4YDJA

Crystal structure of broadly and potently neutralizing antibody 44-vrc13.01 in complex with hiv-1 clade ae strain 93th057 gp120
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
238
structure length
238
Chain Sequence
QVQLVQPGTAMKSLGSSLTITCRVSGDDLGSFHFGTYFMIWVRQAPGQGLEYMGGILPSTKTPTYAHKFRGRVSISAPGVPPVLSLALTNLTYDDTATYFCARERGRHFEPKNRDNLEGKFFDLWGRGTFVRVSPASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Repertoire of HIV-1-Neutralizing Antibodies Targeting the CD4 Supersite in 14 Donors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system
molecule keywords Envelope glycoprotein gp160,Envelope glycoprotein gp160
total genus 32
structure length 238
sequence length 238
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ydjA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ydjA01
5FYKE 4KI5C 2QR0A 3VDAA 3PL6C 3QXWA 3B3IA 4NZUL 1OLZA 5ECJE 4RWYL 4M1GL 2ITDA 4C56B 4RGOL 2QTEA 3SJVB 5IBUG 4L9LA 1BZ7B 3S88L 2BSSB 5DFVC 1UM5H 4DGVH 1BVKA 2NQCA 3MA9L 4LVOC 4RISL 4PG9B 3T4AB 2ADFH 1JNNH 3QBTB 4Y4FA 4JANA 1AGDA 4M7LH 2LAGB 4CNIB 5C0RL 4HWZB 4OT1H 5HYJD 1I7UB 2AKRA 2XKNA 3QJFA 2Y25A 3MRJA 4OBRA 5K33A 4BH7B 4KI1A 3L5WA 4U31A 1MAML 3IDXH 3WLWC 4P5KB 1W0WA 3O3AB 1A4KB 2CDEB 3T09A 1GZQB 4R97B 2QHRH 1EEYB 3S96A 3DV6B 2ADJA 2B39A 1JVKA 1T03L 1SJHA 1IEAB 2WQ8A 5F88B 4PJDA 4KZDH 4HUMB 4U6TA 4U3CA 4N8VA 5C0DB 4XX1E 5CHNA 4HF5H 4MNGB 5KVMC 4F15B 4L4VD 3BOVA 1MFBH 2BJML 4H8WH 3TJEL 3BZFB 3D3VA 3VGFA 3W0WD 4NQDB 4R8WL 1MPAL 4XMLH 3CX5K 1MCSA 4TTGA 1WISA 3QUMH 1NSNH 3HNTH 2CLZA 2ZCHL 7FABH 1U8QA 2ORBH 1C7SA 1XF1A 4WO4B 4NZTH 4TVPL 4ONFH 2FCBA 3G9AB 1B6DA 2JCCA 1OAYH 1BM3L 3FO2B 3FAXA 4NZRL 3OXRA 3TPUB 1DR9A 1GOGA 1V05A 4HS8H 1NLDL 1CK0H 2BMKA 3KPTA 3QRGL 3QZWA 1P9MC 2X4OA 4NC1C 4JZJB 35C8L 4X9GA 1KIRA 3LEYH 3NPZB 4GBXD 4C56A 1R5WA 5FA4A 1R6VA 1VEMA 1IM9B 2ZJSL 4G6JL 1RQ5A 1QLRB 2P44B 4F2MB 5CEXB 1BBJB 5CP7A 3KWWB 4R7NA 1JZ4A 1JPSL 1DANU 1TMCB 3BE1H 2ZOLB 3QIUB 4GG6E 3V52L 4LVNC 1R5IA 1U8MA 2PCPA 4G7VH 2YPLB 3QIWD 4OLUH 3L9RB 2CUHA 2FGWL 2KKQA 5T3ZE 4LCCA 3JTTA 2PYFB 3FB8B 2HVKB 2B0SH 1VFBA 5D5MA 5HHPB 1IQDA 1GZQA 1PKOA 3GSNH 3RZCA 1ORSB 1F4WL 1S7VA 1XCQB 5M7QA 4ENED 3IS0X 3QDGE 3DO7B 1I8LC 4JFXA 3ZDXF 3OKMA 4HC1L 5EU6A 4POYA 5ILTH 3EYOB 1ES0B 2DI9A 4NO3A 4DQOH 1F4YH 1P1ZA 2Y06L 1FORH 4KXZH 4WNQB 1OAYL 2HFTA 4XWGL 5D5MF 3TCLB 3RDTC 5EN2A 4OFIA 4M62L 1H3XA 2R4SH 2YPKA 4YNYA 4K8RH 5DHVB 1FZMA 2BRRH 4M6NH 4NRZA 5C07B 1CIUA 3IU3A 1K9TA 1K8IA 4G6KH 1FO0L 1Z0MA 4KKLC 1XR9A 1BBDH 1S9XB 4R90L 2RCSL 1Q9LB 4XNXH 3C5SB 4TUOA 2YUZA 4UZGA 3MLRL 3FO2A 1VFAA 5C3LD 1KBGH 4N0CD 4XB8A 5MEQB 1QUNA 4OSUL 2EYSA 1DEEB 4HK3N 2BMKB 4XNZC 1ZGLB 5DUBA 2XZQH 1NUNB 1CG9B 1AD0A 1T2QH 5E95B 1HH9A 2LABA 3H6JA 4XP5H 2C3XA 1TTGA 1AR2A 4R7NB 4RA0C 4D0DB 1IGJA 1T1WA 3CFEA 4HKBB 5DDHB 4OCLC 4YO0B 2BY2A 1NGWA 1CD8A 1RIUL 1U93A 3WJLA 1KG0B 4K3JL 1HSBB 3U9UB 3B9DA 5JW3L 1XEDA 4CVXB 1UM6H 2XQBH 5DMIH 3GHBH 1TITA 2BRRL 1KEML 1S7RB 1S7VB 4QHMA 4H26B 5BS0D 2ZPKL 4XBEL 2IAMD 2ZUYA 4XCFL 5MHSE 1FGNL 5EA0H 1U6AH 3PWPD 2VKWA 2ZCKL 1G7LA 2QQKL 25C8H 3MLVH 2VDLH 4CW1B 1MCPL 1ZHKB 1GGCH 1PD6A 5JMRA 3TP4A 3UC0L 2Z92B 2V2WB 3KPMA 4N0YL 2Q6WA 4C56E 4NQCE 2VNCA 3NH7H 1G1YA 2R9HC 5IG7A 1XIWD 2D7MA 1IARB 4N0FA 1QPPA 2DMCA 3IXTA 5K9JL 4AH2A 3CFKA 5E8NA 4ZNEA 1MSPA 4HJJH 2VITA 5CEZL 1HWHB 1VFAB 1PYWA 1QSEB 3REVA 2GAZB 4FFZH 4GKOA 4G43A 1UWXK 3MV7D 5C07D 2YD1A 2SEBB 4JO3H 2BVTA 1I3GL 2XNAB 1V7ML 1JFQL 3OJVC 5EPMA 1FBIL 4KDTA 2WIIA 3TBYB 3PWPB 2HLAB 2J6EA 3P3YA 3GUTB 2IAMB 2P1YA 1IGJB 1T1WB 5HDBE 3MRPB 4JR9L 1WBYA 1QNZH 3V0VA 3BQUC 3FOMA 4HPYL 3S37H 1JHLH 1FL5B 4Z7WA 5JQ6H 1LEIA 2ATKB 5CINH 2WWKO 3DVNA 1A4JB 4PD4K 1QOKA 4ZS6C 1Z9LA 4EN3A 1AIFB 3VCLB 5DR5H 2GFBA 4R9HA 4K07A 3C6LC 4LSUH 5GS0D 2YEZA 2ZSWB 3CNKA 4LAQL 4KTEH 3RGVC 1S7RA 2YUXA 3QUXA 4QHMB 3E6FB 5TQ0L 4Z18A 1WQVT 5F9JA 3TZVB 5DJAB 2UWEB 3U1SL 2AJUL 4ZG1A 5GGVY 4MAUH 3F7YB 5C0IB 5I75B 3BVNA 1HXMB 3DYPA 5BZWA 5EU3B 1FCGA 5JDJA 1I9JL 5BMFL 5SV4A 3SGEI 3PF2A 2FO1A 1TQBC 4IMLB 1RI8A 4N0FB 2Z4QA 4QYOB 1KC5L 5EOCL 3CVHB 1JFQH 1FAIH 3QYCA 3N1MC 5A1AA 1KN4L 2X9WA 3U36A 2BY0A 3LV3A 3K8KA 3E6HA 4JRXD 4URTB 1VEOA 3MXWL 3UJJL 3H9YA 4NO2B 5F7KC 4I48A 5GISL 3ZKQD 2XNAA 1QFUH 3O41A 4MS8D 1DBJH 5GJSH 3IDGB 1AXTH 2R69L 5FM4A 1VENA 2IAMA 2ZJSH 1YY9C 2GJ6D 5TF0A 3QEQB 3KYOB 1PY9A 4XNQB 1ULVA 5DD6A 5B8CA 2ATKA 4XPGL 1AHWC 2M26A 2NY5C 4B53A 4H20L 1E4WL 3T3MF 2ICWI 3H9SD 5D7LA 1U3JA 2IPTL 3O0RL 2GFBB 4ZDHA 4U6XB 2YEZB 4NO5A 4LCCC 4Q2ZB 4HMDA 5KZCD 1I7RA 1KYOJ 3BSZL 1LP9B 1G1CA 1VESA 3SBWC 3CVHL 2VQUA 3V0WL 1B9ZA 5IK3A 3TV3L 2FB4H 3HZYB 2HT4C 2RQ8A 4OBSA 4YE4L 1JWMA 3Q5OA 3LY6A 4JHWL 1Q1JH 2NXYB 3SDYL 2R2BB 4FTVB 5SWZE 4IHOA 3BDBA 3DO3A 5JOFA 4NO0B 5JLZA 3BXNB 1NKRA 1KB5H 5CD3B 2FBJH 3D39D 3VFPB 1JWSB 1O0VA 4NM4H 3U7YH 4YEEA 1CL7H 4QLRA 3X11B 5KG9A 4HXAL 4PBWD 3DX9B 1DFBH 3PP3H 1VSCA 3SE8H 1UKSA 3VWKA 2CRIA 5TE6L 3RAJH 3HC3H 4Y19B 43C9A 2EE3A 2X1QA 1GHFH 1X5LA 1KPRB 3HG1A 5CZXD 4FQCH 4F7EA 4PLOB 3L7EB 1MNUL 5GRVL 3KJ6H 5E08H 5DRZB 4PRIE 1RUKL 3PDGA 5GGTA 3S4SB 4YBQD 2XN9A 4D9QE 4NNXA 