4YDJB

Crystal structure of broadly and potently neutralizing antibody 44-vrc13.01 in complex with hiv-1 clade ae strain 93th057 gp120
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
205
structure length
205
Chain Sequence
b'QSALTQPASVSGSPGQSINISCAGRSDRVSWYQQRPNGVPKLLMFDVYRRPSGVSDRFSGSHSGDTAFLTISGLQTEDEADYYCTSHPYAFGAGTKVNVLRQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein gp160,Envelope glycoprotein gp160
molecule tags Immune system
source organism Human immunodeficiency virus 1
publication title Structural Repertoire of HIV-1-Neutralizing Antibodies Targeting the CD4 Supersite in 14 Donors.
pubmed doi rcsb
total genus 40
structure length 205
sequence length 205
chains with identical sequence L
ec nomenclature
pdb deposition date 2015-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ydjB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ydjB02
2VITA 3VFSB 2XQYK 5IF0B 1K8IB 1WZMA 4PB9H 1IGTA 3EOYG 4UTBL 1IGYB 4R0LA 4JZNA 3OJVC 1A47A 5MEOB 4OZFB 5CP3H 3SCMC 4APQC 3S5LB 3BKCH 2VAAB 4JO2L 1VPOH 4TTDC 3FT3A 4EN3C 1R6VA 3KJ6L 3NIDE 5BO1H 4HFWA 4QOKE 5EU6B 4D9QD 1YUHA 1QBLH 1EDQA 3T2NH 3WYRA 4JJ5A 3UEZA 3NOIA 4U3XA 2R4RL 1LE9B 1DUZA 4HJ0C 4PRAB 1NC2D 4QRPE 3ULVF 5I8OL 1OTTC 4OIIL 3BYTA 1I4FA 2FZ3B 4MA1C 2IAMC 5BS0A 3U2SB 2GUOB 1N7MH 2UWEB 3I6KB 1ZT4B 3QZWB 3CDCA 2D7QA 5GS2H 3MUZ1 4XHJD 4P0DA 2Q6WA 3UAJD 3GIZH 3TJHC 3D9AL 3RY6A 1E6OH 1MIMH 3MCLL 3T1FA 1KCVH 3CIQA 1EFXA 1A3QA 3O6KH 4Z7VA 4YBQD 1XF1A 4UDTA 4NO2A 1NCBH 1G0XA 4PRHD 1C12A 2DYPB 5C0CB 3MLYL 1ODAA 4HAGA 2NW2A 4OV6F 3O0RH 4F15B 2BJMH 3BH8B 4HT1H 3EFDL 2OTWB 4WW2C 3IAQA 5DZLA 4Y4KD 4P2YA 3FO0L 2VL4A 3BPOB 1G7HB 4DTGH 1F11A 3KLAB 1Y6KR 4HXBH 1EEUA 1X5FA 2FX7H 3CFJB 3QIBD 4ZS6C 3W5MA 4G5ZL 3VRLF 4R7DA 4YBLC 3O3DB 5DJ2B 3QNYB 4KJWC 4PLKC 4XI5D 2X89A 2YN3A 3SKNB 2IPKB 2OS7A 3WBDA 2YD7A 1OLZA 1IL1B 1TZGL 2XTJD 2R56H 2AXJA 2CRZA 4WCYL 4YO0B 5EA0L 2GYSA 1LP9B 4QT5A 4V1DB 5JHLL 2C3XA 1H3UA 3MNZA 4PP2B 1LO0L 5HJ3A 1P1ZA 4DQOH 4N1EA 3R8BB 3BKML 1PYWB 4N68A 3VGGA 4D9RD 1G7PA 5E8PA 1I8IB 5FA3B 1C5CH 2AQ2A 2VE6A 4KGLA 2Q3AA 2A6KB 5E94A 5BW7C 4X5XB 3IFLH 4K3HA 5E9DD 3L3JB 4Y4KB 2FJHA 3TBVA 3T2QA 3CZFB 3LY6A 3UCRA 4G8FB 2XKUA 5D1ZB 2NXYD 4OF5A 3H3BC 4LCWA 1MCNA 3OHXB 1C1EH 3T4AB 4WFED 2BFVH 1RJYA 3RAJH 3TN0C 1EIBA 3FTGA 5T1KD 4K9EC 3W11C 1M6OA 1YN6B 2C3VA 3MOQA 3ULVE 1KIRB 2OM5A 1K5NA 1IM9B 1I9IH 4KTEL 3SDDD 2QHRL 4WJ5A 3DXAD 1V3LA 3STZA 5ISZB 4P23A 1IM3A 3U7YL 3ZLQC 2JLLA 1J0JA 5GGTH 3P4MB 5CINH 3QH3A 1NGZB 3JWDL 5DJ8A 5EB9A 4X7SL 5K9KA 1GHFL 4H1LH 5DA4A 4PTTB 4FABL 5CJOL 3B3IA 4I77L 1FZJA 1FNEA 4PLJD 3QWQB 5HYSG 1TJGL 3LD8B 4D0BB 1BIIB 1DEEA 1OARH 5DD6B 5MP6L 1VEOA 1I1AB 1F8TH 3IXTB 1DN0A 3BP6A 1UG9A 3OGCA 4GBXB 1YC7A 2NX5B 4RA3A 4KPHH 1OPGH 4DVBB 3EYFB 5IT2H 5CP3A 4DW2H 3DUHA 3AB0C 4KK6D 4XZUB 2R2CA 1QVOA 4OLVL 3TA3B 1N59B 1I7TB 3ARGA 3PWPD 1FL3A 3UTQA 1CXFA 2FECI 1EERB 1Q72L 1CDJA 4I18C 4UQ3A 4M48L 3VFNB 2HTLD 4QXUH 3OPZH 5BMFL 4KKLC 1IQDB 5AD0A 2NY1C 2RBLA 4PJAA 1CFSB 3QCTL 4X98B 4PJGA 4JE4B 4P2OB 1U95B 2UV3A 3HUJA 2BNRD 4OZ4A 3E6FA 3X17A 1KPVA 3RTQA 3LPFA 4MDIA 3MNZB 4PP2A 1BF8A 5E2WH 1HYSD 4N90E 3BFOA 5LGKA 1F90H 4JDVB 4ZXBD 3OKEA 3VE0B 4CU7A 3HE6D 1CD9B 3BW9B 5D2LB 4X7SH 1GHFH 2XZAH 1I1FA 2FLRT 4L4TA 1U3HD 4NQCB 3D85B 1IRAY 4KUCD 3ARVA 1IKNA 3C8KB 2Q7YB 3NFPB 4OKVB 4RAUB 2W9EL 3DJ9A 3VXTA 5JPMB 4GG8A 1Q0YL 1BJMA 5J1SC 4JJ5B 1NC4D 3RZCC 4XPBH 3ARYA 1ED3A 4OD3H 2Z8SA 1R3LB 3MV9A 4JLRA 3O2DH 3VWJA 4M8QB 1JCKA 1EK3A 1MCOL 2X1XR 1JGEA 1EX0A 3EO1B 4EI5C 4EVNA 4CN4A 1RK0B 5D96C 3OSKA 1XF3B 2AEQH 2CLZB 1SMAA 1QR4A 1NLBL 1JMXA 1DVFD 1EEYA 5DEZA 4URTB 1MRFL 3SN6N 3QHFL 5IQ7H 2QQQA 1HHGB 4PJHF 2DM2A 1T0MA 2D31B 4TUKL 2IGFL 3L7FB 3MJ7B 5KW9L 4F7EA 4R8WH 2UZXB 5IM7B 5DC4B 4L8SC 1G7LA 1TXKA 4FQXB 1AHWC 1QYGL 1NFDE 3NFNA 5L0QC 3F12B 1GGUA 1J5OH 1Z9SA 5HVHC 1H15B 5AWNH 4EI6B 3L9RA 1UWXH 1GL4B 5SWSD 1QR1B 1AQDA 4FQCL 1K4DB 2OQJA 3QULA 4U6XA 5IMMB 1QSFE 1AI1L 4NUJA 4P59L 3P9MA 3H3KA 3FQXB 1EJOH 2DAVA 2O5ZL 1CFSA 4IRJB 5D72H 4FZ8H 1HHIA 3RL2A 1DN0B 3GHBH 1IC4H 1FE8H 4HCRL 3QBTB 3D9AH 3T2PA 3IJSB 1ZHKA 5LWYH 1NFIB 1U8LA 5AZ2H 5DYOA 4JFPB 2W60B 1KJMA 5MEPB 1ES0A 4HXBL 5CD5C 3LB6C 2XPGA 2L0DA 1VGKB 4CRPA 1ZVYA 3QFJA 1XF4B 1A14H 2RGSA 5GJTH 4Z8FH 1A7PH 4J4PA 2KBGA 4JFZH 3VGAB 5LWYL 4XPGH 2D03L 5C92A 4JFHD 5KAQG 3M1BB 3JTTA 1NUNB 4IM8A 1U91A 1N2RB 2AJVL 1RZIA 4XNYH 5T3ZH 4PRBB 4OD2B 1T3FB 3BQUA 4I77H 1AGCB 2NY4B 4L29B 4MQTB 4W70A 3KLHD 3MGOB 2J88L 5JXAH 4QRPB 3KYKL 4J6RL 4WI6A 3BKYH 1H8SA 3DURA 5F1SA 5I8CB 1BVZA 5E2JA 1Q9OA 4XMPL 4QY8B 1XMWA 5EO0B 4F80A 1YEKL 4NFBA 4I9WD 1Z0MA 5AWNL 3W11D 1YEDB 1I7ZB 1BQSA 3NFSL 1GOHA 4WUKL 1C16B 3NN8A 1CFTB 1UQSB 2R2BA 1JL8A 1Y0LA 5I1GL 4R7DB 4OGXH 2P5WD 1DCLA 4WEUD 2E8YA 2P44B 2GUOA 4R6UA 3RI5F 3T65B 2D31A 1HKFA 1LEGA 1UB5A 3LQZB 2D7TH 1XZ0A 4WHYG 3VXTB 5JPMA 4U6HA 1E4XH 3OKKB 4WFFD 2EIDA 5B8CB 1JZ8A 1BQHA 1EHAA 2WWMD 1LEKA 3S3SA 5ILTH 4G43B 2D7NA 3BAEH 3LEVH 1AJ7L 2OTWA 2VDKH 5FDWB 4EQ3A 2XZZA 5FYLD 2AV1A 1HKLL 4B7IA 1KGCD 2BNQB 5FGBC 4JKLA 1S7QA 2VYRE 1XIWC 2ITDA 2NR6D 3OTTA 3V8OA 5L88H 