB 1WICA 3BN3B 2DLGA 5EBLA 1UXWA 5DGQA 1G7MA 2VITA 2X4NA 4XAKD 3TWCH 4Z77B 5KAQF 2PTVA 3FO0H 2C26A 2JCCA 4JGMA 4P2QE 2XXMB 3QAZC 4R7DB 5DVOA 4U0RC 1NGWA 1BP3B 1QSFB 1P7QB 4R4NC 5DT1H 4ODHL 4RX4D 3DO7B 3HB3D 3LN5B 5HI4C 3ZYJA 3CFKA 1XZ0A 4ETYA 2XRAL 5C0EB 3QQ9D 1T0NA 1PQZA 4P46D 3RZWA 1N26A 1QZ1A 1K2DB 3FRUA 3WE6A 2ADJA 4Z7OF 2DYPD 3NZ8A 2UUDH 3QQ4B 5AEAA 4K3GA 2R2HA 2GCYA 1RZFL 3AUVA 4EIZC 5ERWA 1KSRA 3MBEB 5TGBB 5HBBA 4M4PA 1MWAA 3IAGC 4WHDA 5HHMB 4R26L 1D5XA 3QEUB 1A0QH 4PJBB 3FB6B 5DXWA 5T1KA 2Q3ZA 2F5BH 1INDH 4YDJA 3VXQB 1FC2D 4KZDH 1J86A 4NWUH 2EXWC 4KK6D 1QP1A 3DPBA 1I7TA 4LSRH 3KR3L 5J11C 3RL2A 5HDQL 4EUPA 3CIQA 3SE3A 4E42B 2ZZUT 5IB2B 1K8IB 4WHTB 4GG8A 5MI0B 1NANH 2UZIH 2PW1A 4OBRA 1EVTC 2DB8A 3QO1B 3AS1A 1V7NL 4AIXA 3TN0C 1EGJH 3RL1B 3MMEB 4WW1B 1NC4D 5FKPB 4DCQB 4H25B 4PR5A 5HHOE 3KDMB 4LRIC 2FATH 3CLFH 4EDWH 4JPWL 4HWZA 5I8CB 2Z31B 4ZYKB 2E27H 4QCIB 2ED7A 5E1HB 1UWGH 3P4MB 2HG5A 2YUZA 4L1DA 3IJSA 5CSGA 3SDDA 4XXCA 5D7KD 4XH2A 3CLEH 1T1WA 1T89A 2A0LC 2V7NB 3V4UH 1KENH 3UO1L 5DS8A 3HMXL 1RZGA 2QQNH 2EIZB 2YKLH 3OZ9L 5DRZA 3T0WA 4AQOA 3STBA 1YN6B 2OYPA 2CLZA 3SDCA 3PWVB 3QNYA 5KS9F 3VA6A 4HIXL 1MF2H 1BD2E 4XP5L 5LAXA 1I9EA 2W9EL 4GXUN 1DQJB 1Q9KA 3ZDYF 2J4WH 2A9NH 4MQ7A 5EA0H 2R0WL 1YNLL 2P44B 4YAQA 4Y4KB 3WLBB 3DVIA 5L8KB 3GIVA 4Y89A 4FQQA 2EDKA 5DFVC 1FC1A 2Y36L 1FFRA 1KLGA 3SJVE 5D1ZA 3VFNA 1W0VB 4WV1B 5DJ6A 3WUZA 2BFVH 3T77B 5JR1H 1MCPH 5FYKD 3QPXH 4XPTL 4G8EB 5JHDD 5IQ9A 1X5AA 4L3EA 2JIXB 5BXFB 4BQ9A 5E7BA 1CIUA 1UFUA 5E6IA 2R56L 1YEIL 4PJGE 5ESAB 4WHYH 5H8DA 3SE4A 3KPRD 1U36A 1CDGA 1N6UA 4KTDH 3VH8G 3DVNB 3VMNA 1QR1B 1NGXA 1T66C 3MODL 5F9OL 4K2UH 1F4YL 2Q8BL 1FO0A 3ZO0A 4OQTA 1D6EB 4LU5H 5IW6B 1JP5A 1WFTA 1EHLL 3LRSB 4TULL 1INQA 4FXKA 1XF5B 4Z76A 4L3CB 4BSVA 3HZVB 4U7SA 1JWMA 