4YDJA

Crystal structure of broadly and potently neutralizing antibody 44-vrc13.01 in complex with hiv-1 clade ae strain 93th057 gp120
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
238
structure length
238
Chain Sequence
b'QVQLVQPGTAMKSLGSSLTITCRVSGDDLGSFHFGTYFMIWVRQAPGQGLEYMGGILPSTKTPTYAHKFRGRVSISAPGVPPVLSLALTNLTYDDTATYFCARERGRHFEPKNRDNLEGKFFDLWGRGTFVRVSPASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein gp160,Envelope glycoprotein gp160
publication title Structural Repertoire of HIV-1-Neutralizing Antibodies Targeting the CD4 Supersite in 14 Donors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system
total genus 32
structure length 238
sequence length 238
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ydjA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ydjA01
1OAKL 2CSPA 4PGCB 1H5BC 3JTSB 1GJIA 4XPAH 3QIBB 4GRLC 5SX4I 4G3YL 4LVHC 1N5YL 1Q0XL 2COQA 1Q9LA 4TUJB 1I3GH 1NGWB 3GMMA 3K2UL 2HH0H 4BH7B 1Z9LA 4YDVB 5ANMA 4JM2F 3QPXL 3Q1SH 3WNOA 3VXMB 4L5FL 4UZGA 4HX1B 5FEBA 3BIAX 3RGHA 5CS7A 5DQ9B 2V7HB 5ICXB 3ZLQC 2NW3B 4LEXH 1J87A 5IW3A 1DLHA 1HYSD 2FEDC 1OPGL 5AEAA 3AS3A 3QR2A 4M7LL 2X5PA 1YY9C 3TF7C 2NY5L 3KYOB 2MPAH 3CVHA 1FVDB 4O58L 1S5HA 1ZHBA 4JAMB 3T1FA 1EEUA 1KCRH 1WEJL 1P9MC 3NFNB 3KNBA 5L0QC 1EUUA 1CE6A 1FGNL 1BJ1H 4R97C 1AGEA 1P2CA 3KHQA 3H3KA 4KJYA 4RGMB 2E7MA 3H7BA 1YYLL 4I18C 1C5CL 5E2WL 3D39E 2BVOA 5K9OA 1S7RB 3HNSL 4YH6A 1HH6A 4Z8FL 4LPUA 4NQVA 3SQOL 2Z35B 4D8PA 5D1ZA 4UDUA 4XP4L 3NTCH 5ERWB 4M3JA 1MFBL 3P73A 1QG3A 4WW2F 1CFQB 4FTVB 3X12B 3VWKD 4NQDB 1TNNA 2YUVA 3JWOL 5EBMB 1QSFA 4NYLA 3EO9H 2PCPB 3E6HA 4WENB 1CICB 5F71A 3X11A 3GIZH 4O2EB 4Y5VA 1DSFL 2VC2L 3OF6D 4E41A 3U46B 1ZHKA 5I2IA 2WUBH 3T0XA 2J5LC 4WHTB 1B4JH 5BV7L 3FOMB 5DJ0A 4PTUA 4I4WB 1DDHA 5C09B 1GGCH 2LVEA 4LCWB 3FB8A 4NOFA 3MREA 4YHYC 1MWAB 4HHAA 1T89C 1GZQA 5C0CE 2J88L 3TJHC 2EH8H 3BP7B 3AXLB 3S3JA 1XF4B 2DLEA 4XGZA 5CJXA 4JVPA 5DUML 1UM5L 1KN4H 1AO7B 3LV3B 3U4EB 1YN6A 1MF2L 3OZ9H 1L0XA 5HYQB 5D2LF 5D9SA 2B4CH 3S37H 4YFLF 3TESA 4ZXBD 3IYLW 3MYZA 5CSGA 3BP4B 2RR3A 5HI4C 2ESVA 1X4YA 4HIEA 4DJMA 1MI5B 3KPSB 4LBEA 4NNPL 3KPPB 3U9PL 5D72H 4QRRE 1XF2B 2P47B 2YA2A 5HYSB 3GI9H 4JKMA 2BK8A 3PWPA 1MJ7L 4NC2B 4X7SH 5D93C 5GRWA 4A2MA 2B5IC 1XF3A 3V0VA 1OAQL 2WBJD 1OT2A 4OIIL 1G7MB 3OQ3B 1JK8A 5GGSB 5D7JA 3SO5A 5MENB 1HIMH 3GMLA 3L5JA 4NDMB 3L9RA 3MLUH 4M02A 2EDOA 3LN4B 1E4WH 2XWJB 3O9WC 2GEEA 2VQ1B 5CUSL 3S34H 1U91A 2DIJA 3NCYP 2H3NB 2JJTA 2AERT 2R15A 4ELKA 4HKJB 2Q8AH 1L9NA 4U2YA 1F4HA 2M2DA 3ILQC 3VRLF 4AH2B 4UQ3A 5IBTL 3R06A 4QY8A 5D2LE 4X0KA 3D3VE 2I9TB 3AM8C 4XB7A 3JV4B 1CD8A 5F1IA 4JKPL 4XCFH 4PPTA 2L0DA 3MNVB 4YXHH 3UYPA 5JHDB 4OUUB 3ARQA 5GGVY 5BO1H 2VXTL 1JPSH 1IL1A 2VLRE 4NIKB 3RBSA 1MVUB 1JPST 1E6JL 2DWDA 5I15L 4JZOB 2CLVA 3DRTB 4Y4FC 5E56A 5E08H 4RQQB 1MLBB 1T2QH 4LL9A 4XXDB 3FO9A 4P5TD 3UYOD 3VW3L 3DTXB 2IALA 4OZIA 3ZL4L 1KN2L 3RUGF 2AABL 4P9ML 2WUCL 3DRQA 3HI5L 3D0VA 1URLA 4AMKL 4FFVD 3OAYH 5IM7A 5FDWA 4WHCA 1KENL 3MUY1 4OD1H 5DS8B 4GG8A 3NIGE 5A2FA 4FABL 4XC3L 2VXSH 1IMHC 1I1AC 1ORQA 3MBED 4X9BA 1KIQA 1Y18A 5E7FA 3FOLA 4GXUN 1RK0A 1UACH 2XNAB 3VU2A 2E9BA 4OV5B 2E27L 3NAAL 5F1KC 3AS2A 1L0YA 3ELAT 4M6NL 2XT1B 5CBAA 1MCCA 3WE6B 3VRLE 3MRFB 4PGZA 4J12A 2HN7A 3O4LB 3S4SB 1CE1H 1YEJL 4IEFB 4NQUA 5KSAB 3N9GL 1AD9A 4HUUB 4YHZL 2WWKO 4B7LA 3BUYB 4HEPG 1UVQA 4PJ9B 1M05B 4UV7H 3LD8C 4F7CA 4JE4B 1U8QA 4OLYH 3RVUC 2O5YL 4A6YA 2XV6B 4ENED 5IIEA 3F62A 4L9LC 2R1WA 3K46A 4M1DL 2Y9RT 3AREC 3BDBA 4JRYB 3JV5A 3GMMB 4WNQB 3TV3L 1FFPA 3HC3H 3LKNB 3PP4L 3HNTH 4OLZL 2DAVA 2R0LL 4XRCA 2XWTA 2B20A 5DJ8A 5CJOL 3AUVA 3QDJD 2KQMA 2QBWA 4P99A 5GZOD 2KDGA 4R4FL 1DLHB 1LMKA 1CXHA 3O2WL 3FQXA 1M6OB 1KPUA 4D0BA 3TVMA 5I1KL 4J6RH 4WU5B 4XHJC 3SGEI 3QISA 1YECH 4C57C 5KVMC 1ZHBB 4YHOL 3JWDH 1A6AA 1R3HA 5GRZA 4P2RB 1E28A 3SE8L 3FN0H 3MRNA 1DJSA 1J05B 4BSWA 1AGEB 1P2CB 1KB5A 1IGIH 5C0BD 3H7BB 4ERSH 1JYNA 1JUFA 2BVOB 3QFJE 4JPVL 2FHFA 1HH6B 2VZ3A 3BKYH 3DYPA 3TA3A 2FJGA 1MCOL 4D8PB 5D1ZB 4PJHB 1UQSB 2X9WA 4KUZL 1FSKC 5F89B 1G0DA 4DWHA 4M03A 1ZT4A 4JFFE 3ZTNL 1TTGA 4U1JA 3IF1B 5D96B 3RP1A 4M6AA 1AKJD 2VSCA 5MEQB 3ZSTA 3TH3T 5FGBC 4WFGD 4ZFZA 4D9LL 1BQSA 1IGCL 3MLVH 5ISZB 1ERNA 2AK4E 3H9SB 4NN7B 3VXNB 3F58L 4C56B 5B8CC 4GUPA 3MRDA 2QJDA 3D18B 4C54A 3OB0H 5D1XD 4G8GD 3LKOB 3HC4L 2CDGA 2R29H 3TYGL 4PJFA 4PTUB 4DZBA 4YFLI 1D5IL 5HYJB 1CDBA 5EU6D 2P5EE 4OAWA 1QBLL 2VN4A 3FB8B 4NKIL 1I7RA 5T1KB 3O45A 5EUKB 3BQUA 4HHAB 2ZNXA 4LIQH 4HIHB 2J3SA 1GZQB 2DD8L 4FMKA 1DQLH 3N85H 1T20A 3CXHK 1KGCD 5C0FA 2OJEA 3V5DB 5DJZB 4DOHE 5H2BA 3MUGA 1HDMB 3HHRB 1GGIH 4QRPE 1YN6B 3PUCA 4JFDE 4NSKA 3ZT6A 1R0AL 2EEDA 3SGJA 1YUHA 5J1AA 4UTBH 1JYWA 3OR7A 5JUEH 3D85A 3ZTJH 4HIEB 1ODAA 3V95A 1F3DJ 5F7NC 5I17B 4XTRD 2FBJH 3T3PF 1QHPA 1OAXL 3NA4A 3UXFA 4GS7C 1Q72L 4G9DA 3MRQB 2ADFL 5EBGA 2CKBB 3RVWD 4KKBD 5HGBA 2PO6D 1AY1L 1TCRA 3P77A 1ES0B 4S1SH 4XNYL 1XF3B 3FB5A 4HS6A 2XQBH 4K8RH 8CGTA 1AFVH 5LAXA 2CIIB 1JK8B 3S96A 1U92B 3KYNA 2A77H 1A7NL 5DFWH 5EOCJ 1B4RA 3HNVH 5GGVL 4LVEA 1V7ML 4XAWL 4H88H 5I8KL 3S36L 3UAJD 1OWWA 