3ZE2E 5MEOA 2VLLB 3QDJE 1F4XH 1DFBH 1A1NA 5SWSE 3ORJA 2HG5B 2NY7L 4Z7WB 5HXMA 3PDOB 3ARZA 5F9DC 5K93A 1LO5B 4ZO9A 5ILTL 4HUWA 2ITCA 3PV6B 3CFBA 5ID0B 5EU5A 1FRGL 1HOCB 2OLDA 5DJ0A 3MJ7A 1RUAH 1QSFB 1R3IH 3NBNA 2BSSA 3ECBA 2B8OT 3V0AC 1RSFA 4GRWH 4YXKL 3QO1B 3WFDL 5I19L 1RQ5A 4JFFE 5IW1B 3BEVB 5D2NC 2R9HD 1WTLA 2GK2A 3VWKB 3CPLB 3DI3B 4JZNB 2FH6A 3G6JA 4I3SL 1JFQH 3QQ4B 5DI8B 5D7IB 4G6JL 5GRWA 1QZ1A 4WO4A 4OBRA 4M1GL 4UZGA 4HF5H 5ETUB 1NKRA 4NQDD 1T1XA 4U1NB 3QQ9C 3UYOD 1FVDB 4LSPH 4N0FB 1F02I 2HLAA 1I75A 3OXRB 4OIAA 2G5BB 4J1UB 3SDDC 1P7QB 1AP2A 4GQPH 3ARRA 3OBAA 1EUTA 5L2KD 2FBOJ 3U4EA 4JHAL 3IXAA 5GRUL 1M7DA 2HT4D 4XP9H 4MAYC 3QJFA 4DW2L 1U8KA 1GZPB 4NPYA 1EFXD 4L8CB 3M8OH 3H9SD 1MCCA 1A9BA 4YDKL 2EC8A 4MJ5A 1FJ1B 3RVTC 4QHMA 4EI5D 4LSSH 2EIEA 2EDHA 1C08A 2EXYD 3ARXA 1S5HB 4MXQD 2NY6B 4Y5VC 4KK8C 4M00A 1Q8MA 2YPLA 2I07A 4F7PB 2CLVA 5DRNA 4GW5A 3BXNA 2CRYA 5IB3A 5T5FL 4QXTB 5C0AB 5EUKA 5HDBE 3OAZH 3QXDB 3K0WA 5T3ZE 3QEHA 4OFDA 1FQ9C 4NM4H 4R2GB 2NY3D 4KI5F 2NY4D 3CC5B 4DZBB 5IJKC 4JN1L 2AK1L 2ADJB 1CT8A 3TBSB 4Y2DC 3PQYB 4ZPTB 3V4VH 1KB9J 2APTA 1OVZA 1BP3B 1H0DA 2J6EL 3C5ZD 3QEGL 3WO4C 3LIZH 1I9RH 2AXFB 5C09A 1Q9WB 4OV5B 5JUEL 4KJYB 3T77B 3OKNA 4JFPA 4PJ5A 3MRQA 4F3FB 4XMLH 3BD3A 2WIIB 3NAAH 4KGJA 4NJAL 1CFBA 4R8WL 3CMOL 1RVFH 4XNXL 3F5WB 1OAXL 1DANU 2AK4D 1EZVY 3U9UA 3DECA 4LSDA 4GAYB 4C55A 3EDFA 4M61A 3QWRD 2R2HB 4OFIA 3O6LH 4R9HA 5KVDH 4EIZC 4KVCH 3VXNA 3RIAF 3PGCA 3OAUL 1IM9D 4MD5A 3A67H 4Y5YA 5JW4R 3LSOA 4N1HB 3HE7D 1L7TH 4NQXB 4LGPB 3TT1L 4YPGB 3O81A 5TQ0H 3IFPA 5JDSB 2O93L 1FGVL 4WHCA 1XCQA 1S9YB 2FL5A 2YK1H 3H7BB 4GS7C 4JZOB 1MCHA 1SM3L 3D39E 3K2MC 1CBVH 2DWEB 32C2B 2VLRE 3VRIB 2EH8L 4RZCA 3T0XA 2PXYD 3L5IA 3OXRA 5KVEH 4L8SB 3NZHH 2H9GA 4ZD3H 2W9EH 3U0TB 5LGJA 4PGEB 1QA9A 5DQ9A 3VXMA 2ICWJ 1JWSA 1S7UA 4ZTPH 5JLZB 4RGOH 2CLZA 4CU8A 5E99H 2G75B 2X4PA 4PFEA 4RX4D 1JHTB 3IU4L 4ZDHB 5EU7E 1CICB 5E8EA 1QLEH 3KJ4B 2NQCA 1XH3B 4XNYL 5T3ZL 5EU6E 3ZHDA 1ZA6B 4XCCH 5KANI 1BZ7B 1UCBL 2VABA 1NFDB 3RVUC 4ZG1A 1CR9H 4I18A 4OI8A 3IU3B 1I3RA 2PNDA 2DBLH 3QDMA 2ZPKL 4HLZH 5GGSY 3RZWA 4ODSL 5IM7A 4DUWA 4MJ2A 4ODHH 3RRQA 1I3VA 3WHE1 4QRRE 4ZXBA 2E9JA 3ROLB 1BOGB 4XMPH 2LABA 1U3HA 3W9EA 3U4BH 3LRGA 4HIXH 1UWEH 3CNKA 3BH9A 1KLGA 4FQIH 4HUWB 4KK6C 3L3GA 3D25A 4NQVB 2X09A 1JGDB 3UYPA 3WO3B 1G0DA 1UKSA 2BY1A 4HMCA 5CMAA 3HC0A 3KPRE 4MHHI 2E27L 1MI5E 3EJYD 3G6DL 4IOIA 4DAGH 4ZFZA 1L6XA 1GZQA 1I8LC 3SJVE 2WUBH 4MSWB 4HIXL 5ITFB 2X9XA 4PJEA 3MJGX 4GAYA 3NA4A 3DBXB 1N5AB 5E1AB 2V7NB 3F5WA 3EIFA 4P2RA 5E5UB 2CKBA 3KYAA 1H8OA 4BSWA 5TE7H 1IAKB 3MLVL 1TDQA 5C2BH 3WDIA 4X5WA 4O58H 1BAFH 4ZYKB 3O4LE 5I2IA 2DS4A 5JDSA 4HS8H 2PTVA 2XNAB 3C9NA 1J87A 2CUIA 2VQUA 1HNFA 2LVEA 1J1XH 3FT3B 4TNWF 5E2UH 2JK5B 5E8OA 5BV7H 4I3RH 3TA3C 4PTUB 1YY9D 2AP2A 1I9JL 4PJIF 3FO2A 5F9JB 5L8JB 5D1XB 4PGBB 2W9DH 3S96B 2XTJC 4DJMA 1OHQA 2XA8H 5FUCE 4H1LG 5EH1A 1CE6A 3I3DA 4JVUA 3D3VE 5A2LH 4HG4J 4M61B 1I7UA 4R7NB 5CCKH 1U0QA 1KXTB 4X83A 4C56A 5J56B 5JQ6L 1UGNA 3S3JA 3DVIA 4IMKC 1BQLL 2A6KA 2Q20A 3QH3B 2VDKL 1OOAA 1WC7A 4CADB 4HIEB 1N64H 3NA9H 1KB9K 4TOYL 4BQBA 3QPXH 4P4RB 2GJZB 3KJ4C 1LDPH 1N4XH 3A6BL 2W0LA 3GMNB 1HEZB 1CDBA 2BMKB 1LP9A 4QT5B 3MLPA 2IFGA 4TNVF 3IFOA 2V6HA 1WZ1L 3QEUB 3OXSA 3MJ9A 5I73B 5DUMH 3MRNA 2XV6B 3TC9A 1KC5H 3ZE0F 3S98A 1M6OB 1YN6A 4GBXA 1BQLH 1OF2A 3LAFA 1LO3L 2Z31D 2H45A 3FFDB 4ZS7L 1BFVL 4QF1B 3CFJA 3S36H 5IB2A 3TN0B 1T0NA 4CMMA 4XVSH 1G7HA 4TYUA 5TGBA 5FUCC 2K3TA 5HDLA 4FP8H 3QUMA 5I6XB 2R1YA 3Q2CA 1UVQB 4GSDL 3WD5H 5J6HB 1LK3L 4R96A 2N7BA 5IW6A 5EPMB 1ZLWH 1MNUH 1HWGB 4PJBA 1J1XL 1CGYA 1MWAH 1LWRA 1I85C 2A9NL 4PS4H 2VLJE 1HSAA 3MRBA 1WWCA 3TV3L 2OL3H 4MQSB 4K8RH 1BLNB 3BP5A 2ZG2A 3ECBB 4P5MA 4PRPE 4UOW1 4O51A 2BRQA 3LQMA 2J8UE 1IBGH 4Z0XB 4JQIH 2EO1A 2ZUVA 3SDXE 2R0ZL 4A2MA 4Q0XL 1KLUB 2X4OA 3C6SA 1WVZA 1BM3H 5JPNB 4CVWA 3AS2A 4TTDD 4JG0L 5LGHL 2A83A 3UROR 2COQA 4C54A 1IC1A 5GZND 5I1LB 1F8TL 3M8OL 4OGAC 4LLVA 3OB0H 3FONA 1QD0A 3LOWA 1P84K 4Z7WE 1TJGH 4AM0B 2DTMH 1NCAL 3DVNA 3B5HA 4LK4A 4CAGA 1JHTA 4KDWA 5CILH 4DUXA 1PD6A 4D9LL 1FCGA 1RJZB 3JTSB 3T0BA 1FNHA 2QADB 4YHLH 4JKPL 1CFNB 4HIJB 3U48A 4HK0A 1TQBC 1R3JB 3QDGD 2P46B 4FTVD 1X5JA 3PP4H 5DQDH 2VDLL 3KYMA 4ODSH 1RU9L 3BW9A 5F6HJ 3GB7A 2DDQH 3H2WA 2X4QB 1E0OB 3C60A 1KB5A 1MFAH 2J12B 4R90L 5DVKA 5LQBH 4H8WH 3LKSA 2W65B 5BQ7A 3QYCA 2VXQL 2Z8WC 3X13B 1PJ9A 1KYOK 1J11A 1NGQL 3BKCL 4JRXB 4IS6B 1V7NH 3GMOB 5CJOH 2BNQA 3CSPA 3LZFL 2J4WL 5FCSH 3GGWA 1QBBA 4ALAL 4NSKB 5C7XL 4P59H 3U7WL 3RDTA 2C7UA 1IQDA 4J3UA 4IRZH 1I3GL 5ISZD 5DJDA 3OJ2C 3NCEB 5H37G 1A6TA 4OKVA 5GS1C 1Q94B 1UH3A 4I0KA 4BZYA 3PV6A 4C56D 1DR9A 3QNZB 5DMYA 3WFCH 2C1PA 4HEME 2BSTA 2BVPA 1UYWL 1KULA 1FVEB 1G7MA 1LGVA 4QCIB 2A74B 1A0QH 3PWJB 5F7NC 4X5LA 1AR1C 2BNUB 1FORL 3M07A 1I3GH 5GS3A 2F5AL 3N85H 3QHTC 5D1QC 3DXAB 2F54D 1DE4B 3DX6B 1AGDA 4WI5A 4QRUA 3O0RL 2BJML 5H94A 4D0DB 4Q9QL 1F13A 2Z8VC 4IEFB 1JNNH 1ZEAH 5JOPD 1G6RL 4IJ3C 5ITBH 1S7VB 2AJZB 1BD2E 3WFBL 5C9KA 1OAXH 1FNEB 1DBAH 3ZKND 2YPLB 1W0WA 2VLJB 25C8L 1BIIA 1DEEB 4GKZA 1J1OL 5HYEA 1U8MA 1RUML 5GS1B 3CJJA 1S3KL 4ZO7A 4G8GA 