4YDJB

Crystal structure of broadly and potently neutralizing antibody 44-vrc13.01 in complex with hiv-1 clade ae strain 93th057 gp120
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
205
structure length
205
Chain Sequence
QSALTQPASVSGSPGQSINISCAGRSDRVSWYQQRPNGVPKLLMFDVYRRPSGVSDRFSGSHSGDTAFLTISGLQTEDEADYYCTSHPYAFGAGTKVNVLRQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Repertoire of HIV-1-Neutralizing Antibodies Targeting the CD4 Supersite in 14 Donors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system
molecule keywords Envelope glycoprotein gp160,Envelope glycoprotein gp160
total genus 40
structure length 205
sequence length 205
chains with identical sequence L
ec nomenclature
pdb deposition date 2015-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ydjB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ydjB02
2DB8A 1Y6KR 4JLRB 4XCFH 3VFWA 1MCOH 1P4IL 4TUJB 1A0QH 4POZD 2A83B 1CL7H 1UWXK 3AXLA 1HEZB 3UJJH 4NRXB 3B9KC 4YGVA 3R06B 4H26A 4OLXH 5ADOH 2D4FA 1YMHA 3GRWL 5JMRA 2R2BB 2VITA 4I3RH 2G75B 5IQ7L 3VFPA 5IK3B 1MSPA 3OR7A 5IESL 4OV5A 1F13A 1GPOH 3SE9H 3D25A 3FQWB 4K9EH 5HGDB 5CD5C 4XXDB 5IJKA 4R9HA 4GFTB 3MCKA 3UTTA 4XAWL 4S1QL 3GSVB 1UH4A 3MBEC 1E6JL 2ADIB 2EDTA 3A67L 5JO5A 4PJEB 4IM8A 3DYOA 4PJHE 3DSFH 5FA4A 4JN2B 1JGUL 5D2NC 5CINL 4OCYL 4N5ED 2Z4QA 1ZT7A 2Z35B 2FIRT 1S3KH 1ZHBA 5CJQH 2AEIT 3ELAT 4ZO8A 2H2PD 3E6FA 4OI8A 2UWEF 1KN4H 1S7VA 2BSSB 1ZHNA 3NZHL 4ZS6D 3DYMA 1IAIM 3QYCA 4LASL 4F9PC 3C5ZC 4HBCH 5IF0A 3KLAA 2R1WB 2C3VA 4M8VA 4P59H 2EDRA 4RMRA 5CSZB 5DI8A 4Z18A 1SMAA 4P9HH 1KCVH 3T04D 1VEMA 4BH7A 2VZ3A 1E6JH 4N8VG 1MCNA 1SJEA 3O4OB 2AV1B 2FRGP 4LBEA 3UPRB 1MFDL 1JZ3A 2DYPB 4WI6A 5K9KA 2FDBP 1QPPA 4MMZC 4D0DA 1TXKA 2P5WA 3UZVB 3B9AA 1RZGB 4NQEA 2CKBA 4O58L 4MAYA 4J2XA 4AT6A 5D1XD 4ZXBC 4FQIL 4LPYA 3SJVA 5EB9A 4Y5XA 1OAUH 4AENB 4P2CG 5B38A 4MCYB 4MQ7A 2PW1B 1R5IB 3FMGL 4PYHA 2VIRA 4JO2H 3T77B 1ITCA 5HGAB 3I9GL 2X1QA 1EAPB 4UB0L 1PZ5A 4FFWD 4HHAB 2F53A 3MLXH 4S0SD 2EC9U 3DGGA 2YZ8A 1HN1A 5T33L 3REVB 2J8UA 3TZVA 1ND0B 3LH2H 4PLKC 3QPXH 2BNRB 5INCA 1J10A 3B2UC 4LAJH 4ZPTA 3ZE1E 3MA7B 4F7TB 4K7PH 4Q9QL 1KGCD 2B5IB 5F7DA 4L8DA 4N90E 3SCMA 4NJ9L 1EHLL 1CFVL 2EH7H 2MMXA 2WP3O 1YY8A 3QCTL 4KKLD 4LDEB 5IMMA 3DRQA 4JGUA 1GAFL 4U3XA 5E0QA 2Q7NA 4YC2C 1G6RA 1B0GB 4HKZA 4PJ9D 4I18C 4AH2B 1O7VA 1QSEB 4NKQB 1Q0XH 1F00I 5E03A 1T89A 3DJ9A 3HR5B 5ANMB 3AVEA 3BJLA 1D5XB 4F15C 1S9YA 1XR9A 5EZOH 1T3FA 2X4SA 3KJ6L 5FO7A 4BJLA 3ALXA 4KQ3H 5LAXA 3QIBC 3RY5A 5HHVL 1OAQL 4Q9BA 1A1NB 1A3QA 1MRCL 2CXGA 1Z9SA 4IMKA 1JGVH 2R0KL 1AO7B 1WT5A 4ZO7A 5ESQB 1QHPA 1LDSA 1A5FH 1XFPA 1KT2B 1AKJB 5DT1L 3MRDA 2CPCA 2YUWA 2XA8H 5AAWA 5IROC 3H8NA 1ZHKA 2N4IA 3BVNA 4KJPC 4D0BA 1A6AA 3LMJH 2AI0H 4WTWA 1P53A 3IFPA 1X44A 3HE7C 5J6HB 4U7SA 5ICZA 3QDAA 4UQ3A 3PV6A 1U3YA 5IHLB 1U58A 4J1UB 3KYMA 2NW2B 4D9QD 1BIIB 1F6AB 4N0UA 2CDEA 3CSBA 3TJHD 3VFTA 3JWOH 4PJAB 4GKZB 5FKAA 2OQJA 3FONB 5DD6A 1CGSL 3QUYA 1CICC 2OI9B 4DFHA 1Y0LA 2P7TB 1AH1A 1MLBA 2AI0L 2R0ZH 3G6AB 1N8ZA 3WS3A 4PGJA 1ONQB 1OLZA 1ED3B 3IB4A 5C0GB 2LVCA 5I75C 2YPKA 4P2OC 4E41E 1HXYA 3S88H 5GZND 2R0LL 3BDXA 5BO1H 4YK4C 4NFBA 3QHFL 5I17A 1ZOXA 2L7JA 2XTJE 4L4TA 3U0PA 1TVDA 5I2IA 2XTLA 5C3TA 2XIDA 1A9EB 4JO3L 3B6SA 2XZQL 1F6AA 2AVGA 1L7TL 5B22A 4MVBD 4MNQE 1DBBH 4GAGL 4N5EC 1N4XH 5EBLB 4ZSOE 1KCRL 1G6RL 4G6ML 3PGDA 4NNYB 2R39A 1AR1D 3NOIA 2EYSB 1NCAH 4MNHB 4PRID 3IS0X 3ZYIA 4HKJA 3H9HA 4U0RB 4QOKA 4O2CA 1RUQH 1IKFH 1GGBL 1IGML 2JCCB 3R1GH 4JR9L 5CD5D 4L4VB 3FHQA 5CJOH 5CCKL 4HDIA 2HAZA 3MLZH 4I4WB 5IW1A 4ZXBB 1NGPH 1OD7A 1B9ZA 4QRPB 4Z7OE 1FL5A 4EOWH 4TOYL 3BESR 2KUTA 3V5DA 3RWJB 1I8MB 4MA1B 4ZOEA 4FHBD 4FXLA 3OB0H 5KOMC 4AIZB 4NZRH 3QUML 3WL9B 4YXLH 4OLYL 4MNGA 4KJQD 2NPLX 5IMLB 4WI8A 1YYMH 3QPQC 5DQ9B 1OP3H 2MNUA 2J5LC 3MBEB 2PETA 3AM8A 4LPTA 1T20B 5DJ0A 4YPJA 1T83C 2VKXA 3TYFA 4P2OB 1N0XH 3MSPA 3VD5A 1K8IA 2COQA 1FL5B 2ORBL 4QTHA 3G5VB 2HJLA 5DD0L 3HZVB 2DQFA 4DEPC 1E4WH 1NGWB 4ZPTB 5FA3A 1OPGL 1EJ6A 1S7QA 1BVKA 2QSCL 3QIWC 5DK2B 3RX5A 2XKSA 4R4FL 2D7OA 3UJIL 3I75A 3TA3A 1XMWA 2PKDA 3V2AR 1DBAH 1GGUA 3RTQB 5BZWA 2AJ3B 1W0VB 1LD9A 4F7CB 4BA8A 4JRYB 1SJEB 3L3JB 1IAII 5E4IA 5LVEA 3UDWA 5HYJA 3IETB 3SE4C 1I3VA 2D7MA 5BV7B 4LHUD 5MEPB 1XIWC 3RPIA 3QHZH 5BRZA 3PWJA 5JDJA 1Q9LA 4FXGA 3SKMB 1XF4A 2CMRH 2KQNA 5DT1H 4K3DL 3EYVB 4LGRB 3GSXA 4TSCH 3FRUB 3BKYL 4IOIA 3CSGA 1UJ3B 2N56A 3NCMA 3D3VB 4XNMB 4U1IA 5SWZD 3NFNA 1MCRA 1IC4H 4MLIA 2GJ6D 2F54B 1RJLA 3A0OA 4O2FB 5KG9A 2IC2A 2F74A 3F6IA 3ZT5A 3VW3L 1NUFA 4ZAKB 2AABH 4Y1AB 1UJ3A 3MOAL 4JFYB 1ZLVK 4J4PD 5IVZB 4LSVL 4NUJA 1RJYA 3TFKD 1R3HA 5E7BA 1Z5LA 4NO5B 4PJAE 1FJ1B 1I3RA 5I74B 3MA7A 3U2SA 3L5IA 5A43C 3BDYH 3TCXA 2UZYB 1P7QB 4V1DA 4LVNB 3P77A 4I9WD 2DLFH 1NH6A 2MHAA 1ZLUK 3D2UA 2ZOKA 4RMUA 4GRMB 5DSCB 3U9UB 4KI1A 1J05A 4IRJC 5DRXB 1JN6B 5I1IL 3V5KA 1KB5B 1W72A 1JWUA 4KROB 4NO0A 4OQ1A 3BUTA 1KB5H 1YN6B 5J11B 4CBPA 4H88H 1MHCB 4I8DA 4Q6IC 3TJHC 4N0FA 3F7VA 5FOBA 4KK5D 4GRMA 5EOQH 4ODSH 3G5XA 4X9HA 1G7HB 5C0IB 3S34H 1F3JA 1HH6B 4V1DD 5D2LA 5DURD 1A1NA 4K8RD 1XGUA 3F7QA 3WFEL 4FQQB 