4YDJB

Crystal structure of broadly and potently neutralizing antibody 44-vrc13.01 in complex with hiv-1 clade ae strain 93th057 gp120
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
205
structure length
205
Chain Sequence
QSALTQPASVSGSPGQSINISCAGRSDRVSWYQQRPNGVPKLLMFDVYRRPSGVSDRFSGSHSGDTAFLTISGLQTEDEADYYCTSHPYAFGAGTKVNVLRQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein gp160,Envelope glycoprotein gp160
publication title Structural Repertoire of HIV-1-Neutralizing Antibodies Targeting the CD4 Supersite in 14 Donors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system
total genus 40
structure length 205
sequence length 205
chains with identical sequence L
ec nomenclature
pdb deposition date 2015-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ydjB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ydjB02
1QSFE 1BP3B 4PIRF 3FT2B 4EQ2A 4DKEL 4AG4H 1HHIA 3QUXD 4HQQL 2UZIL 4FXGB 2OLDA 3WV0A 1ZT7A 1SVCP 1P7QD 2VXQL 5C9JA 4U6YB 3JWOL 4R97B 3IVKB 1DQDH 1A7NL 5D2LE 5TDOA 2P8MA 4QRQB 2Q6WA 1TZIB 4BZYA 2WMPA 3OAUL 1T0NA 1MEXH 3M1BB 3MGTB 4YHNB 1DVFB 2MSPA 4NYLA 3GHBH 3O0RH 1MLBA 2A0LC 1FAIL 4Y4KA 1DUYA 3O6FC 2AK1L 3RGVA 4PJ5A 1HOCB 3V0VB 3QDME 1KB5B 5C0BB 2NW2B 1PSKH 2XN9B 3OKLB 4HXAL 4JO1L 1F8TL 4PP2A 5ALBL 4N0YL 1IEAA 3QNYA 4MJIB 3PGCA 4H88H 3BXNB 4KK9D 4IOIA 5E4IA 4Z7QF 3LEVL 1ZHBB 3U4BH 2GUOB 3T0EB 2CRYA 3IU4L 1A7PH 2FJFB 4GXVL 2YD7A 1GAFH 1F3JA 3U36B 4KI1A 3A6BH 1EGJH 3PGDA 3IDMA 1GL4B 4B50A 3OB8A 4K2UH 4O02H 4I3GA 1I9IL 4P49A 4HHAB 5IHZA 3MRQA 1M7IB 3ZE2E 5DT1L 4Y19D 2IAMA 3MX0A 5JHDA 2AJUL 2I9LB 4U0QB 1F02I 5ESAB 4K9EH 4P5TA 3GKZA 4BFBD 1IM9A 5BXFA 2AXFB 4MA1B 3C6LC 4DOHB 1BJMA 2W65A 3CUPB 4Z78B 2Z9TA 1U6AL 4WU7A 3V4UL 1CR9H 3K8MA 5F7EL 4Y1AA 1I75A 1NEZG 3F58H 3H7BB 1U3HA 2ADIB 2PYEE 2Y7QA 4OKVA 1AGDB 3HPLB 3IETA 5DD0L 1MVUA 4XAKE 1CWVA 1EHNA 3CDGB 3D6GA 4JPVL 1MIEL 4YHPA 3LS4H 3TBTA 2YS4A 4XXDB 2AAVA 2QQNL 5E9DD 1I3RA 1NCCL 3SDYH 4K71C 2X4OB 4XC3H 2R8SH 2VL5A 3NACH 5C3TA 1FV1A 1UM5L 2VZ1A 1ZA3A 3EBAA 4TRPL 3GSRA 5TFSL 3DSNA 4HKJA 1MJUL 2AI0H 4GBXC 2BSSB 3M17A 5AZ2L 3U0PA 1UZ6E 3B9EA 3RNQA 4PJCB 4K94H 1KIUA 1KCUH 3FQXA 4H8WC 4PJXF 2XTLA 3PGFH 1JIBA 5CEXA 1IL1A 1EEUA 5EBLA 1NCBH 1K8IB 1A2YA 1JFQH 5CWSB 4AG4L 4XCNA 1CGVA 1CXIA 1EGJA 5KZCB 4Q0XH 4JM4H 2JJWA 4BELD 3RNKA 1DQDL 3O9WD 4JFYB 2QTEA 4EQ3A 1MEXL 1LO4H 5TH2B 5FECA 3VFSA 3QWQB 5DA0B 4HDIA 1J1XH 5C2UB 3GHBL 3O0RL 5SWQB 3QIBC 5JNYA 4HG4K 3WUWA 5T5NF 4QRUB 4I0KA 1KLGB 3C5ZC 1PSKL 3O3BA 4CDHA 1DBAH 4X7EC 5IB3A 3WKNA 4L3EA 3L5WB 3PQYD 3JTTB 4H88L 5D1QA 3VFVA 5CFHA 2VISA 1WZ1H 5FOJA 3ZKQD 3ZTJG 5K9KA 1A7PL 4ZXBC 2VZUA 1GAFL 4XXCC 3A6BL 1G7LB 4F3FA 1EGJL 1PX3A 1T6WA 5E1AA 4P2RD 4K2UL 4O02L 2AJSH 1KPRA 4YHIA 4RA0C 1H3PH 5FYKE 1JRHH 1G7HA 5SV3A 1Q9OA 1WWCA 5D1ZD 1U8QB 1M05A 5BJTA 5DVOA 4ODUA 4K9EL 5ISZD 4ZAKC 5EUKA 2AK4D 1LEKA 3UP1A 1RIUH 1H0DB 3WDIA 1V3MA 3V95A 1I1AC 1NCUA 2IAND 2VYRE 1CR9L 3PWPD 2X4NB 4JJ5B 1RY7B 5CGMA 3F58L 4J23A 3H3PH 3PP4H 2C7UA 1QSFB 5EFIB 1Q38A 2A83A 2K7QA 3MRDB 4NKDA 4HBQA 3LS4L 4FQ2H 3ARBD 3SDAA 3SJVE 4Z76A 4UNUA 5D2LB 2BY1A 4DQOH 3OSKA 3HB3C 3SDYL 4JRXA 5I1AA 1EVTC 2AEPH 4XC3L 2R8SL 3NACL 3QDGD 4XNQA 5D5MF 4YXHH 2VDRH 3KPOA 3WS3A 3D0VA 3EO1B 1NUNB 5FA4A 2AJVH 1UADC 2N56A 4JDZA 3QDMB 1G0YR 1Q1JH 4XPFH 4BYHA 2AI0L 4ALAH 4JN2B 2LU4A 1U95B 1QKZH 4NO0B 4TPRL 1MCSA 4X6FB 4PJAF 3MNVB 2AQ1A 4K94L 5FYKU 1KCUL 1F6FB 1XR8B 3DRQA 5B8CA 3PGFL 5L6YH 4S10A 2IPTH 1NCBL 2VZTA 4CVXB 5DK3A 4PJ8C 1L0QA 2ZKHH 4OAWB 4Q0XL 4PJFF 1T20A 2W9LA 4JM4L 4ENED 2BOBA 2NXYC 2BJMH 2PXYC 2AV1A 2VLMD 3Q3GB 4GO6B 4APQC 3EZJB 4Y5YB 4XH2A 2VABA 1D5XA 3BUTA 1J1XL 1IZKA 1BQHB 3EOAA 4WTZA 5FB8A 3U1SH 3U9UB 1NMCC 4R4BB 1VDGA 2QKIB 2XZZA 4RIRB 2DN7A 4WTXA 2A74A 1C12B 1FP5A 1DBAL 4F7CB 3OAZK 4Q7DA 3L7EB 4QXTB 4PJEE 1U8KB 1WZ1L 3ZE0E 5ADOH 3BOVA 2B7DT 1OF2A 2V2TB 1TVBA 2WZPD 1RZIA 2Z31C 2YHGA 3QG6A 5JA9A 3BQUC 1G1YA 2IH3B 4KZDL 4U1HA 1RD6A 2AJSL 3VGGA 1DE4B 1H3PL 1G7MA 2GQHA 1JRHL 5D9SA 5GS1C 1NBZA 4KK8D 1MVFA 3OB0K 1S78C 2DF3A 4LVHB 1F2XK 3DUSB 2A6IA 3BP4B 3QEUB 1A4KB 5KSAB 4YNYA 1FJ1B 1RIUL 2ZOKA 1UJTA 4KVNH 1P4BH 3GGWA 4X4YA 4R96B 1QR4A 1QLFA 2DLEA 2ZSWB 3ULVC 2ZG1A 1NMAH 5AD0A 3H3PL 1HCVA 3OKOA 3PP4L 3KS0J 1NC4A 3N9GH 3NCBB 2EKSA 1AY1H 1KLUB 3HHRB 1IM3B 3W11C 5J8OA 1ZT4B 4TUJA 4YPGA 4ZOAA 1BJ1H 4FQ2L 1H15B 4R9HA 4W4OC 2NX5D 1RZKH 2JKXA 2AEPL 3LHPH 4YXHL 2VDRL 1T4KB 3QHZH 2CH8A 3O41B 4C59B 5F6HI 2AJVL 5IMLB 1XF4A 3BVNA 4JFPB 3K1DA 1Q1JL 1IQWH 4ALAL 4Q9BA 4PY7B 5HYSA 5F7MC 4PLJC 3TZVA 1QKZL 3MGOA 5FO9B 4D9RD 43CAA 3IDXH 4EUPB 3BPLB 1H3XA 5L6YL 4G8GE 1JPFB 5JXAH 2IPTL 5E6IB 1A8JH 5DJAB 2HA1A 2JTDA 1CLYH 2ZKHL 1DQTA 4ELKA 4XP1H 1JRHI 3H7LA 1MAJA 2BJML 1U58A 1RULL 3I3BA 3RTQA 2HWZH 5KANI 4N5UA 1A6ZA 4KROB 1ZANH 2PNDA 4HW6A 1AKJD 1QD0A 5F6HJ 2ZP0T 4LHUB 3Q2CA 3ARFD 3H9YA 3U1SL 3N1GC 5HHOD 3DTXB 1W2KT 4P3CH 5CGYD 1S7SA 4OCNC 2AJYH 5D1XC 1A3QA 4G6KH 3O2WH 1V5JA 3MV01 4JO2H 3BD4A 1A7BA 4OV5B 5IJVA 4WWKA 5ADOL 2J88H 4ONOA 2Z8WC 3CXHJ 3QJHA 5BZWA 3NMEA 3BZFB 3GBLA 1N3NB 4BQBA 5GGRA 1X5YA 5JW4N 9CGTA 5IW6A 3SJVB 4QRRA 