1WBXB 4K94C 3BZEB 3RPIB 1N7ML 3FO1A 4NQEE 4G8EB 2QSCH 3VRJB 2F53E 3BRGC 5I8OH 5ALBL 1R3HA 2C3VB 5DD0L 1L9MA 1J0KA 1CU4L 2P48B 1W0YT 1KTKE 4OF0A 3TA3D 5DYOB 4BK5A 1LNUB 3VXUB 5IR1A 5EZIH 3MLVH 3V6FB 2F54A 3ARBA 2A77H 1FV1A 1YJDH 4PJHB 3OKDA 4LCCA 3RJQB 3QIBB 1MFDH 3F7PC 3G08A 1FNLA 2V9QA 1OAYL 2ADFL 2GT9A 4FTVE 3MCKA 5IBTH 4UTBH 1CGUA 1CU4H 8CGTA 5I1HL 4ETQA 1TQBB 4DOHB 5T33H 2EO9A 2VE6B 1OGTB 3QG6A 4CDGC 2JJTA 3BN3B 2R4RH 1DLHB 3BGAA 4EZMA 3V5KA 5DGRA 43C9A 1AH1A 4EI6A 5KSAC 5HPMB 2E9BA 3QQ3A 5HI4C 3THML 4NZRH 2UVFA 5C0RH 5EWIH 5I1JH 5B3JE 4RWYL 1QACA 1I1RA 4P3DB 2P8PA 2B1HH 4MWFB 4K94L 4CN6A 1PG7H 4LCWB 5ADOL 5KVFH 4Q9RH 3SDDB 3VGAC 3Q5TA 2FHCA 4J4PD 1U8HA 3D85A 2IF7A 2R1WB 4P5TD 5DK0A 4GW4A 4LRIA 4GW1B 2HG5A 3C60D 2XYCA 1U3HC 4JFYA 5ITFA 1DBKL 3BP7B 3EO0B 1OAUH 4FQCH 2NYYC 5ICZB 1B90A 5BS0E 5I76B 4XVSL 1R3LA 5IEHA 2BNUA 3ARBC 3MODH 1CZ8L 1HWHB 2LTQB 3IJYA 5C0BB 3EO1A 1JHLL 3P0YL 3W82A 5I9QB 1W72H 4G43A 4OCYH 3GSVA 4IRJC 4TRPH 3RWFA 5GGTL 4O5LH 1DSFL 1MEXH 4KDTC 2NTFA 1HILB 3WLBA 3TCLB 4UTAL 3SDCC 1MJ7L 4GRLD 1RZJL 1XGYL 2HFGL 1RZFL 5EA0H 1C5BH 5D1QB 1TETL 4X6FA 4OUUA 3F7YB 1N64L 5F96H 3NA9L 3O2WL 2H6PA 3MV7D 4ZAKD 1LO5A 1W72L 4NQCD 3UYRL 4HUXA 2X9YA 1BD2B 2D2OA 1FNSL 3RU8H 1WCQA 4X4ME 1AHWB 4LLQB 1IGJB 5HHPA 5MHSE 3NABH 5T3XH 4BH7B 5CSBA 4FQXC 1J8KA 3QO0B 5EO0A 1ORSA 5E8EB 2Q76B 3QR2A 2WAHA 4B0MM 5FYKH 3S35H 1WLHA 3DWTA 5C0DB 4LIQH 1RHHB 3MA9H 15C8L 2VMFA 3UTSB 3VXSE 2F53B 3E8UL 1ADQL 5C0JA 1UB5B 3WXVH 5IJKA 4P9ML 2CDGA 4U6HB 4XNUH 1FN4A 1T5WA 2MQ0A 1YDPB 1YQVL 2EYTA 4UT7H 5GIRA 4CNIA 1DL7L 5D8JH 5SX4H 4R4BB 4YQXL 1W72B 2CDFA 4KTYA 1SHMA 2IADA 1FFOA 1CYGA 1GGTA 2HJKB 3E6HA 5C0IB 5FO8B 4NGHL 4YFLF 5HPMA 4ZOEA 2L7JA 3BUTA 3V4VL 3ZDZE 2OZ4H 4UINL 4TVSa 2A6DB 5IHLB 2JB6A 4MNQB 3MFFB 1AO7D 5CIPB 3V52H 2YD9A 5BOZG 2WQ8A 3I50L 3MXVL 5DRXB 4JQXA 2DQHL 3AGVA 3Q0HA 4I5BA 4OLEA 2Z91B 3DYMA 4NN7C 3UTTB 2BC4A 4OT1H 4PJ5B 1EV2E 3MZGB 3MCG1 3EJYC 1H3VA 3MRFB 2E6JA 4NZTL 5TDPB 1O7SA 3OKOA 3FQNB 3MRQB 1XF5B 2ZOLB 1FFNB 2ENYA 3EFFB 3KVQA 3WFHA 5IT2L 2GJZA 4JM2C 5DO2C 5MEQB 2EYRA 5E2VH 1NGPH 5FO7B 1HEZA 4OZHA 1EAJA 3GSNH 4U6VL 5IIEB 4TPRH 4OF6A 4QWWC 4Q74A 4CKVX 1T66C 2J1KA 1MLCB 3BJ91 1HQRA 3SDYL 4QXTA 4LCWD 3GKWH 3DNKA 4MNHB 1GPOH 1VDGA 3QI9D 4NNPH 3VFPB 4N8CL 2H26A 5E99L 3VI4E 1OGAD 1IT9L 3UDWA 1ORSB 5D5MB 4KTDH 4HHAB 1R5WB 3VG9B 1A9BB 2MCG1 4ODWB 3SO3B 2PUQT 1JTOA 4JPWH 4RNRB 5GZOC 4A6YA 3P3YA 4Z7WF 1MY5A 3O3DA 1RZ8A 4I0PA 2ZUYA 3MLSL 3SKNA 3L7FA 4PV8A 4XP1H 2DL9A 3W0WB 5FGRA 4UU9A 1I1AD 4CU6A 4LSRL 4FQHA 3UO1L 4AMKL 4KTDL 2WANA 2DLIA 5DRNB 4D0CB 1KTLA 3HR5B 1U92B 1XR9B 3GSOB 2AEIT 3QA3A 2DMBA 2NW2B 3QUZB 4LCYA 4F9PC 4X9HA 5HD8D 1WICA 4JPKH 4F7MB 4PREA 5JNYA 3L3DA 1C12B 1MCDA 3GMOA 2IFFH 5F7UA 5TH2B 1F3DJ 1HSBB 3VJ6B 5HGBA 3TIEA 5EUOA 2OYPA 2G2RB 3QULB 1IILE 4WFGE 3IAPA 3X3GL 4NO0A 4WW1B 2Y6SC 3QRFM 1MIEL 3SO3C 3D25B 1RY7B 2X4PB 3ARGD 1EVUA 5DO2D 3PWPA 1Q9LB 4LMQI 4NBXB 1ZA3A 4JFEE 2VDMH 4NQVA 1PFCA 4PJAF 1AO7E 3WEXA 2HH0H 1I3UA 5D1XC 5T3XD 3VFNA 2GJ6B 3B43A 3GSVB 2FB4H 5GZOD 5AZEH 3LCYA 5DJCA 4U2YA 4D9LH 5FYJD 3K80A 4NNPL 1B0GB 4O58L 3WNMA 3HLAB 3RTQD 1A3LL 4E0RB 3UPCA 1NCUA 4ENEC 4YBLB 4ZSOA 5FKAA 2A83B 4NC0B 4HWBA 2HT2C 3DGGB 3HG1E 4X9FA 3TO2A 4X7CC 3HAEH 4LHUA 4WY7L 4QHUB 1OP5H 3Q6GH 3QUKB 3BPOC 4RGOL 1UKTA 4J3OC 1AGBA 1P4IL 2X41A 3BQUB 4JDTH 1KEGH 1EPFA 2HP4A 3J7HA 4QTHA 5C07A 1A3LH 5ICYA 3EYOB 2LU3A 5IG7A 3RWCB 1CDGA 1WF5A 5DS8B 2AV7B 4WV1C 4ODWA 4XNUL 3RWJA 4ODXB 5JR1H 2Y4SA 3MLWL 4N9OB 1RZJH 1CL7I 3GSRB 3PQYA 1CGTA 3GJEA 4NRZB 2UY6A 2B2XH 4ISVB 2IAMB 3SDAD 2YZ8A 2GSIA 1R24A 4HUUA 1T22A 2XA3A 4LQ1A 3CFKA 1NAKL 2BNRA 4RISH 5M95B 1EO5A 4HIHB 1JZ2A 3ROOB 3QFJE 4MQ7B 1FAKT 2VO5A 4HIIB 4HS6B 2Q86B 1FNSH 3RU8L 4JRXD 4X4YB 4YAQA 4Z77B 3MPCA 5CIPA 5ICXB 3CX5K 4PGBA 2HWZL 5DEFA 4XP4L 5C9JB 1KB5H 1YECH 4OF8A 3QQ3B 1BWWA 4TTGA 2KQMA 2X7LB 4L3EA 1LO0H 3WXWH 1CF8H 4JY4B 4HZLB 1XF2A 1LQSR 2J8HA 1J88A 2X70B 1N5YH 3V5DA 3ME0A 5D2NB 3VWJD 2I5YH 1FYTE 4DKAA 4YJZL 4TSCH 1VEMA 3MRHA 4I2XE 1A4KA 3REVA 3HNVH 4X6CB 4NNYA 5CZVH 2B5IC 1A9EB 5KS9A 3LEVL 1AJ7H 4LPXA 2BK8A 5BVJB 5FB8B 1BM3L 1KSRA 3CFEB 3L3IA 1X5ZA 3IETB 4BH8B 1HIMH 4NQDA 4E0RA 5JR1L 1PZ5B 3GMMA 2QKIA 2EE6A 3TPUA 1B4JH 1Z3GH 3BP4A 5DMJB 4N5UA 4WHYH 4PRHE 1T5WB 4M5ZH 4P2OD 3S97C 2V7HB 5D1QA 1INEL 4O2FB 5CEYB 1YEJL 1AR2A 5KSUB 4PLOB 3HMXH 1NH6A 2G5BA 3QXDA 3H9YA 3EYOA 1CFQB 4P9MH 1V3JA 5IG7B 4S1SL 1MFCL 2YA2A 1OTSC 4OQ1A 1A3RL 3PL6B 1IFHH 2AKRA 2CR3A 1F11B 1ZLUK 3SDCA 1Y18A 2XKNA 2XWBB 4KDTA 5DJAA 3UBXG 2I26N 5J6GA 3MRGB 1JWUB 3D0LB 2N7AA 3VFRA 3I02B 1DQML 5KSAA 3EJZC 1XEDA 3F58L 3WFBH 1CDHA 1E6OL 4ODUA 2DD8L 2DKSA 4U0RC 2FJGB 1J9CT 4YDJA 1VFAA 5F8RC 5HVFB 3BD5A 1RULH 4BKLB 3ZE2F 2ATPA 4ZD3L 2QSCL 4MNQE 1ND0A 2X4SB 1X7QA 4PGDA 4MA1B 5I1EL 2BHUA 5TE6L 2IQ9L 2X4RA 5HHNA 4JRXE 1A2YB 1SEQH 3GMRA 1GC1C 5DTFA 2BVYA 5EC2B 3MACH 2IANB 1NCTA 3F58H 4PJBB 4WRLA 1GGIH 1WWWX 5CSZA 1YJDL 5I9QC 3NIGF 5KBNC 4HWZA 1IGJA 4OM1H 1T03H 4YC2C 3QHFH 5T1KB 4K3DL 3SCMB 3OAUH 1NUGA 5FKPB 4RA0C 2J4WH 4HBQA 1FAIL 2H9GB 1HYRC 3WLWD 4YWGL 1RJLB 4WI3A 1EFQA 5C0FA 