4MQXD 4PY7B 1YEKH 3W82A 3CFEA 1CLOH 4LLAA 1HQ4A 3LDBC 3VXTA 3WFDH 3MGOA 1OSZA 2YBRA 4HGKC 1I9JH 1KC5L 2OJEA 5CJXA 4JHAL 2FYYB 1KG0A 1P5VA 2HYMA 4UUJB 2C9AA 2GY7B 1KXTB 3FOMA 2YKLL 2PF6A 2X4PB 1SEBA 1U8JB 3GI8L 1A7RL 1FE8H 3H3PL 3SDCD 1CICA 3F7YA 2YN3A 1U41A 4JEGB 3GB7A 3QHFH 1IEAB 3Q1SL 5CBEA 5B8CC 2QR0B 4LASH 4OZIA 5C08D 1J1OH 3JWNC 2XWBB 4NP4H 2RAMA 1BVZA 5MEQB 3R8BB 1QBAA 3L5JA 3UPAA 1RULH 5BVJA 4H0IA 4E42A 1NL0L 4MNQD 2VDMH 3O3AA 5J1AB 4OZFG 1KIUA 4CU8A 3TBVA 3TWCH 4MD4A 4D0CA 2ZOLA 1V7NL 4O02L 4PV8B 3FHAA 4HFUL 2ZG1A 1JHLL 1OQOA 2AK4B 2VQ1A 3BE1H 1RUAH 2A73A 2G75A 4LHJB 1I8LC 2CJUH 3RDTB 1J1OL 2BMKB 4NP4L 5E9DB 4IMKC 5ENWB 1BOGA 2VZ1A 4DK6A 3BGFB 3UTSD 2CO6B 5MP6H 4QXWA 3K3QA 3K8MA 3KLDA 1A6ZB 5GS3A 5ACZB 4CVZA 4GAJH 5FM8A 3SE3A 4PLJD 1N64H 4K94C 2H9GB 4OLYH 5IVOA 1G7JB 3MLUH 3NPZB 1ZHLA 4CVUA 2LAGB 2GCYA 2R2HA 43CAA 3OZ9H 1CI5A 4GRWE 4I18A 4XCYB 3VFRB 5I1JL 4M93B 3BXNA 5DD6B 3PGCA 2AJVL 2GTWA 3SE8H 3U6RA 4L4TE 2PN5A 1WBZB 3EHBC 4OLEA 4KZDH 3SY0A 3LKRA 2VXVH 3PP3K 1QLRA 1ZTXL 4NZRL 3ZYZA 1S7UA 1T1ZB 1U8HA 4GRLD 3FN9A 3CDFA 2ADIA 3PWLB 1E0OB 2IPTL 4LGSB 4YJZL 1T4KA 1BQHB 1ZWIB 4IIQC 4CKVX 1QFWH 4PJBE 3ZTJG 2IH3B 5GGRA 4YZFE 4PGCA 3MV9E 4ZAKC 4TSBL 5KAQG 5ALCL 4Y16C 5T33H 5KANG 2CRIA 7FABH 1U91B 1H3PL 3V4UL 3QB7C 3WSQL 4WFFD 3C6LD 1B0WA 4NM8H 3U36A 5D7IF 4GG8A 2HRPL 4OZFB 4HW6A 3U4BL 4UTAH 5EBLA 1EHAA 3MRCB 4ZXBA 1ZTXH 2B4CL 4R26L 1NGYB 4MAYC 5DJXB 3FZUD 3MV11 3FFCD 1F4XL 1NAMH 3DO7A 3KLHD 4K71B 1U8MB 4UB0H 3ARGC 1TPXC 1CXEA 4XPAL 2ARJQ 3WLBB 2OP4L 1MRFL 1RAMA 3CFDA 1OAXH 3DV6B 1AHWA 2B1HL 3WUWA 4JN1L 4PB9H 5CIPB 5H35B 1RU9L 3OR6A 1MWAL 1IC4L 3SDXE 1MCDA 1NDGA 4G9FD 5GRJH 3C5ZA 4KQ3L 2NY5H 1P5UA 5DJ2A 4DJMA 1OAZH 1UKQA 4ODVL 5E6IA 1IGIH 4XPFH 3F58H 3UTZA 1U8OB 1XGPA 2R23A 1HHIA 4P57B 1YPZA 1P1ZB 3T0EA 5CFHA 2E9JA 1NUNB 5IWLC 2A6DA 4P2QA 3TVMC 3CLFH 1H0DA 4H5SA 3X13B 5F96L 1I9JL 5INCB 3FN0L 1A6VL 4PRIA 2BSTB 3VXUD 2DLHA 1I7ZA 4F7TA 1I1AB 2XTJD 3N1GC 4UZGA 4PJXF 2NW3B 3CZJA 4MNGE 1ORSA 4L5FH 5SX5K 2ARJB 3FN0H 5E2JA 3O4LA 4MJ6B 3EJZD 4AG4L 4PRDA 1M71A 5HGHB 3U82B 1BJ1H 5JXAL 5KSBB 5FYJH 4GXVH 4IDJH 2XXMB 1MFCL 1VSCA 1X5KA 4Y5XB 3EW3B 1IGIL 5HSFA 2VLLA 4J6RL 5BRZB 2FBOJ 3B9KA 3X3FH 1IL1A 3MNZA 4WVRA 4BFIA 4Z7VE 4U1KA 1ZAGA 1UWGL 4HK0B 4PJGF 4M7JL 3GBMH 3IFLL 1CTOA 1NAKL 1MCSA 3O11B 1MFBH 3F5WB 5E95B 4QXGH 5DJDB 3GSQB 3D1MC 1J0YA 3EYOA 2HJKB 5C08A 3H42L 5HI5D 4HUKB 1VERA 2M1KA 4BH7B 2FEDC 4GG6A 2NY2D 1QBBA 4YDIL 5C8JA 4TNWK 4M4PA 2DDQH 3H6JA 3QNYB 1L7IH 5FYJL 1FNAA 3P4LA 1B0GA 4HKZB 4DTGL 1ACYL 4HG4J 5ALBL 1FORL 1T3FB 4OZGF 5F8QC 3MC0A 3MUY1 3QEQE 1VADB 1QBMH 2AP2A 1FGVH 25C8L 1S9YB 5L0QC 3F5WA 5HYSA 4WUKH 5DEGB 2EKJA 4MDIB 4OD1L 4YE4H 5DEFA 2AXGB 3T8XA 2F53D 5KVMC 4KMTH 1GZPA 4QY8B 1RPQA 4XPBH 3FO1B 1R5VA 2G5BB 4HBQA 2DLGA 2R1YA 5DJ8A 5TDPA 4NQSB 4WU7B 3UJIH 1S78C 3QNYA 5C0FA 3GKWL 1OPGH 1NEUA 5HHQA 2IQ9H 2LV4A 3LEXA 3SCMD 5DK3A 1SYSA 5FYKH 1LO5B 2BY3A 1X5GA 5C2BL 1OVZA 2Q6WB 1AE6L 3O3DB 1UYWH 5DJAA 2YPLE 4EVNA 4N90D 4M5YH 3HMXH 2DL9A 2ZJSH 4N8VB 1XGYL 3H9HB 2R4RH 4P3DB 2FYYA 5FUCE 1QSEE 3CX5K 4FQJL 1I8KB 1CGXA 1NCCL 4C83B 2ZJSL 4KJYA 3GI8H 4OSUH 4FQQA 1H5BC 3MRNB 4D9RD 1P4IH 3JXAA 3FO9B 3LQZA 1D6VH 2W59A 3MRDB 2NQCA 2VRAA 5E8PB 2E9BA 1KV3A 4OGAD 1BECA 5IVXE 2DQHL 3GKWH 4FQHA 1RFDH 1NC4A 2BJML 1E28A 4ODHH 4FFVD 3W39A 5GRUH 3MA9H 3WUWG 4HG4K 4YO0B 3HI5H 5DO2D 1UWEH 2NY3B 5LCVL 4PJFE 5E2UL 3U9PL 4HLZH 4HWZB 2UWEB 4WW2F 1DANU 2H26B 5GJSL 3RVTC 1V7ML 1IM3A 1AD0B 3SKOA 2OZ4H 4GBXA 3JV4A 1UQSB 4U6VH 1UXSB 4ODVH 4DUXA 4Z7VA 1T22B 1YNTA 5HGDA 4ERSL 4XBPB 4M3KB 4Y4KB 2W0KA 3B5TA 4PV9A 1HSAB 1R3IL 3QXAA 3ARTA 3H9SE 4NDMA 4HWNA 4Z7QE 3NTCL 5EDXA 3ZHLA 3LKQB 4XMKL 2P8LB 3LKRB 3VFOA 5I8CB 4R4BB 5SV3A 3L7EA 4HUVB 5FCUH 4WW2C 4X5XB 5J9PA 3S7GA 2GK2A 2P5WD 3GDBA 5D7IB 1R3JB 1H0DB 1IQWH 5CMAA 1JHTA 2V5YA 2LU7A 2VXSH 1J11A 3HNVH 1G7JA 1XZ0A 4HUXB 4F7MB 2O61B 4L9LA 5GQBA 1CDGA 4XP4L 2CRYA 4RIRB 3N06B 4ZOCA 3U4AA 5IHBA 4XBGB 3NIDE 1YEGH 3E0GA 4M6AA 1Q9LB 4FXGB 5EBMA 2GTWB 3RZCA 3RL2B 5KVEH 3PGFL 4OUOA 4OIIL 3FQTB 3PP3H 1M6OA 4TUJA 4P46C 5DA4A 2DOCA 3QUKA 5ICXB 1NANI 5KVEL 1T7WA 4XMPL 5EO1A 4OBSA 4OI9A 1Q0YH 4UQ2A 4OFYA 4HLZG 1KJ2A 4HXAL 3RA7H 3WN5B 3S37L 1OT2A 4RGOL 3VWKB 1A7NL 4P23C 2A9ML 4GRLB 3O2DL 4UOW0 4OZHA 4ZUUB 4HJJH 3HG1A 1G0XA 1F02I 2DQJL 4LLMB 3QHTC 3U7WL 1IT9H 3MRHA 4JN2A 4GG8B 1OSPL 3HB3D 3DETD 3O6FB 4JO4H 3VRLE 1NCNA 1I1RA 3PDOA 4OKDA 1U95B 3A67H 5TQ0H 1YNTB 4IHOA 1ES0B 4G6JL 4LLMA 3GSUA 4PRNB 1RSFA 3D69B 3KAAA 5F3BA 4HMCA 5H2BB 5E2WL 4OV5B 4UV4H 2ID5A 3MV9A 2ZCKH 4KJQC 1FNEB 1U95A 5FDWB 2HT2C 1GGTA 1IM9B 1XH3A 1FZMB 3WE6B 1NAMB 3RWDA 3LQAC 1UZ8B 4UU9A 4XPAH 2A6JA 2AJUH 4P5TD 2H1PL 5AUMA 4BQBA 1KCUL 2XNAA 3BHBB 4LPUA 2CKBH 5D2LB 4PG9B 4YIQA 5I1EH 5E6IB 1A9BB 4U6HB 2DM4A 5JIPA 5FUOL 4AT6B 5FB8B 1L9MA 1UEMA 2BNQD 5GRVK 5LGHH 4XBGA 4XAWH 3VXRA 5B39G 3P40A 2VLME 1BF2A 4NOFA 5HGBB 2VIRB 3MYZA 2I5YH 4X6DB 4UUJA 3WIFA 4KKCC 5EOCL 3B8SA 3DSFL 4GW1A 4Y4FD 5FYJE 2FIKA 1RIHH 1S5IL 4LDLB 5JOPE 1W72H 4PY7A 5CSZA 2MHAB 4JFHD 4K7FB 3OJDB 4MX7A 1D5MB 1H8SA 5EUOE 3G6JA 4WGWB 4HWEH 5C0BD 