5C9JA 1R3HA 1YYML 1MQ8A 5L8JB 4RISH 1FL6A 5GSVB 2EE9A 3V5KA 25C8L 3CK0L 4M1CC 3BH9A 3S35H 1JK8B 4HPOL 4XNQA 4YDIH 5DD6B 2A83B 4FZ8L 4FNLL 3OPZH 3TNNB 2BVQA 5CJ5A 2ZUWA 2YZ1A 5I1JH 1QG3A 3DXAE 3WFDL 3VXMD 3KAAA 1Q72H 3QIWA 3SO5A 4ZDHB 4U6XA 5J13C 3K4AA 2EDDA 4ZAKB 1DBKH 4PR5A 5FECB 1MQKL 3V5HA 3O3EA 2NXYC 1TFHA 4KRLB 5DK2A 2EKSA 1F11B 2Q8BL 1QRNB 4HJGA 1QBBA 4PD4J 2A6DA 3SJVD 4XAKD 4ZS6D 1LE5A 5D93B 4C56D 4K23L 3X3FH 4P2OC 3L5XL 4JQVA 3BZEB 2DDQL 4LNRA 4ETQB 4HT1L 4UAOC 1YMMB 4CJ0A 4IHOB 3VFSB 5JOFB 4LGPB 5F96L 1TETL 5LJYH 5FYLL 1R3KA 3UTSE 1MELA 5DQDH 4OFVA 1TPXC 2X7LA 1ZT7A 4R96B 1INQB 4PFEA 4JZOA 1GPOH 4PJ8D 1EFXD 4TRPL 1PEWA 3WDJA 1ZVSA 2ICEA 1S5IL 1YMMD 3GMPB 3LPWA 1OGAA 3VWJD 1K2DA 1JTTA 2Y4SA 2FWOA 4ELKB 3W0WA 3MRKB 1IC7H 1KNOB 5TH2B 5IP4A 3QUMB 2L7UA 4LAQH 1RU9L 1IGTB 3MRGB 4EQ3A 3GBNL 1CR9L 4MZ2A 1QEWA 1M4KA 4HLJA 4OGAC 3FQTA 3RIFK 5C8JB 1F3DH 1D6EB 3Q6GL 4NKIH 4HK3J 4YH6A 3QDJA 5IMOA 2VLRE 3O6ML 3P0VH 2FH6A 4L8SB 1MCDA 1A1MB 4QRRE 3OKOA 3VI4F 1T1YA 3VFRA 2ZCLH 4PJ5D 4X5XA 1MFDH 2XY2A 5SV3A 4KMTL 5AUMA 2W60B 3X3FL 1ZWIB 3FCTA 4ZUUB 3LZFL 1GAFH 2NZ9C 4HWBH 1F8TL 1KIQB 2KZWA 4U1KA 3LN4B 4PJBE 5DEGB 3SDDD 2P49B 1P69B 4AEIH 3MLTB 2UYLA 2YMXL 5E2WL 2NY5L 4X6CF 1NGZA 3VGAB 5DJDA 2HAZA 4F9LC 1S7WA 3S3SA 1JPTL 4M1CD 1D9KA 4JPWH 2UUDH 2K7PA 1P6AB 5HGAA 5E6IA 3AAZA 4RFNB 2GK2A 3KPSA 1ZANH 1F3JA 3TN0B 1BEYH 1A0QH 1J1XH 2YN5A 3M17B 1DCLA 3PG2A 1PY4A 3DROB 3VH8G 4BYHA 2VE6A 5E8EA 4QT5A 5A2KH 4S1SL 4P49A 1RZ7H 1GIGL 5GGUB 1H0DA 3OKDB 4JG1H 1KNOA 5DWUH 4FFVD 1WZ1H 4JAMB 3I84A 3C60B 5C8JA 1D6EA 4P9ML 4WW1A 4YIQB 3VMNA 4FQ2L 4U1GB 1FFRA 5CGMA 3VMOA 1LP9F 2OXHA 4IOFC 3VFNB 4JFQB 4LARH 1SMAA 4X5XB 4G8GB 1U3HC 3SDXF 5ICZB 2X42A 3ZE1E 2X1OA 1FH5L 1X5FA 1LEKB 1I3UA 2Y9RT 1Q38A 4LF3A 3QEQD 1A6ZA 4X6FB 4JCMA 4HIEA 3TO4D 3DHJA 4QRRB 4IIQB 4U1IB 1NBVL 3MA7B 4OM0L 5HVWA 3EJJX 4Y4KD 3ARYA 3ZE0F 3IF1B 2BNRA 2QSQA 3JWOL 1XGQA 4BQBA 5C9KA 5DD5H 2I9LB 5F6IC 4X4XB 2JB6A 4L8BA 1HCVA 1PVHA 4PGDB 5HY9B 2BNQA 2DQFB 1TNMA 1UJ3C 3HUJF 3P9MB 4NJ9H 5JHLH 3WNLA 5HHME 3DV4A 4LMQI 1HK6A 5DO2D 4XHQA 1TCMA 2YHGA 3W5MA 5AEAA 2DI7A 3Q3GB 3AAZB 2ICWA 4HIHA 4OD3L 2HJFB 1OTTC 4OCMC 4RAUB 3MV8A 1IBGH 3QUKA 3QA3B 1J8HB 1G0DA 5KSBA 4N90D 3O2DL 2P5EA 3ZKMC 1UCTA 2YKLH 3WN5C 2X9YA 2IEPA 1V7MH 2PETA 4GG8A 1U8PB 4R0LC 4MHHI 2IQ9L 1MQKH 3GJFK 1TXKA 4UDUB 1FQ9C 4Y5XC 1CBVL 2FD6H 5CIPH 4EVNB 5KAQF 1MF2H 4XXCA 1I9RH 3O3BB 4HX1B 1ZKAA 3HZKB 5ALCL 4PRHB 2QL1A 1A8JH 3PWNA 5IEKB 1NBYB 2WUCL 4X6BB 3MRIA 4YPGA 4H1LH 4JY4A 4QF1B 5TPWH 1G7QA 4G6JH 3RWGA 3GMOA 2IBZX 4QRRA 1NEUA 4XH2B 4KROB 1EAPB 4HIIA 3M07A 4LBEA 2HVJB 4EOWL 4BELD 5F1IA 2VXQH 8FABB 3NFSH 2HFGL 5CEYA 1EEZA 2VXUH 4K23H 2ZZUT 1UT9A 2WBJD 3KLDA 3M8OL 4LASH 4P5MB 5CGYC 2NY2D 5I8EA 1UADC 2PR4H 4FQQB 4M7KL 2AV1A 3ESUF 4G3YH 1R24A 4MJ6A 4OGYH 1CLOL 2PTUA 1U3HB 4YBHA 3REWA 1KEGL 3QUKB 1J8KA 1NH6A 1XF3A 1F4YL 2F58L 5J6HB 5CIPB 1OAKL 1B0RA 4Y5VB 3DJ9A 4IOSD 3WO4C 1QBMH 3BGMB 5DQJB 5AAWA 3PV6B 4GG8B 4A2LA 2AJVL 1OTUD 4DFIA 2FH8A 3IRZA 2FYYA 3CXDH 5EOTB 4HX1A 2BNRE 4YAQA 5F1NB 3QQ4B 5IM7A 2MKWA 4CU7A 1AO7E 4ODVH 4JPIB 4U49A 1JPST 5CJ8A 3MA9H 2WINA 1SBSH 2BFVH 4IEFB 4RFNC 1TJGH 1RIVH 4Y1AA 5E9DA 2BVPA 1S9YA 1PSKH 1T1XA 3O8XC 4R7DA 1NCCH 4PLNC 1RZGA 2E7LC 1U3HD 2H45A 4OTXL 3VXOA 4HIIB 5B39B 1HEZB 4M5YH 3VFOB 3O6LH 2DLTA 5F7WC 3RZCC 2QLVB 3GEWB 2G75B 5DJ8B 5KVDH 4ODUB 1RUPL 3TFKD 4WUUA 1ROWA 4DEPC 3GFUA 4HH8A 5SWQB 3UROR 2GT9A 3VFWA 1NL0H 4KI5D 1YNLH 5FHAH 3UZVB 4YHLH 1ZANL 2AK4E 2OTPA 4XWGH 1WEJL 2HWZL 3SKJH 5T1KD 3S97C 3NH7L 1AHWA 1D5IH 4X5LA 4I18B 3WKML 4OZIE 1I1AB 4RGNC 4A6YL 2O5YL 1YYMH 4FXKB 5IVXA 1LO2L 3H3BC 4KJYA 3HI6H 3UTTB 4XAKE 3U4EA 5I73C 3CAFA 1T2XA 1BOYA 1NMAH 1RZKH 5IROC 4XNUH 2J8UF 5B4MD 4LKXA 1VGEH 1PZUB 1HYSD 3WJJC 3QH3B 3R1GH 4LLAA 3MYJB 5L2KD 1OAXH 4XC1H 4M5YL 1T1XB 2Y5TA 5E8PB 5I76A 1RZGB 3SDDB 1YECH 4NFBA 4Z95H 2Y06H 4YHMH 5CJXA 3ARPA 2VUOA 5D1QA 4BKLA 1P4BH 2VLMD 4P2OB 5DJYB 2Y07H 2DKUA 5HYQB 4LIQL 1D5ZB 5I18H 3QEUA 3NZHH 2P46B 1PAMA 5SWSE 1BREA 4HIJB 3MJ9L 2FZ3A 1AD9A 4HT1H 4QTHB 4NHUB 5KVEL 2HRPL 4K7FA 4PRPA 5EZIH 5TE4H 3MFFB 4QRPD 5IB3B 3KPOB 4NWUH 1MHHA 2YRPA 1F13A 4JM2F 5KSAB 4TRPH 3VRLF 3QI9C 2O5YH 1KJVA 2R23B 4RMUA 4I3SH 5C6WH 4L8CB 3FTGA 4DK3A 3CIQA 4N0UE 3N9GL 2QQKH 2A6KA 4FABL 4PGEA 3NCYS 3QUZC 5CJBA 5I74C 1BBDL 4R90H 4LSSH 1LO4H 3BISA 3EFDH 2O93L 3QUYB 4XCEA 1FFQA 2DWDA 3O11B 4JG0L 5LCVH 5H8DA 1YEHH 1OAXL 4G8GD 3L3OB 2YD8A 5HI5D 4HKJB 3UTTA 2VXSL 3ZKSD 2W9EH 2D03L 4OF7A 1MI5E 5IFHH 2B5IB 3MBXH 3QXUA 1BQHA 4ISVB 1IC4H 1MF2L 2XI9A 4F7TA 1ZHBB 1T22B 4GJTB 3D2UA 4XB7A 2APFA 1MWAL 4ZXBB 3LCYA 4WW2B 2KBGA 4KC3B 3IFPB 5F1SA 5C0BA 1AP2A 3O6FD 3EO1A 1GZPA 1Z9MA 2R2HB 3S35X 4BH7A 2WBWB 4I18C 4Z7VB 1JTOA 5SWZD 4M1GH 4AG4L 2UZIL 2LFGA 4MAYD 2OCFD 5DF0A 4BA8A 1GH7A 1DQDH 4Q6IA 4R3SA 1T2JA 2OL3A 5ANME 3FO1B 1RIHL 3DV6A 1A7OL 2NX5E 5DRNA 4IRSC 5EOQL 4OIIH 2P5WE 5GS1B 4XVSL 3RPIA 1FP5A 3QEQE 3O4OC 3SE4C 5KSAA 3BP7B 1L0XA 4P2QE 1EO8H 3VWJB 1A2YB 4H88H 2F53A 5L2JB 1BPVA 4HUVB 4U7SA 1DEDA 5HHXH 1K3IA 3MV7E 4GAGH 2ADGA 2QHRL 1NMCB 5ACZA 5IFHL 3QUYA 