3UROR 1A6TB 4E42B 4ZODA 4HJJH 4YR6A 3KG5A 1UWXK 2YPKA 2NY3C 3F62A 5IMKB 3TBWB 4TUKH 1HILA 4LFHG 4NFDA 5T1KD 1MCPH 1ZXQA 3ARWA 5DQDH 3ZMRA 2IFFL 1LEIB 2DYPB 2BNQE 3S96B 5IBTH 1QRNA 3G6JE 4KVNL 1P4BL 2OL3A 1VADB 3DUHA 5BXFB 3ZSSA 1YYMH 4PB9H 4QOKA 4R0LB 4OZGA 4MD0A 5GS0D 3CH1A 2C1PB 4PJGE 3MLSH 4I2XE 3N9GL 4NKMA 2Z35B 2CRMA 1W0WA 4J4PA 3EUUA 1AY1L 2FJGA 1E4XH 4FFZH 3WEXB 4MD5A 2UZYB 3QEGH 1KN4H 1RZKL 4RFOH 2NY6D 1VFUA 3SE3A 1X5LA 3LHPL 3PV6A 1SYSA 4IRJA 1AO7A 3TBTB 2VXVH 3DBXB 1EX0A 3HZYB 5EOTA 4L9LB 3QHZL 1TMCB 4L4VA 1N64H 2E8YA 3TT3H 1IQWL 3QI9B 4XAWH 4YDJB 5IVXE 2AJZB 4KUZH 4NQSA 5CJ5A 5DD6B 1N6VA 5IB2B 1CF8H 1RJZB 4S1QH 3N1FC 3L3IB 3IDXL 4PJEB 3NA4A 2LTQB 4HGKC 2OR7A 3JWDC 5JXAL 1VESA 4GKZB 5IROC 5D70H 5C6TL 2XXMB 1CLYL 2VAAA 3P9LA 1A9BA 2DTSA 2HFEA 5DYOB 1QPPA 4HEME 4G9DB 4XP1L 4JVWA 1EUTA 3D69B 4WI4A 1JV5A 5ID1B 3WDJA 2ZUQB 2P5WA 3OTTA 1JNLH 1NBVH 4HS8L 2HWZL 1ZANL 3GB7A 2C5DC 1OAYH 3VD9A 1K4CB 1CE6B 4JZOA 3QUMB 2AERT 2VDOH 2GTWA 2VITA 5BRZA 1CIDA 3J7HA 1P2CB 4GKNA 4YEFA 4U33A 2HLAB 3SKMB 1P6FA 1J10A 5E6ZA 4P3CL 5F1OB 3FQUA 3DX9B 4PRPE 5TQ0H 1JF1A 3T8XB 2AJYL 3IKCB 3TO4B 4G6KL 3O2WL 3UTZB 4JO2L 3VD5A 1CDIA 1ED3B 3R1GH 4PBWD 1NKOA 4IOSD 2ARJB 2J88L 2NYYC 3EFDH 4NSKB 4W6WB 4BH8B 2NLJB 1UXWA 4G42A 3NCFB 5HHXH 4L8SC 4Y7MA 4P99A 1J05B 1MI5D 1ONQA 4HJJL 1MAKA 4XHJC 2H8PA 5SWZE 2HYMA 4OQ1A 2DJSA 2YKLH 5BS0E 3KWWB 4TUKL 1GGCH 1CTNA 1MCPL 3HTLX 1JGVH 5DQDL 5I1DA 1J87A 5EB9A 3JUZA 5IBTL 2X89D 2R29H 3HE7D 3PWVB 4KTDH 2LABA 4TULH 3DRTA 2A73B 3GDBA 5HI5C 1YYML 4PB9L 2Y4SA 1SEBA 2YBRA 4WEBH 5KBNC 5FOBA 3MLSL 4MJ5B 2IGFH 5GSVA 4G8GB 1NGWB 5EN2A 3SQBA 1E4XL 3SCMD 1KF9B 4FFZL 2GITB 1NFDE 3QEGL 1KN4L 3V7AG 4UB0H 1TQCC 5LVEA 2HRLA 1TLKA 4RFOL 5E2UH 1PG7W 3PABA 1XF3A 2HVJB 1JF6A 2VXVL 3DSFH 2ITCA 4C4KT 3VWJD 4U0RB 1Z0MA 4KRPC 1PY4A 1YN7A 3FB6A 3CMGA 3TT3L 4XAWL 1F90H 3SY0A 2H3NA 5GZOC 4KUZL 3OR7B 3LD8B 1QBLH 4HZLA 4R3SA 5GIRB 1T22B 1CF8L 4S1QL 5I74C 5C0GA 3GSQB 2ZOLA 2WQRA 2YD3A 4WI3A 5F7DB 1RHHA 1KUMA 2DOCA 2EYTB 4LCCC 1K5NA 5D70L 3VXME 3H9HA 2EE3A 3KYMB 2K7PA 1WIUA 3MLZH 1T1ZB 4KZEH 3MUHL 1JGUH 4OIBA 2BVPB 5E5RB 5I6XB 5DMIL 3MLUH 1RFDH 4RGND 5J1AA 1Q0XH 5DZNA 2IEPA 1G7IB 2JK5B 1JNLL 1NBVL 1TCMA 3G6AB 5GGRY 3DMMA 5ICZA 5FO7B 1AD9B 3WFZA 1OAYL 1RI8A 4N9GA 5E8PA 2CKBB 5GQBA 2VDOL 1ZAGA 3ROLA 2OR9H 4ZG1A 2X9YA 2Q76A 4H20H 3C5SA 3CVHB 3VGAC 4XGZA 5TQ0L 2BNQB 2V9RA 3BZ4B 5CKAA 1IGYA 4Y4HC 3G6JB 4AIZA 4TNWK 3SDXA 1E4XI 3R1GL 1MQ8A 4PJGB 4HJ0C 4PLNC 3SDCD 3T0XA 4I2XB 4QRPE 4JPIB 2FD6H 3EFDL 5DJ8B 1MELA 3KXFB 1FYHB 5FKAA 3QXAA 3CZFB 4HIIA 2XACC 4PJDE 1JPSH 5EWIH 5HHXL 3O6KH 2PYFB 4TQEH 3VFRB 3MNWB 5C08D 5SX5H 1X5ZA 4P3WA 4U1GC 2YKLL 1S9YB 1KJ2H 2GSGA 4GOSA 1GGCL 2Z93A 1JGVL 3C6LB 3JWOC 1WC7B 1PAMA 4JM2A 2H2PC 4RISH 1CDCA 2R29L 1BBJA 4KTDL 2A6IB 1S7WB 4TULL 5TJWK 2DKSA 2EDHA 4WEBL 1U0QA 2JIXB 3VFOA 4D94A 5FGBC 4U6HA 3QULB 3U48A 2IGFL 4NUJB 2V5RA 4JFDA 4MJ4A 3MLWH 3BKYH 2IBZX 3HRZA 3G5XA 3BJ91 4H25A 1T7VA 3QRFM 2OSLA 4YPJA 4ZSOA 5JW5B 2MCG1 4K71B 2L7UA 5E2UL 5I2IA 3EYFA 3DV6A 3ZDXF 3MRGB 5C07E 2RHEA 4O2EA 1Y6MR 4CW1A 3F12A 4F58H 1OP5H 4YFLI 4GBXB 3F8UB 5FHAH 1F90L 3LQZB 5D7LE 3I02A 2CO7B 1GVIA 2XNAB 4PRPB 3A6CH 2EDKA 1QBLL 2RBLA 2RFXA 2WANA 3ET9F 3ULVE 2F53E 4RAVA 2GCYA 5C0IB 3DHJA 3RZCA 4JY5H 1NDMA 3CFKB 3BFOA 5D2NA 1DUZB 2P5EA 3KLAA 2NY0D 4Q2ZA 1TZHA 1PX4A 4K7FA 3LN4A 5KSVA 1A02N 3FT4A 5HDQH 1JWSA 3MLZL 2YPLA 4KZEL 1I4FB 1JGUL 5CIPH 2VRAA 2YD9A 3D39D 4U1JA 3MLUL 1RFDL 1Q0XL 5J3HC 4M48H 5I0DA 2VLKA 1BIIA 3EZ8A 3WJJC 1FCCA 1KJ2A 3QIBB 5FM5M 2R2BB 4ELKB 1TNMA 3FOLB 5ID0B 5EC2B 5SWZB 1N59A 3UTSE 2R2EA 4K7PX 1H3TA 1EFXD 3W0WE 3EJZD 2OR9L 3C5ZB 5BS0B 5DRZA 1IGMH 1YMME 4H20L 3O6MH 3HRPA 1DQQA 4U1IB 5DUBA 3MUY1 1LP9F 1AIFB 1DQJA 3QEQE 5I8EB 3ZSTA 3FFCE 3FB7B 3V6FA 4LDLB 5MERB 3MCG1 4ZXBB 3KLHD 4ZDHA 1BF8A 5ICXB 4UMGA 5E7FA 3VDCA 2FD6L 3H9ZA 2VERN 3HZKB 4H1LH 5DHYB 3JV4B 5CZVH 4AY0A 3VXUA 2Q20A 2YSSA 1JPSL 5EWIL 3QXDB 1AH1A 3O6KL 1KG0B 4KQ3H 5IK3A 2P8PB 1MCQA 1BQHG 1NFDB 1TNNA 4TQEL 4MHHI 3ILPA 2C3GA 4C83B 2ESVA 1E4KA 3C08H 1U3HC 2XFXA 1KJ2L 1AJ7H 4AT6A 2IMMA 3HC3H 3IRZA 3IJSB 4X9GA 4ZAKB 4YR6B 3VFUA 1D6EB 3P4NA 1I1AB 1X6NA 4RISL 4LGSB 2FSEB 3BWAA 2EYSB 3B43A 3VFTA 3GMNB 1A9EB 3VH8A 3GBMH 3MRJB 4M7JH 4XTRC 2OJEA 4X80H 5IQ9A 4LVOC 1R3JB 2GYSA 3MBEA 5IW3A 2JJUA 2KZ1B 3MLWL 2Q7YA 2J5LC 3BKYL 3A0OA 4HBCH 4KKCD 3VXMB 4CMMA 4PRDA 1LE5A 4OZGB 5CIPA 4PJBE 5IFJA 3CC5A 2BVOB 3S34H 5C0JB 1MCHA 1W0WB 5EZJA 4DCQA 4GRWF 4IRZH 3GM8A 4ZPVA 3EJYD 1HXMA 1JUFB 1EJ6A 3MYJA 2NY2D 8CGTA 2JCCE 4C56D 5IEHA 4P2OA 5DQ9A 3TBVA 3STBA 3OR6B 1KJVA 5FHAL 3RL1A 4XZUB 3WHE1 1MRDH 3A6CL 1J1PH 1OAQH 1NKRA 3M8OH 5B3NA 4JY5L 3CLEH 4MXWH 1QEWA 4HFUH 3RDTD 1XGRA 3KPSA 1U41A 5F96H 1MREH 1LHZA 5F21B 1BFTA 5T3XE 4PJ8B 4H1LA 3WE6A 5C09A 3VFMA 3OAYH 4QRPB 1NMBL 1V3LA 1XAUA 2NXYB 1QLEH 2PXYB 5HDQL 1NAMB 1J0JA 4G5ZH 5FKPA 2XKNA 1D6VH 1JCKA 4PJDB 1NPUA 3MXWH 1JGLH 1MCKA 2EE2A 4PD4J 4M48L 5J4MA 3BP6B 3UZQA 4P4KD 2DBJA 1ZSDA 1NMCB 4OFPA 2GJ6A 1EEYA 2OMBA 1IGML 2PW2A 2Q87A 3O6ML 3QNZB 1IKNA 5EU4A 1RK1A 5C0AD 4ZYKA 1KCSH 4WNQB 3ARXA 4X6BA 