3WNOA 4YEFA 5HI5C 2YD2A 1QA9B 5DRWA 3O3EB 1KYOJ 4RMTA 2Y72A 5I1CL 4WFED 3PQYB 4NPYA 5E70A 3MRHB 2DMBA 3LDBB 3LPWA 3P4OB 4UI2A 2DQGH 3VXUE 5BOZG 5DHYA 3CC5A 4KJWD 1HHHB 1NFDB 4ODTL 1AXTL 1FVCB 3GBNH 3N85L 4G8GA 1WV7T 5C0EA 4S1SL 3MRBB 4IS6A 4JFXB 4UTAL 4OCSL 2AK4E 4GKNA 2OZ4L 1JUFB 3VXSE 4XB8A 5FYLL 3V52L 3TBYA 4WWKC 3ALPA 4QHKI 3WNMA 3IVKA 1P7QA 5T3ZL 2PTTA 1J1XH 3DWTA 5CEXB 4GW4A 2A74B 5HI3C 1OHQA 2W07A 5D8JL 2L4OA 2BSED 3DX7A 5CP7A 3LEVH 4YPGB 3VFVA 4UTBH 3UJTH 2JJWA 1Q1JL 1T22A 1FNFA 4OTXL 4MA8L 4LLUA 3QRGH 4HIHB 3MLPA 1DBJH 1JCKA 3UC0H 1N6VA 1HHKA 2PXYC 1RZKH 5EN2A 4L3CA 5EU6B 5ID0A 2AQ3A 5JQHC 4PJ8B 1P7KB 1UACL 2WWMC 3QJFA 2VLRD 2WBJB 3GSNL 4KPHL 3ILQD 2X4OA 1MUJA 3IXAB 5F7LB 1ZLVH 3BPNC 4HZLB 2W0PA 5FYKE 4DCQA 5A16B 4ZUVB 3T2QA 4YUEH 5DK0B 3M17A 3JUZA 3MRFB 3PP4L 4R0LA 5I9QB 4KJYB 3JUYA 1FAKT 5HPMA 4R4ND 2DIJA 4G6FD 3EHBD 3MOQA 5FIEA 2AGJH 4QHNA 4XPGL 3OHXB 4XP6L 3WYRA 4XVJL 5F3HA 4HPOL 4M7ZC 1AGFB 4UV7H 1BIIA 5EZOL 3CXHJ 4XI5C 1CF8H 2P8PB 1JZ4A 5JW5B 4FA8A 5T1MB 5BOPA 1WWAX 1RUPH 1YQVL 4P5TA 1C16B 4Y89A 1WWBX 1BX2A 3GUTB 4GH7B 3DV4B 2DN7A 2AW2A 5AAMA 4Z7WF 3PL6A 1KPVB 1U58B 1EDQA 4LSUH 2B7DT 4MZ2A 3VFSB 2HG5B 3O6LL 4LSTH 5J57B 4WRLA 5B3JE 1S9VB 2XG5A 1OAZL 5I30L 4HEME 4JFFB 4LKXA 4XNUH 3ZTJH 3T3ME 2PXYB 3V6OA 5AEAA 4ONOA 3FQXA 2A77H 4O2CB 3CCHB 2NY0B 4QXUH 5D96C 5T3XH 3BZ4B 3NACH 1KCUH 3NZ8B 1L0YA 4R2GD 1L7IL 1NFIB 1SYVA 3Q48A 2OXGA 1WEJL 5CAYB 1DEEB 1OTSD 2HT4D 4GKSB 5D7JD 5KSVB 3CVIL 4J7RA 3UTQB 3OAZH 2R0WH 3MJ9L 2FZ3B 1FL6A 3WJLA 1DUYB 4G6KL 4L4VA 5HHOA 4Z7VF 3RVVD 2NNAA 4MDJA 3MJ9H 3WNPA 1A9EA 4HMEA 1CDCA 4OLVL 5GS1A 5J7CC 4JRWA 1A0QL 4IBLT 5DRZA 1FDLL 1H3VA 5T3ZE 4QOKD 4LCYA 2IFGA 4NBZB 5M95B 5H37H 5T5NF 3O4LB 5JHDD 3RVWD 2P5ED 3O6MH 1YECL 1FYTE 2QL1A 3KHQA 3BPOB 2C7UB 1XGTB 3I02B 2IQ9L 4NQDA 4P5MB 2R56L 4HIJA 5BRZE 1X5YA 1A4KB 3KJ4C 3F6LA 1JPGB 3B6SB 3I2CH 4HUMB 4AL8H 2XQBL 3ALWA 4NZJA 5FFLA 1S7RB 5DJZB 1JNLH 4MJ6A 4NKDB 4JJ5A 1IC1A 3VRIB 4LQFH 2CK2A 5HGHA 3QCUH 4LSQH 3O8XD 1LQSR 3BGFC 25C8H 2D7TH 2X42A 4LCYB 4M62H 5AG8A 2DYPA 3PGFH 4MD5A 5HD8D 2HVKB 3HC4H 3FOLB 1G7IA 1DQLH 2Z31B 4TNVK 2NZ9D 4U1KB 3PWPA 1P6AB 2VUOA 1DVFD 2A6KB 4QRPA 1Z0MA 1PVHA 1U8MA 2HLFC 1DQLL 2VLKD 4LFHD 3DIFB 3PNWA 1YN7A 4P0DA 1AKJA 4PJBA 4EI6A 3ZKXB 4M7KH 1JMXA 5JW4N 4L29A 4LP5A 3A6BH 5FF6A 1LEGB 2I07B 2WIIB 4LSPH 3SBWC 5H35A 3C6LA 1I85C 1NC4D 2GW5A 1HIML 3IFOB 3KYOA 4KMTL 4MDJB 3X3GH 1OTUD 2YPVH 4A2LA 4EI6B 3HAEG 4PRHD 1WAAA 4P46A 3P73B 3OKEB 3G9AB 5BRZD 3GBLA 2Z91A 2A6KA 5HI3D 4L8CB 3B9KB 1EFXD 3CNKA 5F1SA 4ELMB 3T0VA 5DQDH 4R7NB 3ZTNL 1F4HA 2AEPL 3CDYA 4L9LC 4JFFD 3MLVL 4UTBL 3H9SA 1PLGL 2APBA 5FYKD 1UM6L 2DJSA 2WBKA 4LF3A 1YZZA 1ETZA 3Q5TA 3QAZC 2CKBL 5I1EL 3LN5B 4WW2A 5DHVB 1HHHA 4KK6D 3VRJB 3A6CL 4YBHA 5DZLA 1I1FA 1I1AA 3LKNA 1TJHL 4S2SB 2XKUA 5DMKA 5EU5A 4WGVB 3CXHK 2R4SL 5CHNB 1TCMA 4PJ5E 3EGSB 3G6JE 4GAJL 1DANT 5F7EL 5DEFB 3RIAF 3UTTE 2R4SH 1TPXB 2DD8L 4IRJB 3PL6D 2VXTL 5ITFB 4HK3J 3RWCA 1DUZB 3ZKSD 4YHYB 1NMBL 5C09D 2HVJA 3BN9C 3AREC 4Y4HD 5BMFL 1T0NA 5HHPB 4HHAA 4JCLA 3DMMB 3VXSD 1BVLB 4NQEE 4OQTA 1VB9A 1LWRA 3LKOA 2I27N 4KFZC 5EU6A 4AEIL 2E27L 2BSRB 5CJ8A 4HS8H 4ZO9A 3ULVL 1KEGH 4EIGB 1QFHA 3ISWA 5MENB 2DQIH 5JPMA 4BK4A 1H3WM 4WWID 3MLWL 2QEJA 4KUZH 3ZE2F 1KFAL 1NSNH 2J1KA 5TDNA 4L4TB 3U0PB 4K3JL 1MAMH 2D31B 5C0BE 4WNQB 4HUUB 4BUHA 4K3JH 4GKNB 4TSBH 4FQLH 1LO3H 4PRPB 2V6HA 4CNIB 3P3YA 5BVJB 2YD7A 1JNJA 4NN6B 1VA9A 4I0PA 1H15A 2ED9A 3RWGA 5BW7C 4WY7H 1YEDB 2CXKA 5FO8A 4IRZL 1LGVA 1MELA 3FO0L 2QQNH 4UMGA 2HN7A 2NLJB 5E8NB 4XT1C 3B9EA 3EOYG 1G6VK 1S5HA 3PHQB 1HINL 3HA0A 4QRRE 5CSBA 3CGTA 2K7PA 3M17B 3H0TB 2F58H 3FO0H 3QSKB 4KTEH 2DM7A 1CE1L 1TDQA 3HS0B 3B9VA 4JDVB 3VXPB 3EDEA 5KZCB 2B4CH 1OAQH 3DBXB 1N59B 3KNBA 5CEZE 1XR8A 1G9ML 2EYTA 2FBJH 3B3IB 1DQJB 5F6IB 1IZJA 4UQ2B 3CH1B 1PDKA 2ZSWB 3B5GA 3VG9B 1YA5A 4ELKB 3FCTB 1W72L 4PJIB 3GSRB 5SX4H 2Y7QB 1FFNB 2BY0A 5D1XC 3V0AC 3V9FA 3QBTB 3MBXH 1FZJB 1T0PB 2V9QA 5J9PB 5JORA 4P4RA 4LCIL 2P5EE 1T7ZA 1A47A 5IFAH 4DVRL 4R2GB 1IFHL 5DS8B 5C9KA 2HT2D 5EORL 4E41D 4MXQC 1IGYB 4PD4J 3W5NA 4QKXB 1AKJD 1CE6B 5LBSH 4F9LA 5MI0C 2OTWA 4PGBB 4ODUB 5J13C 1UFUA 2CR6A 1RUQL 3EO1B 1XGRB 3ZKNC 1QVOA 2DF3A 3V5HA 1G9MH 3OKNB 4KY1H 3V52H 3LD8C 4JDTH 2BDNH 3JV4B 2ZSWA 4IRSA 1FIGL 3L7FA 5DDHA 4LAQH 5J4MA 4D9LH 4P23D 4UDTB 4PJHB 1QSFA 4PRPA 3MV7A 1J8HE 3IJHB 2BVEA 5HBBA 5AWNL 2CIIA 4JG1L 4AMKL 2X7LB 2QQKH 4K7PX 3DXAA 3QISA 3MODL 3L6FA 1YPZF 3CLEL 4M1DL 4O4YH 5JXED 1UQSA 2NZ9C 4OZGA 4IOFD 3C8DA 5DMJB 3RPIB 4Y16B 2UZIL 2V17L 6CGTA 3BE1L 1KJ2B 1YMME 5EZJB 3KPLA 1KJ2H 1CGVA 4P2OD 1GC1L 4DZ8A 1S5IH 3O4OC 3WKML 1DN2A 3BZDA 3D2UD 4NHCL 3HZMB 1H8OA 1ZLWK 3B3IA 5I1DA 2HKFL 3WDIA 2BK8A 3HRPA 3TVMA 3C5SB 4MCZB 1QHOA 3RZCB 3T0EC 3FJTA 3AAZB 2RIKA 4KXZH 1H3TA 3C09C 2VDQH 5E6IC 1FBIL 2OCFD 2MCPL 1XGUB 4U4BA 2YD6A 5HHOD 2G9HB 4XMLH 3MFFA 2LQRA 3BOVA 4WO4D 4AIOA 2DI8A 4Y19A 2UZIH 2V17H 2AEQL 5D6CB 1QSVA 5GRXG 1U9KA 3GMPB 3T3PF 1LD9B 3G04A 2H6PB 2KZWA 2W91A 4HKXA 4XC1L 5J1TC 4I13B 1CL7I 3T09A 4BSWA 1OAYL 4XP1H 5JA9A 3MQIA 3D87B 1C08A 5IF0B 4N9OB 2O5ZH 4CN1A 2X1XR 