1WBZA 4XCEB 3ARZA 3MNZA 3BP4B 3KPPB 3B2UC 4Y4HC 5BMFH 3DUSB 2MKLC 5GRVK 5GGRA 2PKDA 4IOIB 4Z5RA 5AYUH 4E5XA 3I50H 3OF6D 4H8WL 1RZKC 3VXSE 1QFWH 2Y5EA 1G0XA 1ONQA 1OGTB 4X0KB 3OJ2C 4XCNA 5CBAB 4Y4HA 5F88A 5CSZA 4MCZB 1IM9A 1QRND 2YOCA 4LFHD 4OQTH 4PJCE 4ODSL 4JQIH 2AS5M 3PHQA 3IFPA 4EXPX 4LLUA 3IKKA 3RVTD 5EOQH 1I85A 4MMXC 4HWBA 2E9WA 5KANG 3HCVA 1MWAA 3SQOL 1ZHNB 2HT2D 1JGLH 3LKQB 1NMBL 3MGAA 2XICA 3WHE1 4EDWL 1I8MB 4UU9A 1TJIH 2YK1H 3L3DA 2HKFL 5E2UL 1KLFA 3WFDH 2AXGA 5FKAB 3HMXA 3BKJH 3BZDA 5HHXL 4U7KA 5SX5H 2Z93B 5E6ZA 3ULSB 3BYYA 3SN6N 4OJFL 3K8MA 4XHJC 2DTSA 5EN2B 5GISH 5HI3D 1N59A 3HPJA 1RMFL 1KIUA 1ZA3A 4M6OH 4P57B 3B9AA 4K94L 2ZOLA 3VG9B 5E24E 4C54A 1S7TB 3W5NA 3V6FA 1U91A 4P4KD 2PTTB 2J5LB 3MRBA 3W9DA 3L3GA 5H35B 4J3OC 1IGIL 3MXWH 1NCTA 2BSTA 4PJGA 5ILTL 2HVKA 3VI4E 3SGJA 4HHAB 4Y16D 3OJDA 2JJWA 3B83A 4N8CL 4OZFG 3TA3C 4CMHC 2ZUSA 2AABH 2PN5A 4JPVL 5GSRB 2H9GB 3ARFA 3DBXA 3MRDA 1N8ZA 1ES0A 1TQCC 4OF5A 4HW6A 4WNQA 3CFEB 1G6RH 2OTWB 4NWUL 3WNKA 2NZIA 2NR6D 4KRPC 1FZMB 2CGRH 3O4LA 2HJKB 4KUCF 3DSFH 3EZ8A 1LD9A 3BH8A 2X40A 2O61A 4FQPA 3N0PB 3DTXA 5D71H 3WCYA 3O45A 2ZG3A 1RVFH 4GAYB 3TVMB 3EKCA 1MHPH 3L3DB 4RFEB 3VGDA 3C5ZD 3OSKA 4JO4H 4H26A 4NO0D 1MCBA 4J1UA 4XPTH 1Z0NA 4LIQH 3RY4A 3U46B 1Q9OB 2Z93A 5GIRB 1I7ZB 1KJ2B 2IH3B 2ICCA 1F58L 4RDQG 1KEGH 3Q1SL 5AZ2L 3HPJB 1EUUA 2R0WL 4N68A 4JY6A 2GI7A 1FFNA 1AI1L 5JHDE 1IGML 1T0PB 3RWFB 4RGMB 3MNWB 5DD1H 5CEZE 1IEBB 3P4OA 1U93B 1S7TA 4P2CG 4G80A 1NGXB 3DWTA 2V17H 1GGIL 3SE8L 4KUZL 4I8DA 2R4RL 3B9EA 3GI8L 4IIQC 1HI6B 4BSWA 1NGYA 2G60H 4RGNE 4A2MA 2R56H 3OJDB 4ZQKA 1T0NA 4FS0A 5IF0B 3BKYH 1CD9B 2A1WL 5BZDA 3BHBA 2HLAA 5EDXA 5MERA 3VGBA 1QR1A 3X13B 3WS3A 3VXSA 1KLGA 3O3DA 2B4CL 3RIAF 5C7XL 3FOMB 3LAFA 3X3GL 1WT5A 3KPMB 5DZLA 4NNPL 4M6MH 4YK4B 4WHTB 2IQAA 5E8OA 3B9KA 2H1PH 2XWJA 1MY5A 2EO9A 2VC2L 1V3LA 1IKNA 3DTXB 4ONHB 3TBVA 3FQRB 4X8XA 5F8QC 1A47A 1FNEB 2FD6L 4EKXA 3CH1A 3FT4A 3D0LB 1TVHA 3GSWA 4XVUC 5CUSH 5A2LH 2DAVA 1YUHB 1FZKA 2R4SL 3UBXG 1E6JL 1Q9OA 2A2QT 4X6EA 2ZKHL 2SEBA 3DLQR 3IETA 1MHEA 4QXUL 4WI5A 1C08B 1U3YA 4P3DB 4LSPL 5GGSB 4HKXB 4B0MM 5F7DA 5EPMB 3QO1B 1WV7T 3OHXB 3GI8H 4JY6B 1INDL 3NCEB 3O81A 1AE6H 2I25N 1IC5H 1MHCA 2AK1L 1X4ZA 2FECI 3IFOB 3CVIH 2EYRB 3BKCL 4XBGA 2HWZH 5KSBF 3FZUD 2YUVA 3GRWA 4G80B 4YHNB 5SWSD 2BCKB 1I4FB 3P9WB 3QQ3B 3B9KD 3RQ3A 3IGAA 5JXAH 2C3VB 4P23C 3O2VH 3NFSL 4NO2A 5DQ9A 4ZYKB 5J1SC 3A67H 3L5IA 2VZ3A 3IDJB 1I9JH 3SE9L 5F9JB 4HQQL 2A9NH 2UWEA 2QSCL 2XG5A 1S9VA 5JNYA 4I5BA 1CFBA 3MBED 4L8SC 5I17A 1TCRB 1I8IA 3ZYOA 2ARWA 3RTQA 5I15H 3JV4A 4I3RL 3I02B 1BF8A 1LDPH 1X4XA 5FCUH 5KN5B 4OCSH 3AY4A 2NY3B 4I77H 3U36B 4JFOA 4R4BA 3VFTA 3SDXA 4Q9QH 4Y8DC 5D1ZC 1W8OA 2VL5B 5A2IH 1MCPH 3QI9A 1GGTA 4D8PA 5IQ7H 3UTOA 1LP9A 3S6CA 2Z31A 1U8NA 1B4RA 1T5XB 1HQ4A 3VGEA 4RSVA 3IAPA 1NANH 4ONGL 4DZ8A 4WI3A 4HKXA 1T21B 3OR6B 3PP4L 5ERWB 3ARRA 5CSBA 1JHKL 1N26A 1YDPA 2ZUQB 4FTVA 5MI0B 4NO0A 5JLZB 1BP3B 4HMEA 4ELMA 3C5ZA 3WE6A 3VFPA 2EYRA 5JR1L 2CMRH 2E7CA 4WHDA 3NAAL 1V5JA 2IFFL 5B8CB 1F2QA 3U0TA 1ITCA 1YEGL 3ARGB 1S7QB 4YGAB 3D85D 4JO3L 3UAJD 3ZZ1A 4NOBA 3RDTD 2EEBA 4TUJB 1U92B 3I6LD 5JHLL 4PJXF 1QLFB 4PRBA 5HGDA 5IV2A 2NNAB 4YFLI 2X1XR 2V7HA 4KY1L 4ZAKC 4G8EA 4B50A 1ZHLA 3OGCB 1FYTD 1I7RB 2GITA 2JJSA 3E3QC 1EHAA 5DS8B 4UDTA 2H32H 4PJDE 4XXDA 5D7IB 3RKDC 2APWA 5DUPH 3ARFD 5FHBL 2JCCF 2EDOA 1CFNB 5I16A 2C4XA 3MLPA 2JJSC 1JE6A 4LCUA 1DVFB 4MLIA 3KYMA 2R2BA 3QEHB 1OAZL 5F96H 5B38G 2F54B 1C7TA 1FVCA 5BO1L 4NUJB 2GSGB 2VABA 2E9IA 5IBTH 5C0EB 1UWXH 5CLWA 2EDEA 4K8RL 4CKVX 2GYSA 4OLZH 3SY0A 3OAUL 5I71B 5HGBB 2V17L 3HZVA 5H37G 1CE1H 3LS5H 5HHNA 2E3VA 5JW4R 2Y1VA 3U30B 2EKSB 4KGLA 1H5BB 4XNUL 3ZTNH 3ULUL 2GKIA 3JWDL 4K3EL 4NN5C 4LCWD 4BK4A 1M6OB 2VLKE 3OR6A 2E7BA 4G6ML 2A74B 4HWEH 4M93B 4KZEL 4JRXE 2EKJA 3I75B 2DTML 4DKFH 3QXDA 2BNUB 1OP3H 2IAMC 3PGFL 5E2TH 2AJZB 5F7UA 4X7SL 3GRWH 3MCKB 2ZCLL 1NC2B 1T1ZA 4PJ9A 1UKTA 2ATPB 2VIRA 3MLUH 3U0TB 4M9PA 1J7VR 2A0LC 3K46A 1I7TB 1YNKH 5IT2L 2BSRB 1J10A 2FRGP 1DLHA 5CKGA 4XC3L 2FWOB 2OX5A 3V5HB 2QSVA 3TNMA 2NYYD 4IDLA 4DGVL 1QRNA 4OQTL 1X9QA 1EO7A 5KOMC 4PB0L 4MJIA 1JV5A 1XGTB 5AZEH 3RGVD 3ULUF 3FO9A 3TO4C 2ED7A 5B3JF 4LSPH 2OXGA 1AJ7H 1WAAE 5E4EC 3BN9C 1FVCB 5ESAA 1C5CH 2XOTA 3IFLH 3T8XB 3CFCL 1CICA 3WIHA 3MLXL 1IC5L 3VXQA 2X7LB 1EXUB 1AQKH 4UILL 2IMMA 3G04A 1A9EB 2X44D 3CMOL 3FCTB 2Y36L 1MJJA 4QWWD 4G6MH 2VSDA 4Y2DD 4DKEH 2X4RB 1CR9H 4NRYA 2PR4L 4LMQE 5DEGA 3FFCA 1R3JB 5IW6A 4NQDD 4X98B 2UYLB 3TIEA 4Z7WE 3W0WB 3O2VL 3RKDD 3PWLA 4GO6B 5CMAA 5EIIA 1SHMA 2EC9U 2BJMH 2HT3C 3EDJA 2EO1A 3BWUC 2BNUA 4A6YB 4ODHL 4LVHB 4W68A 5CWSB 3FOLB 1QA9A 5KSUB 1CGYA 2ZP0T 4YHYB 3AREC 1RZ8B 3V6OA 5L8LB 2VDOH 4OD2A 4JCLA 3MLYH 2JELH 2W60A 5C6PB 1YY9D 2BOBB 4B7LA 3RGVB 4UMGA 3NIFE 3PL6A 1QBLH 5GGUA 2I9TA 4I3GA 2BDNL 3IU4H 5HD8C 3D2UD 4JAMA 4F58L 5FEBA 3UAJC 4CMHB 1FZOB 3LKNA 3CMOH 1ZV5A 5DSCA 1E27B 3MROB 1VKXA 1W72B 4HZLB 5TE7L 4AT6B 2A9NL 2G2RB 4R6UA 2OJEA 4MA1B 2B2XL 2X09A 4XP4H 5ESAB 1VGKB 3T8XA 1G84A 4TVPD 2DQTH 1BVZA 3L7FB 1OWWA 3UBXB 1OTTD 1U8HB 3SDAB 5CILL 3VG0H 1Q0XH 5EORH 1J0HA 5HHOA 