4YDTA

Beta1 synthetic solenoid protein
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
215
structure length
215
Chain Sequence
HMNVGEILRHYAAGKRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthetic beta-solenoid proteins with the fragment-free computational design of a beta-hairpin extension.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Structural protein
molecule keywords beta1 protein
total genus 98
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 4ydtA00
2O6WA 5DNSA 2QYUA 4YDTA 3SY2A 2XTWA 3DU1X 3PSZA 3NAWA 2XT4A 3PSSA 2XTYA 3SQVA 3NB2A 4YC5A 2J8KA 4YCQA 2XTXA 2XT2A 2QZAA 4YFOA 4YEIA
chains in the Genus database with same CATH superfamily
3EQOA 3N90A 2X85A 5C1CA 1K8FA 1O8KA 1LLWA 5DNSA 3N6ZA 1OFMA 1PLUA 4XN0A 2Z8GA 2VBKA 4W8QA 4OJOA 4W8RA 1TYVA 4I84A 1IDKA 1TYUA 1PE9A 1OFLA 1BN8A 4U4BA 1DBOA 3DU1X 3ML3A 4OJLA 4Z05A 4C2LA 1O8GA 2PYGA 5JMCB 3VMWA 3JX8A 1DBGA 3LMWA 2X6WA 2VJIA 2VFNA 1QQ1A 2QXZA 4NK8A 2XC1A 3VSVA 2NT9A 1JTAA 3EQNA 2XTYA 3H09A 1IB4A 3GQ9A 1QCXA 4XOTA 1OFEA 2J8KA 1EE6A 1WMRA 2PYHA 2X6YA 1WXRA 3WWGA 3GRHA 1OOCA 1GQ8A 4MR0A 3BH6B 1O8EA 1QRCA 2O1DA 2O6WA 1DABA 1X0CA 2F3LA 1OFDA 2QY1A 4XNFA 1CZFA 2G0YA 3T9GA 2BX6A 1O8DA 1TYXA 1OGOX 1K4ZA 4XR6A 2NTBA 2J8IA 3B90A 4XMYA 1BHEA 2BM6A 2O0VA 1XG2A 1LLZA 3P4GA 2O04A 4XOPA 2UVEA 4XQFA 2XT4A 4YZQA 3UW0A 2VFMA 3VSUA 4EW9A 3TH0A 4MXNA 4YC5A 1VBLA 1LM1A 2IQ7A 2QX3A 4U49A 4XORA 2NTPA 2PECA 1RMGA 2QZAA 2YUHA 4YFOA 4YEIA 1AIRA 1KCCA 1O8FA 2UVFA 4XLHA 2BM5A 4XONA 1O8MA 2QYUA 4OJPA 3SUCA 1HG8A 2X3HA 1RWRA 4YZ0A 3GQ8A 3SY2A 1O8IA 4V02C 4JRAC 3VMVA 1TYWA 3B4NA 4W8SA 4W8TA 1QA3A 4URRA 1QRBA 4XKWA 1EA0A 3GQ7A 1O8LA 3ZPPA 3NAWA 2NTQA 3SYJA 1QA2A 4Z06A 1QJVA 3VSTA 3AK5A 1KQ5A 4Z03A 4HWVA 1NHCA 3NB2A 4XLCA 4XLAA 1PXZA 2INUA 2ODLA 4OZYA 4XLEA 4OJ6A 2VFQA 4YCQA 2XTXA 2BM4A 3SZEA 1O8JA 5C1EA 1RU4A 2VJJA 2VFPA 3LJYA 2B0RA 4AVZA 3LYCA 2EWEA 1EZGA 3BH7B 4YZAA 4YDTA 5AMVA 1IA5A 4YELA 2VFOA 1QA1A 2NSPA 4OZZA 3KRGA 2VBMA 2VBEA 2XTWA 4OJ5A 1JRGA 4XKVA 4XN3A 3RIQA 3GQAA 4YZXA 3ZSCA 2X6XA 3FY3A 1O8HA 3JURA 2INVA 2W7ZA 4XM3A 4YEJA 2BSPA 3PSZA 2IOUG 1KTWA 4XLFA 4KH3A 3PSSA 2O17A 1OGMX 3B8YA 4NK6A 1HF2A 1CLWA 3SQVA 1KCDA 3PETA 2BM7A 1K5CA 2NT6A 1L1IA 5JLVC 4PMHA 2O0WA 2XT2A 4OM9A 1O88A 2V5IA 1H80A 1TSPA 4OPWA 1IDJA 4XL9A 2NSTA 2NZMA
chains in the Genus database with same CATH topology
2O6WA 5DNSA 2QYUA 4YDTA 3SY2A 2XTWA 3DU1X 3PSZA 3NAWA 2XT4A 3PSSA 2XTYA 3SQVA 3NB2A 4YC5A 2J8KA 4YCQA 2XTXA 2XT2A 2QZAA 4YFOA 4YEIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O6W A;  5DNS A;  2QYU A;  4YDT A;  3SY2 A;  2XTW A;  3DU1 X;  3PSZ A;  3NAW A;  2XT4 A;  3PSS A;  2XTY A;  3SQV A;  3NB2 A;  4YC5 A;  2J8K A;  4YCQ A;  2XTX A;  2XT2 A;  2QZA A;  4YFO A;  4YEI A; 
