4YDJA

Crystal structure of broadly and potently neutralizing antibody 44-vrc13.01 in complex with hiv-1 clade ae strain 93th057 gp120
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
238
structure length
238
Chain Sequence
QVQLVQPGTAMKSLGSSLTITCRVSGDDLGSFHFGTYFMIWVRQAPGQGLEYMGGILPSTKTPTYAHKFRGRVSISAPGVPPVLSLALTNLTYDDTATYFCARERGRHFEPKNRDNLEGKFFDLWGRGTFVRVSPASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein gp160,Envelope glycoprotein gp160
publication title Structural Repertoire of HIV-1-Neutralizing Antibodies Targeting the CD4 Supersite in 14 Donors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system
total genus 32
structure length 238
sequence length 238
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ydjA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ydjA01
3QFJD 1XGTA 1J1XL 3S97C 2EKSB 2X4NB 4HMCA 1J1PH 2DM7A 2NY6B 3QSKB 3TPUB 1I7RA 4RAHA 3TFKD 4QXTA 3AM8A 3QH3A 2CLZA 4WEBH 4PJEA 3NZHL 1NCCH 2QLVB 1U3HD 2E7CA 4YHNA 5I15H 3K8KA 1NLDH 3X12A 2DICA 4YGAB 1ZLWH 1BQHA 4Q6IC 1K9TA 3H9SB 5ALBH 3PNWB 4LAQH 3VXOA 1F90L 5GGRY 4AEEA 2IF7A 4WO4B 3QIUD 4XBPA 2CLRA 4PD4J 4YBHA 1RZJL 3VXUB 3NH7L 2BJML 3UTTD 1CDUA 4LNRB 5GRUL 1S9WB 1WFOA 4LPUA 2W0PA 1KN2H 4YO0A 3OKDB 3PABA 4Z7WE 4QRPA 3KYAA 3GO1H 1KLFA 3UDWC 3SCMA 3HCVA 4N0UA 2XY1A 1T1XB 1B0WA 3E1F1 4XXCC 4K94L 2VZVA 3T0EE 4RGMB 2SEBA 5C0BA 2IBZY 2LVCA 1FJ1B 3ZL4H 2OX5A 3RIFK 3B9KB 4HG4K 1MFCL 2ZCKL 4NQEB 5EWIH 4LDLB 3U46A 2VISB 1CD1A 3MBED 4MB4A 2DKMA 5IV2A 4PJBF 4L4TB 4XC3H 1U42A 3BH9B 3C5ZC 5F93C 2HLAB 3BJLA 4WTXA 4M1GH 1A6TB 4UQ2B 2BZDA 4PGZA 3I2CH 3QB7C 4P59L 4JY6B 3KPPA 3KJ4B 1KJMA 5MEQA 1JRHH 2W60A 1YDPA 2ADFL 5EOTA 2YD6A 4YEEA 1ED3B 3M07A 1JNNL 1FPTL 5GGTL 1VDGA 1MRDL 3BPLC 3TM6A 2IGFH 1HINL 1MCJA 1OHQA 2EIZB 5HGHA 3EBAA 3BQUC 4JQXA 3MODH 5J4MA 2B2XL 2F58H 5CP3A 4YHIB 1AHWA 4XNYL 3ZT7A 2AV1A 2AQ3A 3DTXA 5JZ7C 2HT3D 1U9KA 2NX5B 1ES0B 1ZEAL 5EBWB 3RVVD 3T0XA 4M9OA 5F6IC 2V7NB 4WV1C 3MBXL 5I1IH 5JHDB 1HHKA 4KVNL 3RWFA 3UPRA 3RX5A 4ZUUB 4NKMA 5DRWB 4KQ3L 1LO0L 5ACLA 3VXMD 1R3IH 3BKML 4KJQD 5IOPA 4FQ1L 3GIZH 5HDLA 4PBVC 4OF8A 5JO5B 3KWWA 1Q9KB 3W2DH 1A6VL 1HHGA 3SDDD 5KSBA 5I71C 4JN2B 1D9KC 3GSXA 1UEMA 4LIQL 4OFDA 1OLLA 2HP4A 4AL8L 1CDHA 1LP9E 1TDQA 3LQMA 1SEBB 1IZKA 4LRIC 2CJUL 3VCLB 3LKOB 5JORA 5ITBH 5EG6C 3QXVA 4Y16B 5IT2H 4PJ5A 4G6FB 1WF5A 2W59A 2WBJB 2A1WL 4EUPA 2OR8A 1U6AH 3EGSB 3RIFF 2R1YB 1SEQL 2AK4A 3IDMA 2E7LA 2XN9B 5D7JD 5FYJE 1M05B 4DOHB 2PYFA 1EHAA 1Q94B 1AFVH 1UM4H 1DVFD 5FEBA 3FQXA 4YHNB 2ED7A 4LHUG 2R2CA 1JWMB 2WUBL 5D1XC 4ZOBA 1MCLA 4PTUA 5I8EA 1HNFA 3FTGB 4R0LB 4U6XA 1KIQA 1UEYA 4ONGH 3VXOB 1CLYH 3DPBA 1ZVHA 2HRLA 4C55A 4GRLD 4LSSH 3RUGA 3TV3H 2OQJA 2X4UA 3F58H 3O8XC 3BXNB 3GSNL 4XNZB 5E99L 3CXHJ 4NHUA 3NAAH 2PXYC 1CFVL 1T89C 4Y4HC 1GPOL 3RX8A 4PFEA 4LRNL 2BY0A 3VG9C 2F15A 1RULH 5IHLB 1N4XL 5EULV 3KR3L 1ZS8A 2R69L 2YRZA 4L3EA 5D1ZC 5GSRB 4MXVF 1WLHA 1QBBA 1R3JA 3HNVH 5CD5C 2UZXB 1OW0C 5MERB 2DWDA 4D9RD 3LD8C 1UXSB 1IC4H 4DZ8A 1MLBA 2VLKD 1P5UA 4YHOH 3MLXH 1N0LA 4PGCA 3MUY1 3O3BB 4JFPA 5D4QA 5EN2B 3R8BB 1JV5A 2DYPB 4LLWA 3MLRL 2J8UF 1T21A 3MPCA 5D1QB 1NPUA 4ZFFB 1IGIL 3AS0A 3EYSH 1WAAE 3QHFL 2AKRA 1MAKA 4HWBA 1T0NB 3UTSA 5IEKA 4HJ0D 4Y5XB 1XF3A 2F53D 4WI4A 1LEGA 3MXVL 1QOKA 4PLKC 3IDGB 2V2WA 1DBAH 4Y2OA 2NR6D 2HJKB 4QY8B 2W9LA 4K2UH 2AXFA 2Y5TB 4LCIL 4PD4K 4LLUA 2WBWB 5GHWL 3VGFA 5HGHB 3S8WA 1R6VA 3W11C 3QG6A 1SMOA 2R39A 4FQXA 5I30L 1I9JL 1HILB 3NBNA 4PRPD 3P3YA 3VFTB 1CK0H 1UQSA 3H3KA 3H9ZA 1NC4D 1HHKB 4C57C 4F7CB 4FTVB 1MFEH 4AJ0A 1IT9L 3QUXC 4FQCL 1PAMA 4Y0GA 4H25B 4YC2C 3H42L 5E9DA 3TLRA 1GOGA 4ZTOL 2WK2A 4Z6AT 2DM3A 4X6CF 5IMOB 1MJUL 2WWMC 5KG9A 4FQ2H 2BHYA 5BW7C 5HD8C 1PW3A 2R4SH 2X4OA 4EOWL 2YD1A 4U6YA 4PLJD 1FFQA 1MHHA 5TDPA 5HHMD 3BIKA 5GS0L 4LSVH 4BSJA 3LEYH 1LMKA 5HGGS 4EUPB 2Y7QB 1XT5A 4LARL 3QAZB 2QTEA 2JJUA 1MVFA 3OB0H 4JHAL 1G7HA 1HQRA 1N6QL 4NJ9H 4EN3C 5INDB 3QXDB 4I3SH 3IFOA 4JKLA 4PJDE 5FGCB 5IF0B 3SGEH 3MA9H 4EI6B 4XCCL 1DQML 1XGRA 4LL9A 4GAGH 2E7BA 4H88H 5DEGA 2RB8A 4ZAKC 4MQXC 3EOAA 3VJ6B 4Q6IA 5ID0B 1GGCL 2Z92A 5LGKA 1DUZA 2J6EA 3UYRH 2OQJB 1I1AC 2VABB 1HYSC 2W91A 4JLRB 1JWSB 5KSUB 3QR2A 5DR5H 1P9MC 1OAZH 1CDCA 3R06A 1MCIA 4XNXL 3T1FB 1X5XA 3T0EA 4UT7L 3RVUD 2ZUTA 1D3CA 1ZS8B 35C8H 3TCLA 5BV7C 3ZE2F 3BAEH 3C6LB 1KCVL 2DN7A 4JFZH 4BQ9A 3UDWA 2X9YA 1YMHB 5FO7A 43C9A 1R3KB 1SM3L 2G5BB 4UV7L 5JW4M 1C12B 2ICEA 2HT4D 4KI5D 2AEPH 4MA8H 3LN9A 3PL6B 3L3KA 4R4BA 3SOBL 4MAYC 2HVJA 3U83A 4LP5A 3DYPA 3D0VA 3P0YL 2A9NH 1FYTE 5E6ID 2FJHA 5E2VH 2G9HB 2R2BA 2O5YL 4F57H 3QULB 3C5ZA 5GGRB 4HIHA 4P5TA 3TBVB 3GSUB 2HTLC 1A6WH 5FK9B 1XF2A 2OI9C 9CGTA 3H8NA 3QA3B 4KHTH 4OCLC 4PJFF 3I50H 4KK8C 4X6FB 2X1OA 3PWPE 3ET9F 1P1ZA 1AJ7L 1LO5A 2PN5A 3S37L 4XI5D 4NNXA 2W0KA 4LLMA 2UWEE 3FT2A 2J2ZA 1QLFA 4MS8C 2GAZA 4MVBD 3ALXA 4HHAA 4M7JL 5DXWA 1CIDA 1YNLL 3HC4L 5F1NA 4CDGC 3BQUA 2OJEA 4CADB 2BRRH 5IW1B 4HDIB 1F3JB 3BHBA 3SPVB 4LHJB 4UAOB 2X4SB 3GSRA 5HYQB 1UM5L 1QSEB 3PF2A 2P8PB 1FH5L 1WFTA 2DLFH 3BE1L 2IEPA 3CXDH 1LP9A 4HKZA 4X6BB 1CTNA 2H32A 4QHLA 5C0EA 1CDBA 1NCDL 3SKOA 1IAOA 