4YDTA

Beta1 synthetic solenoid protein
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
215
structure length
215
Chain Sequence
HMNVGEILRHYAAGKRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthetic beta-solenoid proteins with the fragment-free computational design of a beta-hairpin extension.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Structural protein
molecule keywords beta1 protein
total genus 98
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 4ydtA00
4YDTA 2QZAA 2QYUA 3NB2A 2J8KA 2XTYA 5DNSA 2XTXA 4YEIA 3NAWA 2O6WA 4YC5A 3DU1X 4YCQA 4YFOA 3PSZA 2XT2A 3PSSA 2XTWA 3SQVA 3SY2A 2XT4A
chains in the Genus database with same CATH superfamily
2NSPA 1AIRA 2UVEA 4OZZA 1K5CA 2QYUA 1DBGA 2IQ7A 2INVA 2VBEA 2J8KA 2BX6A 4NK8A 3RIQA 2QY1A 2VJJA 2INUA 3SZEA 1O8GA 1BN8A 2ODLA 1RMGA 3B8YA 4URRA 3LJYA 3ZSCA 5JLVC 3NAWA 2O6WA 4YC5A 4YCQA 3B4NA 3GQAA 1QRCA 1DBOA 1LLWA 1DABA 4V02C 1QRBA 1NHCA 4MXNA 5JMCB 3JURA 1TYUA 1O8KA 1K4ZA 3LMWA 2X6XA 1JRGA 4U49A 3PETA 3SUCA 1PE9A 1OFLA 2NT9A 1QA3A 1PLUA 2XT2A 3KRGA 4XNFA 4OJPA 1O88A 1EZGA 1OGMX 3H09A 2X85A 1H80A 3PSSA 4W8QA 4XOPA 3ML3A 4OJ6A 1O8LA 2IOUG 3SY2A 3ZPPA 1KCCA 2O0WA 1OGOX 2Z8GA 4Z06A 4U4BA 1O8IA 1KTWA 2X6WA 4OJOA 5DNSA 2BM6A 2XTXA 4I84A 4MR0A 1LLZA 4XQFA 4XLEA 2W7ZA 2O04A 3GQ7A 1TSPA 3VMWA 2VFQA 4KH3A 3DU1X 1VBLA 1EE6A 2PECA 2NTBA 4XMYA 3TH0A 2VFNA 3AK5A 2PYGA 3GQ8A 4YZQA 1IDKA 4XL9A 2X6YA 1O8HA 1PXZA 2J8IA 2VBKA 1CLWA 3T9GA 2NTPA 4YZXA 5C1CA 1KQ5A 3LYCA 1L1IA 2BM5A 3PSZA 4XKWA 2V5IA 4OZYA 4XN3A 1O8JA 3VSVA 4XLFA 4C2LA 2O0VA 3SQVA 1QCXA 4Z03A 2BSPA 3N6ZA 4XKVA 1OFEA 1TYVA 1RWRA 4NK6A 1QJVA 1HG8A 2VFOA 2G0YA 2VFPA 2XTYA 2B0RA 3P4GA 4XLAA 3JX8A 4YEIA 1RU4A 3GQ9A 5C1EA 4EW9A 4XOTA 4JRAC 4XORA 2VBMA 2VFMA 1EA0A 2BM7A 4YZ0A 2EWEA 1CZFA 4XONA 2F3LA 1GQ8A 2O17A 4YFOA 2NZMA 4YEJA 1OFMA 1O8EA 1QA1A 2QX3A 1IDJA 1OOCA 2UVFA 3VSTA 1WMRA 2XTWA 1JTAA 5AMVA 1LM1A 3UW0A 1QQ1A 4PMHA 4AVZA 1KCDA 1TYWA 1O8DA 4XLHA 4YDTA 1K8FA 4Z05A 2O1DA 3WWGA 1O8MA 2QZAA 3NB2A 4OPWA 4W8SA 4W8TA 1TYXA 4XN0A 4HWVA 3EQOA 1XG2A 4OM9A 1IA5A 2PYHA 1O8FA 2YUHA 1BHEA 3BH7B 2NTQA 2BM4A 3GRHA 4XLCA 3FY3A 2VJIA 4YZAA 4W8RA 2NT6A 1X0CA 3B90A 3SYJA 2XC1A 3VMVA 1HF2A 4OJLA 2NSTA 4OJ5A 4XM3A 1QA2A 1OFDA 1IB4A 1WXRA 4YELA 4XR6A 2X3HA 3EQNA 3BH6B 3VSUA 2QXZA 3N90A 2XT4A
chains in the Genus database with same CATH topology
4YDTA 2QZAA 2QYUA 3NB2A 2J8KA 2XTYA 5DNSA 2XTXA 4YEIA 3NAWA 2O6WA 4YC5A 3DU1X 4YCQA 4YFOA 3PSZA 2XT2A 3PSSA 2XTWA 3SQVA 3SY2A 2XT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YDT A;  2QZA A;  2QYU A;  3NB2 A;  2J8K A;  2XTY A;  5DNS A;  2XTX A;  4YEI A;  3NAW A;  2O6W A;  4YC5 A;  3DU1 X;  4YCQ A;  4YFO A;  3PSZ A;  2XT2 A;  3PSS A;  2XTW A;  3SQV A;  3SY2 A;  2XT4 A; 