5DQ9B 4KTEH 4MXWH 1AGEB 5DJ0B 3I3BA 2EH8H 4JM4L 3VXRA 3LKOB 1JWMB 1I1CA 1KENH 4JDZA 1NCWH 1BX2B 2XN9A 3NN8B 2DM4A 3QJHA 1BZ9A 4Z76A 1NGYB 1MIEH 5JUEH 2E9IA 2V5RA 3H7BA 4RRPA 3FZUC 1DDHB 4PB0H 1QSEE 2NX5A 2HKHL 5DFTA 4P57A 4QGYA 3EJZD 3OQ3B 2H3NA 4G6KL 4HG4K 4RFEB 3FOMA 3V6ZA 3DURB 4NOFA 4KKAD 3SKMB 2XICA 1WISA 4HUKB 4JY6A 3GEWB 2V2TB 4Y2DD 3TN0D 4AYFA 5FUOL 3FFDA 4I3GA 1ADQA 3WV0A 2D4FA 2DQJL 4ZO6A 5I73C 3EYSL 3IDJA 4EDWH 4LPYA 5FM5M 3VXUA 3V52L 4I0PB 1M7IA 4GRWE 4QNPE 3VXRD 5CP7A 1MFBH 4UB0H 4XPAL 1T04A 4GKSB 3F65A 1A6VH 4I3RL 3KXFB 4QHLA 4X8JA 2ED9A 5B3JF 4YHLL 2VKXA 4JKPH 4FFZL 3HUJF 4NZUL 4M03A 5GHWH 3BDYH 3NIGE 4P2RB 2D7PA 2DQEH 3VXPA 5F1IA 4PJ5D 4L4JA 4JY5L 1YY8B 5DF0A 4M7KL 2CDEB 1VACA 2ZJSH 1RFDH 2R0KL 3IU4H 2V17H 5HI3D 1KCSH 3ARWA 2F74B 1K2DA 5IBTL 1SMOA 4ZFZB 5F9JA 2QADC 1K6QH 4ZUWA 2DOCA 4EQ2A 1JRHL 5C0AE 4Y19A 5DFVD 3U4AA 1RAMA 5CLTA 2NY4C 2GTZB 1MIML 4RMQA 1FFNA 1G1CA 2OP4H 1DBML 2DQFA 1YQVH 2CIIB 1KT2B 2P8LB 2YUXA 1KN4L 5LKNA 1AP2B 2EEAA 3R06A 2FYYA 1VPOL 1CGWA 4OFPA 4JDZB 1CF8L 5FIEA 4N9GB 3EHBC 3SY0A 4UTAH 3IT8D 3ILQD 1HHGA 4BYHA 4UMGA 9CGTA 5MENE 1U41A 4F58H 4QHMB 1P69B 1LMKA 3N85L 3O3AA 1HINL 3KPTA 1MCIA 2Z31C 3N50A 4LSRH 4P5TC 3NABL 2VZVA 3RGVB 2G2RA 4RGNC 3HZVA 1JNLH 1TTUA 3FOLB 1ZEAL 3UX9B 4U2ZA 1AO7B 1X9QA 3MV9B 4GRWF 4QNPF 4APQD 3IFLL 4GRMB 4X9IA 4KC3B 4LP5A 3MBEC 4JGJA 4MNGE 3VMOA 4KVNH 1C5CL 3SGEI 1YEHL 1R5IA 5E2TL 4O5LL 5IQ7L 3MO1A 2KZ1B 4OTXH 4ZFOA 5K9JL 4MA7L 4WI9A 4QRSB 2E7HA 5JOEA 4XP4H 5EOCJ 2FJFB 3RWFB 3FT4A 4KHTH 4UOJA 4GBXD 5DRZB 4XGZA 1UFUA 5IOPA 4PRID 3MR9A 4KZEH 2ZSWA 3BISA 4WV1B 1XH3A 2VOTA 3MX0A 1UM5L 1GGBH 3H8NA 4X6CF 3QUZC 4F57H 5AG8A 2D0FA 1PW3A 3OMZA 5I66B 5KN5B 1P5VA 4LVNC 3ARTA 5L7XH 3O41A 3L7EB 4O02H 3TYGL 1A5FL 3QCUH 4M7ZC 4PJ7F 3ULUC 3B5TA 3RIFF 4JPIB 5I8EB 3KXFE 1X5GA 4XT1C 4CBPA 1PVHA 4WENB 5T1LD 3DGCR 4NKOB 5D9SA 1KG0A 2R56L 1MCOH 5ERWB 2FNBA 1E6JL 1XIWA 1A7BA 2V2XB 4JHAH 2CK0L 1M71B 2EYSB 2P24B 1OGAB 4M6MH 1FDLH 1XF2B 3FB7B 3PGDB 4PJXF 1HQ4A 1E27A 4WFEE 3TZVD 2Z35B 3Q6FA 1NJ9B 4G8IB 4PJEF 4RCAA 2VQTA 4XVTH 1A9EA 1ACYL 2EIZB 2VLRB 4G6JH 5JXAL 2HA1A 1A4KB 2PW1B 3L95B 1WBZB 4OQTA 5KS9B 2P5WE 1AFVL 2OSLB 1MFCH 5CJBA 3O2VL 5IFJA 3VXUD 2PYED 5GGUB 4XP6L 5EO1A 2E7LA 2AERT 3QUZD 1XGUB 3RZCA 1EXUA 1QP1A 4MMXC 2FEEI 3ZKMD 5IHBA 3M1BA 3FHAA 3RVWD 4OZHB 1A4JB 4JM2B 3VXQB 3FFCB 2A9NH 3ZT7A 3GI9L 3CUPA 1LEIA 4M7ZB 4G9FD 5ADPH 3QWOB 4YE4L 1LILA 1HIML 2XG5A 3G6JE 3QDJB 4KJPD 1FORH 4Y19D 4P2OC 3GHEH 3L3KA 5DXWA 3CGTA 4HJ0D 3FQNA 3QRGH 1F3DH 2LQRA 5CSGA 3M45A 3AU1B 3ULUL 4HJGB 3IJSA 4WEMB 1OL0A 2H8PB 4YK4C 1U42A 4HWEL 5D6CB 2VNCA 3OR6B 5TQ0L 3VH8B 3NCFB 3ZE0E 4Y16A 3ALXA 5C08E 4PJ7E 3MLXL 3L5WA 4C4KO 4ZOCA 1TVBB 5T1KA 2W0FA 1N0XH 4JQVC 4KMQA 4JEGB 1UXWA 4AENB 1B4RA 1YEIH 1G9MC 5L9DL 1FFRA 2G60H 1ORQA 3DXAA 5KVEL 4PJXA 2FX9L 4GMSH 1OY3B 2AJSL 2NW3A 1JF1A 3CD4A 1EAPB 2NZ9C 1BQUA 4K07A 3GRWL 1MAJA 3KLSA 4APQB 1RJYB 2AXGA 2RQ8A 5E2VL 3VDCA 2DLGA 3LH2H 4P2QA 5EZOH 3B2VH 2VAJA 3GNMH 2XQYG 3SBWA 1NGWA 3JV4B 4JB9L 5D7IA 5ETUA 1N0XL 2XRAL 2ZCLH 4KKLD 4XBGB 4F8TA 3LN4A 1JYWA 3P11L 4LVEA 2FD6H 2DQDH 3QCVH 3MV7B 4MSWA 1R0AH 4WV1A 2FSEA 3PGFL 4G8IA 3FMGH 2ZUUA 4PB0L 1V7NL 2GKIA 1TNNA 2ZUQB 3VWJB 2JB5H 5IROC 5TE4H 3I02A 4BH7A 1DQDH 5IESH 5INCB 1N26A 1T1YA 3QAZC 2AJ3B 4M8QA 4XPHH 4F7MA 5C70A 5JNYB 4NZRL 5C0RL 3NACH 4FQIL 2DJSA 2NNAB 4ZNCD 4HGKC 1B0GA 1I4FB 2FZ3A 5FYKU 2VUOA 4ODTH 2ZSVA 5DMGC 2N56A 4NKOA 5H2BA 3Q5YA 5CJXA 2NY2D 2K1MA 4NBYB 3TM6A 3VCLA 5L2JB 5AAWA 1TZHB 1YMMB 4O2EA 5KVDL 1MJUL 2JCCB 4IMLB 4OCXL 3JV6A 4BFIB 2J8OA 4DAGL 2WBJD 1NSNL 4C83A 1WWBX 3WJJC 4NM8L 5LJYH 5I1CL 2BSED 4LLDA 5I1LA 4ZUTB 1IQWL 4EJ1C 4EVNB 1JUFA 3KLHC 3SDXB 2KL6A 4NO0B 4YHNA 3IAGC 1F58L 4OSUH 1HZHL 4GFTB 1BFOA 1K3ZA 4N0CD 3RX8A 5JIIA 3GM0A 2HFTA 1OP5K 3RWGB 4HX1B 3WKMH 4KQ3H 4DUVA 1E4WL 3D69B 4JO1H 3VFUB 5DK2B 4BZ2H 3GBML 5LG1A 1X44A 3O6KL 3G04A 5I1CH 2EKSA 4R2GC 2P43B 3ZT6A 5KG9A 2JJSC 3WCYA 5FYLH 1SJEB 2OXGA 3CDGB 4F7CA 1CXIA 3MRNB 5F7MC 1RI8A 2K7QA 4JZJB 2UUDH 4U1MA 2YUWA 1IC4L 1S9XB 2XN9D 5C0BA 1EAPA 5CWSA 3H9HA 4ONGH 1I7RA 3DYOA 4MD5B 2HH0L 3B9DA 4XNQB 2C4FT 3I6GB 3UJJL 3T3MF 2NY3C 4Y5XA 3RIAK 4YXLL 5EU4B 5CJQH 1NC4B 4MZ3A 4LIQL 1MJJB 1FNGA 4MAYB 2DLTA 2J8UB 2P7TA 4I48B 4MD4B 4P3WA 5J1AA 1UM5H 3PL6D 2V5TA 2VB5A 2B1AL 5DRXA 3K8KA 2EXWC 1J8HD 2X70A 2YSSA 3EBAA 4G3YH 3KYOA 5DVOA 1NFKA 1H3TA 3JTTB 1NUFA 2EE9A 4UT7L 1UXSB 4JFOA 4X80L 4P23B 3MRBB 2XIDA 2HTKD 4R26L 3L5HA 3PWJA 2W60A 3NZHL 3DO3A 2NY0D 3QCUL 4R2GD 1PG7L 4JM2A 4PY8I 1YMHB 2BCKA 1ERNA 4OI7A 1IEAA 1VGEH 4ZAKA 5EUKB 3LEXA 3RX7A 4JFED 4MHHG 3QXTA 4PD4J 4JPVH 2QR0A 2P8MB 4QRRD 1G6RA 3RWDB 2C9AA 1YEKH 3BRDA 2JIXD 2NY3B 5KSAD 4MGXA 3BN9C 3TBVB 4F58L 1KACB 3INUH 1FL6B 5JIPA 1OQOA 2JB6B 4LMQE 2Y7QA 3BIAX 4L4VE 4RMTA 2CKBL 2PTTA 3GJEB 2YPLE 4NRZA 4U0RB 5E2UL 1F6LL 1ITCA 4GRLB 3MLRL 1LK2A 4JRYB 5E70A 4HMEA 2VXQH 4KQ4L 3QNYA 1XIWB 3TIDA 3IDGB 2BSTB 2YRPA 4AEIL 5F70A 2BVEA 5J57B 2ORBH 2JTDA 5H2BB 1DQTA 2V5MA 1A22B 1HKLH 4PJEB 3RVTD 2KDGA 2X4TB 3C08L 1MF2H 5BOPA 1T7YA 3S4SG 1A8JH 4DCQA 2O61A 1LHZA 4X99B 4EI5A 3MXWH 