1AR2A 4OM0H 4M48L 4Y4KB 2DQEL 1U91B 1A7RL 1NGYB 3TC9A 5IW6A 1RJZA 2Y4SA 4NO0D 1KEMH 43CAA 3KYKH 1S3KH 4XI5D 4BM7A 4X0KB 3E2HC 3E6FA 2EKSA 1H0DA 2NLJB 4OFVA 3SDYL 4DN4H 4GBXD 1X7QA 3STBA 2DQHL 3A67L 4L8DB 4Q9QL 3QNYA 3UPRA 1IL1B 3C9NA 3T3PE 3ET9F 2ZG2A 1LK3H 2EIZA 1A6WH 1U8NA 4F7EB 1TQCC 1L7TH 3RL1A 3HPLB 1D5ZB 2HRPL 1A4KB 1RUAH 1LQSR 5GRXG 1UZ6F 3GUTA 5ITFB 1BFSA 3JWOC 3RY5A 1G7JA 4TRPH 2C3HA 5EULV 2ICWA 3IFOA 4IDJL 1LNUA 3ZKMC 3D9AL 3D0VB 5C71A 3QEQE 1QO3B 5GS0D 5IM7B 4TUOB 5B38B 1JTPA 2GFBA 4MAYC 3QDMD 4XCYA 3MZTA 4R96B 2FECL 4BZ2H 1NBVH 3VWJC 4JFEA 1O7SA 4LU5H 3BD4A 2Q3AA 2HFEB 3RI5K 3MO1A 2EDHA 3EOBA 1K2DB 5HI5D 3KLDA 5IFHL 4HH9A 1UJ3A 3AY4C 3DXAA 2DLFH 4MJIA 1QPXA 4OKVB 5BV7C 3TO4C 5IG7A 2Y5TA 5CBAB 4ZFOB 7CGTA 1PYWA 1BZQK 3RA7H 4PJ8A 4EBQL 1Z0NA 1SM3H 4Y4HD 4GSDH 1JWUB 1A3RH 3V7MA 3R8QA 4OD2A 3UDWC 5HXMA 2OJZH 2D4FA 2YPLD 3VXUA 2F58H 1DP0A 1F90H 4N8VA 1PVHA 5I1JH 2Y7QB 1FPTL 3DBXB 4PR5A 1I1YA 2GT9A 1TZIA 1UVQB 3F12B 4PJEF 5C08A 1II4E 5EUOE 3BDYH 4OCRH 2A6JB 1YNLL 5E1HB 3INUL 5D70L 1CXLA 4G5ZH 4OGAD 1N6VA 2CLZB 1F42A 3IFNL 4FXKB 4HIIA 2FO4A 3TBSA 1WFTA 5GIRA 1T4KB 3EOYG 4G6JL 3IDJA 1CIDA 3I75A 3O2DL 5IVXF 5IB3A 2R1WB 5I0ZA 1S78C 2C3WA 1I7ZB 1MFCH 5GJSL 3VFGH 3NABH 1GCFA 5E1AA 4XRCB 4O9HH 1RZKL 1KIRA 6CGTA 2I26N 2VL5B 2EYSB 5E2VL 4YXKH 2G2RA 2MQ0A 4RDQF 1PLGL 4AIZA 1KCSH 5E6YA 1LWRA 2ORBL 1BJMA 5CZVH 3WD5H 1BJ1J 3P4MA 3UJJL 4WGWB 3VXRB 3WUWA 4D0BB 2L7UA 4HSQA 2QTEA 4JRWA 4L8BA 4PRDB 5EZIL 4EQ2A 1I4FA 3UPCA 4D0DA 2V2TA 4D9QE 1I1FB 1T04A 3MLRL 5D71L 3KJ6L 4R7DB 3O3BA 1A6AB 5HHOD 4JPKL 1CDIA 1R3HB 5H37G 5LCVH 3O3AA 3P4NB 3MRNB 4XH2B 1GOFA 3RJQB 4BSWB 4F2MA 2GJZB 4NZRL 1JUFB 3D3VB 4G43B 4M43L 3QO1A 2FRGP 3G6AB 2VAJA 3HZYB 4PJEE 15C8L 4ZS7L 5JIHA 3TA3B 3KPMA 1ZGLB 2C4FU 3LEXA 3DV6B 3RGVC 2BSED 3PDDA 1WAAA 1EV2E 2D9CA 3OKDB 3V4UL 1N8ZB 2N4IA 2NY3B 5SX5K 3BJ91 3PWNB 3WHXA 4MD0A 3W0WB 3Q6FB 5GS2H 1PY4A 5FFLA 1LEKA 1T83C 3O6MH 1K8IA 5E00A 1JBJA 1TJIH 4ZYKA 3KDMA 1GHFH 5J56B 1ZA3B 3MOAL 1XGQB 3VFTA 1YEEH 4GUPB 3HMXH 4QHNA 1NBZA 3CIQA 3RI5F 4MNGE 5IB4A 5IB1A 2PF6A 4I77H 1BFVL 5FA4A 2PXYC 3CMGA 4MXQD 4OAWB 4GW4B 4X4XA 1I7RB 4WWKB 3O45B 3RWCB 1JHLH 1V3KA 5HPMA 3TLRA 1JP5A 4AEFA 3V6OA 3AROA 3QUKB 3WHE1 5I9QB 3UBXA 1JNJA 5E2JA 3MUGB 1DEEB 2KQNA 3VXSA 3Q5YA 1CTOA 4OZFH 2AEPL 4UBDC 5DT1H 4KY1L 1EIBA 2V2WA 4NSKB 4R3SA 4TYUA 1YUHB 1FP5A 2EH7H 3DYOA 4WDIB 5DFVC 3VFNA 2GJJA 4OD3L 1NL0L 2VQUA 5J1AB 4LVOB 3AGVA 4JR9H 1F3JB 5BS0B 4UNVA 5A3ID 1UWXH 1AGBA 5AG8A 1GAFH 1ZHNA 3VGDA 1RQ5A 4MA1C 4PB9L 5DXWA 4CMHB 3RFZC 5CILL 1SYVA 5HHQA 4KKCD 2DM2A 1RPQA 4H8WL 2BSTA 3QXWA 3IETB 4P0DA 1NJ9B 3K74B 5IMMB 5E99L 5GPRA 1Z3GL 2VTFA 4H25A 5HGBB 3PDOB 3P77B 3S8WA 3NBNA 2OL3A 32C2A 2BNRD 3MV9B 3HMXA 1CGVA 3T0EA 5DZLA 4KRNA 5DF0A 5ICYB 3KYNB 4Y5XB 3HZKA 3WKMH 1TXKA 4PBXA 2VIRA 2C1PB 1QA9A 5F9WB 4WFED 4LDLB 2AJSL 3SGKC 3W9EB 4JN1L 5J11C 2MOVA 1S9XB 3HG1E 3KPLA 1ITCA 3CCHA 5JW4Q 1ZA6A 3QBTB 4FQIL 5FGRA 2F54D 4F8QA 1RJZB 4R0LC 1RU9L 1OAUL 2XTJD 3UTZA 4YHIA 1JIBA 3QFJB 4OZFA 4Q0XL 2XZCH 3EJZD 4DAGL 1QLRB 3E6FB 2YN3A 1HHJA 4JM4L 1FNGA 1D6EB 4NZTH 3H0TB 1OGAB 1U3YA 5FYLE 4JO2L 2AEQH 1IGYB 2D0HA 3B83A 1QBML 3GO1H 3ULSA 3V4PH 2OR9L 4LCUA 1G6VK 2BJMH 2ENYA 3DSFH 5MEPB 4GRWH 1YMMA 4AEHL 4Q97A 1CXKA 1W72B 4MXWL 4YIQA 3KPRE 5F6IB 3OGOE 1KYOJ 4MAUL 3BN3B 4ODWA 3SKJH 1NMBH 2HLFC 2UWEA 4LPTA 1C5BL 5ECJE 2NZ9D 4LPWA 5JXAL 4TULL 5ICZB 3GUTB 1QLEH 1PKQA 2OP4H 2W9LA 4KU1A 2AK4B 4PREB 2VLKE 3LN9A 3QUXD 2ICWB 5DC0A 3IFOB 3ARRA 4O5LL 4LLAA 5FUZL 4U1GB 5F3HA 4KC3B 4WGVB 3PL6B 2HFFA 4C4KT 1JPFA 4L4TA 3WFCH 3SJVD 3FMGH 4XCYB 4Y4FD 1NMAL 3MO1B 2ZUXA 2ED8A 2A9NH 3D25B 3ULUC 2FO1A 1UJ3B 2JELH 1VFAB 4KK5D 2W0FB 2B0SH 3RDTB 3T65B 4ZD3H 5C07D 3DO7B 5DMJB 1BIIA 1RD6A 1R3LB 2NXYC 2Y5TB 4DCQA 1QNZH 3L1OH 3QAZB 1IGFH 3QUMA 2K1MA 4NRZB 4KMQA 1PYWB 3MLSH 4ODBD 5HDBF 4G8EA 1HCVA 4OLXH 3NACH 4Z0BH 4G42B 5T3ZL 4OD2B 3VRJA 2VXUL 1TJHL 5B21A 4APQC 5LGJA 1E4XH 4Y1AA 5CD5C 5ALCL 4S1RL 1K85A 1Z0MA 5IEKB 4JJ5B 1T6VN 1MFEL 1G7QB 4PRPD 3BXNA 4PV9A 4Z76A 1FIEA 1RUQH 4OFKA 3VXTB 3UTSA 3BAEH 5DJXA 3ESUF 1EJOL 4LSQL 4HIIB 5T3ZD 2X4OA 2Z31B 2BNQB 3TO2B 1RZGB 3WFBH 5IB3B 2J1KA 1FZJA 4IIQB 1H3UA 3QXDB 1I9IH 2NY1D 3SKNB 4R2GC 3BMVA 5E6IC 1EMTH 4V2BA 1MFAL 1CU4L 4XVJH 5E1AB 2X9YA 1C5DA 4POYA 2QADB 3B2VL 1U58B 3T2PA 1X9QA 5INCA 4HD9A 3VFOA 3U1SH 1C16B 3F7YA 2HT2D 3P4MB 2WLZA 3ARED 4GMTL 4R26H 1FLRH 1FC1A 1I4FB 4XNMB 5SX4H 4B41A 4G6AC 4QXTA 3LQAC 4F7PA 4RRPG 4KJWD 3O3BB 3FHQA 1BOYA 4HXBL 5LXGH 3JUZA 3O3AB 3C6LC 3UYRH 1INEL 4J1UA 5AWNH 4KXZH 3D87B 3OKYA 5IW1A 2XA8L 5EZOL 3K8KA 3QWOA 4NQEA 1ZOXA 2YWZA 5GGUA 5CIPH 4S0SD 3PXJA 5IV2B 1TTUA 3PHQB 3KLAA 4QRQA 5EO0B 4QCIA 2DDQH 4QRUB 1TDQA 3E1F1 3QWRD 4QF1A 1BQHA 3QDGE 5GS1B 4XB8A 4FQCH 4XP1L 2JK5A 1WTLA 4P23C 4ISVA 4H5SB 2GJ6A 3LEXB 1QFOA 1KTRL 4X6FA 4EUPH 1IQDB 1YYML 1BM3H 3O8XD 5J12C 3TN0A 4L1DA 2A0LC 3DI3B 3R1GL 4HPYL 2CR3A 2CRYA 1WFUA 2V17H 1P7QB 4LGSB 5L9DH 4U1IA 4CMMA 5J3HD 3WHXB 1A7OL 4MD0B 4YE4H 2NNAA 1LEKB 5E00B 4ORGB 1MQKL 5DRZA 1LO0H 2WW8A 1XGRB 3KDMB 5ID0A 5EA0L 4EXPX 4EVNB 3QHTC 2OI9B 3QH3A 3JBG7 