3D6GA 5JDSB 5HVHC 4KJWC 1AJ7L 4GG6F 3BZFA 4PG9A 2K3TA 4O9HL 3EO9L 4TPRH 2UYLA 4KROD 2BNUA 5IM7A 3GO1H 2EDWA 4KRPD 3KPRA 5IQ7H 4NCC1 1VEPA 4G8FB 4RISL 3MJ8B 1JUFA 2ZUUA 5H2BA 1ZA3A 4UQ3B 4MB3A 3MLTA 1OGTA 3MXVH 2X4TA 2JJTC 2GSGA 4QHMB 4XNUL 5KJRL 4MJ4A 4ZAKA 4J3TA 4OZGB 4QGTA 1QR1A 3J7HA 2EE3A 2IH1B 3NCFB 1CZ8L 3MJ7B 3WFZA 5KSAC 4G9FE 1TETL 4HXBH 4PTUB 3IFOA 4HUUA 1NFDE 1UCBL 2E9WA 3PDDA 5MEOB 4MQSB 3TNNB 3MMEA 5JTWA 3BSZL 2IBBA 5GS0H 1LP9A 3OKEA 3L3OA 1GOHA 4M48H 3OB0K 1D5ZB 4QRPE 4LPVA 4TVSa 3GHBH 4JZJA 5GRWA 3SKMA 4C59B 2ICCA 3D3VD 3X3GL 3L3DB 3RRQA 5I18H 2LTQB 2AKRB 3SPVB 5DRNA 4HQQH 5T1LD 2FIKB 1T1XA 1WWWX 3ARVA 4XP4H 1DUZA 1CU4L 5IEHA 3UTPD 5AZ2L 1RZ7L 3LHPL 4JKMA 2V9RA 1CK0H 1DFBL 5SV4A 5HHOE 4JFZL 4PJ8C 3QWOA 4LU5H 4KTDH 1ETZB 4PJDE 3DX9B 5EU7E 5DJ6B 2PYEB 2R8SL 2EYTB 2BVUA 5DD5H 3CVHL 3BPCB 1D9KA 1R24B 3RAJH 2XXCB 3LEYL 4JRYD 5DLML 5E00B 1I8LA 2XZAH 5F9WC 1YN7B 3TO4C 4PUBL 2FX9L 4O58H 5IMMB 3BKJL 3KPPA 2ZSVA 4I3GA 1KPRA 1WC7B 3AC0A 5HI4C 2AXJA 1YMMD 5EO0A 1U3HC 1ONQA 3S6CA 2D7TL 2J2ZA 4I5BA 1TFHA 5C9JA 2DQDH 4RFEA 5I66A 1HYSC 5E99L 3WNKA 1I1AD 3JZ7A 1CFTA 4QT5A 1I3GH 4LRNL 4Z0BL 4ONGH 5M7QA 1PZ5B 5DJ6A 2RFXB 4JQVA 1FG2B 2P7TA 3UZEA 3BVNB 4KU1A 4P2YA 4BSVB 5F88A 1V05A 4QRQB 3H2WA 4LSSL 4QHNB 1EXUB 1OB1A 3HR6A 1R6VA 4WEUD 2CKNA 2FZ3A 1X5JA 5ICZB 4TN9A 4R90H 3K2UH 5I8EB 3S37X 2Y36H 2EYSA 3UAJD 5D7LD 3DURB 2P1YA 3NZ8A 5IJVB 2ICWB 4PY8I 5EC2A 2LTQC 3HUJB 5CJXC 3LD8B 4YEEA 4HIEA 2Y07L 4EEEA 3O3BB 4OF0A 1FL6B 3T2NH 3S9DB 2X4NA 5IW6B 3QI9C 3SDDB 5E08L 1N2RA 2EDBA 2FLBT 1FP5A 3QUMB 3QIUA 3TN0B 1LO4L 3INUL 4AM0A 5JXEA 1TCRB 3EJYD 3LIZH 4OKVB 4Y2OA 3OTTA 3U36B 1F90L 5CEYA 5IV2A 5FGCB 3SDDA 1EIBA 4UT6L 1T7VA 4BELD 1U8PA 1XGTA 3I02A 4P5MA 5D70H 5IB1B 1BFOA 4J12A 2X4UA 3RWIB 5HI4D 5JQ6L 4LDOB 5ADPL 3HFML 1KENL 1S7RA 2YEZA 4N8PA 4UINL 5F1IB 1VGEH 5J89A 5L88L 4AIZA 1S78D 1ZEAL 1D7FA 4Y5YB 4F9LC 1B0RA 4PREB 4MS8C 2OXHA 2Y23A 3ULUE 3QUZB 5MERA 5D72H 3LKPA 1TJGL 4YDJB 3WKNA 3JVGA 1KJVB 3IYLW 1PX3A 3FFCE 2XT1B 2AJUL 5L2KB 1IEHA 4N9GA 4KUCD 2CDEB 3M1BA 4LSPL 4MAYB 2E8ZA 1U8OA 1XGPB 3BRFA 4KZDL 3HAEH 4XVTH 4JVUA 1TQCB 1RFDL 4G7VL 4R97C 5LQBL 3H7BB 5HHXH 2C1PB 2B1AL 2FO1A 1YEHH 1FNLA 3PQYD 1CN4A 4GLRI 3OPZH 3MV9D 1E6OH 4JB9L 5KSVA 1NGYA 2GITA 4QRUA 3PP4H 4BKLA 2EIZA 5D7KD 1GC1C 3CPLA 4FXKB 3AAZA 5EIQA 4OD3L 3TIDB 5KSBA 1QQDA 2JJSA 1QTYT 1PLGH 4YDVB 4LBEB 3EJJX 4Y4FB 3KWWA 4GT7A 1JYVA 5C0RL 2NY6D 5IGXH 5JUEH 4P5KB 2XWJB 5DYOB 4CMMA 5TE6L 3ZE1F 4JO4L 2Q8BH 4AH2A 1OLLA 2AERT 3SOBH 3T0BA 4I0PC 3CFIC 3MV7D 1TQBB 1D6VL 1KBGH 4TQEH 4RFOH 1ZLWH 3FB8A 3QIWA 2NXYD 3MPCA 5I16A 4NBYB 4X6EA 3SO3C 2DWDA 3TV3H 3MLWH 1ZWIA 3MRCA 4HEPG 3R1GL 1HWGB 2ESVA 3L5WB 3UO1H 2E6JA 5GHWH 3V8OA 3KYAA 3HN3A 1YDPA 4QYOA 4CVXA 1QFUL 3FT2A 5A2FA 4PLJC 4TVPE 4ALAL 2E7HA 1M05A 3O6KH 5JO5B 1J88A 1KJ3H 2YWZA 2MKWA 3B2UD 1FYHB 4KQ4L 1W0WB 4GQPH 4M3JA 3QEUB 2R69L 1YYML 1TTGA 3DGGB 1SBSH 5GZOD 1CK0L 1QFWM 3JV6A 2KH2B 4MB4A 5F7YC 1JNNL 2GAZB 3S96A 4KVCL 5HHNB 1U93A 5GSRA 9CGTA 4WW1A 1CT8A 3OXSA 5EWIH 5FCUL 4E5XB 4M9PA 2BVOB 4Z7WA 3DRTB 1I1YA 2O26U 1CVRA 4RGMB 1UM5L 2ZOLB 4IDJL 1KLFA 1CQYA 1D5MA 4CJ1A 3NVQA 2F9BT 2X9WA 3K4AA 3NAAH 4QXUL 4HWEL 4DKEH 3VXSB 43C9A 2Y4SA 5FV1L 4M8QB 2P4AB 4ETQB 2DTSA 4YLQT 4EDWH 4HC1A 3B9DA 3MV9B 1FVCA 5M94B 1U2HA 1YJDH 3BMVA 3UAJC 3Q6GL 4MJIA 4P2RA 2V7HB 5E56A 2YPLA 3CFKA 5LAXB 4WHDA 1DQQA 1I3RB 3QIUD 3LIZL 3BIKB 3U9PH 2FJHA 3H3KA 1S7VB 2A74A 4NZDA 3V6ZB 2YHGA 5C09A 4Y8DC 3DX7B 1U8JA 3QT2A 2ATKA 4YGAB 5JW4M 1A14L 1V5JA 4ZAKD 1RZFH 2X1OA 4NN7B 3OKMA 1MCBA 2IQAA 4FP8L 2CK0L 5EA0L 1MFAH 5JPMB 4U6TA 1YNKL 4QHKJ 4M7LH 5LXGH 1RK1B 4OFKA 3GNMH 3PQYA 4NPYB 1P2CB 2SEBA 4Q6YA 1Q38A 2FGZA 1G7LB 3SBWA 1YY8B 1BEYH 1KYOK 3NACL 1OSZB 1UWGH 1PYWA 1MHHA 4KK6C 5TQ2L 4M6OH 4OI7A 1NFDA 5IB4A 2Y07H 1UT9A 4ZS7H 4WTZG 4BFGA 1X5HA 4P4RB 1FYTD 2VZVA 4G6FB 4FQHB 4OB5L 3UYRH 2CLZA 3RI5K 2WLZA 2FJHB 2P46B 4MYWB 3OJ2C 1A2YB 4L3EB 4MD0B 5FK9B 4ZNEE 1CICB 1ZK9A 2HLAA 4H8WH 4L1HA 3VD3A 1TVHA 1U93B 1EAPA 4FQPA 2YD9A 3IDXL 2ADFL 4CRPA 2PW2B 1G1CA 5IBLD 1I8KA 3N1PC 4OZGE 3RTQD 4RAVB 5EZLB 4QF1B 2DQDL 1A2YA 4MD0A 4JFQA 4PJ7A 3GSOB 3K2MC 4NJAL 5FYKU 2HVJB 1CG9B 1YEJL 3S35H 3V6BR 3HS0A 1M7IA 5IROA 3VXSA 43C9B 1HHKB 4YR6A 1BBJA 4X9BA 2JE8A 3VXMB 2W9DL 3O2DA 4JGMA 3ARFC 3HRZA 4OCSH 1U6AH 2HRLA 4EUPB 5SWSE 1EK3A 5J06A 5FHAH 4V2BA 3WHE1 3V7AG 4HV8A 4NUGL 5K9OA 2B0SH 3CZFA 4QLRA 4OLXL 4Z95H 4X4MA 1YEEL 4WCYL 3RNQB 3QI9B 3DARA 3BP6B 4C58B 2FB4L 4L9DA 2X4UB 4KAQH 3OKMB 1ZANH 3QCVL 1CE6A 3RUGF 2MSPA 2LU4A 3QA3A 3T2NL 1WAAF 4K2UL 1OWRM 1TJGH 4NC2B 5FV2A 5IB5B 5C3LD 3MNVA 1F5WA 2YOCA 4XH2B 5IVXF 1M6OB 2G60H 5DZNA 4JY4A 4FABL 2OMNA 2HMID 5F71A 1EUTA 1U6AL 1RHFA 4YHNA 5D7KE 1C1EH 1N0LA 2GUOA 4P4KB 1MJ8H 3GHEL 3QULB 3QNZB 5DFWH 5BJTB 1KIRA 5IW6A 5K9JL 1ZGLM 4YWGH 3V6OC 3QQ9D 3BT2L 2VXVL 5FXCH 5KVFL 2J8UE 2DQUH 3QDJD 1WBXA 5D5MF 3MLXL 3TWCL 1DN0A 1N59A 1I8IB 5IBLC 1X5AA 2PW2A 5DVLA 4TSAH 1JYNA 1HE7A 3EYFB 2YR3A 3C9NA 5A3IC 1U2CA 1QPXA 2EICA 2YUXA 1EEYA 3MXVL 4NKIH 4F3FB 5CKGA 4ZTPH 4S1DD 4NUJB 1NC2B 3QUYB 2NY0D 4K3GA 4MXWH 4HUWA 5HYQB 3ZHKA 