3L5HA 4UDUA 3RNQB 3U83A 4AT6B 3V6FB 4H0IA 5ISZD 1U8QB 1E27B 3OR7A 4TPRH 3U9UB 1XIWC 4QRTB 1ZT4B 4XCFL 4KU1A 3ARDC 1F58L 5IK3B 8FABA 4I3RL 4S0TD 2XZCL 1SYSB 3B2VH 2F8VA 3O4LD 3QIWB 5C08D 1I9RL 1I85C 3G9VA 3H7BA 5ILTH 3RTQC 3KPQB 2MHAB 1Z3GH 4N1HB 4UB0H 4DW2H 4LPYA 1PZUB 4DQOL 1IQDB 4QWWC 3JUZA 5SWSA 3TO4A 1JF1B 1EV2E 3VXTB 4X0KA 1SJHA 1EXUB 2XWTB 2XTJC 3FB7A 5DD1H 4KZEL 3ARXA 2EKSA 2PCPB 1E0OB 1KLUB 2X4RA 2ZPKL 5JORB 4E41D 2ERJC 4F8TA 5JPNA 3D18A 2QQQA 2VQUA 4LLWA 2DBLH 4TN9A 2VN7A 4H0GA 2R1XB 5IM7A 3GJEA 4ZUVA 3SKMA 5IWLC 1G84A 4WFFE 4D8PB 1KJ2H 4HIIA 5B21A 3GIVB 2IH3B 4RGND 3WLBA 1S7UA 1TPXC 4TSAL 3LSOB 2W9DL 3CSYB 4XX1G 3WJLA 2DBJA 5CKGA 4C58B 4D9QD 3C6LD 3O41A 2D7PA 3QG7H 1DUYA 5HYFA 2H3NB 4ZFFA 2EE2A 5EZOL 3O6KH 4TUJB 4HIJB 4C56E 1VCAA 3TBVB 1RZIB 3WS3B 3DXAB 4TVPE 4PTUB 1U8KA 1DN0B 3R4DA 1OSZA 1AHWC 3G5XA 4LSVL 3VI3F 4V1DD 1EZVX 4Y5VC 3OG4B 3UPCA 3HI5H 1KEMH 5DJAB 3V5DB 2EEDA 1EEYB 1BGXH 4PJ7A 3TZVC 5F9JB 3SE9H 4OM1L 4YHZH 3S3PA 3HFML 5AUMB 1YNLH 4O02L 1WFUA 4MX7A 5GJSH 1N5YL 3P4MA 5IQ7L 4G9DB 4XPBH 1OAQH 3L95B 3WD5H 5LGKA 1ND0A 5E2UL 1XGUB 4Y1AE 3KPSD 3L5WB 5D5MA 4F7CA 5JO5B 1P4IH 1W72B 3QXDB 5H37H 1NQBA 4P2RE 3G5VA 5KBNC 3BZDA 4U1GB 1RZKC 4LL9A 3MROA 2Y06L 4OZ4B 3RL1A 2AXFB 3BN9C 2PNDA 3VGAB 2Y4SA 4NQVA 1KPUA 1E28B 4R97C 5D1XD 4WWKD 4L3EE 4F15C 5KSBE 5F7MC 1CGSH 3O2DH 4KDTC 4MWFA 1HOCA 3TO2B 3SGEI 3KPSE 2DLIA 2J88L 4LVHB 1CE1H 5E2TH 1FLRL 5FKAB 2FL5A 5T3ZH 3OR7B 1YY9D 3MUGB 5F3BA 4JKPH 4M02A 3AAZA 4S1RH 2OL3L 2CLVA 3FB6A 2NY3D 5T1KB 2EIEA 2IBZY 4JG1H 3S5LG 1BVKA 5C0GB 1RZ8A 4NQEA 4W70A 3HE6B 3QDAA 1IAIH 4PB9H 1WBYB 1QO3A 3BH8B 1QBAA 3FQWB 4WWKA 5L2KB 1QR1A 4R6UA 3O4LA 2GTWB 2EDOA 1SJXA 5JQ6L 5BQ7B 1GGBL 4NRYA 2FO4A 2BVQB 3VG0H 1OW0C 3SCMA 4C56D 3KR3H 1C5BH 1W72L 1IARB 3I3EA 