4EUPG 4CVUA 4LCYB 4LBEA 3T65A 2DD8H 2FWOA 2DMKA 3LSOB 1QQDB 1CFNB 1MH5B 4PJ9C 1G0DA 4PJIA 1CGUA 1T5XB 2Z31B 5CZVL 3THMH 3BQUB 4X0KA 4KQ3L 4PG2C 4X7TB 4PJXA 5GS1B 4LHUG 1KIQA 2VB5A 4PTTA 1CFBA 2V7HB 3C8DA 4ISVB 2X41A 1YEKH 3C08L 5M94B 1U8OB 3NIGF 1AJ7L 1FIGH 3T1FB 4Q9QH 3HC3L 2XZAH 5C07B 4WEUD 3HE6A 1RHFA 1XGTB 1E4WH 2CR6A 1WAAE 3DYOA 5D7LB 2X4SA 4MXVE 2VOTA 3I6KB 4G6MH 2F53B 1VHPA 3GBML 1JGDB 4M7JL 3RWCB 4ZNEE 3SDDD 1NGZB 4X80L 4YXLH 1LEGA 3BP5A 3TVMD 2WBJC 2OTWA 4HBCL 4KU1A 1UA6H 4ZFFB 4OZHE 1JYVA 3DXAE 5LGJA 3S34L 1CG9A 1S7QB 3OJDB 1FGNH 3N1MC 5IVZB 3V6OC 4IRZL 4XBPB 5E8OA 4PYHA 4KWUA 4FA8A 4NFCA 1UGNA 3IFOB 1FCGA 3VRLF 3UTSB 5JXEA 1J0HA 4JFEE 3W0WB 2VDMH 1ZWIB 1YMMB 1KN2H 4NDMB 4J3WA 1MRDL 1JP5A 1PJ9A 1J1PL 4PGDA 1OAQL 3M8OL 1AGBA 3IGAB 3QEQB 4UUJA 5HI3D 4GW5A 1RAMA 1BZQK 3FFCB 3VXOB 1RUKH 3CLEL 5JPNB 4MXWL 3OXSA 2EXWD 4HFUL 1AXIB 5F96L 5HPMA 1IZJA 1KPUB 3T4AA 1HDMB 3CFDB 1WCBB 3H9SD 3X11A 3ES6A 1T2QH 1QLEL 3FFDB 3QH3B 4G5ZL 3GJFH 3KYOB 1D6VL 3WLWC 4QXUH 5HGHA 3IDNB 3MXWL 1FL3A 1JGLL 3DETC 5F3BB 4OLYH 2VLJD 2B1AH 2AVGA 4FABH 2HLFD 3EO0B 3DO7A 1Z9SA 2YN5A 4L9DA 1SJEB 4QTHA 4Y16D 4QHUB 3QDJE 1V05A 5T5FH 1NGXB 1KCSL 3ARGD 4N9GB 2Y06L 3FCTA 4WJ5B 2XT1B 4NQXB 4P46C 2DD8L 4LRIA 2KL6A 4PG9B 4YE4H 1J12A 1G7QB 4ELME 4M6OH 3NH7H 2B39A 3THML 4Z7NF 4PY8J 4ZUVB 4HUUA 4PJBB 5EZOH 4IHOA 5C3LD 1PKQA 1CVRA 1UJ3A 3LY6A 1JBJA 1BLNA 2DJ4A 4QYOA 2NY3B 1J86A 1YEKL 1YNLH 5C0CE 2ERJC 5AZEH 3L9RA 4PJFA 2YOCA 4NO2A 1FIGL 4Q9QL 1NH6A 2IMNA 2XZAL 2JCCB 3BIKB 4MAYA 1S9XA 2EDQA 5EO1A 4PRID 1BQSA 5I8CA 4Z7UE 1X4XA 4GG6F 1E4WL 3LZFH 1IAKB 4PLOB 2DQGH 1R3IL 4G6ML 4YIQA 3BZEB 1HK6A 4JFZL 3LKOA 4YXLL 1ZHNA 1I8KB 1B6UA 3GJFA 4O2FB 2HFFA 3R06B 1NJ9A 1UA6L 1CIUA 3WHXA 1ZEAH 1GHFH 3MR9A 1TITA 1FGNL 3L6FB 4IBLT 2BSRB 1S7VA 3V6ZB 3TEUA 4X4XB 1TQBC 3CX5J 4MNHA 1HYSC 2XWTB 4GSDH 2FIKA 1T1YB 4JJHA 3AY4C 3HB3D 3W9EA 3RA7H 1H5BC 3QPQD 2VDML 2DL2A 1YY8A 3TA3D 1HYRC 1KN2L 4LCUA 4R7DA 1P9MC 3BUYA 2APXA 4O2EB 5KVEH 5H35A 1BX2A 4KY1H 1RUKL 5H2BB 5E5MA 1QLRB 4NQCA 3DIFB 4MVBD 4Y5XA 1CGYA 1UB5B 2ZUUA 4L5FH 2ARJQ 1ODAA 1XCTB 1T2QL 4OCYH 4LIQH 2P24B 4RBPK 4QXUL 2LE9A 4JQXA 5E24E 4OLYL 4P0DA 3QJFA 3ISWA 2B1AL 3MPCA 4FABL 4GAYA 4EI5A 5I1LA 4MDIB 3QIUC 3WO4C 2IPKA 1XGUB 4DGIH 3ZHLA 3ULSA 4O2CA 2VLKB 4K7PH 1BIIB 3QEHB 5JIIA 1AGFB 4WWID 5T5FL 5ICYB 5C0RH 4N68A 3FN3A 5A2KH 1DP0A 3IKKA 1IAOA 1CICA 1RZKC 5CUSL 1EV2E 2GEEA 1D9KC 4JKLA 1M6OA 1IGJB 3FO9B 3UBXA 1J0IA 3IF1B 4HUNB 2VDPH 4HEPG 3T0VA 1OTSC 5H37G 4YE4L 4EI6B 2YUXA 5HDBF 2OJZH 1NUFA 1ZT1B 2W1NA 4M6OL 4ORGB 3NH7L 3K81A 4OZHB 4UQ2A 4L8SB 3DXAB 2BRRH 5EZOL 3LRHA 3BGMB 3VMPA 1HEZB 4D0CB 1S7TA 4M8QB 4HLZH 4FFVC 5I8KH 3ULUH 3PF2A 3CLFH 2H2SD 4RNRA 2DI7A 1S78D 1EO8H 4QWWD 1IEHA 5IMOB 2VUYA 3ILPB 4JFEB 1JTPA 3TPKA 3LZFL 5JOPD 2CDFA 3VRJA 5JZ7C 2J2ZA 4JFOA 3WFDH 1MCDA 3C60A 2DQGL 2IH1A 4MSWA 4FTVB 2R0KH 4QGTA 4G80A 1X5FA 2PO6C 4NKOB 4HG4J 3Q5YA 3RI5F 1UWEH 4P5MB 1HHJA 3UTQB 1DBBH 5K9OA 4LCIL 3T3MF 1ZEAL 5CEZH 5E95B 1R3LA 3D2UD 1GHFL 1T89C 1TQCB 5DHVH 1Z9OA 1HH9A 1OW0C 3RUGE 1NCDH 2OXHA 2ILLA 5I1JH 3R8QA 4L4TD 3AC0A 4UQ3B 1GZQA 1BFSA 4GSDL 4ZFOB 1NL0H 3HAEH 2RIKA 3MREA 3RA7L 1DLHB 4KRPB 3EDDA 3WIFA 4AQ1B 3KPMB 5FYJE 3QDJB 3I6LD 5EPMA 5D7IE 5I74B 1FVEA 2EXYC 4PFEA 1SYVA 5KVEL 4PLJD 4KY1L 5CZKA 25C8H 3RIFF 4LCCB 1Y18B 4J2XA 3GSVA 3NCYP 4MNQD 4L5FL 4ELMB 4OCYL 4EIGB 4LIQL 1IQDA 4FRWA 4I0PC 1MCOH 2FBOJ 3GSUB 5IB4A 4D8PB 3VXSE 1DQLH 3O8XA 1C08A 1UC6A 2ZZUT 1A1NB 3O3DA 4TVPH 1P7KA 4JFFE 4G9FE 4XI5C 4IEFB 5C0CB 2VAJA 4MLIA 4DGIL 2PN5A 1PD6A 3VGAB 1HIMH 3CMOH 4K7PL 1MPAH 3BH8A 1YN6B 5C0RL 2WQ8A 5DI8B 4Z7UB 4Y4HB 4YDKH 1MCCA 1JYWA 1FZJA 5C6PB 3UBXI 3HS0B 1RVFH 4MZ3A 1R5WA 2ICWJ 3RWIB 5D1XD 1TENA 4WO4A 2VDPL 3QUYA 3C8HA 2OJZL 1HNGA 4LBEB 1KCKA 1R3KA 1X9QA 2G9HB 4IRSB 3D5OF 3VJ6A 4V1DE 5CBEB 1Q9LB 5DHVA 5FYJU 1UWGH 3HG1D 3LRGA 2BRRL 3FQRA 2XYCA 2QL1A 4NM4H 1JZ7A 3M45A 5EU3B 2BHYA 3PG2A 2HT3D 2BY0A 4KI5C 3MLYH 4P3DA 3S3JA 5I8KL 3NOIA 3HAEA 4WUUE 1RZFH 3PL6D 4W70A 3ULUL 4G43B 3CLFL 1EO8L 4J1UB 3UPRA 1FPTH 3ZDZF 4CUCA 2E6JA 2D03H 4O9HH 1Q9KA 4ACPA 1ZVYA 4I4WB 3MV7D 3RHWK 2GK0A 3WFDL 1QR1B 4YLQT 2R0KL 2MKWA 3F6LA 4H0IA 5GHWH 3BO8B 3ZKND 4NT6B 4HH8A 1N4XH 1UWEL 4FQHB 1T7WA 1DBBL 4O5LH 15C8H 5CEZL 1ZGLP 3ZTNH 3PWLB 3QNXA 1BVLB 2G60H 5EUOF 2UUDH 3MRCB 4NGHH 3JXAA 2PUQT 3DROB 4E5XB 1NCDL 3TCXA 2F9BT 5HJ3A 5I1JL 4FG6C 3VFPB 1JHLH 3H2WA 4E41A 1I1FB 1BD2A 1HXYB 3RJDA 2GJZA 3AREC 2ZCHH 1NL0L 3VE0B 4KV5E 1K2DB 4ODXA 1CDGA 2XPGA 4F2MB 3L5JA 1R24A 1Y0LA 1TIUA 4ZUTA 4EN3C 4AM0B 2E5EA 1M71A 1QFWM 1RZ8A 3ARDC 4OFYA 2YRLA 4L8DB 2E6QA 1EHAA 5EO0B 3WYRA 4XMKH 1CI5A 4LLWA 4LOUD 2CK0H 25C8L 3DMMC 4P2QA 5D72H 3GSXA 3MC0A 2RR3A 1FO0B 1SQ2N 3KPNA 4DGYH 3QA3B 1OT2A 5K33A 3S37X 3DPBA 4NRYB 3LS5H 4MJ6A 3RRQA 1MCOL 5DVMA 3V6OE 2BX5A 3VI3E 3W2DH 5IESH 1DQLL 2IBZY 1BWMA 2R0WH 3BEVA 3PWNB 3OKNB 4G8IA 2B4CC 1BOGA 3X11B 4HK0B 3MJ8B 4TVPL 4P9HH 4WFEE 5GGUB 4BJLA 5MEND 3PIQA 4HKXB 3B9KD 2A9NH 2DRUA 3VGDA 1EO5A 2XKUA 1HIML 5I16B 3PNWA 1MPAL 4Y4FC 1BZ7A 5L8JB 4XP9H 4WW2F 1OSZA 4YDKL 3V4PH 3VGEA 5DRNA 3TIEA 1RVFL 3GIVA 