4AIXA 2X44D 2RCSH 4JRYA 3AREB 3EYSL 3FO2A 1A3LL 4ZO6A 4OIBA 2EYRB 2X09A 1DBML 3FB6B 4WJ5A 5D2LF 4TUKH 3NCYP 4F7EA 5DTFA 1RVFH 4TULH 4BQ8A 4MNGB 1FNEA 2C26A 4GMSL 2IBZX 2EECA 5D9SB 2CUIA 1JF1A 1N5AB 1W0YT 4K3DH 4PJAF 2X41A 4HPYL 1BJ1J 1R3JA 4BFBD 2RBLA 1R3IH 3CZFB 5BS0A 5HXMA 3VRIA 5IVXA 4G8EA 3QO1A 2BZDA 5EOCJ 3QHZL 5E5RB 4I77H 4XPGH 3Q6FA 2YA2A 4NKIL 1E4KA 1ZT1A 4NO3A 4MAYD 1N5YL 3C5JA 3CMOL 3I6LE 4ENED 5I8KH 3LQAL 2ICES 2YD4A 1R3LB 2JELH 3Q2CA 2NXYB 3CFBB 4OQTH 5TJWK 4ZUWA 1IT9L 1AR2A 3MBEA 3MRJB 1CR9H 4YDLB 3O2VL 1IM9D 5D93C 1RIVH 3F58L 3RWFA 3LKSA 1NMCB 1NJ9A 1J0HA 4OD3H 3P11L 1VKXA 5GRVL 3BP7A 5GS0D 4AL8L 4XNQB 1IBGL 1S7QB 1PEZA 2AKRA 4LRIA 3STZB 3HPJB 1A1MB 2NXZD 3B8YA 4G8GE 1YECH 4X4ME 5INDA 2D7QA 3WN5A 3EOTH 4W4OC 4KZEH 4ZFGH 4PTTA 1F4XH 1NAML 2VERN 3LSOB 5F6HI 5L2JB 2IPUG 4C83A 4F58H 1KLUB 4NM4L 3KYKL 3T1FB 3ZL4L 2EH8H 1FN4B 4XP5H 3D48R 3F65A 5EU6E 3ARPA 1P4BH 4YFLF 1W0WA 5EA0H 1QYGH 4C56E 4OZHF 4L29B 1T80A 5DHVA 5EOQL 3VRJA 5IB2A 1P4LB 5E4EC 3QR2A 2PO6C 4LSQL 4HJJL 3WO4C 4WU7A 1QFUH 1CIUA 1C5BL 2HFTA 4KC3B 3CSYB 3WFCL 1WUNT 3RQ3A 3FTGB 3QXTA 2HFEA 1FPTL 1BFVH 3CFJB 3P30H 3KPSA 3QUZD 2N1KA 3Q6FB 3LRGA 3UEZA 5A2JH 3V7MA 4EN3D 1INEL 3ULUL 1GZPB 4QY8A 1MCPL 3Q3GA 1V3JA 4M61A 1DLHA 3D9AL 1ZV5A 1KEML 1X5ZA 4KDTA 2DM2A 2HJFA 3IT8D 4J3OC 5FKPA 3CLFL 3IDXH 5ADPH 3QXDB 1ZANL 2GSIA 2FBJL 3JTTB 4XVUC 4JFDD 4HJGB 3C08H 1UM5H 3RHWF 5EH1A 4P9ML 3GBNL 3TBSA 4ODXB 2HH0L 2Z91B 3PWUA 1TCRA 5C1MB 1LMKA 3WUZA 3JWDC 4OGAC 5CUSL 1K4CA 2P45B 3BJ91 1KN2L 4YHKH 4UNVA 1VENA 4OLUH 4QHLB 5GGQH 2EDJA 4BSVA 2XRAL 1SJXA 4ODXA 5T3XL 5I2IB 3OAYK 1IEBA 1QSFD 3MLRH 4NZUL 2QSTA 2F5AH 2DRUA 5EU7C 5C0ND 3T2PA 4OGYL 1U0QA 5EU4A 3MLRL 2CR3A 5E9DD 4XWGH 1AGEA 3W81A 4RSVA 5GGRB 3MREB 4EVNB 4JZOB 1X4XA 1NKRA 2WBWB 4G7YL 4LEOB 1DVFA 2MPAL 8FABA 3UO1L 1KN2H 4YHKL 1FLRL 1HOCA 1KJVA 2MQCA 2Y9RT 1DLFH 4G42A 2VAAB 4KKBC 2YSSB 5DWUH 2ZUQB 2ITDB 5T5FH 3SKJH 3TZVB 3OKLB 4ZFOB 1SJHA 5I66B 5C0RH 1BWWA 2FD6L 2YPKB 5CGTA 4TTDC 1AI1H 2R56H 3SDCB 2NR6D 4HULB 3V4VL 1KPRB 1UG9A 4ZMAT 1LNUB 2RJMA 4PJ9B 1KUMA 3RVXD 3O9WB 4WUKL 2YSSA 2Q1EA 3LEVL 5JOFA 4PJ7B 2AK1H 1PD6A 2L7UA 1U8PB 2G60L 2OX5A 3FL7A 4FFVC 1K3IA 1ZLSL 1XAUA 4LEOA 5C0AB 3I6KB 5JA8B 1ZT4A 4XPHH 1WVZA 1RIUH 3AMLA 1B2WH 4H26B 4NQDB 1B90A 3LV3A 1NGZA 4RQQB 2BMKA 5DJ2B 3RX7A 4LLVB 1NBVL 3HLAA 4I9WE 1D6EB 1NCBH 4YXKL 1KTLA 2WUBL 2DLEA 3NCCB 1U92B 1UVQB 1NGXA 5AZEH 4ACPA 1ZKAA 4LCWB 2HFFA 4N0YL 4U0QB 3K81A 4JFDB 2O5ZL 3MRPB 4DW2H 1T1YA 1WEJH 2FB4H 2PYFB 4D9RE 1IAOB 1NBYA 3KNBB 2KL6A 2MWCA 3OHXA 5F1KC 3CVHA 2VUYA 2VLRA 1KGCE 3H9ZA 1F4YL 3U7YL 5F44A 3ARGD 4OCXL 4CGTA 2DLTA 1MRDH 1VPOH 4PJGB 4XNZB 4RX4A 4XNQA 1BQLL 4X98A 3FZUC 4K07A 5IVNA 3PL6B 2EH7L 4BZ2L 2E6QA 1EJOL 4QTIH 1T2QL 4JPWL 4C56D 3ARBB 5C2UB 1Q8MA 1RUPL 1S3KL 4NKOB 1MAJA 1AGCA 4RISH 1RJLB 4O2FA 3NABH 4LKCB 1CG9A 4NHUB 35C8L 4CDHA 4WI7A 1FV1A 1JF1B 1KPVA 2OJZH 5F9JA 3L5XL 5A2IH 4NGHL 1QVOB 2GTZB 4LSRL 3OGOE 4X6BB 5E2TL 5T3XE 3U1SL 4F57L 3HE7D 3EYFA 1P4LA 4NQEB 3GGWB 3J8F7 5L8JB 3TO4D 1DVFC 3KPQA 3QUKB 5FA4B 1MJJB 1H5BA 2RQ8A 1HSBB 4MQTB 1F58H 1T21B 2J8HA 2UUDK 2WIMA 2VITB 1NEZB 3RFZC 1R0AL 3WIFB 3HC4L 2X05A 4PRBB 1OSPH 4U1NA 4F7CA 3BQUD 5HGAA 4U0RC 3G04B 4GMSH 2FL5A 4E0RB 2AV1A 3C08L 4OFYD 1MIMH 2W9DH 1DUYA 3K2UL 2AEQH 2GYSA 4H20L 2EDHA 1WJ3A 4PJXA 3O3EA 2H2SC 3QWRD 1M1SA 3I6GB 2VWEC 5HDQH 4WEMB 5T1KA 3VXQA 2BCKA 3DX8B 5EUKA 1YNLL 3TPKA 3KYNB 1XF3A 1SVZA 3SDAA 1JPFA 1KNOB 3JSSA 3GSNA 4AEIH 1F2XK 1ZHBB 3OX8B 5E8OA 2PNDA 1UGNA 5T3ZH 1L6XA 1PKOA 3BHBA 3DGCR 5D1QD 4DGVH 1JBJA 2VABB 2P48B 1EFXB 2J8OA 3PABB 3O6ML 4J3XA 5F70A 4NZTL 1KJ2L 4TRPH 3U2SB 3CFCH 3RIAK 3DVIA 1D9KD 1RUMH 1BFVL 2V5MA 2ZCLL 3ILPB 1EHXA 4DKDC 1ZSDA 3ORJA 3UTPE 1J7VR 2F15A 1EFXA 4KI5D 3ARSA 3QUYD 1OWWA 3SGEH 3GSNB 4I3RL 5DC9B 3MV01 5BCAA 4WDIA 8CGTA 4JHAH 3MRLA 4LMQI 1MFNA 4GQ9L 1BPVA 1HHGB 4AZ8A 3VWKD 4NYLB 4IOIB 4R97B 1G0YR 4XPBL 4OCRH 4GMTL 1A6UH 1N64L 1MI5D 4QGYA 5GGSY 2O5XL 4PS4L 4HIIA 4PRBA 3QDGD 3ULUC 3CD4A 4E5XA 4W4OA 3WHE0 5T3ZD 4HWUA 2UV3A 4WHYH 2Q3ZA 1BM3L 3ULVC 4M1GL 5KS9F 4Q2ZA 2NX5D 4UT6H 2I5YL 4Z77B 3G6DH 1PYWB 1C1EL 2VDML 5T1LA 3VFUA 3QZWB 4QNPE 1B4JL 2OSLA 3VH8B 4P59L 1CT8B 1UM4L 3HKFA 4OD2B 4Z76A 2CDGB 2AV7A 2AAVA 4WI5A 3MA9L 4JDVA 4O02H 1KEGL 2ZUQC 2RHEA 3VXRB 4X6FB 1ED3A 4S10A 4X4XA 4K2UH 3S5LB 2IAMA 1KJMA 3ARYA 2IPKA 1KTLB 2K7QA 1FG9C 1XF1A 3NA9L 4H8WC 1UKSA 4XGZB 1OAKH 1NQBA 1NCUA 1V3MA 5IWLA 1MQKL 4U6XB 4ZUSA 5IGXL 4JFFE 3K74B 1BZ9B 1CVSC 1AXSA 2NY3D 2ZPKL 2VR9A 3BPLB 1E4KC 4YHZL 2F54A 1SEQH 1AQKH 1SHMA 1B3JA 5BO1L 5HHXL 4UNUA 5B39B 2EXYC 3O2WH 1DQQB 5I73B 3EYUH 1F11B 4KTDL 1I1FB 5IW1B 2Y25A 5FECB 3BD3A 3U4EA 3I3EA 1RVFL 4TULL 5A3ID 2H8PB 1MAML 4MWFA 2OP4H 35C8H 3VXRE 1AHWC 4YFEA 3RAJL 1NKOA 4TSAL 4R90L 1DQMH 2OJEB 3V5DB 3C8KB 1LO3L 1FFOA 1QD0A 3ARGA 3HZYA 4HH8A 4KVNH 3RIFK 1T04B 1IC5L 5IJVA 3TN0A 4NM8L 3MUGB 2JELL 2NXZB 2Z8VC 3MR9A 2VLKE 1IKFL 4NWTL 1F2QA 1NGZB 3BZ4A 3SN6N 2R1XA 2JIXB 4X7FC 1AGEB 3LMJL 3L3KB 2VTFA 1CLYL 2X70A 2OTUB 3QQ3B 3B43A 5DR5L 5FKPB 3O4LE 1NLBL 2AQ1A 3DVNB 4X5XA 3HC3L 1JK8B 4YQXL 1K5NA 