#chains in the Genus database with same CATH topology
 3EQO A;  3N90 A;  2X85 A;  5C1C A;  1K8F A;  1O8K A;  1LLW A;  5DNS A;  3N6Z A;  1OFM A;  1PLU A;  4XN0 A;  2Z8G A;  2VBK A;  4W8Q A;  4OJO A;  4W8R A;  1TYV A;  4I84 A;  1IDK A;  1TYU A;  1PE9 A;  1OFL A;  1BN8 A;  4U4B A;  1DBO A;  3DU1 X;  3ML3 A;  4OJL A;  4Z05 A;  4C2L A;  1O8G A;  2PYG A;  5JMC B;  3VMW A;  3JX8 A;  1DBG A;  3LMW A;  2X6W A;  2VJI A;  2VFN A;  1QQ1 A;  2QXZ A;  4NK8 A;  2XC1 A;  3VSV A;  2NT9 A;  1JTA A;  3EQN A;  2XTY A;  3H09 A;  1IB4 A;  3GQ9 A;  1QCX A;  4XOT A;  1OFE A;  2J8K A;  1EE6 A;  1WMR A;  2PYH A;  2X6Y A;  1WXR A;  3WWG A;  3GRH A;  1OOC A;  1GQ8 A;  4MR0 A;  3BH6 B;  1O8E A;  1QRC A;  2O1D A;  2O6W A;  1DAB A;  1X0C A;  2F3L A;  1OFD A;  2QY1 A;  4XNF A;  1CZF A;  2G0Y A;  3T9G A;  2BX6 A;  1O8D A;  1TYX A;  1OGO X;  1K4Z A;  4XR6 A;  2NTB A;  2J8I A;  3B90 A;  4XMY A;  1BHE A;  2BM6 A;  2O0V A;  1XG2 A;  1LLZ A;  3P4G A;  2O04 A;  4XOP A;  2UVE A;  4XQF A;  2XT4 A;  4YZQ A;  3UW0 A;  2VFM A;  3VSU A;  4EW9 A;  3TH0 A;  4MXN A;  4YC5 A;  1VBL A;  1LM1 A;  2IQ7 A;  2QX3 A;  4U49 A;  4XOR A;  2NTP A;  2PEC A;  1RMG A;  2QZA A;  2YUH A;  4YFO A;  4YEI A;  1AIR A;  1KCC A;  1O8F A;  2UVF A;  4XLH A;  2BM5 A;  4XON A;  1O8M A;  2QYU A;  4OJP A;  3SUC A;  1HG8 A;  2X3H A;  1RWR A;  4YZ0 A;  3GQ8 A;  3SY2 A;  1O8I A;  4V02 C;  4JRA C;  3VMV A;  1TYW A;  3B4N A;  4W8S A;  4W8T A;  1QA3 A;  4URR A;  1QRB A;  4XKW A;  1EA0 A;  3GQ7 A;  1O8L A;  3ZPP A;  3NAW A;  2NTQ A;  3SYJ A;  1QA2 A;  4Z06 A;  1QJV A;  3VST A;  3AK5 A;  1KQ5 A;  4Z03 A;  4HWV A;  1NHC A;  3NB2 A;  4XLC A;  4XLA A;  1PXZ A;  2INU A;  2ODL A;  4OZY A;  4XLE A;  4OJ6 A;  2VFQ A;  4YCQ A;  2XTX A;  2BM4 A;  3SZE A;  1O8J A;  5C1E A;  1RU4 A;  2VJJ A;  2VFP A;  3LJY A;  2B0R A;  4AVZ A;  3LYC A;  2EWE A;  1EZG A;  3BH7 B;  4YZA A;  4YDT A;  5AMV A;  1IA5 A;  4YEL A;  2VFO A;  1QA1 A;  2NSP A;  4OZZ A;  3KRG A;  2VBM A;  2VBE A;  2XTW A;  4OJ5 A;  1JRG A;  4XKV A;  4XN3 A;  3RIQ A;  3GQA A;  4YZX A;  3ZSC A;  2X6X A;  3FY3 A;  1O8H A;  3JUR A;  2INV A;  2W7Z A;  4XM3 A;  4YEJ A;  2BSP A;  3PSZ A;  2IOU G;  1KTW A;  4XLF A;  4KH3 A;  3PSS A;  2O17 A;  1OGM X;  3B8Y A;  4NK6 A;  1HF2 A;  1CLW A;  3SQV A;  1KCD A;  3PET A;  2BM7 A;  1K5C A;  2NT6 A;  1L1I A;  5JLV C;  4PMH A;  2O0W A;  2XT2 A;  4OM9 A;  1O88 A;  2V5I A;  1H80 A;  1TSP A;  4OPW A;  1IDJ A;  4XL9 A;  2NST A;  2NZM A; 
#chains in the Genus database with same CATH homology
 2O6W A;  5DNS A;  2QYU A;  4YDT A;  3SY2 A;  2XTW A;  3DU1 X;  3PSZ A;  3NAW A;  2XT4 A;  3PSS A;  2XTY A;  3SQV A;  3NB2 A;  4YC5 A;  2J8K A;  4YCQ A;  2XTX A;  2XT2 A;  2QZA A;  4YFO A;  4YEI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...