1D6EB 2K9UA 4LSDA 4YUEL 5DLML 2R0LH 1B0RA 1QFUH 1KPUB 1VACB 3ES6A 5E5RB 1A6AB 4KK6C 3LMJL 4LRIA 3SBWC 3QIWC 2V5SA 5EPMB 2ERJB 3DVGA 5KZCB 4HWBL 4U3XA 5J8OA 4K8RH 5C08B 5T5NF 4HH9B 3T77B 1IILE 5D7IB 1KN4H 1RZ7H 3V5KB 4JPKH 1DEDA 4X6EA 4MLIA 4Y7MA 4V1DD 4EI5D 3HR5A 4YXLL 2CKBH 3ECBB 5GRZA 3D85D 2VXUL 2X2YA 1WBZB 2Y36L 4K7PH 5E2WH 3V0WL 4YR6A 2HFEA 3EO9H 4ALAL 1CD9B 5D1XA 1AXTL 5IMMA 4RGNE 5DEZA 5HI4D 4KKBD 4LF3A 1KJ3L 2AJVL 5E70A 2WLZA 4G8FB 4E41D 1IARB 2ARJB 1JTPA 2GUOB 3Q5YA 2QSVA 2PXYA 4OGXL 4CVXB 5H35A 1T89A 1E4XH 4Y4HA 1L4IA 4PJAB 1RUML 1CFTB 1P7HL 4JFEE 3QPQC 4PB0H 5IVZA 1OQXA 5CMAB 5EU6D 1IAKA 3WS3B 4F15C 4QF1B 4DN4H 4JDTH 2P44B 3P4LA 1ZVYA 4H8WL 4KVCL 2MWCA 5ADOL 1OW0A 5BO1L 5JQ6L 4JDZA 3ZKND 1Q0XL 1WAAA 4M5ZH 2CD0A 3MRHA 1AC0A 5FM5O 4LEXL 4DGVL 4CBPA 2DQIL 1N7ML 3MV01 5LGHH 2E9WA 2JJSC 2QHRH 3LZFL 4OF0A 2IANE 3IDUA 2CKNA 1GIGH 4P2OC 5TE7L 5DK0A 5A2LH 1WGOA 2RFXB 3M17A 2GCYA 3AB0B 1MRFL 3C5JB 1I9RH 2ITCA 3GRWA 2E7MA 1FE8H 1KOAA 2XFXB 1S78C 3BPLB 2ZJSH 4C83A 4L4VB 3UMTA 1EHNA 3LKPB 2H2PC 4JG1H 1ZHNB 1EGJH 1ETZB 1KTKE 5F1NB 5DUML 3BQUB 2VH5L 4KZEL 5CINL 5FCSH 4GMTL 1EO7A 4WGWB 3KYNB 1VFAA 5EIIB 5J11C 5F6IB 3MLZL 4WV1B 2P8LA 4NKIH 5C0JB 4IIQA 4NQCB 4PGDB 2GJ6D 2X10A 3LPGA 1D5XB 4NGHH 1G9NC 4LASH 4NZJA 5DRNB 2VDKH 5IMLB 1G7LA 4ODXA 5HYJB 1YY9D 3VH8G 4QHLB 4QGYA 4X9IA 4MCZB 3X13A 5I71B 1X5JA 1D9KB 2BHUA 4LCYA 5ICZA 4XTRD 1F6AB 4OUUB 4LLQA 5BZDA 4P5MB 1VGEH 1JE6A 4I0KA 5LWYH 4PJDA 3NTCH 2AEQL 1PVHA 3AREA 5CGMA 3K46A 1UWEL 4JFFB 1CL7H 4OLYH 3MV7E 5FYKH 3NGBC 3CC5A 1BREA 1P84J 5C0BD 4YXKL 3OJMB 1URLA 1WVZA 1OTTD 5C0RL 5J13C 5FCUL 3MREA 3QDGB 4X7SH 1ND0A 4CMMA 1MCDA 1IGFH 5GQBA 3MRKB 4ZO9A 3VXUE 3VGDA 2GTWB 3IFPA 2XKSA 5GS0D 5E94B 4P4KB 4MDIB 3GSOA 1UB5B 3ULVF 4AENA 1MWAB 4XMKH 5FV1L 3FHQA 5C0DA 5ITFB 3O8XB 2C5DC 3WFZA 4U3CA 2CIKB 1Q9OB 2OXGA 1P9MA 2HN7B 4HFWB 3O81A 4GXUM 2EDNA 5GZOD 5D1ZB 4L8DB 3ZLQC 4M7KH 3MRRB 1XMWA 3ZYZA 1FYTA 4M3KB 3LD8B 1HSAA 4KMTH 2APFA 1SY6A 2M26A 3BDYH 4OCWH 4KDTA 4TSAL 1NCWL 4HAGA 4QRUA 2DQJL 4QHUA 5FYJL 1JGEB 5CUSH 3QXTA 3WIIH 1AKJA 2HFGL 5DJ8A 3LOWA 3RQ3A 4Z0XA 2YPLD 4LOUC 4P3CH 3PP3H 1N8ZB 2MHAA 1MOEA 3HE6C 1MAMH 3SKUD 3RKDD 3PWPA 3L3DA 4KTEL 3DLQR 5F1IB 5IVXF 3TJHC 4ZD3H 5IB3B 1FN4A 1TZGL 2E27H 1JCKA 4OLVL 3GSWA 5TQ2L 4OT1H 4H1LB 2ITCB 3BGAA 2XA3A 3BZ4A 3GJFH 3MOAH 2OR9L 5EU3A 3R8QA 5J06A 4JO4H 2DTML 2XG4A 1EVTC 3NCBB 2P42B 3ZDZF 5SX4H 4BUGA 3B43A 2GHWB 5LJYH 1Z3GH 3ULUH 4OGYL 4APQB 4JPVH 4GBXB 1EPFA 4AM0B 5I1GL 4UOW0 3OR6B 1TXKA 2GIYA 5L7XH 1LEIA 2AK4D 4MSWB 4Z8FL 3LS4L 4I3RL 1ZHLB 2FX8H 3OAUL 4M9PA 1WZKA 1XGPB 3T0WA 5L2KB 1JPFB 1QSZA 3P9MA 4O00A 4NKDA 5D93C 4DN3H 1AGFB 3QUXB 4IMKC 4ZSOA 2EECA 2F8VA 4PLOB 4YC2B 5B8CC 3UC0H 3V79C 2V7HA 3RJQB 4JB9H 5BRZB 2BFVL 2D9QB 4KJWD 4IS6B 4IDJL 5IGXL 3MZTA 4NO0B 4WFHD 2DL9A 4BFIB 3G6DL 4RQQA 3UTQA 1A7QL 2LAAA 4OM0L 1LEKA 3MNZA 2QL1A 4OI9A 4OZFB 1MNUH 4PBWD 4LLVA 4NHCH 1I8KB 2PNDA 4OCMC 5BVPL 1IEBA 4JQVA 1G7PB 1BF2A 1K8DB 5HHNA 1WICA 3FQRA 2AJXH 4AT6B 5BVJA 1HHJA 4DUWA 4JAMA 3BESR 1BM3L 3HNTH 3TH2T 4X5XA 3GRWL 4EN3B 1MHCA 4HSQA 4X6DB 1EO8H 2FO4A 2ZUQC 1KELH 4M1DH 3BVNB 5IP4A 5CBEB 4ZAKB 3VWJC 1CE6B 4HCRA 3UTSD 4TN9A 2EYSB 3RY6C 1T03L 4JFEA 2VXQL 4OF7A 3UEZA 4TTDD 1I1AB 4WFED 4U49A 3OKMB 4G7VL 2YD7A 3PQYB 4L3CA 1P4LB 2PTVA 4UT9H 4U1GC 2FLBT 4WI7A 4ETYA 3UTPE 4W81A 1H3PL 3FB7A 3TT3L 3MJ8A 2PR4L 4DGIH 5J1SC 2HKHH 4MQ7B 3SEPA 3IDXL 4YWGL 3G5ZA 1IEHA 3UTZB 4YHYB 1KTDB 3KPQB 4FQXD 4WFFD 2Q76A 3MUZ1 4NUJB 5F9OH 3G08A 2EYRA 5B3JF 2IANA 3SDCC 4PJ9B 2I9LA 3MGTB 5F7EL 3RU8H 2Z35A 2VL5A 3MXWH 2P7TA 1DN0B 4RMVA 5D72H 1PKQB 2YRPA 1EFQA 1EEQA 5DJ8B 4BK4A 4MAYB 3K0WA 5CHNA 4BSVB 3VFWB 5CEZE 3S34H 5FYLL 4R7NA 2I24N 4NPYA 3FB8B 5E9DD 4OZ4A 1Q8MA 2V17L 4NFBA 4P2OA 2FB4H 4QHNA 3W39B 4IHOB 1WT5C 3GSWB 3QPXL 2OP4L 3N9GH 4HT1H 1QHOA 2CDFB 2F19H 1FNGA 2OI9B 3P9WB 1OPGH 1SBSL 4PGBA 5C07A 2ARJQ 2ATPB 3F65A 1I7UB 3O9WC 1AQKL 1MQ8A 1QFOA 4GLRI 2I60L 1G7IB 3FAXA 3QO0B 3VXPB 4QOKD 3GBNL 2PW1B 3B6SB 1JGLH 4PIRF 1H8OA 4S1RL 3SKJL 3A0OA 2IAMD 3W9EA 4FTVE 3S9DB 3CH1B 4XVJL 2XV6B 4HK3J 5HGAB 1JHTA 3VFOA 5DUPH 5HYIA 3VW3L 4TTGA 4Z9KB 4QLRA 2QJDA 3MRIA 3WFHB 1MCSA 3MLTB 4ZSOB 4ODUA 1S5IH 5FIEA 1OP5K 4OCNC 4XP4L 5BV7L 4YQXH 4I4WA 2HFFA 4HXBH 3STBA 4UILH 3IS1X 2EKJA 1SY6L 5DSCA 2DM2A 5ENWA 1L6ZA 4RNRB 4D9QE 2V2TA 4R8WH 5IJVA 3ARDC 3GKWH 1K5NB 3UTQB 4IRSC 1YN7B 4K3HA 1B2WL 5MEPB 2YA2A 1YEGH 4PUBH 5F7DA 5KW9L 3MV7A 3GGWB 3T0ED 5EIVA 3QIWB 2VR5A 5I1KH 4JKKA 3WYRA 1BFVH 1TTGA 2A2QT 1B4RA 2KH2B 5J6GB 4KXZH 4PGEB 1FZMB 3QUMA 3CPLA 1Y6KR 5E8DH 1INEL 4X5XB 1P7QB 1RZKH 3RAJL 2Z4QB 3BEWB 1UM6L 1AGDA 2B1AL 4QTIL 1CLOL 5C8JA 3MV9E 5DMGC 1XH3A 1T1WA 3BP6B 2NY4D 2GTZA 4UNUA 5ICYB 4J3OC 5D7SH 2W9DH 4ZS6C 3VA2C 3N85H 4JFQA 5DQJA 3P77A 2MCG1 3BO8B 1EAPA 4P5TD 4GUPA 3SDXB 5SWZB 4R96B 1IQWL 4X6CE 4C4KT 2VKWA 3B3IA 2ZCHL 1XF5B 1X5HA 3P4OB 3MNWA 1ZLUH 2Q3AA 4O5LL 4CN6A 2GSGB 3ARFC 4E42A 4LHUB 1ZVSB 4Z78A 4KROD 3T8XB 1MCPL 4BFEA 3AMKA 4F9LA 2EXWC 4F15B 4HPOH 1O7VA 3P30L 2ED8A 4A2MA 1NSNL 4NNYB 4EVNB 2VL5B 1CLCA 2MOVA 5AD0A 1TZIB 2XZAH 4ODVH 3S5LG 