3OX8A 1AJ7L 5CEZD 4S1DD 3WS6A 2QQLH 3PJSA 1AGCA 1MH5B 2IH3B 5IB4B 4Q6IA 5F7YC 5IB1B 1NCDL 2FGWH 5ACZA 2NCMA 4NUJB 2XY2A 2AXGA 3FO1A 4Z0XB 1A3LL 5CAYB 4XNZC 4KFZC 2W9EH 3QA3B 1BP3B 2H1PH 1VPOL 3VGEA 5IB5A 4HF5L 1M4KA 1F11B 3DJ9A 4XMPL 4FQ1L 1G6RL 1FZOA 5IQ9A 4OLUH 4JO3L 4HT1H 1V8HA 3VXSB 3IKCA 1JN6B 5CIPA 1N5AA 2IANE 4O00A 4BA8A 2N56A 1ZLWK 1OAZH 4RISL 4ZUUA 3HA0A 3NA9H 3VFNB 5JR1H 1M7DB 5EUOB 2GK0A 4IOIB 5J4MA 2GIYA 4NHCH 1XIWA 4EUPA 3ARFB 3WJLA 1I85C 2ICEB 2QSQA 2IFFH 1VADB 2C4FT 2VLJA 2PTTA 3LZFH 3MRPA 5DWUL 3BUTA 5D7IF 4KPHL 5HHQB 4JKWA 2P7TA 2CJUH 5IJVB 5C1MB 4JFQA 1T7YA 2IAMD 5BXFA 3IRPX 2X89D 4H25B 4D0CA 4XP5H 2DLIA 4FQLH 3BT2L 2FX8L 1ULVA 5HI3C 1WC7B 3WNLA 4PRBA 4X4YA 5F7UA 3TBTA 5IBLD 1SY6L 4P46B 4WI4A 1J5OL 1RZKC 1AHWA 4HK0B 3HZKB 1G9EA 2D31A 1CK0H 4JANB 1FN4A 3OF6A 2YK1L 1BREA 2VN7A 1DBBH 1QBBA 3WSQL 2DMBA 1OM3H 2NW2B 1QSED 2XN9D 5L8KB 1IKFL 1CR9H 4PJCF 2NY2B 1XZ0A 1JF1B 4LSTH 3OKOA 2FD6L 3CCHB 3MODL 1KXTB 3MRBA 1UFUA 2Z8RA 5IVZA 4JFXA 1P84K 2MMXA 3LN5A 2QSTA 3UTZB 5I1LA 4OZFB 3QIUD 2DLGA 4OTXL 5TE7L 4HC1H 4X6DE 1FNGB 3BP5B 1XH3A 4GH7B 3TPKA 4ZTOH 5FYJD 2FDBP 2DBLL 4RFNB 2DB8A 5ESAA 4NT6B 5KJRL 3ULSB 1UADC 4Y2DC 1PX3A 3I6LD 1DLFH 3LPFA 5D7IE 2ATKA 3NGBC 1EBPA 2P1YA 1VFUA 1N3NA 35C8H 4EDWH 4GRMA 5J9PA 3O41A 4JDZB 4XPBL 5H94A 4Z7UF 5CJ8A 1PKQB 3LIZH 3S5LA 4CJ0A 2VDKH 5JOFA 2XI9A 4LSDA 1G1YA 2YD6A 1D5MB 2FSEB 4HAFA 3WN5C 1A8JH 2BVPB 2HFFB 2UZXB 4RMQA 1JPFB 4L4TB 4Q7DA 3VXPA 5F6HI 3CDCA 4W68A 3TGXA 4M1GH 4ODSL 4MNQD 4ONFL 5C0DA 3L7FA 3MTRA 5FO8A 4X6CF 3RVVC 2VDPL 4YNYA 3NFPA 5E5MA 4F80A 3QDJE 4I0PC 2BDNL 3BN9C 3FB7B 1IVLA 4W81A 4PJCE 3NCMA 4ZUSA 3KXFA 4DCQB 3MV8B 2ZUQC 2HKFH 3IU3B 4G8FA 1XCQB 1CFTA 4P9HC 4NJAL 3VWJD 2CK0L 2DQJH 3VMPA 3VRJB 5ETUB 3GSNH 1CL7L 2ADIA 4Y1AB 4K3GA 4HC1A 3B9KB 4LSVH 4ZAKD 5GGRB 4ZQKA 4Y16C 3TZVD 3BJLA 4UI2A 4HUWB 4A2LA 3PGCB 3L3DA 3IDXH 5C0BE 1A02N 4PV9B 1RUPL 1Q1JH 3EYOA 3X3FL 2N7AA 5GGQL 5D1QC 4GRWB 3WJJC 1T66D 5DJXB 3OG4B 2YUZA 3HAEG 1OARH 5HDOA 2NY0C 1FBIH 2UZIH 3W2DL 2Q6WA 4Z7UE 4PRNA 5DLML 1OP3H 4ODVL 1FFRA 4KUCD 1VB9A 1L7IL 2YUXA 5CP3H 2R4RH 4JO1H 1C5DB 4L3CB 1MHEB 3BI9X 4YQXH 2HT4C 3PWJA 3GMRB 3U4BH 4X6CE 3VFOB 3WS3A 4KRPC 4RNRB 3F7YB 4OLWL 2ICES 3PQYB 4LOUC 5EBLB 3FO2A 1TQBB 1Q0YL 3F6IA 1JNHB 3HG1B 4G8GE 1A6UH 1J9CT 1IBGL 2ZSWA 4R4BA 3Q5OA 1KT2A 2H26B 4WO4B 4BQCA 4U1HB 4QKXB 1XGYL 4FG6C 4RZCA 5EU6E 4EKXA 4J1UB 1JMZA 4WUUB 1SJHB 4OZGF 4MSWA 3C09C 4L8SC 3S4SG 1UB5A 2DS4A 3MXWL 1FJ1A 4U4BA 4NQEB 3SE9H 4JQIL 3HE6A 3BZEB 4OCMC 3MZGB 1WITA 4NZDA 3KLAB 1A0QL 3D39A 3RZCD 2BFVH 4QCIB 4O51A 1HXMA 5KANG 4QF1B 2BY0A 3CX2A 3L3GB 4MHHI 1MRFL 1UM6H 2F5AH 3FN3A 1E4JA 2GJ6B 4Y88A 2OZ4A 4X6FB 3GSXA 3TN0B 4PJIE 3RTQD 3MGOA 4XBGA 4R8WL 2YPVH 1CGSH 4N0RA 5B4MD 3RAJL 5I66A 2F53D 3U7AA 4PGBA 5HPOA 4P2OC 3UZVB 1FZMA 1HEZA 1QRNE 5C0AD 4M6ML 2V6HA 3CXHJ 3O11B 3CH1B 2X10A 5DRZB 4JM2A 5GGSY 4GMSL 4CNIA 1EFQA 3M8OL 4N1EA 1KELH 4HCRL 4YHMH 1EGJA 1YJDC 4PJ5D 2P5WA 5J7CC 2ZCLL 4G6KH 2FIKB 3L3OA 3ARGA 5DD6A 1K5NA 2NMSA 1JGDA 5ACZB 3D69B 3T3MF 1R5VB 3BZFA 3FO1B 2CMRH 5JXEC 3X13A 2IGFL 1DVFC 1KJ3H 3P9MA 3LKPA 1TZHA 1CZ8L 3RL2B 2XYCA 5C0CA 1BPVA 1FH5L 4KAQH 3QULA 4AEIH 2QLVB 1HQ4A 2F8VA 3FZUC 3AC0A 1KLUB 5F7LB 5CEXA 4ESKA 1FAIH 1OB1A 3GEWB 4ZUUB 2YEZA 3GSQA 3C8KB 4EEEA 3ARZA 4N1CA 2VDML 4G7VL 4S10A 2ZOLA 5E8NA 3U6RB 2X6MA 5DD0H 4GQ9L 1AXTL 3C2AL 3RBGA 4QTIH 2J8UA 2BHYA 1S7SA 2PTTB 2XZZA 3GRWL 3U2SA 2W0LA 4FFYH 4X9IA 4C83B 3H9HB 4UBDD 1LDPH 3ARBA 2Q3ZA 4WU7A 4QRRA 4HJGB 3QI9C 4JFQB 3VWKB 1DQDL 4W70A 2VH5H 5KVFH 4KRLB 4D0CB 4PJGA 4C58B 1AKJA 1I9JL 3F7VB 1KCVH 4LHJB 2W92A 4LLWA 3REWB 4HXAH 4KKAD 1TPXB 3MRIA 3T0VA 2E9IA 1MREH 1YPZF 1CLYL 1UM4L 1FRGL 1FYTD 2D31B 4LRIC 4XMKH 3MRJA 1FN4B 2A83B 4GAJH 1ZMYA 2XOTA 3SE3C 4NUGH 3DX9B 1NC4A 5ALBH 4QXUH 3MFFA 2RJMA 3V8CA 3NOIA 3SCMC 5D7LD 4M5YH 4CAGA 1QHOA 2X4PA 4K71B 4DGVH 1PG7W 5I1LB 2YSSB 5MI0C 5IROC 3BSZH 2Z9TA 4K7PX 2Y25A 3IS0X 1T7ZA 5L88L 3SDXF 2K7PA 3ARWA 2YPLE 3S88L 4EOWL 3LQZA 4M6OL 4X83A 3X14A 3TFKC 4F15B 2ATKB 2NX5D 5KSUA 1CBVL 3NIFF 2VLRA 5HHXL 3C5ZA 3TP4A 1N3NB 4XAKD 4M7KL 1CF8H 5FK9A 5J9PB 3O41B 2VZSA 3SKMB 1ACZA 3HUJE 1J0ZA 3RWEA 3BE1H 1JJUA 1JI2A 3KYMB 1KOAA 4OSUL 3NFSL 1U3HA 3EOTH 5EC1B 5ITBL 4W4OA 5CGYD 3GJFK 4K3EL 5L8LB 2GAZB 5I73B 2GY5A 2ZUVA 3VFWA 3OKLB 5L2JA 3VXPB 2WBJB 2HVJB 4I2XE 4XVSH 5C0DB 3L7FB 3I3EA 2A6KA 1QEWB 2LU7A 1IC1A 1KJ2A 5E5MB 5GS0H 1AC0A 2XQYG 3QDAA 2DM4A 4G9FD 3BKML 4KJPD 2X4NA 4ZUSB 1NUNB 3MLXH 2ZCKH 1VACB 3KXFB 4KVCH 4G7YL 1T7WA 3FT4B 3HKFA 4PS4H 5AAMA 4S1QH 3CD4A 2WSKA 4NWUL 2R9HC 4G8FB 1D9KC 3UC0L 2VAAA 2J6EH 3OXSB 3ROLA 1SYSB 4CRPA 1AE6H 5KTEH 3BYTA 5IESL 5GZND 5HHMD 4PJ7B 3ULUD 1A9EA 2ADIB 1IAKB 4WEBL 4N0CD 4BK4A 2EZ0C 4HWEH 5GHWH 4NO0A 2LU4A 1OLZA 4U3HA 2NXYD 1HH9A 4NP4L 4OQ1A 5CKGA 4ZO9A 4KZDH 1MWAL 3EYFA 3EYOB 3NIFE 2R4SL 5A16A 4GQPH 1AGDA 3FQWA 2H9GA 5F9OH 4U6HA 5IB2A 5CD5D 2DMKA 1I8KB 1H8OA 1RUML 3RWIB 4F7TB 4OGYH 5TE6H 4HFUH 4LVNB 2YA1A 2IG2H 3IU4L 1MIEH 3BFOA 1MCBA 3RUGA 1F58L 3GSOA 3QJFB 3PDGA 4K7FB 1IM9A 4NO3A 2JCCE 4YLQT 2R23A 3CFEA 4P5TB 4L4VD 2FZ3B 2XRAL 