#chains in the Genus database with same CATH topology
 2NSP A;  1AIR A;  2UVE A;  4OZZ A;  1K5C A;  2QYU A;  1DBG A;  2IQ7 A;  2INV A;  2VBE A;  2J8K A;  2BX6 A;  4NK8 A;  3RIQ A;  2QY1 A;  2VJJ A;  2INU A;  3SZE A;  1O8G A;  1BN8 A;  2ODL A;  1RMG A;  3B8Y A;  4URR A;  3LJY A;  3ZSC A;  5JLV C;  3NAW A;  2O6W A;  4YC5 A;  4YCQ A;  3B4N A;  3GQA A;  1QRC A;  1DBO A;  1LLW A;  1DAB A;  4V02 C;  1QRB A;  1NHC A;  4MXN A;  5JMC B;  3JUR A;  1TYU A;  1O8K A;  1K4Z A;  3LMW A;  2X6X A;  1JRG A;  4U49 A;  3PET A;  3SUC A;  1PE9 A;  1OFL A;  2NT9 A;  1QA3 A;  1PLU A;  2XT2 A;  3KRG A;  4XNF A;  4OJP A;  1O88 A;  1EZG A;  1OGM X;  3H09 A;  2X85 A;  1H80 A;  3PSS A;  4W8Q A;  4XOP A;  3ML3 A;  4OJ6 A;  1O8L A;  2IOU G;  3SY2 A;  3ZPP A;  1KCC A;  2O0W A;  1OGO X;  2Z8G A;  4Z06 A;  4U4B A;  1O8I A;  1KTW A;  2X6W A;  4OJO A;  5DNS A;  2BM6 A;  2XTX A;  4I84 A;  4MR0 A;  1LLZ A;  4XQF A;  4XLE A;  2W7Z A;  2O04 A;  3GQ7 A;  1TSP A;  3VMW A;  2VFQ A;  4KH3 A;  3DU1 X;  1VBL A;  1EE6 A;  2PEC A;  2NTB A;  4XMY A;  3TH0 A;  2VFN A;  3AK5 A;  2PYG A;  3GQ8 A;  4YZQ A;  1IDK A;  4XL9 A;  2X6Y A;  1O8H A;  1PXZ A;  2J8I A;  2VBK A;  1CLW A;  3T9G A;  2NTP A;  4YZX A;  5C1C A;  1KQ5 A;  3LYC A;  1L1I A;  2BM5 A;  3PSZ A;  4XKW A;  2V5I A;  4OZY A;  4XN3 A;  1O8J A;  3VSV A;  4XLF A;  4C2L A;  2O0V A;  3SQV A;  1QCX A;  4Z03 A;  2BSP A;  3N6Z A;  4XKV A;  1OFE A;  1TYV A;  1RWR A;  4NK6 A;  1QJV A;  1HG8 A;  2VFO A;  2G0Y A;  2VFP A;  2XTY A;  2B0R A;  3P4G A;  4XLA A;  3JX8 A;  4YEI A;  1RU4 A;  3GQ9 A;  5C1E A;  4EW9 A;  4XOT A;  4JRA C;  4XOR A;  2VBM A;  2VFM A;  1EA0 A;  2BM7 A;  4YZ0 A;  2EWE A;  1CZF A;  4XON A;  2F3L A;  1GQ8 A;  2O17 A;  4YFO A;  2NZM A;  4YEJ A;  1OFM A;  1O8E A;  1QA1 A;  2QX3 A;  1IDJ A;  1OOC A;  2UVF A;  3VST A;  1WMR A;  2XTW A;  1JTA A;  5AMV A;  1LM1 A;  3UW0 A;  1QQ1 A;  4PMH A;  4AVZ A;  1KCD A;  1TYW A;  1O8D A;  4XLH A;  4YDT A;  1K8F A;  4Z05 A;  2O1D A;  3WWG A;  1O8M A;  2QZA A;  3NB2 A;  4OPW A;  4W8S A;  4W8T A;  1TYX A;  4XN0 A;  4HWV A;  3EQO A;  1XG2 A;  4OM9 A;  1IA5 A;  2PYH A;  1O8F A;  2YUH A;  1BHE A;  3BH7 B;  2NTQ A;  2BM4 A;  3GRH A;  4XLC A;  3FY3 A;  2VJI A;  4YZA A;  4W8R A;  2NT6 A;  1X0C A;  3B90 A;  3SYJ A;  2XC1 A;  3VMV A;  1HF2 A;  4OJL A;  2NST A;  4OJ5 A;  4XM3 A;  1QA2 A;  1OFD A;  1IB4 A;  1WXR A;  4YEL A;  4XR6 A;  2X3H A;  3EQN A;  3BH6 B;  3VSU A;  2QXZ A;  3N90 A;  2XT4 A; 
#chains in the Genus database with same CATH homology
 4YDT A;  2QZA A;  2QYU A;  3NB2 A;  2J8K A;  2XTY A;  5DNS A;  2XTX A;  4YEI A;  3NAW A;  2O6W A;  4YC5 A;  3DU1 X;  4YCQ A;  4YFO A;  3PSZ A;  2XT2 A;  3PSS A;  2XTW A;  3SQV A;  3SY2 A;  2XT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...