3G5YA 1IAII 3LKNA 3CFBA 5HHVH 3O2WH 1BFSA 5F6HI 1UYWH 4XGZB 2G2RB 5DK2A 3WLWD 4Z76B 4TSCL 4Z5RA 2B39A 3X3FL 5C6TH 2EDYA 1KULA 4R4ND 5T1KB 2FLRT 3WKMH 1RUQH 5AG8A 4G6KH 3HI1A 1X44A 3X3GH 4C56B 1FNGB 1G7MB 1A1OB 1VA9A 4XPAL 4FFYL 1QQDA 3D6GA 4FHBD 5C07B 5TDNB 1ULVA 1U8IB 3RX7A 3HZKB 4P49A 5E00A 1I8MA 2MCPH 3MNVB 4BSWA 2CH8A 3CZJA 4UBDD 4FFZH 5DWUL 1KFAH 5FGSA 4CUCA 3W9EB 2NY5H 4XP6L 1BJ8A 4GAFB 3WO4C 2ZSWB 5D7LB 2EH7H 2XI9A 1HQ4A 3D48R 3OKNB 4M93C 1JPGA 3K80A 1U3JA 1R5IA 1QLRA 4XX1E 5J11B 1OGAE 4R7DB 3FT4A 1SVZA 2H2SC 4KJYB 5GJTL 2Z31A 1AGCB 1QPXA 5FYKU 5DC4B 2PYEE 5DJZB 1U8MA 4UDUA 4H26B 3GEWB 4IMKA 5DHYA 4X0KA 4YHZH 5IHZA 5D2LB 2AGJL 4O58L 4QHMB 2E5EA 4PRHB 2AEWA 5HDQL 3V7AE 1UGNA 2OYPA 5DSCB 2I9TB 4XHJD 1T0PB 3MLUH 3RY5A 1QD0A 3EOBB 2ESVB 4LLDB 4FNLH 5DVOA 4U1LA 5I19H 3D25B 3DARA 5F7DB 4Y19D 3VA6A 1VENA 1I9EA 4PJFE 2R8SL 5DO2C 1YJDH 2Q3ZA 1JK8A 3E8UL 5DT1H 4BH8A 2O61B 3FQNB 1EJ6A 2DQCH 4O2FA 1VCAA 2YKLH 2D4FA 1QBLH 3CPLB 2B1HL 2ZCLL 3NPZB 1KLUB 4JY5H 4KHXL 4D94A 1MREH 3NGBB 4JDVB 5TGBB 1XR8A 4WI2A 2GITA 4KRNA 5JW5B 2XQYG 3H0TA 2P5ED 5L6YH 4ODSL 3B8SA 1CFSA 2P47B 1RUAH 4QYOA 3U9UB 4JY4B 1A14H 4WUKL 1E6JH 4DK3A 5KTEL 4K7FA 1WK0A 1FVDB 3DRTA 5DQJB 2XTJC 2LVEA 4YX2L 4UTBH 3WSQH 1PEWA 5BXFA 3EJZC 3RY6A 3WFBL 3QCUL 3CUPA 4XP9L 5K93A 3Q5TA 3Q6GL 3RNKB 4NZRL 1J0IA 1KIRB 5EDXA 2OZ4A 4E42B 3W0WB 3I84A 3QI9C 1OP3K 5IJKC 2NMSA 1G9NL 1VERA 1LO3H 2OJZL 4G8IB 2AS5M 2VDRL 5IB5B 4XPGH 3W5MA 4I18C 1RPQA 1BHGA 3LSOB 5EU7C 5A2KH 4S0SD 1FIGL 4TVPE 1MI5B 4F9PA 4JHWH 1X6LA 4X9BA 3IYLW 3LCYA 5E8OB 1J86A 1BLNA 3BKJH 3BYTA 4O02H 1WBXA 3GJEB 5T1LB 3DETC 5KJRH 3BRFA 5CGTA 1SMAA 3FQTB 3U1SL 4I13B 3GMNB 4OZHF 1PG7X 4E5XA 3LDBC 2B0SL 2AP2A 1FVEA 3ALWA 4K3JL 5DHVA 3QQ4A 2JIXB 4ZXBB 1PQZA 1J87A 3HE7C 4OGAC 4P2RE 4OFKA 5I73C 3HE6B 1T80A 2GQHA 2OS7A 1PYWB 5IESL 3VGGA 1DUYB 3QUML 3U6RA 1OM3L 2L4OA 2AXHA 3SE4C 2NY3C 5C0IA 1KCUL 4G6JL 4M48H 4J8RB 1EFXB 1DQJB 4N8VA 4DVBB 4UINH 4BFGA 2HA1A 1OAKH 5KVGH 5F21B 5EO9A 4N0FA 4W4OC 1CQYA 5ISZB 3O9WA 2IPTL 3BT2H 3X11A 3N1QC 3ARED 5EA0L 2DLHA 4XB8A 1NEZA 1BVLB 5HGBB 3BISA 4YPGB 1UVQA 5DVLA 2VZ3A 4U1IB 3MCKB 3L3OB 4PJBB 5DMKA 5HYJE 4BQ6A 1FNAA 4WI6A 1G9MH 4Y4KC 4HQQH 2P46B 2H1PL 3TO2B 1C16A 4KDWA 2VLJD 2DQGL 4QNPF 5D93B 5FUCC 4CMHC 5K59F 4O4YH 1ZLWK 4HV8A 3F12B 4R4FH 5B8CB 1MCEA 3KLDA 4L8CA 4RMQA 3WDHA 1NBYB 5D8JL 5D9SB 3L5IA 4U1LB 3AUVA 5GRYA 5FUCE 1F4YL 3TNMB 1A3LH 1R5VA 2Y6SC 1T20A 1OTUD 1U95B 2HVKA 3KGRA 2EDBA 2GY7B 3TESA 1QPPA 1MF2H 4JGUA 4U0QB 1BAFH 5FF6A 3V4VH 4OTXL 1U8JA 3DXAD 3RWCB 4QT5A 2F8XC 3MV9A 3QDGE 4QRRB 1FL3B 3KHOA 4NKOA 4UV4L 3FB5B 3K4AA 2D7TL 2QQKH 1FYTD 1F4HA 2GK0A 4UIMA 1QA9A 4ZUWA 4S10A 1BFOB 1B9ZA 1TCMA 3H0TB 3TBTA 2HAZA 3C9NB 4PG2C 4YE4H 4P23C 1Z9SA 3PIQA 1JGVL 1AKJD 4X6CA 2ZUQB 4JFDB 2JE8A 3VXTA 3FN3A 1J1XH 4PP2A 1BMGA 4KRLB 1ZT1A 3D2UB 4WI9A 3DUUA 1U3ZA 3VWJB 3NZHH 1Q9LA 2JJTC 3B2UD 4F7EB 3H6JA 2IFFH 2VWEE 4U1GB 3MZGB 1QFWM 3WE6A 3JV6B 1AE6L 1F90H 3BP4B 3ARFA 3GUTA 1HI6B 1XGQB 1NC2B 3HI6H 1TJHL 4QCIB 3FL7A 3NH7H 4FA8A 5IEHB 2DWEB 4HWUA 5AZEL 5GRUH 2HMIC 4CAGA 3EYVB 2BSRA 3H2WA 1T3FA 2CK0H 3SDCB 2AV7B 3TYGL 1JNLH 2R1XB 4X5WA 3CFDA 5DHVB 3ULVC 3FCTB 5CEXA 3CFIC 1K8IB 4K94H 3GB7B 4Z7VF 1DANU 1UC6A 4S2SA 5C0IB 4N0RA 4P2QE 1MFCH 1QO3A 3T3PF 3BD3A 3V6OC 3B5HA 5I9QC 1IZJA 1LO4L 1IL1A 2CDEB 1C5DB 2Z91A 5L8LB 3L3JB 3WLBA 5H94A 2D7PA 4B41A 5EO9B 3GMOB 4DEPC 1P4BL 1OGAA 5EUKB 4X7DC 5J6HB 2NZ9D 2DMCA 3TBWA 1GOHA 5LBSH 4CJ1A 3HPJA 5EBMB 1VSCA 1CGYA 5KAQG 1JNNH 1FPTH 1T5WA 4JFXA 2J8UB 1LE9A 5DEFB 4OAWA 2OZ4L 1R3HB 3RL2A 3VWKD 5CCKH 1EUTA 4RGND 1MIML 2R4RH 2B2XH 1C16B 1XZ0B 4WY7H 1KPRA 2OK0L 4OF6A 1M1SA 2PO6C 3LH2H 3C09C 5IBTL 1FL5B 2DQTH 2DMKA 4LSTH 5I1DB 5I1LB 3HMWH 1FRGL 2W1NA 4XAKE 1AIFA 2RBLA 5IFJB 4PJFA 1DR9A 3H9HB 4JFED 3I6KA 3MRMB 4FABL 1DJSA 3ARDB 2RGSA 4OBRA 4IRSB 3GSVB 3PP4L 4FQ1H 4XCYB 5DMJB 4GXVL 1A6VH 2XWBB 5EOQH 3DYMA 3QHTC 1N3NB 3IJYB 3ZDZE 1LE5A 4QXGL 4LIQH 2C3XA 2V9RA 3K1DA 4AL8H 1CZ8L 1U8PB 5SWSB 5I8OH 4JM4L 3ILQC 4FZ8L 2CJUH 4C54A 2IAND 1GZPB 1W0VB 4OB5H 4Q74A 1DEEA 5EO1B 2J4WL 3EHBD 1UWGL 3S4SA 1S7TA 2A1WH 3H7LA 3GMRA 1SEQH 1X5IA 2JCCF 4FG6C 1NGZB 1WFNA 2BX5A 3NIFF 5C09D 2W92A 1J9CT 1MFAL 4NFCA 4ZNCD 3LKQB 4HX1A 5FKAA 4IRJC 3EFDL 1M7IA 2MJWA 2FEDD 1RURH 5K9OA 2ADJB 2HLFC 3VMNA 3QI9A 5IJKA 3P4NB 3A6BL 4V2BA 3V6FA 1RSFA 4S1QL 1YEKL 2X4PB 1NAKH 3ARBA 5J1TC 1YN6B 4ODBD 5E99H 3DGGA 4I18A 3V4UH 4MNHB 2D31B 2VDPH 3SE8L 1CFVH 1JL8A 4M6NH 4OCXL 5FKPB 1GPOH 2BSRB 3BUYB 4Y2DC 5JNYA 1HZHL 4LRNH 4L29B 4P2RA 2X7LB 1N4XH 2OCFD 4XWOD 3PGFH 2VQUA 2R69H 1A5FL 3V5DB 3B4NA 1C7SA 2CDGB 1B0GA 3DX9A 3C2AL 3QBTB 2APXA 1C08B 1QG3A 3CVIL 5BMFH 2LE9A 1LK2A 3WHE1 2ZOKA 1QO3B 3R4DA 3OKOB 4HMDA 4BZ2L 3MLRH 4M43L 5CZVH 3BEVB 1IGIH 3C60D 4UIKH 5ID1A 5LQBL 2APVA 2XWTB 3U4EB 2OLDA 2FJFB 5HVHC 3BMVA 5EBLB 5MI0B 3QHFH 3WNKA 4LPWA 3HG1E 3MV7D 5MP6L 1NGXB 4MGXA 3J7HA 2O5ZL 3A67L 4HUWA 3L5XL 5FHBH 4JPIA 3HPJB 4GG6F 3WO4B 3HNSH 5EC2B 3TN0A 1UJ3A 1Y0LA 4OAWB 3VXUD 1GGBL 2C3VA 2JLLA 4LCIH 4CU7A 5GHWH 4ESKA 1OSZB 4KI5F 4WTZA 4DWHA 2DQEL 4K71B 2FECI 5I30H 1I9JH 3RVXD 