3PWJB 5T5FH 1T80A 5T33L 1HCFX 3WS3B 1KF9B 2W38A 1AXIB 1QFWH 3BGFC 1IQWL 2NY4C 3MRRB 4R2GD 4XMLH 1CLOH 3B2UD 4ELMA 4NC1C 1C12A 1I7UB 5CZXD 3ISWA 2D03H 1MAML 3BH9B 2PR4L 1KT2B 1XCTB 1M71B 1S7UB 3IFLL 5J13C 3MBEB 4GAGL 3RKDC 4YDKL 3MRHA 5DO2C 2J6EA 3OPZL 1T1WB 3MA9H 1FO0A 5GSVB 4M7JH 1UB5B 3GSNB 4YXLH 2Y6SD 3HE6B 1NDGA 1PDKA 1JZ5A 1DL7L 1GH7A 4N0UA 4LQFL 4PJBE 3QG7H 4I3RL 1VGKB 4PJXF 1NLBL 2VR9A 4UTAH 2Q86B 4TOYL 4PGEA 2GCYA 4KROC 4LPYA 2I5YL 4XBGB 2WWMD 4JFFA 3VDCA 2OR7A 1PBYA 4MQ7A 3LS5H 5MEND 2B1HL 5I66B 4PGBB 4CADB 4NO2A 3EDKA 3V6ZA 1U41A 1WK0A 2FX9L 4DGIL 3CMOL 3PGFL 1U8MB 2HJFA 4FNLL 3MCLL 3SGDI 2DQGL 4EI6A 4HUKB 1BZ7A 5FHAH 4JZJB 4BUGA 2VXVH 3IJSB 2D7TL 5DK2A 3FFDB 3P9WB 5DMGC 1MPAL 1E27A 4QWWD 1T5WA 3W81A 5TE4H 5B39A 4RMSA 1H5BA 3QDJB 3L3OB 1PW3A 5DD6B 4HJJL 1K5NB 4GRLA 3B8YA 5FYKU 1YEDB 5A2JH 2GQHA 1SEQL 5C7XL 2FECI 3X13B 3WFDL 3P9MB 1OOAA 2WMPA 1QFPA 4JFPB 3DUSA 1UCBL 2X7LA 5GGTA 1HKFA 1CTNA 4MZ3A 4N9OB 1RHHB 5F7FA 3GSUA 3SBWC 3NPSB 3QULB 3HE7D 1IAOA 3CC5A 2DQCH 5IHUH 5KN5B 1OAYH 1L4IA 4PJXE 3QPQC 4JFDA 4CVXB 2YEZB 2HG5A 1KFAH 1YEKH 2F54E 3P4OB 1U8JA 5I6XC 1OF2A 2ZOLB 3GSVB 5E8NB 2ERJC 4WI3A 5FYJU 4XPFH 1OSZB 4OZHA 4HZLA 2J8UB 3O81A 2AI0H 1X5FA 2WV3A 1JWMA 2NY7L 1P9MA 5EIIA 3OBAA 4Y19E 2W0PA 4WU7B 1BAFL 3P0GB 4QEGA 8FABA 4I18A 5DVNA 4PJGB 2H2PC 1AKJB 4YR6B 1MSPA 1DUZB 3O6FC 4LLWB 3E8UL 3PP3H 4KI5C 5L2KA 3PV7A 2NXZD 3TNMB 5HDQL 4N0YL 1R3KA 3MV7D 5KAQG 1OW0C 5E8DL 1Q38A 3DV4A 2C26A 4UT6L 5E2UL 3DMMC 2G5BA 1JGVH 5DRXA 1EHAA 5D1XB 1B0RA 3E0GA 4G8GB 5HI3D 3TWCL 2VABB 4HKZA 3DLQR 1G9NL 4EDXA 4D3CH 1MNUL 5DDHB 4BELD 4P3DA 7FABL 5C07E 4JREC 4HBCL 3V0WL 1DQQA 4F57L 4UT7H 2E7CA 1WQVT 3W9DA 1UXSA 5FGSA 4QXGL 1FNHA 5JIIA 4ZDHA 4XP9L 2NQCA 1ZKAA 1BVZA 1IGTB 3V4VH 5DJCB 4FQHA 3TIEB 3EZ8A 1T89A 3FO0L 1P1ZB 3X14B 5IKCA 3DURA 3Q48A 3ZMRA 4QXWA 1A5FL 2YOCA 4QTHB 1QUNA 4PRPE 1FVCA 3I2CL 1PAMA 1DE4B 1YN7A 3FQRA 5FK9B 5IF0B 5HVGB 4JZNA 5SV4A 1WTGT 3AS1A 5D2NC 5T3ZE 1FL5B 2GSGA 2P8LB 1U3HB 3K81A 4PY7A 1EEZB 4TVPD 2FJFB 5C0JB 4TNWF 2EDXA 3LS4L 2PO6B 4YWGL 3VFWB 4BYHA 2Y23A 4H26A 4XPAL 1JZ7A 4XWOD 4HBQA 4P2QA 1HZHH 3LKQA 3BW9A 1NGZA 4RGNE 1I3GL 4JY4A 1WZKA 2C7UB 4LSSH 5CCKH 2HH0L 3MPCA 1T1XA 4LF3A 4TVSa 3Q1SL 3GNMH 1KACB 3CDGA 3UO1H 1WUNT 4WI7A 4GG6F 1Q9OA 2UZYB 2OXHA 1VKXA 4LEXL 4GKZA 3K8MA 1WT5C 1QSFD 3L3HA 2UY7A 1IJ9A 3TYFA 3TPUA 4JFHE 2HMIC 4U1SA 4UV4H 2MPAL 4NO0B 1WJ3A 2HKHH 1HH9B 4LKCA 5DA4A 2AW2A 4IOFC 2BC4A 3ZTJG 1KCRL 3O9WA 1NBYA 2YMXH 1TENA 4YDJA 3HR5A 1MJJA 1OHQA 4GBXB 1WWBX 4E41D 5ESVB 1MUJA 3MJ9H 1KTKE 1OT1A 4PLKD 4CVZA 3ULVC 2E3VA 2HTKD 1IEAA 1EFXA 1K4CA 1OQXA 4QO1A 4K23H 4J7RA 3AM8A 3RUGB 3NTCL 3BPLB 5FOBA 2QQKH 5FF6B 3ZDZF 1MCIA 2NY0D 5K9JH 5I1IH 3VXOA 4K3DL 5CMAB 4YPJA 2HA1A 4NO5B 1IRAY 3EO9L 4NFDA 4YZFF 2P8PA 3QDMB 4ELMB 3HFMH 1C12B 4Y4FA 3GIZL 3U82B 3QIBC 4LLMB 4GW5B 5C9JB 5EO1A 2YRZA 1RIUH 1I3UA 1T1ZA 2WIIB 1FG2A 2ESVD 3MRHB 5ACMA 4KRPD 5LBSH 5J6GB 2IMMA 2YD3A 5KVGH 1ADQH 2I60H 5HYIA 2WUBL 3U0PA 1B4JL 3L3KA 1ZGLM 4N8VG 1A6VH 1MCJA 4N0UB 3PWPD 4Y4HB 2KBGA 5M95B 3QNZA 1B0GB 1GGCL 5FKPA 1I1AA 2YPLB 1QSZA 5CINL 1XR8A 1EA9C 2EH8L 3HI1A 3SPVB 1CD0A 3MJ9A 1KN4L 4M62H 4MJ4A 1ORSA 5D7JD 3QQNA 5F9DC 5IVXA 3R0MA 3OZ9L 3HUJB 4JN2A 2RHEA 5JW4M 4DN3H 2B4CL 3S37L 1HHHA 4RGMC 1S7TB 3G5ZA 3ZDZE 4NM4H 1XAUA 2DI7A 3K1DA 4F58H 4LP4A 1BZ7B 3QNXA 5DK2B 4I2XB 1KNOB 1T5WB 2EDFA 4PFEA 5D72L 3WUWG 1H5BB 3GI9L 4ETYA 4MNGA 2R1YA 4X7CC 4ZG1A 4JDVA 5CEZH 4L9LA 3P0VH 4X7SL 1MHHB 4FFZL 4F3FB 4EXKA 4U6VH 1ZLVK 3AREA 3QRGH 4LARH 4MD5B 4MMXC 5DK0B 1RK1A 4MDIA 3HMWH 3GSUB 1FHGA 4K7PY 1QSEE 5HHOB 2FYYA 1HIML 1W0WA 4JJHA 2EDKA 3MLUL 1E4WL 2HG5B 1U8JB 5DR5H 2WP3T 3S34L 4LLQB 3PXHA 3VGGA 2FWOA 2YBRB 4QT5A 4ZFOL 1BZ9B 4OZHB 3TBVB 4HZLB 5SWQA 3HN3A 2MNUA 1U95A 5BW7C 3WIHH 2Q8AL 5MHSD 3FZUD 3DO3A 4KZEH 3KGRA 3MRLB 3G6JB 3TH4T 5CKAA 2M1KA 4R97B 3I6LE 4K2UH 4I18B 4XCFL 3U9UA 1OTTC 4YXHL 4MVBD 3GJEB 3HRZA 2JCCB 1KTLB 5BO1L 5L2KB 1JPSL 2XFXA 5JPMB 1QFUH 2CLRB 5A40E 4DVRH 4X7DC 2ITDA 2E9WA 3DV4B 1IEBB 2ILLA 1NCBH 4N90E 1JGEA 5IR1B 5H37H 3IAPA 4YHKH 3NCFB 5E9DA 1A2YA 5E08L 2NY6D 1T2QL 2G5BB 3LEVH 1B0RB 4HGKC 4OCSH 5TF0A 3T8XB 3ZKNC 4Z77B 5D8JH 5FGBA 5FYKH 3X3GH 4DKDC 5EU3B 3BPOB 4HKZB 4EDXB 1V3LA 4KV5F 5ENWA 3UBXG 4OD1L 5E8OA 4KI5F 5B8CA 4MQTB 1M7XA 2HJKB 4TSBL 2VXSL 4FP8H 3PWLA 4PJBB 1CQYA 2BVYA 2X09A 4NNXA 1UACL 4UOW1 3MBXH 5E8EB 4D2NA 4JGUA 5EC2A 3OAUH 4JHWH 2LAGB 4M00A 4OGZA 5C8JB 1CDUA 1EK3A 4XZUA 2HJLB 3ARYA 4OV6F 5FYJH 2J8OA 1X5IA 1CE1L 3G9AB 3TVMD 5SX5H 3KPRA 3G6DH 1F6AB 4JZNB 1LO3H 4I8DA 3JTTA 1RJLA 3KLHC 1DQML 5GSRA 1DN0A 3KVQA 4UV7L 3UTQA 5JZ7D 2VLKA 2X89A 3RQ3A 4OLYL 4DFIA 4MA8H 4N5UA 3THMH 2ARJB 1RY7B 3I3DA 4Z7QE 2D7OA 4P2QB 3BO8B 3LKQB 1JI1A 2BNRB 4LEOA 3SQOH 3RWFB 4MDJA 2IPKB 1R3JA 3WDIA 4IMLA 5IVNA 1T1XB 3HC3L 4HWUA 3HNTL 3DYMA 4PRHA 3CDGB 2F5BH 1NEUA 5I75B 4JRXE 5KSBF 1NFDF 4P59H 3VFMB 5J6HA 1S7VA 2A74B 4YHLH 1VKXB 4L4JA 4LLDB 2VISB 4GKZB 5JW4N 2FL5A 3MQIA 1J0HA 2OTWB 1TVBB 4OZFG 1I1RA 1TTFA 2KL6A 1JWSA 4HK3J 4J6RL 2EDRA 3TYFB 5TDOB 5AYQA 1FNEA 1YECL 2F54B 3OR6A 1S9KC 4U1SB 3ZKSD 2XTJB 