4JKWA 4KHXL 4OCMC 3PDGA 3LEYH 3DX6A 4LLDB 4LARH 1ZWIA 5BMFH 2A38A 3MV9E 4GG6B 3UZVB 5EFIB 3ZSSA 5GRUH 5J12C 5EUOB 3R8QA 3T0VA 3VWKC 3WUWG 1PX3A 4DK6A 4JM2F 3K2UH 1CWVA 1INDH 5GSVB 3DROA 3CCHA 5IROA 1TTGA 1A2YA 4IJ3B 3KLDA 1QA9B 3PXJA 5DQDL 3TESA 5T1MB 2Q7YA 3C8KA 2EICA 3G5XA 1SJHA 5E8NB 4RFNB 3VD4A 1CFQA 1MFBL 4UB0L 1QSFA 3KWWB 2B5IB 5E5MB 3TJEH 3DARA 5HGGS 1TTFA 3EO9L 4NYLA 5DD5H 1AXTH 3UTQB 5HHOE 3RUGF 2ED7A 1UZ8B 1VFAB 3SBWC 2Y06L 2ZUQC 3IDYC 4I3SH 5FM4A 1JGUL 4MDIB 3MRMB 1NFDA 2BHYA 5T1DH 4TQEL 5C0BD 3X3GH 2BP3A 4H20L 1DQJB 1AY1L 3IFNL 1GC1H 4M62H 4WO4D 2DQHH 5E08L 4XRCB 5FXCH 3MOBH 1WAAF 3LB6D 4YHMH 1NDMB 1ACYH 2HTKC 1BQHB 5E9DB 1KTLB 3HR5A 3NTCH 3D6GA 3K4AA 5ENWB 3HMWH 2FRGP 4UT6L 1G6RB 1U3HB 3W9EB 5BS0B 4LGRB 4Y1AA 1AD9A 1GIGH 3GJFH 1GGBL 3PL6A 3PWUB 4PJCA 1QLRB 5B8CC 4XBPB 3FQRB 4QXGL 3MLSH 4RGND 4LVHB 3V5HB 1LDSA 2WLZA 3T8XA 3V5KB 5EC1B 4UBDC 3DRTB 4OF7A 4F2MB 2I9TB 4RNRA 2FX9H 4GMSL 2DJ4A 3VH8G 4K71B 4AQ1B 5K59F 5KSAB 4YHZL 5LBSL 3G6AB 5F3HA 3A6BH 3TBSA 2Q8AH 1YNKH 2WWMC 4X7DC 4JPKL 5CZXC 4LSUH 1SVCP 4H0IA 3G08B 1FNFA 1GPOL 4YK4B 3QP3A 3HC3H 4WW2F 1NAMA 1U92A 1ZHLB 1D5MA 2WMPA 4HWEH 3N06B 3SO5A 4ZS7H 2E6QA 4O51B 4ZFGL 1MJJA 3C87A 3V0WH 4XMLL 3WFCL 2DKUA 3SKOA 2YPKB 2PO6A 2DB8A 4HKXA 5F1NB 12E8L 2DDQL 3EDKA 1HHKA 3SOBL 1I9RL 3GRWA 5E24E 1X4XA 1UM4H 4PJDB 3ISWA 1RK1A 1BFSA 5F7EL 3RGVD 1F4AA 2IH1A 2HJKA 3E6HB 5C0IA 5J06A 3IETA 4LHQB 2YC1A 1A7OL 1D6VH 3T2NL 4HKJB 1EEQA 3ULVC 1XGQA 4QRTA 3JXAA 4QYOA 4H1LB 1EBPA 3QXVA 2BRRH 3O4LA 4PYGA 1CZ8H 3A6CH 2PYEA 5DJ6B 5C6TH 5D7LA 5ALCH 1KUMA 4HJGA 5JQHC 3HNSH 1FBIL 2VLRD 3H3PH 3TZVC 1A7PL 2R9HC 4LHUD 4PP1D 4U1SA 4HFUL 2KH2B 2Q76A 4KKNA 2VTFA 5ABDE 3U0WL 4KXZI 2VZTA 1U8NA 3NH7L 2BOBB 1TIUA 4KJWD 4PBWD 3FRUA 3ZMRA 4RDQF 1SJXA 4JFFA 2OR8A 3VWJC 3MBXH 4X6FB 5AYUL 3PWUA 5EU6D 3PWNB 4LLWA 1YDPA 5FHAH 4HIIA 4XH2B 4GO6B 4R0LC 5ITBL 3EGSB 4JRYD 4PJCB 3RWIA 3NPSC 3QWRA 2ICES 2ERJC 3HE6C 2BVUA 4D9QE 2NR6C 1JNJA 1T4KA 2YHGA 5FHBL 2MWCA 2NY1B 1AO7A 3P9MB 4F33B 4YHNB 4U3CA 4HSQA 4PY7A 3V95A 2DQEL 3ARDA 2DQIL 1VFUA 3T1WA 4QTIH 4X99A 4EI5B 3I9GH 5DZNA 3AB0B 1G7MB 4QCIA 2XA8L 2F54E 3O2WH 4S0TD 4POZD 4YFDB 4XWGH 1QBML 3VW3L 3CK0L 1RZFH 5D5ME 1DUYA 1MVUA 3JBG7 2P4AB 4L3CA 2XTJB 3LKPA 1BOGA 3VA6A 5HI3C 4MA3B 4OM0H 4RIRA 3NCMA 5EUOF 3D18A 1L7IL 4ODBD 1MQ8A 2GCYB 4RGNB 1MRDH 4JDVA 1UWGH 1CQKA 3HB3C 1MCLA 2XQBL 3HI6H 2KUTA 4AM0A 5I1KL 2IBZX 2ITDB 4WUKH 5GJSL 2VXUH 4Y19B 2MCPL 5GS0L 1MAKA 2VLLA 2PYFA 4M9PA 4ZQKB 5CS7A 2ERJB 3HE6B 5CJQL 5FYKD 2ID5A 1L7IH 2F15A 4R0LB 3GMQB 2HN7B 3MLXH 4IHOA 3BQUC 4LDLB 3RZCD 5D7LB 3MOBL 3KYMB 1JZ4A 4J8RB 3RPKA 1JZ3A 4M5YH 4Z7OE 1JK8B 3OB8A 5IR1B 4O9HH 4WHDA 1MRCL 4PJ5E 4PTTA 3HFMH 4Z7VE 1RMFL 4UQ3B 1LEGB 3LQZA 5E56A 3RAJL 3EOTH 5D1ZC 5C07D 4WHTA 1P4BH 4I18B 1PZ5A 3GMMB 4D2NA 2D9CA 1U8NB 4KKBC 4PJ9C 4CJ0A 1NC2B 5GRVL 3RGVA 4XHQA 2BNQE 1XFPA 4GXVH 3RPIA 5J89A 1RHFA 3VXQA 4PV9B 3VFPA 2F19L 2Q8BL 1ZGLA 5IB4A 4MDJB 4K3DH 4NP4L 3W0WE 1VFOA 2DWDA 1X4ZA 3MRLB 4U1HB 1NPUA 2A0LC 1OARL 3B2UD 4P2RD 4P4KD 5CBAB 5D7KE 2Y72A 1YEFH 5I0DA 1T0PB 3V6FA 2EIZA 2VLRA 3QHZH 4JG0H 4RMRA 2APWA 2HVKA 3KHOA 4NJ9L 1J8HA 3VFMB 1CICC 2AXFA 5C09B 5F7DB 4L1HA 1IAIL 1MREL 3BT2L 4ODXA 1M7IB 5HI5D 5GGRY 2VISA 2YPKA 2R4SH 3HZMA 1WCBA 1T2QH 4LSVL 3S35L 5DVNA 1IAKA 5I1DB 5BRZD 2AJXH 4GG6E 1I8MB 3GBLA 4J23A 1KCRH 3EYVA 2Q1EA 1JHKH 3QEHB 5GGSB 1VHPA 4HIHA 1ZSDB 5FUOH 1T0NB 4BFEA 3L5XH 5GGUA 4WWID 4QF1A 5I16A 5TQ2L 4G9DA 1A6ZB 5F7KC 4P57B 5ID1A 2XXMB 2MKWA 2V9RA 2Q8AL 4HWZB 5HVGB 1HQ4B 1P5UA 3QFJB 5TDNB 3O6FA 3MBEB 4GQ9L 4W4OA 1NJ9A 3DRQA 4LVHC 1A0QL 4JLRB 1BD2A 1TZGH 3G5VA 1MPAH 1BVLB 1U2CA 3MRDA 3RGVC 3RWCA 3QDAA 1RZJC 4U6TA 1CR9L 4FQLH 1JHLH 2DM3A 1AGEA 1WT5C 5FYKE 2C1OA 5FO9B 4KROD 1NANH 1A02N 5DMKA 4QRRA 1R5IB 3HZKB 4HWNA 1DSFH 1UEYA 4NO3B 1OSPH 2QQNH 3TO2B 3ZYZA 3MRKA 1T22B 4XRCA 5FYJH 1F5WA 5I30H 3MLYH 2VN7A 2AJYL 1NDMA 2EXYC 2QEJA 4P5KB 3HN3A 4Y16D 3FONB 4LRIC 3VMPA 3U79A 1T1ZB 1R5VA 1ZVHA 2B1HL 4Z7VB 5F3BA 4JRXA 2PKDA 4NJAH 4AZ8A 1FFOB 4I1NB 4O2EB 5ESAB 1UACH 5MERA 4F33A 2X4UB 4OGAD 4R90H 4KKCD 5LQBL 5KOVC 2HMID 1H3XA 2OXHA 3GSNL 1BBDH 1RU9H 1SYSB 3ROLA 1EGJL 5TFSH 1VCAA 1X6NA 4R26H 1WIOA 5IFHH 1OM3H 3A67L 5E7BA 2F58H 3MJ8A 2FEDC 4NQUA 4M1CC 5C7XH 3RWGA 1MCWM 1P7KA 1VFBA 4PR5B 1OAYH 2ADFH 2MFNA 1T83C 3ULUD 3D3VA 3E0GA 2YA1A 1F4YL 1FYHB 4X0KA 2DICA 4PJXB 3W2DH 5KSBE 3N1GC 2CIKA 1C5DB 3O2DL 2UZYB 1SBSL 4PRNA 2YD3A 3FO0H 1U95A 5K59E 5IVXF 4GOSA 1OCWL 3RY4A 5FCUL 1YY8A 2CD0A 2HT3D 1EEZB 3QPQC 5DD6A 3BGFB 4Z9KB 3MLWH 3EOBB 4Y8AA 4Q6YA 2EH7L 4JHZA 2A77L 3RNQA 1MCEA 1RIHH 3S34L 1NBZB 3FFCD 4YFLI 4X4MA 2VDPL 4UAOC 4OT1L 5FYLL 1UCBH 4JFFB 2BY0A 3STZB 3EYFA 3AAZA 4F9PA 1BECA 3MBEA 3ZYOA 1CLYH 4PJCF 2J2ZA 4XZUA 1ZAGA 1Q9OB 1U36A 1AIFA 4LCUA 3CMGA 4KK9C 4U1IA 3VI3F 4XXDB 1S7SB 4WY7H 5L7XL 3VFWA 4P2CG 5DJAB 2NX5D 2R0KH 2JIXA 4S10A 3BMWA 5HDOA 3OGOE 1NAML 1PLGH 5DMKB 3MV01 1SYVA 4ESKA 1WITA 1F2QA 1QFWH 5GJSH 1O7VA 1KIQB 1UYWH 4UUJA 3ARBB 3RVVC 1ZVSB 4OLUL 2HKFH 5DA0B 1YMHA 2ADGA 3QG7H 4ELKA 3WLWC 1H3GA 2P5ED 4PGCB 3U7YH 3WN5A 3VRJA 1H3WM 2IPTH 4P23C 1KF9B 