1KC5L 3VFUA 3VXSB 1F02I 1JGUH 4M8QA 3T08A 3S35L 4ZFGH 3JUYA 3DI3B 4GW1A 1HDMA 5GIRA 2FBJH 4G6ML 1P4IL 5INCA 4ODHL 5MENB 3R0NA 2LFGA 2AEIT 2IMNA 1IT9H 4D8PA 1ZT7B 3HRPA 4XBGB 4M6ML 5GRWA 3O6ML 5KVDH 3MSPA 1SJVA 4UMGA 5EB9A 2OL3B 1A2YB 5ECJE 3WS6A 1IBGL 2V5MA 3G6JB 4NZDA 3OKYA 1MJUH 4L4TD 1LE5B 1SYVA 3QDHA 1ONQB 1MLCB 3UJIH 4NRXB 1TFHA 1FGNH 1U92A 5GGUA 3STLA 1YMMB 3AY4A 4XP5L 3D3VB 4XPHL 4PY8I 5FOBA 2H8PB 4PRIB 1WWWX 3BWAA 3VXRB 5EZJB 1Y18B 2CRMA 5K9JH 3VFSA 3ALPA 3SDXE 3IDNB 4LARH 1IM9B 1JFQL 1EAJA 2VAAB 3BZEB 5DD3L 3V6ZA 1AD0A 4URTB 1N6QH 1W2KT 5C6PB 2YSSB 1SJHA 2FATH 4I1NB 4ZPVB 2EXYD 3D87B 1FYHB 2XTJB 5DJXA 3WUWA 4KUCD 4GS7C 4LFHG 4XHQA 5FDWA 1D5ZA 4JRXB 5HTSA 4LAJH 1NL0H 2W0FB 5HGDB 1S7RA 4OLEA 3GNMH 5HYSG 1YEEH 2JK5B 2NTFB 3QI9B 4MD0B 3ZKMC 1GGCH 3S88L 1KUMA 4I18B 4P46C 5I1EL 4I77L 2AJUL 2WMPA 5JNYB 3OAZH 3DSNA 5HHOB 3OG4B 5I1JL 5FB8A 1DE4A 4UT7H 2OTWA 1IGYA 2FX9L 1MFBH 2XXMB 2AJSL 1KACB 2W9EL 3LDBB 1KCVH 4P2QA 2Z31D 5HJ3A 3NACL 4FXLA 1FC2D 2VQ1A 4OSUL 4UV7H 4FXKB 3HE7B 5FUOL 4MNQE 2WBJD 4JZNB 4RCAA 4MQTB 4I0PC 4KH2A 4M3JA 1F11B 3FZUD 5CGYC 1HHHB 5DQ9B 2I5YL 1ORQB 3FQUB 2NY3B 1RY7B 3E3QC 4LLYB 3P0YH 2EDFA 1IKNC 4ZOEA 3V6OA 1AGBA 4EUPH 3VFRB 5DJDA 1GH7A 2QSQA 4G6AC 5I1HL 1E4KC 3BH8A 2DJ4A 3MV11 3FO1B 4YNYA 4JPIB 1A4KB 5I1CL 1T22B 2XZQL 5EBGA 3PJSB 1EBPA 4KAQH 3DIFA 4F7PA 4OI8A 1Y0LB 4UTAL 4FQQB 3CZFB 3S37H 4PB9H 4RAUB 3TYFB 3O6FC 4GRWF 1YUHA 3QEQE 3KXFE 4HUVB 2NY0D 1R5WB 3TO4A 3L95A 1YNLH 2WINA 3HC4H 1A6UL 3IKCB 4Y4KB 2GSIA 1Q1JL 1UACL 2C1PA 2R2HB 2X1PA 3A6CH 5IVXA 4CMHB 1CR9H 2PO6A 4QRQB 2A73B 5MEOB 1PSKH 3UTPD 4JO2L 5KVEL 3MRBB 1JJUA 2VLRE 5J12C 1UM5H 5L9DH 4MWFA 3EJYC 4YZFE 1LQSR 1UJTA 3DV4B 4S0TD 4B7IA 3D69A 2HJFB 1CLZL 4D0BB 3ARGC 4BYHA 1SYVB 4TOYL 5EZOH 4NYLA 1IQDB 1NCDH 2ENSA 3EZJB 5BS0A 2EDLA 3STLB 5LKNA 5DLMH 4F58L 2DJSA 2BHZA 4CNIA 4GAYA 2XA8L 3KPTA 3DX6B 1MJ7L 5CEZD 3LMJH 4YJZL 1XCQB 3BWAB 3PG2A 4ZFZB 3LN5B 3CX5K 1YY8B 3VI4F 5ACZA 4HWBH 5E8EA 4PJEF 4H20H 4P23B 2ZSVA 1KG0B 4B0MM 3WNNA 1Z0NA 3P40A 3MRDA 2NY2C 4WDIB 2R0ZL 1SJHB 2Y72A 4TVSa 1FP5A 1YECL 4X9HA 4HC1L 5DUBB 1WBYB 3WXVL 2VDLH 3QNZA 4LPYA 1GL4B 2N1KA 1SHMA 1NGWA 5FO8A 2YC1B 3V0WH 2Y36H 1V5JA 3GMLB 4ALAH 4IRJA 1TVBB 4I8DA 4RRPG 1DQLL 1AXTH 4WEUD 5JUEH 4KKLC 2K7QA 4FTVD 5BQ7B 1UH4A 1B6DA 4YBQC 4JFYB 3DMMC 5GRJH 5CZKA 1KJ3H 2AJVH 4XXDA 2YPKA 1NCNA 4DFHA 3CFCL 1E27B 1WCBB 2W65A 1KXVC 4FFVD 2DQFB 4OGXH 1HH6A 5L8KB 3MRCA 3C08H 4TPRH 3EYUH 4RZCA 4IJ3C 5HI5D 5C3LD 4LSQL 5F9JB 3HAEB 4N1HB 4D9QD 4XP1L 5ADOH 5BO1H 4G3YL 2ADGB 5IK3A 2E8ZA 3O0RL 1LK3H 4LEXH 4PJXB 3E6FA 3QIBA 1N7MH 3HG1A 4GKZA 4HLZH 1KCLA 3LZFH 5FXCH 5I9QB 1AGBB 1BPVA 2ZUWA 2G75A 4EZMA 4L5FL 4RDQF 4XT1C 3LRSB 5T3XH 5DHXB 5TE7H 2BNRB 2CPCA 4MXQD 1IRAY 1N59A 5CIPA 5I76A 4DEPB 1IAIH 3RIAK 2NLJA 1WCQA 4LSRL 1A3RL 4HBCL 3TFKC 1R24A 2VLLA 1M4KA 2VDOH 3JXAA 4F7PB 4NM8L 5EUOF 3MV9D 1U3HC 1AD9A 5K9KB 3EYOB 3QFJE 3T1WA 3MACH 4DKEL 3U7WL 1FZJA 1ZWIA 1YUHB 3EO0B 4YHPB 2X4QA 3L95B 1A47A 5T1DL 4NZTL 3WN5A 3QNXA 5E1AA 5A40E 5IVXB 1I7TA 2PO6B 3QIUC 2VZUA 5IFHL 3OGCA 5F7WC 3E6HA 4K3DL 4JKPL 4XCFH 3C09B 4GW4A 1AI1H 5I17B 1AXSA 1BGXL 3U2SA 1L0XA 4XC1H 1G7QB 3L9RA 1TVHA 3L7EB 3KPSA 1FNEA 4X80L 1W72A 4I48A 5T3ZL 4NUGH 3VXNA 4GSDH 5HI3C 5DJYB 3UTTE 5DQDL 5CEYB 1S7VB 5JXAL 1LNUA 2R0WL 3MRQA 5BS0B 2Y06L 4ZOCA 2WUCL 3QFDA 1V8HA 3UPCA 1JUFB 1H5BC 5TF1H 5C0CA 2J88L 3RWGA 3T2NL 3MBEC 1ZGLM 3D39B 4ZYKB 4M61A 1CFQA 1N64L 5C92A 1K6QL 4ONHA 1I1FB 4Y5VC 3PHSA 1NGQH 3QHZL 2MPAL 2IPKA 1BZ7A 1MCQA 2NNAA 1VKXB 4ELME 1IC5H 5K59E 1GAFL 2H26B 1I1YB 4LKXA 2EE3A 1EEZA 3G6AA 1LDPH 4S1SL 1BF8A 4OM1L 4AEHL 3GHEL 1XGUA 3RUGF 3VRIB 4G9FE 1SYSA 3RIAF 1KXTB 1RJYA 1J10A 1PY4A 3WD5H 1TVDA 1GC1C 5JMOC 3RWDB 5E8PB 4KPHH 4TNVK 2HT3C 2A6IA 4RGOL 1X7QA 4DQOL 1OGAD 3RVVC 2R0KH 4KKCD 1P6FA 1QR1A 4H5SA 1WISA 5DS8B 3PHQA 1NCUA 3MRCB 1KJ2A 2PYED 2R9HD 4Y2DB 2LU3A 3MRLA 4G8EB 3VRLF 3TNNB 3SO3C 5GRXG 4MNQA 2X4RA 4KJQC 4ZDHB 4DUVA 4RISL 2H32H 4DW2L 3TIDA 1K4CB 1EH9A 5DJ0A 4P9HC 4HH8A 3SDDC 4HKJA 5DRXA 2FYYB 5KZCD 4UNVA 2MQ3A 3DV6B 4TSAH 4Y4FC 2HKFL 3GMQA 2DQJH 4PJIB 4Q97A 4GKZB 4I0PA 2NY1D 1NMBH 1N6VA 3FO2B 4U33A 4HS6A 5DMIL 2EDTA 4Q9CA 4F7TA 3SGJC 4TULL 2M1KA 3TA3C 5HVHB 2DTSA 1OAYH 4LBEA 3V6BR 3G9AB 3T0DA 1TZGH 3F7VB 5D7JC 4NP4L 4OLVH 5LGJA 5TDOA 3QEQA 4WUUB 5JPMA 2K7PA 1JRHI 3K81A 2VLLB 5TQ2H 4NZUL 1DVFC 3REWB 2OR9H 4M62H 3EFFB 4JO3L 3S36X 5KS9E 2DTMH 1M7DB 4X8JB 3EYFB 3ILPA 5I1AA 1RK1B 4YFEA 4X83A 4XNQA 3QNXB 2YK1L 4OIBA 2IALB 1MWAH 1JPTL 4U1JB 5I1GH 5DFVD 3HLAA 1YPZB 4GRLC 3UO1L 2D0HA 4YDVB 5C9JB 4Z8FH 4PJGB 3LS4H 4I3RH 2YD2A 3OAUH 4NQDE 5CP7B 2BSED 4LSUH 4J6RL 2AABL 3BDXA 3L9RB 4PV8A 5GGQL 2EDJA 3LN4B 1KIUA 4NRZA 3KPSB 4PJ7E 3HZMB 3V52L 2NYYD 4JJ5B 3ULUF 2ZWLT 3V5HA 2ITDA 4OCRL 4OFYA 4TVPD 3BYYA 3DO3A 3VXNB 5CD3A 4NNPL 5SX5H 2BERA 2X1XR 2XNAA 3MRQB 2AQ2A 4LQFH 2QADD 3ARBD 2XWJA 2H9GA 3OKEA 4GH7B 1A7QH 4OM0H 3P0VH 3OX8A 4JZJA 2AJYH 3N1MC 5C2BL 2XKNB 1CU4L 2P24B 5KSAA 3PWNB 4P2RD 4OZGB 2E7HA 5BVPH 4HUMB 4JCLA 2VLKE 4ORZC 1MHPL 4L4VD 3GKZA 4HJ0C 4ZTPH 1RUKL 3STZB 4MHHI 3SQBA 4H1LH 4LKXB 