4JFYA 4ZOAA 3U48A 1NC4B 1NMCC 3FMGH 5EBMB 3AY4C 3QFJA 5BCAA 2B8OT 4AQ1B 1HQRB 1WCBB 3UO1H 4NZJA 4JJ5A 3X12B 4MSWB 3RI5F 3STZB 3MV9B 3IF1A 3VFVA 2XRAH 1HIML 3PWLB 3U7WH 3TT3H 1MRFH 4MJ2A 4WV1C 4XMPL 5EIIB 4QRPA 1UVQB 1HKLH 4WWID 4PRPE 3VGAC 1VACA 2KPNA 3CFJB 4PGDA 4Y2DA 5HY9A 3MUJA 1PKQE 4MXQD 3UPAA 3WDIA 3MLZH 4A6YA 4WIQA 1X5IA 1IZJA 5CWSA 3PP4H 1SY6H 4UUJB 2DLEA 1J0JA 4JFDE 1A7PL 2VZSA 1PGRB 3HNVL 1PG7X 3KNBB 5KSBB 2I5YL 3RGVA 2PYEE 4UBDC 3FT3A 1CLYH 3WIIH 4J23A 3SCMC 5D4QA 4HK0B 3PHOA 1M7IB 1BIIA 4NWTH 4S1QL 5E9DE 4NJ9L 2HN7A 5TDOB 5EB9A 1K6QL 1CT8A 3MJ8B 4OJFH 5C0AB 3RWEA 4DEPB 2AXFB 1KCRL 3LKNB 2L0DA 4G8IA 4HZLA 4AT6A 1I1RA 1MFBL 4XX1G 5CZKA 2E6PA 3ARBA 1EJ6A 3FFDB 3HE7A 1VGKA 3PWJA 3FB5A 2MSPA 3AMLA 5IMKB 2NCMA 4EUPG 1NBYA 2X1WL 3QUML 4YBQC 2VXSH 1W72H 2QR0B 3Q3GA 3PGFH 3OG4B 4MQTB 4NQCB 2ICWB 4JM2C 1CLOH 3FONA 2CLRB 4G5ZL 5IJVA 2AK4B 2GW5A 4XCFH 3QA3A 4Z7WF 4NN7B 4L8DB 4XH2A 3EJYD 4LSVH 1ZXQA 5C0FA 4FHBD 2F54E 1MJUH 4DCQA 3SKOB 1OARL 5FGSA 3DYMA 1SJEB 1SYVA 4U1SA 2EXYD 3PDOB 2H2SD 3LRSA 2A77L 5F1IB 1IZKA 4P2YA 4WEUD 1U8IB 2NY3D 5C0NC 4D0CA 3VD7A 2I60L 3KJ6L 3V6OC 5L7XL 1JF1B 5ESVA 4JGMA 4ODVL 4FQQA 3SKNB 3U4BH 1CE6A 5JA9A 4DGYH 4L3EE 4FQLH 1K8DA 3G5YB 3P0YL 1U3HA 4YK4C 3GBLA 4XNMA 4KHTL 3A6OA 5GS0H 3DGGB 4ZUVB 1A3RH 3TO2B 4XAWL 2NLJB 1LO4L 1J18A 1C12A 1S7UA 5JA8B 4I4WA 4WW2C 1EO8L 4K94H 4N5UA 2ERJB 1XF5B 3M8OH 1HHIA 1X4YA 2D3VA 4KVNH 3BP6A 3FRPA 1EGJL 4TQEH 4CADB 3MO1B 1L7IH 3RX5A 4MXQC 2DL9A 5MENA 2JCCB 3D85A 4XPFL 2MCPL 4QXWA 1DQDL 4X7TB 5D70L 5HI4C 5ICYA 4WWKA 3F5WA 4L5FL 2G9HA 1J1OH 5BV7H 4XTRC 4FXGA 3LKSB 4H25B 3WEXA 5JOPD 5DQDL 2VDOL 1EHLL 5ANMB 3EJZC 1WITA 3ECBA 2BVOB 5C0FB 3OAZH 3HI1A 5T33H 2BHYA 3KS0H 4MNHA 3SKOA 4NKOA 5D1XB 4LFHG 3QI9D 1HYRC 2VDKL 3QFJE 1SMOA 4ZFGL 2FYYB 4N90E 4NQXB 3R8QA 4YAQB 1VFBB 2EECA 2Y7QA 2ZG1A 4JQXC 3RTQD 2FO4A 1HYSC 1QFWL 5DC0A 1SYSA 4WJ5A 3GMLA 3QNYB 1QBAA 3MV01 2DQGH 4Y88A 4BZ2H 4OZHF 1KN4H 3MBEA 3ZE0E 5DI8B 3EYOA 4UOJA 1JWUA 1C12B 3TYGH 1N6QL 3TCLA 1VFMA 4UOW0 4LCWE 5EUKA 3BUTA 1AHWB 2XPGA 3VXME 5HSFA 3V8CA 4KDWA 4FMKA 4GQ9H 1K8IB 1EPFA 4J6RL 4UB0L 2WNGA 3EYSL 3D9AH 1TZIB 3BPOB 1U0QA 3MGTB 4PTUA 2NY3C 3RWIA 2HFEA 3TYFA 3V4UH 3BDYL 3CZJA 4ODUA 3IKCB 4TULL 4Z0BH 4WUUB 3MYJA 3SGDH 1JGEA 1QSZA 2BOCA 5IVZA 5LVEA 3D87B 1KB5A 5GRYA 5CD5C 4Y4FC 4Y5YB 1S7SB 2VYRE 4MNGE 5I19L 2P5WA 1FE8H 3EAKA 4BSVA 1KIPB 4O58L 5HYQA 5FYKL 1Q1JL 5IIEA 3INUH 1K4DB 4G6AD 1FFOA 3DMMA 3LKOA 5IB1A 1N6UA 2EIBA 5C0CD 5KS9A 3OGOE 4KJYB 1HIMH 3WYRA 1MCQA 4H1LG 4DUXA 1I1CA 5DHVH 4PTTA 2D31A 3BT2H 1M7XA 1N6VA 1RZJH 4PRPB 3QHTC 2D03H 4JKKA 1JGUL 2XA8L 2CK2A 3BI9X 5FYJH 3S5LB 4HCRH 2P8MA 1FV1A 2FO4B 4QTIL 3AU1A 5FDYA 1NEZA 1WT5C 4IS6A 5DYOB 2OI9B 4GQPH 3U9PL 5L8KB 2NXZB 3WV0A 2C26A 4L8CA 4JPVH 4AIXA 4YLQT 2XZAH 3P40A 2YRZA 3TO4A 2AJ3A 4PRAB 1EUTA 2Q8AH 1ADQA 3TA3B 2AK1H 1BQHG 1AO7D 3EYFB 1WTLA 1J1PL 5GJTH 4D3CL 1IGIH 5D7KD 5F7HA 5INDB 5E5MB 1NAKL 1FNLA 3T0EB 4J3SA 2AI0L 4HIJA 1WICA 1OF2B 2H8PA 1OOAA 1SM3H 4GW1B 2NY4B 1JGVL 2BHZA 2VITB 5J4MA 4XGZA 5CJOL 1JP5A 4DTGH 3AB0C 1AFVL 1RJYA 3KPOA 5FYKH 1IL1A 1NFDE 2HKHL 1OP5H 4YX2L 5IVZB 2C1OB 2ESVA 4R4FH 3WS6A 3GI9H 4RIRB 2PTVA 3FN0L 3C8KA 5LGJB 3NCBB 2H6PB 3RU8H 2R2HA 4HUWA 2PYEA 3BT2L 1A6VL 3PHSA 5IHZB 4RCAA 1F4XH 3V0VB 3V6ZA 1ZA6A 3IAGC 2UV3A 4Z9KB 2N56A 3QWOA 1A14H 3FN3A 5I1CL 3LH2L 4EN3B 1F00I 1YNLL 4NM8H 4WFEE 4E9LA 5TFSH 2H3NA 4PRID 1F90H 3B43A 5CBEB 4KXZI 1IAIH 1K4CA 2YR3A 3O0RH 2BY3A 1UEMA 3HR6A 4HXBH 4PREB 4QY8A 5DD1L 1A7NL 4KPHH 4X5WA 1IFHL 1U6AL 3TO4B 1RU9H 1GZPB 2DBLL 3EFFB 3QPXL 4W70A 4OZHE 2R2EB 4XVTH 2LU3A 2VXTH 4PJBB 4TUKL 4Z7VA 5INDA 1C16B 4ODXA 1F6FB 4Z5RB 3BIAX 1CDIA 1MIEL 1YMHA 2JTDA 4GLRH 1ADQL 1AGBA 3CUPB 4Y4HB 5E2TL 5I1EH 5IJKA 4C4KT 3LHPL 2AXHA 4XHJD 3H9ZA 4LHUB 3RPIB 1JPGA 4JFDB 1FNHA 1NPUA 3LN5A 1WCQA 4L3EA 3FJTA 1AXIB 3MR9A 3VWJC 4NC2B 3DYOA 5DA4A 3VWJA 3V7MA 1EVTC 2H6PA 3A6CL 4MQXD 4X83A 4LLWA 4Z77B 3UO1L 1M71B 2ARJB 4APQB 43CAA 1NCDL 1EFXA 2YD4A 5IHZA 3SDXE 3LQZA 4IRSB 1I1FB 2DN7A 4GKSB 5FAAA 5IMLA 1X6NA 5E6YA 4UU9B 1RK0A 4PP1C 3TEUA 3RL2B 4XXCC 4MHHG 3OKNA 4PLJC 1DZBA 1M05B 3GMMA 4GW4A 5T3ZL 1IFHH 4X99B 4OZIA 4KKLD 3B3IB 4N8CH 3SGKC 4L4TE 1XF2A 3SJVA 2EH8H 3L3JA 5MEPA 1CXKA 4AL8L 3KGRA 1J0KA 2W0FA 4UV7H 4FP8L 3JVGC 4ZPVA 2W1NA 4EBQL 4QY8B 5KS9E 5T3XD 4LHUD 3WIIL 3KLHD 5I0ZA 2ERJC 2X10A 4XT1C 1RULH 2V5YA 2VTFA 1I3VA 4GSDL 1UZ6F 3CDYA 4G42A 4ODXB 2X4NA 1A6TA 5GHWL 5EIVA 4P5KA 1JWSA 5D6CB 1FNGA 1LWRA 5A2JH 4NCDA 4U1GC 1L7TH 3X11A 2OTUB 1EEYA 3AGVA 4OZHB 5D2NA 2H26B 4OTXH 3C60C 4IBLT 3VWKB 5GSRA 4RGND 4APQD 1KSRA 3GSRB 3HZMA 1FNFA 1JGUH 3L3IA 2OTWA 4GXVL 4LKCB 4MD0B 1HHHA 5KSAC 5KVDL 4NDMA 2F19H 32C2B 5ETUB 2C3HA 4N1HB 3VWKD 4C83B 1G6VK 2O61B 1EFXB 1FL6B 4I77L 2J8UE 3GMNB 1F6AA 3TVMA 1JK8A 3BUYA 4X6CB 3D39A 4S0SD 4JFHD 3EOTL 4PJGB 1A02N 1D5XA 1NLBH 2FGZA 3NCJL 3GIVA 5DRWB 5SWZA 3ARWA 3H2WA 5GIRA 4HUXB 4JZJA 1ZVHA 3B4NA 1DQQB 5IFJB 4GSDH 1R5WB 4OZGF 4ZSOE 5FA4B 5EZOH 5DK0A 2OMNA 3JWOC 1N8ZB 5MEPB 2ADIA 4FQ1L 2C9AA 3T0BA 2AV7B 3GM0A 4JANB 5C0BD 2AXJA 1AGDB 3TH2T 3GBMH 2DOCA 3JZ7A 