3MRQB 3MCG1 3BP5A 3ARPA 3OAZH 4KXZI 4NM8H 4N8PA 3JWDH 1RHFA 1UYWL 1P7QD 1ODAA 1HINH 5C92A 1AHWA 1QKZL 3QPQD 4O2EA 4Q9CA 2H2SD 2N1KA 1CCZA 3V6OE 4PG9A 4PJ9B 3IU4H 2CLRA 4PV8B 5EBLB 2WNGA 4XRCB 3VH8A 5DJYB 5C0BA 4WNQA 2IALA 1BREA 1FNHA 4ZUTA 5I15H 1AGBB 5DJ8A 1TJGH 3RQ3A 4LEXH 1UWXK 5CZXC 1FZJB 2YUXA 4LSDA 1ROWA 3PDOA 3I50L 3LKSA 5IEKA 3WEXA 2DRUA 5DJ2B 1HK6A 1IQWH 4UINL 3NVQA 4OF5A 4M7LH 5D7JD 3HI6H 4P2OB 1F4AA 4U7MA 3VFSB 1KN4L 3X14A 1DBAL 2QSVA 3D2UA 5DHVH 3ZTJG 3RU8L 1IM3A 5ICYA 1HCVA 4F3FB 2V7NA 1FYTD 1P2CB 1RZKH 4G8GE 1R5IA 4XH2B 1FZKB 2BMKB 1RURH 5ICYB 4OIIL 1YYMH 4HLZH 5HVHC 1WWBX 3KYKL 1I9IH 1I9RH 3VFSA 1UVQB 3F6IA 2XZAH 2XWJA 5ACLA 3SE9L 2FEEL 1PAMA 1YEFH 1PEWA 3MV9D 4QLRA 2CRIA 4XPFH 1DN2A 5EG6C 1P6AB 1QFWL 1Z0MA 3MNZB 1V7ML 1A6ZA 4H1LG 3MJ9L 1RY7B 5FO8B 2KUTA 3M1BA 4UT9H 3RTQA 1F3RB 3P30H 1N0LA 3JTSA 2W91A 1HHGA 4KAQH 1A4JA 2H32A 4JFDB 4XB8A 4FQCH 5GS0L 5BMFL 5A2FA 3QNXB 4CVWA 5GRJH 3ARGB 3ECBB 5AWNL 4FFVD 4ZODA 4ZOAA 4RFEA 1P4LB 3DO3A 1AXTL 3WL9B 2DQUH 3IS1X 1P53A 4Y4HA 1MCWW 1T1YB 4Y5VB 1RHHA 2ZP0T 1KJ2L 1OAYH 3BP5B 5GXBB 3SQOH 4AH2B 2EEAA 1EIBA 1I4FB 3K8LA 2RBLA 1D9KA 3T0ED 2XKNA 4PJ7F 4TUOB 1F2XK 1ZSDB 4O4YL 4KUCF 5JR1L 3X3FH 1AKJD 1M7DA 4P0DA 5EO0B 2NTSP 4POZC 4AM0B 4WWKB 4F58H 1NMCB 2MCPL 3T0BA 3U4EB 3ARDB 1G7IB 2XQBL 3FN0H 1IAOB 2XY1A 2ESVD 4WUUA 1UACL 1WGOA 3VCLA 2DIAA 1OQOA 1P5UA 3MRFB 5C7XL 4BK5A 3C8DA 3LAFA 5MENB 3MJ7B 5I76B 1X3DA 1KPRA 4TQEH 4NQCD 4WDIB 4XNXH 3WO4B 1F4HA 3GIZL 1KXTB 5DFWH 5F7FA 4PRNB 3W39B 5DHVA 3DV4A 3FJTA 1DVFB 4J3TA 4LLUB 3TJEH 3MV01 4OD1L 2IQAB 4RIRA 5D71L 4I18C 2BY3A 1FIEA 5LWYL 2IPKA 1LILA 3BO8A 1HH6A 5CEZE 1BQHG 1F3DJ 4KFZC 5F7NC 3TBYB 2D0HA 3OBAA 5FO8A 1WT5C 3E6FB 2JJSA 3LV3B 4PJGB 1IGTB 4JKMA 4X7TA 2DOCA 1W0WB 2AQ3A 4F9PC 3AS0A 1GIGL 5I1AB 