3JWDL 3DI2B 3O9WB 1D9KD 2DKUA 2EDQA 4EN3C 3FN0L 3EO1A 4M4PA 4YDJB 4V1DD 3HR5B 1LEGA 5HVHC 1NCNA 4YC2B 1IGIL 1PFCA 4ERSL 5I1EH 2VITA 4CVZB 3IVKA 4OUOA 2NYYC 4P49A 1IEAB 1K4CB 3BKYL 3BQUD 3D5OF 5KSAC 1XGPA 5FOBB 3MOQA 4Z7WE 1QR1B 2F53E 3NZHH 2EXWC 4GKNA 2DQUH 2I07B 3B6SB 5C0AE 4J23A 3VD9A 4PJ9C 3QUXB 4ZTPH 5T5NF 3WIFA 1KUMA 3GZKA 1CDHA 3SJVB 4PJ5E 3MLVL 1QQDB 4Y4FB 3ULVF 1H9VA 3CUPA 4JY6A 3LKSA 5D2NE 5KSBE 1JNNH 4NNYA 1H3TA 5I8OH 1SBSH 1FG2B 5ID1B 3HI6H 2WLYA 2AV1A 3D85D 5DD1H 3BWUC 5E70A 4U0QB 2ARJQ 1TCMA 1CCZA 1F4YH 3OSKA 2R29L 4MAYA 3TBWA 3S35H 3VWJA 2I9LA 5CP7A 3QNZB 2O5XH 3HZMB 4JKKA 1MCWM 3MLWH 1DQJA 4W6WB 1XR9A 1FE8H 4LIQL 1R3IH 4PJDF 2E8YA 1T1YB 3UTTD 3AY4A 1DQLL 1XR8B 3N85L 3QQ9D 2AKRA 3IXTB 4WFFD 4U1NA 1LDSA 3TO4A 4PRPB 4FA8A 2EIEA 4NRXA 5KS9E 1GGIL 1P53A 1UT9A 3LB6C 5IVXB 1E6OH 3UDWA 4KKNA 4K7PL 2X42A 5M7QA 3BZDA 3VFSA 3QCVH 1NBQA 5BVJA 1U93A 1WCBB 5JUEL 4Y2OA 2NY1B 1MRCH 3I9GH 2MQ3A 2RIKA 4MLIA 4LLVB 5FDYA 1JGUH 3EYVB 3U0TA 3OAZK 4JKPH 1A6ZA 2VLLA 3VFRB 2YUWA 1A14H 2AJUH 2FH8A 2IPTH 4L9LB 4MX7B 4N9GA 2B8OT 5D96C 4NPYA 25C8H 3EAKA 1FYTE 3AREB 3PWUB 4S1SL 2XQBL 2HWZH 4K8RL 1FC2D 1CG9B 2VR5A 1AFVL 4MDIB 5DMGD 5IVOA 3OGCA 1VENA 2A77L 1W0VA 3F5WA 4NN6B 4NN7C 5SWZA 1JYXA 5HHVH 4TTDD 3HNVL 2WNGA 3GBNH 3OKEA 5D7LE 5C0NC 4H88L 2IANA 4OIBA 4PJDE 1J1OH 4L8CB 5MERA 4OM0L 3DHJA 3GHBH 2QQNH 1BQHG 1IZJA 5FA3A 4E5XA 4R90H 1CL7I 2CUMA 5SWQB 3KAAA 3CXDH 1ZEAH 1KEML 5BZWB 3KYKL 4JFED 1S3KL 3GSWA 3VXME 2GW5A 4NGHH 3VFPB 3VD3A 5JLZA 4IS6B 5D5MB 2NX5E 2RFXA 3U9UB 3DXAD 4DN4L 4MJID 4LCCB 4AK1A 2BOBA 3HRZB 3IDGA 4PBVC 1XFPA 3RWJB 4CU6A 5D6CB 4G6MH 4PJ8D 1FSKB 5D6DC 1LK3L 4JFYA 1A6WL 2ITDB 3CFKA 1L7TL 1Z5LA 3K80A 4X99A 4ZO8A 3RGVA 1ZSDB 1IILE 4BFIB 4U1MA 1D3CA 3VXUD 3CSBA 1F4WL 4CN1A 3P2TA 3QYCA 4LFHG 1RUAL 2H2PD 4TSCH 1T5XA 4TRPL 5C08D 4BQ6A 3GBLA 4JY5H 1AXSA 1T83A 4KK8C 4YEEA 3NN8A 3ARDC 4XVTH 4YK4B 1DUYA 5ENWB 4U3CA 2CIKB 2HAZA 5GGRY 5JOPE 2BCKA 1R24A 5JQ6H 1RAMA 4BZ2L 1NBVL 2W0KA 1LP9E 4LU5L 2EYTB 2AJZA 3IFPA 3QJHB 1CFNB 5LWYH 4P5MA 5FHBH 4FTVE 3I02B 2DLFL 4YGVA 4NQDE 3G5VA 4XCCH 4J4PC 2PXYA 5HHME 3DUUA 4R4FH 5EC2B 4EUPG 3RA7L 4XZUB 1SM3L 4ZPTB 5FM4A 4GSDL 1V05A 4Y4KC 1A3RL 1NLDH 4JFOB 2F58L 1NGQH 3EOAA 4YHOH 5I1JL 2HLAB 4L1HA 2DWEB 2E7BA 4N5EC 3QO0A 2RCSH 3QG6A 3ZHLA 1G9MH 3BDYL 4OCRL 2IAMB 4G5ZL 4O02L 5C09E 1T22B 3L3IB 3JV6B 4LCWE 1QACA 3IDMB 5SWSA 4U33A 3CLFH 4XPTH 2WINA 2MKWA 3CK0H 1FNAA 3CFJB 1MFCL 3VFGL 4IMLB 3NABL 2GTZA 1A21A 2R2CA 4Q9RH 5IHLB 1AQKH 1ZHLA 4PJCA 4PRHB 4O9HL 4URTB 2EXYC 2FB4H 5DRNB 2M8XA 4I48A 1DBMH 4YXKL 1QSEB 1S7VB 2UV3A 2XN9B 5CD3B 1KCSL 1FFNB 3WD5L 5CZVL 3B9AA 1VEPA 4LLYB 1T03H 4PV8A 2I25N 4BK5A 1S9WA 1ZV5A 4E9LA 3OR6B 3SOBH 1W8OA 4NRYB 2VUYA 3QIUB 5GJTH 3EYUH 3O2VH 5E03A 3ULUH 5LCVL 3SGKA 3EO1B 3K7UA 5TDPA 4NHUA 2AJXH 2W60A 3V5KB 2HTLD 4GT7A 1YQ2A 4IRJD 4NKIH 2MWCA 2OTPA 4ZFGH 2IFGA 1JHKH 3KG5A 4R0LA 1ZVSB 4Z7UA 1DBJH 5DEFA 3EJYD 3ROOA 3S5LG 1FYHB 3TCLA 4KK9D 2O5ZH 5MENE 4HPOH 43C9A 1G7LB 5HGGS 4I9WD 5DHVA 4IRSC 3BPCA 5CHNB 4ZSOB 1RZ8A 3LVEA 2C1OA 4WW2C 4M9PA 3V7AG 1U8PA 3WO3B 3ULVD 5EFIA 4X6CA 3TCXA 3GMNA 1UWEH 1NEZB 4M8QA 3MMEA 4MNQB 3O6ML 1R5WB 4FFWC 1TJIL 1GHFL 1BX2A 2ZKHH 2EECA 1V5JA 2IJ0C 4CKVX 1HILA 4AIXA 1V7NH 3D2UA 1XF1A 2WM0A 1YEEL 3HMXL 2NR6D 4MJ6B 4Y5YC 4J3XA 3ECBA 3RHWK 4P57B 5JHDE 4OB5H 3M1BA 2PYEA 3SDDC 2X1XR 5FO7A 4I77L 3VWJB 4X5WB 1DQJB 1XR9B 2BSSA 2PYFA 4F37K 1JHLL 1BF2A 1WVZA 3SKUD 1KEGH 3ARUA 3LQAH 2E7LC 4U1NB 3N1GC 4YBLB 1A7NH 4UQ2A 1UH4A 3T0ED 5DMKA 3GMPB 4MWFA 4NRXB 2EYRB 3IT8D 4I3SH 3UZEA 4M5ZH 4ZNEE 1U8KB 2IF7A 5DT1L 5LG1A 1A47A 3GKZA 4X9HA 3RNQA 4NC0B 1OWRM 4APQA 2EH7L 4TPRH 4P3CH 3ZDXF 2CR6A 3DX6A 4JR9L 1G0XA 2G9HB 1S9YB 1GAFL 4PJAF 3TA3C 5DJAB 3T2QA 1CFBA 4Q58C 1J8HA 1HINH 4L4VA 2E6JA 2XQYK 4NN5C 2DJSA 3CSYA 4HUNB 4N9GB 4HH8A 4NPYB 4K9EC 4ZO6A 4K94C 5J57B 2NY3C 3QCUH 3WEXB 1OLLA 5CWSB 4G8IA 3WO4B 3DX7A 2R2EB 2UVFA 5E6IA 1IFHH 1WWCA 4WFHE 4QRSA 4EIGB 4MS8D 2YXMA 1MOEA 2I24N 4OZGA 1YMMD 1BLNB 1GC1H 3MR9B 3F5WB 1ZLUK 2CPCA 4HS8H 3MUZ1 3WKML 4AJ0A 4PJHF 4Z7VA 3OKEB 2ED7A 2P44B 1D5BA 1WF5A 5DEGA 3RX7A 2R2BB 5GXBB 3HAEH 5FA3B 3UMTA 2BXZA 1A22B 3HTLX 4E5XB 1G7PB 1FNSH 3RZCB 4U6YA 2XXCB 4NKMA 3JWDC 4WWKC 4L4TD 3C6LA 4MB3A 5IFHH 5ANME 2AXJA 3GSWB 1MCNA 5HD8C 4K3HA 2XZCL 3NZ8B 5I71B 1QLFA 2P45B 5JLZB 5I9QC 3IXAB 3MNWA 5F3BB 4NZTL 2R0KH 2SEBB 1ETZB 4EBQH 4Z7WB 5JW4R 2AEQL 3IDGB 2F53B 3KR3H 1BEYH 3GO1L 1MAJA 2EDWA 3V4PL 5EN2A 5F93C 5C0AB 5EIQA 1OTUD 2BJML 3DSFL 4P23A 5TFSH 4GAYB 5I18H 4LVOC 4HQQH 3VDBA 3RNKA 1RZIB 1KLGB 4P2RE 1NMBL 3SKJL 3K3QA 4LKXA 1YC8A 1HQRB 3FONB 1R5IA 3QXTA 1QLEL 4UDTA 2OP4L 2X4TB 5E8PB 5DUBB 4U6TA 1A6TB 1ED3B 5C0EB 1AXSB 3NN8B 2EIBA 1DUYB 4KHTH 1GSMA 3UTSD 1YNKH 3PIQA 3WFCL 3RHWF 2BCKB 3FMGL 1CD1A 3S98A 4PJHE 3O3EA 4BZ1H 1FORH 4XNQA 5D7KD 2LQRA 4UINH 3DGGA 2F8OA 1B2WH 5IK3A 2A9NL 2JELL 2XWBA 2B0SL 4F37F 4Y5XC 4ZD3L 1KJMB 3H3BC 4KVNH 1HI6A 3BKCH 2CD0A 1EBAA 3DUUB 1QNZL 3L1OL 1IGFL 4IM8A 3BRDA 5F9WC 5IHZB 1INDH 3MLZH 3REVA 3MLSL 4M61A 1N6QH 5KS9B 4OLXL 2E6PA 1FNLA 3NACL 5EZIH 4Z0BL 5I1DB 1JHTB 4DEPB 