5IBLC 5IW1B 4DN4H 4K3JH 3V0WH 2PCPB 2CD0A 1BIHA 1OHQA 3G6JA 4QRQB 1HCFX 4LNRB 3C08H 4JHBA 1TZHA 2VN4A 5I1HL 3H9SA 5D7LD 4G42B 1REIA 3ILPA 3CSPA 3UTTD 1D6VH 5HHPA 1XZ0B 2GJ6A 5DJ2B 3U0PB 5I6XB 5KANI 4FA8A 1ND0A 5IF0A 2VN7A 2NW2A 1A1NA 1T89A 4R2GD 3OKMB 3RVXD 1X7QB 1RUQH 3TZVC 4ELKA 1KCSH 2P45B 3KPNA 1UB5B 4Q74A 3C09B 4Z7VF 1NCAH 1UENA 3V9FA 1TVBA 2R1XA 1INEH 2A73B 4EOWH 4PRPD 1PQZA 1MIML 1UZ8A 3DX6A 4CDHA 4WFFE 1Z5LB 1BZQK 3HR5A 2XQYG 3PGCA 1X6LA 5CILH 3K1DA 3ZL4L 5K9QI 4MB4A 3QDAA 4W6XB 3VGHA 1WWAX 4FNLH 4RBPK 2E9BA 3KR3L 4WI7A 5IVXE 5DUBB 4TOYL 2IMNA 3GMRA 5D1QD 2HTLD 4NRXA 1KGCD 4P2RB 3MLTA 4JR9H 5JMOC 3L5HA 4NHCH 1U8MB 3X13A 5LQBH 3S34L 3O3DB 2D7PA 3VDBA 4NZTL 2R39A 3SDCC 1FDLH 4YQXL 1MCHA 2Q8BH 5LXGH 3BESR 5DFVD 4EN3D 2OS7A 3I2CH 2W65B 4F33B 4Q97A 4EIGB 1HKFA 4MQ7A 5DURB 3P4NA 3RVTC 3TBVB 5EO0B 1XCQA 4NN7C 1TETH 4HBCH 1MEXH 1ZLVH 3VJ6A 5I1IH 3WLWD 3BMVA 1J0YA 3HRZB 2IWGA 4F57H 4I0PB 2Z8SA 3S36X 1KXQE 5E8EB 3CVIL 3MRFB 3QT2A 5AZEL 5EOCJ 5JNYB 1XGYH 1NJ9B 3KLSA 1U8KB 3HG1E 5F7DB 3RVUC 1MY7A 4LDEB 1CXEA 2NY6B 3MGOA 3BEWB 5E5RB 1CU4H 3HTLX 2GEEA 1JF6A 3QHFH 3NCYP 5GRUH 2E27L 3WIHL 4JVWA 3CZFA 4WUUD 5HI3C 2C5DC 2NY4D 1NGPL 2CUMA 5CSGA 2XTJD 2VMFA 1A64A 1UZ8B 4EI5D 1B0GA 5I73B 5JXED 3HR5B 3PGCB 4TYUA 1XIWA 2IQ9H 3A6BH 3IGAB 3QCVL 5ICZA 1T03H 1Z6JT 2ZUXA 4MLSA 5GGTH 1CDCA 1UB6A 1WF5A 2WM0A 4TTDD 3L3KB 4X9HA 1Q94A 3LDBC 5FK9B 1KPUA 3G5ZA 2GK0A 4FQHB 1RJCA 3PWPA 4O2CA 5FUOL 1YDPB 4J8RA 1CQKA 5HHMD 5DVOA 4TNVK 5GJSL 1YA5A 3MRPA 4DAGL 1WBYB 1KG0A 1UA6H 2R1YA 1TCRA 4NYLA 3WUZA 2XV6B 4J3UA 4TNWF 2YXFA 5HYSB 3HAEA 3WUWA 1KJ2L 4GXUM 4H5SB 3LKPB 3RVWC 5IB2B 4TUJA 4N0CC 5IWLC 2FX9H 3EW3B 4YDKH 5I1LB 2Z9TA 4QRUB 2V7HB 1EMTL 1CU4L 4NCC1 4GRWF 4QOKD 4LSRL 3OR7A 2DQCL 4KKAD 5GRUL 3OJMB 3HNVH 4MB3A 1IT9H 2FJGB 3HPLA 1A0QL 1J1XL 5EU5B 1CFNA 1U9KA 3SJVE 4ENEC 2Q6WB 3MRNA 3C6SB 1HXMA 1FIGL 5DC9B 2Q3AA 4ZTOH 4NN5B 3U79A 4OLXH 1L7IL 3BD3A 4KI5E 2WLYA 4OM1L 3GK8L 4LCIL 3CVHA 3S8WA 4NFDA 3EOBA 3MLWH 4JFPA 1DDHB 4G43B 2NR6C 2X2YA 1XIWB 4NT6B 3QR2A 1B90A 4X6BA 5TE4L 5MP6L 2QADB 3MRIB 3LH2H 4F9PC 1I75A 1AE6L 5KVEH 2EDLA 3HC3L 3TBYA 4LLQA 4G5ZH 1EHLH 1OCWL 2GK0B 4P3CL 5EU6D 4FQHA 4QRRD 1A6WL 3F62A 4L1HA 5T5NF 4RA3A 4RMRA 1EH9A 1JF5A 4JHAH 4JREC 2Q1EA 2CDGA 1MUJB 3UXFA 4HS3B 3QEHA 4MA8L 1BQLH 4UQ3A 5IB5B 2XXMB 1AIFA 3BYTA 5HYSA 2HTLC 4D94A 3IB4A 1HXYB 1HINH 2XTJC 5EOCH 4JRYA 3BPLC 4K3EH 3CFBB 4QRUA 4NO5B 2AV1B 4X6DE 4MNQB 2ZUVA 5AWNL 5CAYB 4G7VL 5GS0L 3BD4A 1SEQL 4DKAA 1KCRH 3UJTH 1QZ1A 2NX5B 4XAWH 5BRZD 3BVNB 4GBXA 5F7MC 2P5ED 4LVEA 5FDWB 5JIPA 3DUHA 4IMLA 3VFGH 3VXUD 1N5YL 2X4SA 1AGFB 3CJJA 4HFUL 3BXNA 3G5XA 1AGEB 1NC2A 3HKFA 4PJ9B 4QRPE 2FIKA 4HH9B 5IVNA 3ZO0A 2X89A 2BNQD 3EOBB 3D69B 4Z0BL 3TGXA 2YD6A 2JK5B 3GHBL 4JGUA 4I48B 4KTYA 4BH8B 3JV5A 2IPTH 4PB0H 2C1PA 1DUYA 4U6YB 4XVSH 1R3JA 5IW6B 4W4NA 1MJUL 2YUWA 5F6HJ 3DUUA 5E94B 3D3VD 4GW5A 1LEGA 2AJYL 4PJ7B 1E4KA 3MLXH 3UTQA 1YEGH 4YHZH 4K8RC 4P23A 2I60H 3FO9B 1HH6A 1X5GA 4GKZB 2OR9H 1J11A 5B39A 1BQUA 1QSEE 1OQOA 1E4XL 1NGQL 3DX7A 1FYHB 3WXWH 5LGKA 4ZPTA 4ZOCA 3TNNA 1BWMA 1WAAF 1U8LA 4JLRA 2Z8VC 3I50L 5DJ8A 4HGKC 5FYJL 2J8HA 5HYJA 3U7AA 1P7KB 3D0VA 3R4DA 5D70H 3PWPE 5JHDB 3O9WB 4ZAKA 4O2EA 2H1PL 4P46C 1FRGL 1OLLA 1ZT1B 3ZT6A 3QAZB 1BAFL 1IKNC 2LVCA 4MJ5A 5E4EB 2GTWA 3ZDXE 1S3KH 3UYPA 4JVUA 2IBZY 3QG7L 4V1DD 5FDWA 4M61A 4F57L 4D3CH 1YPZA 3QPQD 2G2RA 1ZLSH 1T6WA 4ETQA 3KPLB 2QKIA 5E6ID 5I2IA 5DZNA 3BIBX 4OLVH 1CK0L 3T0AA 3IJHB 1INQA 3RY6C 4MX7A 4OD2B 3D69A 4HIXH 1MFAL 5K9OB 4KV5F 3N1QC 3TBSA 1KPRA 3OAYH 4PG2C 5E03A 1NGPH 3NIDE 2ICEB 1G0YR 2X70A 2VLME 4G6FD 1DUYB 4V1DA 2EIDA 4OLUL 2FB4L 1RD6A 3GI9L 1EJOL 3WUWG 4U7MA 5E94A 4MS8C 4WHYH 3K4DA 4HUNB 5EZOL 3SDDA 4F15C 1EEQA 4LCYA 4Y89A 4OCXL 4QRTA 4ZAKD 2P5EE 4WUKH 1FG9C 3MUGA 1P9MA 4L9DA 1JNLL 3CFJA 4Y2DB 4U6VH 1HH6B 4GKZA 1QO3B 4U3XA 3S4SG 3HS0B 3QEUB 5I66A 4R97C 4H1LA 3OKLA 4EJ1C 2J88L 3F12B 3OB0K 4LRIA 3W11C 2E6QA 4QTHA 1JZ7A 4XP6L 1OSZB 1X5HA 3UPRB 1G7MA 3QDJD 4G6KL 3C09C 5E08L 4JY5L 3LN4A 4LPXA 1WCBA 4AQOA 4HULB 2FNBA 4CAGA 3MRMA 3MJ8A 1LK3L 3ROLB 1OGAD 4PGJA 4JZJC 1YMMA 4K55A 4WFGD 3ZYZA 4X9IA 3N50A 4PJXE 5FGRA 3ARBB 3NTCL 4PJ8A 2X89D 1S7WB 3QWRA 1BFOA 1LO0H 4ZO8A 3CFIC 4DZBB 3QNZB 1A7QH 1NC2D 3IAQA 3L3HB 3IJHA 3AS0A 4LSTL 2DYPA 3M17A 4OD1H 3ISWA 2HRLA 3MODH 5T1MA 3VXUA 3TBSB 5IHLB 1AFVH 2NXYD 5E8DL 4QT5B 1NDMB 1P6FA 1ERNA 4L8DA 2FEEI 2VLJD 3BSZH 3BWAB 4LCWB 1OAUH 4JFDD 2AEIT 4I2XA 2CRMA 4K3HA 1XR8A 1KOAA 4PJBF 1ZLUH 3ZKND 4U1JA 4OI8A 1FAIL 1AXSA 3LRSB 3EO1B 5F9OL 5E1HB 2WWKT 5CGTA 4L8SA 3GSUA 4WW1B 3BFOA 4OF6A 1QO3A 1FGNH 4NN6C 2FL5B 3VXMA 4AMKH 2CKBA 4HG4K 1JF1A 5ESVB 5JOPE 4B7IA 3SKNA 1KEMH 1LMKA 3FO1A 1CGXA 5ITFA 4WDIB 3G5YA 5DRNB 4YXLL 5IFAH 4JO2L 1IKFL 2KUTA 3DVGA 4K8RD 2ZCKH 4ZUVA 4LF3B 1A6ZB 1S78C 2VDRH 3PQYA 4HBCL 4I4WB 2AW2A 4LPUA 3ME0A 3KPRE 3FQWA 1YZZA 1CIDA 2EE2A 2JB5L 3H3PL 4TVPE 3T2OA 1JTPA 1RHHA 1KELH 4QGYA 4HUVA 1ZTXL 4PV9B 3TLRA 1XH3B 4CN6A 1Y18B 1ITBB 1SM3L 1KENH 3NIGE 1TLKA 4AIOA 2BNQB 2DQFA 5CJOH 4KU1A 2PW1B 2NYYC 4KJWC 5IESH 4WWKB 3CFDB 4QHUA 5BS0E 5J7CC 1YEHL 1MPAH 