4AY0A 1JPFA 4M43L 5E8DL 1RK1B 4LU5L 5I1IL 3RHWF 4MJ6B 2VLKA 4XVJL 1OB1A 1NANI 2OTPA 4NKQB 3VFVA 5I1GH 4OLUH 3SJVB 1IAOA 4Y2DB 4F57L 5C0AA 5D1ZD 1YPZA 3TVMD 4KMTL 5KTEL 5DHYA 5ANMB 3V0VA 2OMNA 1FV1B 4YDVB 1S9KC 3NIFE 4YXKH 1ZHNB 3WFDH 1V8HA 1UWGL 1KIPA 1D9KA 4DZ8A 1AI1H 1V3MA 5HHME 1MWAB 2NY6C 5FYJE 5TQ2H 1H0DB 1SY6L 3ILPB 1UB6A 3ZL4L 1UENA 1CLYL 3BEVA 3AM8C 3HKFA 5KTEH 1A6UH 4K94H 1MELA 1XCTA 3H9HB 4X6EA 2IPKA 5EOQH 3KPRA 4YDLB 5IMLB 1MI5A 1ZS8B 3QO1A 5HY9A 2X1QA 5FYLE 4PBXA 1BZ9B 4Y16C 4MJID 2V2XA 1T89A 2H2SD 3QDJD 4IDLA 5E6ZA 3VI3E 3TZVA 1Y6MR 4AQOA 4RQQB 2OMBA 4WI4A 3MV11 4LHUB 3CCHB 3PL6C 2FJHB 2HRPL 1T2XA 4HV8A 4U1LB 3L3HB 1N6QH 3S96A 3GIVA 3GMQA 3QG7L 4FFVC 4E41D 4WEBL 5D7JD 2IALB 5DC9B 3RGHA 3B9EA 1MLBA 3L5XL 1QEWB 2VXSH 2NZIA 3RWJB 1HNGA 3BPNC 4G6MH 3SKJH 4Z76B 2XN9B 2IH3A 4M7LT 5HYJD 3TNNA 3CXHK 4QEGA 4F7EB 1HILA 1LO4H 4JHWH 2CH8A 4HUVA 3P4OB 1CVSC 5IVOA 3OF6A 4H25A 1LO2H 3WHXB 1FZKA 2ZKHH 5AUMB 4J2XA 4OQTL 3AREA 2AK1H 5D7IF 2QLVB 4S0SD 1Y0LB 4NZJA 1FG2A 1HHHB 5IB5A 4HLJA 5JHDE 3SCMD 3CSGA 4WW1A 4PS4L 4S2SA 2NW3B 2D0GA 5IB1B 2P1YA 2CUMA 4NO2B 5GGQH 3CXDL 3NIFF 3QIUA 2WQRA 4QO1A 1AFVH 2ZZUT 1AHWA 4LLQA 1B2WL 3MXWL 1MAML 2WM0A 3CSYB 3F62A 2CDEA 2RCSL 1SBSH 1XGYH 3TJHD 1KPRA 5IW3A 5K9QI 2EC9U 2DBLL 4NO5A 3UYRH 3V0WL 4I0PD 1SM3H 3VG9C 2DQFB 2LVCA 1JF1B 3ARED 1JPFB 4ZSOE 3KPRB 5T3ZD 5EFIA 3X12A 5F7YC 4M5YL 5IFHL 1FLRH 3EFFA 1EUUA 1T83A 5DD3L 1ZWIB 1IT9H 2MKLC 5H35B 4OZ4B 5DFVC 3OV6A 1A6ZA 3T0DA 1IEHA 1NLBH 1CDUA 2LAGB 3KAAA 5D7LD 4RX4A 1DVFB 1IJ9A 3KPMB 1A7RH 2E6PA 1DFBL 4L9LA 3JV4A 4Z7VF 1KCLA 4EXKA 5T1DL 4XP1L 5GGVL 2J8UA 2P7TB 4I48A 2CJUH 4K8RC 3QIUC 1MLCA 3NCJL 2CIIA 2XOTA 1ETZA 3MQIA 1IM3B 3KPSE 4P4KA 1HN1A 1BVLA 1H3PH 3O8XA 4BJLA 3TCXA 1KBGL 4ONGL 4NCC2 1RUQL 1R5WA 3K1DA 3GFUA 3T08A 2FCBA 2BVPB 1OGAE 2BDNH 4C56B 1R3KB 1HHKB 5EWIL 5KG9B 3S9DB 1JF5A 1F6AA 3QIWB 3QUXC 5BZDB 1I1AA 3IXTA 4XPFL 4PJHA 5HYJE 5BW7A 1WT5A 3EYVB 4OD3L 3ULSB 4KQ3L 4FMKA 2C3GA 5CLWA 3KPOB 1FJ1A 3FN9A 3BZFA 3GGWB 3GMLB 4Z6AT 1OAKL 5FHBH 5I75B 1EO8H 4U05A 3FN0L 4OBSA 1TLKA 4P2QE 3UTOA 4LPUA 1JZ6A 3BKJH 4XP5H 4U31A 3BWAA 5DT1H 2NXZD 4GBXC 3QB7C 2A2QT 3UC0L 3FCTB 4RWHA 1RIUL 2VZSA 4JQVA 4NKMA 1J8HB 1LD9B 4XXCC 3GIZL 2YD8A 3QNZA 3P0VL 5C71A 1P7KB 4NM4L 5KSBB 1KG0B 2P24A 3MJ8B 2RHEA 25C8H 5HHVH 1NBZA 5EOQL 4BFGA 2MQCA 4WW2B 5E4EC 1FVDA 4ORGA 4LVNB 2BVOA 5IQ9B 1N5AA 1CE6B 1A5FH 3FN0H 2XG4A 3MTRA 5H94B 4BSVB 1QFPA 2WP3T 1TENA 5IK3A 4NC2B 1JFQL 2YRZA 3G5YB 3ULVH 3VGHA 4XWOC 1NQBA 4LOUD 4UOW0 1FO0H 4WI2A 1RIVL 4M6ML 4OI9A 3KS0J 3MSPA 3GDBA 3QZWA 3JSSA 1W0VA 2AQ1A 1MH5A 3VMNA 3JWDH 2FB4L 4N5EC 4Z18A 1CTOA 2ZWLT 4MA7H 3TCLA 1TQCC 2XWJB 3FQWB 3KYNB 1D6EA 1S9VA 4YDIL 5SX4I 4YHIB 1A21A 5EU6A 3SOBH 1T7VA 2ESVA 3EJJX 2JJVA 2LTQC 4EN3A 4WTZG 3BEWB 3P9LA 3QQNA 1LK2B 1Z9LA 4JRYA 4KROC 2VKWA 5IEHB 2R2EA 3MROB 3VD3A 4G8GE 4ERSH 1B88A 4NQED 4OB5H 1PKQA 1QFUH 4HBCH 5C8JB 2CXGA 5I8CA 1AKJA 1CD8A 3GSXA 3RTQC 4L8BB 1S5IL 1XR9A 3BESR 4S1QH 4IIQA 3RWDA 2D7MA 4XH2A 3A6OA 3U9UB 5J8OA 2H32B 2XZQL 4YNYB 2HJLB 4ERSL 5MENA 1BLNA 1UM6L 1W8NA 2NY0B 3DI2B 1SYSA 1T1WA 4YIQB 5IHZA 4WDIA 3VXOA 2P8PB 4MJ6A 2ADIB 1GH7A 3I85A 2YXMA 5DJXA 2ZUSA 3D3VD 5C2BL 3TO4A 4N5ED 4U3HA 1S9WA 2I25N 3NFSH 5ANME 3LIZL 5D7SL 5BVPL 4OM0L 3BWAB 1CXKA 1QFOA 4NKMB 2H2PD 3ARDB 3U36A 3DO7A 4ZPTA 3CZJA 2VAAA 4R96B 4AEHL 3MGTA 3DX9A 3MRRA 3Q6GL 1WAAA 2AV1B 1JI2A 3QIBC 2MSPA 43CAA 4CVZA 4JG1L 3VH8A 2E5EA 5E6YA 4UNTA 4WUUA 4OD2A 1YNLH 2BC4B 3UBXB 1OQXA 2X4TA 1JHKL 5B39G 4XBEL 5C0GB 1NCNA 4WGWB 3KDMB 3R06B 1JTTA 4G80B 3LKRA 2JE8A 5D2LF 1P7QD 1VGKA 1U8PB 3UBXI 4ELMA 2ILLA 1WIPA 4LVOC 4WTXA 4OD1L 2APVA 3VG0H 4HLZG 2X10A 1S9XA 1REIA 3JV5A 4I0PC 4NQDB 3H9SB 4GKOA 4HWBH 3JUYA 1NEZB 1KIRA 2FATH 2EKJA 1RZKC 3TV3H 3W81A 2Z91A 1NCDL 3ESUF 4XNZC 4NQSB 1QQDA 3MRHB 1LE5B 3UTSA 2GFBB 3PHQA 2BOCB 4JFEA 4Q9QH 1N6QL 2F19H 2Q8BH 4MYWB 2WK2A 3RKPA 5ECJE 2MNUA 2XACC 2CGRL 1BJ1J 1AGFA 3LH2L 4E42A 5CGTA 5HJ3B 3BUYB 1UCTA 1VENA 3SE3A 2EYTB 3OKOB 1SJEA 3MMEA 4HIEA 4R4BA 2YK1L 2CJUL 5ICXA 2YBRB 2BY3A 4FN0A 4K9EL 4I8DA 3DUSB 2V7NA 4N90D 1RUQH 2CLRB 2CKBB 3PQYD 4YNYA 4U1HA 3L1OH 3KLAA 4YC2B 4TVPD 2RIKA 1A1MA 4LSUL 4ZUVB 5D2LA 1U8OA 2C7UB 3DYPA 4KXZH 1NC4A 3P0GB 4J12A 4EUPB 3CFCH 5F9AC 5HDQH 3V79C 1UADC 3HTLX 5JO5A 3DX9B 1AY1H 1GZQB 3IFNH 2IANA 3CXDH 4MCYA 3V7AG 3VFRB 5JMOC 4PY7B 4FXKB 3ARQA 1CIDA 4KZDH 3FB7A 2AJUL 1SEQL 3BX7C 4OZGB 3U1SL 4P2OA 1CGSH 4UT9H 2VQ1A 1J05A 3ZYIA 5TE7L 2IQ9H 3T0EC 4Y5VB 1RZGB 4O4YL 1NL0L 5SWZA 4EUPG 2JELL 3LQAL 4PUBL 2WBJB 4Q9BA 2PXYB 2HJLA 1U3YA 4LPWA 2IH3B 1BOYA 2X4SA 3UPRA 2FDBP 4KKCC 2YMXL 4PJ7A 1QTYT 4XCYA 2DTSA 1CDCA 2VC2L 3OKEB 3VE0A 2E7LC 1FH5H 2AJUH 3TH3T 4W4OC 4ZS6D 4YUEL 3GK8H 2GY5A 1A6WL 4QOKD 3QQ4A 5D6DA 4BA8A 2B1AH 2BOBA 3LKQB 3MRPA 2NZ9D 4DVBA 5F7HA 3TBWB 4HS3A 1R5VB 5IB1A 3ZKXB 1IGTB 2I60L 3PNWB 2A73A 3HAEB 1HSBA 3VJ6A 4D3CL 1QRNE 2GHWB 3ZT5A 1K3IA 4MAYD 1QSED 4GW4B 1NMCB 3MUGA 4S1DC 4U7SA 2FH8A 4M6OL 5D7IE 3NVQA 4NRXB 1CI5A 4PRDB 4RAHA 5C08B 3WS6C 4NRYB 4WI8A 2WNGA 3TNNB 4FG6D 3RVUD 1EHLH 4FQJL 4MWFA 3GK8L 4Y1AD 1LD9A 1MJUH 1EJ6A 4TN9A 