4X7TA 5ISZE 3ETBF 1JPGB 2Z8VC 2EC9U 1HOCB 1E4XL 4XWGH 3EOAB 5CGTA 4X5XA 5IMLB 4KGJA 3EW3B 3OAYK 1RUQL 3VG0H 2VE6B 1FL6A 1KYOK 4NZRH 4HWZA 1JPTH 3BAEL 4MJ2A 3CVHH 4C59B 5JNYB 3PABB 1YPZA 1BFOA 3PHOA 5SWSB 4MQXD 1I85A 3T4AB 4TVPH 4NQED 5I1CH 3VD5A 3WFBL 2D3VA 2Z0BA 1I9IL 3UTPE 2A1WH 2E8ZA 1FYTB 1EHXA 1EMTL 4XVJL 3RRQA 1ZHLB 4LSPH 3FT3A 3D6GA 2Q7NA 4LLUA 2OMBA 4UT9H 3O2DA 3GIVA 1KJVB 12E8H 2EE3A 1MCDA 3U1SL 2G75A 1G7IA 1BBJB 1UJTA 5D7LB 4OZ4B 3CVIH 4NWTH 4PV8B 4R26L 4OI8A 1FLRL 4BSVB 2KUTA 3PL6C 1J88A 1AD0A 3G9VA 3SDXA 1PQZB 3G08A 2Z93A 3DETC 5LXGL 2H6PA 1G7HB 2BVQA 3UYRL 4PP1C 1BMGA 4X4MA 5TDPB 1BFTA 5AWNL 3FL7A 3RDTC 4NHUB 3TIDA 3DROA 3MCKB 4Z5RA 3QAZC 3BMWA 4P9HH 1LE9A 4D9RD 1Q9KB 2NX5B 4LFHD 3DECA 5DEFB 3ROOB 2DDQL 3TCLB 3RPIA 2XA3A 3WNNA 3FAXA 2UUDH 4FQCL 1OVZA 3OV6A 43C9B 1S7WA 2QSCH 3KPQA 3L7EB 1BM3L 1WWAX 3BPCB 4U7SA 4KY1H 4Y2DA 4Z78B 5KANI 3WLWC 5IT2H 4RAVA 2V17L 1S7QA 5EFIB 5L9DL 1HWGB 4OFYA 5C6PB 1BVLA 3GMNB 3SY0A 5DSCA 2X4SB 4UU9A 4YE4L 4M8QB 4P4KC 5K93A 4MGXA 2X4RB 2Z31C 4ZPVB 1RSFA 1LO0L 3U36B 1A1NA 1OTSC 3GMOA 1IGJB 1BX2B 4IIQC 1VEMA 1XIWD 2VXQH 4G9FB 4ZS6C 5F7DB 4YAQB 2ADJB 3PV6A 2VLJD 1LP9B 1VFMA 2XPGB 3DVIA 2QQLL 3WN5A 5IQ7H 5T1LA 4UIMA 2PYEB 2EDEA 2QADC 5FO7B 2FGWL 5IJKC 3H3PH 1J1XH 5IEHA 1RIHH 2VWEE 3QEHA 4N8CH 4I3GA 4XCEA 5JDSB 3WFHB 2BSSB 5HHMB 4I0PA 2W9EL 2PYFB 2H1PL 5FCUH 5IMKA 1WGOA 2NXYB 4OLUL 4YUEH 4HT1L 5DMKB 3QZWA 4OZIE 5EZLA 2FLRT 3B4NA 2IC2A 4POZC 4JHAH 1OAZL 1N59A 1QKZH 3F7RA 4U1LA 3NA9L 3H6JA 5JR1L 5MHSE 2DQIH 3P4LA 4Y16A 2JJWA 4NHCL 4I0KA 1MRDH 5MEOA 2FGZA 1RU9H 3OB0K 3OJDB 4N0FA 3MSPA 1V3JA 4ETQA 1HK6A 3LZFL 2AVGA 2IFFL 4O2CA 4L9DA 4RBPK 5D1QA 4KKLC 5GS1C 4X98A 3FB6A 3WJJA 5EORH 5CJQH 1J8HB 2CJUL 4L4VB 5BRZA 4NQCA 1AGFB 2O61A 2W65A 1H3GA 4XP5L 4HGWA 4FQLL 1YC7A 4DGYH 4HG4K 1VFBA 4R2GB 5K59F 3DX7B 4MXWH 4QRSB 1FFOA 3BZ4A 5HHNA 4YHNA 4OZGB 2BZDA 5DRWA 1BBDH 1OP5H 4HUVA 4PRIA 4JGMA 4QRTA 4TULH 2VMFA 1CK0L 1I9RH 2OI9C 1WISA 1YJDH 4M1CD 3GMQA 4ZUVB 4Z7VB 2K7QA 2A6IB 1TVHB 3L95A 1DBBL 2Z4QB 5DEGB 1OM3L 4CGTA 4U6XA 3AMLA 4PJXA 4H20H 5I1HH 3PGDA 1IT9H 1CR9L 1KC5H 4KK6C 3MRKB 4UB0H 4DVBB 4LSTL 4U6YB 2XY1A 4OKDA 2CDEA 4NKMB 3CLEH 4FQXC 3CFBA 1VFOA 4OLVH 1RJYB 2YC1A 2DTSA 5HHPA 1RIVH 4L8SA 5JIKA 4Y19A 4BKLA 4HC1L 2CRZA 3MNWB 3LOWA 3TT1H 1CFVH 4ZTOL 1X44A 3KXFD 3QEUB 3GJFA 2OSLB 3NIGF 3P11H 3VXRE 4LSRH 3UP1A 1P4LB 2E9JA 1Y0LA 1DLFL 4MA3A 1P7KB 4HJ0C 4XBEH 1ACYH 5B39G 35C8L 4EDWL 3RNKB 4FQQB 3FRUB 2AAVA 3RWGA 2E6QA 5JO5B 3ARFC 3KPOA 2M26A 4LKXB 2X44D 1R5IB 1TJGH 2IPUG 1LE5A 1LO5A 1IAMA 3LIZL 5K59E 3WUZA 1JFQH 4XVUC 2VDKL 4P2OA 4WV1B 3P9LA 2V7NB 3K4AA 2DM3A 1T2XA 1LK2A 1OSPH 3F7PC 2OBGA 3MRGA 1JRHH 1C08A 3JUYA 3PIQB 4M1GL 3VI4F 4XP6H 4XNQB 3BIKA 3CFIC 3HE7B 1H15A 4L3EA 4OBSA 2XWBB 3EHBC 4A6YH 3HAEB 3MJ7A 1NGXA 4P46C 4X8JA 5C0GB 5JXEA 2HKFL 3WLBA 1DVFA 1JZ2A 4BQ9A 2VKXA 1JE6A 3VXQA 3HB3D 3W0WE 5D4QA 3W39B 4CN6A 2JKXA 5JHLH 4XBPB 4YHPA 2DQJL 2AXFA 2FJHA 2EEAA 1QTYT 3GBMH 5E0QA 2NY2C 3GSNL 1CVSC 5EIVA 1W8NA 1YDPA 4LSVL 2QHLA 5E94A 3DVGA 2H8PA 2VSDA 3GFUA 3QUYC 3IDXL 5ESQB 1HYRC 2IADA 4Z9KB 1UG9A 1Q1JL 1WFOA 3LKRB 3GSRA 1UGNA 3FCTB 4HWZB 2Q76B 1CLZH 1OARL 5E6ZA 2F15A 4RFNC 4UMGA 4LCIH 3UCRA 1FBIL 1GGTA 2UZIL 4Z6AT 5AZ2H 3HE6D 2NXZB 2CRIA 2P24B 3MV7B 4KQ4H 3D39D 2X4QA 5AD0A 3QRFM 3QI9A 1KB5H 2R4RL 4U3XA 5E7BA 4XXCC 4WJ5A 3UX9B 1X6NA 3FT3B 4LRNH 4YQXL 3PNWB 3GIVB 3V5HA 5DYOA 1MLCA 5LKNA 4IJ3B 3VI4E 3U4BL 3UJTH 1G7IB 4WHYG 1YNTB 4ONGH 4BH8A 5F96L 3CDYA 4YDLB 1IC4H 5AG9A 5BS0E 1JZ3A 3HCVA 4LRIA 1BIHA 1ZAGA 4PRAA 4LSUH 3SDXB 1Q9LB 1A6UL 3B9EA 3BP6A 3G08B 4JM2D 3SE3A 1LD9A 2Q20A 5C6TH 2P5WD 5ANMB 1T3FA 3SCMA 1T0MA 3DROB 4KH2A 3SE9L 3ARGD 4Y0GA 3WBDA 3MV9E 2BFVL 2BMKA 5IROA 2YXFA 1WLHA 2EC9T 2UVEA 3RPIB 5I1AA 3VGAB 1EEYA 4ZFFA 4NJ9H 1QP1A 1T0PB 1UM6L 1SEBA 2F5AL 3B9KC 4JG1H 3KPQB 3LAFA 3LHPH 1N64H 5C0CD 3CVHB 3MX0A 1L6ZA 1S5HB 2Z91A 3T1FB 4LIQE 2YPVL 4Y2DB 1CGSL 1MFDH 2YR3A 1LO2H 3SY0B 3WMSA 3KNBB 4I0CC 3L5WA 3ZYOA 1T21A 3T0DA 5K9KA 1CE6B 3W5NA 4KJYB 2PN5A 4MYWB 5EBWA 1J0IA 1A1NB 2R56H 3SHSA 5K9OB 4GG6A 4KHXL 1KELL 4CDGC 1KPRA 3QFDA 4YHML 4NQVB 3PV6B 1I8IA 4UDUB 5I30H 1BQUA 2YD8A 3WN5B 3BX7C 1OGAE 5JMOC 4G6KL 3P73B 2EDLA 3ARBD 4QRRD 1X5JA 2VZTA 5IEHB 1I3VA 3QEHB 5F1NA 2CMRL 1KJ3L 1QSFB 5BJTA 4NYLB 3L5XH 5IMKB 2YPKA 1I1CA 3E6HB 1P6FA 4HZAA 4YO0A 3WFZA 3X11B 4KAQL 1TQBC 2OX5A 4AEIL 1T0NA 4Y5VB 3QZWB 1S7XA 3SDDD 3P3YA 1D9KA 4WO4C 3FHAA 4PTTA 4V1DA 4E41B 1FAIL 4PP2A 2WQRA 4YEFA 1ZHKB 5BQ7A 5I2IB 1G6RA 1NC4D 1X5YA 1O5DT 3VFVA 3FRPA 5DJ0B 5T1MA 3BGMA 1QFWM 5DD0L 1DDHB 1SJEA 1UH2A 5EU7E 4QTIL 3EYSH 3MREB 2E5EA 3DXAE 3OJVC 4IMKC 4FFYL 4LAJH 1Q94A 4X98B 1LDPL 2EICA 3DSNA 4XGZB 2NY0B 4NQCB 3BEWA 4C4KO 1SBBA 2VH5L 5KVFL 4HGWB 4JQVC 1G0YR 1KCVL 3OWEA 1N4XH 5TPWH 4HXAL 3UJIH 1KBGH 2X4UA 5D9SB 3P0YH 5HHNB 1MHPH 4C55A 4YHNB 1MREL 4DQOH 5DRWB 2VLRD 3ESVF 3C5ZD 5C08E 3S35X 5T3XH 1C1EH 3OKKA 4XMKL 3QEGH 2ESVB 4GAJL 1NFIA 3H9ZA 2DYPA 4KRPB 1HNFA 1MELA 3JVGC 5FO9A 4LBEB 1K3ZA 4X6BA 4NUGL 3DIFA 4JPIA 4G80A 1UWXK 4WTZA 3PGDB 5ALBL 4QXUL 1U3HD 2BNQE 3PWPB 2BNUA 4M5YL 1HYSC 