4P23C 4FQXA 2R4RH 4GLRH 3BZDA 2WSKA 1UM4H 3IRPX 1A47A 4KKAC 3MOQA 3N50A 2NTSP 1I1CA 4R4NC 2UV3A 2D7MA 1S7UA 4HCRH 3SPVB 1UWGL 2ID5A 4JM2C 5D7JD 4HUVB 4NM4L 3MRLB 4V2BA 5DURB 3RWGB 4PBXA 3C5JB 3MLYL 4Y2DA 3RUGB 2BVEA 12E8H 4X8JA 1RZFL 1VCAA 3U4EB 2BSED 3L7FA 1FPTL 4X9HA 4PB0H 2D03L 4K7PY 4M8VA 2D4FA 4O9HL 3S5LG 4NZRH 4PRHA 3TNNA 4ODHH 4N0FA 5EO9A 5ESQB 5D7IB 5IF0B 4Z5RA 2D7QA 3Q5TA 4CL7A 2BRQA 3WMSA 1IT9L 1U8NA 2O5XH 4OM0H 2X4PB 5IHUH 2X1OA 3S36X 5GHWL 4LVOB 4LAJH 4DEPC 2J5LB 3OKDA 3DX7B 1N4XL 2YXMA 3BMVA 5A2FA 5L2KE 1IEBB 3CFJA 3FHAA 3MRHA 4O5LL 5DC4B 15C8L 2NZ9C 3ZTNL 2VSCA 4MCYB 2G60L 4J12A 4NGHL 3VI4E 3MA7A 3VXSB 3OGCA 3BN9D 1URLA 2HFFB 4HUWB 4HH9A 2VXTH 4PTUA 1S5IH 1JHLL 5GRVL 4TVSa 5F1IA 4JFFB 3MR9B 1W0YT 2ZCHL 4G9FB 4ESKA 1ND0A 4AIXA 1N7MH 4HV8B 1DFBH 3CK0H 4MNHB 5A40E 4FQQB 1MHHA 2MHAA 3QCUH 4X6DF 1A6VH 5J9PA 3W81A 4WCYH 6CGTA 3G5VB 3IYLW 3QUZD 1DZBA 3HR5B 2N4IA 5BVJB 1KTLA 3EDFA 4XMKL 5SWSD 2CK0L 4UNTA 1T0MB 4DK3A 3B5GA 5D72L 4NQVB 4LVNC 5FM8A 3EJJX 2DM7A 2BNRE 1QFOA 2YC1A 3QFJE 3LS5L 4LCWE 5ANME 3DGCR 3W2DL 1K85A 5IESL 4V1DB 4R2GC 3BRDA 3MV9E 2R0WL 2PTVA 3DV4A 3TM6A 2AQ3A 3L3OA 4LGPB 4P9HL 2VZVA 3ROOA 8FABB 4X6CA 1JZ2A 5BV7H 2AEIT 4WUUB 4O4YL 2A9NL 4LLAA 3E1F1 3HN3A 4X8XA 5TF1H 3HKFA 1MJJB 4TUOB 1XGQA 1ORQA 4M93C 4XP9L 2G5BA 1TTGA 4GUPB 5IBUB 3RWJB 3WFHB 3V4PL 3INUH 1OGAE 4JREC 4RRPA 3SE9H 2R4RL 5ELIA 1UM4L 4PJ9B 1FYTD 4Q6IB 3OX8B 5KSAD 2BC4A 3JWNC 3EYOA 2EO9A 4KKBD 4XCFH 4HCRL 5E1HB 5JTWA 3GSWB 1FNEB 1C5DB 2JJVA 1M4KA 3GSOB 2OQJA 1I7UA 4A2LA 4MZ2A 3KPRA 5E8DH 1XZ0B 3MJ9H 5HYJA 12E8L 1R5VA 2JJSA 2OCFD 3ILQC 3RX7A 3FOMB 4QY8B 2QLVB 4ONFH 2CSPA 2UWEE 3ZYJA 5DMKA 4PB0L 5CP7A 5TQ2H 4PJHA 4NZRL 1M7DA 4ODHL 5D4QA 4YDLB 4KMQA 3D3VD 1JN6A 4GRWH 3ZT7A 4L3CB 1FZOA 4D9LH 2O5XL 5IHUL 4OM0L 5DEGB 1INDH 1YMHA 2VQTA 5T3ZH 2NTFB 3QUXC 5ERWB 3MMEA 2CDFB 1AP2B 1AXTH 4JFXB 2WBJB 2AABH 5EC1A 2D7OA 1LP9A 3JUYA 4KDTA 4MAUH 1F3RB 1AXSA 4OF0A 1T1WA 1J8HA 4JANB 4A6YA 2VKWA 4E0RA 2FH8A 3VXQA 2VXTL 3CSBA 1LE9B 1BMGA 1S5IL 5CJQH 1IGIH 2XOTA 2RQ8A 1P1ZB 4M6MH 2J6EH 1N7ML 2WP3O 1JI2A 3WUZA 1DFBL 3CK0L 2BVQB 3NPZB 2NY5C 4KK9C 1UQSA 4MA3B 3QCUL 4GLRI 1A6VL 3LQMA 1NEZA 4WCYL 3V0AC 5KSUA 4ETYA 2J8OA 2W0LA 1AO7E 2BCKB 3ZTJH 4G8FA 2DQCH 1I7ZB 3P2TA 2F54E 2AJ3A 4WHTA 3DVNA 5JO5A 4Y4KD 4YK4C 2YMXH 1KULA 5CJBA 3L3HB 3RGVD 4Q9CA 1NAKH 2GT9A 4PJ5D 5C92A 5DEFA 3MJ9A 1KSRA 32C2A 5IMMB 5EDXA 3I6GA 1LNUB 2FZ3A 1U3JA 1E28A 2J7LA 5BV7L 2EECA 1BECA 3O3EB 1EMTH 2VLRA 3CSYA 5TF1L 5D7KD 2V5TA 4JCLA 1EBPA 5I17B 4JE4B 3RL2B 1B4JH 3TPUA 1CGXA 5E0QA 2GK2A 3MZGB 4ETQB 4P46B 4XC1H 4NJ9L 3INUL 4DJMA 2BNUB 3SE9L 1CD1B 1SMOA 2WM0A 1PKOA 1ZLUH 3BH8B 4RMVA 1N5YH 2P44B 1UVQA 2X4RB 5L0QB 5INCA 4QHNA 3RX5A 3ARYA 2NY4B 2IAMD 3IJYA 4GRLA 4MNGE 1GGYA 5JHDD 1SBSH 1QA9A 3D1MC 4XCFL 5L2KB 1U91A 3C2AH 3FHQA 1SJHA 4P5TD 2I07A 5E94B 1CFSA 1IM9D 2R0ZH 5CSZA 4ZPTB 2DIBA 5E8DL 3MJ9L 4QO1A 4YDIH 4Y88A 1CT8B 1DDHA 1FFQA 4HGWB 3WKMH 4Y1AD 1ZHLB 1UM6H 2HJFA 2J6EA 4IMLA 4ONFL 1QSEA 2D7NA 3G04A 1B0RA 3ARSA 3WDHA 5TQ2L 1J7VR 4NJAH 1WICA 1WV7T 4LHJB 1RJLB 4F57L 1PZ5B 3MLTA 4WI7A 4ZQKB 3V5KB 4QXGH 4RDQF 3UPRB 3MRKA 4D9LL 1PLGH 2J8UA 1A5FH 4I5BA 3HPJA 1TTFA 5TGBB 5T3ZL 1U93A 4PPTA 5MEQA 3QIWA 3QDAA 1AXTL 1HHKA 3U6RA 2AABL 1QVOA 4M6NH 2BNRB 4S11A 1WLHA 1F4WH 4ZTOH 2OP4H 3O9WC 4MAUL 4PREA 1KB9K 3QFJB 4LCWB 1F6AB 5ANMB 4UIMB 3IDGA 4X7DC 3HA0A 5EOCH 1S7XB 4KI5E 5HHVH 3BE1H 4S0SD 3BHBA 2W9DH 4JY4B 2H6PB 3MV9B 1TQBB 4KK5D 2SEBA 4UT9H 5CJQL 1IGIL 1H5BB 4LLUB 3BRGC 4M6ML 2J6EL 3SGKA 2H32B 3BT2H 1ZLVH 4JRYA 4JQVA 1C1EH 4E41B 4NNYA 2AKRB 3MRFA 4I18C 3MRMA 4P48A 2F5BH 1EDQA 1OGAB 4UDTA 5GGSB 2CXGA 4URTB 3UDWA 2DQCL 5GRYA 3GUTA 5L2JB 4K8RD 4Z7VE 1EK3A 5EU6E 5MEOA 5KAQF 4LKXB 3S37H 2WBWB 2YMXL 3PP3H 1NAKL 2VQ1A 1ZE3C 4PJEF 5J0BA 3FO1B 4L3ED 3STLB 5D1ZC 2QSTA 4NQDA 3WO4B 4FQ1H 4Q9RH 5D1QD 1NLBH 1KJMA 4OZIE 3AMLA 4PGZA 3VRIA 4R7NA 2UWEB 1PEWA 1E6JH 4NRZB 1B4JL 2EYRA 4GRMB 3KYKH 3LKQA 4F7TA 1D9KB 4XC1L 2BY2A 3PXHA 3V5HB 1I7TA 3MV8E 4MD4B 3U82B 4JZNB 3GO1H 1N5YL 2IG2H 1G9NC 5D71H 5DJ0A 4I48B 2A6KB 2R1YA 4NZTH 3RPKA 2FEEL 2GTZA 3VCLA 1VKXB 2CDGB 3OGOE 1SBSL 4AEEA 3ARBC 1YEDA 2Q3AA 4MS8D 1BPVA 3C2AL 5EBWA 2EDFA 2R0ZL 1ZS8A 1HHGB 3T04D 3SBWC 4RMRA 2XRAH 2BOCB 5C0ND 3GSNL 5BQ7A 3FT3A 1S3KH 4X5XA 2FO4A 3G08B 3BMWA 1UM6L 5HXMA 2A6JB 2YUZA 4L3AA 3H0TB 3MJ6A 4AENA 3CXHK 2X4UA 3FQTA 4NJAL 5DO2C 5HYIA 4YAQA 2HVKA 3S9DB 3L7FB 4QXGL 4AH2B 5A16A 1JTOA 1GGBH 3O4LE 1A5FL 3SDAD 3RY6A 3LEXB 4OI8A 2GHWB 3ARUA 3EYUH 2LU7A 4M6NL 3F7YB 3S36H 4JRXD 2DWEB 4ENEC 3X13B 3UTTB 2BVTA 2EZ0D 5C0DB 3HZVA 1F4WL 4ZTOL 2OP4L 4MMXC 3B2VH 1AHWC 3VXPB 1LDPH 4NWUH 4TN9A 5EOCL 4X9FA 5HHVL 1UCTA 3BE1L 2W9DL 4XNXH 5ITFB 1SHMA 3DURA 2XWBA 5DMJB 4PJ7A 2CIIB 2HFTA 3BX7C 4UT9L 5DVNA 3H9SA 1VFMA 4ONHA 1FGVH 5A43C 5F89B 3NBNA 2ZNXA 5CMAB 1UXSB 1NBYB 3TN0A 3CFBA 1FL5B 3B4NA 3BT2L 5DRWA 4PTUB 3IDYC 2ENYA 2NW3B 1C1EL 5DJDA 3BGAA 2VJXA 5AUMA 1DCLA 4I9WE 5TPWH 3KJ4C 3OHXB 1DN2A 2W59A 1R3HA 3G9VA 4KXZH 5K59F 2F5BL 4HJGA 3X3FH 4NQEE 3R0NA 2FEEI 5HHQB 3LDBC 1FQ9C 3KDMB 5CSBA 3WL9B 4CNIB 1Q9WA 3KPQA 3KYNB 2VDQH 