3N1FC 4WHTB 1FPTH 4IIQA 3HPLB 1DQML 5F7UA 4U3HA 1X9QA 3TBTA 2NYYD 4IJ3B 3NFSL 1PAMA 2ZUWA 2QADC 2VDNH 32C2A 3P9WB 3T0EE 4LSRH 4UU9B 2R29L 1YUHA 5F1IA 3P4MB 3ZE2E 3RWEA 1PQZB 3L1OL 1KCSL 7CGTA 3O6KL 1ZA6B 1PKQA 4U6YA 3GJFB 3QEHB 5F9OL 5GSVB 5DR5H 3TNMA 3QUZA 2ADJA 1TLKA 3UBXI 1RZJL 2WANA 1HXYB 2EEAA 2BHYA 4D3CL 4WV1C 3HC3H 4U3CA 4HD9A 5CZVL 3SE3C 2BFVH 1SBBA 3N9GL 3IXTA 1FHGA 4APQD 5DEZA 1Q72H 3KDMA 2XWTA 3OKOB 3ET9F 5C0BA 4BM7A 1HOCB 2VLJD 3FQNB 3HB3C 2QLVB 2W0LA 3P30L 1NBZA 3ARFA 5GGSA 1LO2H 5I0DA 3T0ED 4N0CD 4YXHL 1DQTA 1W8NA 3L3DA 1FIEA 2D0FA 1TETH 3RVUD 1IGJB 2HMIC 2GJJA 4HIJB 1HDMB 4Z78B 3I2CL 5C0BB 4E9LA 3KPMB 4EI5C 2PYFA 4P23B 1I8IA 3KYOB 4F37K 4OZFH 4ODWA 4WFHD 2P5EB 5EBWA 2YRZA 5CILL 4U1NB 2E7LC 2R1XB 4LK4A 3BGAA 2RB8A 3QNZA 4JHWH 2AEWA 5DUBB 4XWOC 1YY9C 5I9QC 1ZGLA 3QG6B 2W0FA 2WINB 1I9IH 1ORQB 5B8CA 1HH9A 4X6BA 1BP3B 3S96B 1JI1A 3OGCB 1NBZB 3ARFB 3MMEB 5GGSB 2YXMA 3EDKA 5CEXA 1MF2L 4PJ7F 1FVDB 1GH7A 4FMFA 1ORSB 5GISH 4OCNC 2GT9A 5LXGL 1GIGH 3V4VH 4MDIA 3PGCB 5IVXB 1JGLH 1QSEA 4Q7DA 1BVKB 4AMKH 4KUCF 4MHHG 2Q86A 4X0KB 1PBYA 4KK8C 4CVXB 2OK0L 2XTJC 3FT3B 1RQ5A 3AS2A 2BVPA 1X6NA 4XC3L 3RDTD 4XCFL 3GIZL 3T0XA 3N0PB 1PEWA 1EFQA 1N3NB 2I9LB 5CJQL 2Y5TA 4ZODA 2PW1A 2DTML 3DVFA 2W0FB 3MV8A 1D9KB 5GZNC 5E99H 4G3YH 5KSBE 3FB8B 3QIWB 5DD1H 3MFFB 1BM3H 3WKMH 1NCAL 4R0LB 1A7PL 3P73A 3VXMD 3MRMB 4NFCA 4Q6IA 1VGEL 1KELH 1Y18A 5JHDB 4PJHF 2VR5A 5D71L 4B0MM 1JGLL 3BPCA 1QFWI 3O3BA 5JHLL 1J5OH 4X6CF 2V2WB 3DO7B 2CGRH 1A1MA 2NY4B 3RWCB 1OARL 3KXFE 2R1WA 2NY7L 2VE6A 1GOFA 5KVDL 1E4XI 2L0DA 2OR7A 1RUML 1E27B 3OZ9L 4X6DF 3SPVA 5A2LH 4ALAH 1UEYA 4K23H 1B6DA 4ENEC 5E1AB 5CP7B 2AJZA 1J86A 3TGXA 1UJ3C 4O9HH 3UPCA 1XR9B 1A4JB 1C12B 2PXYD 4HZAA 3TBWB 4LMQE 4RX4D 1AJ7H 3BZFB 4LNVA 2GSIB 3O41A 2WNGA 3VJ6B 3VGDA 5J1AA 4GRLC 5E8EB 5F7WC 3L5XH 4ONFL 1RZJC 1HWHB 3DVGA 2K9UA 1SJHB 4NQUA 5F21B 2LE9A 2GIYA 1KG0B 4CW1A 2ICEA 5K9OB 1T66D 5CD3B 3MGTA 5ELIA 5C07B 3FT3A 3MO1A 3P9LB 2EEDA 5ISZB 2WWKO 5GRUL 5CKAA 1U3JA 5IHUL 1H3GA 1BWMA 2HJFB 2HA1A 3SE4A 4APQC 1AGBA 1VGKB 3H9SD 3SDAD 3QEQA 2AXGA 2VZTA 4X7TA 3T8XB 4JFHE 4PJBF 3X14B 5F3HB 1PY4A 3BXNB 4PJDF 1K6QL 3AS1A 3GJFA 1VADA 5IT2H 3MGOB 5DRZB 2ATPB 3MACH 2Y6SC 1T1ZA 4GBXD 1K6QH 3IF1A 1FCGA 5FO9B 4XVSL 3BPLC 2DKSA 1C5CH 4HZLA 2JJSC 3EYSH 1NLDL 1GHFL 5D7LB 4NKMA 4XVTL 5F7FA 3TT3H 5BJTA 2DQJH 4MNQB 3BKYH 5C09E 1CLOL 2CUHA 1ZXQA 5IB4B 1FFNA 4ESKA 1RY7B 4XMKH 5T1KD 5FO9A 1NAKH 5FDYA 4NWUL 1XIWD 1F3DJ 1QLFA 4JRXE 4N1CA 3PHOB 4GSDL 4PJ5D 3MRBA 4IS6B 1QRND 3P9MA 1F6FB 1TNNA 5K59E 3RNQA 1KIPA 1NANH 5GGVH 5ACLA 3IDMA 4Q9QH 3BISA 2QKIA 5K9QI 3SDXB 3TCLA 4NQDD 3V4UH 1XGRA 3DXAB 1XCTA 1NUGA 3LKQA 3GKZA 3EJZC 1FO0B 5ALCH 5D70L 1Q72L 1RK0B 3KG5A 1FZKB 1HZHL 3BEWB 4OLVH 4PJHA 2ICEB 3QA3B 4PJDA 1DCLA 3VXMA 4GQ9H 5DUML 3HRZB 4MZ3A 1EO8H 5BV7H 1F3DH 5GGVL 1JGEA 4QF1A 1YEIL 4PGZA 1E4XH 3QXUA 4E0RA 3R4DA 3RTQC 4HJ0D 2V5SA 4LCCB 4MJID 5D4QA 5C0DA 5C6PB 5CBAB 4JKLA 4XNXH 4XXDA 3ZKQD 3QFDB 2J6EH 3KS0H 4Q97A 4HMDA 1NEZA 5ID1B 5T1KB 3VXQB 3RDTA 4HCRL 2XZQH 3IRZA 3WFEH 3KYKH 4GKSA 3LN9A 3I75B 5JXEC 3QIUC 2R69H 4ZDHB 3MROA 5E08H 4KTEL 1HEZA 4QRRD 3TVMB 3DVNA 4OBRA 4OJFL 2J88H 2Q76B 5HGBA 4YFDB 3RWHB 3MRPA 4TTDD 2FJFA 4P2OA 3LZFH 1JGEB 1NC2A 1G0DA 5FB8A 4R6UA 4QXTB 1MJJA 1KPUA 4OUUA 4HS6B 4OCYH 3LN5A 2WUCL 2X9XA 4HWBL 5ICXA 2BOCA 5GGVY 3HAEB 1A3RH 4EQ3A 3FB7B 1YDPB 4QYOB 5IVZA 4KK8D 4YDJA 2BC4B 1H9VA 3MYJB 1S7XB 5ETUA 5HHNA 1NL0H 3QUXC 2Z4QB 2WWKT 3D69A 4M7ZB 4OUUB 3PABA 3TJEH 4JQVC 1RHHA 5I76A 4MA3B 2W9LA 2IQAB 3CK0H 5JIIA 3EFFB 1OW0C 4NYLA 1QR1B 4QO1A 1A7QL 1KTRL 5EU3A 1T5WA 2GJ6B 3HMWL 4F7PA 5DSCA 1IZKA 5TE7L 1MFEH 1CXHA 3MJ8A 3LS5L 2EO9A 2VLJA 3SDAB 3SKUD 2HT3D 3ABZA 1CU4H 5I1CH 1EEYB 4OZHB 3WD5L 4YDKH 3IJHA 3RHWK 3RVTD 1C08B 4FZ8H 5BV7C 1YMHB 4JG1H 4Y2DB 4JFEB 1D9KC 3QIBA 1MVUA 2C1OA 3QO0B 4AEFA 2BY1A 3ILQC 4O5LL 4KTYA 5JW4R 2LU3A 5F1NB 1MIEL 1UB6B 5GIRA 4PJ8A 4HKXB 3G08A 2FX7L 3D3VA 1QBML 1O7SA 5C0AD 2APXA 5EZLA 3VI3E 1G7QB 2IANE 4YHYC 3GSQA 3ARBC 3C2AH 5F89B 1LK3H 5LWYH 1T89C 2GJZB 1H3PH 2IBGA 1IARB 1VFBB 5JUEL 4X4YB 1XF3B 4XP9L 1I1YB 5D7JA 4NNXA 4XNZC 3VE0A 4JZJC 1INDL 1N8ZB 2FD6H 2Y06L 2VXTH 1IC7H 4XCNA 1FJ1A 1ZGLP 1R5WA 5CJOL 5D8JH 2C4XA 5CCKH 5T5FL 4LL9A 2HN7B 2IMNA 4JJ5B 2H2SD 1UCBH 4XCEA 4BQ6A 2CO7B 4Y1AE 2FX7H 1XCQA 1QRNB 5KSAA 2WQRA 2WBJD 4M00A 3MRQA 3GJEA 4FS0A 3N50A 4C57C 4E42B 4WV1B 3PV6B 5KG9B 3O41B 3STLA 4S0TD 3VDCA 3AU1B 4KDWA 5E8EA 4LSDA 1KJ3L 1O5DT 4XXCA 1DL7L 3TYGH 1OAYH 4JFED 4G9FB 4Z7UB 5CBEB 4D0BB 3KGRA 3MX0A 3VFTB 5IUSA 5LJYH 4Y5XC 2BDNL 5D5ME 2JK5A 4Y4KD 5D71H 4LLDA 4PJBB 1Q9OA 2WM0A 4TTGA 4M03A 3OMZA 1J1PH 4FQLL 1XCTB 3SGKC 3T65B 4FQ2H 2R1YB 3ARDA 3FQRB 3BD5A 3GMQB 5IG7B 5IP4A 1NFKA 1S9XA 3BH9B 3M07A 1R3KB 2BRRL 4JRXD 4KHTL 2ESVE 3IS1X 3DX6A 4GS7C 1MCQA 4BYHA 3NFPA 1CD9B 5E1AA 4F9PA 1R3KA 4K55A 2EDQA 3NGBB 5D1XB 1T5XA 1HNFA 4X80L 4WENB 1JZ5A 2KDGA 5D7LA 1A21A 3QFDA 1F4YH 4OFDA 5C0CD 3CCHA 3LKOB 2Y7QA 5GISL 3NBNA 1ITBB 2QADD 4LOUD 3CJJA 4R3SB 4IMLA 4UIMA 1N0XL 3V4PL 2VR4A 1JWMB 2DLFL 2OL3L 1ZLUH 4ELMF 5KTEL 3S88L 1EHNA 3H3BC 3FB5A 3U79A 4NGHH 