3TBWA 4YHOL 4ODTL 4X0KA 4XBPB 5DJCA 2DTMH 3F6IA 3MV8B 4FXGB 2ITDB 5CSZB 3G08A 4P4RA 4Q6IC 2E8ZA 4O02L 5ANMA 2CXGA 2P5EB 3UYOD 2NLJA 1F3DJ 4YHYC 3S3PA 3MQIA 1CGWA 3HI1B 5IHUH 3C60A 2F19L 2QQLH 5ISZB 3T4AA 2EYTA 4GQ9L 1OGAE 2LQRA 4WHCA 3MZTA 4BZ1L 3ZDZE 4YPJA 3HCVB 4XC3H 4OB5L 3LEYL 1EFQA 2FL5A 1ODAA 3AS1A 1I8MA 1QFWI 3BDYH 3T2PA 5B21A 5F89B 4F3FA 5C86A 4O2FA 2P47B 4PJHF 5DRXA 2P4AB 3DVGB 4EDXB 3RUGB 2OZ4H 5BW7A 4K9EL 2X4QB 4IIQA 2NY6C 4FRWA 4GMSH 1KENL 2DKSA 3VE0A 1KTKE 1MH5A 2N1KA 1OL0A 4ZFGH 3RHWF 4Y7MA 1NFDA 4Z7UE 1ZA3B 1KTLB 4L8BB 1DSFH 2XWTB 3WFCL 3RZWA 2ZNXA 1G7PA 4PRNB 1DQTA 1Y6NR 4YUEL 4JRXA 5JXEA 1XF4B 1RUPH 3ZKXC 3TYFB 1EEZB 1SQ2N 4LPCA 1MREH 3B9KC 5JORB 2Q20A 2F54D 1EA9C 1JGEB 1YMME 2X4UA 2VH5L 4U0RC 4P59H 1CFVH 2VUYA 1C5BL 1J05B 3A6CH 4O4YH 3EBAA 3ARFB 1S7SA 3WMSA 3TT1L 1FJ1A 3KDMB 1B0RB 4F7MA 5CP7B 1G6RA 2CK0H 4LSDA 5C0GA 3BRDA 1FVDA 5IW3A 3BGMA 3PWVB 1CD0A 3CPLA 3O4LB 3QUXD 2XWBB 3VXUE 2W59A 3QHZL 3BDXA 3BO8B 3E2HB 2XQYK 3MOAH 4ZS7H 5FYJE 4FQIH 4ZFOB 4I2XE 4X4ZA 1RZKL 3ARGD 1FLRL 1S5IH 3HUJE 2VXQL 4LIQE 4NNYA 5SWSB 2PO6B 1RK1A 5GQBA 1CXFA 2B5IC 2YXMA 1TQBB 4TOYH 3O2DH 3CD4A 4RNRB 1KUMA 4Z7VE 4Y1AB 4JFXB 1PLGH 4JM4H 4IOFD 3RUGA 4GKNA 4JN2A 4AEHH 4OCYL 5HHMB 1GIGH 3T3PF 3AUVA 1OAKH 1TNNA 5BVPL 2PO6D 1SEQH 3LS4H 4OKVA 4NRZB 4Z95L 1KLUA 3ABZA 5J1AB 4UINL 2RR3A 1N64H 3MV7A 4WW2F 2XWTA 4P9MH 2HFFB 4QTIH 5DUPL 3MOBL 5IB1B 3RGHA 3VFOA 1IEBA 3P4OB 4P5MA 3GSOA 3VXTB 3O6FC 1W0VB 3GHEH 4PV8A 4X4MA 1P7QA 3OXSB 4XGZB 3K4ZA 1LQSR 3CXDL 4MJIE 5MEQA 5GGVH 3UC0H 3AREA 2FDBP 5FB8A 3M45A 1BFSA 4N0YH 5BOZG 3KVQA 5GGRY 1T0NB 3DRTB 5SWQA 5DTFA 3IJSB 3WFEL 2GT9B 1AD0B 5ENWB 4LNVA 4IRJC 2Q87A 2DLIA 4HS8L 4OIAA 4XCCH 1P84K 1JCKA 5KVGL 4X9FA 1V3KA 2AJ3B 3V4VH 5HVFB 1NCWL 1CF8L 4JM2D 3GSQB 1NGWB 3TIDA 5BW7C 4S2SB 5BS0A 2P7TB 4Z6AT 1L4IA 5L88L 4JKPH 4ZFOA 5F1NA 1LVEA 1DP0A 1R3LB 4GXUN 3O6LL 4NNYB 4UNUA 1TVHB 3GSWB 4OM1H 4AM0B 4X4YB 4ZNCD 5IEHB 5IT2H 1RVFL 4CVZB 3R0NA 1FZKB 3I3BA 4I3RH 4JN2B 2MNUA 5I30H 1JUFB 4PJFE 4M7JL 1XCTA 4QGTA 4KK6C 4CW1A 2W92A 1FVEA 1KCKA 2DS4A 1ZT4A 4P2QB 1YYLH 5LKNA 1HNFA 4L1DA 5F9WB 5D2LA 3WL9A 1MAJA 4H0HB 5D6DA 2CIIB 1FH5H 5A3IC 4AH2B 4O9HL 4HD9A 3DMMC 3GB7A 4JVPA 1IGMH 3QCTH 4YDKL 3TVMD 1IC7L 2W9LA 4BZ1H 3T2NL 1K85A 3RJDA 2B20A 4OLVL 2FSEA 5LBSH 2HLFC 3FHAA 1DQMH 3LN5B 1HINL 1DBAL 1L9MA 5HHQA 4AL8H 5DD5L 3WD5H 4XVTL 2F5BL 3IDJA 5CGYD 3T08A 1EVUA 1HE7A 4GOSA 5I1AB 3STBA 1H15B 4NBZB 3SE3A 3GIZL 2D0HA 4ODTH 4APQA 5HI4D 2DQEL 1JPFB 3LD8B 2M1KA 1FO0A 5D93C 5IVXB 4G8GE 3U6RA 4ODWA 4XTRD 1LEIB 5E0QA 1SBBA 4PJIF 3RZCD 2YBRB 2DIAA 4Y16B 5IB4A 3BN9D 5FHBH 3QJHB 1OAQL 1FL3A 1M05A 2EXWC 3EOAB 3CXHJ 3EJZD 4NKDB 4EI6B 4LHJB 3VH8A 4ISVA 3EO0B 1MVUA 1MCNA 3MLYL 5DEFB 5FOBB 3J8F7 3S5LG 3E6FA 4LHUA 2N4IA 1T7XA 4WW2A 2RIKA 4B41A 4OLEA 1P2CA 4P9HC 3GKWL 3DHMA 2CDFB 5TJWK 1WTGT 1ZT4B 3SPVB 3M1BB 4HAFA 5EU3A 4GKSA 1AD9B 5CD5D 3PQYE 3C5ZB 4PB9H 4NHUA 4HLZH 3WE6B 2CIIA 5J9PA 4QYOA 1S9WA 2OL3B 5GRJH 1HZHL 2JJUA 3VA6A 1LO0L 2W0PA 5DXWA 3B6SB 4LOUC 5IV2B 1I8KB 2J6EH 4ZS7L 4G7YH 2FSEB 1KJVB 2IFGA 5EO9B 4OCWL 4P5TB 4DUVA 2YD5A 1FGVL 1FHGA 4J3WA 4LSQL 1A2YA 3NA9L 5I1AA 2VQ1A 3SGEH 5EBWA 1OAUL 4R2GB 5I16B 3OWEA 1CFVL 3SDAD 4U0QB 2AERT 2ADGB 5ACZB 3X14A 3T77A 4M4RA 3ARXA 4EUPB 4RBPH 5D1QC 2IALA 5FKPB 4NC0B 4PLKD 4M62H 4AIZB 5I8KH 5J0BA 1WFUA 5HYIA 2X4NB 2ED9A 5I8CA 2BVUA 1ZK9A 5D7LB 3UEZA 4MA3B 4PRDB 4U1NB 1N6QH 4U0RB 4OFYD 2AABL 5D7IE 4HUXA 3L5JA 5AD0B 3HI5L 4ALAL 2VZTA 2H26A 5IROA 4I3SL 3HZVB 1NL0L 3UMTA 2JJTC 1W2KT 2V7NA 1QHPA 1NFDF 3DSFL 3VFUA 4JE4B 4ETYA 1DBBL 5ETUA 5E7FA 1DL7L 4NQVA 5EUOA 3VA2C 2FEDC 3I3EA 1MWAB 3HRPA 2FX7L 4I1NB 1CFTB 1I9EA 2W38A 1E4KC 5HJ3A 3Q6FB 4NKMA 4X6CA 1KB9K 1FC2D 5JR1H 4RMSA 1ND0B 4WI9A 5ADOH 4F7PA 4KUCD 4G9FD 5T3ZD 5AAMA 4DOHB 4LEXL 2YA1A 1IM3B 4Y19A 5CJXC 3P77A 2ZNWA 5IFJA 3KPQA 4XC1L 1KV3A 5DMIL 5FM5M 4ZTPH 3AS2A 3C08L 1FIGH 4PY8I 4XVUD 1S3KL 3H8NA 5H94B 3O6KL 1IAOB 4NNXB 5C9JB 4DUWA 3GK8H 4LCIH 1OW0A 3BIKB 4R0LA 1OM3H 2ILLA 2VDLL 1JJUA 4QRQA 2IALB 5FKPA 2DQIL 4PJEF 4KKCD 3DX6B 1U91B 2APTA 3LN9A 1JI1A 2XZCH 2A83A 5C08E 1B6UA 4MA8H 2BC4B 2R2CA 1RUAL 5IOPB 5CBAA 3W2DL 2IAND 4AK1A 4ZFFB 5I8OH 3AVEA 3PGDB 1EHXA 3G04B 1V3JA 4ONOA 4M3JA 4G9DB 1AO7A 2F8VA 4WY7L 5K59F 3UTTE 4MVBD 4FOMA 3V7AG 3MRDB 3O3EB 1G9MH 3DBXB 3TPKA 5HVHB 1GGBL 3CXHK 4Y4FB 4M6ML 2Q3ZA 1CE1L 3LS5L 4OGXH 4NKQB 3QJFB 3O3UN 1I7UA 1GXEA 5CMAB 2HJKA 2F5BH 5LAXB 1T66C 4UV4H 5BRZE 2FECL 4OAWB 5KW9H 4M7JH 2DL2A 5C09B 3QEGL 1DQJB 5T3XL 3V4PL 3RA7L 1IEAA 2Q76B 3QCVH 4R96A 2Z91A 5CKAA 5JPMA 5D7SL 2ZUUA 4IRSD 4QCIB 4X7SH 2R0LH 4HJ0C 4IRZL 3VDCA 1YECL 2EZ0D 3F65A 1OTSC 1N59B 1PFCA 1YPZE 1NJ9A 3O6FB 3P77B 5DR5L 4KQ4H 2NY1D 3MLVL 4P57A 4QXUH 3UZEA 4JDZA 3QUMA 1DE4B 2J1KA 4QHKI 4WO4A 5F7EH 2HRPH 4J3TA 4DOHE 2R1WA 4KKBD 1CTNA 3RWFA 1VKXB 5EH1A 2OJEB 2W91A 4KJPD 5CP3H 3AXLB 3IYLW 1A7OH 2AJXH 3N06B 5DT1H 4DW2H 3IFLL 1BD2D 5DC4B 2X4PA 2H9GA 5E2VH 3H3KA 4WTZA 3HRZA 1KIQA 1BBJA 3S7GA 4OUUB 4UV4L 4BZ2L 4LPTA 3HE6D 3I9GH 5FO7A 4MNQD 4PLJD 3KPRD 3Q5TA 3WS3B 5KJRL 3PP3K 3K2UH 3B5TA 3MGOB 1UJTA 4UNTA 5AZ2H 