3OWEA 3ZZ1A 4I0PB 5EBMB 1R5IB 1MAMH 4MNGB 3CCHA 3S8WA 2Y07H 3MCKB 4XP6H 3MLXH 3F6IA 5B4MD 3QXVA 4KK8C 5C7XH 2VZOA 4RWHA 3GI8H 3BKMH 4FQ1L 4Q9RL 1NUGA 4B53A 1FLTX 3JV5A 1LK2B 3GMLB 2BMKB 1KTKE 2R39A 1S5HA 5T1MA 4JO4H 1E6JL 3ROOB 3E6FB 3QUKB 3JV0A 4QRTA 3KYKL 4O51A 5IVNA 1Q94B 3EDJA 3E6HB 4IIQC 3GO1L 2P1YA 2IG2L 1P6AB 5HY9A 5J13B 5D71L 1IGCH 5KOMC 4XX1E 4NZTL 3UTOA 1KGCD 4J3TA 1KOAA 3MLVH 4ODBD 4Q74A 2AXGA 2XRAL 3RWFA 5TDNB 1LQSR 1S3KL 4LP4A 3WJLC 3AFLA 1OGTA 1XCQB 1ACZA 1I7UB 5DC9B 3VXUE 1NC4D 2EIZA 2GAZA 1XIWA 1LK3H 5DJCA 4F9PC 1UG9A 5GSRB 5D6DA 2J12B 4WFHE 1RZGA 2EDJA 1GGBL 2Y25A 1JNJA 3AU1B 5EOCJ 4HWZA 3I75B 4EVNB 3ARQA 5JORB 2FL5A 3EYUL 2ORBH 4HKZA 3U2SB 2HT4D 4P5KA 5FUCC 3B2VL 4Z7VB 1LDPL 5EU6B 4NWUL 3SGJC 1AD0B 3G5YA 1UB6A 2DIAA 2RB8A 4XNXL 3M07A 1U8PB 3GIZH 4LLQB 5F88B 1UZ8B 1JZ4A 3ARFC 3TZVD 3AREB 3K80A 3QQ4A 3BH9A 1FGVL 1IAIH 5B39B 3TO2B 3CSGA 5GRJH 1A6AA 4EN3B 5FGRA 2P8LB 4Z7QE 3ARDB 5CHNB 4HIEA 5TPWL 1E27B 2VXUH 2DI8A 3PDOB 3VWKA 4GJTB 4QHKI 4XRCB 3MV8B 3VXRA 2FYYB 3C9NA 1UQSB 3RTQD 1QYGH 2PETA 1P84K 1K9TA 2BZDA 2VDQL 4WHYG 2WUBH 3WLBA 5IVOA 3F7VB 1NFKA 1VPOH 1MY7A 2Y07L 3DX6B 4G8FB 4XP6L 3MLXL 5FK9A 4LQFH 5SV4A 3O45A 4BFIB 2DQJH 2Y5EA 5C7XL 2E7LC 3DVGA 4ORZC 3GI8L 3O11A 3BKML 5T1LB 3TNMA 4JZJC 1KB5H 4HFWA 1NBQA 2FIRT 1YA5A 4JFQA 3T4YB 2H26A 1CFQB 4Y4FB 3P77A 3QRGH 4JO4L 1JF5A 4WWKD 1U8MA 2X70A 2XWJA 5F9DC 4QHKJ 4NC0B 5E00B 3V2AR 4P23B 1LWRA 1HN1A 4J3SA 5GS0C 3AAZA 1L9NA 1OAZH 1I8MA 3O4LB 5CP3H 5BVPH 4QRRD 1IGCL 2IBBA 5BW7A 4UOW0 4U1KA 4J8RA 1L7TH 2MMXA 1NFIA 2C3VB 4BH7A 4OLUH 4Y19E 3MLVL 1FL6B 4PRAB 2R69H 2NY6C 4W4NA 3SE4C 4NKQB 1DN0B 3KPPB 4ZUSA 1QA9B 2B1HH 1QRND 5LCVH 4NN5C 4AIOA 4L8BA 1T2XA 5DXWA 4QOKD 4G8EA 1H8SA 2JE8A 4LSVH 1VACB 4KXZI 1LO2H 4J4PD 1NFDF 2DQFA 1LK3L 4OUUB 4IMLB 3FT2A 5IJKA 2EDNA 2MKLC 2D9QB 4FXGA 1F00I 4RFEB 3O3AB 5BOZG 4DEPB 3P4OB 4U6YA 4NQEB 4FQPA 3IVKA 3IDJB 4QRQA 2ORBL 1TZIA 2WINB 2EDDA 3I50H 1U8JB 3M1BA 3BW9B 3ECBB 4JPKH 4IRJD 1AO7D 1DVFA 5E9DE 1II4E 2X9WA 1LO3H 4NWTH 4RX4A 5JW3H 2NXZD 4L4VD 3U30C 3GIZL 3I85A 1HOCA 3V0VA 1KB5A 5C0BA 2NW2A 2XN9A 3OKLA 4KJWD 4XP4H 3QHTC 4UTBL 1IAIL 1IMHC 3QFDB 1G6RB 1KTRL 4MJIA 4JRWA 4OZGF 2P47B 4PGBB 3BXNA 3LKPA 4KTEH 3GM0A 3IFPB 5GRJL 1JZ5A 3HZMB 3MTRA 1BREA 1ZHBA 1N8ZB 2GUOA 1EA9C 4BK4A 3T0EA 2DM3A 4UILL 2VXUL 2FJFA 3U36A 5I0ZA 4OFVA 5FO8B 4U1MB 4LVNB 3HC4H 3PJSB 4S1SH 2P5WD 5C71A 1QYGL 4HHAA 4CN4A 4N0UE 1M7IA 2WUBL 1JNHB 5F1NB 3P4LA 1VPOL 3HI5H 2BERA 5FEBA 5BRZD 3UC0H 4AMKH 2H9GB 2I9LA 4LQFL 5ALCH 4FFWD 5ESAA 2DQJL 1TCRB 2AXFA 5DD5H 2EEDA 3C09C 1KB5L 3CUPA 4Z78A 2JB6B 4Z77B 3K2MC 3PQYE 5IWLC 2R2CA 3V0WH 3AGVA 5DJZB 1OPGH 2CLZB 4M93B 3QRGL 3MJ7B 4DK6A 3HE7C 4GKSB 4TSBH 3H7BA 1GJIA 2ADIA 4NOBA 3C2SA 5ACLA 1Y6KR 4UU9B 5C2BH 4JREB 4OCLC 1JPTH 1AGDA 3HPLA 5ADPH 2ADFL 4WTZG 5EBGA 3CDGA 1OAZL 3OJMB 5EIIB 1UT9A 5BVPL 1OB1B 5E2WH 4P2RE 3SCMC 1L7TL 4XXDA 2G2RB 3S4SB 3SGDH 3UXFA 4OLUL 2X4OA 1KFAH 2MQCA 2GFBB 4OF5A 2R69L 1W72B 5D5ME 1IAII 3T08A 2GTZB 5ISZE 1WJ3A 3L1OH 5LCVL 2AK4E 1P69B 5IIEB 2BSSA 4Y2OA 3VWJC 2IANE 4LSTH 4X9BA 1PG7H 3PWPE 4LSVL 4PJCA 4JY6B 1LO2L 4PJAE 1X3DA 1RUMH 3ZLQC 1K8IA 1VEPA 5CWSA 3HLAB 4RMTA 3P11H 4KJQD 4OCMC 3QUXB 4U1NB 4PJFE 4R4FH 3EFFB 3MFGB 1P7QB 5A2LH 3TBSA 4JFYA 2YD4A 3I50L 2RJMA 5EU5A 2X4QB 3RX8A 4JPKL 2AEWA 1FHGA 5TH2A 5DLML 3WNNA 4RGNC 1LO3L 4NWTL 3BWUC 1H3VA 5JW3L 3ULVF 5SWQA 2YPVH 4GAFB 3QDGE 4WI2A 1KIRB 1FN4B 4OZFB 4QRUA 5I1IH 1KLGA 3G9AB 1ZA6B 4D9QD 1CVSC 4XP4L 3QO1B 5DJ6B 3L3GB 5DVKA 3L5WA 5JW4Q 5CJXA 4XVSH 3JTTA 2ADGB 1I9JL 3MODH 1U3YA 4KTEL 5HHNB 3JV6B 1CXFA 3S35X 5FM4A 3IAQA 3OF6A 1FZKB 1F11B 4HWNA 4EJ1C 5L88H 1N0XH 4WDIB 3EYVB 5DJYB 1EVUA 1G7LA 2BVYA 3HC4L 1ZLWH 3SDCC 5IBLD 1JHTB 3RY4A 2I26N 3OKEB 4OQTH 5I30H 3QWRA 3DMMD 4WFFD 3OKYA 1QHPA 2VLME 4UT6H 4UDUB 4YK4B 4MQXD 3T0AA 5LAXB 5DC0A 1XMWA 3HI5L 2NY1D 1PYWB 3UC0L 1U8QA 4Y19B 4AMKL 5C70A 4WTWA 1S7RB 1QNZH 5ALCL 3TIDB 5DD5L 1CTOA 1H0DA 5HYQB 4GT7A 3P3YA 1A1MB 3MLPA 2ADJB 5KS9E 4XCEB 2FHBA 2X4NA 1OPGL 4JJ5A 1K4DB 4TSBL 1MOEA 1ZK9A 3IJHB 3CIQA 3LAFA 2EH7H 3CH8A 5C2BL 1JPTL 1QSFA 1F4AA 4NQTA 5EFIA 1OAXH 4ODWB 5E7BA 3MRDA 3UAJD 4UTAH 2F74B 5DRXB 5E2WL 1YJDH 3N06B 2X4TB 1FAKT 4DN3H 5D2LA 4X5WB 3EOBB 4KMTH 3QHFH 1KFAL 3LVEA 5E9DB 1VGKA 2O93L 3EO1A 4JM2D 3V7AE 4YHYC 1I9EA 3L1OL 1GXEA 1RZJH 3QDMA 4OD2B 3T2PA 5IM7B 1OTTD 1P4LB 1X5XA 3OJVC 1JZ6A 1U95A 3SDXF 4LSTL 4R26H 5GGTH 4DUWA 4NO0A 4CVZB 1PG7L 3HNTH 1PGRB 4X6FA 5ETUB 5SX5K 1XR8A 3MRRB 4JFDD 1BEYH 2KQMA 1RUML 4OGAD 2D7TH 3UJTH 3V79C 4CVXA 3RP1A 3P11L 1P53A 1JMXA 2NY0C 1BVKB 4OQTA 2IPUG 4R4FL 5LJYH 1U9KA 5F93C 3VW3H 2ZWLT 3WIHH 4XT1C 1UH4A 2FHCA 2AQ2A 3O9WB 2NX5E 1EZVY 2VIRB 5F97E 4Y5YA 4N0UB 2YWYA 4M9OA 1BQHA 2YPVL 4MMZC 3U9UA 4R4BA 2QKIA 5CCKH 5KSBB 4RIRA 1C12A 3HNVH 4X83A 5I1IL 1A3RH 1BZ9B 3EJZC 4F7CA 3G5YB 4LIQE 3L7EA 3QQ3B 3RZCD 4XVSL 4MA7H 2YD1A 3MODL 4BSWB 4NPYB 1YEJH 2LV4A 3PQYB 4QXTA 4D9RE 2P5ED 1CD0A 3LB6D 4C54A 1U8KA 4I18B 2PYEA 4EUPH 4QCIB 2AP2A 4YGVB 3WIIH 1OP5K 2YPLD 1N0XL 4U7KA 4Z18A 5L88L 2V2TA 3QG7H 3KLHC 2ICEB 3LKNB 4G6FD 4LKCB 4NQUA 1TXKA 4UZGA 