2IQAA 3F7VB 3TIDB 5IGXH 2Z4QA 4I2XA 5FUZH 3BUYA 1JGVH 3GMNA 5ALBH 4E42B 5I6XC 4RDQG 4PYHA 1RURH 5KZCD 4YE4H 3QEQD 3ZTJG 5ICZA 4D3CH 4CGTA 1UXWB 1ZVSA 3L3DB 2J88H 3ULSA 2WINA 5BO1L 2F53D 3EYSH 4CMMB 3NZ8A 4Y89A 2HJFB 2R2HA 3I2CL 4U0QB 4XPFH 4Y4FA 2CLRA 2OBGA 5C3LD 2H32H 4L9LB 3TT3L 2V2TA 1XT5A 2EDRA 5GGSA 1DLFH 4CL7A 1ZLVH 3VFWB 4APQA 4CMHC 1EA9C 1OB1B 3VFVB 1MWAL 4G6FB 2VXVL 1WZ1H 3T77A 1WUNT 3WXVL 2XZQH 4S1RH 5DT1L 4P9HH 5EUOE 4HZLA 4Q97A 5EZOL 4ZUWB 4GAGL 1M1SA 4AIXA 1BBDL 3N0PB 4TRPL 2CK2A 4ZPVB 2C1PB 2HWZH 1D9KB 1I85A 3DSFH 3HG1B 2BFVL 3IF1B 4XAKD 1C8PA 1FN4B 3ARPA 1K8DA 4U1KA 4NHUA 1EXUB 3EOBA 3ULVD 1NAMB 2ENSA 4NQEA 1E28A 2FEEL 1AQKL 1FZJB 2BDNL 4JG1H 3KPQA 4BQ8A 1YQ2A 1UKQA 4OCNC 3T0EE 4XCFH 4JB9H 1KYOJ 2GEEA 4Q2ZA 2OK0L 1R3IL 2A6DA 1OWRM 1T66D 1URLA 1TCMA 1FRGH 4WCYH 4HKBB 4MCZA 3KPNA 3GSNA 4KZEL 3O8XB 2HLFD 5JW3H 1IKNC 4G8GB 4LNRA 3AMKA 3CU7A 3IDJB 2PR4L 4NRXA 3FQUB 4LLAA 5TDOA 1WFTA 4Q6IC 1J0IA 2V9TA 3RL2B 2IPTL 5TF0A 3WJLC 3N1MC 3ARFC 4LEXH 3D69A 4JO4L 1TJIL 4N0UA 3MNWB 3M17B 2OL3A 5HHOB 2Z0BA 35C8H 3QXWA 1AE6L 3MREA 2EDBA 4IOIB 3L1OL 4ODUB 4IS6A 2HTLC 2VDRH 2YS4A 3DETD 3MRPB 4LSTL 3RBGA 1PYWA 3GKZA 2NMSA 5GGQL 3RVXC 4UDTB 1QFWM 1HH9B 2XN9E 4PBVC 5MI0B 1NCDH 1HHHA 1EMTL 4CUCA 1IEBB 3BIKB 4ODVH 4JFFD 3QEQE 4PRIE 2CKNA 3ZKQD 3BDBA 5FECA 5IB5B 4XCNB 4B53A 4D0CA 3TJEL 1CLZH 2NX5E 2BNRE 5EU3B 1U58A 5CAYB 3O3EB 4POZC 4TULH 4JQIL 5IEKB 1JNHA 5FA4B 1I1AC 1JRHI 1T6VN 2ITCB 4A6YH 3X3FL 4M8VA 2W1NA 3G5VB 3PE9A 3PWPB 1FP5A 5F88B 5L0QB 1G9ML 2EDLA 5CGYC 3BO8A 1BF2A 4CN1A 4NNXB 1FO0A 3ILPA 3U9PL 2UYLA 4RMWA 4U1JB 1OPGL 3BGMB 2ZSWB 3B8YA 4OZIA 1QSEA 5DDHA 5I18H 4L3EE 3HUJB 4GW1A 5L2KE 3QI9A 1JWUA 3SKUD 4G6KH 2HRPH 1PEZA 2F8OA 1A64A 3H9SE 1GOFA 4OLWH 1GGCH 2LFGA 3JVGC 3Q1SL 2ZG3A 3OZ9L 1XZ0B 1VADA 3HZKA 1C7SA 1QFUL 5HGDA 3OKKA 5D96B 1L0XA 5LXGL 4MB4A 3W0WA 1IC5H 2IBZY 3U1SH 4WI7A 1NEZA 4GUPA 3TBYB 5IJVA 2J6EA 4G6ML 4KY1H 1EHNA 2EZ0D 3ULUF 4AJ0A 1A6UL 5HGHA 3T0ED 3C09B 3VD7A 3KPNB 4QY8A 3D85D 4S11A 3WN5B 4QRQA 1G7IB 3DV4B 4KWUA 2UZIL 4HD9A 1VKXA 4KRPB 1ZLSL 4W6WB 4KVCL 4ZUVA 4PJ8B 2X4NB 1HI6B 2HKHH 4AL8H 3BKMH 1ZANH 4PRHA 3P0YH 4Y19E 2B4CL 4R7NA 4KI5C 5EBMA 2EDYA 4RGMC 1YPZB 2IAND 4FQQA 3IB4A 3NIDF 2DQGL 1OAZH 3ARGC 2JIXB 1IEAB 3WFZA 1CBVL 3IDMB 3WO4B 4M3JA 4OZGF 3AU1A 3OKNB 3IDGA 1F6AB 3QIWA 2ICEB 4MJ5B 2CQVA 4OGYL 3QEUA 1Q0YH 2GSGB 5CINL 2YD5A 1RZ7H 3QQ9D 4LASH 2AK4E 4XNQA 1C5BL 3D5OF 2A6IA 7FABL 4GKSA 43C9B 2AS5M 2IC2A 1PY4A 3V6OC 4QHLB 3BPCA 1S9WB 2VXVH 3BN9D 3IKCB 2YXFA 5EZLA 4CNIB 4FQLL 4YAQB 5F9OL 4YHML 3K8MA 3GMLA 3C5JA 3TFKC 4MX7A 4DZBA 1F90L 4X7FC 5EBGA 2XFXB 5C0EB 3B4NA 1NGQH 2YPVH 5ACZA 1GIGL 3FQXA 5DEGB 1BMGA 3QEQB 1OW0A 3HE7A 5D71H 3MZTA 5T33L 4MNQA 3P40A 1NAKH 4LDEB 2DLFH 5JXEC 1OCWH 5J13C 1B0WA 1A14L 4KAQL 3O3BA 1QO3B 3C8DA 4K7PL 4J3XA 4YZFE 1O0VA 2UYLB 1R24B 3X12B 3PABB 1MQKH 3ZYJA 4X4XA 3QJFB 4Z78A 4K7PY 1CLCA 2FO4B 4LCUB 1NBQA 2EDQA 5C6WH 3HLAA 2GJ6D 4M48H 1W2KT 5BV7C 3EYUH 1UZ8A 3SGEH 3QRGL 4Y8DC 2W9LA 4PLJC 4BQ6A 4WFGD 3VXMD 2K9UA 3RNQB 1F45A 2DI8A 3WLBB 2CDGB 1JRHH 3WDJA 5IB3B 1MQKL 2PN5A 4K3JL 3TF7C 3E2HC 4NKIL 4I9WE 3WKML 3VGDA 4QHUA 2MHAB 1ZTXL 1X5XA 1OAQH 1I3RB 4ZO8A 1AGBB 1WFOA 2ZG1A 3FB8A 4LF3A 4GAJH 3H42H 4MDJA 3R0NA 4QRPD 4Y7MA 1MFDL 1AKJD 2VR5A 1G7IA 3DV4A 1JGEB 3BGMA 1NLDH 1UH2A 3BDYL 1U3JA 1G6RH 5FDWA 4OCXH 4JFDE 4M4RA 4S1DD 4HJJL 4Y4HD 1OW0C 1JGDA 3HE7C 3SDCB 4Z8FL 1AR1D 3MRIB 3BEWA 3OKLB 2ZNXA 3OB0K 5E6ID 3UC0H 2X05A 5D7LE 4QRSA 4HC1A 3MO1B 3SGDI 4OD1H 5C0JB 2OK0H 5HYSA 3T65A 2WBJA 4KVNL 4PPTA 3AM8A 1RZ8B 4W6YB 4CW1B 3SPVA 1YN7A 4LAJH 5IMLA 1CG9A 5EBWA 4NCC1 2DIJA 3KPSD 1JUFB 1MUJA 4FQ1H 4EUPA 3JV0A 4IDJH 4C83B 1SY6H 4KJPC 4LCYB 2VC2H 1FIGL 3SDAB 4RQQA 2FECL 5I16B 4XBGA 4ZUUA 5KSBF 3P2TA 1RUAL 3HMXA 3WS6A 4RAUA 1N4XL 1S9VB 4Y4HA 3WE6B 3U0TA 3WUZA 2V7HA 5D70H 1YEGH 4WW2A 3CFBB 1RZGA 4HK3J 3V5DB 1MFEH 3W9DB 4H1LA 2NY5H 1IZJA 1ZA3B 5DJ8B 1DN2A 1S7XB 3AVEA 1KT2A 2P8LA 1I8KA 1JNLL 4LU5H 5I1IH 3CFDA 5D2NE 1QBAA 2FWOA 5CZXD 3LSOB 3QXUA 4OLXL 1F42A 1A7QL 1YEHH 4MS8D 4BH8A 2A0LD 2ARWA 5J0BA 2Y07L 1WC7B 4CADA 1MAMH 1BPVA 5ID1B 4HJJH 5HHOA 4GKZB 4MA8L 3MJ6A 3OKDB 4LCCB 3DXAE 3I75A 3PJSB 1A6PA 3AY4C 4PJXE 4PJCE 4CVUA 3HRZA 4K7FA 2ZCHL 1BQHG 5DJYA 1JGVL 2VXSL 4NO0D 2MTPA 5B38A 1FFPA 3DTXB 2VLKE 3K74B 3PWNA 4HGMA 4FNLL 5CEYA 5HI5C 43CAB 4GLRH 1KPUB 2OR7A 1OF2B 2BVQA 1AXTL 4Z7UF 1JPGB 5GRVK 4PJFE 3PWVA 3MRDB 5CUSH 3G6AA 5F3HB 2Z35A 3B9KC 3Q6FB 4Q0XH 3MBED 4KPHL 3AAZB 3SQBA 1ZT7B 1KFAL 3GJFA 3FO9B 2E7BA 2XY2A 4N8PA 1E4KA 3U83A 2AV7A 1H5BB 2ZOKB 3L6FB 5IKCB 5INDB 4JFDD 1EH9A 1XGPA 3AXLA 3CH1B 3AMLA 5T5FH 2ZUWA 2W92A 4PJ9A 3QIUD 3B8SA 4WEBH 5CEZE 5BZDA 4XPGL 3MXVH 1KEGL 4F7PA 4HUUB 2JCCF 3GSUA 4MX7B 4PRPD 5KZCB 4NFCA 4XC1H 2NY2C 3MA9L 4Y5XB 2BNRB 5IMOB 2UUDK 3EO9H 2YUZA 4PG9B 3DO7B 1QHPA 3MGTB 3B83A 3OAYH 1OSZA 1FYTA 1NGYA 3L9RB 3U36B 3WL9A 2FIKB 2P45B 3Q3GB 1P9MA 3UTTD 1DL7H 4ODVL 4XPHL 1F4HA 1NGXB 1MRDL 3MA7B 3TBYA 4Y4HB 2ZCKL 1ZK9A 2IGFH 5KW9H 3UAJC 4F7TA 2HLAB 4ZFOL 2AAVA 3O11A 1J0ZA 2FBJH 3G5XB 5TF1H 2HMIC 4IHOB 1L7TL 5ESVB 3S88H 1U6AH 1RJLA 7FABH 