2VXSL 3ESVF 4PS4L 1T5XA 2NR6C 2NCMA 1G7JA 1IGML 4MD5B 3FT3B 3JWDL 4GS7B 4YDJA 1SYSB 1II4E 4Z7WF 2X6MA 3T09A 1RJYB 4NQCD 3O2VL 4YHML 5L8JB 3GJFB 2ICWA 1T03H 2VXQH 5HVFB 5CJXC 3QXUA 5GZND 4H5SB 3GMPB 5HYJD 1IC1A 4P46B 1P53A 2IQAA 3HUJF 2BVUA 3FO9A 4KDVA 4EDXB 5JLZB 1UZ8B 1H3PH 3TT3H 3VFMB 1H0DB 1X4ZA 5IQ9A 2PR4H 3C8KB 1W72L 1FVCB 1QACA 4K3GA 4NJAL 1NUNB 4FQJH 2LV4A 3F6IA 4YWGH 1CICA 3HI5H 1ITCA 4L9LA 3UYOD 5IMKB 2H3NA 2RCSH 2EDEA 4BELD 4N0CD 3IDYC 4XH2B 2NW3B 3G04B 3V0VA 4PLJC 5SV4A 4DTGL 2VITB 4YEFA 3X17A 1RIVL 4F7TB 5FYLH 1JPSL 1DBKL 5FM4A 4LBEB 1BOGA 4MNGE 1RIHL 3QDGD 4HUKB 3O45B 2CIIA 3RVTD 3QFJA 5F3BA 5LGJB 4IMLA 4JM2D 2OP4H 2ARWA 2P4AB 4ZUTB 3QJHA 4WW1A 1V3LA 4P4KD 2D9CA 1SJXA 1CT8A 1RIUL 1ITBB 3ORJA 4M1CD 5I8CA 5DD5H 3RNQB 3OPZH 2EO9A 4N1EA 3KJ6H 1F8TH 1AQKH 3ARYA 3KPRE 4LPCA 2I60H 4WNQB 3O6FB 3ARXA 2VR4A 1S9VB 5I6XB 1S7WA 4P3DB 4JO1L 4D9LL 2GT9A 4GKNB 4U7SA 2H6PB 1XIWB 3RWJB 3QIUA 5D1ZD 5DJAA 5C0GA 3VW3H 4YDIL 1XCTB 4HUUB 4U1SA 2FJGB 3UTTA 2IQ9L 3QDMB 1U91A 3WEXB 3O4LE 3JTTA 5C7XH 5CKGA 4P4RA 3RVUC 3B2VL 1DN2A 5C0AE 5BV7H 1QSFE 4WW2B 2XNAB 1I7ZA 1WJ3A 3ARGB 3PV6B 1IC7L 1SY6H 3GIVB 5CBAB 3DNKA 2R2EA 2HT4C 4KI5C 1RZJC 3KYOA 4NO5A 2VZOA 5C6WH 1RZFH 3NZ8A 4RX4D 1H5BA 1LVEA 2FZ3A 4J4PD 3SDAD 5KW9H 4LKCA 4Q58C 5C9KA 4ELMA 1T7WA 3RPKA 5T5FH 2AJZB 4CVUA 3P9LB 3MBEA 5E2TL 4N9GB 5ESAB 1OT2A 2VDML 5TFSL 4EUPG 3RWHB 4JRXE 3LQAC 3MFFB 4G9FA 2UZIH 4APQD 3MRNA 1IFHL 4GBXD 1ZE3C 2E9IA 3I6GA 1D5MA 1UM6H 1XAUA 1KSRA 2B1AH 1CVSC 4QTIH 3SGEI 4LDOB 1CLOH 3BKYL 5CSZB 2ADIA 1FZOA 4XCNB 4XI5C 2C4FT 2D03L 5F9AC 2OXHA 1IGJA 4MVBC 4HK0B 1KJVA 5IKCA 5HHOE 5T1MA 4WHTA 3FRPA 3DMMB 4BZ1L 2W0LA 5ADPH 3WIHH 3BP5A 4XVSH 2ZCHH 1KB9J 2FGZA 2BY2A 4Z77B 3T4YA 1C8PA 1OY3B 3QUKA 2MFNA 2WWMD 1DL7H 4PV9B 4G8GB 5SWQA 3BGMB 2YD9A 4PR5A 3FB6B 3VXMA 3GK8L 3OJDA 2FGWL 1A6ZA 4XVTL 4JE4B 1I8IB 4IJ3B 3UBXB 3SY0A 5ICXB 1YEHH 2X1QA 3SDDA 1NSNH 3TEUA 4PJHB 3B5TA 1U41A 2GFBA 1KTLB 5TPWL 1JF6A 3P4MB 1A0QL 3CSYA 2NY7L 5JDSA 1BBJA 3V4PL 2ZG3A 1HEZA 1JI2A 4OLUL 4HWZB 1UENA 5F9WC 2AXGA 1MY5A 4MA3B 4BK5A 3M8OL 1MIEL 2NXYD 3CFEB 2X9XA 2Y9RT 3X3FH 5D7KE 4TQEH 1S5HB 4PRDA 3MOBL 4QKXB 4MX7A 4EI5C 4XPAH 1CT8B 1CFNB 4OZHB 3IS0X 5ETUA 1GJIA 1DVFA 2DKSA 1U3HB 1CE1H 2EH8L 3JWOC 2XPGB 3VGBA 4R26L 1S9XB 1QRKA 1EMTL 4PBXA 5DWUH 1UG9A 3NABL 5ILTH 4U6HB 4NQDA 4UZGA 5C0FA 4Z7VA 3FQWA 2PKDA 1G6RB 4XP6H 5IFAL 5K9QG 3NA4A 1U8KA 4PJ7A 2YPVH 5HI4C 4GKSA 4GRLA 4BFBD 3EJJX 1CDJA 3NCYP 5IB1A 5I0DA 3AVEA 3VH8A 3LKRA 4X4YA 1H8SA 4X7EC 1EK3A 3WMSA 4PJ9D 1UWXK 3Q6FA 3ARSA 3TC9A 4J3XA 3FOMA 1W0WB 4BH7B 2QQNL 4ZFOB 2PTTA 1G6VK 4D0CA 3IKKA 2AGJH 3DOSA 2CXKA 4X4XA 1A22B 1I7ZB 4MAYD 4O58H 5EU5B 1J11A 2KDGA 5HDQH 5F44A 2BMKA 4M4RA 1TTFA 1KB5B 4M6OH 3ZKNC 1NFDE 2R2EB 1KEMH 3DO7A 3N1PC 1JN6B 4NBXB 1CXHA 2VLKA 3KYOB 3DX8A 4H0IA 4PJDF 1YYML 4RIRB 1NDGB 3NZ8B 4P9MH 1H5BB 1UCBL 1KBGL 3MCLL 3TZVA 3I9GH 4LCCA 2R8SH 1NCTA 3E8UH 4GG8A 4HLZG 4NQUA 2AJ3B 5D6DC 4Y5VB 1V7ML 1KT2B 4R2GD 1ZGLB 3OJVC 1HKLL 2ZCLH 3MRNB 4KHXH 1D5MB 4PG9A 5F88B 1Q72L 2F53A 4UOW1 3DUSA 2FD6L 4ODSH 4DGYL 4F80A 3BPOC 3HG1D 1J88A 1D5IH 1DBBL 4JZOA 3HC0B 1IGJB 5KTEH 1G6RL 1Z6JT 2VDNL 5FYJU 3UXFA 3ROOA 4P5KA 3KYKL 3NFPA 4HJGB 2V5TA 4YX2H 1NGYB 1JBJA 4WRLA 4UQ3B 4ZPTA 2MNUA 4PRPA 3QCUH 4LPVA 3EO1B 3FJTA 5AZ2L 5E6ZA 1NC4A 3AM8C 4U05A 3IDJA 1H15B 3P73A 1EEYA 2FWOA 3CD4A 1G9NH 2OJZH 2VDRH 1CGTA 5CFHA 2NW2B 4R90L 3VXMB 2D7OA 1CIUA 2R1WB 4KK5D 1UB6B 4RMSA 3LKSB 1FIGH 1YY9C 5LCVL 3OKKA 1FFNB 2YS4A 2FIKA 2V5RA 1INDL 5D70L 1KB5L 4JRYE 2IG2L 3RPIA 2J3SA 1NUFA 3I02A 2GFBB 5GISL 4XTRC 2IADA 3U1SH 4Y4FB 3O6LL 4MNGA 3D18B 4MA7L 3ZDXE 1O5DT 1E28A 1YQ2A 4NO3B 3HZVA 2P1YA 1P7QD 4TNWF 2UWEF 5J56B 1BIIA 2J8OA 3HFML 1DFBH 3CLFL 5ESQB 3JTSA 3TA3B 4EDWH 5DRZA 3SCMC 3QUMH 4WWKB 1AP2B 2GKIA 1P5VA 5D5MF 2BNQB 4NO2B 1KCUH 3KPRA 5D7JB 2BSSA 3IVKB 1C1EH 1WEJH 5JIKA 1ZHKA 1DBJL 1U8LB 5ETUB 1DVFB 32C2B 3BZDA 3IXAA 1OTTC 2QEJA 3U4BH 3DX7B 4HGKC 1T4KA 4Z0BL 1XR9B 1JYNA 1V7NL 3EIFA 3WIFA 5DTFB 3PDOB 3LHPH 1OAUL 3KPLA 2IPTH 3FQWB 3LVEA 3BZFA 4GXUN 2VXVL 5GS0C 1GC1L 2ZOLB 1J0JA 1U8KB 5EA0H 4RWYL 3O4LA 2VIRA 1AH1A 5IHUL 4LU5H 5IM7A 3RHWK 2WLYA 5KSVA 5C0AA 4TSBH 1J8HB 1U8HB 5F89B 3M1BA 1QSFA 4OV5A 3FONB 2XZCL 3O3DB 5IBUB 3MMEA 4OD1L 2EEAA 3Q6FB 3JV4B 2DQGH 4QTHA 3EDKA 2YD5A 3CK0L 4HPYH 3REVB 1CXKA 3R1GL 3U30C 5GZOC 2ZUSA 3ISWA 4JQXC 4YDLB 1I4FB 4GG6A 2BMKB 1UZ6E 2A9ML 3O41A 5J1AB 2EZ0D 5FA3A 4F33A 1B4JH 4RBPH 4NDMA 4PRAA 1JZ6A 4KRMB 5HY9B 1IEAB 4OF5A 3THMH 2Z8RA 1FZKB 1J1PL 5ALCH 4C56D 3UPAA 4TUOB 4MNQD 4JFOA 2A6DA 5E6IA 4MMXC 1NCCL 3RKDC 3KPMA 4NM4H 4QEGA 1CL7I 5ESVA 1X9QA 2IPUG 4OI7A 4UV4H 1BEYL 2WSKA 4JHBA 5FECA 2D7TH 3FRUB 3TBYB 3ARZA 4I2XE 1T0MB 5ALBL 5HHQA 3LV3A 1FG2B 5FO9B 1H3WM 1MCRA 5GS2H 4JZOB 3TH3T 3FFDB 1KN2L 1JZ7A 1MH5B 1VFBB 3H3BC 4FFWD 4HG4J 3WDJA 4HWNA 2E7LC 3QEQD 5GS3A 3KXFD 5IQ7L 1NC4B 3KAAA 3SQOL 1OQOA 3MRGB 5C2UB 1LHZA 1QSVA 3PHOB 1IGCL 4X99B 2JCCB 4GKOA 2UUDH 3O3EB 2Z8VC 2ZKHL 2Z8SA 3QWRA 1JZ3A 3ROLB 3RVWC 4KJWC 4P3WA 2VLRD 4XC3L 1VFUA 3L5WB 1FFOA 2XT1B 4MJ2A 2DLEA 3VU2A 5AAWA 4RSVA 4M1GL 3HZYA 