4OQTL 3SGDI 2VLKD 5I30L 2V7NB 1HSAB 5FUCE 3TP4A 2IH3A 4UT6L 1DE4A 4U6XB 3WN5C 2PW1B 4PV8B 3UPAA 3C9NB 2ZJSH 4IS6B 5FYKH 3DUSA 5J6HB 1QNZL 2DAVA 3BP4A 5D1ZB 3QEUA 4R2GD 5HHOE 5I8OH 1A4KA 5D5MB 4NBYB 4OLXH 3L5HA 5ISZB 1FJ1A 1UFUA 5GGTA 4WU5B 4Z8FH 2AK4B 1I1RA 4C55A 2IANB 4R96A 5JR1H 3DVGB 3PWPB 3QWOB 2ZSWA 4DKDC 1V7NH 2EH7L 4PJAB 4NM8H 2H26B 1KLUA 3VXUD 2WP3T 1IM3A 1OAXL 1ZT4A 3WIHA 4UTAL 2DI9A 5IW1B 3ZKMD 4CMHC 3U7YH 3SGEH 1H15A 1YJDL 4KKCC 4DN3L 3ARBB 1K3ZA 2ESVD 4YUEH 4KMTL 3QHFL 4Y0GA 1IAMA 2ZSVB 2NY7H 3KPLB 4S1DD 4MXVF 3FMGH 2JJTA 2K3TA 1T4KA 3EJYC 4FTVD 3FQNB 3QDGB 3O3UN 3O41A 5IMLA 2YR3A 2NY2C 3KR3H 4JFPA 1RZJL 3DX8B 2J8HA 5E5UB 5IOPB 1FNGB 5I1CH 2WAHA 4R26L 5GGTL 5FO9A 2RCSH 3HNTL 4Y5VC 1I8IB 1E6OH 4EUPA 1BEYL 3MBED 1WGOA 2D7TL 3UJTL 1JPFA 1KNOB 4DFIA 4H5SA 5E6IA 5DJAA 3RDTC 5AG9A 4FZ8H 2R2HB 4OKDA 2DLFH 1YEHH 3VFNB 3VW3L 3WIHL 4WGVB 1L6XA 1GYAA 3H6JA 1AHWB 1CL7H 3WFCH 1S9WB 4P2OD 1WWAX 1QG3A 4X4ME 4LHUA 2YA0A 1XR9B 1JVKA 5LWYH 4P4KC 5CCKL 1KBGH 3DTXA 1INQB 3HNVL 2BFVH 5I19H 5F9AC 3AM8A 3OV6A 1YEJL 2ICWB 4CADB 3KPSD 5KS9B 2VR5A 1QOKA 5I1GH 3KJ4B 5C09D 4OV5A 4U1SB 3IB4A 1UACH 3WIIL 3LKPB 3BZFA 3QG7L 4PS4H 3LDBB 5GRWA 1N3NA 2DQDH 3CX5K 5I71B 1KELH 3T09A 3SJVA 2VE6B 1A6TA 4E42A 4XCCH 1A6WH 2GJ6D 2ZJSL 1CD8A 1YY9D 5FYKL 2IQAB 1IC4H 5IMKA 2UYLB 4KTYA 3OAYK 3TBWA 3QUMH 5I8OL 1MWAB 1G9EA 4X5LA 5B39G 3CPLB 1LEIA 1MQKH 4OLXL 2DYPA 3S96A 1NANI 4K8RH 2E7HA 4Z8FL 1DJSA 1GGUA 4M7KH 1VADA 5D7SH 1CXKA 5JR1L 4R0LA 2LU3A 1KC5H 2C1PA 1V7NL 1EAPB 2Z35A 1D5MB 4NM8L 4IIQB 4UIKH 3SDDC 1SEQH 4I13B 3WEXA 5IEKB 3TVMC 3U7YL 4QF1B 4YUEL 2HP4A 5C0FB 4Z7UF 1MI5E 4NZUH 3HUJE 2NX5B 3UO1H 4L8CB 1ERNA 2ZCLH 4KMLB 2NY7L 4OFKA 4MXQD 1N26A 3FMGL 3V7MA 3DBXA 3HZYA 4L9LA 2Z8VC 3HE6D 3FRUB 4HUXB 3KR3L 4NBXB 4RFNC 1JK8B 3QI9A 4YDJA 2VO5A 2AJZA 5I1CL 5DD6A 1FSKB 4N8VB 5IB2A 1RJZA 3H8NA 3SEPA 1E6OL 3FN0H 3L3IA 2YUWA 4PJEA 2B2XL 5HI3C 4MDJB 4PJIF 3LV3B 3Q1SH 4GKZA 1YNTB 4MHHG 1YUHB 2OTUB 4W6YB 2EXWC 4FZ8L 3FN9A 3D18B 5DYOA 2I60H 5J6GB 2DLFL 4G9DA 1YEHL 5EG6C 4NO5B 3BJLA 3D69A 1BFVH 1T3FB 4XPAH 1IC5H 5ID1A 2F8VA 1CL7L 3WFCL 2V6HA 2Q8AH 5JXED 1K4CA 1CE6A 5LWYL 1AKJB 3QUMA 3TBSB 3D85B 2HLFC 1Q8MA 1RJYB 3ARFB 4Y16C 4X98B 1P2CA 5EU5B 5J1TC 1ORSB 2HLAA 3SKMA 5HHOB 2BFVL 5I19L 1ZGLM 3DX9A 3T8XA 1QACA 3IKCA 3TO4A 4POZD 2DKMA 3ARGC 3UTZA 5I1GL 1ED3A 5F7NC 4ZO6A 4ZUUB 4KRLB 1CDHA 1KXQE 3S35H 1ZGLB 2ARJA 1UACL 4LSUH 4P4RB 3SGEI 3VXNB 2C4XA 4NSKA 2DQEH 4PS4L 1A21A 5E8EB 2DQDL 3AS0A 3U4BL 4BH8A 3BPCB 2NLJA 4YDVB 2D31B 2FECL 5EZIH 3KHQA 4RGNE 1J05A 4XCCL 1A6WL 4NN7C 1F97A 1CBVH 3JVGC 4RMWA 5K9QI 5FDYA 4YO0B 1KXVC 1IC4L 4F9LA 4ODSH 3KWWA 1QBBA 2CKBH 3QUML 4JZJB 3GJFK 4BKLB 1MQKL 2MQ3A 4HXBH 1F2QA 1RU9H 1XGYH 4LSPH 3CVHH 4LLMB 4K8RL 2WBKA 3PWVA 3K46A 3F65A 4NRXB 4PR5B 2YD6A 4M7KL 1A7OH 2A73A 5D7SL 4M7ZC 1GGTA 5FGCE 4I1NB 3CU1A 1KC5L 4FQJH 3NZ8B 4MJ5A 5DTFB 4G8GA 1NGWA 5I1HH 4UIKL 1WBYB 4WV1C 1SEQL 4XX1G 2GITA 1CL7I 5E99H 2HRPH 2BHUA 1X6LA 3IS1X 4CU7A 1ZVSB 4WI8A 4NZUL 3P0GB 3UO1L 2HVJA 5C08E 2ZCLL 2NY6B 5F7YC 3O6LH 4MAYD 1TFHA 2FLRT 3ZDXE 2R1XB 2CGRH 1AR1D 4NN5B 1NCNA 1T1XB 1WT5C 1XH3A 1VGKB 3QPQC 1J0YA 3DI2B 4LLVB 3OR7A 4XNUH 1T22A 5GIRA 2PF6A 3TA3C 3VDAA 4RWYH 3GSQA 3FN0L 3B5TA 4ZOCA 1EUUA 3NVQA 5F7DA 4FQCH 3RUGF 2EYTA 3Q1SL 5DO2D 4LARH 1OHQA 2FECI 3KYMA 4MVBC 3F5WB 4WGWB 5F9WC 1T1ZA 4PRBB 5K93A 4K07A 3MRIB 2BVPA 1BFVL 4WVRA 3S4SG 2CQVA 4XPAL 1JFQL 1IC5L 3VU2A 1G7IA 2JK5A 4QGYA 3G6AA 2QQKH 5KN5B 5FO7A 1AD9A 5D7IF 2Q8AL 2VLLB 2CKBA 2Q86B 3KNBB 4GH7B 3MOAH 3HI1B 1JMZA 1YPZE 1LO4L 3CVHA 4FHBD 1FFOB 2I25N 4W68A 4OLVH 4EBQH 2YXFA 4DZ8B 3GMRB 4KQ4H 2BNQA 1LP9E 5CD5D 2G75B 3BZ4A 3TJHD 3G6JA 4NQCD 4H8WH 2O61B 4TOYH 4PJGA 3S35L 4LSUL 4QTIH 1T5WB 4I2XA 4JPIA 5DJ8A 2DQEL 2B5IC 3KXFA 4QHLB 3CZFA 2PYEB 3D39E 5EZIL 3FTGB 2PYFA 4EI5D 5E2JA 3MRPB 5AYUH 3VFRA 1MHEB 1MHCA 1MI5B 3MNWA 5I1KH 4XWOD 1W8NA 3HUJB 5KW9H 1EXUB 1CBVL 3HNSH 4OZFG 1F42A 1LD9B 1S9YA 5FF6B 5HYEA 3S97C 4ODSL 2CKBL 3C6LA 2CD0A 3C09B 3FZUD 2H2SC 4HXBL 1RU9L 1CICD 1WC7A 1XGYL 2KH2B 4LSPL 4QWWC 4O00A 3CVHL 1WFTA 5D93C 1S7WA 1CN4A 4KH2A 5BW7C 3HE7B 1A7OL 4JDTH 4KJYB 1KB9J 4HWBH 2JIXA 4FQJL 3WD5H 3QULA 4JN1H 5HHMD 4GS7B 4M7LH 4NUJA 4K55A 2OTPA 5I1HL 3U4AA 3FB5B 5ACMA 3SCMB 5E99L 2HRPL 2VLRE 1KJ3H 2R1WB 1GZPB 1UCBH 3P4MB 5JW5A 4CAGA 1A1OB 2ATPB 2HFGH 4XWGH 4GG8B 1MLCB 4CKVX 2VN7A 3O6LL 1BVZA 3MRGA 3CVIH 2CGRL 5GRZA 4DQOL 2V5YA 4GBXA 4WENB 3VWJB 1OCWH 5J7CC 4HX1B 3LQZA 2CDEB 3C60D 2XNAA 4PRPA 1YEFH 5DSCB 1PQZB 4XNUL 4RWYL 4MLSA 5C0IA 3CFKA 3OG4B 1DUZA 4XPFL 5HHPB 2P48B 4WI9A 4FQCL 2A6DB 3BPOC 4LARL 3WS6C 3U83A 2OL3H 5GISH 1SY6H 3W9DB 1KIPB 3OKKB 1I4FA 4Z0BH 3BSZH 4H5SB 1ITCA 2CIKB 4POUB 2Y23A 4MWFB 4RGNB 1K8DB 2QQKL 1NUDA 3QIBA 1NGYB 2R2BA 3ZT6A 3FOLA 5ID0A 5EC2A 5SWZA 3LKSB 3WFEH 4IM8A 4C56E 1FC1A 3MOAL 1HHHB 3C5ZA 5T5NG 3V5DB 5BS0A 3UZEA 3NN8B 4FMKA 4U1IA 4OLVL 4JDVB 3RJQB 4EBQL 1AIFA 4KQ4L 5LGHH 5TDPB 1HQ4B 5I8EA 3FB7A 5BZDB 4HWBA 3VI3F 1OP3H 5HDOA 1ZV5A 4H8WL 5FGCB 5MERA 5DZOA 4ZXBA 4TOYL 2C1OB 4YHKH 5ICXA 3GJEB 2Y5TA 4QTIL 4XXCA 1MJ7H 1MCFA 3DGGB 3HZKA 3SDCB 