4MQSB 4DGVL 3UTTA 3V0VB 4OF3A 1LEIA 1AI1H 2FATH 1RZJH 2VZVA 3BSZL 3PWVA 3C09B 4OJFH 4CW1A 2DTMH 2R0ZH 1FZKA 3H42H 3UROR 4LHQB 5D7JB 3GMLB 2PETA 3L9RB 2W9DL 4FXGA 4K3JH 1Y0LB 2X1WL 3GK8H 4RDQG 4YPGA 1BD2A 4NCDA 5EU5A 4WVRA 2NY5C 1CF8L 2KZ1B 4UNTA 1FIGH 3RWGB 3RVTC 5CZKA 3RZWA 1U3JA 4ELKB 3I50H 3BE1L 9CGTA 1LO5B 4UQ3B 5HYFA 3R06B 1WCQA 4QY8B 2XKNA 5CBEA 1FQ9C 3P9LB 3EOTL 4KDTC 4HMDA 3VWKC 3MYJA 1LO4H 3V79C 5F1IB 5KVEH 2J8HA 4MXVE 4AEEA 1G84A 4XVSL 1NDMA 2MCPH 2D7QA 5EUOF 1TPXC 5DMIH 5GS0L 3WKNA 5F8QC 2DWDB 1HXYA 1NGXB 3MLXL 2ZCKL 5F1SA 4KVCL 2CLVB 1LVEA 4PS4L 4RIRA 2X40A 4S1QL 3CJJA 1IM9D 2OQJA 4R6UA 3FO9B 4GXVH 2XACC 3T08A 4OZIB 2IALB 4YHPB 2J6EL 2DKSA 5J1SC 2PUQT 1AE6L 2EO1A 5CEYA 5TF1H 5KTEL 4LHUD 3DRQB 3SBWA 3ZKQD 1A64A 4WCYH 3NH7H 5FDWB 2LVCA 4JLRA 5I8CA 2DJ4A 5E94B 3DVGB 4GG8B 3I6GA 4HWEL 5GHWL 4K71C 4WTWA 2PW2A 4IBLT 4KZDL 1ORQB 1Z6JT 1WBZA 1KIQB 5EWIH 1Y18B 1CQKA 2C3VA 3FOLB 1RK0B 5F9OL 3K4ZA 2DI9A 3VG9C 6FABH 4QHLA 3G5YA 4OGYL 2H2SD 5TE6L 2J7LA 4HFUL 4HK3N 4KQ3H 3V6OE 4ZXBC 2HN7B 2IG2L 1MIEL 3QXAA 3RWHA 5AD0B 1ZLVH 4MCYA 5TDNA 4NKDA 1AD9B 3OTTA 3VXSE 3CFDA 2NY6B 1NGPH 3V5HB 1MLCB 2FH6A 3U7WH 3O6FA 4JRXA 4R9HA 5T5FL 4KTEH 1B0WA 3MA7A 4JFFD 4B50A 3EYQD 1QFWL 4Q9BA 4F7CB 4L29A 1U8QB 5I73C 2GUOA 1OW0A 4A6YB 1RHFA 4XMLL 1CLOL 1F97A 2Y5EA 1H3XA 3IJYA 5IIEB 4NM8H 2D03L 2WBJC 2H32H 3DMMA 4GAFB 3LRHA 4JB9H 1CDCA 4HKBA 4RAUA 1FFPB 4MLSA 3MA9L 2RAMA 4M7JL 2DRUA 1T0MB 3N50A 4YXLL 2XWTB 2F19H 1VGEH 5DJ8B 3M17A 1J0YA 4GRLD 3QG7L 5MI0B 1CZ8H 3PE9A 5I1AB 3FQXB 3IDUA 4UTAL 1EEYB 1KPUB 2P5ED 1AP2A 3TVMB 1OD9A 1X6LA 4Z18A 1UENA 1QZ1A 3J8F7 1E28B 5JQHC 3L5HA 5FM5O 3GB7A 4OM1H 2FR4A 3L5WB 3KJ4B 4DUWA 4QRPD 2FEDD 1NCAH 5E2TH 4JFDD 1KB5B 1BF8A 4OF6A 2ZJSH 3ARSA 1YY9D 3ULVH 4GG6B 2Z92A 5D2NA 3BISA 3ES6A 1KIPA 1NFDA 1WZ1H 1A9BA 2VXVL 4LVNC 2FJGB 1QOKA 1I8IB 1U8HA 2JIXA 3AS0A 2CXGA 5TE4L 2EO9A 5CSZA 1DFBH 1ZT4B 4PY8J 4P5TC 4U1JB 4HCRA 1P6AB 2VDRH 2H32A 4GRWF 1Z9SA 4HWBH 4FFVC 2YPKB 4ZFZB 1F00I 2KZWA 3DX8A 5L2KD 3FQTA 1PKQE 2DQCL 2X1QA 5FCSH 1D9KB 2OL3H 3MBEC 5IHUL 4V1DB 5IGXH 2JB5H 2ZPKH 1J86A 1OAYL 4P5KA 3MRDB 1KB9K 2QR0A 1WT5A 3D0LA 4L4TE 5BQ7B 1KFAL 1YEKL 2XZQH 4IRJA 2CDGB 5DJ6A 3VFVB 4GKOA 1H3WM 3G04A 5T1MB 3BGMB 4PJFB 1JV5A 4DZBB 4XPFL 3MFGB 4XX1G 4EI5C 2VLME 2AI0L 3BQUB 1VDGA 1IAIH 1T20B 2GITA 5C0FB 3VE0A 3MV8E 1ZLSH 2OJEB 3QHZH 1NQBA 3ZKXB 1NEZG 4XT1C 5H2BB 2FEEL 1TVDA 4UNUA 4EQ3A 2J12B 4HS3A 3GRWA 3CPLA 4BJLA 4Y1AE 4ENEC 3KYAA 1RJCA 2DIBA 3TJHD 2EIDA 3OR7B 3OKKB 3D85B 4JZJC 1NFIB 3IDNA 5FO9B 4GRWE 1JGVL 3DIFB 4E42A 4S2SA 4HWBA 4PJDA 4PGCA 4G9DB 4M8VA 3JTSA 4D3CL 4CUCA 5I19H 1P5VA 4TNVK 1CFSA 1TCRB 5J13B 3QEQD 3UTTB 3FB5B 4HS6B 5HI4D 1NGWA 4P2QD 4UT7L 4YDVA 3EO0A 5LAXB 4ZOCA 4RFOH 4MNHA 3S96B 1EXUA 4KK6D 5DQ9A 3UC0H 5ICXA 2NW3A 5EO9A 4QOKA 1BWMA 3PQYE 3NIDF 5FUCC 4XPHH 4RMWA 3B3IA 1XGUA 2K3TA 4FQXD 1EO8H 1CT8A 1KCUL 1TIUA 2BVEA 4KROB 5AZEL 1BD2B 1FVDA 2XKSA 1IGMH 5I74B 3QUMH 5IW6B 2WANA 2P46B 3WFEL 4WHDA 3G5XA 4WUUE 5EDXA 4OLEA 43CAB 5CBEB 4NBXB 2P49B 2ID5A 4NQEE 2EKSB 3O9WD 1H0DB 4RMVA 3VGHA 1X7QB 1S7RA 1WZLA 1NDMB 2VDLH 3QNYB 1HZHL 5DHYA 5GRJH 3UPRB 3C9NB 2GJ6E 3ILQD 4AENA 1U8IA 5ERWA 2EIZB 4LSSL 1U8NB 5CCKL 1EFXD 2XG4A 3RL1B 1CFQA 3MOBH 3X12A 5TQ2H 3GNML 3UO1L 4NQDA 2OQJB 5EBMA 5D1XC 2DI8A 4NQSA 1G7JB 3N1PC 4TSAH 5CEYB 3U30C 1MEXH 1LNUB 3K1KC 1MJ8H 4O2EA 5I8CB 2GFBB 3IFLH 3I6GB 4UV4L 3ZYIA 2HKHL 4JFEB 3NIDE 4D9QD 3MXVH 3EOBB 4NBZB 1IEHA 5EH1A 4D9RE 1WBZB 3QHFH 4HH9B 4ZNCD 2C3VB 3DXAB 4MHHG 4MJIB 3STZA 2ERJB 3MJ9L 5C09A 5IG7B 2KPNA 5BW7A 4ZOEA 4PJ8B 2DKMA 4PLNC 3BP7A 4K23L 1I1AD 4MCYB 5TDNB 4NKDB 3VXUB 1CLCA 5F7EL 4N8VB 2QQKL 1AO7A 4AL8H 3LV3A 3MJ6A 2FX7H 4PR5B 4Q74A 1I1YB 2GT9B 1F2QA 2RQ8A 1TZIB 1QRKA 3O6FB 4XTRC 5FM8A 5K9JL 5I1IL 5E4EB 5C08B 1YQVH 5HYQA 3IGAA 3AB0B 3JZ7A 5E24E 3RVWC 4KKBC 4L29B 2GUOB 2PO6C 3O6KH 3HS0A 3HFML 3IJYB 2FO4B 2VLJE 4GLRH 3TBSB 2DQTH 5GIRB 3TBYA 3IDJB 1VA9A 3I75B 1RI8A 1MI5A 3KPSA 3NCJH 3PF2A 3D1MC 1RIUL 3KPPA 4Z95H 5EOQH 4TNVF 4NFCA 4RAUB 4LMQE 4UILH 5HYSA 5LBSL 2KKQA 2CO7B 3GI8H 5ADOL 4U0RB 4HUMB 5KVGL 1ADQL 2I60L 1OP3K 1KIRB 3RVUD 3M17B 3UAJC 2YKLH 1A6VL 2G2RB 4NCC2 3VMOA 4JREB 5EB9A 4AIZB 3BHBA 1AQDA 1B3JA 1F3DH 2RB8A 3WUWB 1AP2B 4L8BB 5L8JB 5KOVC 4D0DB 2AQ3A 2V2TB 1P4BH 1T04B 4XI5C 3WXWH 3LN4A 4M62L 2Z8SA 2FR4B 2VQ1A 4GBXC 4DN3L 4F2MB 2H3NA 2X41A 5L7XH 1F13A 4XHJD 1OCWH 4NM4L 3QO1B 2IBZX 4OQTH 1NFDB 5EOCH 1VHPA 1MCPH 3K2MC 2Q7YA 2OYPA 4PJ7F 3CH8A 3HLAA 3KPMB 4QNPE 2I9TA 5BVPH 3JV4A 3H8NA 2B1AH 3MNVA 1WZMA 5JHDA 2FBOJ 5CEZL 2DQDH 3P0VL 4GOSA 4U6VL 5ABDE 3QRGL 4LARL 1MVUA 5GS0C 4RWYH 3HMWL 4FXLA 2HYMA 3DRTA 1K8IB 4ZYKB 2XICA 4RQQA 5HI5C 3DTXA 3VFTB 4P5KB 5E9DD 4QHNB 2QR0B 4LGRB 4HG4J 1NBZB 3D0LB 3RU8H 1UKTA 4IRJB 3CNKA 5DR5L 1XMWA 4HWNA 5I1GH 3V7AE 2DF3A 3T09A 1E4KC 5DS8A 5FA4B 7FABH 5DD3H 1JNLH 4Y4HC 3BPNB 5TJWK 4V2CB 2IEPA 4X4XB 2VZOA 4FOMA 3WIHL 4EN3A 1UA6H 2VDNH 4RMRA 5HPMB 3KXFE 1D7FA 4KZEL 2GITB 2XNAA 4QXGH 3LEYH 5IFAH 4ODHH 4K2UL 3UBXB 3V52H 4FS0A 4U1KA 3FQNA 2BRQA 3WE6A 1REIA 4HS3B 4OQTA 1TMCB 3MRFA 3H9YA 4U05A 5DHXB 3O4LA 