1YA5A 5FCUH 2VQ1B 3PDDA 5DURD 4BELD 3C6LA 3P30H 1UH4A 3MC0A 2OR9H 3R0MA 1VKXB 1EEYB 4DN4H 4JANB 1U3ZA 5H37H 1EGJA 4QLRA 5JORB 1WGOA 3E3QE 3GSRA 1KOAA 5HYFA 1GGIL 4NWTH 3MRJB 4BM7A 2VXUL 5K9OA 1IGCL 4NN5B 1CICA 4XPBL 2I9LA 4WHTB 3RKDD 2BX5A 3I6KA 2Q6WB 3LKSB 4UBDD 2N4IA 5C0BE 3RFZC 4YHPA 4Z7OF 5ICYB 1P4LB 1IC7H 3WE6A 1T20A 5A16A 4S1RL 3PV7A 1AD9B 4O4YH 2C3HA 1SJHB 5SX5H 1NMBH 5EBLA 1UJ3C 3C2AH 4ONFH 3EHBD 1J05B 4AT6A 3U7AA 2A73B 5I71C 4JFQA 4HUMB 4G6AC 3FOLA 2PW2B 3SE3C 3MACL 2EDNA 3MRMA 3B9AA 3MROA 5F9WB 3WSQL 2G75A 1DQLL 2CR6A 1MHCA 4GAJL 4PJFB 1FIEA 4YGVA 1ZLSH 4P9HC 5F97E 1A7NH 2J6EH 3QFDB 1I9JH 4YDVA 2MMXA 2IMNA 4PLNC 1F58H 4OSUL 1V7ML 1KEMH 4YX2H 1Z0NA 3SQOH 4IMKA 5C6PB 2BVOB 2P42B 5IQ9A 1QSFD 1IQWH 2OX5A 3P4OA 1SY6A 1B6UA 4XP9L 2IPUG 3MV8E 3O4OB 3WNKA 1JPTH 3QDMB 2H2PC 5A2JH 3EDDA 4YDJB 4FXGB 4YBHA 5HYQA 1EHLL 4LLYB 3TH2T 3MUY1 2B20A 4R97C 5MEQA 5HY9B 3GJFK 3NH7H 2X7LA 3GBMH 3ILQC 4LL9A 3SQOL 2DLHA 5IW6B 4KV5E 4DGIH 1NBYA 3O3AB 1P84J 3O6FB 3DIFB 3GI8H 3MGOA 3VXRE 5JHDB 3JUZA 4R3SA 4H0GA 4MJIB 2WUCL 3N1QC 2EE3A 2AEPH 3REVB 1MCWW 2YPVL 5KANG 5HGAA 4YPJA 5E5RB 1EO7A 1BFVH 1QQDB 2AI0H 5I1AB 2PO6C 3U30C 4OLZL 4D0DA 2VIRB 5FEBA 3S34H 3JZ7A 3ZTNH 1B0RA 3OAZK 1VB9A 2HT4C 4TVPE 2EYRB 2X5PA 2R1XA 2NLJB 4BZ1H 3VFOA 1J0YA 4H0HB 5DD0H 4HAFA 4GG6F 4W4NA 5FM8A 4PJDA 5F89A 2APXA 1OSZB 1GZPA 4NPYB 4AG4H 1YYLL 3DMMA 1FC1A 4L4VA 4YGAB 1N8ZA 1QBLL 4Y5YC 4F7CB 1TFHA 4ZYKA 5I15L 2UWEF 5J11B 3UZEA 3T3ME 5I0ZA 3B9KB 1TVHB 1A4JA 4IOFC 3NPZB 2ZNWA 4ZTOL 3RZCB 1KXQE 2PYEB 3BD4A 3QXAB 3DVGB 4YUEH 5D1XA 2H3NB 4JRWA 2E3VA 4P46D 1INQA 1SQ2N 4S1QL 3WIIL 4XAWL 2EEBA 3WUWB 4OLXH 4M3KB 5CZVL 3F6LA 1II4E 5CJ8A 2VXTH 1K4DA 3MRRB 1EGJH 2Z4QB 4CVXA 4DOHE 5F6IB 5DHXB 3S37L 5IOPB 5D7SH 4L8CA 5FK9B 3FT4B 4WU7B 3IGAB 3PGDA 5DQJA 3LMJH 1FG2B 2LE9A 2J5LC 1N5YL 1IC5L 2M2DA 4ACPA 1YEEH 2WSKA 5BCAA 5TE6H 1X7QB 4G5ZH 1T1WB 1T20B 4YIQA 5A16B 1U8QB 4QWWD 1WBYA 2FIRT 3O41B 2BSRB 4XAWH 4Z95H 5CHNB 4BUGA 4IRSA 2DLEA 2VR9A 1WFUA 4G7YH 4Y1AE 3HRPA 4U7KA 4AIZA 3FFCE 5H35A 2EEDA 1BBJA 4GG6A 1G84A 4OZFA 3B6SA 3ZDXF 1DQMH 1IZKA 3MBXL 2AGJH 3OR7A 4NQCE 1MFAL 3PUCA 4NP4H 3H42L 3VDAA 2BSSB 3KS0H 3K4DA 2CO6B 1P7QA 1IGFL 4KKBD 3I6LE 5FGCB 5MHSD 2NXZC 4RRPG 1NGWB 1PKQE 2ZKHL 3TWCH 4L3CB 2HFEB 1OP3H 5GQBA 4H26B 5GS0D 3KWWA 1CLZL 3HS0B 3MUGB 3IDUA 1RULL 5E6IA 1YNTB 5SWZB 3BIKA 1DUZB 3VXSD 1CFNA 1INDL 5INCA 5GXBB 1XR8B 5GGRA 2OP4L 1WEJL 1YEFL 3QPQD 2QHLA 4NFDA 4ZSOB 5FKAB 2P5EE 4X6BA 3GMPB 3ZKSD 4WU5A 3CX5J 1ZXQA 1GGYA 4N0YL 4UDUB 4NKDB 3ARFD 3CFEA 3L3IB 3BWUC 5JPNA 2A1WH 1T2QL 4LSVH 5B39B 3HPLA 1MCFA 1FZMA 1TJIH 4Q6IA 4U6YA 1OP9A 3C08H 3IS0X 4HXAH 1A1MB 3WSQH 4F9LC 1DBJL 5E5MA 4M6AA 2NXYB 3EUUA 3O3EA 3QUYA 3DUUA 1D6EB 1U8JB 4L8SA 4GS7B 3IDNB 2G9HA 4L5FH 1DZBA 4M5ZL 5D7JC 4KJYA 4X6DA 2CK0H 4XNMB 4PG2A 1B4JL 2EDKA 2PYEE 1BJ1H 1JYNA 4Y4KC 5FK9A 3RY5A 2BMKA 1T04B 3RWEA 5F7DA 2AABH 4AENA 1TITA 1MWAA 1PX4A 1WSST 2EXWD 3HZYA 1KLFA 2YPLD 3OJMB 5EOTB 4U1GC 3D0LA 1Q1JH 2XRAH 2ZCLL 3O6ML 3C6LB 3PGCB 5DSCA 2XXCB 1JGLH 5BRZA 3TVMB 1U8IB 3WS3A 3FZUD 4MVBC 1UEMA 1TJHL 1K8DB 1QPPA 4U1KB 5L6YL 1HH6A 1FPTH 4FQ2L 4WUUD 1ZSDA 3D39B 5C2UB 3L3JA 4Y4KA 5JHDA 3HA0A 1XF4A 4HK3N 5DUML 3Q3GA 4JM4H 1OSPL 3PHOB 1D5BB 2NY5C 3PG2A 4ONHB 3TPUB 4TUKH 4YHYC 2ICWB 2FX8H 3UTSE 5L9DH 4QHNA 1ZLVK 5FGSA 5JHLH 5C08D 1WBXA 3MRFA 1B0RB 3UTZA 3O3BB 4CJ1A 2H26B 2YSSB 3GRWH 1JPSL 1UXSA 3THMH 4X6CA 2AEWA 1FO0L 1FPTL 3I6LD 4FQ2H 3RX5A 4NOBA 4HC1L 5I17A 2KPNA 1FGNH 1I1YB 3JWDC 3KG5A 2QTEA 4NDMB 4PJFF 3ARBD 1TVHA 4ONOA 4Z7NF 4HT1L 2RFXB 2VDLH 1JV5B 1ZGLB 2AXHA 5E1HB 4HQQL 7CGTA 1FL5B 4JFHE 4KRPC 5FO8A 3SEPA 1LO4L 2OI9C 5TJWK 4KRMB 2AQ3A 3CDFA 1GOGA 4OZFG 4DKDC 1TPXC 1JZ7A 2JK5A 3UJTL 1K5NB 3V5HA 5HHVL 2Y1VA 2JCCA 4IMLA 4U1MB 3FQRA 2AJXL 3ZTNL 4EN3B 5EBLB 4XWOD 3VDBA 3I9GL 4EOWL 3TO4D 5LAXA 4PRDA 5C08A 2R8SH 2QADD 4D8PB 1A6TB 1QUNA 3ZE1E 4WDIB 4LLUB 3K7UA 3RWHA 3DSNA 5DK2A 4L8BA 3PDOA 1WJ3A 4IIQC 4DWHA 2EE2A 3C5SB 4HX1A 1A1OA 1OAKH 3T0AA 1WFNA 5C8JA 3RVXD 1A1NB 4LNVA 1ZTXH 5HPOA 2VABB 3Q5OA 3V6OA 2BXZA 2VWEC 5GRXG 1PEWA 4X6BB 4JFDB 2DF3A 1J86A 1CDIA 3RWEB 1KPVB 1UJ3A 3FB6A 3U30B 3BO8B 1OTSD 3SPVB 4EOWH 5DJCB 4LF3B 1FVCB 1LEKB 5DJXB 3QT2A 3ESVF 1EHXA 3RL1A 2L4OA 4X7TA 3VXOB 2APFA 3BH9B 2ATPB 2X4RB 3EGSA 5K9JH 3LKOA 3LKPB 3D18B 3GSWA 2HRLA 3TPKA 3DUUB 1A6VL 4NC1E 4JO1L 2QHRH 2B0SL 3WIHA 4DKEL 2RR3A 3NFPA 3C5ZC 4LHUG 4P3DA 4GSDH 3WJJA 5LCVH 1RZ7L 5AZ2L 4FZEL 3QPXL 1D5IH 5DGQA 3RBSA 5J9PB 2C4XA 1TZIB 5DI8A 3GSNB 1Q9LA 3UTPE 3V2AR 5GSVA 4HBCL 4XCCL 4FXLA 4X7EC 4V2CB 1OTUC 4HHAA 2CIKB 3E6FB 4HZAA 5IVNA 3CLEL 3BP7A 1TCRA 3VFGH 4IRZL 1FL6A 3S5LA 4U1SB 2F74A 1VGEL 3ZSTA 5JORA 2VWEE 4XVJH 5D1XD 5GGRB 3PF2A 2Y07H 2VSCA 2VDOH 4LKXA 2F9BT 2NTSP 4JR9L 3BE1L 3M17A 3MNWA 4NYLB 3GUTB 1GVIA 2P49B 4WWKB 2KKQA 1G7JB 3QUXA 5DWUL 5M94B 4LBEA 2MPAH 4ZAKB 1R3KA 1MFNA 1QVOB 4KQ4H 2J8UF 1F4XL 2X4UA 3QFJD 3OXSB 1IEBA 5CCKL 1PLGL 4W68A 4QHNB 2VJXA 4P2QD 1J8HE 2A6IB 4LLVB 1FG9C 4P4KB 2EDOA 2BVQB 4FMFA 4QKXB 1NUDA 2VDOL 2GJ6E 4KI5D 4YXLH 2R1YB 4OCYL 1VFMA 4FQ1L 3T09A 4XMKL 2VDNH 5LGJB 4JREB 4JPVL 1KTDA