4YDTA

Beta1 synthetic solenoid protein
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
215
structure length
215
Chain Sequence
b'HMNVGEILRHYAAGKRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta1 protein
molecule tags Structural protein
source organism Synthetic construct
publication title Synthetic beta-solenoid proteins with the fragment-free computational design of a beta-hairpin extension.
pubmed doi rcsb
total genus 98
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 4ydtA00
3SY2A 2QZAA 3NB2A 3PSSA 2XT2A 3SQVA 2XT4A 2O6WA 2J8KA 5DNSA 2XTYA 3DU1X 2XTWA 4YEIA 2QYUA 4YFOA 4YCQA 4YDTA 4YC5A 3NAWA 3PSZA 2XTXA
chains in the Genus database with same CATH superfamily
2IQ7A 3T9GA 3SY2A 1K4ZA 2QZAA 4W8RA 3RIQA 2XC1A 1IB4A 3SUCA 2X6YA 2G0YA 2V5IA 2BM4A 2X6XA 1QA1A 1JRGA 2O17A 1DBGA 2XT2A 2NSPA 4HWVA 3EQOA 2VFOA 2VBKA 2QXZA 2NSTA 4U49A 5DNSA 4OM9A 3B90A 3LMWA 4XKVA 3VSVA 2B0RA 2X3HA 4YEIA 4XMYA 1H80A 1PXZA 4XORA 1EE6A 4XNFA 2BX6A 1O8LA 3LYCA 4YFOA 4W8QA 2VBMA 2QX3A 2O1DA 3AK5A 4YC5A 1K5CA 4OJLA 3GQ7A 2PYHA 2XTXA 3EQNA 4EW9A 4XONA 1TYWA 2Z8GA 4XN3A 1LLWA 3PSSA 1O88A 2VBEA 2O0VA 3H09A 1IDJA 1LM1A 2VJIA 4JRAC 3WWGA 1QRBA 2VFQA 5C1CA 1VBLA 1TYXA 2NTQA 1JTAA 4XM3A 4OZZA 1O8EA 2PECA 1EZGA 4OJ6A 3BH7B 4XLAA 1BHEA 2INUA 2O6WA 4PMHA 4XQFA 4XL9A 1OOCA 4V02C 2XTYA 3DU1X 4I84A 4NK6A 3TH0A 1L1IA 4Z03A 1OFMA 4OPWA 3SZEA 2XTWA 1QJVA 3GQAA 1O8KA 1GQ8A 2VFPA 5JMCB 1WXRA 4KH3A 2BM7A 4XN0A 4YCQA 2UVEA 3VMVA 2X85A 3ML3A 1LLZA 5C1EA 1OFEA 1TSPA 3PSZA 3VSTA 1KTWA 2NTPA 3P4GA 2YUHA 3VMWA 2O04A 4OJOA 4YEJA 1QQ1A 2QY1A 3UW0A 4YZ0A 2EWEA 4W8SA 1O8DA 1TYVA 4XLFA 4XR6A 1XG2A 2UVFA 3SQVA 3VSUA 4YZXA 2BSPA 3B8YA 1DABA 1RMGA 2ODLA 4Z05A 3LJYA 1O8HA 1EA0A 1OFDA 1OFLA 2J8KA 3FY3A 4YELA 4W8TA 1OGOX 3GQ8A 4C2LA 4OJPA 3ZSCA 1RWRA 4URRA 1CLWA 1CZFA 1O8FA 2J8IA 2BM6A 2INVA 1O8MA 2VFNA 4OZYA 4XLCA 4AVZA 4XLHA 1NHCA 1PLUA 4Z06A 3N6ZA 1X0CA 2VJJA 3ZPPA 1O8GA 1QA2A 1KQ5A 4YDTA 1KCCA 3SYJA 4XOTA 4MXNA 1KCDA 2X6WA 1IA5A 1QA3A 1HG8A 1PE9A 1DBOA 2W7ZA 3NB2A 4XOPA 3B4NA 2F3LA 2NT6A 1O8IA 1BN8A 3N90A 3PETA 1OGMX 3GRHA 2IOUG 3JURA 1AIRA 1QCXA 1TYUA 2NZMA 2XT4A 4YZAA 5JLVC 2PYGA 3BH6B 4NK8A 4XKWA 4U4BA 1O8JA 3KRGA 4OJ5A 1K8FA 1QRCA 5AMVA 3GQ9A 2O0WA 1HF2A 4YZQA 4XLEA 1IDKA 2NT9A 2QYUA 2VFMA 1WMRA 1RU4A 4MR0A 2BM5A 2NTBA 3NAWA 3JX8A
chains in the Genus database with same CATH topology
3SY2A 2QZAA 3NB2A 3PSSA 2XT2A 3SQVA 2XT4A 2O6WA 2J8KA 5DNSA 2XTYA 3DU1X 2XTWA 4YEIA 2QYUA 4YFOA 4YCQA 4YDTA 4YC5A 3NAWA 3PSZA 2XTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SY2 A;  2QZA A;  3NB2 A;  3PSS A;  2XT2 A;  3SQV A;  2XT4 A;  2O6W A;  2J8K A;  5DNS A;  2XTY A;  3DU1 X;  2XTW A;  4YEI A;  2QYU A;  4YFO A;  4YCQ A;  4YDT A;  4YC5 A;  3NAW A;  3PSZ A;  2XTX A; 