1DBKL 4LLDA 4QRPB 3R06B 5D7IF 2F15A 3ROOB 3IDMA 5BVPH 3DPBA 4J6RH 5IB2A 2BVEA 1IC4L 3P2TA 3QXAA 1N64L 4OAWA 2PUQT 4Q9QL 5C09A 4YR6B 3EDFA 4MDJB 4J1UB 1U8JB 3FT4B 5HGAB 5HGHA 1WEJH 5JPMB 3MV9E 3GHEL 3KPSB 4GFTB 3RTQC 3JWOH 3OBAA 3DROA 1P1ZB 4IRJA 1PJ9A 3MV11 4X6EB 3BMWA 4J3VA 2P43B 1KBGL 3LEXB 1UFUA 5TF1H 2JELL 2NPLX 8CGTA 2O5ZL 3U4BL 4PGZA 1N0LA 5IVXF 3QO1A 1M7IA 3C6SA 1A3LH 5JDSA 5BXFB 3QIWC 2XA3A 5L2KB 4TSAL 2WANA 1W0YT 2HP4A 1OTUC 4UTBL 3HI6L 3ZL4H 2R1YB 3LRHA 4NYLB 2B4CH 5C7XH 4F58H 5BJTA 3WN5B 4DVRH 1MFAH 4HIXL 3VFNA 1SVCP 2BCKA 1DDHA 5K9KA 3T0ED 1T3FA 3AXLA 4K7PL 1H3UA 4PGCA 5I1LA 2Q86A 2XFXA 2FBJL 2MQ0A 5SX4I 3SO3C 3SDCB 4NBYB 3TA3D 4IMKC 1HH9B 4MB5A 5T1KB 3U7YL 5BVJA 1OD9A 3QG6B 2CLRA 3KXFE 5H37H 4OFDA 4N0RA 3VXSB 4UIMA 4XPFH 3HPLB 1CWVA 1S9VB 1AQDA 1N5AB 1KT2A 2ZKHH 5FO7B 1UH2A 2FATH 1OPGL 1GHFL 4WHTA 5I17B 1F4HA 3MLWL 1MUJA 4J2XA 5FF6A 1HSBA 2CQVA 1MNUH 4ZTPL 1SJVA 4YC2B 3R06A 3ARSA 5C0BE 1FPTH 2IGFL 3N1FC 1FNEA 2NY2B 4ZO7A 4JRYB 2NY5H 3LPGA 4KRPD 5IBTL 1LO5A 1WAAA 3P9LB 1MJ7L 4YR6A 2VDNL 4JFPB 3QPQC 4O9HH 1VERA 4FQIL 2DLHA 1QFOA 3EYUL 1T7VA 1A9BA 4RAUA 2VDPH 1K8DB 1MHEB 1C08A 4P3DA 4H0IA 5GGSA 5KVFL 3VD5A 1ZHKA 3FQUB 3MODL 1J8HA 3JWNC 2VDRL 4HC1A 3C2AH 2NX5A 1Q72L 3LEXA 3ALWA 2MTPA 2M2DA 5EBGA 3LQMA 4HQQH 4PJCB 5ERWA 2E8YA 1I3GH 2FHCA 4UQ2B 2WW8A 4UDUA 1A7BA 4JFEB 4V1DE 3BKMH 4R4FL 4HGMA 2B7DT 1RURL 3CX2A 4HH9A 3WN5A 4C4KO 1HXYA 3KYAA 2GAZA 3QUZD 3PWNB 3WLBA 3BZ4B 3D9AL 3GSXB 3SDCA 5BVJB 4PJ9C 2DQDL 2WIIB 4WFFD 1PZ5B 1JIBA 3NFPA 5EC1A 3FQXB 1EIBA 3GUTA 5DHYA 4GW5B 4JHZA 3V6OE 1FFPB 2CO7B 1E6OH 4M6AA 1B88A 4WI4A 1F02I 1LO3L 4MNHB 4JKWA 5FO9A 4JKLA 1Q8MA 1DVFA 1ZTXH 1DUZA 3AC0A 5EUOF 4JFFA 1W8NA 5KSBE 3BEVB 4NQSA 2CUIA 2FJFB 4KTEL 1DBMH 3VXRE 1HDMA 1P7KA 3D0VB 2I26N 1ADQH 3B9VA 1JRHH 2OJZL 5D1XD 4GAGL 5DJAA 4LLMB 2EDQA 2C1PB 5H2BB 2QQQA 1G9MC 2VXVH 1IAKB 1FSKB 2CIKB 4JZNB 1MIEH 4KY1H 1XF3B 4NQED 4FQXA 3JTSB 3F7YA 2VLKD 4AENB 1YEDB 2VAAB 4ZSOA 1NGQH 3BQUD 3LS4L 1JMZA 1YPZB 4LSQH 5E4IA 1HHKA 2Z4QB 3TN0D 3KR3H 4UQ2A 4Z8FH 5HHOD 4WTWA 4DWHA 1A7RL 3HE7C 3C2SA 4HMCA 2RGSA 3LV3B 3MYZA 1RSFA 3DX8B 3RVWD 2A6IB 2X1PA 2BX5A 2QADC 5FV1L 1IAIM 5EU6E 1BAFH 3S88H 1U8LB 1KCVH 2BSRA 4J7RA 2GITB 4WTXA 2EH7H 5BQ7A 3IU4L 5JHDA 4G9FE 3UTSD 3HN3A 4ZD3L 3IDGA 1KPVB 3BP5B 4O2EB 4KTDL 3HUJA 5DHYB 1OT2A 4EI5C 5KVGH 2NY1B 4Y5YA 3PL6D 3MUGB 4YGVB 1JV5B 1U41A 3CMGA 3VXOB 3MMEA 3UTPE 4WV1A 4Y8AA 5IIEB 3SCMD 2O5ZH 2EEAA 3P4LA 3RRQA 2DM4A 4JHWH 3BEVA 2LAAA 4NQSB 3MV8E 3TWCH 4MXVE 3IVKA 4FQ2H 5HGBA 4QXTA 4MX7B 4DN3L 3CVHH 4OZFA 2YSSA 1H3PH 4U1LB 1QTYT 2P8MB 2RFXB 1H5BA 3AU1B 5E2JA 5BV7C 3HZYA 4Y4KB 1SEBB 2DD8H 2L4OA 1E0OB 4PRHE 1NUFA 3MRMB 4FQXB 2A74A 5D1ZD 4POZD 3VXRB 3FFCD 3QXDB 3QULB 1QVOA 4G8FA 1DN2A 1MCRA 4PJIA 5GS2D 1I1AA 3L95A 5C92A 3QAZC 4RAVA 5FFLA 1M7DB 5FOJA 1QA9B 3ARDC 1OM3L 2VH5H 4L4TD 3D3VE 1JYWA 1CICD 4XNYH 4XPAL 4FQCL 3EHBC 1SVZA 1NDMA 5FYJD 3PIQB 5C0AD 3SKUD 4F7EB 3L7EA 5IQ7L 5FYLE 1GYAA 1IL1B 3EO9H 3T1FA 3ZLQC 1XR8B 4HZAA 4CN1A 1KJ2H 2VDNH 2XN9B 2Y5TB 5E8PA 4L4JA 3GO1H 4P46A 1XGTA 1KELL 3C9NB 1X5AA 1WZ1L 5L6YL 4Z76A 3TWCL 3VRIB 3MROA 4K71B 3MMEB 4G9FB 3QO0A 1JGDA 3VXMB 1DN0A 3V6ZB 1YN7B 3ARFC 3RL1A 2G5BA 2FATL 4QRSB 1A9EA 4GG6B 4ZOBA 5I8KL 2GTZB 5CZXC 3RY6A 3PABA 5IHBA 1JBJA 1MCCA 4FQXC 3V95A 4BFGA 5ACMA 1TQCB 3MXVL 2IPUG 4LCWA 2EDKA 4PJDF 1FO0H 3DVIA 3MV9A 1RUQL 1XH3A 4F8TA 4CNIA 5I1GH 4ZFZB 2R2EA 3KJ4C 1VACB 1MCIA 5JW4M 1G9EA 3ZHDA 1C1EL 4P9HL 5J11B 4UIKL 3V8OA 3T3ME 3VD3A 3ZT5A 4ONGH 2BOBA 4OD3H 4M93C 4DGYL 2A1WH 1BQHB 1Q9KB 5J6GA 2X9XA 3KNBA 1RJZA 5C6TL 4KFZC 5C0DA 1T22A 1R5VB 3PQYB 4MNGA 4GG6F 4PJCF 3NCCB 1MVFA 1D7FA 3K74B 3PHOB 3FQWB 5T1DL 5DLMH 4PJ5E 4KVNL 4NN6B 4KAQH 2A38A 1EGJH 1CLZL 3S34H 2AAVA 2HA1A 3ULVD 5J8OA 2JLLA 2IBGA 1FDLL 4YQXH 5IMLB 3L7FA 1WFTA 1L0YA 1RK0B 1O7VA 4KGJA 3HE7B 4Q6IB 4JY5H 4PJ8C 2OL3L 4L5FH 5IMKA 3OXRB 3TPUA 5HHOB 4JFYB 1DVFC 1CICC 4F3FB 2DQIH 3MACH 1LK2A 3G6DL 2I27N 4X99A 4OZIB 3D5OF 2ORBL 3C6LB 2WQRA 3FONB 4U2ZA 4FTVD 1KB9J 3RUGF 5A43C 1KIRB 2HYMA 2V5TA 4X4ME 3MJ7B 4RZCB 5DJZB 5TFSL 3KWWA 4X80H 3B5GA 2Z31D 2QV2A 2XKUA 5ISZA 2PXYC 1V8HA 2EYTB 2OYPA 4U1SB 2Z0BA 4NUGL 3ZE2E 4NWTL 4S1QH 2WBKA 3MOAL 1KGCE 5GXBB 4LSTH 3ULUC 1B0WA 1OWRM 4JFZH 4K9EH 1V7NL 2YD2A 2HFGH 2ZOKB 4GS7C 3WNNA 1XGUA 1UXWB 4P2OD 1NAMA 5GGQH 2QSCH 3ZYIA 3SGJC 1A6AA 1ORSA 4JG0H 2BVYA 3DO7A 4V2CB 4Q9BA 1S7XB 4HK0A 3W82A 3EDKA 4E42A 3UTSB 1YQ2A 2COQA 2R29H 5FYKD 1TIUA 3NIFF 5TDNA 1E4JA 1HHIB 32C2A 2YS4A 4G8IB 1ETZB 1FAKT 2DI8A 4L4TA 2I07B 4JRXB 1Q9LA 5FUOH 1F6AB 2EDHA 1CDBA 5SWSA 4DAGH 2CRYA 4N8VG 5ICYB 3FRUB 3F5WB 4OZ4B 4ERSH 4NQTA 5D1ZA 2VLKB 4UBDD 1IILE 3OKKB 2NXZD 1WBXB 1J05A 3EYUH 2YD3A 3KS0J 1V7NH 1ACYL 5DK0B 1AJ7L 3ARBC 3MUHL 1S5HB 3MLRH 1H5BC 2BVOA 4D0DA 3F7RA 1I1YB 4C58B 5IW1A 4Q0XL 3HMXH 3K0WA 4KK5C 4CDGC 1U8IA 3GBNH 3IDXL 5T5FL 2DD8L 1MRDL 4D0CB 4CRPA 5D7JC 5CJQH 1TZHB 1X3DA 4L9LC 3MRCB 4PBXA 1P7QB 3PNWA 4NQXA 3QIBD 3SCMA 4HIHB 5E5UB 4PGBA 1MFEH 2GJ6B 4L4VE 4E0RB 1SYSB 1DLFL 4WJ5B 1BD2E 2QQLL 3IJSA 3U82B 2Q7YB 5FM8A 1OAZH 4LSVL 1A5FL 3VXSD 3U9PH 2VQTA 