4MJ6B 4ZUVA 1RZIA 2BVOB 2C4XA 1CGWA 5HHMB 3U7YH 4OIIL 3NCCB 4A6YB 2P8MB 3TIEB 4MLSA 4OFYD 5EZLA 3KS0H 1BJ1J 3OXSA 1CVRA 1N0XL 5J3HD 4DKDC 1BQSA 2IGFL 3O3AA 1C5CH 4EQ3A 1MJJA 3DBXB 3FAWA 5FYKE 1LO4H 5IB4A 2F58L 3IXAB 4H1LG 4EI5A 1GYAA 1MAJA 1GZQB 1CF8H 2BVTA 3B9DA 4GOSA 4UT6H 5DYOB 1JF1B 4X7TB 1T1YB 5KSAD 4PJGE 3FO0L 4BJLA 3CCHA 1VADA 3UJTH 3AXLB 4GRMB 3MROA 2BCKA 2FHFA 5B22A 3U0TB 4HGWA 2R29H 1ZA3A 1R3IL 2DLGA 2A6KB 4TTDC 5GGSA 3UAJD 1RK0A 1QRNE 1MI5D 2YEZA 4E41A 3W2DL 1UXWB 3TBSA 3TVMA 1RJZA 3BPNC 3W81A 2OK0H 1HHIA 3OSKA 3AS1A 5IB2B 5GGVY 5ACMA 3IF1B 1FRGH 5EU6A 3S96B 3U9PL 1ERNA 4FQXC 1KNOB 4HIIA 1OLZA 2JIXD 3CMGA 3WXWL 1RZGB 4ZXBD 4CW1B 5IT2L 4OZGE 5A3ID 1U93A 2E3VA 1EXUB 3LS5H 5DHVH 3IJHB 1U6AL 3TJHD 3DHJA 2P49B 4GXVH 1TIUA 3QEUB 1EFXD 4JFOB 4OLZH 1GGTA 3MRJA 1F4XH 3IJSB 5L2JA 1CICD 1ODAA 4Y1AE 1CZ8H 4NRYB 4JM4H 1AO7E 5B38B 5ISZD 3QQ3B 4FZ8H 1D5BB 3NIGF 1I3UA 3M45A 4H8WC 2DB8A 2A83A 3BI9X 1JGDA 1UWGH 1IGTB 1MRCL 4BKLA 5HHXH 4LSSL 3UJJL 4MYWB 1FDLH 3FN9A 4AIZA 4F7MB 2CR6A 4WI8A 2JTDA 5IIEB 4G42A 2HJLA 1FV1B 1GHFH 4J1UB 4DCQA 4ZUSA 3ULUE 3CSGA 1MFAH 1INQB 2IAMC 5KBNC 1I85C 1RULL 1MCHA 1PG7W 1T6VN 1T1ZB 2CGRL 3MRFA 3EFDH 5EFIB 1QVOB 4GW5B 3HNVL 3RWEB 5CWSA 2PCPB 3MGOA 1S9YB 3WHXA 4QOKE 5KN5A 1N6UA 2GJZA 4JRYA 2HWZH 5CSBA 2GJ6A 1KENH 1FFPB 5D2NE 4YHOL 3MLXL 1YEKH 4CU8A 1NJ9B 3VFNA 4U1NB 4OGZA 1ACYH 3S5LA 4HJJH 4X98A 2ED9A 4LCWB 4OCXH 3TWCL 1BVKB 1FL6A 1HZHH 5IHBA 3CDGA 3EYSL 3PWLB 5B4MD 4I5BB 1A5FH 3ARQA 4KTDL 1A1MA 2GYSA 4JR9L 4KUCF 4NWUL 4HWEL 2EEBA 5ERWB 3DVNA 4Z7QE 3T0EC 3C2AH 5IR1B 5DD1H 4MD4B 3KLAA 3CVIH 4U7MA 4K2UL 2CKBA 3NCJH 3LQAL 4F2MA 3L1OL 4G43A 2H45A 4M43H 3RL1B 5IB4B 3RWIA 4IBLT 4HD9A 4DZBA 4V1DB 5LQBH 1IM3B 2CO7B 2X89A 4XZUA 4NSKB 2VN7A 3E0GA 3HUJE 3D85B 1F6FB 4U31A 3OXRA 5HHPA 5MP6H 4LCUB 3ZKXB 2XYCA 2NY4C 4KY1L 4Y5YC 4N8CL 3U36B 4WU5A 4JCMA 3FFCE 3A67H 3L5XH 1Z9OA 3SO5A 3BP7B 1MFEL 2F54B 2LAGB 1K4DA 4P5TC 1NC2D 3DYOA 1EDQA 4G9FD 2VNCA 2OTUA 3BPCA 1SQ2N 2YEZB 1ACZA 5E7BA 4RMTA 2X4TB 1RJZB 3K74B 2PW2A 1KC5H 2UZYB 4FQ2L 2V2XA 3SDCD 4PP1D 5F6HJ 1EHLL 3O2DH 5C70A 4KROC 4BA8A 1AGEA 43CAB 4X9FA 5I16A 3SJVE 1BD2E 1H3GA 3MYJA 4HEPG 3QDJE 4HIIB 2Y4SA 4ODHH 5EUOA 1HOCA 2EDHA 1FORH 3K8LA 1ADQA 2XIDA 4MJIE 4LSVL 3IAGC 1S8DA 4Z7NE 4GRWB 3O6MH 4CL7A 4OFPA 1KIPB 2X70B 3OAZK 5M94B 2FL5A 3GSNB 4KUZL 3OR7B 1IBGH 4OUOA 2IH3B 1NAMA 4M5YH 3PWUA 4I3SL 2YPLA 3OZ9H 3MRJB 3PWJB 4I2XA 1TZHB 5DI8B 3WLWC 1A7NH 4KXZI 4XPHH 2VE6B 3CU1A 4R4NC 4GAGL 3RRQA 3CX2A 1EGJA 3L3IA 2L7JA 2HTKD 4LVNC 2QR0B 3D0LA 3BPOB 3JWOL 4RFEB 2B7DT 3CFJA 2QSCH 1JFQH 1OGTB 2Z9TA 4EEEA 1UADC 3ZTJH 4UBDC 5DD3H 4ZUSB 3QUZD 2I07B 1OAZL 3VFPA 2A77L 5C71A 3WJLC 3T65A 1JHLH 1DQQA 3CIQA 3OBAA 1XGTB 2UVEA 2Z8WC 35C8L 3QXAA 1F97A 3DROA 4OD2A 4LHQB 1I7RB 4JFZL 4ORGA 4QXTB 3QH3B 3GSQA 2CLZB 1F3RB 4PJEB 2GJ6B 3S88H 1RD6A 4H0GA 3X12B 1KCRL 3OG6B 3VFNB 3NA9L 4I77H 5F8RC 4NQDD 1BQHB 4X98B 4FQLL 2AJUH 4L8SA 1ZA6A 1NCAH 3BRGC 3CDGB 4XHJC 3SE3C 3ZE1F 4XBPB 3X14A 4DKFL 2CLRB 1C5BL 5E2VL 1E4JA 4HBQA 2RIKA 2FX9H 1VPOL 2OL3H 2JB6A 1VB9A 5ANME 4G9DA 3F7YA 4YO0B 1U0QA 3PABB 2DD8H 4OSUH 3QEGH 3Q2CA 3OQ3B 5FUOH 3T4AA 3I50L 3MJ9A 4QRPB 3SCMB 3HCVB 3ZSSA 4N0UB 4G43B 2K3TA 4Y19E 4HS8L 4OD3H 2DQUL 2SEBB 1RZ8A 1U8QA 2BVPA 4XZUB 5C0BB 1CXEA 3TZVD 4N5ED 1HK6A 2FR4A 2XRAH 3K2UL 2VERN 4PRNA 1QRNA 3U46B 1CD1B 5IV2B 2EYTA 5IG7A 3QQNA 1K4DB 3IETA 2KUTA 2P5EE 4UTAH 1CS6A 1TJGL 3NCEB 2C3WA 2DLFL 3KPPB 3NFNA 1KJMB 5MEQB 2W60B 1YDPB 5EOTB 5FFLA 25C8H 1UACH 4U3HA 5HDOA 3V2AR 3INUL 5FHAL 2UYLA 4WU7A 3U30B 1KCSH 2Q87A 4JREB 1AHWB 2AV1B 3DTXB 4K8RL 2X09A 5DVKA 4IIQC 3UPRB 3RWFB 1AO7A 1CLZH 3W9DA 1XF4A 3BMWA 4JFHE 4NKMB 3LPFA 4TOYH 4KQ4H 1DTUA 2YPLB 2CKBL 5IOPB 4F58H 3K8MA 4K7PL 1OF2A 1Z5LA 2MSPA 3KWWB 5E2WL 1HHGB 2XA8H 1S7QA 1MHEA 5KSBB 1MJ7H 3KPNA 3C6SA 5F7FA 2R56L 3GSXB 1CQKA 4XMPL 4ETQA 1IJ9A 3PUCA 3CFJB 5E5MA 2ORBL 4OQTH 5JORB 3KYMA 4W70A 4NQVA 1YECH 3VFPB 4QOKA 3AREC 4PJ5B 2ZG1A 3Q3GA 1E4XL 4HC1H 3WXVH 3VXSD 4X9GA 1DLHA 4R3SA 2IAMA 5EIQA 4KTYA 1I85A 5D2NA 3QXAB 2AK4B 3IDMB 3KPRD 1HYRC 2YBRA 2PYFB 5MEND 1DQLH 4HZLA 1EVUA 1R0AH 3ZHKA 3FQXB 2EC9U 4MXWH 3QEHA 4M5ZL 4FQHA 4HUXA 2VXTL 4W6WB 3MLPA 4PTUB 5I8EB 4U6XB 1V3MA 2FBOJ 1ADQL 5LGHL 4H0HB 1KIQB 1F5WA 5DO2D 3O4LD 2E9JA 2QHRL 3ARVA 1P7KA 5D71H 2Z0BA 2DL2A 4J3SA 3RUGB 5C0AD 1GIGL 2VLJE 2X4UB 3RZCA 4Z7WA 5HPMA 1QSFD 5DVNA 1AY1L 4NHUB 2XG5A 1OTUC 4MAUL 3SGKC 1NAML 3SKNA 4FMFA 2OBGA 4XPTL 1WC7A 3HPLA 4JGMA 2G5RA 5H2BA 1I9RL 1U8OA 3H7BA 5CLWA 4L3EB 3O0RH 1FE8L 1IM9D 3HUJA 1R3JB 5JOFA 4JG1L 2DWDB 5B39A 1NFIA 3FFCA 1MLBB 4DZ8B 4KDTC 4L5FH 2UV3A 4PGCB 3QISA 3DXAE 4JFPB 3S6CA 1NANI 1BJMA 1BIHA 2BC4A 4HF5H 3H9YA 1JV5B 4JRXD 1AQDA 4LLWB 4PRNB 2NXZD 5GGVL 3EDJA 1OP9A 1T21B 1X5ZA 2FSEA 4Y5YA 4X5LA 4HBCH 3F5WA 3TH4T 3IXTA 5E1HB 1X5AA 1KYOK 4LASL 4RA3A 2AKRB 1J5OL 4KGLA 3UTSB 3B2UC 1NGPH 5IEKB 5JPNA 4Q9BA 4K7PX 4C58B 4DKEH 1XF3B 3TGXA 3U7WH 1RHHA 3SJVA 1BD2A 2C7UA 1LEGB 3QDJA 5HHOD 2V2WB 4MJIA 5D7IF 3BPNB 4TYUA 3DETD 2AXFB 5IFHH 4K3DH 1QFWH 2XTLA 4JKPH 4LLUB 1OB1A 1RJCA 3QG6B 4OBSA 3SGDH 4X8XA 1BGXH 4FQXB 