3O8XD 5DHYA 5HI4D 3JV4A 1XEDA 4KJPD 1NAMH 3QXDA 1HSBB 1B90A 1KG0A 5CKGA 3ULUD 2P8PA 1NFDA 2EDBA 5AYUL 2EDTA 4C83A 4DUVA 5KW9L 5I1KL 3MUGB 1FG9C 3HNSL 2HT3C 5C08B 3NIGE 3IJSA 4ZAKA 3UCRA 2R56H 4BSVA 3PL6C 1D6EA 2VUOA 1I1AA 2W60B 3GK8H 5C0AE 2NY4D 2FSEA 2EYSA 4U6VH 1L6ZA 1T66D 4UBDD 3GMNA 1FVCB 4WO4D 1A9EA 4JDTL 1D5IH 3MRJA 5JQHC 4HWBL 3QUYD 3WD5L 3K74B 4JN1L 4M61B 5CEZD 4XPBH 4M7LL 1SY6A 1R3JA 3ZKNC 2BXYA 3VXMA 1WCQA 4V2CB 1NMAL 2BVOA 5C0JA 1KJ3L 3ULUF 3C8KB 2IFGA 1UCBL 2QSVA 4HS3B 5IR1B 2EDLA 5DK2B 1ES0B 1VFBB 2HFGL 1N6QH 4XWGL 1JUFA 5HTSA 4RCAA 2VXSH 3RAJH 4OV6F 2A2QT 4F8QA 3CVIL 3RWHB 4YHYB 3NIFF 3OR6A 3V4VH 4KC3B 2ZUXA 1OCWL 1YPZB 1PFCA 4XZUA 1YEFL 3HMXH 3TJEH 2H45A 1EFQA 1DL7H 3JBG7 3MA9H 3FO2B 4WW2C 3ULVH 3K3QA 2VZ3A 4PJ8A 3ALWA 4LOUC 2NY0B 2OL3L 5GISL 1SY6L 1G0XA 4QRPA 3MYZA 2PXYA 1NAMA 4TVPD 3UPCA 4Z0BL 3BSZL 4IMKC 4PJDA 4JKPH 4APQA 4G6AD 1DBMH 5T33H 2FX8H 2IADB 1FH5H 3D39B 4E41D 1BD2D 4KRNA 5A2IH 3BP6A 2VDNH 4F80A 1YZZA 4WIQA 3OJ2C 1CYGA 1XF5B 4HIHB 3WFEL 1EFXB 3QNZA 1CFTB 4OFYD 1F3DH 3G5ZA 1RZ7H 1RUAH 3B9KC 2UUDK 5LGHL 2AS5M 4WNQA 4JLRB 4LEXH 4Y8AA 4LCYA 4P2QD 1XF1A 4Z7WE 3LSOA 5GRVK 1QQDA 4QHMB 1CFNA 1MH5A 4YHKL 1MCWM 5ACZA 2ATKB 3H9SE 2Z31A 1T5XA 2C3XA 3ZYZA 43C9B 3BQUA 5DJ2B 4Z7NE 1NAML 4JHAH 3NAAH 4X7TA 3WN5B 5GS1A 2V7HA 4J3OC 4LQ1A 2VLJE 5D7JC 4ISVA 4HS6B 1U8OA 3T1FA 5EIQA 1U8HB 2WLYA 4XHQA 2R56L 5C07A 1MNUH 5CGTA 3U46B 1DEEB 3HMXA 5HGDB 4B7IA 3ZO0A 1XGTA 3GK8L 1GC1C 4U6TA 2WK2A 4W6XB 4GG6E 1IFHH 4FQXD 5D7LA 1B3JA 3I6KA 4U6VL 5JLZA 1O7VA 2F53A 1D5IL 1JGDA 1X4YA 4HPOH 3RWCA 1PZUB 1NGZA 3EKCA 4GW4B 4KFZC 4XPBL 5F1KC 2F58H 2IBGA 3GNMH 2FBJH 4H0GA 1DEDA 1BJ1J 4CMHB 4TNVF 3ZE1F 4ZFFA 2Z4QB 5L7XH 1S7QA 4W4OA 2UWEF 3OJDA 1KEGH 4Y2DD 3U0TB 3LN9A 5IVZA 4XBPA 1A64A 3Q6GH 1N6QL 3E8UH 2VXSL 3BN9C 3IFOA 1T21B 1U2CA 3RAJL 3UBXG 2NY2B 2EE9A 3UTSA 3W0WA 4C56B 4PRHD 3V4VL 2KUTA 2APFA 2KQNA 1ZWIA 4PRIE 1YMMA 4POYA 1AGCB 3RKDD 3UTTD 4NDMA 3B2UD 3HMXL 1P84J 3TJEL 4Y5VB 1T2JA 3T77B 3IGAA 1DL7L 3QEQA 3BEWB 3FFCA 3MA9L 3MRBB 4P9MH 1N64L 3VXOA 5JPNA 3ULVL 1DSFH 4LP5A 1XH3B 3QUZC 4OD3H 3BISA 4XBGB 1KPUA 3RDTB 1J18A 2HMID 3STZB 1HDMA 3CFDA 1WCBA 3F7PC 1F4YH 4Q58C 5HVWA 5L8KB 1YEEH 3FFDA 5T3XH 3QH3A 3IFLH 3KYOA 4YBQD 2KBGA 4JKPL 3IDNA 1B4RA 4IDJH 1DBML 5T33L 2FX8L 5F3BA 1FH5L 2IWGA 4JHZA 4OFIA 3EO0A 4LK4A 2VDNL 1SJEA 4P4KB 4FS0A 3TCLB 2V2WB 4QHUA 5AWNH 4KUCD 1G7PB 3B9AA 5JPMB 2E3VA 3MROA 4N8VG 4OZ4B 1NGXA 1RZ7L 1RUAL 1VB9A 3O6FB 4HAFA 2X5PA 4DN4H 4WJ5A 4LEXL 1QTYT 4NQXA 5C0AB 4XNYH 4BUHA 2GI7A 3LRSB 4BA8A 4PG9A 5JDSB 3Q6FB 3GSNB 1G7QA 4D0BB 2ZUWA 3PWUB 5I76B 4F7MB 4LLDB 1V8HA 3OQ3B 4ZUVA 5KSAC 4GQ9H 4PJBA 3X17A 4F37K 4JHAL 1WWBX 3NAAL 3UYRH 4KKBC 4D0DB 2E9IA 3C6SB 2Z8RA 4GW1B 1EERB 3RVTD 3RWEB 3EW3B 2I9TB 3WHE0 1EO7A 3BIKA 2JCCA 4KUCF 5E8NB 1MNUL 4MX7B 1MHCB 2UVEA 3BP7B 2CLVB 3L5IA 5F7UA 1IFHL 1IAKA 3X12B 3IFNH 1KCLA 4PGEB 3BZEA 4DZBB 1T83C 4HPOL 3SE8H 3HCVB 2EO1A 5IVXB 3QAZC 3SDDB 1GGIH 1I8KA 2F58L 3GNML 2FBJL 4O2FA 4JEGB 3R06A 3TVMB 2DQTH 4S1RH 5L7XL 3T3ME 2LAGB 2V17H 1OQOA 1KEGL 3KPRD 3L6FA 3C87A 5HYJD 4X6CF 2BSRA 1REIA 3V6ZA 3W82A 2HJKB 3Q6GL 4X4XA 3E8UL 5DQJB 2BXZA 2XWTA 1T1YA 5EORH 1J0KA 4UB0L 1C8PA 4RFNB 4N0RA 4NUGH 1OTUD 3WXVH 4JCMA 3AS1A 1AGEB 3L5XH 4PUBH 4BFEA 3VXTB 4HUKB 5JOPE 2AV7B 3DSFL 2FR4B 2CLRB 1FRGH 1HE7A 2X10A 1LMKA 1U42A 4P9ML 4KI5F 1DSFL 4Z7WB 4WHCA 5H2BA 5IROA 4OD3L 1QLRA 3DIFA 1UB5A 4XB8A 5DDHB 3IXAB 3HAEG 4JG0H 2WIIB 1IRAY 1F4YL 1XCTA 2NNAB 1YEEL 4NCDA 1JE6A 3Q5OA 5IT2H 1J8HD 5T3XL 3QCVH 3IFLL 4AEIH 2P24A 1BFOB 2LFGA 2Z92B 4IDJL 4Y4KC 3BN3B 3D25B 3O81A 4FXLA 3ME0A 3N0PB 3RGVC 2JELH 4OGXH 3RBSA 2VLJB 4L4TE 4MDIA 3KHOA 4Y16B 3CFIC 1XGUA 4NHUB 4PJHF 5AWNL 4F37F 4LHQB 3QEHA 1AGFA 1WBZB 5ICYA 3TT1H 1OWWA 1MCIA 3PV7A 3P73B 1L0YA 4PRNB 3L95A 3PHQB 3I6LE 4DN4L 2XQYK 3ARGB 4XNYL 4NNXB 4GG6B 1KT2B 1JI1A 1WAAA 5DWUH 5E4EC 2HKFH 2EKJA 2P49B 2R0LH 3MNZB 1IGJA 3FO9A 3TYFB 3TBYB 4J6RH 4S2SB 2HH0H 3IF1A 4ZD3H 4EI6A 4LEOB 4MNQE 1ZT1A 4ORGA 3RPIB 2Q8BH 4GQ9L 3PWJB 4OZHA 1OLZA 2IAMC 4L8SA 3DXAA 5KG9B 4BQ8A 1OD7A 2Y5TB 1BOYA 4NN7B 5C0EB 3BGMA 1HEZA 4D0CA 4P5TC 4M8QA 2VLRD 4NC1C 4KHXH 2IF7A 4PLKD 5IMOA 5DEZA 4JFEA 3ZDZE 1A4JB 3D0LB 1X7QB 4N8CH 3RVXD 3WCYA 3AXLB 1A3LH 5T3ZD 4M7ZB 3IFNL 4ZFZB 2B8OT 4BSVB 1AI1H 4FTVA 3SE8L 4GRLD 4NKOA 3VG0H 1RV6X 4RAUB 1FZMB 1GGIL 2MTPA 4WV1B 4P5MA 3UTQA 5FCSH 2DQTL 4PP1D 4S1RL 4UAOC 3HG1E 2V17L 4JGUA 5ENWB 3BRFA 5EUOE 1P5UA 1ZLUK 1B0GB 1UENA 3FB8B 1HWHB 1UKTA 4H0HB 1NC2A 4UQ3A 1QSED 4KK5C 1YECH 4XNZC 4QT5B 5EORL 1CK0H 4ZFOA 3HC0B 3MRNB 1DLHA 3IXTB 5LBSH 4NN6C 4NUGL 3KPMA 4HKBB 3WXVL 3QDJA 4PUBL 3D87B 3TA3B 1RK0B 3MV7E 1FRGL 4F58L 3DO3A 3QIWD 3MXVH 4IDLA 2XTJD 4LCCA 1KXTB 1Y18A 4JG0L 5F9WB 5HGAB 4ELMA 1MFDH 5IT2L 3OPZH 3QCVL 3QO0B 4AEIL 4D8PA 1HH6B 3DOSA 3GSUA 2QHRH 1MCLA 4K8RC 2CKNA 4P57B 3NTCH 2CRZA 4LU5H 1I9RH 5J11C 4MB5A 4K9EC 1A1NA 1BAFH 5KJRH 1YDPB 2JELL 5F9JB 4OGXL 2P46B 4MYWB 1X5HA 2GW5A 3TYGH 5C0CA 2HT2D 4APQB 4JRYD 4F33A 5D1QC 3TT1L 1YN6A 1KV3A 5DI8A 4I3RH 4Z7UA 4Y4HA 2J8UF 3BIAX 3HS0A 5DWUL 2HKFL 1JWUB 1FNFA 2R0LL 3A6OA 3RWIA 4RQQB 