1A6TB 4PGJA 4NBYB 3FTGA 5FOJA 3GSVB 3VXRD 4IIQA 3CUPB 3MLYL 2HT2C 1UB5B 2QADC 4RFNB 3V6OA 1X5LA 5ABDE 2FSEA 5GS0C 1WFOA 2K1MA 3P0GB 3D39A 5EU6E 4EDXA 1PLGH 4AEIH 2OCFD 5GGUB 4K3JL 5IFHH 2F58H 4U6TA 3O4OB 1F5WA 1HKLH 3VRIB 1T3FB 3QQ3B 5DJAA 4HUXB 4D3CL 3VDAA 1W2KT 4P2OA 3R0MA 1N6VA 4M1CC 4UMGA 5HGBA 3L3DA 4QHKJ 5E4EB 1NAML 3VWKD 4ORGA 2ADGB 4TVPL 3PL6C 1FL6B 2ZOKA 1IAIL 2VE6B 4JAMB 4ODVL 1U8JA 3K8MA 4OTXL 4OZGB 4KUZL 5C0FA 5F3HB 3H3PH 5DJXA 2A6DA 1WVZA 2OTPA 1K3ZA 1L7TH 2CLRB 4PV8A 3OXSB 4HUVA 1VACB 3EDFA 3A6OA 3EOYG 4OB5L 4Y2DD 1CLZH 4YEFA 5GIRB 5FV2A 2EDBA 5HHOD 4OGAD 5F1OB 1FVDB 3DI3B 4MJ5B 5C8JB 4X9IA 3MYJA 4XBPA 5J57B 3A67H 3PP4L 4HX1B 4O2CA 2X4RB 5FA3A 1JZ7A 1I8IA 2FBOJ 5FK9B 4KPHL 3CLEL 4NUGL 3B9DA 2QEJA 4CUCA 4QOKA 1SJHB 1MCJA 3MLTB 3AM8A 2PYED 4P2RA 5HJ3A 3O11B 4FNLL 4LFHG 1PBYA 4NWUL 5EUKB 5DVLA 5MEQA 3WD5L 5FDYA 5C0CA 3CLFL 2H9GB 5F7UA 5GRYA 5JXED 4U1MB 3AVEA 1IGMH 1QNZL 3LQZB 5KW9L 1AR1D 5DYOA 1P7HL 2Y6SC 1MLCB 3BX7C 3S36L 1R3LB 5D1XB 3VXOA 1EBAA 1YMMA 5IIEB 1M6OA 1F4WH 2VTFA 1RZJC 2FJGB 5LGHH 2LTQC 1IZJA 4HT1L 4NGHH 4PYGA 4IOSD 1MWAH 4L29A 4HSQA 1Q9LA 2OP4L 3RY6C 3H0TA 4PBWD 1IAKB 4Y16C 2YPLE 3ULSA 3OWEA 3CFBB 2DQHH 4WRLA 2OTWA 3VFVA 5ALCH 5C2BH 4F7CB 4O02H 5C0CE 1J0YA 4U1KA 4XAKE 3VXUD 3KS0H 2XTJD 1LO5B 5H94A 32C2A 5CLTA 2AKRB 2E7HA 3B3IA 4G8EA 2BNQE 1KCUH 3IVKA 1EGJA 1BJ1J 4P4RA 3BGFB 2CIIB 3TM6A 3WFHA 3GSOA 1EERB 2H32H 4QRPB 3ZDYE 4HUVB 4Y4KA 5GZND 4L29B 3U2SA 3RI5F 1BZ7B 5BOPA 4NQDB 5A16A 3PQYB 1DN0A 4NZDA 3RDTD 3T3PE 3EZJB 3RVTD 4M6NH 5L0QB 3QUKB 5GRVL 1LO4H 2NW3B 1D5BB 3MOAH 1HH9A 1CGXA 2Z31D 3FB8B 3C5SA 4QTIL 3BQUC 1FORH 3QO0A 3CSYA 4KI5F 4QOKE 1X4XA 2CMRL 1LEGB 1YJDL 3U36A 3UJTL 3UYOD 4HMEA 1T6WA 4Q9BA 3L6FB 3MFFA 3IETB 3T1FA 2AJXH 1FAIL 3VRIA 3BZFA 3QIBD 4IS6B 5HJ3B 