1VGEL 1YZZA 3D9AH 5CJQL 3HE7D 4EIZC 5LWYL 1MY7A 2X42A 5D5ME 3NTCL 3ZE0E 4RMWA 1UQSB 5AUMA 4X80H 5FA4A 5D6CA 3ULVH 5T3ZH 1CL7L 3HAEH 4OLYL 1JZ2A 5FYKL 5DJCA 4KMQA 1EIBA 3NCMA 2BVYA 3MJ9L 5JXAH 2R0WH 2D3VA 1WUNT 3IT8D 2Y06H 4KRPC 5E9DB 1IKFL 3WUZA 4K9EC 1B6UA 3QWRD 4X7SL 2DS4A 3C6SB 2YOCA 4WCYH 5KG9B 5HXMA 1BBDH 1N64H 2X4OB 5A43C 4U6YB 5HYEA 1H3UA 5D7KD 1MHHB 2Y5EA 3QHZH 2MPAH 1HCFX 2OMNA 1YEJL 2VOTA 5TDPB 3SHSA 3BN9D 2BVQA 3BIKB 1GAFH 4JQVC 2NZ9C 1N5YL 3L5JA 4R3SB 1JNHA 1YNTA 2BOBA 1ZAGA 4S1SH 3WJLA 4AEHH 3BWUC 3GHEH 1G7HB 1A1NA 1HQRB 3VWKC 4OJFH 4RGNC 3SKMA 3IFOB 3ARWA 4A2LA 1SVCP 2YUXA 3MUGA 1JTTA 2J5LC 4KMTL 3BDYL 1XGRB 4RGOH 3QUYA 4R9HA 2APWA 4WI3A 4XB7A 4DQOH 3I3BA 5CUSL 1HH9A 1LWRA 1NCBL 3WIIL 5DEGB 5ANMA 3EOAB 4Q6IB 1A9EA 4YLQT 2Z92B 4P3CL 5A16A 1DUZB 1FO0A 5J0BA 3QWOA 3SE3A 3G5VA 4U1KA 1MAML 2XACC 3VFVA 4M7LH 4RISH 4MA1C 3TVMD 1FCGA 4Y19A 1QNZL 1MVUA 3R06B 5J9PA 4B7LA 2CRZA 3FN0L 5H2BB 3T0EB 3MX0A 2BOCA 1A7RH 3MOAL 3QNYA 3S3SA 2HKFH 5SX5K 3TCLB 4YHKH 4W4NA 5I66A 2LU7A 2D7QA 3PV7A 5FO7B 1Z3GL 43C9B 3ULUL 3G5XA 5B39B 3MR9A 1MFDH 5GXBB 3EHBC 5AYUL 4N8VG 2ICEB 2P5WE 5CJOL 5L7XL 4OZIE 2P5EA 3C5SA 3VE0A 2Q6WA 3L3KB 4R4BB 4P57A 2HVJB 4NP4H 3D0VB 4Y5YB 1C7TA 1CG9A 1LD9A 3BDBA 2FJHB 4AIXA 4ERSH 2C26A 4F3FA 2R2BB 4KMLB 4NZUH 4DN3L 3C5ZB 5JPNB 1M71A 1NEZG 3NN8A 4HIHB 4NQSA 4P5TB 5F72S 1GXEA 4CRPA 2DBLH 3UC0L 1XF2B 2YK1H 3O11A 5C09E 3KLSA 1T04A 2CUMA 2YRLA 1YEIH 4JANA 3UO1H 1P1ZB 3ULSA 1LO5B 5TQ0L 4NNXB 4LLMB 3AU1A 5BZWA 3FT2B 1QLFB 4Z7UE 2GAZB 4HHAB 4XCEA 3OKLA 4J6RH 2AABH 2YD4A 2Q8BL 4PJCE 2J6EL 2MKLC 2OJEB 2IFGA 4JM2F 4ZNEE 4XWOC 2WIIA 3DURA 3QZWA 1P6AB 2ZPKH 3BHBB 4LDEB 1MJ8H 3VGEA 1A7OL 3NIDE 2WBKA 4JRYD 1TCRA 4U0RC 3GSRB 4HIJA 3MRPA 4YIQA 3I75A 1EA9C 3HB3D 3KNBA 3MV8E 1LP9B 4HKZB 1KELL 1U2HA 3VI3E 1DZBA 2H32B 5C0EB 1U3YA 3LEXA 5C2BH 3Q1SH 3SKOB 3FHAA 3C60C 1IAOB 1RVFH 3GHBH 4G7YH 4N5UA 1PZ5A 4LVNB 1B0RB 4K8RD 3ES6B 2DOCA 1MHPH 3PGDA 5HYSA 3MUJA 3DVGB 5BJTA 2VXSH 1YNTB 2BOBB 5F7KC 4DGIL 2HKHL 1IGMH 1KF9B 4U1HA 5ELIA 3L6FA 1A1NB 4I9WE 2QBWA 3BUTA 5GS1A 4X6EB 5GSVA 5MHSE 4YAQA 3O2VH 1GGIH 3HR5B 4LCWE 3H9SE 4YHMH 3MOQA 2X89D 4LPTA 3RVXC 2N4IA 4WVRA 4L8BA 2VLJA 4YR6B 1NEUA 3QJFA 2HFEB 5D1XB 2W38A 4YFLI 5D72L 2LU4A 1M6OA 5IMMB 2NPLX 4TUKL 1OAQL 4RGMC 4KJPD 4U1KB 1W72H 4LF3B 2DQDH 3NIGE 2A6JA 1BQLL 4NJAH 5JOPD 2FB4L 1NLBL 2PXYB 3SGKA 3PGCA 5H35B 4Y4HB 5EU4A 4E0RA 4HT1L 5JQHC 2F19L 3VG9B 2N7AA 1A64A 1F13A 5IVZB 3DXAA 4F9LC 1MCWW 1IAKB 1QBML 1RUPL 2IH1A 4LIQE 5JA8B 1TPXC 4NQEE 4FG6D 1ZT4A 1RIVH 4JDZB 1TNNA 3L3HA 3K1KC 4L4TE 3MRHB 4IRZL 4UU9A 2F54E 3AAZA 2F74A 1FAKT 1QFHA 5DUPL 1JVKA 5F70A 2CXGA 3ZTJG 3QO1A 2EXYC 2A0LD 1KGCE 2HLFD 5DK0B 3M17B 1S5IL 2GCYB 4Q0XH 4HXBL 2UWEA 5TE6H 2Y07L 1SJEA 1WQVT 4UILL 3O11B 3V7AG 3LY6A 3SE9H 1VGKA 4MHHG 1I1RA 2YXFA 3QRFM 1CGSH 3O6KH 2HG5A 1L0QA 4JO1H 1HNGA 5D5MA 4D9LH 3U0PA 4C83B 2NX5E 2CQVA 3CDFA 4MMZC 1EJOL 4YDIH 5JHDE 4IOFD 3EDDA 5TF0A 2IQ9H 1FO0L 3L7FA 4U1MA 4AH2A 4ISVA 1QYGL 2WIIB 2F8OA 3B2VH 1NBVH 3QZWB 2V6HA 1VFAB 1HXMA 1R3LA 3MLVH 2P8LB 4IIQB 2CUHA 2Z31C 1VEMA 4XMLL 1IC7H 4YGVA 2XZZA 1G7LB 4DVRL 2WBJC 4ODXB 3FZUC 3JV5A 3MQIA 2C3HA 3LEXB 4WUUD 3VG0H 3X13B 4NQXA 4LLAA 2CSPA 1QEWA 2F5BL 4LCYB 2W9DL 4FRWA 3BGFC 3N85L 5ICZB 4O51A 5E2TH 3S3JA 4LLQB 5TFSH 5BZDB 4GFTB 4Q9QH 2EDKA 2XN9E 4PJ8A 4R0LC 1OP5H 5FYKD 4DOHE 2PF6A 4PJDB 4YBLC 3AREB 4WI5A 5JIHA 2E6QA 2ICWJ 3OWEA 2CRIA 2DBJA 4NT6A 4EQ2A 2D03H 4YAQB 3CC5B 2HYMA 4HPOL 2NY0C 4QXUL 5EOCL 4OV6F 3VWKA 1LO2H 2RQ8A 4JVWA 3MREB 2RAMA 5T5NG 1JMZA 1ND0B 2EICA 4CMMB 1QRND 3IFNH 4ENED 3DUHA 4JN1L 1W8OA 5EH1A 3IFPB 5DJ6A 5K33A 3HMXH 2Q7YA 3GSOB 4NWTL 3WJJC 4NKQB 4AENB 3IDIA 5H8DA 3RDTA 1UYWL 2DKUA 3AS3A 5C0DB 4QRPE 2VZ1A 3GK8H 2FGWH 4N8PA 4NCDA 1XEDA 3PGCB 1JWUA 4E0RB 4XPFL 2P5WA 2D7MA 1N5AA 1Q0YL 3B9EA 2MCPL 4F9PC 4YH6A 5BV7B 4WEMB 2NY7H 1DQDH 8FABA 12E8H 1ZV5A 4FFZL 3V4PH 4OLUH 2Q8AH 1ZLVK 1FYTB 1HSAB 2NY5L 3KVQA 3AAZB 4QRUB 2F74B 1MIEH 2Z93A 4MCYA 4QHUB 4Y1AD 3W5NA 4JRWA 2D4DA 1AO7D 1RJLA 1AKJB 1NBQA 5FM8A 1DDHA 4Z0XB 3T2QA 3MOBH 3QO1B 2MHAB 1KLGA 5C09A 3WCYA 1T7ZA 3PWPB 4XVUD 3L3DB 5ABDE 4LGPB 4XRCA 1FN4B 4HKXA 2EH8H 4YHZL 4P46D 4R26H 1PY9A 1EMTH 3ZE1E 4Z7UA 3ULUD 3NABH 5DJ2A 5CS7A 1CGXA 3BZ4B 4PJCA 2FDBP 5E95B 5JXED 2KQNA 5IFAH 5EU3B 2BY1A 1S7UA 4FNLL 1YNKH 1Q9WA 5I19L 4ZNEA 1T2QL 5FDYA 2QKIA 4X4ME 4FFVC 1NDMA 5EORH 1YEDA 1H3XA 4M7LT 1YJDL 4M03A 1LEIB 5DT1L 4FZEL 1Z9MA 2QQNH 2DQCL 2YKLL 3MV8A 3SDXF 4G80A 4JY5L 3MO1A 3P2TA 3P9MB 5HI5C 1T2XA 4NKDB 4TUJA 5DD6A 5E8NA 4KRPB 3VD3A 1RUAL 1YYMH 2V7HB 1A14L 3MCLH 2EKSA 5KVFL 3S7GA 1T7XA 1GGUA 1QKZL 3TPUA 3VRJA 4PJ5E 3RZCD 3C60A 2P43B 4RQQB 5DGRA 1V7MH 4MXQC 1LEKB 6CGTA 3MNZB 1HKLH 4LLVB 1WZLA 1Q72H 5DA4A 1IEBB 2FD6H 3H9SA 1EV2E 5HHNB 1LO3L 3ARRA 3PNWA 5FGCE 3FQRB 4WO4A 1XIWD 4NT6B 4XPGL 3WUWG 5BVJB 3V8CA 1HHJB 4JAMB 3VXUA 3FFCD 5K9QI 3T2PA 1FGVL 1G6RH 2VDNH 1MPAH 1MHCB 3KYKH 4LNRA 4RGNB 1S9WA 1FAIL 1I75A 4O02L 4XWGH 3OKDA 2FO4B 2J5LB 5KJRL 4HK3N 1Y6NR 5AZ2H 3CFKA 1BOYA 3ARGD 3ARTA 5CILL 1T1XA 2AQ1A 2VN4A 3TCXA 4JFEB 2WWKT 1QLEH 4KU1A 3SJVD 