1P9MA 5DJAB 2XZAL 5FA3B 5IHUH 2NX5A 1PGRB 4D8PB 5JLZA 3ESUF 3ZDZE 1NMAH 2WLYA 4IMLB 4UIMB 2XG4A 3GBML 3IFLH 4Y19D 4G7VH 2QJDA 4KRPB 4K3EL 1GOGA 4X80H 4LCUB 3OJMB 4NKDA 1K4DB 3FFDB 4X5WA 1MPAH 1EO5A 2ZCHH 3CDGB 4JKPL 4F3FA 4WTZA 2F8XC 2VNCA 5BV7L 1I7RB 4R4BA 2GCYB 4O2EB 4IRSC 4IEFB 1CLZL 3I85A 3ROLA 4OGZA 1JGUH 4DVBB 4WJ5B 1KF9B 1EBAA 5ALBH 4H1LB 4I5BB 2MFNA 5J0BA 3EYVA 3DYPA 3KLSA 5DMGC 4ZNEA 1Q9KA 5TFSH 4R96B 5DQJA 2FATL 1YNLH 4K7PY 4GSDH 5AZEL 4FTVE 3TIDA 2DQHH 5HHOB 3FFCB 4RGNB 2VLMD 1XIWB 4PJFA 3BEVA 1T1YB 4GMTH 4U1JA 5IESH 4G7YH 1PSKL 4H8WL 5D1XA 3VH8G 1NPUA 3K0WA 2ERJB 5JIKA 2OK0H 3GK8L 3AB0B 4WFFE 3IDGA 3C6LB 3GRWH 3SQOH 3MOBH 1F4WH 4B50A 3C6SB 3VFSA 3G6AA 1QQDB 3BDBA 4M6NL 1BHGA 2DBJA 3MLTB 2Z93B 3RX8A 3X17A 3E2HB 1WAAE 3RKDD 3GSVA 1XF2B 3STBA 3A6BL 3TLRA 3SDYH 1FFPA 1JV5A 1MCIA 1Z0NA 3BW9A 1T0MB 4LVHC 3W9DB 1AE6H 5DJZA 1P84J 2FEDD 2YKLH 3IDYB 1BLNA 2X4RB 1M71B 3QXAB 5FYKL 2PTVA 3WEXB 4J3UA 4JPVH 5CLTA 5GSVA 5D1QB 4K8RH 4I0CC 5FUOH 1QRNE 2R9HD 3CH8A 1SY6A 1UC6A 2BVPB 4B7LA 1QO3A 6FABL 4MAUH 2PYEE 5J1SC 1CFQB 4MA8H 1PQZA 4GRWF 4HAGA 2H6PA 3BQUB 5J56B 1UWEL 5D1QA 5KJRH 4ONFH 1BFOB 3KXFD 4JPIB 1PG7X 3C09B 3UTZB 1QRNA 1AC6A 2IWGA 5KSAB 1A6TA 1SM3L 2BJMH 1CDBA 3RBGA 4MJ5B 2ZKHH 5K9JH 1RURL 3PG2A 3W9DA 2XZZA 1RZGA 5DS8A 4E41B 1MJUL 4LVNC 2UYLB 3DX8A 1FZOB 5HDBE 2NY2C 5ITBH 1FO0L 1VEOA 4JFOA 1PY9A 5ILTL 3QDGE 1EH9A 1AHWB 5H37G 3BP4A 1GPOL 4BSWB 2OZ4A 4EN3B 5IT2L 3G08B 4FQXD 2YA0A 3HNVL 3KPMA 1BD2D 4PTUA 2NY4C 1MWAA 5LQBH 3W2DH 4OIAA 5I18L 5EFIA 2PTTB 1U42A 1LP9B 5IM7B 3PWPB 5F9WB 4IHOB 3SJVE 1R3LA 3RJDA 3VG0L 5F6HJ 5DF0A 1R3HB 4XRCA 3W0WB 1QFWL 5BS0B 5IKCA 1I9RH 5TF1H 3UTTB 3EZ8A 4OTXH 1RK1A 1RZJH 1UZ6F 2ZUTA 5TDOA 1JPTL 5I8EA 3RL1B 1IAKA 2HFGL 4PJEA 1K9TA 1BJMA 2J8UB 4PGDA 1EEZA 5FYJD 2Y1VA 4JFXA 4OIIH 4Z8FL 3ARZA 3O2VH 2HFEB 5C0CE 4H5SB 4M02A 1AGFA 3T77A 3HAEA 1OTTC 3MRIA 5SX5H 2A1WL 5IBUG 4YBLB 2IGFH 1JMZA 2HWZH 4OLZH 1TIUA 5JPNA 3LQAH 2BC4A 1AGDA 4M43H 5ESAA 3IU4L 4PJEF 4KVNL 2VN4A 5HPMB 4DGIH 1FNGB 4ISVB 2VL5B 1QA9A 1J87A 3LQMA 5DRWB 3UJJL 1H8NA 2R0LH 1NLBH 1TZGH 1FRGH 3MRIB 2B39A 3RBSA 4PV8A 3ZYJA 4JPKL 3GSOA 1MI5A 4PJIA 3DROA 2P42B 3U4EB 2ZCKL 4JDTL 2P24B 5FGBA 4PRPE 3S3SA 3BIAX 2YBRB 3QZWA 1YMMB 2YD8A 1OY3B 2IMMA 1WISA 2E7MA 2FATH 5EN2B 3I50H 4FMKA 1R24A 2QQNL 3MZTA 2NY0C 5D96B 1EX0A 3NFPB 3THML 1RV6X 3ZZ1A 1IAIH 1VGKA 5E4EB 1WFOA 5EZIH 4M43L 3S4SB 4W6YB 1HNGA 1FGNL 4AG4H 3RWGB 2PR4H 1UJTA 2VISA 4EI5D 2X4QB 3TF7C 2VZSA 5DDHB 4GBXB 1P2CA 2SEBB 4LCWE 3O9WC 3F12B 2BFVL 5DJXA 1RZIA 2P49B 2OSLB 3BEWA 4HV8B 3VH8A 1MY5A 4GW5A 1LO2L 4HJ0C 4ZPVB 4ETQA 1WITA 1QLFB 4QTIL 4PPTA 2DJUA 3VFPB 4J4PC 4X7CC 2ITDA 2NY1C 4OCRL 3WFCH 4M7LL 5T1MA 1N5AA 1ADQL 1QSFB 5EUOB 3EFDL 5C07D 5AWNH 3OAUH 1F8TH 5KSAD 1XCQB 1A7QH 4NQCE 3RKDC 1L7TH 4XAKD 1MHPL 3U46A 2CIKA 4YFLI 2OTUA 3U1SH 4F57H 4HKJB 1GJIA 1KIQB 4KV5F 4P5KA 5DYOA 1VACB 4JM4L 5GS1C 2XQYK 5CUSH 4U2YA 3O0RH 4WO4B 4L8SB 5EU6D 3GRWA 2NX5E 2YD1A 5D6DC 5DURB 3SKNB 3S36H 4OAWA 3QEGL 5IR1B 1DN0B 3U30B 2OR9L 4CN6A 2IPTH 4XPHL 3LVEA 5FUZL 3GSRA 5I1KL 4I48A 3NIFE 2J12B 3D0LA 3JWOL 2XN9B 4NJ9H 4HUVA 4ZS6C 1EHLH 4MWFB 4GXVL 1GZQB 3U46B 4NC0B 2G9HA 4L3AA 5LWYL 4XNMA 2JIXD 5F3BB 4FQXA 3GIZH 5LGJA 3QEUA 4JKPH 4KI5E 3UYPA 1CD0A 5J3HC 3RUGE 3IAQA 3PL6C 4XBPA 2H2PC 4PJDB 1EVTC 5MERB 1UZ8A 2EXYD 1BLNB 2OTPA 2X4RA 4CJ0A 3SDXA 2ED8A 4P5TC 2R4RL 1CFNB 3MXWH 4QWWC 3OGCA 5FO8B 4DK3A 1WFNA 3V6OE 3UTSE 1EGJH 3IKCB 4N68A 4ZXBD 4NHUA 4I4WA 4ZG1A 2EC9T 3QJHA 2PO6B 2DWDB 4KKAD 5CP3H 3MZGB 4QXTA 4YUEL 3IAPA 4R96A 2DIBA 1GGYA 1PFCA 3MYJA 2G2RA 3IDYC 1DQDH 4QRSB 3V5HB 4Q9RH 3PJSB 1II4E 3FRUA 5E94B 1INDH 4M8QA 1QSFE 3GMLB 4YBLC 1CLYH 3OR7B 4N0RA 3LS4L 4LLYA 4MVBC 3BAEL 1JGDB 4ODHL 4Q0XL 1V7MH 4G43A 3K4DA 5F7KC 5F96H 3D0VB 3G6JB 1BZQK 4XNYH 2DMCA 2BNQB 4X7DC 3FQTA 4L8CA 2LVEA 1SY6L 5ID1A 3V0WH 3JTTA 4S2SA 2E6PA 4ZSOB 2YD3A 1DBKH 4HS3B 3CFEB 2BXYA 2C3WA 2GITB 2OM5A 4WTXA 1G7MB 2F19L 3IDIA 2Q7YA 2UWEE 2BXZA 2N7AA 3UBXG 3PE9A 2E3VA 4U1GB 1L6ZA 3TH4T 2P43B 2H32A 1Z9LA 2A6JB 5AUMB 5JNYA 1Z3GH 5C0JB 3RWJA 1I8MA 1V8HA 4LLDB 4RBPK 1FNSL 1JWUB 4NO0B 1ZS8A 2BY2A 4WWKA 3O45A 4P9MH 1RZ7H 3LHPH 1A7OL 5DEGA 2Z8SA 3ZMRA 1QNZL 1F4AA 2ZOKB 3H9SB 5L0QB 4KMLB 3VXNB 3QXWA 4RMSA 3QXDA 3S97C 5IFJA 2CK0H 3TBWA 2VZOA 4DZBA 1A14H 5DTFB 2JB5H 4A6YH 5IFHL 5L2JA 1HQ4B 3VXTB 4RMQA 3WUWB 3Q3GB 1GAFH 3WFBL 2XKNA 3I3BA 4N0CC 3CSPA 4XCEB 4PJAA 5FKAB 3WEXA 4B53A 3S34L 2VOTA 5C0IA 1FORH 4YDVA 4NZTH 5EFIB 5D6DA 4QHLA 1FGVL 2ADGB 2E27H 2EKSB 2C3HA 4L1DA 4V2CB 3ZHDA 1S9WA 3CX2A 4YDIH 1IFHH 3ZE0E 1LEGA 3IF1B 2ICWA 3VMOA 3DLQR 1CWVA 1CLZH 1WZKA 1C12A 4IOSD 5MEOA 3PWVB 4J3WA 4FG6C 4XC3H 4BH8A 1LP9F 2VAJA 1MOEA 3I84A 2NW3A 3QDHA 3W5MA 3KLAB 4M9OA 3E6HB 2I9LA 4CVWA 5FGRA 1LP9E 3REWB 5HJ3A 4AEHH 5IEKA 3QDJE 5HVWA 3KPSB 1M7XA 5B39A 3GMMB 2F53E 5C07A 4FZEL 4PG2A 3OKDB 3CX5J 2NY1D 4M61B 1FYTB 1LDPL 4FQJH 3O9WA 4FFZL 1YEFH 4IRSD 5F1OB 4PJ5A 1A7PH 4LCUA 3BD4A 1FN4A 2XRAH 1QP1A 1AQDB 3VXNA 1SJVA 2ZUSA 1CTNA 4H0GA 1TITA 4W81A 1HKFA 4ZFOL 2FGWH 1U8NA 1YPZE 1IGCH 1KULA 3BH8A 2QTEA 2OMBA 3GMMA 2RR3A 5E00A 