4H8WL 5CP7A 2GUOA 5FUOL 4H1LH 3PGFH 4GRLD 3K74B 3VFPB 2ZSWB 5J6GA 5KZCB 1RZ7L 1FNEB 2CMRH 4OQTL 3UX9B 1S7SA 4P9ML 5CILH 3ZSTA 3QZWB 3WFEH 1XGPA 1MI5E 4LMQE 4XBPB 2BNUB 1YMHA 2IPTL 4LQFH 3MR9A 3QEQA 4JY4B 4DAGH 3K8KA 5EOTA 4HLZG 3TN0D 4WW1A 4NQCB 3QDMB 4KTEH 4KGJA 1YEIH 3ULVD 3VFOB 3ARUA 4N1CA 1VFUA 2AJZB 3GBLA 2B4CC 5JZ7C 4Q9QL 3SDXB 4PJHF 2OJEA 4JVWA 1F6AA 4NYLB 5DJXB 3MRCA 5C0BD 2FHFA 1VGEH 3RTQD 4JRXD 2ARJB 2ICWI 4JGJA 4Y4FB 3E2HC 4M8VA 3GHBH 3FOLA 1M6OB 5D7IB 3ARGD 3GHEL 1OGAD 2HTLD 5T3XH 4MS8D 5MEND 4EN3A 1NUFA 1UENA 2IFGA 3O2DA 3ARGC 1IEAA 4OCSL 1VGEL 1X44A 4PRAA 3MNVA 3VXSE 1VA9A 2HJLB 2JCCF 2HKHH 4HUMB 3LKRB 5J13C 4Y19E 2D31A 4OAWA 3ARDA 1CU4H 3DECA 1FYTA 4GW5A 4L8DB 1NAMB 3ULVC 2DKSA 3IJYB 5GHWL 3UROR 3S98A 2KPNA 2E6PA 4MNHA 3PL6A 1D9KB 1BBJB 5EORL 1AJ7H 4Q6IB 5E08L 5DLML 4NO5B 4AK1A 1KTDA 4QHUA 1MY5A 4IRSA 1OVZA 4TNWK 3SDYH 4JO2H 4JZJC 4PGBA 3EOAA 3C9NB 1PKQE 3AB0C 4U4BA 4MA3B 1D5ZB 5L9DH 3VFNB 4OJFH 4PJCF 3KPMB 3TV3H 5JTWA 5LVEA 5HI5C 1WBXB 4CU8A 3F7YA 3LEYH 2DJ4A 2IQAA 4P59L 4H0HB 4BZ1L 1CDUA 3O3DB 3GBNH 1EAPB 1BLNB 1SHMA 4DK6A 4M93C 1A7NL 1S9VA 4J23A 5KG9A 1EBPA 1FL3A 3CCHA 4ZO6A 3KLHD 5I76A 2LU4A 3QUXC 1Q72L 1J5OL 5KVFL 5IWLA 2AAVA 3HKFA 1QRNB 3EO0B 3P9MA 1S7VA 4IM8A 2X2YA 4LOUC 5IOPB 1GGCL 3X12B 1S7WB 3QEQE 3BYYA 1RUAH 4CBPA 4NZRH 1CLCA 1ZVSA 3ARSA 1FFOA 1HIML 2A74A 2MCPH 3E2HB 5AZEL 4G9FD 2EC8A 1FZKA 4JZNA 4MJIA 1I8MB 1FNLA 1LE5A 1B6UA 1MCDA 1TITA 3IAPA 5DEGA 3MNWA 5IROA 5A43C 3GFUA 2ADIA 4QRPE 2W0PA 4B7IA 1PDKA 5IJKA 1MCSA 4RMTA 2NY4C 3QHFH 4PJFB 4HUWA 3IF1B 3JV6A 4OT1H 4AYFA 1BZ9B 3MRJA 2HJKB 4CADA 2XZZA 1FRGH 3HC4H 1V3MA 2DQHL 1X5JA 2CPCA 4MD5B 3MRHB 4KRLB 4P9HH 4X6EB 4R2GC 2MKWA 1CDIA 1HHKB 4YDIL 3RVUD 3TBYA 1FNSL 2C9AA 4P5KB 3ES6A 3FO2A 1J1PH 1RJLA 4PRIB 3BD5A 3JV5A 