1BD2D 4L3CB 4NIKB 1FJ1A 3QDJD 5FOJA 2VC2L 4LVEA 3NFSL 5LCVH 1JWUB 3B9KA 4MA1B 4NQEA 4MJID 5D70H 1KB5H 3FB7B 4M48L 2IG2H 3MJ8B 1I3VA 2VISA 2YN5A 3HAEG 3WBDA 4L4TA 3CDCA 3BH9A 5F7NC 2B20A 5GISH 4CVWA 2HLAA 4K9EL 3O6LH 3G5ZB 5KVGL 1A6TA 1KV3A 4MA7H 4XAWL 2RJMA 2Q76B 3G08B 2EYRB 4RBPK 3C8HA 3NVQA 2IANB 4JY6A 1EZVX 4D2NA 4ELKA 2I9LB 3HFMH 2Z35B 1OT1A 2P7TB 1ED3A 5E03A 5E56A 1OP3H 4F8QA 5IWLA 5CHNB 3B8YA 2D0GA 2J8HA 2EIZA 4R7NB 2ICES 2C9AA 4HQQL 4NPYB 5JW3L 1DBJH 1A7PL 4OZ4B 3DMMD 4YHIA 4P2OB 3H3PH 2BSTA 4O4YL 4QHNB 2GI7A 4EIGB 4R4FL 2NX5A 1F45A 1ES0A 1V7NH 5EBWA 4QWWD 1OAUH 2V7NA 5JHDA 4YZFF 3MJ7A 1GC1H 4RWYH 4PGBB 2MTPA 4G8GD 4ZUUA 5DD0L 5DRWA 5IHUH 2LQRA 2JELL 1A3LL 5DA0B 4KKCC 2WQRA 2FEEI 2DI7A 2XZCH 5JO5A 1Q9KA 4HCRL 1YA5A 1BAFL 2R9HC 3V4VL 4JN2A 3RA7H 1CCZA 1JHTB 3CK0H 3VFOB 1QSEE 3FKUS 5DK3A 3R1GH 1PG7L 3BFOA 1OVZA 1JYVA 3CSBA 4UUJA 3MRIB 4P9HH 3MGAA 1SEBA 2A9MH 2QQKL 3VCLA 3LKOA 1J7VR 4ODUB 2D2OA 2KQMA 4U0RB 3QUYD 3EZ8A 4Y16A 1N2RA 1WFUA 4I4WB 4YE4L 2HFFB 2WBJA 1MELA 4KZDH 2NY1C 2CMRH 3EGSA 2R1YA 1PLGL 5ENWB 2XN9A 1M05A 2V2TB 3IU4L 2YR3A 3VRJB 5IJVB 3C60B 2ILLA 1Q94A 5I75C 5E24E 1OARH 5C08E 5T3XE 1JWMA 2IFFL 2O5XL 3MV7B 4NN6C 1BEYH 5D7IE 4MZ2A 3FTGA 4R0LA 3QG7H 3BKCL 3HI6L 3QUMB 3BXNA 3UP1A 2P45B 1AGDB 2E9BA 5DFVC 4JG0L 2CK0L 5C8JB 1XH3B 1T1WB 5J13B 2WV3A 4M7ZC 3CFKB 2GTZB 1JNLL 5IQ7H 4U2ZA 3WO3B 5GSRA 3SQOH 5HI3D 4JFQB 3RGVD 5MERA 3P77B 3WJJA 1EAPB 4GUPB 1IGCH 4PJAE 1UXSA 1BX2A 2NYYC 2XY2A 2WP3T 4ACPA 5EC1A 3B3IB 5EN2A 3O3BA 2ZKHH 2KPNA 3MNWB 1WV7T 2DYPA 4JVPA 3ZTNH 3U79A 4Q2ZA 5D1QA 4ZFFA 2OTPA 1E4WL 4Z78B 2QADC 1F2XK 3ARBC 3AB0C 5BOPA 4AIOA 1T0NA 1J0KA 4JFHD 3T0VA 5HSFA 3LEVL 1RMFH 1TPXB 4Y5XA 5F7MC 4ELKB 4OIIH 4HXAL 4JHZA 5LBSL 1OOAA 3IDGA 5CLTA 5AD0B 2XQBH 3V8OA 2O26U 2HJKA 4QY8A 1N0XH 3G5YB 3LKNB 2Y5TA 3CFBB 3UZQA 3AMLA 7FABH 1GVIA 1S3KL 5CCKL 4DFIA 2R4RL 4HW6A 1MCWM 4WY7L 4GJTB 2BSTB 1HILA 3LH2L 5DK2B 4Z5RB 2DQTL 4LSTL 3VFTA 4L4VE 3HMWL 3FO0H 3HI1B 4X4MA 5I74C 3MJ7B 4LVHC 1QQDB 4F7CA 4FTVA 4LFHD 5E00B 1I8MB 1NANH 2B4CC 4H25A 4BSWB 5GZNC 5EOQL 4NQCE 5HYFA 3LB6D 5IMOA 3TN0C 1HQ4B 1UJ3C 4UNTA 2HH0H 4Y4FD 1JPGB 2VZSA 1R5IB 1QLRB 2AI0H 3U7AA 4YXHH 4UUJB 5I8OL 4GQ9L 3FT4B 3EYQD 3U9PH 2Z31B 3WXWH 4OB5L 1U8MB 3OJ2C 4UDUB 1HIML 4ELMF 5DHYB 1N2RB 4N0CC 3TA3D 4X0KB 5IHZB 1X5FA 5JW4Q 4WWKD 2Y7QA 1FC1A 2BNQD 1MQKH 4LNVA 3WFCL 1AR2A 4WTWA 4A6YH 3PDDA 5INDA 1TJIL 3BGFB 3QXDA 1MCKA 5IF0A 3WS6C 4EI6A 4GMSL 1QR4A 1ROWA 3RVTC 4JFFE 1RURL 4JM2C 5C0ND 1JK8B 2G60H 3HA0A 4P4KC 5HVWA 3PWVA 2YA0A 4BH8B 4YBLB 1BQUA 1WWCA 3CJJA 3VJ6A 1MRCH 4O2FB 1CGUA 3AY4C 4M1CC 3UJJH 5ID0A 4I0CC 1NAKL 1J8HD 2VABA 5I18H 2JB5H 1L7IH 1YEFH 4JLRA 3K2MC 3V4UL 1DP0A 1XR8B 2VDPL 1N26A 1JWSA 2NY0B 4M6NL 5KSUA 2GITB 1VHPA 3I85A 1UKQA 3JVGA 2DQHL 1JZ8A 1CFSB 3RTQD 4QYOB 3T1FA 2DIAA 3PGFL 1SBBA 2CGRH 2VWEC 4K7FB 3DRTB 3C6LA 2BXYA 4HULB 1YMHA 5HDBF 2ENYA 2X44D 1R3KA 2YMXL 5BXFB 1BX2B 1LILA 2G5BA 1DANT 5GPRA 3QQ9D 5EC1B 1C12A 3CUPB 5BMFL 4GO6B 3PL6A 2V9TA 3TWCH 4Q2ZB 5CZVL 4FN0A 4UIKL 1AXIB 4UDTA 1RZJH 2G9HA 2HRPL 3QULA 3QP3A 1OSPL 5GGRA 2BJMH 4KK9C 4KTDH 4J4PC 3SDAC 5KS9F 3TBVA 3GSUA 4JR9H 1BLNB 4NWUH 4HWEH 1WBXB 5FHBL 3T0BA 5FK9A 3QA3A 3HNSL 2CUIA 4S1DD 4X6FA 4E5XB 3LQAH 1FVEB 1F4WL 3QQ4B 3V7MA 1QTYT 3L1OH 4APQC 4GBXC 2WWKO 5E6YA 5E7FA 5A2IH 1PQZB 1AR1D 4C4KO 1X3DA 1UFUA 2D0FA 5JW4R 3U6RB 1JGUL 3ZMRA 2P48B 4CADA 2XKUA 4PJ7F 2VKXA 4ZFGL 5IW1A 4HDIA 2ZCKH 4NBZB 2FBJL 4KY1H 5D96C 1T7YA 5IVNA 1F3JA 4N8CH 4N8VB 4RFOL 3SPVA 3U82B 2FH8A 2VDQL 2X4SA 3ARUA 1S7XA 5HYQA 4N0FB 5GRVK 1QSEA 5KVDL 1WIOA 4PJ8D 3O9WB 4P59H 2P8PA 3TP4A 4UI2A 3X11B 4X6BA 5L88L 2ADFH 5L2KE 4Y8AA 1NEZB 2MQCA 2ZUVA 2PYEA 3UJIL 1UVQB 4QRSA 5GGTH 1MCOL 1EHLH 1D6EA 1FGNL 1MRDH 4N0YL 5DMKB 4KV5E 1HINH 4F37K 2MMXA 1CTOA 1KPUA 1VACA 2ICCA 3TO4C 1A6AA 1U58A 5BRZE 5C3TA 4XNYH 5EPMA 4HV8B 5K9JL 1ZEAH 3DJ9A 5C08A 4L8CB 3MBXH 2DIBA 5CEZL 1OTSD 4KUZH 4HH9A 4KVNH 3T77A 5D7IA 3V5KA 3RDTD 2FATL 4XNUL 4KQ3H 1LO0H 1R5VB 3CDYA 3BKMH 3DGCR 5FYLE 6FABL 2NXYC 1T20B 5F8QC 2HVKB 3ECBA 5F7UA 1WBZA 1NL0L 2FHCA 4NCC1 5FF6B 5F7LB 3GNML 3PWVB 1YEEL 2P5WD 1U8JB 4QT5B 1CXIA 2VB5A 4X6DE 3MV9B 3OB8A 3IGAA 3JWOH 4NKOB 5E4IA 4G8FA 2GK0B 4UIMB 1QA9B 2ARJA 4ZUWB 2GUOA 3QCTL 3TBTB 4NOBA 4CVXA 2A77H 4IM8A 4PJAA 1CFTA 3PIQB 2BDNL 4X6CB 4Q9RL 3NMEA 3VXTB 1V3JA 1MFBL 4PP2B 3WS3A 5CMAA 4YHYC 4QF1A 1H9VA 3PQYE 1I3GL 1ZT1B 3DUUB 2R15A 4PJ9C 1Q9LB 1CFBA 4XXCA 1WIPA 1KCRH 2WUBH 3HTLX 3VMOA 3NA9H 1T66D 5CZXC 1TMCB 4FQLH 3WE6B 4WFGD 2VUOA 3UBXG 3ARFB 4GRWH 4UDTB 3GUTB 4DKFH 3GM8A 1C5BH 1UH2A 3GSNH 1VPOH 3FMGL 2RFXA 5I8KL 4F37F 1PKQE 1T3FB 3C5JA 4KAQL 3MV8D 3KR3H 4X5WB 3IRPX 3CFDB 2XFXA 4R2GC 1L6XA 2AXJA 5CEXB 4PB9L 3GI8L 4L4VA 3LKPA 2EO1A 1ZHNA 1ETZA 4OCSL 4HS8H 3CXHK 3U48A 2WP3O 2VSCA 2DQUH 3A6CL 4S2SB 2YUZA 3G6JF 4AK1A 3QIBC 4Z95L 1CR9L 4KI1A 5LVEA 3K2UH 3KYNA 5EIIA 1PSKL 2NY6D 3GBML 4CDHA 4WV1A 1IL1B 2Z91B 5C0JA 4NQCA 3WLBB 4HZAA 4PGDA 3WV0A 1TQBC 1D5XA 5H94B 5M95B 1S7XB 2LTQC 4I9WD 5DRNA 5IMLA 5AEAA 1TJGH 5L9DL 1K2DA 1OGAB 5MHSD 2ZZUT 3CX5J 3V9FA 5HYJA 4LCWD 3H9SD 3TBWB 3MXVH 5EZOL