3G5ZB 3K4ZA 4J6RL 2AJUH 2HH0L 4ZD3L 2B5IB 3MO1B 3S5LB 1FO0H 5IV2B 1ZLVK 4FXKB 2V9QA 2Q8BL 2QR0B 1QFWH 2G9HA 4IRSA 3FONA 5CBEA 4X6EB 1Q9LA 3QQNA 5CEYB 4NQDD 3LCYA 4MS8C 5EU3A 2ARWA 5ACZB 2E9JA 1E4JA 5M95B 4KHXL 5C6WH 4G43A 4NKIH 3VGFA 5C0NC 5MENE 4J1UA 1OY3B 1OQXA 3JSSA 4K94C 3ALPA 1MIMH 2Z91B 5D93B 3PP3K 1XGPB 3S3PA 4N8CL 4I4WA 1A3LL 1WTLA 3UTPD 1AI1L 1QR1A 5E6YA 5FGBA 5A3ID 2OK0H 3BO8A 3VG0L 4KVCH 4NT6A 3SDAC 1MCWW 5MEPB 5JLZB 4FQHA 4FP8H 1T7XA 3PWLA 4U1LB 5AZ2H 1BVLA 5HD8D 2R9HD 3MRCA 2EZ0C 4TSCH 3D2UB 3DROA 4E5XA 2KKQA 5F3HB 2DJUA 2C4FU 3VFPA 1I1FA 4PGCB 1HXYA 4RRPG 1YECL 4L4TB 2O5ZH 4JG1H 1CK0L 5IKCB 3VE0A 1K2DA 5IB1B 5LBSL 3RZWA 4F2MA 5B8CC 4AM0A 3O2VH 5DJXB 2WNGA 5ESVB 1CZ8H 3ARVA 1T7ZA 3E0GA 4L8DA 1TPXC 4X6DE 5FYJH 5I6XC 5EO0A 4L1DA 3P9WB 2FJHB 1IKFH 3MXVL 5DFWH 3BPOB 3LH2H 1FO0A 1AE6H 4M1GH 3QA3A 1N2RB 2FATH 4MNQB 1MFDL 4NRYA 2UZXB 5I1EH 3NGBC 3OPZL 4XNMB 2QHRL 1XF2A 3NTCL 4LU5L 1MREL 1I9RL 3PWNA 2DMBA 3OKNA 4WHYH 3WJJA 3QDHA 1BAFL 3MJ8A 4HK0A 3RU8H 5JUEH 5KJRL 4B41A 5B4MC 5EOQH 5GGUA 1CGSH 3TN0D 3TYGL 4HKXA 5CJ8A 3IDIB 3BESR 5I16A 2YA2A 4CBPA 1GOHA 1X5GA 2X05A 4I3RL 3DVFA 4FMFA 1WBXB 1AQDB 4AL8H 3MROB 5SWSE 3H42H 1G84A 1U8LB 5D1XB 1FO0L 2F5AH 4FQIH 4XCYB 4EKXA 1QFWL 1K6QH 3SPVA 4F15C 2DWDB 3IU3B 4PJ7F 4HUVA 1ETZB 1EIBA 3VA2C 3HG1B 3MRLA 5HPOA 2QADD 3RWGA 5EUOB 3C5JA 3RUGA 3TC9A 1GOFA 2IALB 4DWHA 3MGAA 4NKIL 3CDCA 4H26B 3U4EA 5FIEA 3PL6B 3DARA 4DVBB 1MIML 1EEZB 2ED7A 3KS0H 4RMQA 5ESQA 5D7IA 5IF0A 4YC2C 4BK5A 3MV7B 3BPNC 2X4PA 4LNVA 1MUJB 2OK0L 1FYTE 1D5ZB 3GMPB 1YNKH 4KVCL 2N1KA 3NFPA 4RZCB 4X99B 2VSDA 1QO3B 3DX7A 4FP8L 1IEBA 5FV1L 5KVFH 3RBGA 2HT4C 2PCPB 1WF5A 1YQVH 1T04B 1HWGB 4MCYA 4TSCL 1UEYA 3VXSA 4TPRH 3UYPA 3KAAA 1D5BB 1I1YB 1FORH 3EHBD 2E9WA 4HUWA 5L8LB 3V9FA 3BDYH 3L3DB 4NO3B 4JFFA 5K9JH 2O5ZL 2DM2A 4JG1L 4G9FA 3TZVC 1XIWD 1N5AB 4HT1H 4HV8A 1WVZA 4FQQA 3O2VL 3LKRB 3D3VE 5CAYB 1CZ8L 2A38A 2MNUA 5FYJL 3G5VA 4WFGD 3HR5A 1FFPB 4WW2B 2XQYG 4AZ8A 5BVJA 5GJSH 1IKFL 1T0MA 1CXEA 2VDLH 1QFWI 4NQVA 3LH2L 3RI5K 1AE6L 4M1GL 4G6JH 2APTA 1G7JB 1S8DB 4LLYB 2FATL 2Y1VA 3OG6B 5I66B 3RTQC 2VQUA 5I1EL 2DKUA 2HG5B 5E70A 1KPVB 4M3JA 3RY5A 4V1DA 5GXBB 5JMOC 2BDNH 2YZ8A 4L29B 2Q7NA 4QRSB 3RU8L 2HJLB 5FYLH 5JUEL 4LFHD 5HSFA 1SVZA 8FABA 5EOQL 1CGSL 4UT7H 4WUUA 5MENB 1MJJA 4TUOA 4WW1B 3B9KB 5FGSA 1S9KC 5HVGB 3ARPA 1FG2B 4GUPA 4Z6AT 3RWJA 3VWKD 3WFHA 5C8JB 3GMMB 4KZDH 4L1HA 5I73C 3VXRD 4WWKC 1X5JA 3RIFK 4N0CD 4AL8L 4M5YH 3H42L 3DJ9A 1ZMYA 4PJ9A 3SKNB 5KSBF 2OI9C 4U2ZA 2K9UA 3L95B 3OKMB 4Q6IA 4Z7OF 3OX8A 3DVIA 2F5AL 1VFAB 2UY6A 4FQIL 3DHMA 4WEMB 1K6QL 3VFWB 3GSWA 1FNEA 3NIDF 4PG2A 4A2MA 1C5DA 3GSOA 4PJ5E 5D7JB 1XZ0A 2NMSA 3FOMA 4QY8A 2W0KA 4EDWH 2E8ZA 5D96C 3B8SA 3EGSB 3CAFA 3K4AA 5F72S 1BJ8A 5D7KE 4OLZH 3B3IB 1SJXA 4F7EB 4JFHD 1YNLL 3RVWD 3PXJA 5AZEL 1RUPH 4BSJA 3AVEA 4L3CA 5DZLA 3JTSB 5L9DH 4J4PC 5B38B 4X6DB 1JWMB 5DEGA 2NTFA 5ERWA 1AP2A 4JFXA 2WBJA 1YNKL 1CXLA 3ZL4H 5AG8A 1CDUA 5JHDE 3QR2A 5KVFL 3SE3C 1YQVL 1ACYH 2V2XB 3V6OA 4JANA 4IRJC 4YH6A 3EAKA 4NC1E 3S3SA 4LVEA 1FORL 2X7LB 4JR9H 1BHGA 1I7RB 5FA3B 2BSTB 2DM4A 4XPTH 3BDYL 1LE9A 2NXZC 2R23B 5MP6H 5K9JL 4QEGA 4Y1AE 1WFOA 5GPRA 1P1ZA 3IT8D 2YEZB 4KJWC 4J3VA 1CCZA 4HT1L 1NC2B 2EDWA 2BVQA 1U92B 4BUGA 4MA3A 3WFBH 2M2DA 1RULH 1LILA 2ITDB 1CLCA 3QB7C 3QUZB 5JOFB 5GJSL 4JKKA 2BCKA 2VDLL 2W38A 5SWSB 4HULB 1I7ZA 5D6CB 3QZWB 4G6JL 4WHDA 3MZTA 1DVFD 4LF3B 4FN0A 4U49A 2EH8H 4RX4D 4HMDA 2GSIB 2NR6D 5DMYA 5H94B 3L3KB 1BIHA 2PTTB 3L3HA 3RVUD 2BDNL 5C0BD 2XN9D 4UI2A 5FYLL 5IMMA 2KPNA 3GEWB 1LNUA 1UEMA 4MJID 4FFWC 4UT7L 3O3EA 1HQRB 1B6DA 3T0ED 5I17A 3RL2A 3MUZ1 2H32H 4ETQA 2HTKD 4P46A 4F33B 2BNUA 1CD1A 1TETH 4M5YL 3W39A 2HAZA 2X4RA 4MQ7B 1JHKH 5MHSD 1L7IH 1FYTB 5DGQA 1LO5B 2IFFH 3X14B 5INDA 3RVVD 1S9VB 2VKXA 5L2KA 1RSFA 5E94A 5F8QC 1MY5A 5KS9F 1TVHB 2GKIA 4M9PA 4ZPTA 5IB5B 4L3EE 5KOVC 4GFTB 3FONB 1HI6B 4MQSB 1CT8A 4HGWA 3FRPG 1ZHLA 1H8NA 4EDWL 1C16A 4U1GB 4OLZL 3S98A 3DYMA 2JB5H 4ZUWB 1RJLA 1RUPL 1PZ5A 3PHOB 4ZQKA 3V5KA 1MJ8H 3D3VB 4EDXB 1IGTB 5L9DL 2DIJA 4EIZC 3MACH 1JPGB 3P9MA 4N1EA 3RWDB 1ZHKB 5TGBA 1F13A 4Z0XB 1FVDB 1FFNB 3QAZB 5JMRA 3R8BB 3CD4A 4KJQC 3HR6A 2HN7B 3E3QC 3ZL4L 1UYWH 4LPTA 5ABDE 2BNRA 1W0VA 3ZDYE 3QFJA 4LCWA 1F6AA 5ANMA 4UIMA 4MCZB 1ACYL 1S7XA 4N90D 2HTLD 4JY4A 2H6PA 3MV9A 4K3JH 5CD3B 5DF0A 4JR9L 4IOFD 5EZLB 4XPTL 4JAMB 3AY4A 5MP6L 4N5ED 2GY7B 3LPWA 1H5BA 2P7TB 4LDOB 4NZDA 4M1CD 4LLUA 5C6TH 3DUUB 2H32A 2L4OA 5CBAB 2FEDD 3WFBL 1P9MA 5KZCD 2AKRA 1HHIB 3VD7A 4HS8H 1ZT7B 1OGAA 5K59E 5C9JB 3D85D 5GGSA 1TVDA 4PGJA 2WLZA 5TDOB 2P8MB 2Q6WB 5L2JA 1T0NB 4JRXE 5IBLC 3I9GH 2EH8L 4LKXA 4NYLB 1MLBB 4Y4KB 1DUYB 1T6VN 4MQXC 3RGVB 2XG4A 4WI5A 4PJ5B 2NY1C 3FO1A 3LPFA 3STLA 3QIUA 4PP2B 1ZOXA 3NA9H 3CZJA 1IEAB 2W92A 3QNYB 4PJCF 1XF2B 1SBBA 3PGCB 3H3BC 4GXUN 4IOIB 2R15A 2UWEA 3OF6D 4NRZA 4ZO8A 4GRMA 5E4EB 1D9KA 3ABZA 1F3JB 3V5HA 3CMOL 4MD4A 3TFKD 1TETL 4JZNA 3PGDB 3QWRD 3IDMB 1JHKL 1H3UA 1L7IL 4I48A 2A6KA 5IHZB 1K3IA 3MRQB 4GMTH 3UAJC 4CU6A 2CDGA 1VKXA 1WITA 2IAMB 5JHDB 5LG1A 4UV4H 2XKSA 2L0DA 1HHGA 4P5TB 1IM9B 2BOCA 4OF6A 1ZLWK 2WWMD