3UTSA 2IPKB 1U8PA 1XF5A 5JQHC 4M43L 1UB5A 1QD0A 5EUKB 1FYTB 1CZ8H 2V2WA 1IGCH 1Y6KR 2R4RH 4KMLB 4LU5H 4OKVB 2PXYD 2VWEC 1DBBH 4CADA 4M8VA 5GGVL 1HSAB 1DL7H 1A3LL 2CO6B 3IXTB 3RDTB 1MCOH 3ZTJG 2WUCH 5FYKU 4JFED 4PJIE 5IEKA 1CD1A 4CGTA 1IGYB 1T89C 3GSNA 4RFEA 2DWEB 3EYVA 4AM0A 4QF1A 4HUUB 1PYWB 1F42A 3TBTA 5ADOL 3LKSA 4H25A 1HILB 2A9MH 4OZ4A 3T0XA 2AEPL 1WBXA 1QSFD 2IH3A 5TE7H 5ENWA 3H9SE 5F6HI 2VOTA 1N4XH 4P2QA 4DKFL 1QSFB 5J1TC 1UGNA 4Q58C 4RRPA 1KIPA 4WCYL 4FFZL 3G5VA 2Z35B 2JJVA 3ZE1F 3D25B 3WFHA 2GJZA 4JFFD 1OAQH 3RVVC 1TTUA 1CCZA 1DQLH 3UX9B 2WWMD 3BN3B 4MQ7B 4MJ4A 4MJ6B 3VI3E 1UKQA 2VLRB 3H9HB 1FV1B 2WZPD 3MCLL 3O4LD 3QUXB 4E0RA 3QISA 2IF7A 5J3HD 5JQ6L 3PXHA 1JWUB 1CGSL 4M9OA 3MRFA 5F21B 3HMWH 1QLEH 5DGRA 5MERB 3MCG1 1XGPA 3NFNA 4FG6C 2OK0L 1YY8B 1JN6A 1FO0B 1NLDH 4KVCH 3EFDL 2P8PB 5EOTA 1QQDB 1NCNA 4JO1L 3OKEB 4NZDA 4Y16A 4XNXL 5IB4B 5GZOC 2XWJB 1FL3B 1RZFL 3E3QE 4K3GA 4YZFE 2BRQA 5GS2H 4WFED 2H2PD 3QIBB 4Q9RL 1CD1B 5E00B 3WXVH 3VU2A 4FQJH 1RHFA 1MVUB 4HUUA 4Y2OA 1BZ9B 3ZE2F 5MENE 4R7DB 3IT8D 3IDIA 1FZJA 2IADB 5HHQB 1J8HD 1CGUA 3ZTJH 5IBUB 4BSVB 3SPVA 2PYEB 3M1BA 2K3TA 4NZUH 4RWYH 2EDTA 3ARVA 4DK6A 3G6AB 3LSOA 3CCHA 1JPFA 5FCSH 5KS9B 2HG5A 2Z35A 3CLFH 4XBGB 4ODWB 2G75A 2J7LA 3OKYA 3KXFB 3V4UL 2D31B 1EK3A 12E8H 3TESA 3QJHA 2XG4A 3OQ3B 3S5LA 1WK0A 2OP4H 3CSBA 1PBYA 3H7BB 4KVCL 5KS9F 3RIAK 1KCUH 1JGVH 4XP1H 1RZIA 5FIEA 4M5ZH 3BKJL 3QIUD 1J12A 1MEXL 1JRHL 4GRMA 3NAAH 1P2CB 3NIDF 3IDYB 3TA3A 4RMVA 1A1OB 4NQCD 5B38A 4P2RE 4I18A 2OR8A 4X5WB 1ZVYA 5ESQA 1IM9D 1JWMB 5HTSA 1T20B 4HV8A 4TPRL 1B2WH 1MCWM 2D9QB 5HPOA 2UY6A 4XRCB 5JUEH 5KTEH 3IDNB 2ZWLT 2D7OA 5MEOB 3OF6A 4MD4A 1T2QL 3RWDA 2VLJE 1S9WB 5HD8D 3W0WE 4WVRA 2J8UB 5KN5A 4LVHC 2ED8A 3ULUE 1VFUA 1NFIB 1WZMA 4D0BA 1BZ9A 3QDGA 2O5XL 4NM8L 2Z31B 5EBLB 3K2UL 1T5XA 3U7WL 2F53D 5EZIL 4IRJD 3VRJA 2OZ4A 5DJYA 5EBWB 4K94C 1ZA6B 5EUOB 4XVJH 1IQWL 3T77B 4EUPA 2CDGB 1OD7A 1I1FA 4UB0H 3V5KB 1CFTA 1OSPL 1YEKH 4UQ3B 5IB5A 1P5VA 1WFOA 5IB3A 2AJYH 1LHZA 4KDTC 3TJHC 1YC8A 4HS6A 4U1NA 5DVLA 4MAYA 3QDMA 1NEZG 5HGDB 4KKBC 3QIWB 4NIKB 5HHVH 4MNQA 2FGWH 1I8LA 1K4CB 3HE6A 4U1MB 2IBBA 4Z78A 5H94A 1KYOK 3RVVD 4CU6A 1H3PL 3MBXL 2D9CA 2V7NB 2A6DB 3GNML 4OD1L 1LE5B 5D2LF 4GBXB 2XYCA 2P48B 5HXMA 4PJAE 5E8DH 3L5WB 1MJ8L 1WJ3A 1T20A 4HV8B 3L3OA 3JV6B 5AG8A 1N7MH 1YN6A 5TGBA 1WWWX 5HYFA 4UI2A 5IOPA 5FYLH 4O00A 4MD4B 4AMKL 4B5EA 2FIKB 3ZDZF 4IRZH 3D6GA 4M03A 5GRWA 4WO4D 1ZHBA 3UDWA 5JZ7C 1F90L 5CHNB 1IAIL 2JE8A 3RBSA 2DDQH 4XPBH 3TF7C 4GMTH 4MGXA 3K8LA 4ELME 3NABL 5CINL 1NCAL 4LP4A 4U6HA 5TH2A 1U8QB 4PJEB 4E41E 3KG5A 4NDMB 1M6OA 1RUAH 1QEWB 4RMTA 2VXTL 1WC7B 4HUKB 2UUDK 2XY1A 4C83A 4HEME 4FZEH 4JREB 2MCG1 1DQJA 4XWOD 4Y5YC 1N4XL 5BOPA 2RHEA 3MCKA 4JHAL 4WY7H 1T1YB 2ATPA 2VIRB 2XTJE 3VFRB 3EJYC 5FA3B 3QZWB 1G7HA 4Z7OF 4ZPTB 1VPOL 1D5XB 3T4YA 4HS6B 4MAYB 5AUMB 3AB0B 3C8HA 1Z3GL 3RX8A 5CEXA 4G9DA 1KXVC 4YX2H 2A6JA 3R1GL 4YDLC 3LEVL 1XT5A 1BHGA 4LPYA 4BUGA 1WBZB 1AI1H 3AS3A 3TJEH 2YWYA 4JQXA 1CYGA 4L3AA 3JTTB 1DTUA 1F2XK 1A6TB 4I0CC 3FB8A 5DJDB 4AJ0A 5LAXA 1F4AA 5MHSD 1LO3H 5E99H 5FUCC 1FNGB 2OK0H 3RZCB 5I2IB 3OB0H 1XZ0A 3VXQB 2OMBA 2Q76A 5E6IB 4AEEA 5IR1A 3V6BR 3EOTH 5ACLA 4CBPA 2YK1L 4OUUA 5HI5C 5GS3A 3UPCA 4HEPG 3FFCB 4Q9RH 5HVHC 4ZD3H 3VXRD 5DHVA 4ORGB 5F9DC 1U2CA 4JDZB 3S37X 1CDJA 2E27H 3WIHH 4OLZL 1BLNB 4CVWA 4LCYB 3LKQA 4Z7QE 2VDKH 2RB8A 4YFLF 1TJHH 1BX2A 3H0TB 1GGUA 3QXAB 2A73A 1QRKA 3T0WA 2VDQH 1RZJC 3KXFD 5LCVL 3HS0A 4X8JA 5I66B 5KSUA 4PJEE 5CUSL 5DWUL 1ZGLA 2B1HH 4YE4H 3P11L 1LEKA 5F70A 2B0SL 3SDYH 3SGKA 1HKLL 3PL6B 4PJGF 5A40E 4P0DA 3MA7A 3N1PC 4YO0A 1ZGLP 4P5TC 1SY6L 2CLVB 4KRNA 5E9DD 1A14L 4OI9A 3V6FB 4M5ZL 4OFYA 5E1AB 1UWGH 3H9SB 4Z7OE 1QSFE 3NMEA 3IDMB 2W65A 4F33A 5K9KB 1IEHA 3P9MA 3QNZA 3DV4B 4Z0XB 2NW2B 4PPTA 3TCXA 4JFHE 4I0PC 1U8HA 3SDAA 2UY7A 4PJHA 2IFFH 5HGHB 5KTEL 3SDAC 4XNYL 4XPAH 4TSCL 5DMJB 5C6TH 1OP3K 1NC4A 3GJEB 3RWJB 1C5DB 4IRJB 1CDHA 1PLGL 4JM4L 3KPNB 4KROC 2R0KH 1G7IB 1KT2B 4NOFA 3DXAA 4D9RE 1ZEAL 2DQJL 2ITCA 3EDEA 2XZQL 4NQEB 2BSED 1LD9B 2VKXA 2VLRD 3BH8B 3RNKA 5BXFA 5JDSB 3OX8B 2O5XH 1LE9A 4APQC 3ULVH 3CFKB 1UVQA 3W81A 4EVNA 1CBVH 3BPCA 4OCWH 4J4PC 4OLXL 1QSEA 3REVB 1XGRB 2V2XA 1B0GB 3MRRA 5EFIB 6FABL 3VWKC 5BO1H 1T6VN 3LZFH 4HWBL 4PGCB 3STLB 1EZVX 5CS7A 1T80A 4ACPA 4QNPE 1QACA 5F1KC 1UB6B 3L5XH 3WO4B 2EEDA 1ORQB 1A6WH 1KPUB 3G5ZB 5TPWL 3TZVD 1UJ3A 2J8OA 5IKCA 2AGJH 3EO9L 4WFGE 5ALCH 1BIIB 1N5AA 5C2BL 3P73A 1MI5B 5J06A 2PO6C 1MJ7H 3QZWG 5GRXG 1NGXA 4OT1L 3HFML 3P0GB 2V5SA 2KH2B 3Q48A 1JNNL 4HAGA 3NGBB 5F1OB 3WHXA 3LKPA 3FB5B 2OSLA 3TH3T 3NCJH 4LASL 1PDKA 3K81A 3CFDA 4QHUB 4XZUB 5I9QC 4HJ0D 4LEOB 4PJHB 5BZDB 1R24B 4XBPA 5DJCB 3FHQA 2F74A 3MRQB 3FQXA 3GJEA 3RWJA 1C5DA 1BFVH 2JJTA 3RBGA 3BW9A 3FQUA 4Z7NF 3G9VA 5J6HA 1A6VH 2CKBL 4N9OB 2Y07L 1MREL 5BZWB 4YJZL 4XMKL 3PE9A 2MCPH 2YRLA 1RMFH 1A5FH 2DIBA 3MJ6A 4RRPG 1U58B 3B9KB 4BFIA 1CLCA 5TE6H 3RAJL 5F9AC 1CLZH 3JBG7 4OV5A 3VW3L 5E7BA 3FQRA 2NY7H 1MFNA 1P4LB 2VL4A 5CLTA 2VDMH 5EU4B 1YUHA 3DECA 3IRPX 5FUZH 2YMXH 5L0QB 5C2BH 3T2NH 5ID0A 4JPIA 5D2NC 1TZGH 3QHZH 2WV3A 1IAKA