#chains in the Genus database with same CATH topology
 2IQ7 A;  3T9G A;  3SY2 A;  1K4Z A;  2QZA A;  4W8R A;  3RIQ A;  2XC1 A;  1IB4 A;  3SUC A;  2X6Y A;  2G0Y A;  2V5I A;  2BM4 A;  2X6X A;  1QA1 A;  1JRG A;  2O17 A;  1DBG A;  2XT2 A;  2NSP A;  4HWV A;  3EQO A;  2VFO A;  2VBK A;  2QXZ A;  2NST A;  4U49 A;  5DNS A;  4OM9 A;  3B90 A;  3LMW A;  4XKV A;  3VSV A;  2B0R A;  2X3H A;  4YEI A;  4XMY A;  1H80 A;  1PXZ A;  4XOR A;  1EE6 A;  4XNF A;  2BX6 A;  1O8L A;  3LYC A;  4YFO A;  4W8Q A;  2VBM A;  2QX3 A;  2O1D A;  3AK5 A;  4YC5 A;  1K5C A;  4OJL A;  3GQ7 A;  2PYH A;  2XTX A;  3EQN A;  4EW9 A;  4XON A;  1TYW A;  2Z8G A;  4XN3 A;  1LLW A;  3PSS A;  1O88 A;  2VBE A;  2O0V A;  3H09 A;  1IDJ A;  1LM1 A;  2VJI A;  4JRA C;  3WWG A;  1QRB A;  2VFQ A;  5C1C A;  1VBL A;  1TYX A;  2NTQ A;  1JTA A;  4XM3 A;  4OZZ A;  1O8E A;  2PEC A;  1EZG A;  4OJ6 A;  3BH7 B;  4XLA A;  1BHE A;  2INU A;  2O6W A;  4PMH A;  4XQF A;  4XL9 A;  1OOC A;  4V02 C;  2XTY A;  3DU1 X;  4I84 A;  4NK6 A;  3TH0 A;  1L1I A;  4Z03 A;  1OFM A;  4OPW A;  3SZE A;  2XTW A;  1QJV A;  3GQA A;  1O8K A;  1GQ8 A;  2VFP A;  5JMC B;  1WXR A;  4KH3 A;  2BM7 A;  4XN0 A;  4YCQ A;  2UVE A;  3VMV A;  2X85 A;  3ML3 A;  1LLZ A;  5C1E A;  1OFE A;  1TSP A;  3PSZ A;  3VST A;  1KTW A;  2NTP A;  3P4G A;  2YUH A;  3VMW A;  2O04 A;  4OJO A;  4YEJ A;  1QQ1 A;  2QY1 A;  3UW0 A;  4YZ0 A;  2EWE A;  4W8S A;  1O8D A;  1TYV A;  4XLF A;  4XR6 A;  1XG2 A;  2UVF A;  3SQV A;  3VSU A;  4YZX A;  2BSP A;  3B8Y A;  1DAB A;  1RMG A;  2ODL A;  4Z05 A;  3LJY A;  1O8H A;  1EA0 A;  1OFD A;  1OFL A;  2J8K A;  3FY3 A;  4YEL A;  4W8T A;  1OGO X;  3GQ8 A;  4C2L A;  4OJP A;  3ZSC A;  1RWR A;  4URR A;  1CLW A;  1CZF A;  1O8F A;  2J8I A;  2BM6 A;  2INV A;  1O8M A;  2VFN A;  4OZY A;  4XLC A;  4AVZ A;  4XLH A;  1NHC A;  1PLU A;  4Z06 A;  3N6Z A;  1X0C A;  2VJJ A;  3ZPP A;  1O8G A;  1QA2 A;  1KQ5 A;  4YDT A;  1KCC A;  3SYJ A;  4XOT A;  4MXN A;  1KCD A;  2X6W A;  1IA5 A;  1QA3 A;  1HG8 A;  1PE9 A;  1DBO A;  2W7Z A;  3NB2 A;  4XOP A;  3B4N A;  2F3L A;  2NT6 A;  1O8I A;  1BN8 A;  3N90 A;  3PET A;  1OGM X;  3GRH A;  2IOU G;  3JUR A;  1AIR A;  1QCX A;  1TYU A;  2NZM A;  2XT4 A;  4YZA A;  5JLV C;  2PYG A;  3BH6 B;  4NK8 A;  4XKW A;  4U4B A;  1O8J A;  3KRG A;  4OJ5 A;  1K8F A;  1QRC A;  5AMV A;  3GQ9 A;  2O0W A;  1HF2 A;  4YZQ A;  4XLE A;  1IDK A;  2NT9 A;  2QYU A;  2VFM A;  1WMR A;  1RU4 A;  4MR0 A;  2BM5 A;  2NTB A;  3NAW A;  3JX8 A; 
#chains in the Genus database with same CATH homology
 3SY2 A;  2QZA A;  3NB2 A;  3PSS A;  2XT2 A;  3SQV A;  2XT4 A;  2O6W A;  2J8K A;  5DNS A;  2XTY A;  3DU1 X;  2XTW A;  4YEI A;  2QYU A;  4YFO A;  4YCQ A;  4YDT A;  4YC5 A;  3NAW A;  3PSZ A;  2XTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...