5FGSA 1Z9MA 1KPVA 1NBYB 2VZ3A 2VABA 1HHKA 5F9AC 4ELMA 1T7YA 4TNWF 2YN3A 3BOVA 4CMMB 5IR1B 1DFBL 3ARFA 5GS3A 4GKSA 4JFQB 4OKVA 3JSSA 4XNMA 1UQSB 3EYVB 3ALWA 5CJXC 4NIKB 4GLRH 3TIEB 2BOBB 3NCCB 2NR6C 4Z7QF 1V5JA 1U3HB 4P5TB 2EXWD 4KK6C 5E8EB 3QDGA 4PJFA 3ZKND 4ZO7A 4LCCC 3NFNA 3DX8B 2N7AA 2JJTA 5F7YC 2MCG1 1I85A 5KVGL 4XC3H 3KPPA 4IDJH 5LQBH 3R8QA 3RU8H 2DKUA 4JM4H 5C0JB 4YWGH 2OP4H 3PV7A 3V6BR 1FSKC 2ZCHL 1AD9B 1EK3A 1U8IA 1KFAL 4X5XA 1RIUH 4KPHH 4ZO9A 2XKNB 2NZ9C 2QQNL 1S7VB 3GMQB 4GAJH 4MS8C 4Z0BL 3LKSB 1UEMA 5IEKB 4JRWA 5EBWA 2QQLH 4M5ZL 5E4EC 3VDCA 1KXQE 1YNTA 4LLMA 4OZIB 1URLA 2E8ZA 2IALB 3IXAA 1B2WH 2ATPB 1JWSB 4YZFF 1S9YA 3OGCA 4X4ZA 5FYJD 4XNQA 2F8OA 3WKML 1NFDF 3FO2B 5ID0A 1HHGB 3RGVB 4WHCA 2D3VA 5E94B 5F44A 4UNVA 5CD3B 1HKFA 3GMPA 3VXPB 1MRCH 2B8OT 4JZOB 3RVUC 4HV8A 4NM8L 1JNNH 4A6YB 4MDIB 3DXAE 1LGVA 4ALAH 3IFOB 2COQA 3L3GA 5L88L 2FWOA 4OFKA 1LNUB 3RIFK 1NANI 3K80A 3EYOB 2GTWA 4JN2A 1HE7A 2NY5L 3JVGC 1NAMA 3N85H 5KVFH 3HG1B 4MXWL 1IC4H 1LE5B 2CDFA 2D31B 4H88L 4OAWB 2VLJD 1G7QA 3ZDZE 4MD0B 1IM3B 1RJYB 5GS0H 4PRAB 4S1RL 5E0QA 4W81A 4DOHE 4WW2A 2HLFC 2EIBA 4HIEA 5GS0D 1FPTL 2IANB 3EO0A 3TIEA 5B8CC 4OCMC 2J88H 4YXHH 5DDHA 2CIKA 4TUJA 3VGFA 4YFDB 5K9KB 1A6VH 4EI5A 1WSST 2F53B 3DUSB 1YPZE 3VA2C 4IJ3C 2VAAB 3V79C 2JJTC 2BVOB 4RGOH 2R2BA 1RJLB 4PRIA 5EOCH 2R29L 5A2LH 2P7TA 1E28A 1RIHH 1EO8L 1MOEA 4N0UA 5KSBB 3OKKA 1F8TH 2HTKC 5FYKH 4KMLB 1CD1A 3IAQA 3UDWC 3MLVH 3IDJB 2HJKA 2L4OA 3MLPA 3H9ZA 3EJZD 4YO0B 1S8DA 5BJTB 2PR4H 3VFTA 1ZHLA 1H3UA 1KLUA 2C4FT 3WDHA 3UZVB 4I18B 1JUFB 4N8VB 3WLWD 3OL2A 1HHJB 4JVPA 5GZOD 3AREA 1XR9B 2P8MB 2VXTH 2KQMA 3EHBD 3QDGD 3QI9D 4X80H 5C0GA 4EDWL 1JPGB 1X5XA 1I3GH 4DN4L 5DHXB 3WIIH 4PRIE 2BJMH 4XCYA 3U6RA 4P57B 2D7QA 2X89D 3O6FB 3NCMA 4AENA 4HIJA 1ERNA 2OTUB