2A9MH 1ZEAH 2YPVL 1L0XA 2KQMA 4W6XB 1INEH 1JYWA 4P23A 4QHUB 1FGNH 3NN8A 3U7YH 2OR9H 2DQCH 1LDPH 1UWXH 2X5PA 4ODWB 1K5NB 2UVFA 2GEEA 5HY9A 4NFDA 2QHRH 4X7SL 1EUUA 1IGFH 1UENA 4JM2C 4K9EC 3BH9A 4U1JB 1TZHA 2HKHH 2E7BA 3WIIL 1HI6A 4IJ3C 2EDEA 4EBQH 5I15L 3EBAA 1TVHB 4MHHI 4P4KD 3G5VA 3GFUA 3RZCC 2HH0H 2FWOB 4EKXA 5FEBA 1X7QB 1UH2A 1MCHA 1QLRB 1MRFH 2GQHA 4JB9H 1JGDA 3FQNA 1L4IA 1EEQA 1ODAA 4ODTH 2M8XA 2AJVH 3BI9X 5ERWB 3LS5H 3CDCA 4XGZA 5FECA 5KSBF 5L6YL 1C5DA 3TH2T 1TJHH 1HZHH 3VXUA 4JZNB 3W9EA 3O8XB 2XFXA 2QHRL 4X7SH 3UTSB 2DWEA 4AYFA 1WCQA 2CLRA 1WC7A 3UBXA 2UZXB 4JR9H 2Q8AH 4GXUN 1QG3A 5D6CA 2YS4A 4LVOC 3U30C 4X5WB 3QPXL 3PDOB 5B38G 1ZA6A 4AQ1B 3HNSH 3MCLH 1AQDA 3QH3A 4ZFZA 2O5YH 2BOCB 1DVFB 5JW5A 3JWOC 1KB5L 5IR1A 2C3GA 4G8EB 5I73C 4YAQB 1KSRA 2JCCA 4H20H 5TF1L 4EI5B 3BWAA 1S8DA 2YXFA 5E7FA 4WFHE 3S36L 1HILA 1G9EA 3O45B 1JK8A 3THMH 2WV3A 1LVEA 1R5IA 2WINA 5GRJL 4DKFH 2JJUA 1HYSD 5JOEA 3B5HA 3ZO0A 4HX1A 5F1NA 3DRTA 3QULA 4JN1H 1J18A 4WI3A 3C5JB 4GG6B 1I7UA 4A2MA 2R0KH 1IBGH 2XI9A 3CAFA 1HINH 5GPRA 1ZT7B 4P2QE 4YQXH 1U91A 4TRPL 5DVMA 2QV2A 2F19H 2HVKA 5DI8B 2VQTA 3MACL 3E8UH 3TNNA 3IKCA 3JV0A 3VWJA 5ISZE 1KIQA 4D9LL 1AP2A 1CDHA 1GGCL 1DLHB 4YPGA 1OP3K 2AQ2A 1I3UA 2C3VB 5C7XL 4U7MA 4BFIB 3EOBB 3GMRA 3OB8A 3MNVB 1DBAL 5IQ9B 3QRGL 2CDFB 2VL4A 4U31A 3KDMB 5HYFA 2YRLA 4NT6A 1T5WB 3CUPB 4O00A 5ISZA 1OM3H 1YQVH 4UBDC 1IQDA 4DVRH 2H1PH 3EOBA 3GMRB 4P2RB 3STLB 4Q9CA 5TPWL 5CZVH 4WUUD 4PJGA 5DUPH 1DDHB 3AU1A 3QO1B 1I7ZB 2GI7A 2XQYG 2IF7A 4XZUB 2AJYL 3MUHL 3ULUH 4J8RA 5GGTH 3IGAB 4HKBA 4OJFH 3I50L 4P57A 4BSJA 1VFOA 2IJ0C 2X6MA 4MA3A 2J7LA 1A6WH 5BZWB 3KJ6H 4L8BA 4JAMA 1P7QD 3I6GA 2H32B 2DDQL 1P84K 2EDLA 5AZ2H 1JI2A 4NNXB 3HPJA 2ZWLT 2VLJB 4FP8H 3IDIB 2R8SH 2YMXL 1JZ7A 4JAMB 4E41A 3ZKXC 2I25N 2OL3H 3Q0HA 3KPSE 1MFBL 4F7PB 3IJYA 5ANMA 3I6LD 5I71B 5I1IH 1A6WL 2GJ6E 5BQ7A 4PB0L 3HE6D 5L8KB 4V1DB 3BKMH 1LNUA 2VL5A 4LLQA 4TYUA 1I7TA 4M62L 2A73B 3VCLA 3QFJD 4OLWH 3WE6A 5D7LE 4MQXC 3MV8B 4O5LH 1CXFA 5F7MC 5C0FB 1Q94A 1CXLA 2FGWL 3PHQA 1FLRH 4X99A 3ARRA 4JM4H 4YR6B 4J3VA 4I0PB 3V6FA 1K2DA 4U1LA 3FAXA 3K8LA 4KKNA 1P9MC 1I1CA 1YEDA 5EBGA 5L6YH 4XWGL 3BRGC 3JWDL 1CYGA 3OAYH 4Q9RL 1PG7H 3KR3H 4KHXL 3NCYS 1S7SA 1ERNA 3ULUD 4OF8A 4PIRF 4V1DE 1OF2A 4P2RE 3QAZB 4JDZA 4K94H 4JQXA 1OP5H 4U1HA 4Y5VA 4L3EA 1MLCA 3SDDD 4B7IA 2D31A 2FH6A 1ZVSA 2XOTA 4JQIH 4KH2A 4JCMA 5T5NG 3SGEI 1R5WB 2IBZY 1Y18B 1E27A 5E6YA 4XVJH 5IEKB 5E2VL 2YPLB 3TPUB 1QOKA 3NA9H 5KS9E 2ORBH 4IOFC 1HH6A 3SQOL 3WV0A 3RI5F 2V2WA 3QNXA 4Z76B 1KN4L 4L3EE 5MI0B 3ZDXE 1LE9A 5HDOA 2APWA 5DQJB 3IRPX 3HTLX 3X11B 3HI6H 1AC0A 1CD1A 4NQVB 3RNKB 5JW3L 5I1AB 3NN8B 1NGQL 4Z7WB 1JP5A 3ROLB 1S8DB 1FSKC 4S1DC 2GUOB 2IG2H 4DVBA 2HTLD 3M1BB 2Q6WA 1GYAA 3ARDC 1M7DB 1HILB 3U9UA 3L95B 4RFOL 3BUYA 2QSCH 1WZ1H 2YK1L 1S5HB 2CRMA 5F9JB 2GKIA 4JG0L 2AEPH 4U33A 4XNYL 4MAUL 2EZ0C 1Y6MR 1YYLL 4U2ZA 4WFGE 4X6DE 2W38A 5EIIB 1G7IB 1X4YA 3KPOB 4ELKA 1T7YA 2MKLC 5IB3A 1I75A 1KIPB 3ME0A 2JB5L 4A6YL 4YX2L 1VPOL 3SGDI 1DQJA 2DQEH 4Y16A 1DQDL 4CW1B 1J1PL 2VDLH 2FEEI 4H0HB 5DJYA 1MLBB 1BD2B 4OZ4B 3RGHA 1MJ7L 4KRLB 1K2DB 4U1LB 4X98B 5KAQF 3KPNB 4TUOB 1EVUA 2QHLA 3FMGH 3HMXL 1EMTL 2ILLA 3VXUB 1CS6A 4YK4B 3W39B 4Z7VB 4YHLH 4PP1D 2Z8RA 4F8QA 3CVHB 2D9CA 1EMTH 1P1ZA 3T0EB 3F7RA 1WBYA 5DVKA 2IANB 3BFOA 5ILTH 1CLCA 4Y19E 3VGFA 2EIZB 2OJZL 4PR5B 5ITBL 4LU5L 5D7JC 1Q9WA 4LSVH 1D5IL 1K8DA 4AY0A 5J3HD 4YX2H 2X1WL 1AD0A 1XEDA 3SKOB 1CD8A 3IKKA 2NYYC 4PRAB 4OM0H 3VWJD 1D5BA 1I4FA 3BO8A 3RY6C 3ARBA 1X6LA 3C87A 5TF0A 3ZKND 2C4FT 4MA7L 3LH2L 1MVFA 1FO0H 3WJJC 2M26A 2NNAB 2AJ3A 2VC2L 1DE4B 4LVOB 5BZDB 4G80A 1MH5A 3MRRA 4LLVA 5JMOC 1RIVL 1CFVH 1INQB 1T21A 3QP3A 5CGMA 2C3XA 4NWTH 4K7PL 5D2NE 2EE6A 2P8MB 3TV3L 4CU6A 1A6UL 3FFDA 2DQFB 1BOYA 2FL5B 3TYFB 5CEZH 3U83A 1ZS8B 4WWKB 4M93C 1NMAL 4JRXB 3WNLA 5DA0B 4Z7UF 2IADB 1JPGA 4JHBA 4L9LB 5EO1B 1CR9L 1CE1H 4R2GC 3UYOD 2W9EH 3QUXB 3NPSB 1M4KA 1YEFL 4O2EA 4I2XA 1MNUL 4GJTB 5IFJB 1G7PB 3AY4C 1DZBA 1MIML 3UTOA 3RL2A 2EH8L 4QHMA 2AGJL 3QWQB 1OW0A 4M1CD 5ECJE 2V2TA 1RZ8B 1U8QB 5D1ZB 4Y5YC 1OCWL 3PUCA 5TQ0L 1QO3B 4HPOH 3QUXA 5BXFB 1UKTA 1CICD 2IPUK 3OF6A 4NO5A 1X5FA 3FB6A 3TH3T 1OCWH 4DGIL 4NT6B 3JTSA 1FE8L 1L9NA 2VDKH 4NQCB 4JRYE 3VFMA 4DEPB 4F2MA 2IGFL 4I18B 2A2QT 2DQCL 4LHUB 5B8CB 1CDJA 4LLWA 1IAMA 2GJZA 2AXFB 4NO2A 4HFUH 2QSVA 2V7NB 3HE6A 3F7PC 2J4WH 4DAGL 3UPRA 4OZIF 2AV7B 3ZDYE 5J6GB 1X4ZA 4MJ2A 4NQXB 5L88H 1P7KA 5EPMA 2X40A 4AENA 3PF2A 3PWUB 2DICA 4XBEH 5IFAL 4LCCC 2J88L 1CDUA 1KIRB 1HH9B 3D3VE 5D72L 5K33A 2V2XB 4LIQE 3QEGH 4EXKA 4XBEL 1MQ8A 2BNRD 3PHSA 5C6WH 2CD0A 5DJDA 1NCDH 5FUZH 2XICA 4DGYL 5HHPA 4FFZH 2ATPA 3S98A 3FN3A 3RGVB 3RTQA 3HFMH 2PYEA 2O5XH 3GI9L 3QZWG 4R7DA 3WXVH 1IE5A 5TE4H 1NEZG 3BQUA 4IRJA 2R0WL 3VG0H 5I8OH 2P8PA 1S9WB 4L8SC 5KN5A 2VDPH 4X6CA 1CFTB 4QT5B 1YEHL 2ARJA 2BX5A 5TE4L 1J8HB 5I1LA 3U7AA 4YHPA 3K1KC 3MO1B 3P9LA 4DKAA 3EFFA 4FRWA 4G42B 4P5TB 1IKNA 5EO0B 1NCDL 5F88B 1K4DA 4CADA 3DV4A 1VFAA 2VXQL 2HTKD 4HF5H 4YDLC 1MQKH 3BUYB 4PJIF 3M8OL 4GW5B 4NOBA 1CGSH 1FLTX 2F53B 4HFWA 2Z31D 4MXVE 2IFFL 2X10A 4LFHG 3LSOA 2IH1A 4GG6E