4OGAC 4PJ7E 4AG4L 2V2WB 5FYLD 4R3SB 3JWNC 5KSAA 1QFUL 4X6DF 3BUYA 4DVRL 1GOHA 1K4DA 1NCBL 1AGBB 2ICWJ 4YHKL 4PJ9A 2XIDA 1ZHNB 3KPRD 2L7JA 3LEVL 4OCSL 1V3MA 1SYVB 5D8JL 5FYKL 3X3GL 2BSTB 3S3SA 3DVFA 3A6OA 3S97C 3MJGX 4X80H 2AJYH 3IRZA 3TJEH 3LY6A 2AEWA 2VLKD 1CFSB 2OS7A 4GKSA 4JRYA 2OL3B 4WNQA 32C2B 4FP8L 3LKNA 3EO0B 2R39A 3T0EB 4MNHB 5FUOH 4KXZI 2WBKA 5K9QG 5FYKD 1S9VA 1EXUB 3MBXL 2VIRB 4BQBA 4PRHD 5EO9B 4QOKB 1QA9B 3OAUL 1JTOA 5JORA 4JHWL 3B3IB 1M6OA 1XGUB 5C70A 1JZ6A 4PJAA 1CT8B 4OGXH 3LDBB 4WU5A 5FYJL 5DVKA 1P5UA 3K4DA 2EE9A 2GTWA 3MLYH 3KPLB 3O0RH 5C2BH 1ZA6B 3G6DL 3G5XB 1LO3L 4P2RA 4YHIB 1IM3A 4DKEH 4X5LA 1J05A 1U6AH 3S37X 5IHBA 5LGHH 1NAMH 1HHJB 2RGSA 4OI9A 4LMQI 4F9PC 1M7IA 4PYHA 1F4AA 4MA8L 3THML 3NPZB 1T2JA 3QIWC 4WY7H 3SEPA 2CGRH 4AQ1B 3RVTD 5DHYB 1CYGA 2GSIA 4LCUB 4PJHA 1UQSA 2AS5M 2X1OA 1YMMB 4AENB 4BSJA 1U8IB 5F89A 4YIQB 4GXUM 4E0RA 5JW3H 3A6CH 2J8UF 4ODWB 5DVMA 2F5BL 3IF1A 1FGVH 2UWEB 4K3DH 3DUHA 5B3NA 4P59L 5MEQA 4P48A 4YHLL 4NQSB 5LQBH 2EEBA 2B7DT 5TGBA 3BPOC 2CKBH 1K9TA 5FGCB 4PJGF 5GRUH 1GZPA 4MXQC 5F3HB 5ISZA 5GISH 5GRVL 3E3QE 1YEHH 3FFCA 3H9SA 4BZYA 3OJMB 3VXNA 2P5WE 4HIXH 2ITCA 4C56A 2ZCHH 5DVOA 2BERA 2O26U 1ZK9A 3D18A 1SJVA 2V9QA 3LKOA 5BOZG 3STZB 2ARWA 3ZKMD 1BIIB 5HYJA 1NPUA 3QUMB 5I1EL 3S6CA 3F65A 5T1KA 5EUKA 4MAYD 4HIHA 4HUXA 4JFZH 4G8EB 5CINH 1ZANH 4U7MA 1DBKH 1HN1A 3V5DA 5DJZA 5I8EA 5A3IC 2J4WH 3LPWA 1IKNC 1NAMA 5LGJB 1P4IH 2R0WH 1HDMA 1ZTXH 3NZHL 3QDGD 2DQUL 5FUCE 4OT1H 3TO4D 3GHEH 4KKCC 3IGAB 4ZTPL 3BXNB 4Z76B 1ZLUH 1ROWA 5D6DA 3UTSB 2OZ4H 4MA7H 3HS0B 2J8UE 2X4OB 3EGSA 3QT2A 3TBYB 4PJIF 1CXIA 1PZ5A 2NPLX 5LJYH 1MJUH 1JNNL 1FZJB 5I8OL 5I17A 1SBSL 1BGXH 3HI6L 5DD1L 3MRQA 4H8WC 4HDIA 4PIRF 4PJGE 2CKBA 3ARDA 3K0WA 2LABA 1MIMH 4WUKH 1F4YL 5I75C 4FFZH 4WFGE 1EUTA 5INCB 1ES0A 3S35L 2O5XL 1EGJH 3MLWL 5KG9A 3BHBB 1PG7H 1FE8L 1AQDB 1S78D 5DK3A 1R3IL 2CIIA 3ALWA 1U92A 1SHMA 5DFTA 3RVXC 4QXTB 4J4PA 2OLDA 2YZ8A 4F7PB 2XTLA 2XTJC 2A9MH 5F1OB 1MY5A 3EJZC 4O4YH 3WDHA 4FRWA 5SWZD 2IPUK 4MCZA 4Y4KA 1JGLL 1E6OL 2IAND 1NGYA 3GKWH 5IW1B 3QWOB 3QCVL 4YC2C 4TQEH 5GGUB 1KGCE 4KTDH 1D6VH 2JB6A 4FN0A 3C6SA 1MRCL 3I9GL 4QRQB 2Q7YB 2X70A 3HLAB 1YY8A 1JGUL 1BQHB 3SGEH 4BUHA 4DKFH 1DANT 2IQ9H 4RSVA 2JK5B 4XPGH 2NZ9C 2NLJA 4ISVB 4OF5A 4P4RA 3WHE0 1A14L 2AJUL 1JYVA 2IPTL 4L8DA 3ZT5A 1VESA 2AP2A 1R6VA 4YDIH 3QUXC 5KW9H 2WAHA 25C8L 4PUBH 4ALAH 3M45A 2HWZL 4QGYA 4U1IB 4CMMB 4F7EA 2NNAB 3HPLA 2B2XH 1D5ZA 4N1HB 1A4KA 1EDQA 5ID0B 3RGVD 3AAZA 5ITFA 3PG2A 3ALXA 5HHVL 3QH3B 4KK5C 3GBNL 3OX8B 1A7BA 1X5ZA 1J1OL 5ILTH 3PJSB 1AGCB 1DR9A 1A1OA 1QO3A 2QQNL 3GHBL 1PKOA 1J11A 1IC5H 4TUOA 4Q6IB 5B38A 4ACPA 2P48B 4R90L 2B39A 4LNRA 3S3PA 2Y1VA 4R96A 1SVZA 2AXGB 5DD5H 5HGAA 2HFEA 4TSBH 3CSGA 1K2DA 3CXDL 4EN3B 1ZEAL 5IB5B 4ELMF 2VJXA 4F9LC 4NGHL 1D5XA 5HVHB 4OKVA 1FZOB 5IQ9B 4BQ8A 4XNXL 4ZMAT 4ZFOA 5EG6C 5LVEA 1J8KA 4U1KB 3IKCB 3FQNB 4AIOA 5CIPB 1N5AB 4OCYH 2PXYD 2AK1H 1JWUA 4EI5D 4CDHA 5INDA 4G6ML 1FCCA 2GK0B 2Y7QA 5KSVA 3DBXA 4IRSA 4HKXA 1K4DB 1XIWB 4EUPB 4LPCA 4JO4H 5ADPH 2R69H 1PSKH 2NY1C 3F12A 1DQMH 4WW2A 3QDHA 2VLJB 3L3JA 3MRPB 4TSCL 2A6JA 2AGJH 5I16A 2P7TB 1MFNA 3FQUA 1ITBB 2CLZA 3B9DA 4JY5L 4RGNC 3TT3H 4FXKA 3RIAK 3FAWA 4FQJL 5HSFA 4XVTL 4K9EH 5DFVD 1T4KA 5BXFB 4K94H 1F4XH 3HUJF 2HT2C 3QZWG 4JQXC 5JQ6L 4GKSB 4PRBB 5SWSD 4X4YB 3A6BH 1I7ZA 3RUGE 2Y07H 4Y5YA 2BVTA 3TBTB 5LWYL 3ALPA 2FHCA 5FXCH 3V6BR 2BOCA 5AYUL 5FHBL 4KJWC 3PP3K 3SDDA 3P30H 1AHWB 3RY4A 1S9VB 2EYSA 2VL5A 3O4OB 4NN6C 4XCCL 2C5DC 4XCNA 5DTFA 2Q8BH 2OR8A 4OCWH 1KJ2H 3C5SA 5JORB 3MACH 5DURD 3VXRA 4PJAB 3QDME 3LCYA 4PRDA 4ELME 2BXYA 5FOJA 3VH8A 2E7LA 2GTWB 1NLDL 1I1FA 5BOPA 1XZ0B 1NGQL 1RUKH 3OKOB 4R7DA 3MRBB 5IVZB 3BD5A 4JFXB 5DUPH 1KTDA 3LN5B 5DQDH 3SDAC 3P4NA 2RCSL 4RX4A 2BHZA 1IM3B 1HWHB 3C08H 1G9ML 4XH2A 4RGOH 3O8XC 4JG0H 1NAKH 4DK3A 1GPOH 2GJZA 5D2LA 3KWWA 4N0UE 3D3VA 4G43A 1M7IB 2MJWA 1XH3B 4LCCC 3G6AA 5ESAB 1AR1C 5F9AC 1TFHA 3HZYA 3CLFL 4XPTL 2BVUA 5J3HC 2GSIB 1ZGLA 3CK0L 3CFCH 2DL9A 3WIIH 3DV6A 4CU7A 1RVFL 4E0RB 4OZHF 4M93B 4Q9RL 1AQKL 4GRMB 3R8BB 2MKLC 4XNUH 2FB4L 2MHAA 4S1DC 5H94B 2FIRT 5BZDA 3OKDA 1N8ZA 1DBML 3G6JF 3S5LB 5JOFB 3PWNA 5TGBB 5IOPA 3W0WA 3Q6FA 1F6LL 1NMCB 5KZCD 1T03L 1GZPB 1PEWA 3U4AA 3ZYJA 2VR4A 4YK4C 1RFDH 2JCCF 5JTWA 3SOBL 3FFCB 3B43A 1RZFH 2ITCB 1ZA3A 1FVEA 2JE8A 3DVNA 1HHGA 1XGQA 2HLFD 5FO8B 5GJTL 3EYUL 3O2VL 3DHMA 4YNYB 3NFPB 3ULUL 4OCXH 3U79A 3EFDH 2YD2A 3D2UD 4LPXA 4RBPH 2AJXL 4RA0C 3IJHA 4GW4A 5A43C 2PYED 4WWKA 3ZHKA 5M94B 3ORJA 4ZFGL 1JHKL 3RWCA 1CFTB 2IBZY 4HUXB 4I5BA 1DBJL 4H0HB 4YX2H 1FO0H 5HHOE 5I8EB 3QUKA 3DWTA 3Q2CA 1NAMB 2O5ZL 4TN9A 5E5UB 3T77A 4HPOL 3CU1A 1DEEA 2AJVH 2EDDA 4ZQKB 5HGHA 1ND0A 4PJBF 3RY6C 3L3DB 3SE4C 3EJJX 4K7PH 2IAMC 2YS4A 4WDIA 3W11C 2G60H 2AJ3A 1UC6A 1UWEL 3C60C 3NCBB 4OZHE 1F3RB 1F3JA 3EGSB 3JXAA 5BS0A 4APQD 1PZ5B 3ARXA 2Q6WB 3V8OA 3RIAF 4DTGH 1QRND 4PRNB 2ZKHL 1Y6MR 3G6JE 1W72H 5IBLC 1V7NL 1JL8A 4HLZH 3IETA 4HDIB 4IRZH 1NJ9A 3ARDB 5IMMA 2WP3O 4OB5L 2P43B 3PDOA 2R2HA 2VDQH 3UPAA 1J8HD 5E5RB 1EERB 5L2KE 5TQ0H 3O6LH 5KG9B 4LHUA 4R4NC 3MV9A 4K07A 1J1PH 5ICYA